3W5IA

Crystal structure of nfeob from gallionella capsiferriformans
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
199
structure length
194
Chain Sequence
GQFKRIALLGMPNTGKSTLFNRMTGGAARVGNWPGITVELLSGKILLGADMVEIIDLPGIYDLHGFSDDEQVVRHFLHDNVPDLALVILNATQIERQMSLLLQLKQLNMNIVVLLNMSDEAKQYGITIDSRKMSELLQIPVFQLTGYQEALQAVTRALRYPTPGMAENVRTQLEQDEHIEAEMVRILKSAVQIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Ferrous iron transport protein B
publication title Structure of an atypical FeoB G-domain reveals a putative domain-swapped dimer.
pubmed doi rcsb
source organism Gallionella capsiferriformans
total genus 62
structure length 194
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3w5iA00
2BWJA 4IVQA 4KSCA 4UJ5A 4AC9A 5JHHB 3K70D 3SNHA 1BKDR 2ZJYA 1FNMA 1KO8A 4KFRA 1BYUA 4QL3A 2FJUA 2W0SA 2XB4A 3GPLA 3EZ6A 1Z8FA 2J9RA 1PUIA 3CW2A 1KDTA 3LRPA 1EX7A 3K1JA 4B3CA 4AYWA 1TQ6A 4AWXA 1ONBA 4LJ5A 2XGJA 2JJ1D 4EQ6A 3K0CC 5CM8B 1FUUA 1N6OA 4TLAA 3EPKA 2EFCB 5JZVA 2J1LA 4POAA 5FBRB 4AG6A 5AWFC 1IOZA 3FTQA 1H65A 2BBOA 2ORIA 3AEZA 3BBPA 4TWZA 1LS6A 1RRGA 2CE7A 2GWHA 2HYIC 3PCRB 3UATA 1F6BA 3AV0B 1MABA 3EWSA 4TYPA 4P0TA 4JVSB 5KO2A 2ZRNA 3C15C 3SR0A 4LWZA 1UKZA 2C9YA 3C16C 2BMEA 2GHIA 4TLDA 2YZ2A 4YDSA 2A5YB 2ZITA 1W0JD 1Z83A 5L3QB 4Z1MA 5JECA 5B2ZA 3I4LA 2GETA 2J0QA 3N70A 1COWD 2ERXA 3AF4A 3CUEF 3OF5A 4Y0VA 1UBEA 2FE4A 5KSPA 3T1VA 1E2HA 2IYTA 2QMUA 2XNDA 1XPOA 1RRCA 1T9HA 3THXA 2CCGA 2ZRMA 4M2LA 2ZI7A 4KO8A 2A30A 1P73A 3BERA 3O8RA 1GAJA 1P6XA 1YRBA 4KODA 4M1TA 4OQFA 4BFZA 1E98A 5ELXA 2JASA 3C14C 2XB2A 4AURA 2P5TB 2W6IA 3X2SA 4ZKDA 2GJ8A 1JR3A 2ATXA 1LTQA 1GRRA 5M04A 1GZSA 2XOKA 1P62B 3CR8A 4E5UA 4JL5A 4FCTA 1Z0DA 3OIUA 2J7PD 3ICQB 2LKCA 1QDEA 4CRWB 4PC6A 3FB4A 1D9XA 4C0AC 1DO2A 4LHXA 4B3GA 2ZS7A 4M0LA 1DAFA 1M8PA 1GL6A 4ACBA 5HCNA 1QHGA 1EFCA 1VCMA 5HCIA 5JFGA 3OIYA 1KSGA 5C46F 4DLZA 3PUWA 3U5ZB 4NYMR 1G20E 2VP2A 3WXMA 2MMGA 2VIIA 1Q0UA 2QP3A 4C0LA 2HF8A 5G41A 1U8AA 1GWNA 2BIFA 3IIKA 1KMQA 1NVVQ 1PLLA 4I1SA 3SYKA 4M1SA 5AUNB 1R0YA 3NEYA 1NJGA 4KVGA 3U60B 2D2EA 1SXJD 2H7VA 3U61B 4NBSA 2EWWA 2CEAA 3TE6A 3BB4A 1K6MA 5DI3B 1DO0A 3TVDA 3FHOA 3LLUA 2WWYA 2OM2A 3IKJA 1IHUA 3QUSA 2DFKB 2IYVA 3I1FA 1YR9A 4I1UA 1V5WA 2HT6A 3U2QA 3OEHA 1W48A 4UXIA 4ZI2A 1PJRA 2O5VA 4NYIQ 5CDFA 3KXIA 3UG6A 4DVGA 4KXFB 2ZJ8A 3DZ8A 4PAMA 2IC5A 