3W5IA

Crystal structure of nfeob from gallionella capsiferriformans
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
199
structure length
194
Chain Sequence
GQFKRIALLGMPNTGKSTLFNRMTGGAARVGNWPGITVELLSGKILLGADMVEIIDLPGIYDLHGFSDDEQVVRHFLHDNVPDLALVILNATQIERQMSLLLQLKQLNMNIVVLLNMSDEAKQYGITIDSRKMSELLQIPVFQLTGYQEALQAVTRALRYPTPGMAENVRTQLEQDEHIEAEMVRILKSAVQIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrous iron transport protein B
publication title Structure of an atypical FeoB G-domain reveals a putative domain-swapped dimer.
pubmed doi rcsb
source organism Gallionella capsiferriformans
molecule tags Metal transport
total genus 62
structure length 194
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3w5iA00
1K5GA 1XTKA 3BIFA 1N6NA 2ORVA 4WXRA 4OHYA 4IXMA 2ZSDA 4RCYA 2BCGY 1IXZA 2NO0A 4NE2A 2CL0X 4ZKDA 3WP0A 4EJSC 2QUZA 3RABA 3ZVLA 4E09A 2IYUA 3EAQA 1FX0B 1LVGA 3AF3A 2OFXA 3PEUA 2N42A 5KSZA 2HJVA 5FI0B 1Z0AA 1Z0FA 2JA1A 5IT5A 4S2EA 4BRWA 2IF0A 3KXIA 1M6NA 4YMTA 2H7VA 4M1MA 4DSTA 2FU5C 1CJTC 5K8LA 2AR7A 2ORWA 1CKEA 3FDIA 1I4TD 2GCOA 4ILEA 1F2UB 4P31A 2FMXA 5SZHB 3I61A 1ZNXA 2ZYTX 4NHOA 4PC7A 4BWYA 1DVRA 1AQYA 4BFYA 1E94E 1KNXA 1U99A 4LBYA 4XD7D 3TUJC 2HYIC 2B8TA 2Q9BA 1FMJA 1N3BA 1I4LD 3UG7A 3EIQA 4GOKA 3CONA 4WVFA 3UANA 3REFA 2BHRA 2P6UA 1KDPA 3DVLA 3GLIA 1TADA 2WJGA 3BGWA 2JJ2A 2QQ0A 1COWD 1M2OB 2E9SA 1JR3E 2WWIA 1E2LA 1AS0A 4NZYA 5G3ZA 3SZRA 1UEJA 1S0UA 2AD1A 3IIJA 1H8HA 1NKSA 4GT1A 3LVQE 5AJYA 1E2PA 1SXJA 1XXHB 2JCSA 1U0LA 1ZU5A 1P62B 2NO6A 3KFXA 1OFTA 3SJBA 4BPBA 4I1UA 3L43A 2IXEA 3GLHE 4QNRA 2JIZD 3BAFA 5FPKA 4Q00A 2G77B 2DFTA 4L15A 3WRXC 1Q0UA 1CRPA 2NIPA 2OE2A 8OHMA 5DHFA 5F9HA 3UXMA 2ZSAA 1E2HA 2QAGC 3FYHA 2PZGA 3PQCA 2NPFA 4ZCMA 4QOSA 1GNPA 4TSFD 5GJBA 3X1YA 1ZW6A 1PJRA 2OUKA 1JXMA 2GKSA 5KOYA 3DZ8A 2IS2A 2R6FA 5SZJA 4BLOA 2YOGA 1UBGA 2D7CA 4G5SA 2FEMA 2ZYWX 4LHVA 5BQ5A 1AKYA 2CK3A 2OO7A 4A8JC 1JAHA 2F43B 1YJ5A 4Q4AB 4CEIB 4PFSA 3THXA 3NC0C 3L82B 1UBEA 5F98A 3CPJB 1IN5A 1EWRA 1NN5A 4MGKR 3VR4A 4R2HA 1P9NA 4C0LA 1DAGA 3NBXX 4HUTA 5E3HA 3QKTA 4GNKA 1XMIA 3R9WA 3CUEF 1D6JA 1GZSA 2HCJB 3T1OA 3U3RA 2QMHA 1A4RA 3R8CA 4Q4JA 4MYTA 3WMGA 1MRSA 4AURA 721PA 2BMDA 1RE0A 1CTQA 1W44A 2IYQA 1Q1BA 4MGIR 1IM2A 5FTKA 3THYA 3AVTA 4LYHA 1VDZA 1BKDR 2VP4A 3THWA 4D26A 4GRAA 4BLPA 2WMNB 1P2SA 1XWIA 2DBYA 2X77A 2ZE8A 3CX8A 3IBGA 2JDIA 1AN0A 3TQCA 1BIFA 4HB2A 4PZYA 5ANRB 5FBRB 4U7DA 4YMSA 2VPPA 3EPKA 1II0A 3DM9B 821PA 2XTNA 3EX7C 4KHZA 4A92A 1UFQA 3OFND 4F91B 1OH5A 4JLJA 3AP1A 1KZ7B 1J8MF 2QORA 3OIVA 1A2KC 1ZD9A 3AKCA 1R8SA 1W47A 2I1VB 1GNQA 5GJCA 1Z6GA 4M9SA 3U3JA 2ZI9A 3B13B 4FCVA 2IYRA 1UPTA 5FTLA 3RLFA 2AFHE 1MH1A 5JECA 2WWFA 2FSIA 2YC2C 4PPQA 3RRZA 4GP6A 2CL6X 1S2MA 2HYDA 1HT2E 4YC7A 1GKUB 4TQ9A 4LX0A 4TT3D 1DAMA 1CJUC 4QGFA 1OYYA 3A4NA 3QEJA 4IEEA 1Q1QA 3VU9B 2XB4A 3BWDD 4RY2A 3KUDA 3LV8A 4EJSA 4BFWA 4AYXA 5JRJA 1E1RA 4XVRA 3U61B 1QVAA 2FFHA 3G82C 5E7MA 3C8UA 2VRWA 2H8KA 4PPFA 3NG1A 1ZYUA 2JJ1D 1P73A 1G8GA 2DY1A 2XAUA 4AY2A 5EJEA 1OPXA 2D4HA 1IY1A 1T0HB 3EPJA 2WJJA 2HV8A 1CR1A 5IK2A 1R7RA 5B64A 2D3WA 4PSAA 3TVTA 5JCZA 3CF6R 5JWRA 4LJAA 2IXFA 2XZOA 1TF7A 4MYUA 4BE7B 1E2JA 2YOFA 2ODBA 2XNDD 4LJ5A 3LNCA 2A9KA 3VMFA 4DKXA 3GJ7A 3QUSA 4XVUA 3LO5A 4B3FX 4ZDKA 3AF0A 2FGKA 1X8JA 1ZJ6A 2WWHA 4JLNA 3Q3JB 3C5CA 3TJZA 1EWQA 1MO5A 2WKPA 3C4JA 2MSEB 2VP6A 3HDTA 3VHLB 4HSEA 4DB4A 2ZAOA 3K70B 3C7KA 2XB2A 1J7KA 1VTKA 2E1RA 2XSZA 2GK7A 1ZM9A 2W6JD 5SZKB 1F5NA 3RHFA 1HTWA 1ZIPA 4UQOA 4A36A 2PJZA 2W6ID 1WDTA 5DISB 4KFRA 3DOFA 1YR6A 2O8DB 4JLAA 3BB4A 4G5RA 1VCOA 4WAUA 2QSYA 2A2ZA 2HLDD 5CYPA 1Z06A 5BN5A 5FPSA 4D4LA 1DARA 4QJ4A 4Y0AA 2GXUA 2KB0A 5JZVA 1LNZA 5C4MA 4IOKA 2VF8A 3BOSA 3SFVA 5KU1A 3T1TA 2BVNA 3LFUA 2FFQA 4ZIRB 4QHYA 4CDGA 2L0XA 1Q1ZA 5HZKA 1E79D 3VFDA 1M8PA 2MMCA 4PPNA 3CRRA 1T3HA 1T5IA 1II8A 2OBNA 1M74A 2VHUA 1EX6A 2AFIE 4OJKA 2IEZA 3AB3A 1WQ1R 1UADA 1I4DD 1NLZA 2GZAA 2R2AA 4JKYA 4MH0R 4A8JA 1Z0DA 2ZS7A 2F1RA 5AUNB 2BBWA 2A7QA 5EE9A 4PR0A 4Z1MD 4TL7A 3R7WA 2PZEA 1XB2A 3C15C 5B58C 1W36D 3A36A 4C7OA 1OFIA 1TL7C 2GEUA 1IQPA 1ZM2A 3NTUA 2ZETA 3HPQA 2OAP1 5KDDA 2V8OA 1YRAA 3CPEA 5D3MA 1TPZA 3GJ5A 4NKRA 2CHGA 1W5TA 1ZP6A 4IKEA 4Q02A 2AX4A 1PVOA 4OQXA 3LVRE 1AA9A 2VHTA 2JLRA 1G8FA 4NYJQ 1RRGA 1GL7A 1KKLA 4DT1A 3WHLA 2VP9A 2EWWA 5HTKA 2IHBA 2PH1A 3KB1A 2QP9X 3PV0A 1U90A 2ZTSA 1R5NA 1ZINA 2ZYVX 2GXQA 3RDPA 4D0LB 5EE5B 1XEFA 1GRNA 1EGAA 1DG1G 4IDOA 1Z28A 2BBSA 2ZJAA 1N6PA 2EYUA 1A82A 1QDEA 1RYHA 2BCJQ 4FI3C 4OI4A 4NYIQ 3RC8A 2QZ4A 4DWJA 4R2IA 3SJCA 3JZMA 1IN8A 1QHGA 2OLJA 1X3SA 3I5YA 4YLGA 1KNQA 5EP1A 1IONA 1S9HA 2J9RA 2BMEA 1N5IA 2R6AA 3I8XA 1E1QD 3MGCA 4Q66C 2WV9A 2IYYA 1GOTA 2HT6A 2JATA 2JLUA 1Q12A 4WZ6A 2PT7A 2O8CB 4DDUA 1X8LA 2IHYA 3EG5A 3FGNA 4BRUA 2QG6A 5JWOA 5EUMA 1IN4A 2D7DA 3EC2A 1NG9A 3KJEA 2Y8EA 2J7PA 3BB3A 1DO0A 3FHCB 3QKUA 4B76A 5DLQC 1B0UA 1U0HC 2GNOA 3TH5A 2D06A 1RIFA 1N6HA 1ZIOA 2RHDA 1J2JA 2ASEA 4LJ8A 5FL3A 1GVNB 1ZD1A 4IXNA 1PLJA 3NBFA 4EFMA 3CNLA 3TRFA 2D74A 5FOXA 1ZNWA 2JLWA 2UZIR 1G3QA 3QF7A 1S1CA 1T3LA 2QP3A 4QC2A 5IHPA 4NYMQ 3V4RA 2UVQA 2KBEA 2IWRA 