3W5IA

Crystal structure of nfeob from gallionella capsiferriformans
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
199
structure length
194
Chain Sequence
GQFKRIALLGMPNTGKSTLFNRMTGGAARVGNWPGITVELLSGKILLGADMVEIIDLPGIYDLHGFSDDEQVVRHFLHDNVPDLALVILNATQIERQMSLLLQLKQLNMNIVVLLNMSDEAKQYGITIDSRKMSELLQIPVFQLTGYQEALQAVTRALRYPTPGMAENVRTQLEQDEHIEAEMVRILKSAVQIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrous iron transport protein B
publication title Structure of an atypical FeoB G-domain reveals a putative domain-swapped dimer.
pubmed doi rcsb
source organism Gallionella capsiferriformans
molecule tags Metal transport
total genus 62
structure length 194
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3w5iA00
5FTKA 3FMPB 3WP0A 1UF9A 5JI3E 3OEHA 3QKUA 1P2TA 1N2CE 4HLCA 5IK2A 1ETUA 4Q4LA 1O3YA 3IKJA 2WJGA 3IHLA 3QKRB 2RMKA 4IOKA 3EPHA 5AUOB 5BYKA 3QF4A 4M9QA 1UADA 1C9KA 3AV0B 3GJ5A 1W47A 2YWGA 2ZI7A 3T15A 1NBMD 1W48A 3M1IA 5H68A 4B35A 2BEJA 4JS0A 1A5TA 5EXPA 3DMDA 3CLVA 3UIEA 2GRJA 4DCUA 1W36C 2ZJAA 1KJWA 1XFAA 1GFIA 3OIWA 1KI7A 1E1RD 2IXGA 4NCKA 4YONB 4P4SB 1NN3A 1RZ3A 2JLWA 4PPNA 5G3ZA 1G4UR 3UWKA 4OI1A 3SS8A 1B23P 4PAQA 4UJ5A 4OI4A 2AKAB 2V55B 2YKGA 4BZPA 2XOKD 4V0KA 1VG0B 5CK4A 2AWNA 1KI6B 4XWAA 1ONBA 4N1AA 3KXLA 5FPTA 2IS2A 2C9YA 1FX0A 4ZIRB 5JWHA 1KMHB 2DFTA 4WW0A 2A7QA 2DR3A 1Z6YA 2EFHB 1KO5A 2WJIA 3DHWC 4XSGA 4C0SA 5B58C 4I4LA 5DIFA 1NIJA 1SKYE 1VYTA 2ODBA 1M6NA 4Q5IA 4HUTA 5AUNB 2QBYB 4QM6A 4P3YA 4B3XA 4B3FX 4DUGD 1CEEA 2DWPA 3CZPA 4FMDB 2QMEA 5LBIA 4WAUA 5D3MA 4D2IA 4BZQA 4CW7A 2GXSA 1CJTC 1NN1A 4BE7B 1SVSA 4BFYA 2FU5C 3KKPA 2ZYTX 3O8BA 1NLFA 1E9EA 4LJ5A 4URZR 1KNQA 2LKCA 3Q7QA 4LK2A 1E9RA 4PHGA 3GLFE 3K53A 2OHFA 1K8RA 3EZ6A 3K09A 4HLDA 4LHWA 4UJ3A 2HEIA 2PL3A 1G4AE 1K5GA 1G8YA 2QTVB 4HLUC 4A8JC 5FBVB 4JKYA 4R2IA 1DAKA 4IDNA 4QKQA 2OCAA 5CYPA 2HLDA 3R9IA 3R7WB 3K0CA 2PBRA 4IJMA 5TXGA 1FNNA 3Q72A 3CWQA 4PPQA 4ZV4A 1KSGA 1MABA 521PA 4MH0R 2IYYA 3A1TA 5D3QA 1AIPA 2UKDA 2G6BA 1J7KA 5JZVA 1Z0AA 2MSCB 1YKSA 1COWA 4HDCA 1SVMA 3HYRA 1G5TA 3GLGB 4DEXA 2NQ2C 4YDHB 3BB4A 2D2EA 3CX8A 4GBMA 3TNFA 4AD8A 2J0UB 1NSTA 3KUDA 1IY1A 5JEEA 1E2GA 3QBTA 4PQYA 1KAGA 1R0WA 4GOKA 5D3MB 3AKDA 4ITRC 5SZJA 4BRWA 1QBKC 1AGRA 1KGDA 3GLIA 2NGRA 4A36A 1TX4B 1BO6A 1G5RA 3M0EA 4TMTA 2ONJA 4UXHA 1E79D 4FW9A 4ZKEA 1HV8A 1KMQA 2PLFA 4GOXA 2WJJA 3LW8A 1XBTA 1Z0JA 4DBLC 4G01B 4DDWA 3QIAA 4HZUA 5DN6D 1LW7A 1P72A 4AKHA 4Q01A 1SHKA 1AGPA 1KO7A 3SJAA 2IC5A 4U02A 3BJIC 2PJRA 3B6EA 3AUYA 4CEHA 3B1YA 2X1VA 1KI1A 3RSOA 3OIYA 4QHYA 1AN0A 4IFBA 3U44A 2PMDA 1CRPA 1SVWA 1KDOA 2Z4RA 4F91B 4JYCA 1DO0A 2ZS7A 4ZKDA 4UNSA 2PCLA 3MWKA 4CEJB 4DZZA 2AR7A 1Z22A 1Q0UA 3VR6A 2A9KA 2GVZC 4JKIA 4TTQA 1E0AA 2QSZA 3P27A 2IHYA 1Q3HA 2BCJQ 1H65A 1ESMA 1P61B 3WBJA 4B76A 1WMSA 2ZSEA 4LUCA 1I4LD 1EGAA 3AVWA 4G5SA 3LBHA 1E2QA 4GMDA 2IYSA 2WJYA 4NYMQ 2GXUA 2Q21A 4LHVA 3L0IB 1GSIA 2VA8A 3GLIB 1D2NA 4R9UC 5FUVA 2NPIA 4ILEA 2ZRIA 3AF1A 2IEZA 4P32A 4EQ6A 1NVVR 5HZKA 1ZIOA 4M21A 2ZITA 2JASA 3B85A 3D31A 3K0EA 3QXSA 2P6UA 4FI3C 4OQXA 5L3RA 3PEUA 1R6BX 4B33A 4M8NE 4BPBA 2FMXA 4KBGA 3RS5A 4DCNA 1N6PA 3T5DA 2VP0A 2K5UA 1KI3A 1SXJD 4RZXA 2VHTA 2IL1A 3KTAA 3FKSD 2GBLC 1SXJA 2H17A 2EQBA 4ESHA 2V9PA 1XPUA 5CLQA 4PHFA 1AS3A 3NHBA 1G3RA 3SOPA 2GF9A 3FDIA 5AJZA 2IF0A 3C41J 1XD9A 4TYQA 3T06B 1Q1QA 2BBSA 3ZH9B 3P4XA 5B30A 3MLEA 1G7CA 3RWOA 1T4GA 3AP1A 3PV0A 1MO4A 4KSCA 3TW4A 4B32A 2ZXUA 1SQ5A 4WXRA 3WMFA 4U5XA 2EFDB 4JLKA 4Q9IA 3QG5A 4W5JA 4PC2A 2IBMA 3AKCA 2ZI5A 4EQ6B 4P31A 4N0EA 3ZJYA 3DVLA 1GDDA 1JQJC 1P4SA 4IKEA 4B34A 1XNJA 4IOMA 3VTKA 2NO9A 2XITA 1G16A 2H18A 2PZGA 4GSYA 1NBME 1NKTA 2QENA 3LDAA 1KI9A 2PJZA 3AEZA 2FPLA 3I32A 4B43A 1FOEB 3WYAA 3HWSA 1M7HA 2BKEA 2WSMA 3U61B 1NVWQ 4PC7A 2QP3A 2CE7A 2CK3A 2VSXA 3DZDA 1W0JA 3U7GA 1GRNA 1SXJB 4LBWA 4DSNA 4RVCA 2GWHA 3R9WA 2DY1A 3CNLA 3PFIA 4R7ZA 1E2KA 1LV7A 1GOTA 3I72A 2B6HA 4OYHA 5F98A 1DOAA 5E3HA 2W00A 1II8A 2XNSA 1GG2A 2ONKA 3IPYA 1GKUB 1Z0IA 2ZRFA 3IO5A 4QM7A 3GLGE 3ZVMA 3BH0A 5B57C 1Q57A 1US8B 4A92A 5K8UA 4ACBA 1GILA 4KHZA 2A5FA 4OJKA 4HLUA 2A5YB 4OQMA 5C4GB 1G5PA 121PA 3W9YA 3QNUA 4CT4B 5A4JA 4TQUS 1P9WA 1GL9B 3NH6A 4B2LA 1VIAA 2Z6VA 1P60A 4MDEA 6Q21A 1OXTA 5KU1A 1S1MA 4AI6A 3ONWA 3TH5A 3LQRA 2CL0X 2BMFA 3AF3A 1OF1A 3EAQA 3MWJA 3TQCA 2VP4A 1ZM4A 3B1XA 5FL7D 1YRAA 2R44A 3GJ4A 3UWOA 3ZQJA 2QQEA 1NKSA 2ZUBA 1RYFA 2F3TA 1X8LA 3TW8B 4ARZA 3I8XA 4FWIB 4XSHA 2XTMA 3Q5EA 2WWYA 2G0NA 5C1BA 1HH4A 2FG5A 1JECA 1P6XA 2XJ4A 5KSYA 1N5JA 4L9WA 3EPJA 5KDOA 5EP2A 1RKBA 5EE9A 5FBWB 2O8CA 1DAMA 3A58B 3W90A 4ZPXA 1II8B 1NMZA 3CM0A 2YV5A 4A0HA 5JJIA 4PZLA 4PFSA 5JRJA 1NNEA 4JLJA 2F1IA 5P21A 1D2MA 1G1MA 4XD7D 3ZQ6A 2QEQA 3HJNA 1MKYA 1VMAA 2RGNC 2I1QA 3V4RA 2QG6A 3TK1A 1WQ1R 2FEMA 1FW6A 2C96A 4WA7A 1PVOA 3KQKA 1E94E 4B2IA 2ZS8A 4MKIA 2BJVA 3GJ8A 3B60A 4V02A 1R8SA 4C0QC 3GLIE 1RRGA 4TL8A 4KFRA 5FOUA 2QT1A 4DSOA 1OH7A 4Q02A 2C03A 3KJGA 5JCZA 2NZ8A 5BN5A 1TU3A 2XEXA 1QVRA 1DEKA 3ASYA 1CJUC 2ZJ8A 1DE0A 5KNBA 2CVHA 4ARZB 4TTPA 1YZKA 3C8UA 1W5SA 4JSTA 4R71A 1GIAA 4ZDJA 1DAFA 4JT2A 2GVDC 2GCPA 2IA5A 5LDDC 