1E2JA 3V00A 1XTKA 4YMUA 2WMNB 3Q85A 3Q7QA 1TL7C 4V0KA 4B6FA 1SZPA 2QBYB 2JEOA 1ZVQA 2DY1A 2ONKA 3BIFA 4TMZA 2QE7A 3QKRB 2MMCA 1GRNA 1GUAA 4QGHA 4MUBA 1G3IA 1N6LA 2L0XA 5EXPA 3WRYC 4XWAA 4LX0A 1D8TA 3ADCA 1SKQA 4OYHA 4DEYA 1F3OA 5G3ZA 4DLSA 4GSYA 2ZRPA 2JLVA 3L8YA 2HXYA 4IHQA 4TT3D 3U4QB 8OHMA 2OHFA 1OXTA 4KYUA 5EP1A 2JATA 1UAAA 4CGZA 2YVUA 1HUQA 1MRNA 1YZKA 2IW3A 2QP4A 4D0GA 3QIAA 3I61A 1ZNYA 3LNCA 5CJ2A 1W2GA 3TUIC 3AF0A 5EP3A 2J7KA 3CNNA 1M2OB 4Z1MD 2DFTA 1HE8B 2R65A 1Z0AA 3LQRA 4RD2A 3TIFA 2B7CA 2PCLA 1D2EA 3ASYA 4D2IA 1GOTA 4TMXA 5L3RA 1OYYA 4AG5A 2A7QA 2FPLA 5EZ6B 1VG9B 2XNDD 3MRSA 4M9SA 4LJ9A 1JALA 2VRWA 1SULA 2XSZA 4RFVA 3HR8A 1V43A 4UNNA 4A8JB 2FFBA 3JZMA 3BFKA 3OEEA 1QHXA 2G9NA 3ZVNA 2F1JA 4K8OA 3KQLA 3RRMA 1E1QA 1SQ5A 3F5FA 5L3QA 3DOEA 2P2LA 4UNSA 3RC3A 2OG2A 3NBYC 3QBVA 4BZQA 2FNAA 1GP2A 4F4IA 4CEHB 1D9ZA 2GJAA 4LV5B 2IK8A 3J81k 2YV5A 2JCSA 1JAHA 1XEFA 4O0MA 1YZQA 2D2FA 2C9CA 4BZPA 1GFIA 4JBWA 3VKWA 4BE7B 5KPJA 3VKHA 1R2QA 2QAGC 4PX9A 3OFNA 3W3ZB 2GCOB 1VDZA 5BYJA 3B1VA 2X2EA 3FGNA 3VMFA 4QM7A 2B6HA 2REOA 4ZDJA 1QHHB 1BH2A 2E1RA 2Q6TA 3UIEA 3D8BA 3A4MA 2BBSA 3LV8A 1II8A 4IJMA 1Z0IA 2JJ8A 2YKGA 1NKSA 1BMFA 3NIBA 2WWFA 4QC2A 2V6IA 1CP2A 4HB2A 1DELA 2JLXA 1W49A 4PC1A 1G9XA 2KSQA 3EZ7A 2QROA 1NN3A 3KJHA 4KU4A 5FTMA 5SZKB 3CX8A 4D4LA 4LV8B 3CRRA 3T5GA 3OEHD 1VG8A 3X1XA 2C04A 4B73A 1ZP6A 3MUFA 4DCTA 1F2UB 1ZM3A 2V8OA 4HB0A 4AIIA 4QBHA 2QM7A 1HA3A 2R6FA 4HATA 2UKDA 4WXRA 2C77A 3EZFA 4X8HA 4IOKA 1G6OA 1KO5A 1KY3A 2ZUBA 3UWKA 4Q03A 5F3WB 1KJYA 1T6NA 2YOGA 1J8MF 3GJ4A 4JBYA 3VR2A 421PA 2QE7D 3BE4A 2BDTA 1N5KA 2R6AA 2VLIA 3A1TA 3W34A 3QKUA 2F3RA 1XCGB 2ZS8A 3H2YA 1LNZA 1W46A 3C41J 2QTVB 4WIAA 5L3SA 3KX2A 2YOHA 4JKYA 5AJXA 1RRFA 1G17A 3QPVA 4TZ0A 5IF9A 2IYUA 4OHWA 2FEOA 3OIVA 3ZS8A 1KSJA 1R5BA 3I8XA 4ESHA 1J90A 5AJVB 2QBYA 2A5FA 2WWXA 3A36A 1GNPA 221PA 1TUIA 2CHQA 3GD7A 2X77A 4U00A 1N6PA 4EJSB 3QKRA 3BC1A 2VHTA 3CKLA 2IYLD 2WICA 3B6EA 4N1AA 4NCIA 4QKQA 1UPTA 3V9PA 2ZANA 3M1IA 5JS8A 3UPUA 1ZNXA 1CF4A 1EGAA 1AS3A 4FINA 2QL6A 4AKGA 1WXQA 4AY2A 3SHWA 1OXUA 4A36A 1KI2A 1RE0A 3BK7A 4BLRA 3U4QA 5G40A 4BWYA 1ZNWA 5KDDA 2H1LA 2XSZD 3QKSB 1IJFA 3L2OB 4LK2A 1CXZA 4PHFA 4QFMA 1AK2A 4B3BA 4DSNA 1XD8A 3GLGB 3MLEA 4B2IA 2RGCA 3D3QA 2ODBA 2ZYUX 3IHLA 4F38A 4KLNA 4Y0AA 1Z08A 2AFHE 1NRJB 2GCPA 2IYWA 3GJ3A 3SC3A 2R6CA 4BLQA 