1Z6AA 2FNAA 1ZUIA 2GTPA 2XXAB 1SKQA 2ZJ5A 3CB4A 5L3VA 3BFXA 4BZXA 2QBYA 2FGJA 2JLVA 3QNUA 3PEVA 1U8AA 4URVR 1T9HA 5J40A 4I4LA 1KO4A 1OHHD 4AK9A 4D80A 3TUZC 1E6CA 4AG5A 3KKQA 1E9BA 3ZYCA 3TBKA 1MO3A 3P32A 1J70A 2JJ2D 3SE0A 4CRWB 4DDTA 1W4BA 1QHSA 4PZLA 4JKIA 4WZBE 4Q03A 1GAJA 1BS1A 2J3EA 4DLUA 1SXJD 3RS2A 3C16C 2CCJA 4V0OA 1HYQA 5DE3A 2VYFA 1Q22A 2IXGA 1S8FA 1IN6A 4DCNA 2FZ4A 3KTAA 1R2QA 4JSYA 3TSZA 1W2GA 2RAPA 1MRNA 4XH9B 1KI9A 3BERA 1OFUX 2QGZA 2FSFA 4KYIB 4MUBA 5HZHA 2QL6A 3B9QA 4OHZA 4OL0A 2GHIA 3CWZA 3LXXA 5DO9A 3MWYW 2E87A 2QENA 4NPHA 1LB1B 4A0FA 2IYWA 4LHZA 2A78A 4TN1A 1G5PA 1GP2A 3CRMA 3IO3A 3D7MA 1WF3A 3FKSA 3IHWA 3RSLA 3HJNA 2CK3D 4XOIA 1GUAA 1XEXB 2KJQA 3WNCA 1US8A 3ADDA 1EFCA 1QHXA 5F9FA 2OCAA 2FA9A 1E9AA 4LJ4A 3U7HB 4RZXA 3V9PA 4UNRA 1XCGB 5FL7D 2QSZA 3EIEA 4M8NE 3VAAA 4O0MA 2ZVPX 3THOA 2WM9B 2OFWA 3GLGE 4YQFA 2NO9A 1VHTA 2GZDA 2EW1A 3ZZ0A 3M0EA 4F4IA 4EDHA 1QHHA 3TW8B 2ZVQX 2VSXA 1FTNA 1V43A 4KVGA 3RVBA 1QVRA 4KFSA 2OCPA 4FMBB 5E7IA 1L2TA 1H65A 1KYIA 1U8YA 2EFGA 4QHSA 4TMVA 3A8TA 2O0KA 2WWWA 2UKDA 4US2R 1ELOA 1RW4A 5CM8B 1XZPA 2J0VA 4L9WA 2JDID 1A2BA 1T91A 4DLYA 3HU1A 2ZRIA 1ONBA 4MYHA 3TQFA 1KI7A 4DJTA 1H8ED 2ZRDA 3FFBA 1VECA 2C2HA 4LV5B 2DYKA 4OYHA 2ZRFA 3K9LA 2D2FA 1NP6A 3SC3A 3GEHA 1OH6A 4B74A 4CIDA 2G3YA 4HATA 1RRCA 2A5FA 4L4UA 4IDQA 2YINC 3O8DA 3TMKA 2BBTA 2AN9A 4P4UA 2MMGA 1KHTA 4KVAA 2JJ8A 2W0MA 4TT3A 2YYZA 2FSHA 2ZR9A 1OH8A 1NMYA 3IEVA 2PEZA 1OLOA 4IEIA 4G5OA 3BBPA 4TTPA 2IYSA 1HH4A 3PUXA 4CEJA 2ZRPA 1LS1A 3CWQA 4ASUA 3KQLA 1RVDA 4R71A 3T5GA 1FFHA 3MJRA 4EPVA 4AKEA 3WBJA 4Z51A 3CH4B 4ZDWA 2XTZA 2AWOA 3GLIE 5L3SA 2ZJZA 1Z63A 3B9PA 1ZC3A 2PMDA 2V1XA 4GSYA 4DXAA 3SOPA 2X2FA 1XU4A 2DWPA 1E1RD 2BKUA 3D31A 3E5HA 4KI0A 3ASZA 1SXJE 1XJCA 4JBXA 3RANA 3CPHA 4K8OA 3NVAA 1HY3A 2RGNC 5DI3A 5G41A 2ODWA 1XX6A 3K0FB 3T12A 4B2LA 3I5XA 4JLMA 5B57C 5GVRA 3D3QA 4LC1A 2H16A 2JLSA 2IT1A 2V55B 4A9AA 5TB5A 4PANA 3B5JA 4ERNA 2QTVB 2I3BA 2QT1A 3WXMA 3NDBB 3HYRA 2FPMA 4GDFA 2ATXA 4FD2A 4OK5A 3KZ1E 2ZUCA 1N5KA 3QY0A 4N0EA 4JLOA 5KPDA 1KTVA 5FTMA 4G0NA 4Q7KA 1LF0A 1G20E 3DL0A 3K0AA 4RKEA 4DHEA 2JEOA 1OXTA 2CEAA 4NCJA 3T15A 4B43A 4TYPA 2F9MA 1G4AE 3Q5DA 4DIDA 3CNOA 4FMCF 2F1JA 2HLDA 2ZXUA 1UDWA 3KXKA 5FOVA 2GVZC 1NBMA 1VYVA 3UMFA 1Z2AA 3IBYA 4QJ5A 3GLGB 2FF7A 2X19A 3O47A 2CJWB 1TTTA 3V4FA 4HUQB 2YWEA 3GJ4A 1E79A 1ZM7A 3WNDA 3TAUA 5TXGA 4MQBA 5D3QA 4HEJA 5CIQA 4ZPXA 4Q4HA 3QI2A 1NVWQ 1R0YA 1IY0A 3EZ9A 5EP3A 2B7BA 3QXXA 2ZEJA 3GFOA 2ZUDA 3WBKA 5KHOC 3NH6A 2Z4SA 1KI6A 1DE0A 1BYUA 3SEAA 4N3NA 5DNYB 2TMKA 3N2EA 1G1MA 5HCNA 2NMVA 3VQTA 3UWOA 3CF2A 1GNRA 3NBYC 4IVPA 1CF4A 5HKKD 4Q9HA 1LW7A 2OEPA 2GAAA 4D82A 4GFDA 4ZCLA 521PA 4V0LA 5A4JA 2YNMA 121PA 1NL3A 1W1WA 2V3CC 4PO1A 1C9KA 3KJHA 4HLCA 4JT4A 2GCNA 3PFIA 1GM5A 3P4XA 3KQHA 3AF1A 4BFVA 2ZPTX 4JSTA 5JSZB 4H1UA 1XEWX 1BH2A 1JPJA 1E2GA 2YWFA 3LW8A 4F92B 1JALA 4JVNA 3CX6A 3AF2A 4B3BA 1U0JA 4R7ZA 1FNNA 1KJZA 3FMIA 2P65A 3U44B 4G01B 1JPNA 4LDJA 1E98A 4HYYA 4PHFA 1VIYA 1E2KA 1KO8A 1LS6A 4C0HA 4LJ9A 4HB4A 2Q6TA 4KYUA 1E1QA 1G291 4B33A 2OV2A 2QMEA 3GFPA 3DMNA 4HB3A 4QKQA 1A5TA 5CB6A 1QG2A 1G18A 4IFBA 5K8TA 3KUCA 4PPGA 2H57A 2HT1A 2FFBA 1Q57A 4L8GA 3ZGXA 4Q9LA 2V6IA 2O8FB 3K0EA 1UBFA 2W2TA 4NCKA 5DH9A 4MA4A 4TLCA 5J47A 1F2TA 4HDCA 2NZ8A 1FL9A 4C2TA 1HUQA 2R65A 2CE2X 3E2IA 1R4AA 4TLBA 2YOHA 4A82A 4LHXA 3B60A 4MRRA 3ZVRA 5BWMA 4LV6A 1GITA 2J7PD 4D2IA 3LWNA 2RB4A 1N6RA 3MCAA 2JAQA 1YKSA 4X8HA 1PV4A 3GPLA 2OXCA 2AKYA 1NVVR 1XTSA 3BB1A 1U94A 4P4SA 4V0NA 1OE0A 2VF7A 3IIKA 4QJ3A 2WIBA 2JGNA 2WBLC 4OQLA 2GJAA 3QPVA 4DSOA 5CIWA 3WMFA 1DPFA 5CLQA 2WWYA 2J0UB 4EQ6A 1OHHA 2Q3HA 3I92A 4DLVA 1G21E 4NBSA 3LBNA 4XWKA 4MGYR 1KK1A 2ATVA 2C5LA 2NO7A 3LXRA 1J8YF 4RZ3A 4RCZA 2ZSBA 4A2QA 4DCTA 2RGNA 4PO9A 1P5ZB 1GG2A 1ZCBA 1G5TA 3H0KA 1S3GA 3PEWA 3D8BA 1GIAA 3P1JA 4Q4JB 2PZFA 4NMMA 4BGDA 5IDVA 2DB3A 5UKDA 2QEQA 1E69A 1KJWA 4FXPA 4LV8B 4X8OA 4QBHA 3MJHA 3MSXA 3T34A 3THWB 1UM8A 4YMWA 3K8YA 4OHWA 3JVUA 2GRJA 4JLDA 3S1AB 4DVGA 4M9XA 2DFNA 2QE7A 5GJWC 1CJVC 5JWHA 1M1YE 3U3OA 1OT3A 1E0JA 1NNEA 2AKAB 1MO4A 2W00A 3HR7A 3X1ZA 1G5RA 4CGZA 1P2TA 3NH9A 2FWRA 4FMCB 2C78A 2JASA 2RGDA 2XOKA 3AV0B 4PQFA 5A0FA 3U3MA 1TQ2A 1IOZA 1YVDA 2QTFA 3NIBA 3QBTA 1XNJA 4IFEA 3TE6A 3K0SA 2O8BA 4Q21A 4MITA 1G7SA 2ZI4A 2ZI6A 2ZIAA 3UPUA 2DWOA 2UZ3A 1FX0A 4BLRA 4D4KA 1EESA 1TQDA 2C96A 5FL7A 4C0BA 2QP4A 5G40A 3FKSD 4YMUA 5FBQB 1WXQA 3GEEA 3GMTA 5TMPA 1PLKA 4L16A 1KK2A 3ZZTA 3HU3A 1F2UA 3CR8A 4BFXA 4O3MA 3NHBA 1D2MA 2QM8A 3MMPA 1NJGA 4YXWA 2J1LA 2QI9C 4EJSB 4KLZA 3CBQA 4JYCA 3KX2A 2WHXA 2RMKA 1HQYE 2WSMA 4IHQA 3AVWA 4KO8A 3WRYC 3ZD6A 3H2YA 4TZ6A 2ZJ8A 1IXSB 2O8EB 3W5IA 5C46F 1L4YA 4G5GA 1RYFA 4F4JA 1E2DA 1U8ZA 3FPAA 1KMHB 4Y0VA 1X1SA 3GJXC 4QM7A 3K70C 1H8EA 2EFHB 4AYTA 1FZQA 3UG6A 3B1ZA 1P61B 1E0AA 1XXHA 1RKBA 1KDRA 4NL4H 2F7SA 3U7FB 1P4SA 2OCYC 1GL9B 2IW3A 4JLVA 2FEOA 4GPTA 1GRRA 5TDHA 2ZM5A 2ZYUX 4I1VA 2IYVA 4YDSA 2REXB 1JEDA 3P27A 3PENA 4NCHA 2ZAMA 3QKSB 1G16A 1N25A 4BLSA 3KKPA 6Q21A 4OKSA 5C1BA 3ZVMA 5KSYA 4CVNA 4V0MA 1IJEA 1XD2B 1TUIA 3SBDA 3UIEA 5F2EA 4A2WA 3RS7A 2O0JA 3LQRA 