1UDWA 2IX3A 4C7OA 4AY2A 2DFKB 3ZLJA 2O8CB 2JLSA 4S2EA 4JLNA 2ZJ2A 3O8RA 1HE8B 1ZCBA 1OT3A 4Y0AA 3ICEA 1SHZA 1F48A 1ZD1A 2XB4A 3KUCA 3Q85A 3X1XA 1H8HD 1P9RA 3FKQA 3JZAA 1J8YF 1YZGA 3H86A 4OHVA 1FMJA 4HATA 3PITA 4C0JA 2WOJA 1AJEA 2WJVA 1E9BA 5DE3A 3O8CA 1F2TB 4M9SA 3CONA 5LB4A 4PXAA 4CEIB 4KO8A 3VR4A 4QHSA 4CYMA 4PZYA 2DB3A 1KO4A 2HJVA 2XTZA 2AX4A 3EZ7A 4GDFA 3SHWA 1E2NA 3RABA 1MRSA 1P2SA 3AB3A 1Z0KA 5JECA 1XD2A 3KQNA 1M8PA 3KZ1E 3NH9A 3E2IA 1R7RA 2J7KA 4NBSA 5KTYA 2WSSA 3E70C 1F6BA 1XTSA 2WWXA 4MKGA 1YRBA 2HT6A 1JAHA 1N5LA 4W7SA 5EUMA 4M1MA 3SFVA 4NYMR 3VQTA 4TT3A 2YOHA 1D9XA 4M0LA 5EQTA 1OFTA 3ZZUA 4C7OB 1OHHD 3THXA 3LY5A 1KKMA 2Y8EA 5AK0A 1DS6A 1UKEA 1S9HA 2P6NA 4TN1A 4D80A 2ODNA 3PUXA 1KK2A 5HCNA 4D4JA 2IXEA 1SXJE 1Y3AA 2P5TB 2QORA 4BECA 2BV3A 1NN5A 1IBRA 1ZC3A 4PTLA 3A4LA 4Z8XA 4ASUD 2V8OA 3IILA 2ORVA 5HPYB 2O8FA 4RZ2A 4ASUA 2ZRPA 5L3SB 4LC0A 2VP2A 1N0VC 4NU0A 1T9HA 1AKEA 1NMXA 4TQAA 4RKEA 1XTKA 4UKDA 1NJGA 1WDTA 3SC3A 3FWYA 4BLSA 2Q3MA 4O25A 5IDVA 3SEAA 2C9OA 2NO6A 5SZHB 1XD2B 1JEEA 2OE2A 2ECKA 2G3YA 2ANCA 4WIAA 4ZDKA 4BLOA 4PC1A 5A0FA 1T0HB 2FDCA 2JEOA 1A1VA 4EJSC 3LA6A 4M1KA 5DI9A 2VHUA 1V43A 2HCJB 2WV9A 4EPRA 4DLRA 1OIXA 3G5UA 3UKDA 2CVFA 4JSYA 4HZIA 2KB0A 5E4FA 2CL6X 4MQBA 3THXB 3OIUA 2BBTA 1P75A 1KAOA 1G41A 2NOAA 4LRWA 4AKEA 1ZAKA 5CM9C 4WBSA 3KJIA 4WXPA 1GP2A 3AQ4A 2IWHA 3ZD6A 2W58A 4LJ8A 2FFBA 2ZYWX 1T3SA 5FTJA 4DLZA 3AUXA 2F6RA 1M74A 3OAAA 4AURA 1Z6AA 1L7VC 4BFUA 4TZ6A 1T5LA 1GWNA 2G77B 3U7HB 1G3IA 1JEDA 3JZMA 8OHMA 1OJLA 2Q3FA 1ZM7A 2VLIA 3TKLA 3BAFA 3IHWA 2P2LA 4HLQB 2VBCA 1G21E 3CW2A 2IYLD 3UK6A 3SHFA 1X6VA 4Q1FA 1E1QD 4A2QA 2WWIA 5IT5A 4Q19A 3VHXA 1W46A 1GNRA 4EFLA 3SBDA 2FF7A 4V0NA 4HUQB 4CT5A 2W0MA 4DXAA 5DHFA 1BH2A 1ODFA 4OKSA 3DMNA 5H1YA 1ZJ6A 2BBWA 3UMFA 1OB5A 1OKKA 4DLYA 3WNCA 1LTQA 1XPOA 3T12A 4Q9KA 1JB1A 3DEFA 4MUAA 5BXQC 1U2RA 1HE1C 2RGNA 1CXZA 1TMKA 2GZDA 5EE3A 1KHTA 4O2LA 5EUQB 1LFDB 2GETA 1NP6A 5FOTA 4D81A 2IYQA 3SQXA 4M1YA 3WYFA 1OB2A 4L16A 5KO2A 4MKHA 2VL7A 1SGWA 2HYIC 2R6FA 3K0FB 2D74A 3PEWA 4D4LA 4RD1A 1WCV1 1XF9A 3N2EA 2NMVA 3LV8A 4IDPA 4P4UA 3I5XA 4MGKR 1EFUA 5FTMA 2H57A 4MYUA 4Q4JB 4XVRA 1RRCA 1P2VA 1G7SA 1KI8A 4L5BA 3G0HA 5G53C 1DO2A 1H8EA 1IAQA 3CH5A 2PMKA 3IGFA 2X2EA 4OJQA 1IOZA 1E9AA 1BYUA 4WZ6A 1UM8A 3FHCB 1G6HA 4LGMA 4M2LA 1BYIA 1VCNA 1U81A 3B78A 1MOZA 3GLHA 4FMCB 1XWIA 1ZU4A 1E6CA 2LKDA 4HB3A 1KOFA 3QY0A 1P7CA 3CIOA 3TSWA 1BOFA 5CDFA 4LYHA 3UANA 4HB4A 1U9IC 2ZE7A 1OXXK 2B92A 4D4MA 4BFTA 2XTNA 4DHEA 1OFIA 1E9DA 1XCMA 1KZGB 1YE8A 2BEKA 3A1SA 4PO8A 3CNNA 3PXGA 3FHTA 4AG6A 4GOJA 5KUTA 1P9NA 5M04A 3OEHD 4KXFB 3GFTA 1T0JB 4C0KA 3ZS9A 1CJMA 1XEWY 3D8BA 3N2IA 5CJPA 4BRUA 4K8OA 2ZJYA 2ZTSA 3EXAA 5IK2D 1A2KC 2QRZA 5KOYA 3AF2A 3U6BA 2CJWA 1Z06A 5FOXA 3HU1A 5F2EA 4UQOA 3NKVA 2YC4C 2ZI4A 2IF2A 4PPGA 4KFSA 5HZHA 3LQQA 4E07A 4LJ9A 1ZNXA 4NYJQ 4B47A 4M1SA 1Q22A 2O52A 4TLBA 3T1TA 3S1AB 3KFVA 1N6HA 2ORIA 1AZTA 4LHYA 3KQUA 2YYZA 2WMNB 2KJQA 2XAUA 3W34A 2J7PA 4IFEA 4A15A 4F4CA 3GLHB 4NDZA 1KO1A 1FQJA 5JHGB 1R0ZA 2WBLC 4KLZA 5IHPA 2BKUA 4IHQA 4QGGA 3LAWA 4U7DA 2ZM5A 2NO0A 2XSZA 2ZUDA 2OG2A 2ZRGA 1J70A 3A8TA 4KYIB 3LX5A 3ND9A 4DT1B 3I8SA 4JVNA 2L0XA 4NONA 1TPZA 3F5FA 1C4OA 1XZPA 1IN6A 3SJBA 5FPKA 1CR4A 4TYWA 1F5NA 4PHHA 4BLRA 5JS7A 2RGBA 2Z43A 4QJ5A 1YU9A 1ESNA 2ZQ5A 1IN7A 1IJFA 2HXYA 2PT5A 4C2TA 2Z4SA 3SU8A 1ZD8A 4LPSA 2ERXA 4OK3A 3EWAA 3PCRB 1XU4A 3QF4B 721PA 5HKKA 3RRZA 1VCOA 2QROA 4NL4H 2OAQ1 2FFQA 4URUR 1WBBA 1ZC4A 4EJSA 2JDID 3RYTC 3M4YA 2ZRNA 2GXAA 2QAGA 3R20A 2P6RA 4F93B 2IT1A 1NF3A 2EW1A 4ZDIA 1WBDA 2JDIA 1RRFA 4TL9A 2FSGA 2E1RA 4BUJA 4IVPA 3IIKA 3LXRA 3GD7A 3K8YA 5FTNA 2ZAOA 1Z6GA 4QNMA 5EP3A 3RS4A 4W9MC 4OHYA 1FNMA 2WPDD 3R8FA 1RC8A 3VAAA 2ZU0C 2HLDD 3HDTA 2WPDA 3MD0A 5AJWA 1V5WA 4LY6A 2GEUA 1BKDR 4RSGA 3G82C 1OYYA 3PG5A 4K81B 1AS0A 1XDBA 4URWR 1E9CA 1OFHA 3B82A 1C1YA 2CXXA 2WHXA 3QKSA 4TLAA 4V0LA 1COWD 1Q1BA 1FX0B 4LJ6A 2W83A 1YQTA 2GKSA 1Z28A 2VTKA 4XWOA 2VHCA 2QPTA 3SYLA 4Z1MD 1CRQA 2UZIR 4FWTA 3CZQA 2E87A 3PENA 4Z1MA 5KSZA 1W7AA 2CLCX 5F9HA 1DARA 1KI2A 1ZNZA 2KWIA 2PH1A 1RE0A 5FH9A 1G18A 1QHSA 3GJ3A 3NG1A 1P3JA 4QBGB 5E7JA 4TMZA 4DDVA 1ZYUA 4DLUA 5TB5A 1LF0A 2ZR9A 5L8VA 3FOZA 4PSKA 1KIMA 4TSFA 4GPTA 2FSFA 2WICA 3CPHA 2R8RA 1E96A 3HR8A 4MGIR 4Q1CA 3WXMA 1S3GA 3A1UA 3SBEA 3BC1A 4YDSA 4JMPA 2WJHA 4A4DA 2WOOA 2HT1A 1NG9A 2OLJA 1G3QA 3KB2A 1K6MA 3MSXA 5EE1A 4JT4A 4EPVA 5SZIA 2GF0A 1VIYA 1DPFA 3GJXC 4BFSA 4D0NA 3H84A 2JGNA 3BS4A 1D9ZA 1VCIA 2BCGY 4AK9A 3EC1A 1EK0A 4JLPA 1VHLA 1N25A 3K0AA 4GFDA 3U7FB 1Z8FA 1ZCAA 1MABB 1HURA 3C16C 1AQUA 5FPHA 1FZQA 2OM2A 3MCAA 4DIEA 4IDOA 1N6RA 1CU1A 2YOFA 4MITA 1TQ2A 1TADA 5LD2B 1DELA 1U8YA 2ZI6A 2OCPA 3DOFA 3PUZA 2ZAMA 1XP8A 2HF8A 2OBLA 4RJLA 2EU8A 1N6IA 1WXQA 1J8MF 4RD4A 1W49A 4LC1A 1E2JA 3KDSE 4OHZA 3U60B 2ZR7A 3UG7A 1QHIA 4M1TA 2CNWA 5HR5A 2RB4A 3IO3A 2ZJ5A 1ZBDA 3RC3A 3THYA 2RGAA 4KCGA 4DWJA 5JJKA 4OQFA 3RVBA 4HZUB 4ZDWA 5SZKB 4EDHA 3ADKA 3CBQA 1RPZA 2J1LA 4NPHA 3LLUA 4BZXA 3K0AB 4CEHB 1Q1ZA 1IJEA 1II9A 4POAA 3SI7A 1FUKA 3U44B 3QG1A 4GRAA 4M22A 4UXJA 4LV8B 2QY9A 2B7CA 2YC2C 3BWDD 5BN3A 