1HQCA 3AVTA 2RGEA 3PG5A 4FCVA 4RZXA 4B75A 1OT3A 1W4RA 3G82C 3PQCA 2FFQA 1CJTC 2EVWX 2X8AA 2Y8EA 4Q18A 4DLTA 1OB2A 1OLOA 4A8JA 1EFRA 1VHLA 1ETUA 2CVFA 4OI0A 1Z28A 2BCGY 2VH5R 4B44A 3QVUA 4LYJA 1I2MA 5IRCD 2QGZA 3P1JA 3B8HA 1G7CA 3BB1A 3GFOA 3L0OA 2PT5A 2OLJA 2IS4A 2QP9X 2GAAA 1BMFD 4JBXA 1QBKC 1G8HA 1EK0A 2WIBA 2XEXA 1N5LA 2FN4A 1QG2A 3RDPA 4JJZA 4IOLA 3VR3A 4KHZA 3P20A 1LF0A 2QN6A 3AQ4A 2KWIA 2GCOA 5FUVA 2QMOA 2WWGA 4TLBA 1R0WA 4M1YA 4JL8A 1NBME 4G5GA 3VTKA 1G291 1VYUA 3MGCA 1WF3A 4P4UA 4B3FX 4EAQA 3THWA 4A92A 3NDPA 3C5HA 3TMKA 1ZINA 2FMXA 1E9RA 3NWJA 2FWRA 2IS1A 4Q1AA 4RD6A 4PSAA 4A1FA 4Q9JA 2XAUA 4ON9A 3KQNA 4GI7A 2PMDA 1KDPA 3OE7D 3T5DA 1FTNA 1TEXA 2NO1A 4IW3B 3BS4A 4KFSA 5KSZA 2ZJ5A 4IEEA 2VP9A 1F2UA 1U9IC 2WWWA 1TADA 3NHBA 4QBIA 4XH9B 1AQYA 1XEWY 4B34A 4RCYA 4XWKA 3KL4A 5LPNA 4LHWA 5GVRA 3PXGA 4BUJA 3KTAB 4Q9IA 2CLSA 2JLUA 4MRNA 1DAIA 1P61B 2YOFA 3BD9A 5FTKA 1JEDA 2IF0A 5FOXA 1T91A 1UF9A 1G8FA 4MGYR 3H4MA 4AD8A 2OLKA 4KBGA 1RIFA 2ZSFA 3L43A 4LJ7A 3UMSA 4DBLC 1Z0KA 1H8HD 2A5DA 4Q9HA 2ZRAA 2ZIAA 1S9HA 3LH5A 5D3MB 1NY5A 5FBVB 3EG5A 1SVLA 1FTSA 1QVAA 1P75A 5J47A 5HZKA 5TDHA 1W4AA 1MKYA 2ZYWX 1A4RA 1X8JA 2IEYA 5H70A 3TUJC 3CLVA 3EPJA 4EJSA 2YINC 2P67A 2C9OA 3GMTA 1DAHA 4BFXA 5EXSA 3HYRA 3K09C 5EE1A 1UJ2A 1FFHA 1ZCAA 2MSCB 5CK5A 2KBFA 2R2AA 4JLAA 3SS8A 3RRZA 2VF7A 4LYAA 5CK4A 4F7WA 1P72A 1TAGA 3A1VA 4EDHA 2OCPA 1FP7A 3RS4A 1C4OA 3CH4B 5KU1A 1JXOA 3ZS9A 5K8LA 3JVUA 3WYFA 1KI4A 4OQXA 2QTFA 3DMNA 5A5GA 3FKQA 4UKDA 3GLGA 2MSEB 5LB2A 4PPQA 1XTJA 1W7AA 1OH7A 1VYTA 4DSTA 1R8QA 4PSVA 1ZAKA 2WJHA 2ZJ2A 5HZHA 1GTVA 2IT1A 1VG1A 2NMVA 3H1TA 1E99A 3AVPA 2C8VA 4NMMA 5BXQC 1OFUX 4M9ZA 1J70A 4ESVA 4L15A 3TW4A 2FFAA 1YR8A 3QXJA 4P4SA 5GJWC 4HAXA 1W5TA 3LVRE 1R5NA 5H68A 2J45A 4NCNA 5FBQB 4BLTA 4DRZA 2PZEA 2HYDA 1Q22A 3LQQA 2AWNA 3TGPA 4B3DA 3ND8A 1EWQA 1WBDA 4KBFA 3A1WA 5B58C 1W36C 1TPZA 3SHFA 1CJMA 3VQTA 4Z8YA 3KZ1E 4DDWA 1G4AE 1KDOA 4LPKA 3ZGXA 1E2QA 1E9DA 2Q9AA 2VF8A 1IJEA 3KB2A 1OIXA 4FMDF 2ZI5A 3PIRA 4FMCF 1U2RA 1D5CA 1Q20A 2REBA 4I4LA 5FPYA 4BEBA 2FF7A 2XZLA 1JECA 1OW3B 4TSFD 2OE2A 5ANRB 4M1MA 3EIQA 2P6UA 3FMOB 4DLXA 1G21E 1AZTA 3A4LA 3WBJA 1CKEA 2N42A 1FMLA 2YC4C 2Z4RA 1G8YA 4L8GA 2AHOA 4Q1EA 5AR1A 1OFIA 1ZC3A 1ZW6A 1E4YA 4EPRA 2FSGA 4PQRA 2PL3A 2RAPA 4LPSA 4CEIB 1GNRA 1RYHA 1TF7A 4TL7A 1NIPA 2J41A 1KK2A 2GAOA 3B85A 