1SQ5A 3EA0A 4ACAA 1FQKA 3IO5A 4KBGA 2IUTA 5KPJA 3WYAA 2OHFA 2ZQ5A 2F43A 2BDTA 1WMSA 4CEIA 3KQKA 4TTQA 5L8VA 2QQEA 3VR3A 1RZ3A 4G5QA 3HPRA 4HB0A 4ASUD 2QAGB 5HE9A 3GLHB 2OCBA 4F4CA 1ZM3A 2DFLA 1ESNA 1Z08A 1JEEA 2XGJA 5IRCD 2KBFA 2QU8A 3L0SA 3QBVA 4CEHB 2GDJA 5JJKA 3L0PA 2P0EA 3OZXA 1ZD8A 1OF1A 4DUGA 5L3QB 2AK3A 1K8RA 5DHAA 3ICEA 1G3RA 4E22A 3T35A 2A5DA 4HZUB 3I32A 1OV4A 5FPYA 4FINA 1HQCA 2WAXA 2RKOA 1XTIA 1FQJA 1FNMA 1CLUA 2B92A 3ADBA 1ZAKA 3MLEA 3ZS8A 2BJWA 4URUR 1T8UA 1OH7A 4H9GA 3P26A 2EVWX 4QBIA 3RS3A 3B82A 4TMZA 1Z47A 5EXTA 2VHQA 4C30A 3NBZC 2ZE6A 3H1TA 2O8FA 1VHLA 4MRVA 1XJ0A 4OQNA 2EFCB 5LBIA 3TW4A 4MDEA 3ZVNA 1D9XA 1GKYA 3B2EA 4YONB 5C18A 3VX4A 3Q8XB 2CDNA 1KIMA 4HAXA 1NBMD 5JHGB 2PLFA 3HR8A 3SR0A 1D2NA 2ZJYA 4ON9A 2FDCA 3CNNA 3QG1A 1PUIA 4Q1CA 2VHCA 3WMEA 1ZU4A 3AGPA 4OI2A 3QVVA 5P21A 1N0UA 3FMOB 4B3XA 1MR3F 4KODA 4PAQA 3LBHA 2N46A 1LFDB 3CRVA 5EXSA 5FUVA 2R6CA 1QHYA 3SHFA 1B23P 1JR3A 4H1VA 1W0JA 3WP1B 5AUPB 3RS0A 3TIFA 3VU9A 3AVQA 4O2RA 5HKKA 3SI7A 2I4IA 1CR0A 3U4QA 1R10A 2J59A 3AKYA 1XZQA 3B1VA 4LYJA 1E9DA 1MO6A 4DB2A 4WA7A 1T5LA 2G1JA 1AKEA 1YRBA 2RGGA 1XMVA 2R6DA 5BN3A 1SVWA 1NN3A 2IS4A 1X1RA 2PJRA 2QMUA 4RFSB 2OLKA 3VNVA 3GJ3A 4TQAA 4FCWA 4NTZA 1YZTA 1ZRHA 3SJAA 2CLSA 1ANKA 4KSCA 2CNWA 4HAYA 4TL8A 1RPZA 4EKDA 4RZ2A 2ZSEA 3C41J 1EFRA 1N2CE 1YU9A 5FPHA 4KU4A 1IXRC 2FG5A 4QGHA 4IDNA 5EP4A 2Q3MA 2GXSA 5EXXA 2HCBA 4A15A 4PC6A 3EPHA 4Z8XA 2ANBA 2OESA 3NEJA 1UF9A 3E1SA 4II7A 3WYGA 3AUXA 1JQJC 1L4UA 4RKFA 1Q20A 3HP1A 2PL3A 1I2DA 1G6HA 1KK3A 4ZDIA 5J4KA 1HE8B 1IHUA 4Q9KA 4ZI3A 4LJYA 2ZUBA 4MDFA 1MABB 1JNYA 4IVRA 1Z2CA 1KSHA 3HWSA 4AG6A 3RS4A 2O8DA 1N5LA 4LHYA 4MKIA 2H92A 2VEDA 5J5CA 4DCUA 4P32A 2B6HA 4ZIRA 3LY5A 5JRZA 4Q7MB 1AS3A 4KFTA 1P72A 1KDTA 2XJ9A 1KDOA 1GKIA 4G3XA 5DGXA 4QM6A 4OJQA 2IC5A 4F7WA 1IN7A 2R44A 3NC1C 2Z83A 2R6GA 5CITA 2EU8A 4B3DA 4DLRA 1I2MA 4LJ7A 4AI6A 4ARZB 1AZTA 2N1BA 5BYKA 1RC8A 3KKNA 1IY2A 2XEXA 3K0CC 3MWJA 2IWHA 2BMFA 4QFMA 5EZ5A 1GWNA 1RRFA 4ZI2A 4FWTA 3FMFA 4AD8A 5KDOA 1EX7A 4EAQA 3OHMA 1KI4A 2GEVA 4IOJA 1US8B 2HF8A 2BMJA 2GAOA 4DC9A 1TNDA 4MRPA 2C9OA 4ACBA 1SKYE 2WOOA 3I72A 2F6RA 3EZFA 4WW0A 3IPXA 4BASA 3KXLA 1OXSC 1PLLA 1KOFA 3LRPA 3QENA 5B2ZA 3Q9LA 3U7GA 4LRWA 4B6EA 3LD9A 3SBEA 1D8TA 4LCBA 2QMOA 2QY9A 2WJIA 4DEYA 5KTYA 1R6BX 2DFKB 2XNSA 4B44A 4XVQA 3EC1A 1DG3A 2ZRGA 3EIHA 3FKQA 4NH0A 4IOMA 2BM0A 4D0GA 3PIRA 2PCLA 3QIAA 1E4VA 1OXVA 1T4GA 4URYR 1QG4A 4Q18A 2GETA 1XEWY 4TLEA 1EFTA 3QXJA 3A1UA 3SDZA 2QE7D 3BFVA 2ZRKA 1JB1A 4RJLA 4PZZA 3GP8A 5AJVB 5CJPA 2PMKA 3GLFE 1NVVQ 2QGNA 4I99A 2QNRA 3NHAA 3PEYA 2O8CA 4D81A 2XOKD 4RD6A 1TU3A 5CYOA 4G1UC 1UKVY 5B30A 4FWIB 3RRMA 3PUVA 4MKFA 221PA 3BJIC 4C0QC 3X2SA 1M34E 1E2EA 2W2VA 2WJHA 1E2FA 3W8RA 3LLUA 3N2IA 4FCTA 1CR4A 4BFZA 2IEYA 3MAAC 3OEEA 4FW9A 3O8CA 3VTKA 3IGFA 1XTQA 2GA8A 2J87A 4OK3A 2VP2A 4LZZA 4GMDA 1Z0JA 1CJKC 5BW8A 4ABYA 2ZI7A 1D2EA 4ESVA 3OESA 4CZ2A 2XXAA 2A5YB 3NDPA 2A5GA 1X8KA 3AEZA 5E4FA 4YXWD 2OFOA 1KO1A 1E9CA 3B8HA 5EP2A 1JECA 3VKWA 5TARA 1MOZA 1ZMXA 1NSTA 2IUUA 3SYLA 4BQSA 3CRQA 1ZBDA 1VCMA 2O5VA 2WOJA 1KMQA 3BD9A 2WWXA 1CU1A 2GCPA 4M9QA 2FE4A 1BMFA 4TMWA 1YZLA 4XSGA 4JS0A 2JLXA 1E9EA 1G7TA 2VO1A 2EWVA 3CF0A 2GESA 2C99A 4IW3B 1G9XA 1LY1A 3MRSA 4EPXA 5LDDC 1K5DA 4Q9JA 2XTMA 2BM1A 1GSIA 1QBKC 4PC3A 5KSOA 5LD2B 3Q85A 4DLWA 2WZQA 4TLAA 3NKVA 3QF4A 1NN0A 1VKJA 5IF9A 5TY0A 3BH0A 3MWKA 5AJXA 1TF2A 4JZKA 5FUWA 4HLUC 5CDFA 1MT0A 2RH5A 1SKYB 1Z0KA 2WAYA 3ZD7A 3U6BA 2EYQA 4D25A 1YZNA 3K9NA 2QRZA 1OXXK 1XMJA 2RGXA 3OIUA 4B73A 4ZV4A 5F3WB 3LLMA 3NXSA 4DDVA 1T3SA 4HLDA 4DSUA 1OYWA 2ZE7A 4A6XA 3BH6A 3K9GA 3VHXA 4TMXA 2FV8A 1PUJA 3DMDA 3ETLA 1XEXA 3CX7A 4Q4HB 3AKDA 2JLYA 2AHOA 5KNCA 3BH7A 3LW7A 1WA5A 5CLLA 5CB8A 4PAMA 1OKKA 3FVQA 3W34A 1KI6B 3FE2A 3K0CA 1Y63A 4UXHA 1N6IA 2HXSA 3UWKA 4KLNA 2P67A 4DUGD 3FHOA 5BN4A 1W36B 2BV3A 2R9VA 4RVCA 3VR5A 1HV8A 3GLFB 1Z6TA 4GBMA 4BFSA 5K8UA 3MUFA 4HLQB 3FFAA 2ZRNA 3B78A 5H70A 3RNLA 2PEYA 3PVSA 5ELXA 4M22A 5TVKA 3VR2A 3U3KA 2P5TB 3LX5A 1G3IA 1RJ9B 4KCGA 2HJGA 1DTSA 1U9IC 5AJZA 3KB2A 1O87A 3IIMA 3QVUA 1Z5ZA 3L0OA 3X1DA 4C0AC 4JMPA 4I1SA 2H1LA 2A3RA 2Q9AA 3QEOA 3C5HA 4E07A 2YHSA 2J0SA 5G3YA 4TL6A 3O8BA 3DKPA 1F48A 3CLVA 3PUZA 4WIAA 5AJWA 2ZROA 3A4MA 3VR6A 4PC2A 2GJSA 2J5XA 3IUYA 2CHQA 2PBRA 2BJVA 3IDQA 3KL4A 4TYWA 2YWGA 1ZUNB 5BYJA 2B7CA 5KYKA 1YR7A 2HUPA 1E96A 3L2OB 4LI0A 4TLDA 4Q19A 4EFLA 3AVOA 3TLXA 4E5UA 1YZQA 4NU0A 2QN6A 2BEJA 4ZO4A 3WYFA 2AXPA 1W4CA 1N0VC 4V02A 2ZRMA 3FTQA 1JR3D 1YR9A 1W0JD 4DZZA 4BZPA 4A0RA 3TSWA 1DEKA 2EQBA 4JYBA 1F2TB 4B3GA 1NY6A 1BOFA 1OXUA 1G19A 4RD4A 4TYYA 3SN6A 1P2UA 2C04A 4D6PA 1NRJB 1NG1A 3K0FA 3MFYA 1JJVA 1DAEA 3MD0A 2A30A 1ZC4A 4TMTA 2GCOB 4PQRA 2VA8A 3G5UA 1KKMA 1R0ZA 4P4SB 2F1HA 421PA 5JFGA 2RCNA 2CNWD 1Q3HA 5DYIA 2NG1A 5AWFC 4JL5A 4LHWA 1Z07A 2ODEA 1EFRD 2OT3B 1E32A 4EQ6B 1OIVA 2FH5B 3A4LA 5J4LA 2VP5A 2HEIA 2LWIA 3EWAA 4JLKA 3GLIB 3J81k 1JJ7A 5CJ2A 2W2XA 4LPKA 2HDNB 1AQUA 3E70C 1DAIA 5FOTA 5H68A 4LOAA 4C3ZA 3KQUA 2C03A 2ZU0C 1LF5A 2VIIA 3K70D 1SXJB 3I8SA 3K53A 3AH8A 1DELA 2G0NA 4JVSB 4QBFA 1OJLA 2IUSA 2F1IA 