3CB4A 1JXOA 3TAHA 1NSFA 4A9AA 1DBSA 1XXHA 4Q1DA 4RFSA 3PUVA 3MAAC 4PZZA 4YMVA 1L2TA 1T6NA 3BH6A 4C0LA 4JLVA 5J4YA 5ELXA 2HCBA 3LD9A 5JEDA 4G3XA 3K70C 3ICQB 1UBFA 1QZXA 1E32A 3FMFA 3HP1A 4TLDA 5KNDA 3GCGA 3BFKA 1E3MA 1FQKA 1E69A 1Q44A 2ZUCA 3U6KA 4C30A 4Q00A 2V6JA 1A82A 4JZKA 5FPYA 4PSVA 4QJ3A 1XEWX 2FA9A 1UKZA 3U2QA 4AWXA 4BASA 3T1OA 3R9XA 3GQBA 2W2XA 3LXXA 2RHDA 4Z51A 4E22A 2KBEA 2QPAA 3TR0A 4LI0A 4ABYA 3TR5A 1Z63A 2G1KA 3NBFA 2GNOA 2QA5A 4EIWA 2PEYA 2CK3D 3EIEA 3MJRA 1QHHA 1W0JD 1G19A 3GFOA 3KTAB 3SYNA 4TYNA 4ZI3A 3J81k 4JL8A 2QUZA 2W2TA 1EXMA 1YZQA 2YINC 3AVQA 5H70A 3TLXA 1T91A 1XXHB 5UKDA 1GL7A 1LF5A 3KFXA 3Q9LA 2FSHA 3U4QA 1KY2A 1RVDA 1KK1A 1W5TA 4ZCIA 1XD8A 5HTKA 3C14C 5AWFC 1W36B 2H5EA 3AVUA 3WYGA 4Q66C 1LVGA 2A2ZA 2X19A 2FJUA 2C8VA 3AVPA 3QUSA 3X1YA 4URVR 2JLQA 1N5IA 4A2WA 4ZO4A 5JLJA 1EX7A 1Y63A 4A8JA 4LHZA 3TIFA 3K9LA 3GJ7A 3UMRA 4B3GA 4TMWA 5KNCA 3CPEA 1W44A 1AZSC 1ZM2A 3CWZA 4EUNA 4Q48A 3VHLB 2J5XA 5FOVA 2VHQA 2F43A 4YXWD 2IS6A 1PJRA 2VQSA 3MFYA 1CR2A 3GJ6A 1U94A 4US1R 3UG6A 3V9PA 3W8RA 3REGA 1E2EA 1KNXA 4YXWA 1IQPA 1Q1EA 1OXSC 1M34E 1W4CA 2WWGA 2F9LA 3FPAA 1A4RA 1W2GA 5DO9A 4QGFA 2HDNB 5B2ZA 2ZPTX 3DM9B 3GEIA 1KSHA 1RYHA 1YR8A 4Z54A 4QBFA 2QGZA 5L3VA 4HYYA 4EFMA 4AC9A 1S96A 1XRJA 2DBYA 3N70A 4O0MA 2EVWX 5JI2E 5KSOA 4X8LA 3TVTA 1SVIA 1MRNA 2Q9CA 3PR1A 1NIPA 1E9FA 2BWJA 3I92A 2PEZA 4JVMA 3QEJA 4V0MA 3L0OA 3Q5DA 4UNRA 5FOWA 4IXNA 3OHMA 2ZE6A 3D3QA 3SZRA 5FTLA 3AVOA 1QHXA 2JATA 4NCHA 1XJ0A 3I4LA 2JLRA 1Q20A 4L15A 3BFXA 4TQ9A 3N5CA 3EPLA 4KAXA 2IYVA 5FI0B 4EPXA 4LPKA 1GTVA 4DSUA 1P73A 1UEJA 4O3MA 1MO6A 1W4AA 3X2SA 2F43B 4LWZA 1Z0DA 2PT7A 4PX9A 2GK7A 4AIIA 4TMVA 4JVSB 4X8OA 5GVSA 2FZ4A 1PZNA 4LBYA 1NI3A 5TV2A 3OF5A 1DAIA 1YJ5A 3HR7A 5G41A 4H1UA 3CH4B 5DHAA 1YR9A 4TLCA 5KHOC 2ODEA 5TY0A 4QC2A 1QHNA 3V4FA 2BM0A 4PC3A 4QHTA 2V1UA 2GJ8A 2IW3A 3RRYA 1Z0FA 4H1VA 1X1SA 1G8FA 2WAXA 5JMTA 2RHMA 3QPUA 1VTKA 3WNBA 1ZUIA 5C4MA 1Z5ZA 4NCNA 4B44A 1Q3TA 4X8MA 4QRHA 2GCNA 2WMOB 1P2UA 3KJEA 3ZGXA 1UFQA 1JXMA 2AD5A 3PJRA 1L4YA 2GZHA 5FR1A 2C99A 3RHFA 1X3SA 1VG8A 3SNHA 1GRQA 1TEVA 4ACAA 2GJKA 1Z83A 4CIDA 4BWYA 2ANBA 4XOIA 4CZ2A 5FBRB 3K0SA 4JLOA 1R5BA 3NDPA 3RS2A 3BGWA 3GEHA 4DJTA 2VF8A 2HF9A 1IN8A 3BK7A 1IN4A 2YHSA 3QE0A 2C9CA 3LRPA 1R2QA 2QMHA 3SJZA 1JPNA 4DLXA 2IYRA 2PX0A 4D82A 2QP4A 3K9HA 4JL5A 3LVQE 4OHWA 3OEEA 1DTSA 5FFMA 3ZVRA 4B75A 4DC9A 3KQLA 4IOJA 1IY0A 1NY6A 1HQYE 4GZLA 4L8GA 3CKLA 4AKIA 3GMTA 4JBXA 2GBLA 1YZTA 4PAOA 5AR1A 3ZIAD 3LNCA 2WSSD 4TZ0A 3BORA 3HPQA 5J4HA 1VPLA 2WAYA 3ZIAA 3EX7C 2IYXA 2WWWA 1N6OA 3D6TB 3T1QA 1PV4A 3AVTA 4TT3D 2EYQA 4M4SA 5F9FA 3IBYA 3RWMB 1VYVA 2AWOA 5E7IA 2J41A 5KDDA 1KJYA 1MR3F 4P4TA 1OSNA 1NVUQ 2OV2A 3Q8XB 1KKLA 2R65A 5J4LA 4MRRA 2YWEA 2NPFA 3VU9A 4KU4A 3VR2A 2AK3A 2O0JA 4YMSA 3FFBA 5JWOA 1S2MA 1GKIA 1G7RA 4OI0A 2RGXA 4QNRA 5GADl 3CNOA 2R62A 3PUYA 2JJ1A 4NP6A 4IW3B 4US0R 2FNAA 5DH9A 5CB6A 2JCSA 1KJZA 4KV9A 3VKGA 1QHGA 2DHRA 3SN6A 1Z08A 2D7DA 4GT1A 4JLDA 1OYWA 4MKFA 3DPUA 1HQCA 2QN6A 3MWYW 4LV6A 3R8CA 4KLNA 3VKWA 2VF7A 2ZANA 5KPJA 2PX3A 2GA8A 5JBQA 1SULA 1XEXA 2XNDA 5ANRB 3OIVA 1BMFA 4GL2A 4BFZA 3EARA 3IBGA 1ZU5A 3H0KA 3OE7A 3FMIA 2GCOA 1E4VA 3EZFA 4BFVA 3FE2A 3FMOB 4F92B 4MDFA 4QJ4A 3BD9A 3K9GA 2GJAA 3UATA 2D2FA 5GJCA 1II0A 2N46A 2WIBA 4BEJA 2V3CC 1OW3B 3DO6A 3T5GA 4CDGA 2F7SA 2OEPA 1OIWA 4Q4AA 4F38A 3CO5A 4B6FA 1GRRA 1W4BA 2I3BA 3U3OA 3TUZC 3KKOA 2YVUA 4FCTA 3GLFA 1T3HA 1TF5A 3NBXX 4LHXA 1VCMA 4Q7KA 4QG7A 3QPVA 2O5VA 5FUXA 2CLSA 4HB2A 4X8HA 1FMLA 5GJBA 1KSJA 3BRWD 2D06A 3DZ8A 2ZRMA 5EE0A 3LW7A 5LB2A 4JYBA 5TMPA 2ATXA 3P4YA 2O8FB 1HA3A 2V7QA 1YZNA 3GJ0A 3NBYC 3OFNA 3OAAD 3W6NA 4BGDA 5L3QA 2JJ2A 1M1YE 2ZJZA 3GPLA 4HDQB 3PEYA 1VYUA 2OESA 4LJ4A 5E95A 1R5OA 3BH7A 2R2AA 3DOEA 3ADDA 2IHBA 1XEXB 2GAAA 3NTUA 1XMJA 1G20E 1Q12A 2WKRA 4QOSA 4Q7JB 5KDLA 1MT0A 1SKYB 3TMKA 2XJ9A 4FN5A 2XXAA 2GCOB 2FH5B 1S1CA 5EJEA 1E2PA 4N0DA 1G17A 2W0SA 1FUUA 3AH8A 2OAP1 4LJYA 2HUPA 2J87A 3C4JA 4FD2A 4IOLA 2IS1A 2C04A 3VMFA 3BB1A 5J4KA 3CF0A 2VSFA 1KDTA 3QENA 4Q1AA 2QT0A 3W6PA 1OKKD 1UPTA 3KB1A 1ZIPA 3WP1B 1AKYA 4A0GA 4JL6A 1MH1A 2QPOA 3I3SR 3AGPA 2ATVA 1UEIA 3BE4A 5EP1A 3QXCA 4WVFA 2OLKA 3AP3A 3PQCA 5DI3A 1GITA 3TRFA 3EG5A 1ZM9A 2ZYVX 1AM4D 1HT2E 3KKNA 5K8TA 5L3QB 2BIFA 3GEEA 3T34A 3Q3JB 2KI5A 4I81A 1FTNA 3RRMA 1E2HA 4S35A 5TARA 4F7WA 5EXTA 2FX3A 2W6JD 2J0QA 4TTRA 2R6AA 3P20A 4G1UC 1GZSA 2J9RA 1JALA 3W3AA 2W6JA 4Q47A 1F2UA 2XXAB 1R4AA 1H8ED 1KTVA 2AL7A 4LZZA 1KDRA 3SQWA 5J5CA 1G64A 4G5OA 3ZVLA 1IM2A 2ZVPX 3B9QA 4Q4HA 1R10A 4FMDF 1W0KD 3VNVA 2JLUA 3EA5A 3THOA 2FEOA 2TMKA 1QVAA 2J45A 1W0KA 2FWRA 1DVRA 3PEVA 1IXSB 3QKRA 2F1JA 2B8TA 1WF3A 221PA 2QE7A 4OI2A 3QEOA 4BLPA 4PC6A 4RD3A 1CLUA 3BB3A 3KKMA 2JLXA 3I5YA 5K8LA 1JQLB 2ZRHA 3ZVNA 2ZR0A 2H92A 5CIQA 4MA4A 1VECA 4W5HA 1HUQA 4LBVA 3ND8A 3BERA 2J3EA 4PANA 2F9MA 3HPRA 4P4SA 4HAWA 1XMSA 1KSFX 1UKYA 1G9XA 2P65A 3AF4A 1OIVA 2QU8A 4FINA 4A6XA 2DCUA 1IY2A 1Z2CA 2NZJA 5EP4A 2XZPA 4NH0A 4KFUA 5GJVC 1TTTA 2O0HA 3VR5A 1KY3A 4LBZA 4CGZA 3F3YA 1JPJA 2IUTA 1PLJA 3E5HA 3P1JA 2PZFA 1I4TD 3DDCA 4E03A 5JHHB 4TYPA 1E0JA 