4HDOB 2IXFA 4XTRA 1Z2CA 4PR0A 1HH4A 3CPEA 3EXAA 1G7TA 4YXWD 1DOAA 4N0DA 3U6KA 2X19A 2QQEA 3GJ7A 5TXGA 2OESA 1HQYE 1Q3TA 4NONA 4URZR 2WZQA 2ZR9A 3K0CA 2WPDA 2ZR7A 2IHYA 3IBGA 2WSMA 3FWYA 4JIMA 1P4SA 3KTAA 2BEJA 521PA 4ZPXA 4DSUA 4QG7A 2VHUA 3RRYA 1Z29A 2PH1A 3KFXA 4BLSA 3X1YA 3CX6A 3KKMA 4G01B 3W5IA 3EWAA 4HUQB 1MOZA 2RGGA 3GLIE 2ANBA 3LAWA 2FPKA 4KV9A 3GJXC 4BZXA 3KJGA 2HT1A 1SHKA 1SXJE 2YWFA 2FZ4A 3IQWA 5J5CA 4LZZA 3QI2A 4EFMA 5D3MA 3K70C 2O52A 3CH5A 1A82A 2OBNA 5HPYB 2ZU0C 2JLSA 5LBIA 3U3KA 4L5BA 4IXNA 4YMVA 2XJ9A 1LW7A 5FPKA 3T15A 2V7QA 4Q21A 2QI9C 4RZUA 4EPVA 5IT5A 2HDNB 1OIWA 2NO7A 1UADA 3EC2A 3UANA 4D81A 1CLUA 1AQUA 1QHSA 1XD2B 2V1UA 1RW4A 1NLYA 3C4JA 4DB2A 3B1ZA 4WBSA 4PAOA 1KZ7B 3FMPB 4F4CA 3DDCA 1CRPA 5EE5B 3PUYA 3PUZA 4Q1DA 3EW9A 4KLZA 4M4SA 1T0HB 1WRBA 4ZCLA 2IBMA 3EA0A 4LJAA 4XIGS 3MJHA 2GF9A 2R6GA 4UNPA 4P3YA 5KYKA 2OUKA 3X1ZA 5FTLA 2AKYA 2O8DB 4K46A 3N5CA 1VECA 3GLHE 2FZLA 2YWGA 3LW7A 4B76A 2VEDA 4PQFA 1NP6A 1Z6XA 1ZMXA 1DAGA 2IL1A 1YZNA 3AVVA 3I72A 2ZAOA 4LHYA 4TTPA 5HTKA 3U44B 4HLUC 1UFQA 1J99A 3AGPA 3JZAA 4O25A 3CO5A 4GPTA 3SU8A 1KOFA 3CRMA 4R2IA 4JVLA 4ZDWA 2OAP1 3HYTA 4LC1A 3RABA 4PPGA 4M1WA 3ZIAA 2LWIA 4GOKA 2O0HA 1DAKA 4MKGA 4HUTA 1G8PA 3CPJB 1Q1BA 4TMWA 3A58B 1FUKA 4B3XA 2BVNA 4URUR 4D4MA 2WWIA 4NYIR 4Q9LA 1E2KA 3W6OA 1XRJA 1GL7A 3LY5A 3MWLA 5F9FA 1U98A 2RGDA 3R9XA 1L2TA 3AF3A 4CF7A 3QXCA 4AYTA 4DCNA 5CLQA 4KITB 2VHJA 4MGKR 4NU0A 3FVQA 4M21A 2N1BA 5DYIA 2IYYA 1TX4B 621PA 4RJLA 2IYRA 1E9FA 2ODEA 2F9MA 2NQ2C 2OFWA 4HB3A 3WMEA 2WV9A 4MYHA 5JSZB 4UNQA 1GDDA 3AUYA 1NG9A 2QT0A 2HEIA 4YONB 1P9WA 5JHGB 2WPDD 3SJAA 2SHKA 1L4YA 4CEIA 1Z63A 2EFDB 2AK3A 3EPHA 3ADKA 1E9EA 3MJRA 1HTWA 4HZIA 3T35A 5KOYA 2CL6X 4MGZR 2GEVA 3I92A 5FBWB 3CZPA 5K8IA 2IA5A 2R44A 4B33A 4AKHA 1II8B 3VNUA 5SZIA 1NMYA 3CRQA 1SXJC 2FH5B 4BFWA 3KDSE 2V1XA 4MRPA 2V9PA 1RFLA 1NL3A 4DLVA 1EWRA 2BBTA 3C5CA 5A4JA 1N3BA 2OEPA 3WHLA 2PX0A 4MRRA 4DLYA 2VPPA 3BGWA 5KDOA 3ONWA 3AVXA 2GXQA 3DKPA 3ZYCA 5CDFE 2V7QD 3QXHA 1LVGA 1N0WA 4HUQA 3O47A 3TLXA 1Q3HA 2FFHA 1LB1B 4X8LA 3UK6A 1XWIA 4QXAA 1Z2AA 4XJXA 5KNBA 3REGA 1TEVA 1KI1A 1ESNA 1QRAA 3B1WA 1CIPA 1E2EA 1U99A 1VMAA 2AL7A 2XX3A 2O8EB 1W4CA 2PX3A 3LD9A 1DAMA 1JAIA 4Q9KA 2JGNA 4UJ3A 3W6NA 1MO3A 2GDJA 1NLFA 1VCIA 2Z0MA 4HDCA 5AUPB 4R9UC 1VIAA 4EFLA 3VR4A 4XD7A 3GQBA 2WJVA 4ZKEA 3R9IA 5L3SB 