5KO2A 3GLGA 2CJWA 1DO2A 4HUQA 4Q48A 2WVJA 2GF9A 3TUIC 2CLCX 4GI7A 1E2IA 1Q1EA 1S9DA 2RHMA 4B3CA 1EFHA 1W0KA 2C9YA 1G17A 3H4MA 1NF3A 1X86B 3MWLA 1N6OA 1FP6A 3TVDA 5FPTA 4HLUA 4OBEA 1VYTA 2EFDB 3OEHD 1W4RA 2XJ4A 1G7RA 2ERYA 3I1FA 3W3AA 2WICA 5FR1A 2BC9A 4M1OA 5FBVB 3OIYA 3EW9A 5EUQB 5JBQA 2O8BB 2ANCA 1R8QA 4YMVA 5JJIA 3CRW1 1YZUA 4HI0E 1OB2A 3THXB 4XTRA 1F3OA 2IF2A 2ZJOA 3I4LA 1NJFA 3K9HA 4RFVA 5LB2A 4UNNA 4OQMA 2GF0A 1KO7A 3WY9A 3ASYA 2AWNA 1KGDA 3CM0A 3QKRA 3W6NA 1P7CA 1VG0B 3A1TA 3QG5A 3SYKA 4JJZA 1AIPA 1AM4D 2XZPA 1XBTA 3GJ8A 2IS6A 2QTHA 3TR0A 3X1XA 3ND9A 4PC1A 2KWIA 3EWSA 5JSZA 1CEEA 1TU4A 3R9IA 4LYFA 4MGZR 4R9UC 2C77A 2VP0A 5K8IA 1HE1C 3A58B 3DEFA 3F8TA 3W8NA 2P6RA 2ZS8A 3THYB 3U44A 2BBOA 3L8YA 3GFTA 2REBA 4LUCA 2Z43A 2XITA 4NP6A 3EZ7A 4RZUA 1U9IA 3SU8A 4XWAA 3I73A 1GILA 2IYXA 3AP3A 5C4GB 4DCSA 4P3YA 3L8ZA 3SS8A 1WP9A 3I3SR 4KITB 3PUWA 1XPRA 1FOEB 1KSGA 1QZXA 5J4VA 2QPTA 4RSGA 3W6OA 3KJGA 2ZR0A 1SHZA 3SQWA 1A1VA 1Q3TA 2WJYA 4KSBA 4HDQB 1DAKA 4QL3A 3CO5A 4PTLA 4XSHA 4HAUA 2OZEA 3GD7A 1WB9A 2O0HA 3DKVA 3ZS9A 1IBRA 1M7HA 4B47A 1XRJA 4ZCIA 1LTQA 4OHVA 4CYMA 5JLJA 1SZPA 2B21A 2WPDA 1VG8A 2FSGA 1G8HA 1VPLA 5JHHB 4IRUB 2KI5A 4PQYA 1VG9B 3N70A 3QXCA 4DEXA 1G3MA 1KSJA 3U2QA 3OEED 1X6VA 4UXIA 3W5JA 3A6PC 1GTVA 3DO6A 3EA5A 1QHIA 2GILA 5G53C 1S1MA 2FJUA 5FBLB 1UBCA 1O3YA 3HU2A 1G8PA 3GQBA 4XWOA 2J0UA 3LAWA 1N0WA 3Q5EA 4V0KA 1CULC 3FWYA 4QRHA 3ZZUA 4C0SA 1UDXA 4PSVA 4A2PA 2F9LA 3EXAA 3PR1A 1R5BA 3AKEA 1KI8A 3DM5A 2HF9A 2DCUA 2LKDA 4M1WA 2IK8A 2Z5FA 3K1JA 3AVVA 3VX3A 2AXNA 4I81A 4GZLA 2I1QA 3QE0A 4DRZA 4BEJA 5BXQC 2CCGA 2FPLA 4TYQA 1OFHA 1BMFD 3ZH9B 3SQXA 1XFAA 2GJ8A 1E9RA 4MRNA 1WBBA 2Z6VA 5DIFA 2NPIA 5GADl 3UMSA 4HDOB 3SJZA 4LSGA 3S1AA 4BEBA 1JAIA 4RD0A 1S96A 3ADCA 4TZ0A 5FI1B 1KY3A 3PCRB 2ZE5A 3CW2A 1ZCAA 5FOSA 1ZM4A 1NMXA 1E2NA 2ZITA 1NKTA 3LA6A 1XTRA 2F3RA 2VHJA 2AL7A 5H8WA 2OILA 3B6EA 3V00A 2YVUA 3PJRA 1DAHA 2Q3FA 4PSKA 3B1WA 3BE4A 3F3YA 4MKHA 4Q4AA 4QBGB 5DI9A 1W4AA 2CXXA 1T0JB 4K46A 3TNFA 1C4OA 1KY2A 3NEYA 4DLXA 4JIMA 3SHWA 2AK2A 1DBSA 2IBMA 1EXMA 1TF5A 2YC4C 4Q01A 2QA5A 4Q1BA 2C9CA 1XD8A 2B8WA 3ECCA 3OIWA 5HR5A 1KO5A 1YHNA 2W83A 1TQ6A 4TTRA 4HAVA 4PHGA 4RD1A 1II8B 3AVXA 2WKQA 4UNSA 1P2VA 4KJZA 4M53A 3RAPR 3T61A 1J99A 4NONA 4FMDF 1SVMA 2CLDX 5GJVC 2WSSA 4A8JB 1OKKD 3DHWC 2KSQA 3ZIAD 3AVUA 2H5EA 3U4QB 4JL6A 3CKLA 2ECKA 1DADA 2KE5A 4JBYA 4C4PA 5AR1A 621PA 2BEKA 1TEXA 3R7WB 1DS6A 3UMRA 2G1KA 1SVSA 2DR3A 4C7OB 4GP7A 4UJ3A 1QF9A 4TL9A 3TR5A 4UKDA 3DZDA 2O8EA 2DPXA 5KDLA 4C0JA 4FN5A 3WHKA 1FMLA 4OI1A 5D3MB 5KNDA 1KMHA 3KKOA 4YDHB 3CR7A 5A5GA 3ONWA 2OBLA 4MYCA 1R0WA 1W5SA 4W5HA 4WZAE 1Z83A 3AGQA 1TAGA 2Z4RA 2VSFA 4QGAA 2GVDC 3IKJA 2WWGA 3RWOA 4DT1B 1P60A 2DHRA 2X2EA 3FMPB 3IQXA 3LQQA 5FUYA 2R8RA 4CF7A 3QOFA 2GJ9A 4IOLA 1CBUA 3ZLJA 5HCIA 1KK0A 2ZSFA 1PZNA 1TMKA 3QPWA 4W5WA 2ZANA 3QKSA 2IYTA 3ZJYA 4HZIA 1KJYA 2CVHA 1ODFA 5DYGA 3TK1A 4E03A 1G64A 1U2RA 1D5CA 3P20A 1NIPA 1XCMA 5KSPA 1Z29A 1T8TA 4J0QA 2VBCA 4LC0A 2V9PA 4TYNA 1XD2A 2NTYC 1OIWA 2FN4A 2G83A 3IQWA 3QJYA 5FR2A 5JI3E 1FTSA 4W9MC 4XTCS 3VKGA 2F55A 1VMAA 2DWQA 4URZR 1G8YA 1J90A 2OXRA 4B2PA 4K81B 4TWZA 3VNUA 1AJEA 3OE7A 1E4YA 1JBKA 4A4DA 1KAGA 3A1SA 4FIDA 2PX0A 2ZI5A 1HEIA 2BIFA 1L7VC 2QAGA 2IS1A 2ERXA 3GLHA 2H18A 4HAWA 2QM7A 3FOZA 3X1WA 4CEHA 1ZNYA 3U7EB 4BLQA 1R5OA 3OAAA 4DIEA 4EPYA 1NLFA 1SVIA 2RGAA 1GDDA 5L3QA 4LPSA 4M1SA 2IX3A 3ND8A 4AC9A 3HYTA 4AKGA 3NWJA 4F93B 2OSBA 4HZUA 4RD3A 4U5XA 4WBSA 5SZIA 4Q1DA 1CRQA 1WCV1 2MSDB 3ADKA 3ZQ6A 1QHNA 5FFMA 2CHVA 1XJQA 2SHKA 3DOEA 3EARA 1L8QA 4QG7A 3BRWD 5EE3A 1EFUA 1WRBA 4QNMA 2QBYB 2PLRA 1W2HA 4JBWA 2YWHA 1P75A 2V7QA 2GZHA 1E3MA 3KJIA 1NN1A 5CDFE 2HXYA 2CCKA 1MKYA 1XCPA 4HAZA 5EZ6B 3IEUA 5AUQA 4DSNA 1YZKA 2P2LA 1VIAA 3KQNA 2Z0MA 3SFZA 3T5DA 2RGEA 3EZ2A 5FOWA 4CT4B 2QPAA 1D9ZA 4UNPA 2VQSA 4EPRA 3P4YA 2JLZA 4B32A 4L9SA 5FBWB 4DCVA 1SVOA 4S35A 4QXAA 5DN6A 2QRNA 2GK6A 3KTAB 3QSYA 4JLBA 1JR6A 4ZKEA 4PHHA 2D62A 4DBLC 5EXPA 3OEHA 4IDPA 3ZDQA 2ZJ2A 1NMZA 1C1YA 1W0KD 4LYAA 4NDZA 1W7AA 1IJFA 4LJ6A 1E9SA 1M7GA 1E99A 1M7BA 4KXFB 2IYLD 3N5CA 2ZR7A 4BZQA 2CBZA 2LKCA 1Q21A 1ETUA 3B85A 1NLYA 4LY6A 4PAOA 3A37A 1Q44A 3RWMB 2ZRHA 5HPYB 3Q7PA 1T6NA 5CM9C 4PXAA 3KDSE 3BFKA 4BUJA 2REOA 3T1QA 1XDBA 2NQ2C 5C2JB 2X1VA 4Q1EA 2PT5A 1YR8A 4I1OA 5JEDA 4WOPA 2ONJA 3RSOA 2QPOA 1TUEA 2Q0HA 1NSFA 2ZRAA 4B48A 4F38A 4B2IA 3G0HA 4URWR 3W9YA 4LBZA 1CIPA 4RFSA 3CZQA 5FTNA 2WMOB 3EZ6A 3R9XA 1HA3A 1NBME 5M04A 1N6KA 2P3SA 3AVPA 1CXZA 4XD7A 1KSFX 2JLQA 3RS5A 1E2MA 4FMDB 5JI2E 1BO6A 3I62A 1QHHB 3MG9A 3RRNA 1YZGA 2CMKA 3U6KA 2YJTD 3R8FA 2G9NA 3ZQJA 1VYUA 4RD2A 2C95A 2BKEA 1OSNA 1SGWA 3B1XA 1JI0A 1COWA 5LD2C 4ITRC 2F3TA 4LK2A 4U00A 3AVYA 2ZRBA 5JS7A 2J41A 2YKGA 4US1R 1K6MA 3FB4A 1MV5A 4R98A 2YV5A 3FHTA 4BFTA 2FOLA 2FX3A 2W58A 1CJMA 1XD9A 1II9A 1AGPA 2GBLC 3T06B 5KUTA 3EPLA 3EASA 1MABA 2JIZA 4EPWA 3ICQB 3BC1A 4IVQA 1AZSC 1H8HD 2ONKA 2OAQ1 2AD5A 1AK2A 1ZVQA 2CL7X 4B71A 4JVLA 4C9BA 2RGBA 1XPOA 5E95A 4IJMA 2ZRCA 2V1UA 3AF4A 1NVXQ 1VG1A 3UK6A 4TSFA 3F0TA 3QF4B 3QQ5A 1P9WA 2GXAA 3TKLA 1XPUA 4LWZA 4P0TA 4UJ5A 1Z8FA 