3LVRE 3KX2A 5F3WB 4B3DA 3VR1A 1KI6A 1QDEA 3QJYA 2FSIA 4H9GA 4Q4HB 2J7PD 2ZSAA 4ZIRA 3IIJA 1KMHA 5J40A 2REXB 3TE6A 4B73A 2ZEJA 3B1ZA 4RD6A 2G9NA 2QTFA 4JLBA 1J2JA 2FGJA 4V0OA 2XSZD 1SXJC 3EASA 4B6EA 4DVGA 2QBYA 3THWA 2FFAA 4MGYR 4PAMA 3T1VA 2UVQA 1SVKA 4I1OA 1NLYA 3KQHA 1UAAA 3VX4A 3B7GA 3SR0A 2VPPA 2D7CA 1E2DA 4KI0A 4CF7A 1NBMA 2DWQA 1MO3A 1KDPA 2IYWA 3TUJC 2MSDB 3QF7A 4XTCS 5BN4A 2Z5FA 4Q21A 1U0LA 1GM5A 1F3OA 2HXSA 2CJWB 1TL7C 1E1RA 3BBPA 1X8KA 2CDNA 5EE5B 3D7MA 5HKKD 1XTQA 1YZLA 4LYJA 2VP6A 1ZVQA 3R7WA 1I2DA 4G5GA 1NLZA 4MGZR 4A2PA 4DCSA 2NG1A 3H1TA 1RJ9A 3EW9A 3LFUA 3IIMA 4ON9A 4M9ZA 2BMJA 2XOKA 3TUIC 4EKDA 2F55A 4DDTA 4ERNA 1YZUA 3HU2A 3C5HA 1G8HA 1CKEA 2QGNA 1L4UA 2ZSFA 4G5QA 5EZ5A 1LS1A 1D8TA 5AUQA 2WWFA 1Q21A 2AHOA 4FIDA 3GLGA 5JWRA 1ZD9A 4C2UA 4ZI2A 2V1XA 3JVVA 2ODWA 4GNKA 2J0VA 5KSPA 3TGPA 2J0UA 5DYIA 5CIWA 4JLMA 3THWB 2H16A 2V54A 1DG3A 1OLOA 3UXMA 4DLWA 2ZYUX 4XVUA 4DB2A 2OILA 3U3JA 4MRSA 3CRQA 1DAGA 1XMVA 2VIIA 4DUGA 1CBUA 2YNMA 4C0HA 4WZBE 2IEYA 1N5KA 1YHNA 3EIQA 3FGNA 4B3BA 1NJFA 1E4YA 3WBKA 1T3LA 2BMEA 1EFRD 2JA1A 4LYFA 2SHKA 1NY5A 2IWRA 1XZQA 4MYTA 3ZZTA 1EFRA 2IUSA 3FTQA 1XTJA 4PO9A 2GXQA 1B0UA 1NVXQ 5G40A 4A6PA 2ORWA 2OXRA 3QVUA 5J4VA 1G8PA 5CB8A 3I1FA 4Q7LA 4NTZA 4KYUA 2A3RA 4LJ7A 4RFVA 4C3ZA 1RJ9B 3CF6R 2J46A 2VP5A 1TNDA 4TSFD 4C0AC 1Z2AA 3WRYC 1R0YA 4EJSB 2QAGB 3QPWA 3EZ9A 4TL7A 4QFMA 1X1RA 3CPJB 2H8KA 3RRNA 2P5SA 4CEJA 5FUWA 2GEVA 1HTWA 3VFDA 3VNUA 2WKPA 1CP2A 5J47A 4RY2A 2IYUA 1N6LA 2EWVA 4M1WA 3HYTA 4XVQA 1G8GA 1Z47A 4G0NA 4EPWA 1QF9A 2RGGA 1S8FA 3KXIA 3NIBA 4I1UA 1VDZA 3ZYCA 4MRNA 2QP9X 1NL3A 3U7EB 2AK2A 4NZYA 2Z83A 4US2R 2EFCB 4URXR 2ZE5A 1KYIA 3ZDQA 2ASEA 4NKRA 4Q1EA 3QKSB 2ZE8A 2CMKA 2X77A 3CR8A 3B9PA 4OK6A 4B71A 1TF7A 5BYJA 3RC8A 3FVQA 1ZNWA 1TUIA 5K8IA 2UZ3A 1XCGB 2H1LA 1E79A 2A5DA 3RNLA 1AA9A 2NO1A 4OHXA 1WE2A 4YMWA 2WKQA 2YWHA 3FHOA 4AKGA 2BDTA 4RD0A 1U98A 5DN6A 4BLTA 1VHTA 2A78A 2O0KA 2Q0HA 1D6JA 2CE2X 4Q03A 3VX3A 2B8WA 2CNWD 1AS2A 2FGKA 1OH5A 1HY3A 1EFCA 4L9SA 4DCTA 1AQYA 2GDJA 2Q6TA 3LBIA 3WY9A 1OE0A 2BMDA 1KZ7B 3SFZA 4XTRA 4MUBA 2GZAA 3EPKA 5C46F 1U9IA 4IVQA 1LB1B 2ERYA 3A36A 4U00A 3QQ5A 4Q9HA 4FXPA 4YC7A 5EXSA 5BWMA 2J0SA 4TWZA 3FFAA 3SE0A 5FBQB 1S3SA 2CHVA 1S0UA 1CS4C 2FPKA 2FV8A 4UXIA 4FCWA 1DAEA 2W2VA 3OZXA 2QQ0A 3CF2A 2ZRDA 2EFGA 1YR7A 3C15C 4GI7A 2QL6A 3RS0A 3QKTA 3AP2A 3ZS8A 4LYAA 5IRCD 4JBWA 3GLHE 3IEVA 4FMBB 3W5JA 3QBVA 3QXJA 2ZRAA 4Y0VA 3ECCA 1JNYA 2QRNA 4DLTA 4YQFA 5CDFE 4XWKA 1Z3IX 1FP6A 3CX7A 1ANKA 1T8UA 2OFWA 5GVRA 2FE4A 3QXXA 3GFPA 2D62A 3TBKA 1JR3D 2OCBA 2OSBA 1TU4A 4NHOA 4Q18A 3AM1A 5JJLA 1JR3A 1UJ2A 1W36D 1KO8A 1N6NA 2JJ8A 2OCYC 1J99A 3ASZA 3WNDA 1ZUNB 1U8AA 1PLKA 1E2LA 2ZS9A 3WMEA 4LSGA 3A6PC 2ZRBA 1D2EA 1ZRHA 4FCVA 1E9SA 1XCPA 3CRMA 2VHJA 4AYTA 3PIRA 1RFLA 5B64A 3MWLA 4B3CA 3PUWA 1O87A 2GK6A 1MV5A 2KBFA 1FTSA 3C7KA 1F60A 4G5RA 3AKYA 4D0GA 3THYB 3FKSA 4JBYA 1GVNB 1E2FA 1YVDA 4GP7A 3QVVA 2OBNA 2XGJA 3AF0A 4ESVA 2QZ4A 4IEEA 2ZRLA 2YWFA 4D0LB 2AXNA 3A4MA 2FPMA 1TAGA 4DDUA 2ZROA 4B2PA 1ZM3A 4V03A 2P0EA 2CBZA 1N3BA 2VEDA 1FP7A 1IXRC 1SVOA 2QM8A 3F0TA 3C5CA 1JJ7A 1US8A 4HAZA 1RIFA 4Q9JA 3IQWA 1ELOA 1T8TA 2DWOA 3L0SA 4QXAA 4DEYA 2ZRCA 2R6CA 2NO7A 2PZEA 1IN5A 3NEYA 4NYJR 1FL9A 3FB4A 4AYWA 4DIDA 4RFSB 4KJZA 1I4DD 4DLVA 5C2JB 5FUYA 1ZINA 1EWRA 4AG5A 3TVDA 4C9BA 1VG9B 5JCPA 5DSZA 3ETLA 3ZZ0A 3B8HA 2CCGA 2E9SA 5JRZA 1QG4A 2C95A 2ZJOA 4MRVA 4NYIQ 1Z6TA 3A1WA 2XZLA 3U3KA 3L0PA 5DNYB 1W1WA 1M2OB 3SYKA 3LO5A 1D5CA 2GESA 2ZVQX 3O47A 2HV8A 3RANA 4JLAA 3IPXA 3X1DA 4BFWA 3VR3A 3T35A 3K1JA 1GUAA 2B21A 2X8AA 4JJZA 4R2HA 3PVSA 3NC1C 1TUEA 4JIMA 3RSLA 1E0SA 2IXFA 2V4ZA 2Z0MA 3L2OB 5FBLB 4TMXA 3SDZA 1QHYA 1JR6A 2BJWA 4BEBA 2O8EA 2HYDA 4PO1A 4PSAA 1P62B 1SKQA 3BOSA 3B5JA 2QAJA 5C18A 2XB2A 5EZ6B 2ZRKA 1QHHB 5AJXA 1CTQA 3A4NA 3REFA 4OQNA 4HDOB 4YLGA 1E2IA 3AVYA 2AKYA 4DKXA 3BXZA 4TLEA 2REOA 1I2MA 2IYZA 2VH5R 1PUJA 5BW8A 2QSYA 2FOLA 3EZ2A 821PA 3U4QB 1JI0A 3DL0A 4MYHA 2BOVA 2F1RA 1R0XA 1T5IA 4XJXA 4LCBA 3U3MA 1W4RA 421PA 4XH9B 4RCZA 2ZI3A 3H2YA 4XIGS 3FYHA 5JS8A 5CITA 1UBCA 4OQLA 4BQSA 5FL7A 1E0KA 1HEIA 1PLLA 3MMPA 3E1SA 4IVRA 1OV4A 5H8WA 2FZLA 4LJAA 4A8JB 3JVUA 1UKVY 3MGCA 2VRWA 2YJTD 1IHUA 2QMUA 4M53A 4PPFA 621PA 4HSEA 5G3YA 3IEUA 3NBZC 3LX8A 2QTHA 1R8QA 1E99A 2HJGA 2XX3A 4A1FA 1NG1A 1CIPA 1QRAA 2C78A 2O8EB 3ADCA 4PHTA 1DG1G 3KKQA 4IXMA 4HAXA 5GJWC 3VKHA 3WRXC 1TQDA 1Z29A 3L8ZA 1U0HC 5LPNA 4Z8YA 3NHAA 3LBNA 2JLZA 2GHIA 2ZSBA 4HI0E 2OBMA 1F2TA 4XD7A 3NWJA 4I99A 2RGCA 3W3ZB 2MMGA 4EPTA 4CEIA 3O8DA 5EXXA 1XMIA 3KL4A 1M7GA 3TJZA 1EFTA 2REBA 3I73A 2BM1A 3CRW1 4DB4A 3A37A 2DYKA 5DLQC 4PQRA 5CM8B 2CHGA 2BBOA 1OXVA 3QOFA 2GJ9A 2AD1A 3IDQA 4RD2A 4UNPA 3DKVA 1U0JA 2C5LA 1WRBA 4IEIA 2DFNA 2A5GA 2RKOA 5KPDA 1KI4A 1IXZA 4OBEA 1OH8A 1S9DA 4UNNA 3F8TA 1XX6A 1BIFA 1K5DA 2EYUA 4EFNA 3UMSA 1GAJA 1ZW6A 4A0RA 2Q9BA 2YZ2A 3TQFA 2WWHA 2GILA 3A1VA 4Q1BA 4JJKA 4UNQA 2GJSA 2I1VB 2WIAA 3AGQA 3P32A 2VYFA 2ZREA 2QM7A 3OEED 2RGDA 2W6ID 1XPRA 3MUFA 3Q7PA 1BS1A 4LOAA 2XZOA 4HAVA 5DISB 4ZCMA 2W6IA 3MJHA 2VSOA 4KVGA 1U99A 2Q3HA 2VP9A 3LH5A 1CR0A 2RCNA 3CRVA 