2ZE6A 5C4GB 2NGRA 2AKAB 1WP9A 4GOXA 4MRSA 1P2VA 4BPBA 1XD2A 4LBZA 1TUEA 5FI1B 3RRNA 1OPXA 2P5SA 1II0A 1OF1A 1SVMA 2OILA 4IDQA 1SVIA 1MO5A 3FHCB 5EE3A 3TR5A 2QENA 4G5QA 2D7DA 5E3HA 2FGKA 3GJ8A 4NE2A 1OSNA 1IM2A 4Q66C 1CJKC 2N46A 1Y63A 4DKXA 2ERYA 4NCHA 5FOUA 1J8YF 821PA 4O2LA 4XSHA 1XU4A 1IONA 2DFNA 1QHYA 2PEYA 1NSFA 4GDFA 4NYJQ 1VG0B 3UXMA 4BFYA 2O8DA 3K0FA 4QNMA 5H1YA 1UKVY 5E7IA 1G19A 1XXHE 1CR0A 1E0SA 1ZUHA 2GBLA 2YWEA 4GMDA 4Q4LA 2QMEA 2EYUA 3AGQA 5JEDA 2C95A 3AUXA 3U44A 4KSBA 1FW6A 5KDLA 4MDFA 2IUSA 4K81B 5EZ5A 3IIMA 4D0LB 2ZI4A 1ZCBA 1GKYA 4HDQB 1R0ZA 2D06A 3NTUA 2RMKA 2H8KA 2VTKA 3AKEA 2A3RA 4TYQA 2FSHA 2CJWA 2ZRIA 4IDNA 5FUXA 3GJ0A 4QJ4A 4ZIRB 1GKIA 2WAYA 2J46A 4AKEA 4EUNA 2G1KA 3C8UA 3OIWA 1F2TB 2Q9CA 3PFIA 3IBYA 3Q72A 4GP7A 1QVRA 2PJRA 1G3MA 2IS2A 2GXSA 3EC1A 2WWHA 2R62A 4RD4A 3RS3A 2HCJB 4PZZA 1E2MA 4QHSA 3SZRA 4L4UA 1PZNA 2W6ID 2GESA 1ZD9A 3CF6R 1JR3D 4Q7JB 5EP2A 4A2WA 2O8CB 4HLCA 2XOKD 3B13B 5FTJA 1AN0A 1I2DA 4MUAA 4JLPA 2OV2A 1OB5A 2YYZA 1M74A 4KFTA 5JSZA 2EFEB 2ZRCA 4X8OA 5CYOA 1MV5A 1E2NA 1NF3A 4FMBB 4JMPA 1AM4D 2A5JA 4MKHA 4GOJA 3FOZA 5TMPA 4RSGA 3SJCA 4AK9A 2GVDC 4KFUA 2LKDA 3LX8A 3QENA 5E95A 5JEEA 4HAUA 2IHBA 2XXAB 4OI2A 2ATVA 2OT3B 5AUOB 1AS0A 4KJZA 3UMRA 4YQFA 1KK1A 5FOVA 1E9BA 1UKYA 4IXMA 2Q3MA 2PBRA 3KJEA 2IF2A 3THWB 5EP4A 3TW8B 5DYGA 5J4VA 4D25A 2FU5C 5LD2B 2DFLA 3CM0A 2ZREA 1FZQA 3IILA 5BQ5A 4G5RA 4ITRC 3RHFA 2GVZC 2QEQA 2B21A 4ASUA 1R6BX 5EUMA 1P9RA 4YMTA 4XVQA 3B9PA 1AA9A 4XD7D 3VX4A 4W5HA 3ZDQA 1TU3A 1R4AA 5BYKA 1GL9B 4M1OA 1GNQA 2B8TA 4MYUA 3E2IA 3WYGA 2CMKA 2EQBA 4PTLA 5CLLA 1Q21A 4OJQA 4C0BA 2OBLA 4GP6A 5DN6A 1JEEA 3DHWC 2O8EA 4PO9A 4PO1A 4US0R 2A5GA 2GZHA 4LC0A 3TKLA 2ZSDA 3EIHA 3ZJYA 3SBEA 5J4HA 2ZROA 3K8YA 1PLKA 5JJIA 3HPRA 2BM1A 3WP0A 2GJ9A 4B35A 1OH6A 1KJWA 5FUWA 3VHLB 4HSEA 1D6JA 1SVWA 3NH9A 3VR1A 1FQKA 1JPJA 2KE5A 1Q57A 3Q7PA 4JLMA 1W44A 4TQUS 1MO6A 2CE2X 2PCJA 1X1RA 1W0KA 2ZJAA 1T3HA 1UEJA 3GJ6A 1CEEA 3CB4A 3FYHA 4OK3A 1IBRA 3F8TA 4OKSA 1KO4A 4D0NA 4O3MA 2Z43A 1LF5A 4RD0A 4CW7A 3PEYA 1BIFA 3HDTA 2C78A 4IRUB 4V0NA 1FNNA 5F98A 2HCBA 4OK5A 5IHPA 1KGDA 2I3BA 1KI3A 3IPXA 4WA7A 4J0QA 3SOPA 1XDBA 4U5XA 2A2ZA 1YQTA 4EFNA 3U7HB 2H5EA 5IK2A 1TNDA 2XJ4A 3MG9A 4GNKA 3A8TA 1EFTA 4PHTA 4B71A 3N2IA 4D4JA 3DZDA 3HU3A 1NN1A 2IYXA 3OEED 2XZPA 4GZMA 4JLKA 4PZLA 4GRAA 3QF4A 1E1QD 5AK0A 