4BFUA 4NCNA 1UKYA 1S4QA 3IPYA 3K09C 3M4YA 2RGCA 2NGRA 2VTKA 2WPDD 2YZ2A 4Z54A 4ARZA 2ZRJA 3L0IB 1XF9A 1TEVA 3PITA 4CEJB 2C98A 4M1TA 4KV9A 5EE1A 3TGPA 4IDHA 5LB4A 1W36C 1TX4B 1R0XA 1DAFA 2J46A 3TAHA 5EE0A 5HE8A 5L3SB 3AQ4A 3H86A 3BORA 4GZMA 4EPTA 1KI3A 4CW7A 1E0KA 3PG5A 1Z0IA 4C2UA 1SVLA 3BS4A 2G0TA 4AKIA 1E0SA 4EFNA 5FTJA 5J4YA 2OBMA 3LDAA 5DI3B 2K5UA 3WNBA 4XIGS 5J4HA 3SYNA 5JS8A 4DLTA 3F5FA 1S3SA 5AK0A 4B35A 1VCNA 4CT5A 2Q21A 2V4ZA 3GJ0A 2NZJA 5EQTA 1EG7A 2R62A 1SULA 2D2EA 1FP7A 3GCGA 1JQLB 2GJKA 1OW3B 4DLZA 1ESMA 2ZRLA 4QGGA 1G41A 2GWHA 2BOVA 1GRQA 3K0AB 3AM1A 3LBIA 3U60B 1NVUQ 4MRSA 4AKHA 4B6FA 1GFIA 4URXR 3OFNA 3BK7A 4AWXA 4U02A 2P5SA 1AS2A 3QPUA 1DOAA 2G6BA 4Q1AA 4M2LA 2CE7A 4Q1FA 1E2QA 2X8AA 3CH5A 1UEIA 1P3JA 4UNQA 1RRPA 2QAJA 3M1IA 4N1AA 2LCFA 3CIOA 4JL8A 2O52A 3B7GA 3W6PA 1ZNZA 4C0KA 3UATA 3BXZA 3Q7QA 1W46A 1P9RA 1UKZA 5JJLA 1W49A 3A1WA 1OIXA 4M1KA 1UJ2A 3W90A 1SHKA 1WE2A 4MUAA 2XX3A 4OHXA 1OB5A 1FW6A 3H84A 3ZIAA 1HURA 2FPKA 4D0NA 3KFVA 1CS4C 5L3RA 2J7KA 1Z6YA 1G3UA 2J45A 4NCIA 3RC3A 1P6XA 1IAQA 4V03A 4D4JA 5KNBA 1U81A 4EUNA 2XZLA 2JJ1A 3REGA 2WSSD 1KZGB 4M0LA 1AGRA 1F60A 4PHTA 4DDWA 4QHTA 4OI0A 2ZS9A 1JXOA 2FZLA 3TSOA 3AP2A 1YE8A 4TQUS 4US0R 1N6LA 2FFAA 4WXPA 2XNDA 1ZUHA 3OF5A 4KBFA 4POAA 3B1YA 3GEIA 2NO1A 1G4UR 1EK0A 4LBVA 4A0GA 5IK2D 1SXJC 1Z6XA 3R20A 5FH9A 1RFLA 4OK6A 1XTJA 4O2LA 4JVMA 1F6BA 4BECA 2VH5R 4O25A 3A1VA 3PUYA 1N5JA 4PX9A 4GOJA 2MSCB 2W6JA 4Q5IA 4BLTA 2Q9CA 1CR2A 2CVFA 2ZJBA 4M4SA 5FUXA 2W6IA 4N0DA 4NYJR 5AUOB 4B34A 2GBLA 1LV7A 1VCIA 3KKMA 1FUUA 1KAOA 1G7CA 1Z3IX 4LBWA 2XSZD 1BYIA 4A6PA 3JVVA 1V5WA 2QROA 1A7JA 2WJVA 5H1YA 4W5JA 4M9ZA 4X8MA 2IA5A 2V6JA 1KI1A 4ZDJA 4KFUA 4D4MA 5TV2A 4M21A 1TQ4A 1Z22A 3UKDA 1KI2A 4NYIR 5GVSA 2PX3A 3OE7D 1FPMA 1E9FA 3QXHA 2VLIA 4JLPA 3W3ZB 4B75A 4ESHA 3AUYA 4OQFA 2EFEB 5LPNA 4AIIA 3DDCA 4XJXA 4Q47A 1XXHE 3K09A 2ZREA 1HT1E 4Q4LA 4GOXA 4P4TA 2H17A 4JT2A 4Q9IA 2ZI3A 4AYWA 2J0QA 4LGMA 4Z1MA 3IHLA 2NOAA 1FUKA 3OAAD 1NY5A 3U5ZB 4UXJA 4TMKA 3M6AA 2WTUA 4M1YA 1WBDA 3IILA 2IL1A 1U98A 2V54A 3GLFA 3C14C 1XMSA 3D6TB 1XP8A 4GL2A 2ORIA 3Q72A 4DLSA 4W7SA 2VSOA 4PO8A 3LX8A 3RRYA 3DPUA 3QXSA 2G88A 5CK5A 2GEDA 2OG2A 2QT0A 2OM2A 1NI3A 4V0ME 2ODNA 2VL7A 3QKRB 1RJ9A 2W0SA 3GJ6A 4X8LA 1UAAA 5DSZA 2ZU6A 4EIWA 2V7QD 2WKRA 4A0HA 4NYMR 2WIAA 2C8VA 3VKHA 1YQTA 3O8RA 2BWJA 5JMTA 3JZAA 4KAXA 4Z8YA 3T1VA 5JEEA 1UKEA 3PXGA 4A1FA 5JCPA 4P33A 2IYZA 5CK4A 1SVKA 2A5JA 2P6NA 5FOUA 4L5BA 4Q7JB 3SNHA 3CZPA 5E7JA 4GMXA 1CP2A 1QRAA 1NIJA 3RYTC 5DN6D 1Y3AA 4MKGA 1GL6A 4JJKA 2PCJA 3LH5A 3VR1A 1G6OA 1W48A 4Q7LA
chains in the Genus database with same CATH superfamily
4RYLA 3ANXA 1N6NA 1PR9A 1SBCA 4OHYA 3CVOA 3ZHXA 4IXMA 2E55A 2HFKA 2XWQA 1ADBA 3GDGA 5EINA 3O9MA 4L57A 2FWMX 2E4ZA 5F4BA 5B7PA 4MWEA 3W1WA 2HWUA 2B6NA 1P45A 2CL0X 1L9KA 1HLGA 3IAXA 5J63A 4AF7A 1VI5A 3EGXB 3B6IA 5CDSA 4E09A 1ODKA 3M3DA 1FX0B 3TSAA 1GTMA 3ZHTA 1S01A 1WG8A 2Q50A 2Z57A 5KSZA 1Q0RA 1Z0FA 2VT7A 1V5IA 2X42A 3GUUA 1YR1A 1ISMA 3LPDA 5DM1A 3W7BA 4M1MA 3DE3X 1S02A 3HLTA 5H59A 1Y9EA 3IB3A 2AR7A 2P30A 3OZFA 1LI4A 1Z6ZA 1Z12A 4ILEA 4XYGA 1KQFA 1XLWA 2FMXA 3EW7A 1KVTA 4QQNA 3RJ5A 1IZYA 2FUG1 3P9ZA 5IARA 1IWOA 1PIWA 2HBRA 3DE2X 3T38A 3GPCA 3STYA 1QFXA 2ISCA 1H4QA 2I76A 1KNXA 2A84A 1SUFA 3A7DA 3B38A 3FRHA 4LBYA 4M98A 1S4MA 2PZMA 2EL9A 1YBMA 2O20A 1RDFA 2R1VB 1NVTA 3D3WA 3CONA 4WVFA 4PTYA 4QPJC 1FYEA 1SD5A 2CMGA 2G0AA 2G28A 2P6UA 3A3NA 1G2PA 3ESQA 1XQ6A 4JLUA 3W2IA 3GLIA 4UEOA 5DTRA 2GVNA 5DGHA 1N9GA 1M2OB 2V98A 4OU4A 3ROMA 1E2LA 1K06A 1M2FA 4NZYA 1CY6A 1QO0D 2AD1A 4ER5A 3IIJA 4PZPA 4DM7A 1Y1PA 1L7NA 3CXRA 3M9XA 3PGKA 5AJYA 3N0TA 5DT2A 1YCFA 1CZHA 1HFKA 3SBXA 1P62B 4D45A 2YWBA 5HBGA 1B7GO 2AN5A 2WK1A 5EIFA 3OPQA 5C1IA 2IXEA 4OMUA 1TIKA 2JGKA 1AQ6A 1UOPA 2W2LA 4MO2A 5LFAA 2F90A 4Q3CA 4DZTA 4Q00A 4TX1A 1FIUA 2G77B 3KJNA 1S8OA 1Q0UA 3KVRA 4FU0A 2C0CA 4YRQA 1E2BA 3DAPA 5JAOA 2R0QC 2JI7A 3KAJA 3UXMA 1C41A 1D5WA 1L7DA 3PE3A 5CA1B 2PZGA 4ZCMA 5I7OA 4PRKA 4UD2A 1XRLA 2YRWA 3NJRA 1GNPA 1GLVA 4KXLA 1U2ZA 1G20A 3VDRA 1ZW6A 2C9BA 3CEAA 3I5UA 4CQLA 5BMVA 4C7JA 3KEGA 2GKSA 3E2PA 2ZBPA 4Y8VA 5BVHA 4LDQA 5KOYA 4BXOA 2JD2A 4U2BA 4P86A 2YOGA 3AIIA 5CGQB 2ZJ1A 2D7CA 4G5SA 4JXKA 2FEMA 2OFPA 2ZYWX 1MJFA 1AKYA 5IMBA 5IWCA 1KRXA 2J9FA 1RAEA 2BDEA 2G06A 4WVLA 3TN7A 1YJ5A 4Q4AB 4CEIB 3P9QA 5JDCC 3BEOA 3NHKA 3TOCA 1YIOA 3NC0C 4YCSA 5JOQA 3LBFA 1H2ZA 1UBEA 3PPWA 1E6EA 2WD7B 2WI8A 1PS8A 3CUTA 1IN5A 1EWRA 1NN5A 1X0VA 3C7AA 4MR8B 4MWDA 1WM1A 1UKAA 2X9NA 3AUUA 4R2HA 4RXTA 4MWGA 5E4JA 5KQLA 4DNPA 1SBTA 3TFOA 1W96A 3NV7A 1DAGA 3DOUA 1K97A 3IERA 5CURA 2XHEA 1ZOSA 1XMIA 3R9WA 1D6JA 2HCJB 1PYDA 3TMAA 2QNBA 4XYEA 2QMHA 4UOZA 3IESA 4Q4JA 1Z4QA 1YL5A 1MRSA 3NTXA 3PC4A 1WWKA 1YC2A 2I2DA 4AY3A 5CIYA 2C5SA 1NNSA 3QWBA 1W44A 1SEVA 2CZQA 4N8SA 4BZWA 3LL7A 4MGIR 2PUGA 1NXXA 3OZUA 3L7KA 4DDHA 1W4LA 4AT1A 4LZNA 4KPYA 3V4SA 4FS8A 3TOXA 1V37A 2I2XB 1P2SA 1JLSA 3CX8A 2XYHA 2JDIA 5AIAA 1AN0A 2O8NA 3K5HA 3DF9A 3TQCA 4HGZA 4ENTA 4PLTA 4PZYA 4CR8A 2EL7A 3BWMA 1Y6ZA 5HUQA 4U7DA 4DQKA 3EPKA 4FC7A 4X61A 4ARBA 3PNYA 5LQAA 3EX7C 4HMQA 2VDNB 