4RKFA 2G88A 4WOPA 3TSOA 2V6IA 1OH6A 2DFLA 1H8HA 5HE9A 3RDPA 4LV5B 4GMXA 3B13B 2GTPA 4KSBA 1CR1A 1A2BA 1LS6A 3CX6A 5L3SA 5A5GA 2PLRA 2OT3B 2Q9AA 4A0FA 3K70D 1KK3A 3EIHA 4KFTA 2OUKA 3I61A 2O8DA 1OFUX 3W8NA 3NC0C 4Q7MB 3L82B 3NEJA 4NE2A 5FR2A 1M7BA 3RS3A 5IF9A 1XTIA 2G83A 3I62A 1GNQA 3L43A 1L8QA 2N42A 2J59A 3B1WA 1EG7A 2G1JA 2R6DA 4EAQA 2JJ1D 3QI2A 1XEFA 1XXHE 2BC9A 1LNZA 1P5ZB 1TQ6A 3RAPR 2GEDA 2EWWA 3X1ZA 1FFHA 4NMMA 4TYYA 1JR3E 2A5JA 1DADA 4I1SA 4QBIA 2P67A 2IUUA 3SJCA 1XB2A 4AYXA 2B7BA 2YOGA 1EX6A 1XJQA 3OESA 1Z07A 1X86B 2XNDD 3KXKA 1CF4A 2P3SA 1BMFD 1XTRA 5TVKA 4QGAA 1Z6XA 4C4PA 4F4IA 2LCFA 3V00A 3OE7D 4PQFA 1EESA 4KBFA 1GL6A 4GZMA 3MRSA 4B48A 1OHHA 4DLSA 1WP9A 4N3NA 2AXPA 2NIPA 1R5NA 4P33A 4QBHA 4E09A 5AUPB 4OL0A 1N6KA 4C0BA 1G3UA 2FFHA 3KJHA 4HAUA 2QI9C 2A30A 3RLFA 1QG2A 4CVNA 2MMCA 5HE8A 1RRPA 5E7MA 4IRUB 3B2EA 2O8DB 3U3RA 4BFXA 3K70B 2OZEA 3NDBB 4FMCF 1N0WA 2CHQA 2IS4A 3VU9B 2C98A 5FPSA 2JLYA 2ZRJA 1CJVC 1EWQA 2F3RA 1J90A 1ZP6A 2IK8A 5KYKA 2AN9A 2KE5A 1EFHA 2V7QD 3OFND 2H7VA 5FI1B 2JJ2D 3UPUA 1OXUA 1IONA 3M6AA 4IDQA 4LX0A 2QAGC 1E98A 1UBGA 4HUQA 4Q9LA 1NN0A 3QSYA 4J0QA 4PR0A 3ADBA 5CYOA 2X2FA 3X1WA 4L4UA 2O8BA 2MSEB 2OFOA 3NVAA 1A7JA 2RH5A 4W5WA 4ZCLA 1MO5A 2CCKA 3P26A 3K09C 3WMGA 2DPXA 4IDHA 1HYQA 3RS7A 3AVXA 2C2HA 1OPXA 5DYGA 2BVNA 3U5ZB 3TAUA 4KODA 3K0CC 2PCJA 1S4QA 3EC2A 4TL6A 2G0TA 3EWSA 2D4HA 2EFEB 4LDJA 3K9NA 2ZIAA 2ZSDA 4F4JA 2NTYC 3K0FA 3MG9A 5FL3A 3H4MA 4DRZA 4Q4AB 2R9VA 5BQ5A 2D3WA 2OXCA 4JVLA 2ZETA 3GLFB 4HEJA 4E5UA 3WHKA 4D26A 1KK0A 4NYIR 4Q4JA 3QXHA 2QMOA 4D6PA 3LLMA 1ZUHA 4P0TA 1UDXA 3IQXA 2KSQA 4RCYA 2R6GA 5LD2C 2OFXA 2I4IA 4B74A 1GNPA 2JIZD 4HB0A 4BLQA 4QGHA 2RGEA 4MRPA 3IUYA 3TSZA 2JIZA 5AJVB 1E1QA 1N0UA 3W5IA 1UBEA 4HAYA 1JAIA 1TQ4A 4RZ3A 3DKPA 4GP6A 1E2MA 3AVVA 2O8BB 4V0ME 1JJVA 2QNRA 1LY1A 1U8ZA 2CLDX 5CLLA 3T61A 1JBKA 2LWIA 2WVJA 1PUIA 1SZPA 1TEXA 2CEAA 3BIFA 4NCJA 2CCJA 4TMKA 1G6OA 1NVVQ 3CUEF 5JSZA 4A82A 1SVLA 4YMUA 1HT1E 5CK5A 4QL3A 4RZUA 2N1BA 2ZI9A 2ZU6A 4M9XA 2FN4A 1TF2A 1FPMA 4URYR 1GKYA 3DM5A 2WZQA 4D25A 4MYCA 3ZD7A 2C77A 3L8YA 3W6OA 1U90A 2OO7A 2CL7X 4D4KA 1CULC 2ZJBA 2RAPA 1YR6A 4KITB 5TDHA 2QE7D 1RW4A 5JFGA 4CRWB 1ZMXA 2AFIE 3HU3A 4II7A 2WM9B 2F1HA 4O2RA 1NRJB 5HCIA 4DCVA 4R98A 1DAHA 4DSTA 1WA5A 1AK2A 5FOSA 5AJYA 1XJCA 1VKJA 1G7TA 3CR7A 4K46A 3S1AA 3GP8A 1G3MA 5DI3B 3BFVA 3WHLA 2JLVA 3CRRA 2AFHE 2JAQA 1G291 4KVAA 5CJ2A 5DGXA 1X8JA 2BHRA 1NMYA 3AKEA 1CJKC 4M1OA 1W2HA 1ZNYA 1VG1A 4OK5A 2WTUA 4EPYA 3B1VA 2IYTA 4I1VA 3NXSA 1F2UB 2VO1A 3LWNA 4YMTA 5JSZB 3EA0A 1WB9A 4DT1A 4NCIA 2GAOA 4WZAE
chains in the Genus database with same CATH superfamily
2YV4A 3N2KB 4L22A 1W5EA 1HKUA 1IDOA 1Y37A 4XQ9A 1EFVA 3DV0A 1XTBA 3PX3A 4MEBA 2H00A 4IGEA 1U7DA 4CUZA 2NV6A 3LO8A 2UZ1A 4HLCA 3FNFA 1ND5A 2PWAA 1L8AA 1XDWA 2Z09A 4NAHA 2WJGA 3IHLA 3W0LB 3QKRB 2IYFA 4D9GA 1L8OA 3RFUA 2JC3A 3EPHA 3GDOA 4B7XA 3MBIA 1Z8HA 5BYKA 4K0KB 4MP6A 4CCAA 3R9KA 4DPLA 2B5OA 3AV0B 3GJ5A 2YWGA 5TQ0B 1W48A 1J07A 1K9SA 2ONYA 5HKAA 4I50A 4RV9A 2JD1A 4WASA 2BEJA 4B5KA 4JS0A 3LUKA 4FFBB 1N5DA 5JROA 4YT2A 2P3OA 3DTVA 1FDSA 1GFIA 2RC5A 3QUBA 1XLVA 4YONB 4EMTA 4P4SB 4L2IA 1NAHA 3KS9A 4ZWNA 1NN3A 3OX2A 3SEZA 1E7QA 1I32A 1QYCA 2NAPA 5EWMB 1NT2A 2B78A 2VHWA 1YK0A 3I0ZA 4FDUA 1PNTA 4FE4A 1A7KA 3REQB 4OI4A 4EW1A 2E85A 3WICA 2BLNA 3TG8A 4EX7A 5BWLA 4PV7A 2YKGA 3EGXB 3UWMA 4BZPA 1JHYA 2XGMA 4BMZA 4DR6B 2G06A 3IS3A 2DSNA 2A4KA 4L5YA 5DBOA 5HDQA 1Z37A 1OBVA 5DWQA 1E3IA 4N1AA 4KZPA 4NOJA 2IU0A 1DTWA 1FX0A 1Z4QA 4N0DA 4HNUA 1EFVB 2Q28A 3DV0B 4OKIA 1JU9A 5E6UA 2UZ1B 3SXJA 4ZVVA 4YH1A 2W2KA 3ZOKA 4BKOA 5IKMA 1KO5A 1FJXA 3VJRA 2AYYA 2FUG6 2FWIA 3DHWC 4DMFA 3TFOA 1OA1A 4O4IA 1NIJA 1VYTA 2B35A 1M6NA 2JCXA 2RHJA 3IXMA 4WESA 1BMQA 2P7IA 4IRMA 1CEEA 1T8WA 2YNMD 3FFWA 2I7CA 2DWPA 4E7OA 2RARA 5LBIA 1A4IA 1ISHA 3F98A 1NVBA 4WAUA 4DV7B 1ZAYA 1UJBA 2GXSA 1CJTC 1NN1A 4EB0A 5DNCA 4G4SP 3A6DA 1DKQA 2BFNA 2PM8A 1M2GA 1NVTA 3EUAA 4URZR 1PR9A 2LKCA 16PKA 1UBKS 1E9RA 3Q7QA 2PL1A 4UVDA 1KOLA 3N8GA 3QW2A 1Y1LA 1E3LA 4I5EA 4OMDA 1EXDA 1KDZA 1NBIA 2DJ5A 1JFSA 1K5GA 3VZPA 1T3ZA 2AEEA 4HHEA 5ALGA 1QP4A 4R2IA 5AI6A 1Z5VA 2DQZA 4S0ZA 5CYPA 1O03A 2ZKIA 1GQQA 3R9IA 3K0CA 5JD3A 2ATEA 2PBRA 5TXGA 3V1TC 4P6VF 3C4VA 1FDRA 4L3OA 3QLVA 3Q72A 2Q6KA 3DPIA 1B00A 1T1RA 2P2DA 3NM5A 1U3WA 5IX8A 1WL8A 5KQGA 1QH9A 1DTWB 5D3QA 2C8KA 3A1TA 3K0HA 3T3DA 2G6BA 5JZVA 1Z0AA 4ZVLA 1B4DA 1COWA 5THKA 5E6UB 4DEXA 5K0EA 2A92A 5KOIA 1YBAA 2D2EA 3CX8A 1TA0A 2PBZA 4O4IB 5AK5A 3TNFA 4B1FA 5LKAA 5D6NA 9GPBA 4IIDA 3BIJA 4EI8A 1NKVA 1K86A 4I4IA 2P9EA 3CMCO 4J2OA 4Y98A 3CQ9A 3ONNA 1ONNA 4NAUA 3ZR4B 4XYBA 4F5DA 1KAGA 3LGAA 4YIHA 2W22A 1ZN8A 2AQIA 5KCZA 2O4UX 2OOKA 5BSRA 2P77A 4EH1A 3RS8A 3QV2A 1ULBA 1AGRA 5B7NA 4LDZA 3GI1A 4OPMA 2NGRA 1WQ4A 1I33A 4IL5A 4CMAA 2X6TA 2IH2A 4Y18A 3PFGA 2Q2OA 1G5RA 3P94A 2F4VB 1XJWA 1DXHA 1Y3CE 3L7OA 1YFKA 2JCYA 4LDQA 1QV6A 1YOVA 2J3MA 4ZKEA 3W78A 3SDBA 1Z0JA 2HLHA 3AJ9A 3TK1A 4TWRA 4NFLA 1SBNE 2OM6A 1LW7A 4RX1A 4DREA 4DIKA 1YVUA 3AJEA 2YIMA 3OM8A 2XCSB 4U02A 2AZMA 1JGTA 1H1LA 3DCNA 4X65B 2QTRA 4CLDA 5A9RA 5KCMA 5BMVA 