4BFSA 2VYFA 1U9IA 2WTUA 5BN5A 2CLDX 4TTRA 1E4VA 2FSFA 3SQWA 2QMHA 2VA8A 2EFGA 3FDIA 3GCGA 1N5JA 4ZIRA 3ETLA 4P4TA 3AKYA 4JZKA 721PA 1GITA 1Q44A 4RZ3A 2HV8A 2ZSBA 1IXSB 1F2TA 4OK6A 1LV7A 1XTQA 3H84A 2CL0X 4JLVA 4P4SB 3O8BA 2WBLC 4F4JA 4PQYA 2CCKA 2OFOA 3BH7A 3NEJA 3OFND 4MDEA 3LFUA 3AVWA 2KI5A 2O0KA 1UEIA 2G6BA 4TTQA 4JYBA 1S8FA 2O8CA 1KI6B 5CIWA 2ZE7A 3BFXA 4C2UA 5BN4A 1E3MA 2RKOA 1ZUNB 2WKRA 2ZR0A 4S35A 1S4QA 1YZUA 1T5IA 1VIYA 2Z6VA 3Q8XB 3QY0A 4LGMA 5HR5A 2VP5A 2IXGA 4ASUD 2A78A 3A1UA 2CNWA 3A37A 4C7OB 1NLZA 4GMXA 3NKVA 2F43B 2JIZA 1YJ5A 2XXAA 3GEEA 2VP6A 2JLYA 4IOJA 1U81A 3I8SA 1ANKA 2ZRDA 1E9CA 3LXXA 1AIPA 4V02A 3DOFA 4A6PA 2XTMA 4HZUB 4A15A 2Q0HA 5DN6D 1S0UA 3QBTA 3TBKA 4JKIA 1N6RA 3QEOA 5DNYB 3NBXX 2BMFA 2RGAA 3CWQA 4DCVA 1LFDB 3AP2A 4FN5A 4BLOA 2EWVA 3EZ9A 4A6XA 3GLFB 3QKTA 1W4BA 1OHHA 1SHZA 2QUZA 1M7HA 2GEDA 2QA5A 4G5OA 5HE8A 1CU1A 4D82A 1GIAA 3N2EA 4EPYA 3MSXA 3SDZA 3AM1A 1G7SA 3SI7A 5TVKA 5TB5A 3SQXA 1WCV1 4B74A 4QGGA 1GRQA 3M4YA 3B5JA 1P9NA 4DDVA 1ZJ6A 2YWHA 1R0XA 3IO3A 1US8A 3R7WB 3OESA 4E03A 4HAZA 4LJ6A 1NJFA 1E9AA 2QGNA 2YJTD 2W00A 2WSSA 4I1OA 2WJYA 4ZDIA 3MWKA 1TQDA 4A0GA 1ZM2A 1VTKA 2EU8A 1KMHB 3QNUA 5EQTA 1E2DA 1UBGA 3FPAA 3KXKA 2ZXUA 1PVOA 1E6CA 4HEJA 2QAJA 4DT1B 4W5JA 5JJLA 3GJ5A 5JJKA 2XTNA 3UKDA 1YHNA 1NBMA 1O87A 3OZXA 1JR6A 4BRUA 2NO0A 3U7FB 1VPLA 4FW9A 1CRQA 2Z5FA 3W3AA 4C0HA 1HYQA 5HKKA 4PHGA 1SKYE 3ZZ0A 4D6PA 3GEHA 2PLFA 4OJKA 4A8JC 1KHTA 1X1SA 2JDIA 4FMDB 4LBWA 3I62A 4FMCB 1Z6TA 2ODNA 1CR1A 2AXPA 3K53A 4JT2A 3GLGE 4IOMA 3RLFA 2RHMA 3M6AA 1M1YE 1RYFA 2J0UB 1DEKA 2CCJA 2QPAA 3KKOA 2OCAA 2B7BA 4IFEA 3TSZA 4XWOA 3FHTA 1QHIA 3T34A 4A0FA 4ABYA 2D3WA 4MGIR 4BEJA 5JWOA 1ZIPA 4MYCA 2D74A 1NNEA 1T3LA 4MRVA 2DWOA 2R8RA 4US2R 5FOTA 4PXAA 4ZI3A 1KNXA 1KAOA 3IO5A 1N6NA 3L0SA 1HE1C 4L16A 5GJCA 4FWIB 1EFRD 3Q9LA 3D31A 4GT1A 4MA4A 3SN6A 3UWOA 4DWJA 2FV8A 2ODWA 2RCNA 4QOSA 2FDCA 3GLIB 2HUPA 4ARZB 4ZV4A 2GA8A 2OCBA 4R7ZA 1E0KA 1TTTA 1MO4A 4MKFA 2GXUA 3B78A 1OXSC 3QOFA 4ERNA 3DO6A 2ASEA 5FR1A 4KVAA 3RAPR 4BASA 5L3VA 5JWHA 3DMDA 1BYIA 2QSYA 5FPTA 1XMIA 3SEAA 2BKUA 2V55B 3B82A 4Q47A 1WBBA 1G5TA 4KI0A 4A0HA 2CNWD 2DWQA 2JIZD 2ZETA 4XVUA 4D80A 1ESMA 4E07A 4OQNA 1KI6A 3PR1A 3VX3A 1XMSA 4Q01A 1FQJA 3R8FA 2HLDA 3BH0A 3HU1A 3GFTA 3T1OA 5JI3E 2ZUDA 3ZVMA 1JBKA 3A1SA 1G7RA 1Z47A 2VHQA 2XITA 5JCPA 3WYAA 1L4UA 