2YXDA 4FFPA 4DR4B 3NHSA 1C80A 1CF9A 2R7LA 4TKVA 1J8MF 1O95A 2CB0A 2VBFA 4LN1A 1N7HA 1KYYA 2I1VB 1ADCA 2JKZA 3P9PA 3SFTA 3V8PA 3WMWA 4B80A 5B5SA 2C2OA 4M9SA 4LQLA 4F84A 1W76A 3QFTA 2C57A 2WR8A 3ZK8A 5GZ3A 1UPTA 2XUGA 3DQQA 2OPHA 2WFLA 3KD3A 4FOSA 4IJ5A 1J00A 3RLFA 4QTUB 4LIPD 1E7YA 3SLKA 3VO9A 5AVQA 4LNUB 3RRZA 1R88A 3E82A 2N0SA 1S2MA 2O2XA 2QYSA 4OHCA 3O7WA 5K0FA 4DR5B 4YC7A 1A4UA 1AU9A 1GKUB 1K6XA 1XQYA 2IYPA 2NXWA 2Y27A 4TQ9A 3BMQA 4E2FA 5FTWA 3RKSA 4JEIA 1OYYA 4G0UA 3MWDA 1DRKA 2W42A 1RZRD 1MIOA 1JEQB 4BFWA 1RD4A 3PD0A 1PL6A 1RWKA 4HXGA 1M8FA 2WMYA 4XVRA 2A1TR 2ID9A 3TQOA 3EFEA 2BKAA 5IC4A 5E7MA 5FHQA 2FCAA 1JLRA 4GC9A 3TYXA 5C5EA 4PPFA 4RKWA 3NG1A 4I6EA 3JQCA 2JJ1D 3LUKA 3C6MA 1G8GA 3ONVA 5BN3B 3G1TA 3ED1A 1OPXA 3I6ZA 4N82A 3HXPA 1I14A 1KE2A 1G8MA 4O6VA 5M5BA 4ZOCA 1R7RA 1CDOA 1IHOA 4PSAA 3ZTTA 1HZZC 1J9ZA 3ZV3A 3C2QA 3F7NA 4Y2SA 3ZCXA 2XZOA 1TF7A 4COOA 4MINA 1HT0A 4LJ5A 2A9KA 3V7YA 3WSTA 1MOQA 1A7UA 1UXKA 4DNOA 2CV2A 2R5WA 4E46A 3B3QA 4D3SA 3LY9A 2NUPB 2WWHA 1QTQA 1T2EA 3TJZA 2WKPA 2I34A 2UYYA 5KMGB 3TLAA 3C4JA 1HL3A 4FR0A 2VP6A 4WADA 3HDTA 4W1QA 2P62A 2J32A 4ZO6A 4E1BA 4BB9A 3C7KA 4F1WA 4F6CA 4DB4A 2XRMA 2XB2A 3MS2A 2GK7A 1ZM9A 4IIGA 2UZ4A 1HOXA 1ZIPA 2JK0A 3E3LA 3IH5A 2N3ZA 3LWDA 4EY6A 4MQLA 4A36A 5B4UA 1EXNA 3ZJ5A 5JQGB 1LI7A 2QWXA 4KFRA 5KNCH 3I39X 3TTVA 1W1IA 4G5RA 5K0CA 4WAUA 2QSYA 2A2ZA 4HNSA 4DR2B 5BN5A 2VT6A 3I2FA 4KQ1A 3IE1A 1DARA 4QJ4A 3LQ4A 1U7TA 2GXUA 2KB0A 1LNZA 5TJ9A 3WRXA 2VF8A 3BOSA 4BNGA 5KU1A 1UT6A 2XIJA 2IH5A 1CB7A 4MVJD 4X7RA 4CDGA 2GPNA 4YT8A 5K01A 2JBHA 4NC9A 3TNJA 3FPCA 1KPGA 4WRRA 4PPNA 3EGWA 1CSEE 2BYTA 3GOQA 1WXDA 3VR5H 5DOZA 3JWIA 5LU9A 1ID8A 1TQ8A 1M74A 1KZ9A 3LQYA 2AFIE 2DGDA 3DG9A 3G7NA 2IEZA 3TLMA 3WHPA 2PZ8A 2Q45A 1K66A 1NLZA 2R2AA 3E8SA 5THQA 4B8ZA 4M46A 4BP9A 1Z0DA 2ZS7A 2F1RA 3ABOB 5EE9A 2A7QA 2F67A 2W6ZA 4ZOQI 4YRPA 2LP4Y 3O4VA 5J2TB 3O95A 2PZEA 3M9WA 5B58C 1W36D 4CLXA 3A36A 4LECA 2GEUA 4NMHA 3NNSA 4MVJP 4OYLA 2Q3LA 3F5QA 4IO1A 5REQA 4JQSA 2HPHA 2W2QA 5KDDA 3TZ6A 1QYXA 3CGWA 4OO3A 5D3MA 1TPZA 4FHZA 4MI9A 3GJ5A 1ISPA 3TLBA 4YR7A 4J0FA 3WQRA 1PEKE 2WG0A 5JXWA 2AFHB 3ZWBA 3R7SA 1HNZB 2JLRA 5P8WA 3KAKA 4Z4CA 2Q5JA 3PQDA 1RWPA 1WETA 2CFOA 2EWWA 2PH1A 4FZRA 3BF8A 1C7QA 1ETHA 5EUBA 5GONA 1Q0ZA 5IBPA 3SC2A 1SN7A 4FILA 3PV0A 3PLAE 2ZTSA 1JHMA 1ZINA 2ZYVX 2KM1A 4D0LB 4DBLE 5DLYA 4NDNE 4WQMA 2JCBA 3GDFA 1FXSA 3ZHZA 1VZ3A 1Z28A 2BBSA 1Q92A 3PU6A 1QDEA 2FPIA 4OGWA 1TYZA 4HNUA 1PD1A 2QZ4A 2H65A 2OV4A 3EPRA 4R2IA 2YWJA 2J08A 5HJ5A 2ET6A 3UMMA 3T9CA 2FR8A 5HUHA 3MT0A 2POCA 1UFRA 1S9HA 4WXEA 5EP1A 4UVEA 3MGCA 3VYRB 3HE3A 4DSAA 1E1QD 5FUMA 2I7CA 4MJXA 1XJ5A 1VMIA 3WGKA 2JATA 3EBLA 4C4ZA 2QUJA 2O8CB 3BGIA 4JHXA 4KQEA 5I9NA 2IHYA 3EG5A 2NP6A 4ALNA 3ZCQA 4F5WA 1SRRA 2D7DA 2GZ1A 1IHDA 4MDHA 1NX6A 1C4XA 2NVBA 2J9XB 1JG4A 1DMSA 5DFAA 3UMCA 5KC8A 5KOHA 3TH5A 5I9LA 3IP1A 1RIFA 4L50A 1AKMA 5DMHA 4D46A 2GGSA 2O57A 1J2JA 4LJ8A 5FL3A 2ZBDA 1ZD1A 2EBUA 4YRDA 16PKA 2NVUB 3IKVA 1PLJA 2X8LA 4JB2A 3CNLA 1NOJA 2D74A 5FOXA 1IQUA 1N9KA 2CFCA 2UZIR 2IPOA 1NUSA 1ZEJA 1D2RA 1TLFA 2QP3A 2XF8A 3IDFA 3NDJA 2ZYAA 3BE6A 3OA2A 3ZHCA 5IHPA 1DGQA 3ZY4A 1I01A 4GHWA 4IWXA 1Z6AA 2FNAA 1ZUIA 2BGMA 2NTEA 3O2JA 4R54A 2ZJ5A 3T6KA 4MR9A 1NFRA 1G8AA 2IDJA 3K5WA 3KR1A 2OFFA 3N2KB 3VC2A 2QBYA 1FJHA 2FGJA 3HB0A 3KD2A 2JLVA 5G2OA 3GN2A 6REQB 1YE3A 2YWDA 1HFJA 3K1AA 3BXGA 4I4LA 3UV6A 1SCUA 1KO4A 1V5EA 3ZLTA 4D80A 1TC1A 4C20A 2W6QA 3KKQA 4N5DA 5DZSA 4EGCB 3HYSA 5JDIA 5BVGA 3FYSA 4PXSA 1QIIA 3N2GA 3IP9A 3AZPA 4W63A 2XQJA 4WZBE 2PLAA 3OOHA 1NVFA 1VI6A 2FG6C 1HXHA 3GRPA 1SXJD 4GF5A 4EY4A 5H81A 4V0OA 2RH8A 3A2KA 4ZAFA 1IN6A 1P2BA 4DCNA 5IDWA 2BI4A 2FZ4A 3RFFA 3ZWCA 4HEA1 2RAPA 1E3EA 1L4MA 2X8JA 1BRMA 3V97A 3IQZA 4XIIA 4ZYZA 5LWQA 4UMDA 1OFUX 3DDZX 4MUBA 3ZWXA 5HZHA 3PKIA 5TEWA 3OF2A 4QDKA 1IG0A 3BILA 1K3FA 1ZSYA 5HF5A 2VDWA 3PTLA 1QIMA 4P1ZA 2GZSA 2H1OA 3ZDRA 1B2LA 3LXXA 3NWOA 2CNDA 3A11A 1LB1B 4G8CA 1Z33A 3G0DA 1Q17A 3VU3A 1T35A 4XUGB 2TECE 2YH2A 1GP2A 2IKSA 4EHDA 4MGEA 1H4SA 4DABA 4G89A 4EGSA 4EITA 2I3AA 3FGOA 2C7OA 1REQB 2CK3D 4NOMA 1U5AA 1XEXB 3WNCA 1US8A 5AOBA 2VYVA 1EFCA 4MB6A 1QHXA 4ESOA 4EYGA 2OCAA 3KXDA 3ADDA 3WO0A 3PQ7A 5LLSA 3P0HA 4DR1B 3V9PA 2WAAA 2B30A 1N4AA 3LT1A 5FL7D 3SMQA 3EIEA 1U8CB 4HVAA 5HKLA 3VR4D 3UOGA 1XKLA 2Q2NA 2IFTA 3AUTA 3H2GA 2ALJA 2WM9B 4H60A 1J2YA 4MHTA 2RHLA 3GLGE 3OSZA 2WIKA 5JT1A 5SYAA 2YWCA 3F7TA 3H19A 3BGDA 3UZUA 1YRWA 4IHKA 4YRCA 4EDHA 1XJWA 1XVTA 1ONOA 3ZK7A 2XNJA 4G1CA 3EZGA 2YFKA 3H16A 1V43A 4P4NA 4B0PA 5H0IA 1NBAA 1Y1RA 2P9JA 2NV6A 3PB3A 3RVBA 1AXGA 4ER0A 5A5VA 5HK8A 2OQIA 1PVDA 4W1SA 1Q2XA 3HCAA 1SKMA 2OCPA 5KYGA 4FMBB 1E7WA 2CJFA 1UINA 3HM2A 4R41A 5TE9A 1KYIA 1U8YA 3ZWQA 3V32A 4Y2QA 2P6MA 3A8TA 3ZWKA 5FBKA 4US2R 1ELOA 2Q4TA 4RAOA 4K9LA 5CM8B 1XZPA 2J0VA 1AZWA 5LVAA 1G59A 4L9WA 3WIEA 1E3IA 1YI8A 3HU1A 3JASB 4EG5A 5J1SB 1FRFS 1Z8HA 1QIJA 4R7TA 3TQFA 1ZKMA 4LSWA 3RU2A 1H8ED 1UZUA 2IXBA 5E1OA 2BSXA 1Q74A 1NJ2A 1G4HA 1SK8A 2WJ3A 1DX6A 3RUPA 1DKLA 2BGJA 2EKBA 1M6VB 4D9NA 1GR1A 2QZ9A 3NBAA 4E94A 1HF3A 2YINC 2MHCA 3MUOA 4UDYX 3NPAA 5AT1A 