5IASA 3RSOA 4CLXA 2VN8A 4S05A 3VI4B 2W43A 5FUMA 4IFBA 3NHMA 1MXHA 3HR4A 1SVWA 1KDOA 3ECAA 4BMNA 5BWNA 3ZI0A 5JAOA 2FUCA 4W63A 4H16A 5FA5A 4F2HA 2NVBA 1WV0A 3E3NA 2RK3A 3ZLUA 3DO5A 4JKIA 3HA2A 5T3YA 1MAVA 2QSZA 1PV1A 3P27A 3O26A 1HR0B 2PJDA 3TLJA 3TM5A 1Q3HA 2E2WA 1H65A 3B2QA 3TTVA 4YAIA 2X40A 1WSBA 1N2SA 4LUCA 1I4LD 2HRRA 3T9AA 1CUHA 3R5FA 2IYEA 1NR7A 5IM5A 1E2QA 2NYUA 5HQTA 4ZC8A 2WJYA 3QLTA 1UPBA 4U2KA 1L7NA 4LHVA 3ZXUB 3JZFA 1T6YA 2VFAA 2OHGA 3KQWA 1CRLA 1UL1X 5IN4A 4CN9A 1I8TA 4R51A 2QRLA 3RIXA 1PR0A 4R9UC 2JVKA 2XRZA 2MYTA 1RPTA 2H8GA 4XQCA 1YHYA 3KLBA 4IDGA 1QOPB 2GB4A 4W6QA 3U1VA 2ZRIA 3DD1A 4R1NA 5HFNA 3UMCA 1PYDA 4P32A 4N6NA 2PNJA 3RE1A 2ZCUA 1GTG1 1QRTA 1HZJA 4RTNA 1ZIOA 2HJHA 2OBBA 1P4AA 2PZKA 4X1KB 2C20A 3H2BA 2C4WA 2JASA 2W6OA 3D31A 4QA9A 4BVKA 4E33A 3Q8KA 1K08A 4FI3C 5CP8A 1JL3A 4OQXA 3I6QA 3MB8A 1KZ9A 2FRVA 3B3JA 1R6BX 1T36A 3LMKA 3PEUA 4NZZA 1FW8A 3GPCA 4M8NE 2FMXA 2G5GX 4MV0A 4OA5A 3GRAA 2E82A 3DAPA 1NMEA 2V97A 3NZEA 4OSOA 3E2PA 5AT1A 5BMVB 3KOZA 1AXGA 2IFTA 1DCMA 2BEVA 2DWUA 1T1IA 2PQ2A 2K5UA 3DQZA 2PIDA 1KI3A 5F64A 4TKLA 4D3DA 1PVDA 4RZXA 1T2NA 4E2YA 2C3PA 3C6YA 3AM3A 3Q3IA 4NZ9A 3CEJA 2Y2UA 5EWLA 1LZKA 1SXJA 2V9PA 3H1AA 3KAKA 4WCFC 1SOUA 3CYFA 2JG3A 3FROA 5ADHA 4QU5A 3MN1A 4ZEWA 4KQ9A 1EVZA 2AQKA 2O2YA 3C41J 1JLKA 3Q3EA 4X6LA 2H85A 1MCZA 2XXJA 5T41A 1G2OA 3M6LA 3T1HB 4TUYF 3V80A 1XZIA 1E9VA 3ZGLA 3B12A 3PV0A 4A27A 2H2IA 1GZ4A 1T4CA 2DWCA 4KSCA 2GAFA 5D87A 4CMCA 4E5SA 4U5XA 1NJ8A 1IZ7A 4AKTA 3MT7A 3HBAA 1E7WA 2AN3A 4Q9IA 1U7TA 4P86A 3AKCA 2ZI5A 2YWRA 1FYWA 3DVLA 4BX9A 1P4SA 3NV7A 5K20A 1XNJA 4IOMA 3U80A 3VTKA 1T9ZA 2NW6A 2NO9A 4GECA 2F4NA 3I01A 4MO9A 5C5CA 2J5RA 2PZGA 3MBKA 5FPPA 1VB3A 1T36B 4GLJA 1EJ6A 3DTTA 4UHHA 1TA4A 1XN1A 5C35A 5LQAA 3WYAA 3KEMA 3M4NA 3WLKX 4D8VA 4CF5A 2BKEA 2WSMA 3S4YA 3IDSA 4XLZA 2PL5A 3R5TA 4MDHA 4ZQFA 1NYLA 2GUWA 4B79A 1NTOA 2QP3A 3IKLA 1DAPA 1JE0A 2BGLA 2CK3A 5ERGB 1U8EA 3LY8A 4FGSA 4UE3S 4BP9A 1W0JA 2V5UA 4J0DA 4CG0A 4LDPA 3U7GA 1SXJB 2LUOA 2G1UA 3VR3D 2KHZA 3L7BA 1J7JA 2B3TA 4E2WA 3KNZA 4RVCA 4BGEA 4D57A 2JAOA 2LDXA 3HABA 3MTEA 2GWHA 5LMNB 3CNLA 3F6YA 3R9WA 2I1LA 4MSUA 3KTOA 4R7ZA 2A84A 1RDFA 4KIGA 4LF6B 3D8UA 3NWPA 3I72A 4X92A 1TC1A 5KVQA 1Y6ZA 1C7ZA 5COBA 4LS3A 4PLZA 2W00A 5EINA 1U0GA 5J59A 5A71A 1L5RA 4XUEA 3F5MA 2X2OA 1C30B 2IZOA 4LC9A 4XAQA 3ZVMA 2HX1A 2V96A 1YZYA 3DLHA 1XVAA 5DM1A 3PQFA 1U3FA 4ACBA 4FJ1A 1E5QA 1TTHA 1CUFA 3GN2A 3DMGA 3OM0A 3EQZA 1L7PA 3JQ9A 4OSEA 5F1YA 2VYVD 1SB9A 4R4JA 4CT4B 5A4JA 2GS9A 3I58A 1GL9B 3UGJA 2X14A 4C4TA 1VIAA 1P4JA 4DMGA 4CQNA 3GGDA 2BFBB 1S1MA 3OLCX 3DGFC 4PPYA 4F04A 3G9XA 4TM8A 3ONWA 3GLUA 1JLRA 4ZVMA 3EVZA 4ZMSA 3P2IA 1FFEA 4H7IA 3TQCA 5AW0A 1KZ4A 3HUDA 2PYIA 3B1XA 4L07A 3AHDA 3PDCA 3SKVA 3T7TA 4DPKA 3UWOA 5A9SA 4JC4A 4QYIA 5AKHA 2PRJA 2I5PO 1NKSA 3M1AA 2XT9A 4K6CA 4ZODA 3O21A 3SK0A 2F3TA 4RK1A 1X8LA 1H22A 1TC2A 2AF3C 4TZTA 4PWYA 4PZPA 3EODA 2Y1CA 3H6GA 3O84A 4HH1A 4HBGA 5D3KA 4NR0A 4MHTA 5JBNA 2HDOA 1J49A 4YRDA 4L50A 1DTEA 3UC5A 3EPJA 5KDOA 5EP2A 4G8JA 5FBWB 4AG3A 1DAMA 3IV9A 1AQLA 5KOHA 2FHPA 1CUBA 3D4BA 4TS3A 1LNQA 1M6VB 5T4HA 3CM0A 4BBAA 4F56A 1JHAA 4GI5A 4YRKA 4PFJA 4WKBA 1NNEA 3GGJA 1D2MA 3TTSA 4YPOA 1G21B 4IRXA 2FXIA 3CCCA 1FXUA 1MKYA 1Q50A 2RGNC 3NDRA 2QG6A 1B3RA 1BX0A 5F3RA 1ACJA 2VVTA 3I9LA 1XQYA 4MV7A 1WQ1R 1GTRA 3NJ4A 4R6XA 3BE5A 2WEKA 3H8VA 3NM4A 1YI8A 1EBBA 1EBFA 1R74A 3BZBA 4Z4QA 3ANMA 4QPPA 3WGZA 3N0TA 4XCQA 5IT0A 4G0VA 4ZEMA 2AFRA 4TL8A 1EFLA 1OH7A 5IMSA 2C03A 4OXQA 5JCZA 2XW6A 2TECE 5A9SB 5LYYA 5BR4A 2AJBA 5BN5A 5FOQA 2IOFK 2QKYA 1CJUC 3DE7X 1N9KA 4H08A 2C7QA 4BMVA 1EKXA 1DE0A 1MAAA 4X1OA 5KNBA 1C1XA 1LSOA 1VLZA 2I6GA 2FUNB 1YZKA 1RC0A 3N2GB 2PBFA 1W5SA 3Q11A 4JSTA 4UUNA 3KEQA 3LI2A 2CKMA 1QMPA 1IZ8A 1TZKA 1YI1A 4FYJA 4YP7A 4QVIA 1FNCA 2WSYB 4UMVA 4AY2A 2ZQYA 4BVHA 1ECBA 4JI2B 1XAJA 4BO1A 4S1WA 4XGQA 5KOHB 4NEHB 4JLNA 4UM9D 3IAEA 1JH8A 1ZCBA 3A14A 3O8RA 3I1YA 1ZD1A 3O92A 2WW8A 3Q85A 1PZMA 2W98A 2ACKA 3QX8A 3JZAA 4PLWA 3T4EA 2GAIA 4C6RA 3LQKA 4F8JA 1CDZA 2EP5A 3PL1A 5AMXA 2B4QA 3PITA 4E1AA 1XCLA 1ZRSA 4XEHA 4ZRDA 3H4TA 3UK2A 2EF0A 3PX2A 1MAUA 1GDHA 3CONA 3HVIA 4J4BA 5P8WA 1Y1TA 4KO8A 3JD0A 4MV4A 2Q1SA 3VR4A 1JHXA 1RWWA 3G6WA 2N9UA 2DOKA 4PZYA 1YXMA 1T5BA 2LIVA 4PS0A 3PLAE 1NVAA 4F96A 1AH2A 1QIJA 2D59A 2YJZA 2H4HA 4WV3A 4YJDA 2HJVA 2MINA 2AX4A 4MW5A 1H6AA 3SHWA 4GDFA 1E2NA 2H29A 4LZNA 3AB3A 3O7MA 3P9KA 5TT1A 3GHYA 5IAOA 1KA9H 3BDIA 2OV6A 1DKUA 3CA8A 5AM2A 3P2OA 3FSRA 3LBYA 2YHBA 1RMYA 1XTSA 3PUJA 2PG3A 2EKBA 4G1EB 4Y9TA 1RHQA 2HT6A 2G72A 5CB0A 2GYWA 1ZUD1 3SFVA 5DBEX 3SBOA 3SX2A 4M0LA 4DOMA 1OFTA 5C1PA 4G1FA 5CG2A 1U5BA 3URKA 2JIOA 1OHHD 4PLFA 3PUIA 5KTKA 4B31A 3THXA 1KKMA 4OHUA 3EXEA 2E4ZA 1T2DA 4BP3A 5L7YA 5TE9A 2I91A 2P6MA 1KK2A 1R5JA 1N4AA 1LDGA 1Y7LA 4PICA 1NV9A 3KV3O 4Z6KA 2CHUA 2I3ZA 3PHLA 4PZEA 2QORA 4U8GA 4BC0A 5I7SA 3RIGA 1NN5A 1XV5A 3A4LA 1U63A 2VYQA 5HPYB 4RXTA 2PX8A 4HEHA 5SYNA 4Y8VA 5DIZA 3OOHA 2FF5A 2ZRPA 2WFLB 2IHJA 3SD7A 5L3SB 3NGXA 3I53A 2VP2A 4WKCA 5JWHA 1T9HA 3X1KA 4A0SA 4MEJA 3NVKI 4AU1A 4TQAA 4EHBA 5BSMA 2O05A 3AXSA 5IZCC 