3GP8A 1XD9A 1QG4A 3BH6A 4G3XA 4M53A 3EIEA 1S2MA 4V0MA 4C7OA 2VSFA 1AKYA 2F43A 2ZYVX 1XPRA 3BJIC 3S1AB 2JA1A 5JCZA 1CULC 5DI9A 2QRNA 1NMXA 4HZUA 4QRHA 4DDUA 5K8UA 5DH9A 2XTZA 2ZI9A 5AJYA 2F1IA 2QSZA 2IEZA 3Q3JB 2R6DA 5EXXA 3V4FA 4EJSC 4OL0A 4NCJA 3A4NA 4OHXA 3GLFA 1U8YA 5TV2A 1S96A 4TYNA 5AUQA 3O8DA 3U3MA 5B30A 4TL9A 3U3OA 2P6RA 1E9SA 2ZJZA 1T5LA 1XNJA 4TL6A 4Q4JB 3DPUA 4TMKA 4CT4B 2QT1A 1I4DD 4A4DA 3IIJA 3RNLA 3R7WA 2ORVA 1PUJA 3MFYA 4LHZA 5HKKD 1W0JA 3TH5A 3AB3A 3NC1C 4HLUA 4HAVA 4TLCA 3WP1B 4LI0A 4AKIA 2NG1A 2JDID 1OFHA 3TSOA 1COWA 4DCSA 1KMHA 3CRW1 3TRFA 3IHWA 4GFDA 4MYTA 1UBCA 3KJIA 4DT1A 5FH9A 3T1QA 5JS7A 4ACAA 4Q19A 4G0NA 3WBKA 3ZQ6A 1CBUA 2ZJOA 1XTIA 4JVMA 3AVQA 2CK3A 3P4YA 1H8EA 1M34E 4M8NE 1HEIA 1KO7A 2ECKA 4IDHA 1O3YA 1XTSA 4Q1BA 1G16A 3BORA 4ILEA 4Q00A 4CT5A 3THOA 4PC7A 5B57C 4B2PA 2BBWA 2CLCX 2J7PA 1P5ZB 2J0UA 2AN9A 1JJ7A 1NN5A 1SGWA 1FPMA 1P7CA 1VHTA 4UXHA 1XCMA 3E5HA 4OHZA 2GKSA 1J7KA 4IFBA 3REFA 2QPOA 2QAGB 2PZGA 1IY1A 2RGNC 2QQ0A 2RGBA 2ZU6A 1G3UA 4DZZA 5EE9A 4QBGB 1M6NA 5SZHB 3LVQE 3GLIA 3QG5A 1AGPA 2BHRA 1M7BA 4ARZA 4AI6A 4D4KA 5LB4A 4C0SA 1YVDA 4F91B 4C2TA 3K0FB 1SXJA 3K0AB 1ZD8A 1E94E 3MWYW 1E96A 1EFHA 4A0RA 4LDJA 3F3YA 3D7MA 2HLDD 2IWHA 4LJ4A 4DEXA 5C18A 1W47A 5J4YA 5DHFA 2PLRA 1NVVR 4BLPA 4M9QA 3U7GA 2PJZA 3RSLA 2VSOA 1LY1A 2PT7A 4IDPA 1ODFA 3DVLA 3EZ2A 3KQKA 4LSGA 3G0HA 2A9KA 1ZRHA 1WMSA 1E2PA 4N3NA 2W6JA 1HT2E 2QRZA 1NVWQ 2WAXA 3GFPA 1G4UR 2CJWB 4V03A 1Z0JA 3W8NA 3TQCA 4TQAA 2OBMA 2YNMA 4Z51A 3KFVA 3QQ5A 1DG1G 2ORWA 1KZGB 1EG7A 2C98A 1GVNB 2DCUA 1N6KA 4OI1A 3DEFA 4JLBA 1XEXB 1GG2A 1JB1A 3CWZA 3ND9A 5IDVA 1X6VA 2EFHB 4M9XA 4US1R 2ZTSA 2ZYTX 3CX7A 3MAAC 1JR3E 3RS0A 2BMJA 3PV0A 4PO8A 5CB6A 5EXTA 3S1AA 5BN3A 3WY9A 4YLGA 1YR6A 5GJBA 4TT3A 3DM9B 3GLHA 2QG6A 3RYTC 5EUQB 2QORA 4FIDA 3TQFA 2VL7A 3RS7A 4BRWA 2AFIE 2NOAA 1XXHB 4ZDKA 3THYB 3ADBA 1E0JA 2WOJA 3E70C 4HB4A 3AVOA 1S1CA 2J5XA 3PEWA 1MH1A 2BMDA 5DGXA 3B1XA 4KAXA 2ONJA 3AF2A 4RD3A 4NYJR 5KNCA 2Q3FA 4OBEA 4QHYA 4HAYA 1IAQA 3L8ZA 3VHXA 5UKDA 5KSYA 2NO6A 2F3TA 2VSXA 4HAWA 3KXLA 2JLWA 2C99A 4WW0A 4IDOA 5FOSA 2J87A 2WOOA 1N6HA 4PPNA 2ZEJA 4V0OA 4DSOA 5E7JA 4ZCIA 1J2JA 2CVHA 2ZSEA 2DPXA 3F0TA 4Q4JA 5P21A 5EJEA 4MITA 1CR4A 2CK3D 4LCBA 4XSGA 1H8ED 3T61A 3UG7A 2DBYA 2WHXA 5FOWA 4NZYA 4W5WA 1E32A 3KKPA 1XCPA 1GSIA 3CPHA 3SFVA 3VR6A 2F1HA 3CR7A 