2HZ7A 1NM5C 4KVAA 4S24A 4PX2A 3MIIA 1M54A 1NNUA 3ISVA 2O05A 3FSGA 1JQDA 3C3MA 3HI6A 4Z3OA 3AUKA 4LY3A 2P27A 2ZR9A 3ZPXA 4F6LA 3RVLA 5AKYA 1VBKA 5HRUA 1KERA 2QQFA 3LPNA 1NAHA 2R68A 4F3CA 1JN0A 3BBPA 1BQ3A 4TTPA 3PUXA 1SRQA 4M7WA 1LLCA 1K8ZB 1PBNA 1PQWA 3VMMA 5B58T 3LO8A 1FJGB 3MTIA 4F97A 1EFVA 1P6UA 1QKIA 1YIDA 3W05A 3RUDA 4DEVA 3EEOA 5C31A 2Y68A 4Y9DA 3T5GA 3KQLA 1N3YA 4EPVA 3WBJA 3DDUA 2G7ZA 3PFCA 4Z51A 1GSHA 5MN6A 2R7AA 3CY6A 1Y37A 3PA6A 4TYMA 5L3SA 4LJRA 4S1TA 1D6NA 2J3DA 2FPPA 1O8BA 2QX8A 3ROTA 1DCMA 2V1XA 4GSYA 2P6PA 5DDIP 4DXAA 4YRIA 2PUEA 1XU4A 2J3QA 2YBDA 2OK7A 1E1RD 3HA5A 2HNBA 2XYQA 3I45A 3K4QA 1DEOA 3RANA 4K8OA 4UCFA 3VOTA 4UAUA 2IBTA 3O4FA 1GCGA 2V3VA 3F6RA 1QONA 2P9ZA 3FRIA 3HKDA 4LC1A 3N76A 1QFMA 2IT1A 2V55B 2WY2D 3VPFA 1SK9A 5K0SA 4PEVA 4IS2A 3VPHA 1ATZA 2NTNA 2ZQYA 3BD8A 4IIHA 4RULA 3KSAC 4GDFA 3KM0A 1LGYA 4LYDA 4BFCA 4UPEA 2E5FA 2C2WA 1N5KA 2NZUG 1K8YB 4N0EA 3P9KA 5D1HA 2B4YA 5FTMA 4G0NA 4Q7KA 4A7PA 3WOHA 4F06A 4QOJA 3IALA 4EJ2A 3QP9A 3L84A 2AG6A 2JEOA 2XOXA 4H18A 1ONPA 1FXWF 2GZMA 4NCJA 4B43A 2H8GA 4EKGA 2HTFA 2F9MA 2ZSJA 2CUKA 2OM6A 4OB8A 4EY3A 5KTOA 5H9VA 1N5OX 5CVVA 1VYHA 4YUVA 1SKBA 4FMCF 4HDSB 2W8BA 4IIXA 1FDTA 4W8GA 1BX0A 4W9NC 3NB0A 1VYVA 2W37A 1OR8A 4B3RB 1LWOA 2OV8A 1E1CB 1YCHA 4U2CA 1TTTA 2UZAA 2YWEA 3GJ4A 4OP3A 3CURA 3V8BA 1MW8X 4X94A 1ZM7A 3DKIA 2PYDA 4P92A 3Q87B 2OQVA 4XVHA 4XZ3A 1M9NA 3USZA 1Z5VA 3WNDA 5E0OA 4G0WA 2M6KA 2DBVO 2B3TA 3QI2A 4GIBA 2XNKA 5D01A 3UHAA 2F4NA 1G6KA 4CQMA 3EAFA 2X40A 3IDAA 3EZ9A 1V3VA 4JROA 3ST7A 2FVXA 5BWLA 8MHTA 1X7WA 1JSZA 2B7BA 2NQTA 1CUWA 2ZEJA 3JR7A 1QNFA 3QXXA 4WXYB 3HUUA 3NH6A 4J29A 4A8HA 2Z4SA 5IZ4A 4I6JA 1W94A 2DERA 5E6SB 3KWJA 3WLEA 4P98A 4EB6A 4QTYA 2QK4A 2TMKA 1YBVA 3UH0A 4NESA 2R66A 3E05A 3MMSA 1G1MA 1UQTA 5HCNA 3P2EA 3NBYC 1V71A 1A95A 2BI8A 2HA6A 5F1YA 5K9ZA 4KR2A 1AHHA 3BXPA 4V0LA 5A4JA 2YNMA 1U6IA 3H99A 1NL3A 4L8FA 4M60A 1QH1A 1W1WA 1ZJWA 5T6BA 1WJGA 4EVQA 4NBKA 3ICVA 3L8DA 3Q9UA 1UMCB 1VJCA 1JLHA 2GPSA 2ISQA 1NP3A 4ZVTA 3TKAA 4JT4A 1RQGA 2PH3A 4ZGBA 1GM5A 4IZOA 2D13A 3AF1A 4ZI7A 4BO0A 4IPTA 2PWAA 1AQNA 4MW7A 4MOWA 4N5HX 5G1NA 1XHFA 2HSEA 3MS7A 5I4CA 1UDCA 1HM5A 3KR0A 1QCZA 1FNNA 3ZWYA 1H2BA 3H13A 3CKKA 2VJLA 1JPNA 3FWNA 2YN4A 1ZL0A 1E98A 2H1IA 1AX9A 2WM3A 1G9TA 3QPCA 4HYYA 1YHZA 2YYYA 1KO8A 3KE9A 1RXSA 3NHJA 3EUFA 1P74A 4D0SA 4HB4A 1N9GB 1YNSA 2Q6TA 1ZRSA 1QQAA 1EBFA 1G291 3TZCA 2BUAA 1Z4PX 4Y2HA 4YP5A 3GHYA 2QMEA 3H2JA 5EOVA 4JB0A 4HB3A 4PYRA 1NW8A 4QKQA 2HO4A 1G18A 4OXXA 1Q7TA 4OP2A 4S1OA 3OZSA 4JC4A 3UJ6A 1AUOA 4BVFA 3CSSA 1EI9A 3KUCA 5A02A 3EYAA 5BT9A 4JP5A 4GBED 1M8GA 1Z38A 2JZNA 3ZE8A 3K6SA 3OQMA 4QTXA 4NCKA 1DFGA 5IG2A 3BKWA 4M8SA 1LVUA 5GM2A 2PAAA 2QTLA 3MCUA 2PXCA 4L27A 3BFPA 4XJVA 2C82A 4KAAA 1R4AA 3DFMA 1V11B 4A82A 4LHXA 4XIJA 3CBGA 1BD4A 5TQ0A 5AHXA 4LV6A 3RSQA 1ZITA 3WTBA 5I7FA 2LCIA 1C3OB 5JMOA 2D3TA 5BMVB 1GTZA 3JATB 3MCAA 5H3HA 3EIWA 5EHXA 4X8HA 3B20A 3ZHYA 1XF1A 4DW8A 4YCNA 3OD1A 4FKMA 4ZAYA 1P1IA 1XTSA 2W2KB 4KWEA 4WLNA 4BMXA 2VNIA 2PKWA 1IZ7A 5ER6A 2J9FB 2VF7A 3O8QA 4ENWA 1A9QA 2D5LA 1MHTA 2JGNA 1Y82A 1ML4A 2WBLC 3KUUA 4HWPA 1RBQA 4JUFA 3GPDG 4MJ3A 4DSOA 5C3MA 3V1MA 3TRKA 2VDPB 3TZHA 4WEOA 1OHHA 2FYTA 3CQ9A 1FPQA 1GAWA 3I92A 1G21E 3JQ6A 4QYMA 4E4YA 4H7PA 5G02A 5HS4A 4RV5A 2YHIB 4D9KA 3LXRA 1J8YF 4JCCA 4AZ3B 1ZRNA 4X1KB 4X7PA 1OQAA 1GQSA 1P5ZB 1Y4ZA 4H7KA 1L4LA 4HPWA 1G5TA 2LR0A 1BJTA 1FSZA 2DH5A 2I6TA 3PEWA 4BJ5A 2OKCA 3D8BA 4FB5A 4Q4JB 2D1QA 1PTJC 5BNTA 3W0LB 3AR4A 4NMMA 1EGVB 4WNYA 5IDVA 2DB3A 3F3MA 1P7PA 2DPLA 4BYGA 1E69A 3EK2A 3A14A 2SCUA 2JHFA 1CDZA 3MJHA 3VA7A 4F2GA 4IIVA 2NU7B 3Q3EA 4JLDA 4DVGA 2QE7A 1IIBA 1TECE 5GJWC 1CJVC 4LMBA 1M1YE 3LWZA 1E0JA 3SKXA 1NNEA 3ZZNA 2W00A 4FFRA 3HKEB 3OKFA 3HR7A 3ZXXA 2A35A 4EJMA 3NC4A 4CL3A 5JUWA 1QV9A 5DEOA 3NH9A 4BX0A 4LKOA 1ULSA 1MF7A 3U40A 1BS9A 4HX2A 3HVUA 4WN9A 4YJHB 4E6EA 4ZGWA 1TQ2A 2J3LA 5KTMA 1XA0A 1L3CA 2QTFA 3MYRA 4KMRA 3QBTA 1XNJA 5A7HA 3T1YB 4JX9A 2PQMA 4LXXA 2JEZA 1BWRA 2ZIAA 2XBMA 4UUNA 1A8PA 3RC2A 3A2MA 2IEAA 1UZAA 3NYIA 5AM2A 2ENWA 4MP3A 4CDRA 4W7IA 2QP4A 2X4DA 4O1MA 3FKSD 4YMUA 3JARA 1U5BA 1WO8A 4WHMA 4Y6RA 3DLHA 4MW6A 1X13A 4NI5A 1NZJA 4NZ9A 2YZGA 4F0JA 2XCUA 1F2UA 2AOTB 3HU3A 2A9FA 4PFKA 1BN6A 2GPBA 4C4AA 4O3MA 4BMYA 2QTBA 2QM8A 1HWYA 4DA8A 4XPIA 1H2EA 2YIVX 4ID3A 1TLTA 1NJGA 4MLDA 2J1LA 4MJLA 4P7FA 4YXWA 3WLIA 5BXYA 2QI9C 4OF4A 3UQYS 1KJIA 1TK9A 3HO1A 3F6BX 4LE1A 3MFQA 5DF1A 3TTUA 3PLRA 1OWMA 2HA5A 4RDHA 5L53A 5FO0A 4I8DA 1F0KA 1X1AA 2H2HA 2IUFA 1Y3DE 2ZJ8A 4IILA 4MWOA 4BX9A 3AJDA 4HDKB 5C1DA 1SURA 1F5SA 2DPYA 2C92A 5C46F 1RYFA 2JH9A 4J0GA 4F4JA 4JOQA 5IYZA 4ZT2A 1KMHB 3GJXC 1PO7A 4PFJA 4GAEA 4AUMA 4QM7A 1S8AA 4R0VA 3RB8A 3UG6A 4AYTA 1M0EA 1SUSA 4P22A 1XXHA 4XLLA 1EJ2A 4MQMA 2F7SA 3K71B 3ESBA 1TT7A 4MLCA 3PLNA 1GL9B 3N6XA 2QL7A 3OMWA 4TPKA 5B36A 4MXDA 2IW3A 2HRZA 3G0BA 3T54A 4GPTA 1GRRA 4DKJA 3N0VA 2EKPA 1QF7A 5BUCA 4JJ6A 4MW2A 2ZAMA 1OVGA 3REQA 1ZOPA 5H83A 1N1MA 4HZGA 4DNFA 1RLOA 2O3SA 1T8YA 2V7WA 1EIWA 1NV9A 2V6FA 4I1IA 3AOEC 4OKSA 1ZQ9A 1RRKA 4V0MA 1PL0A 3UJ3X 3V4RA 1DNPA 3MGBA 3SNKA 4F96A 1O9HA 