3H17A 4NMWA 1SPBS 1U1DA 4LOKA 4XUDA 3SC3A 3P9RA 1MQAA 4GGOA 1F8GA 1CUUA 2GO1A 5IDVA 4B3IA 4QDJA 2C9OA 3F71A 4OGGA 3UJNA 5HS4A 4Z4IA 4JOCA 4YJ2A 4IUDS 4P7KA 1KYTA 1NULA 2J0EA 2ECKA 4GXNA 1XKLA 5CHEA 1DT3A 4WIAA 1T0HB 3G8BA 3R4VA 3UUEA 3UAXA 1KYQA 1Z4JA 4KNWA 2H4ZA 1YK1A 3LA6A 2YCBA 3CH6A 4M1KA 3E3AA 4LTNA 1RQ7A 1RQLA 1V43A 2WIKA 3FJOA 4G1MB 2P9ZA 4KQIA 2LVBA 4DLRA 3D6UA 4B6QA 3ENZA 4JSYA 2E5LB 5E4FA 2KB0A 3OOJA 4LTDA 1QVVA 2RH9B 2WG2A 4YWHA 5CXQA 1FVHA 1NGSA 2BBTA 3THXB 5GPBA 4LRWA 1ZAKA 5FHQA 3HXMA 4IJWA 3DOIA 3PHCA 4NRDA 3B3AA 4WBSA 3KJIA 3PNYA 4MLDA 4W6ZA 1BHSA 4LJ8A 2DBVO 3ZGVA 1GPH1 1KP2A 2H3EA 5DVZA 5EJ2A 5JV5A 4RZHA 5DCWA 5C1OA 4D79A 2B3DA 4RELA 3DT6A 4AURA 3EDRA 3LHKA 4Q34A 4ZVPA 1L7VC 3FNEA 2OFFA 3OWXA 1L7RA 4MS4B 4F1JA 2E55A 4UD2A 4CIXA 4TZ6A 5CFQA 3TSYA 4EG1A 1J2UA 2G77B 3HI4A 5JNRA 4KOAA 1I1QB 3V8RA 1Z0SA 2Q3FA 3KPJA 3ND7A 4BTEA 3BAFA 4RJIA 1KDVA 4BMOB 3OC0A 2JI9A 3R3YA 4AX8A 4LF7B 3FOFC 2EXXA 2C8JA 2IU4A 4FT2A 4J07A 2WHQA 1E1QD 1YD7A 1HYGA 1S8NA 3G9TA 5K0SA 2O1EA 4HT3B 2BFDB 1YAHA 1ZN9A 1GNRA 2WSIA 2C2BA 2EZ8A 1C7JA 3SBDA 3HV2A 2HA4A 2PGOA 1Y9EA 4CT5A 4K6FA 1K92A 1BH2A 4YUVA 3C7DB 2VSYA 4OKSA 5T64A 4DSZA 2R79A 3VNQA 3BSSA 3VNAA 4YUYA 5L7TA 3H4VA 4Y2UA 3ML1A 3ABSB 2G5PA 4QQNA 1JB1A 1ZXBA 3DEFA 3IEKA 2GKOA 1YRLA 2H0RA 2H1HA 3A6JA 3FPKA 2GZDA 4KO2S 3EQ6A 5JC8A 2IEBA 1LFDB 3SHTA 3IP7A 2JLBA 4D81A 2O0LA 4AKSA 2GNAA 3QMMA 1R4NA 1I2ZA 5HGJA 2CF5A 4KPFC 3QOYA 1XZKA 5BWCA 3GCWA 4OLBA 3SQXA 1D6SA 3LC0A 3BL5A 5G4KB 1C7FA 1IU9A 1QRUA 1SGWA 1SMKA 3DDWA 3IBCA 2J5QA 1ONOA 4IH4A 4JQCA 5C4IA 2W11A 2YDYA 3KB6A 3L7YA 4G24A 4RD1A 1E3DA 1WCV1 1XF9A 2PANA 2ZTMA 1J9ZA 4M0KA 4AO8A 1IVSA 2VQ3A 1JLLA 4OREX 5FTMA 2VS1A 4ARAA 3IE2A 3G7SA 2QLTA 3MOIA 4M60A 4YJGA 3PHGA 4RESA 3OE1A 1J0EA 2Q0XA 1Z25A 3H19A 3JCZA 5EC8A 2FWNA 4GVPA 4L5BA 3G0HA 4KVZA 2EIXA 4RH3A 4CCYA 3OO0A 3VDNB 5JU6A 3DBLA 3LFHA 4H2DA 1DQYA 1Z88A 4OJQA 4QDTA 1IOZA 2C9BA 4KBYA 3FHCB 1DZ3A 3TZKA 4HDKB 4LGMA 1OASA 4G85A 5DT9A 1U81A 4P82A 5ILGA 2VH1A 4FMCB 1XWIA 4Q3KA 3LT1A 4GGMX 1E6CA 2LKDA 2DHCA 1FPQA 3CIOA 5AHWA 4OXRA 5F5XA 1BOFA 5F3DA 4LYHA 3TSWA 2GM3A 2JFXA 1VJ5A 2LR0A 4HB4A 1U9IC 3IR5A 1JF8A 1OXXK 1THZA 2B92A 1W9HA 2BI8A 4U8HA 5DEOA 3A1SA 3EGIA 4YRIA 4DLAA 3TNLA 2H5IA 2HK8A 3PXGA 1TT5A 2NO5A 2WTBA 4PE5B 3WBBA 4GOJA 2J8ZA 5TIIA 1P9NA 3M3HA 1X7ZA 2C84A 2R96A 1JIJA 1GZ7A 1T0JB 4RTLA 2PAFA 4G0OA 1P2BA 3ZS9A 3CZ5A 4ZEVA 1QTIA 3V2IA 4MRAA 2J31A 2RB5A 3PF8A 2X3FA 4BKUA 4WXEA 2QRZA 3AF2A 3L8FA 1OX5A 2VZEA 1OBOA 3QP9A 1IUKA 5JCXA 3HU1A 3PE4A 1JSRA 4K1LA 2W70A 3CUKA 2JKYA 1H3NA 3BTSA 5K51A 3VGJA 2JAPA 3KDPA 2XUGA 1NBHA 2EKZA 1JLLB 2ZI4A 2R8OA 5LOVB 5HZHA 2OECA 4P7GA 1YIOA 1HNWB 1Q74A 2B2CA 5C9ZA 1ZNXA 3NONA 1FTGA 1VP3A 4BUZA 5B2FA 3CU5A 1RWMA 3DTVD 4RTSA 4I4CA 4OB7A 3VI3B 1VQ1A 5GIOE 3ZJTA 1K89A 1RSZA 2Y92A 3KFVA 4H6WA 4MUMA 1YB4A 2ORIA 5FJJA 4EKEA 5KYGA 2WMNB 2KJQA 3ETJA 3W34A 5HKLA 2IP1A 4UBKA 4NDZA 4EYKA 5GY7A 4WUTA 1KO1A 2W2MA 4LMRA 1OCEA 2F3PA 3AXTA 4HCJA 3RI3A 2XE7A 2J9YB 3WLNA 1PL6A 1ENPA 2BKUA 3GFRA 3QHPA 2JI4A 3CLUD 1E3QA 3PLRA 4KXNA 3N0XA 4CFZA 2REQA 1TJ5A 3CVOA 4AJ9A 4RORA 1CUIA 1CSEE 5DLEA 1OVGA 3KDAA 2WHEA 2ZUFA 5IC6A 3BWMA 2QHXA 4DT1B 3PQ7A 1TPZA 2CGEA 4JN6B 1C4OA 1XZPA 2ACWA 3D0QA 1JHUA 1IN6A 4UBNA 3UW3A 4F6LA 4NCXA 5K0BA 1DQPA 1AN9A 1CR4A 3BMNB 1QIEA 5JS7A 3R3VA 2LZ0A 4E6EA 1ESNA 1IN7A 1PJAA 3TKYA 3RU7A 3OICA 1OC2A 1YS7A 1SG0A 1Z4IA 1DIOB 2AG5A 2PT5A 1ZD8A 3LUCA 4MK4A 2M6LA 4LPSA 3SU8A 4OK3A 2O2EA 2ZJ0A 4NV0A 4RL6A 3EWAA 4HQLA 5IHXA 1FJHA 4M8SA 4GRDA 3BWBA 1UBOS 3RRZA 4DR4B 4NL4H 1E7RA 4FOSA 1YBVA 3UAGA 1WBBA 2FFQA 5GTDA 4BX0A 1QPBA 4YAUA 4DG8A 3GPIA 2AN5A 2XUAA 3CJTA 1ZX1A 3R20A 4F93B 1WBDA 1K9VF 4Y9RA 1CD5A 4LMPA 4UVIA 5CA0F 1QVWA 4G0PA 4JP5A 2OV4A 3IIKA 4JAVC 3WK6A 5FTNA 3LKZA 1DX4A 1PNOA 1XZDA 4OFWA 2ZWVA 4C4SA 4ARCA 2WPDD 4D9NA 1K7FB 4P1ZA 3VAAA 2ZU0C 1ISPA 2ISCA 3FRJA 3MD0A 5AJWA 1GT6A 4RE5A 1V5WA 1GG5A 4LY6A 3RFFA 3SXPA 1ZONA 1JDBB 1A69A 3NIFB 4K81B 1W94A 4IP0A 1O58A 4Q3LA 4K40A 4TLAA 2D1RA 3E03A 2QW0X 2BW0A 4B6OA 3BHNA 1COWD 3L8DA 4OMFG 3WGIA 4YRNA 4RS3A 5DP2A 2GKSA 4XWOA 3TZQA 4GOMD 3E9MA 4CUKA 1Z39A 1PJSA 4UHKA 4L8FA 4OX9B 2EZ4A 4GKKB 3CZQA 2RHOA 5KSZA 3OJCA 1GD1O 1DARA 4O1MA 2KWIA 2GEJA 3C43A 2GYYA 4I6EA 3NBMA 3SJUA 1M3SA 3NTLA 1P3JA 4WDRA 4FFSA 4DRYA 2GBIA 2R25B 2VJMA 4TMZA 5GZ3A 1ZYUA 1RBYA 4UTZA 5TB5A 3WGHA 3WLFA 2ZR9A 2HXGA 5EMJA 5MGNA 3U9SA 1UC9A 3EBOA 1BHJA 2PVPA 4PSKA 1KIMA 1B43A 3AIMA 2EGUA 1QHEA 4NENB 4GPTA 4MDYA 3MXOA 4C1NA 2JANA 3RK0A 5IKOA 3EXHB 2R8RA 1P7VA 4HX5A 3VU0A 2V6FA 4JUDX 3ZW7A 4EA9A 1M5TA 3WE7A 4DG5A 1B16A 4ZAVA 4B0PA 1IN1A 2ORYA 2WOOA 5EESA 2OLJA 4C43A 2AH5A 1O1YA 3GAFA 1JSLA 1IM5A 1DEAA 2N0SA 1MJFA 4KWCA 1J5PA 2C82A 3H84A 2I4OA 3I2IA 3UH1A 2GPWA 1KPIA 1OWMA 1UC5B 1VCIA 2BP7A 3EC1A 3VZSA 2IH5A 1OI7A 1IEQA 2VBFA 1BD3A 4GFDA 1Z8FA 2BKAA 5CW1A 5DEIA 1LZLA 1TJPB 5SY6A 4LRQA 3EFBA 4PN7A 1XKQA 3TW8B 2UAGA 3OKAA 3V1LA 1NVKA 2OM2A 2GRAA 2FUEA 3BK1A 4IDOA 5I6DA 2FPGA 2ZZKA 5LMUB 1OY1A 4H27A 2YW2A 4QICA 2AMJA 4JXKA 1UWLA 3PXAA 1Z12A 4XR9A 4H3SA 2CLFB 1HQKA 4EI9A 3LZDA 2WTNA 