4M0UA 3SM9A 4TV9A 2WKSA 4C4RA 5CXUA 1UBSB 2EX0A 3EA0A 5JSHA 1FQKA 1PW5A 3F90A 3IO5A 2P7HA 4HQLA 4B1FA 3WYAA 2OHFA 4ZANA 5ADVA 1KJ8A 2Q2WA 2RC5A 3RC9A 2YFYA 1WMSA 1K7EB 5ERXA 5T3UA 3HFGA 1BDBA 1H23A 1JYFA 4M8IA 3VR3A 4G5QA 5DM60 1I9CA 2LDBA 2VXBA 4LVUA 3HPRA 3UMVA 1IHXA 1NXSA 5KBYA 1U3VA 2QAGB 5HOQA 2JD1A 1SBIA 1W19A 1ESNA 3OICA 1C1DB 2BEWB 3LFTA 3P9RA 3CZAA 4H16A 2XGJA 1QYRA 3OIFA 4TUYA 1XK6A 1PL8A 1XWWA 3G8CA 4RPKA 3ZV5A 1QWOA 4LISA 1V6AA 4LTNA 5A9TA 1NUUA 1ZD8A 2X9QA 2YVAA 3DYBA 3BZWA 3OZXA 2VTDA 4IGAA 2CXSA 5KREA 1K8RA 4RTLA 1VHQA 3ICEA 1H2WA 1G3RA 2AFVA 5BOSA 3ZWDA 3MINB 2QR5A 2PDAA 3L0ZA 1HRKA 5ITZA 4JHLA 1TA0A 1M2JA 4FINA 4L8LA 3WZ2A 3ZCPA 4LMRA 4YREA 1ZN8A 4HYEA 4TLLB 5KNDH 3EXEA 4WCFC 3VM6A 1L5OA 3AO0B 1OBFO 3VR5D 4BJHB 1ECJA 3V2GA 4AULA 4EKYA 1UAGA 4M9RA 4Y18A 5REQB 4BX3A 4RTJA 3J7AC 2BJWA 2BY4A 2RHJA 4URUR 1OH7A 2QW0X 3IBCA 3P26A 3H7AA 4ND5A 3W06A 1BX3A 4Z7JA 5LQJA 3RS3A 3RRJA 1PWXA 4L6AA 3TLGA 1LDMA 3B82A 4KG7A 7YASA 2O59A 4TMZA 3WIDA 3PHIA 1Z47A 1NXVA 3TECE 2B94A 4IH9A 4C30A 1JMKC 3IUEA 1CRWG 2DH6A 1USUA 2NLOA 5IDYA 1N33B 3SC6A 1CCWA 2IEIA 1ADJA 3H1TA 1VHLA 4GE3A 4PIPA 4OQNA 5A0VA 2RB5A 5LBIA 3TW4A 2WDZA 3TSCA 2H5IA 5EHQA 1NQTA 1OC4A 1SC3A 2DLNA 3NDRA 4N49A 4F5ZA 4HAXA 5C18A 3TVYA 2PLFA 4UU8A 2BGLA 2I71A 4CKWB 5I5EA 3CNNA 4P36A 1O6FA 4JC5A 2VHCA 4Q1CA 4B6GA 4P0QB 2HNKA 1JJFA 3I01A 3AGPA 1N2SA 1SMKA 2PGJA 4OI2A 5FAXA 5FPPA 4UHEA 1N0UA 2B2XA 3FMOB 3RUCA 3VAZA 2PS3A 1MR3F 4KODA 4X90A 3I6QA 4RDIA 2J8ZA 2HX1A 2DULA 3AMVA 5FUVA 3CRVA 4D8WA 1BEZA 1QHYA 5DTJA 3MCWA 2PNJA 1JR4A 3SHFA 3TI7A 1W0JA 2OCDA 3WP1B 5AUPB 5K0ZA 3VU9A 1DX4A 4OUKX 1TAQA 4N3GA 5AM4A 2AS0A 5ICCA 4ZAVA 3ROXA 2P4HX 3I9KA 3PT9A 1CR0A 4GPEA 4TKUA 2ZZNA 1R10A 2J59A 1CLEA 1MFPA 2JKYA 3B1VA 3R6WA 3DBOB 4XFDA 1MIHA 2VXOA 4KK3A 1T5LA 2BGNA 2EW2A 3H6HA 2A9VA 3G2JA 3OFVA 3K8ZA 4G9BA 1YRBA 4MV3A 1O0CA 3PC8A 1BFKA 1Z5PA 2VXYA 3U7QA 5JR3A 3ELDA 2IS4A 3OJFA 1LPAB 5IDXA 2PJRA 2QMUA 4G56A 4F3YA 1T0UA 2OORC 2OLKA 4CCYB 4BQFA 3OZRA 4A16A 1ZRHA 2V0CA 3ABRB 2CLSA 1ANKA 3DKKA 2CNWA 2NN3C 2RG7A 4TL8A 3SZMA 2E2WA 4V3CA 3TRJA 1VB5A 5LQNA 5LYJF 4DR7B 2C07A 3RUIA 1EM8A 3VJLA 1TMYA 3CTPA 3H0EA 1N2CE 3HVKA 5FPHA 4AWBA 4CETA 5D7BA 5JY6A 1J1UA 2GR9A 1H1LB 2BGUA 1V8PA 1AV7A 3WRYA 4C7KA 2HCBA 5IFLA 3SF8A 1WHTB 3JYNA 3P9XA 2FCRA 3W4KA 1JPUA 2WJ4A 2I1WA 1UF9A 5B1HA 1ZJJA 5F7XA 1XTZA 5DXJA 4QPPA 4YT2A 1SO8A 4RKFA 1Q20A 1NJSA 2DPHA 4P08A 2PTGA 5J4KA 1GR0A 4ZI3A 4KTTE 2XQGA 3EOBI 4ZXFA 4G0ZA 1MABB 1RKUA 3C1OA 3N2GB 3PK0A 4DYVA 4DSZA 1WR8A 2HDWA 5MFZA 1ZIXA 3RS4A 1FDIA 4C89A 2BM9A 3GT0A 4LA4A 5CRIA 4JJGA 2GJ4A 3KPVA 1ZUWA 4P32A 2B6HA 2XQVA 1GPH1 4ZIRA 1MT3A 1KDYA 2IIBA 1XIVA 4Z99A 1Z0SA 1T2DA 3OZIA 2GZRA 4QM6A 3OCZA 3RD5A 4OBXA 1E1KA 4DIUA 4F7WA 4RBNA 3I53A 5DX0A 1LPSA 2AMJA 4WACA 4X3OA 5LZ8A 3WFJA 5HZGA 4ARIA 2VDWB 5CITA 4WBNB 3GUCA 4TV8F 4LJ7A 3EXHC 4MSUA 3DA8A 1NTOA 3UGKA 5AW0A 5H7XA 1T0PA 1U63A 5CDTA 2MINA 4BE7B 3B51X 4TVSA 4JOSA 3W9BA 4BTEA 5EZ5A 1BXGA 1GWNA 1EK5A 5DRTA 5EN4A 4YP9A 3KQPA 1A2QA 4IMIB 4I3FA 4HDNA 4LY9A 3O82A 3JWPA 3OHMA 3L6CA 3V34A 4EEZA 4IOJA 1US8B 4KMSA 2KMLA 1BA3A 2HF8A 5HX7A 2GAOA 1MD9A 3OIDA 4DIFA 4MRPA 4UMFA 1CS0B 2ZSHA 4RCVA 5IX8A 2H00A 1QPGA 5JZSA 1NMQA 4BASA 3FPJA 1J0XO 1XQVA 3M3PA 3SKVA 1D2CA 3N6VA 2OD9A 2OHHA 4HEQA 4LCBA 2QY9A 3FNRA 4DEYA 4ZFNA 2B8EA 1QFSA 5A1JA 5K5EA 3K5IA 2DC1A 2Q1XA 3MJSA 2DFKB 1NW6A 2IHJA 5H16A 3EC1A 4PNZA 4AUNA 5ITVA 3EIHA 3FKQA 4NH0A 5JC1A 1Z82A 5GMOA 3RLIA 1M6YA 3PYXA 4X93A 3WE7A 3OOYA 3W5AA 4NNOA 2D54A 2NSHA 2PU5A 4IJKA 2PRZA 4YUWA 3URKA 1OXVA 3UJBA 3GGPA 4A0SA 5EJ6A 3L6UA 4Z5XA 4Q18A 2GETA 3HNOA 4NBWA 4TLEA 1FFWA 5JATA 1JB1A 2V7VA 4NCXA 1W2WB 5EZYB 1MJGM 4CM6A 2W43A 3OCVA 5CJPA 4KPUB 3AERA 4LRQA 2P3OA 3PL5A 3Q7TA 4OXIA 3GLFE 4C2AA 2JS7A 1O9GA 3V5NA 2QGNA 4I99A 1AUXA 1YKFA 3LC2O 4KIGA 4RD6A 5AKHA 3BG5A 3K31A 3O6VA 5B30A 3REOA 3VBEA 4FWIB 3PUVA 3QWIA 4EVRA 4MCHA 3BJIC 4C0QC 4UTXA 3OJ0A 4WERA 5CHEA 3O3MB 2WJHA 1E2FA 2B4TO 3QELB 1XZLA 3LLUA 3N2IA 4FCTA 3FR8A 1RS0A 5CR9A 3MAAC 4BFZA 3O8CA 1O7JA 7MDHA 5DV9A 3IQIX 1XTQA 2GA8A 3ZI0A 3D7NA 1XZMA 4G0PA 5EZSA 4UFPA 1MJHA 2PX4A 4KO4S 4UHDA 5F76A 2WRZA 1EFVB 1T2AA 2NXCA 3IQHX 2X1HA 5BW8A 4XWWA 3KKLA 1JQ3A 4MUMA 5T67A 4CTOA 4ESVA 2OO3A 2A5GA 1X8KA 1LA2A 3AEZA 3MAJA 3GD5A 2ZAGA 5CDHA 2Q3DA 3PC6A 3SEQA 1E9CA 5EP2A 1X15A 1CZRA 4BNUA 4OKNA 5JE8A 1I2BA 5TARA 3WV4A 5KHAA 1ZMXA 4MPJA 4DMLA 1KJNA 1V16A 5AXBA 3SYLA 1M0TA 4GL4A 1ZBDA 5B2EA 2G9VA 5DULA 1G8JA 2Z6AA 1MPTA 4OP1A 4DY4A 2VJNA 2WOJA 3ZY3A 3MF4A 2O2EA 2FSPA 1XDGA 2PSDA 1YZLA 4TMWA 5A62A 3ZDFA 3BN3A 4GPAA 2FUNB 4P80A 2I54A 1K3TA 2VO1A 2EWVA 3BK2A 5A2GA 1UXIA 3CV3A 1LY1A 2D5IA 5KKNB 2BFCA 3E9ZA 1TQHA 3PXEA 3QRWA 3UPUA 3GJTA 4RS4A 1MAVA 5EA2A 1O94C 3LKZA 5DSXA 4CQJA 1UM9B 2BM1A 1QBKC 3NO4A 2HSZA 3P96A 3PVZA 4OQ4A 3JAKB 3CG4A 3Q85A 2WZQA 2XUIA 4PXYA 4BC0A 4OPMA 5A6VA 4ZHQB 3GBPA 4KIFA 3S2UA 2GT1A 3KJFA 1JL3A 3U4IA 4RHTA 1CG6A 3DTVD 4A5SA 3A0UA 4GR4A 1MT0A 1SKYB 2HMYB 2DETA 4OY3A 2QPLA 5ALRA 1AGNA 1T0BA 3G2NA 3Q2IA 4UM9D 1ZN9A 3HA3A 4B73A 1AOXA 5F3WB 5FQNA 3LLMA 3O26A 2ZJ6A 1EP3B