2O2GA 5JSYA 3DOFA 3V34A 1ZUNA 2C94A 2WIJA 2HF8A 4JGIA 5LP6C 1SU8A 1HEUA 2CL5A 1UMCB 1WXQA 1KBZA 3V2GA 1W49A 4BQQA 3KDSE 4GG1A 4QOGA 2HPVA 3U60B 8ABPA 3OTOB 2CNWA 2FZCA 4UHFA 1MEOA 2EL9A 3M9WA 2Z5VA 4J8PA 4GQAA 2O54A 3WLHA 4MCAA 1QGZA 1Y8RB 3IO3A 1VL2A 4TLLB 5K0NA 3VOTA 4WCVA 2FG6C 1YSCA 3IJRA 4DUPA 1PK7A 4U2DA 4Z4FA 4DS3A 4O5OA 4OMCA 2HHLA 5SZKB 3RAJA 2OHHA 2QZZA 5ITVA 4AQ7A 4I6JA 3ZI4A 5A5FA 4CKYA 4KQ6A 3QFSA 2CFTA 1D2GA 2BP7B 1KEEA 1F3LA 4AQYB 4U7TB 4NPHA 1XVUA 4RK7A 5DHUA 1F2DA 2FN8A 1DFGA 1KBQA 1JZTA 1ULAA 3RKUA 3VVCA 3SI7A 1FUKA 3O4JA 1P8JA 4HQFA 4M22A 4CL8A 1BKSB 1ABEA 1RYDA 4CM3A 5F1KA 3Q3VA 3QLUA 2HTEA 3CB4A 1SRRA 5MHTA 3NHUA 2XB6A 1A95A 2XF8A 3ISVA 2X5NA 3W1EA 1HE3A 2WM2A 5HILA 2V4UA 4RFSA 4AECA 4PZZA 5K3FA 1TVMA 4DGQA 2X8BA 5C8DA 3ZQKA 1T6NA 1A3CA 1FVOA 4D9BA 2Y93A 1PDWA 2WMYA 2HCBA 3FCSB 3LD9A 4DCOA 4CODB 5JEDA 4YCDA 4RULA 1E32A 3QVTA 1RJWA 3FMFA 1PJ8A 3HP1A 4K6KA 4J3JA 4NZOA 3ZWYA 4N5DA 4R2JA 4UEOA 1E69A 2MIIA 1Q7TA 2FPUA 4UTXA 4HY3A 4WKNA 1ISIA 4XW2A 1PQWA 3ZW8A 2R2GA 2TRSB 1L5OA 2V4MA 1Z56C 1XEWX 4GMFA 3HYCA 2CUZA 1UKZA 1H2XA 2EQ5A 4BO6A 3JYLA 2W2XA 2B1GA 1NUTA 3ZV4A 4E22A 1D4ZA 1P44A 5ICEA 3FZYA 3TZHA 4XLLA 2V6GA 1BXKA 1P5RA 1JFTA 3KELA 3DF7A 4MR7A 5LOVA 4ML3A 1FMTA 2G1KA 4RTMA 2NPOA 1KAHA 3E9DA 3I30X 3KUXA 3FWNA 5DHRA 2PEYA 2CK3D 3KJFA 1ZISA 4KKVA 2UXBB 1FBNA 1KYXA 1QHHA 1W0JD 4HRAA 2C0PA 2BCEA 4KO4S 4R05A 5HJ2A 3T52A 4DR5B 3KTAB 2AJLI 4LW8A 3G0DA 4JL8A 3AVQA 1QAOA 4F60A 5H70A 2IELA 3C39A 1AMOA 2P2GA 1HDGO 4P98A 2RJOA 3HVJA 1DKRA 3LL7A 4RF2A 1TO2E 3Q9LA 2FSHA 1GUYA 5DULA 1RVDA 4OB8A 5K3FB 3KQPA 3T99A 3JR7A 2H1VA 4PYKA 5HTKA 4ZAZA 4HNAB 1BMDA 4MUYA 5FHRA 3LPLA 4MV8A 1BHO1 3WYGA 3Q7SA 3WYDA 1LVGA 2DPGA 1ZRNA 2FR8A 2FJUA 1G98A 2X19A 1PJLA 2ZTHA 3QUSA 4MYDA 3DAYA 3ZCSA 4EW2A 2JLQA 2GHTA 5B3AA 4I4NA 4A2WA 3DR3A 4ZO4A 1E5VA 2ZB7A 4GDMA 1N34B 1MFZA 1N8NA 4A8JA 4IDDA 3B9BA 3M49A 3GJ7A 2P1DA 4MW1A 4YCAA 3TIFA 1NBWB 3IUMA 5AW1A 1GY8A 1ZWKA 2IHTA 1AZSC 4ZD6A 4EUNA 2J9GA 4TUYA 3HSKA 2J5XA 2VK8A 1VBKA 2OD7A 2VHQA 3HDVA 1QGDA 2F43A 4K1XA 4ZOBA 5FOVA 3UB2A 1PJRA 3MFYA 4TX1A 3DKIA 5HSGA 1CDOA 3L7MA 3Q1LA 4MR7B 4US1R 3L1IA 3ZV5A 5BSVA 4NS1A 5KYXA 1CVRA 2CXUA 2F9LA 3BGDA 3Q12A 5D85A 1MFPA 3DEHA 1V4VA 1A4RA 1HZZC 1W2GA 4XYLA 2CDRA 4NATA 5K0FA 3TSAA 2ZPTX 2HSEA 3IMFA 2CMDA 4MGHA 4JOQA 3V8MA 1RLTA 1YR8A 4YO8A 4CMBA 1KR5A 5T8KC 3N70A 3ZWCA 2E4WA 4KXVA 2N3ZA 4ZP1A 1M1YB 2OBYA 2PV0A 2ZGVA 4TYMA 4ZALA 1SVIA 2G40A 4L6AA 2FFJA 1S89A 1EP3B 3EMKA 3H9BA 1E9FA 3JQRA 1H05A 1NMSA 2BWJA 2PEZA 4V0MA 3LK6A 3Q5DA 3BHIA 1Y1PA 5CD9A 3G2IA 2GPTA 3GV0A 3HB0A 4H7PA 3R0JA 1G63A 3L0YA 2ZE6A 3O7WA 3RLIA 2HK7A 1WZ2A 1QHXA 2M6RA 2EGGA 1NT4A 3P52A 5EXDA 2JLRA 2GUGA 2PA3A 4L15A 2R85A 5ES3A 1BDBA 1PR4A 2D0PB 3IXQA 1ILWA 3BFXA 4D9HA 4IQFA 5LZ4A 2XQGA 2H54A 4TQ9A 3ZU5A 1UEXC 1CQIB 1MIHA 3N5CA 1YFZA 2G1PA 1GTVA 1FFXA 2GSWA 4TUYB 1XP5A 2QVXX 2POCA 2F43B 2NADA 1MGOA 4W1PA 2YTZA 3BRSA 3C5WP 2BZ0A 2GK7A 2POQX 4YRGA 2X0EA 1TLFA 1CUAA 2QR2A 5GVSA 5THXA 3PXUA 1HT0A 4IINA 4HTFA 3FRHA 1YJ5A 2OQVA 4JQOA 2VJCA 1PGJA 2GX6A 2YHIB 1Y9JA 4EP1A 1H4SA 3N8NA 4Z4GA 5KNBD 5TY0A 4B6PA 2OENG 1QHNA 3ZCXA 1S3IA 4ENPA 3RRYA 2O1WA 3QU4A 1OI3A 1QE0A 5HG0A 1C8BA 5KWSA 5JMTA 1F0NA 2AFHA 2OY0A 1EDEA 1MH9A 4N3GA 4YP5A 5F4BA 3WLOA 4QECA 1Q0RA 5C4MA 2EP8A 2IOYA 3EGWA 4X8MA 4QRHA 1VHQA 2GCNA 5A3SA 2WMOB 3MWEA 1P2UA 3UMGA 4GNRA 4HJRA 2CV2A 3IOCA 3ZGXA 1UFQA 1J23A 2O3SA 4BNFA 1SQGA 2XE4A 3OP4A 3ZCVA 3ZDAA 1RAHA 2AD5A 3TPCA 2YJ6A 3PJRA 4UBIA 3TR6A 2CLLB 1X3SA 2DTEA 4HWSA 1TEVA 4ACAA 4CR8A 1BDIA 1CUYA 2FW7A 2GJKA 2IHVA 1X0XA 2M1ZA 3FFXA 2ZBUA 4R1TA 5I8WA 4JLOA 4KR2A 3VR4D 2WTEA 1YB6A 3KCNA 4DJTA 4OV6B 2HF9A 1Y4AE 4F6RB 3CINA 1V8FA 4J7UA 1WPQA 4XX0B 4JKOA 2YS7A 1SBIA 2EX1A 2XVXA 4L4SA 1MX3A 2D8MA 2PX0A 3BILA 4BU1A 4JL5A 2D2VA 4D82A 1T8YA 3OEEA 4KZKA 4OHWA 5LLSA 2PK3A 4G0WA 1VBNA 3EC7A 3KSRA 4FNOA 1VSUA 1NY6A 1OQAA 2XA1A 1TTQB 1LTKA 1VXOA 3CKLA 3VPDA 4GPZA 4PAOA 2GBLA 4D0SA 2QRQA 3VKVA 4RK5A 3EYWA 1MQ8B 2ZWIA 3UK1A 3CHYA 2J3KA 4KHPB 2I2AA 5L6MB 1VPLA 1X77A 2WAYA 3ZIAA 2GK4A 2YMLA 3KEFA 1E6EA 1N6OA 1NBEA 1SURA 2AOWA 1O97C 1XDZA 3D7KA 1A5SB 2EEZA 2AWOA 2JEZA 4D4IA 2J41A 1MR3F 2OPBA 4GZ6A 5BNIA 4MOWA 2OV2A 1K7SN 2X86A 4WL0A 4Z2YA 4K2AA 3U4IA 3IE0A 2BLLA 3OLYA 4MRRA 3PC8A 3W2EA 4KU4A 5AKJA 2BFEA 2HTFA 2O0JA 4N39A 3FFBA 3V1UA 1L7BA 2QNIA 4A8HA 5CEEA 3H5TA 3WGJA 4ARBA 4HNSA 1NW3A 4RS4A 1B0ZA 3NGMA 4QNRA 1GSAA 5CAEA 2VHVA 3PUYA 2JJ1A 4NP6A 4US0R 4HTAA 3ESYA 3E1GA 1F1BA 2JCSA 4KV9A 3KXDA 2Q4EA 1GQRA 4A16A 2OHJA 1H5UA 2DTDA 5E2BA 3TBHA 2D7DA 4R0MA 2Y1WA 4MKFA 4E13A 5L3ZA 4MO2A 3GJTA 1JZSA 4KLRA 2CJFA 4LV6A 3VKWA 1OFUA 3WLSA 2PX3A 4KQMA 1LXCA 1N5MA 1PD0A 4HEQA 4JENA 4E5MA 2PGNA 3GVIA 4BFZA 4YQEA 4E5DA 4GL2A 3CNQS 3VTZA 3QMWA 1M0WA 2ONZA 3CLUC 3ESCA 4BFVA 2WQ6A 1EI9A 1I0ZA 2Z5LA 4JITA 2WRZA 1U1GA 5DCYA 3RUAA 3I2KA 5EKSA 1C3EA 2CDCA 3BD9A 2GFHA 1RJFA 4CFYA 4ONEA 4HQKA 4PG5A 2RBKA 4K9NA 1Z74A 5GJCA 2WIBA 5F5LA 5FAKA 2QJTA 1KR2A 2RJ3A 3DO6A 1DC6A 3T5GA 3VZQA 1JS1X 1QBGA 1QYWA 4F38A 1RQRA 1WCYA 1W4BA 3LIPA 4FEGA 1TK2A 1TVCA 2XUIA 3Q2KA 4KDRA