1G5RA 3K9HA 2DR3A 2ZSAA 4DLWA 4CEJB 1JXMA 4G1UC 5CM9C 1ZC4A 4F92B 2K5UA 3BAFA 1OH5A 1HT1E 1Q1QA 4OHYA 4C4PA 3V4RA 1N0UA 1W1WA 3WMGA 3LLMA 3X1DA 1EXMA 1G41A 1AJEA 1XTRA 2O8FB 3ZVLA 3U7EB 3IGFA 4A2PA 2G0NA 3W9YA 6Q21A 1JJVA 3NDBB 2BC9A 3ADDA 4QGFA 1OE0A 1JQJC 2RGXA 4Q48A 2UZ3A 1U94A 2YHSA 3FFAA 3VR5A 1P2SA 3P26A 4NH0A 5DHAA 2QU8A 2GNOA 3RS5A 5K8TA 4JL6A 4WZ6A 2JLQA 4JSYA 1IN8A 4I1VA 5F9HA 1IN4A 1N25A 3K0SA 3NHAA 2X2FA 2VBCA 2AX4A 4URWR 2QAGA 4LRWA 4XVRA 2P3SA 2ZRFA 2PEZA 2ZVPX 1RC8A 3BRWD 1DVRA 3K9LA 4FCWA 4M22A 4URYR 4A2QA 3ZLJA 5DIFA 2ZRLA 3ZIAD 4B43A 2CBZA 3LBNA 2W6JD 2YC2C 4I81A 4DB4A 1XBTA 3PVSA 3K0AA 2P6NA 5HE9A 1ZD1A 4JVNA 3QPUA 3T06B 3ZH9B 2B92A 2WKPA 5E4FA 4DHEA 3U3JA 1N5IA 3LW8A 3QF4B 4IVPA 3VFDA 4FWTA 4OI4A 2D4HA 3MMPA 2H16A 2V4ZA 3NBFA 1HV8A 5FL7A 2AXNA 1XMVA 1TMKA 3I73A 3I5YA 4DDTA 4CDGA 2IUTA 5GVSA 4Q02A 2ANCA 3QE0A 3W6PA 4U7DA 3AVUA 1RRPA 3IEUA 2HXSA 3TNFA 2JJ2A 3AVYA 1WA5A 4WZBE 5C1BA 1X3SA 3I5XA 1F48A 1FMJA 2OXRA 2OXCA 1P2UA 3KKNA 1XEXA 5CITA 3O8CA 5AJWA 1U90A 5JLJA 3OHMA 4R71A 1ZU5A 2WVJA 4X8MA 1G3QA 2ZE5A 4QM6A 2NIPA 4QJ5A 5JWRA 2JAQA 2Q3HA 1WQ1R 4LYFA 1G6HA 1II9A 4Q7MB 1FX0B 4NPHA 3RANA 1KYIA 1BO6A 1G64A 1B23P 5A0FA 2WJGA 1YRAA 4NYMQ 1ELOA 3P4XA 2GZAA 3PENA 3W90A 1X8KA 3ICEA 2BJWA 1OJLA 1XXHA 4B32A 3THYA 3WNCA 2JLZA 3SYNA 4LOAA 1HURA 1DTSA 2OZEA 3CZQA 3CF0A 3MWJA 5H8WA 1K5GA 3HJNA 1ZYUA 4OQLA 1UM8A 2AR7A 2ZQ5A 3JVVA 2C96A 4PANA 4RD1A 3AKDA 3CBQA 1ZNZA 2W2TA 3HU2A 3W5JA 1U8ZA 4OQMA 1IY0A 2BOVA 3DM5A 1UDWA 2GTPA 4QNRA 4P33A 3U3RA 5GADl 3K0EA 4GZLA 2CHVA 5J4LA 3QXSA 3AF1A 4PFSA 2IWRA 5LDDC 5D3QA 3EX7C 1Z06A 1R5OA 2RB4A 4BFVA 4IEIA 2D62A 3TK1A 2J0SA 4GBMA 2F1RA 5KHOC 1PV4A 2FSIA 2GJKA 2ZE8A 5FTNA 4NCKA 2LCFA 4CIDA 4IVRA 4PC3A 2EW1A 3WMFA 1E1RA 1S1MA 4CEJA 4URVR 1VYVA 2ZRGA 2GRJA 4H1VA 4V0LA 1XMJA 1YZLA 3A6PC 1DBSA 4DLUA 2X1VA 3PITA 1US8B 1CTQA 1X86B 4CZ2A 2FPMA 4G5SA 2F9LA 1R7RA 2GBLC 3TUZC 3R20A 1VKJA 2PZFA 4BQSA 2WM9B 1Z22A 1E2FA 1XP8A 3VAAA 1ZM9A 2Q21A 4C0JA 5JRZA 1PLJA 2IYQA 3SFZA 2IUUA 1KY2A 4MH0R 2O8FA 2Z4SA 3RWOA 4TN1A 4XTCS 3QF7A 1WB9A 3FKSA 1KAGA 3CNOA 2FOLA 1W36B 2GF0A 3FE2A 4TQ9A 4IKEA 2J59A 1S9DA 4CYMA 3B1YA 1P60A 2O8BB 4QHTA 3CNLA 1FOEB 4I99A 2G3YA 1YZTA 1RZ3A 2HJGA 5CYPA 2H57A 1IN5A 4B48A 2AD1A 2BEKA 1KKLA 3PEVA 4Q1FA 5DI3A 1I4TD 3ZD6A 3OE7A 1W5SA 2WMOB 2AWOA 1P2TA 4RKEA 3KKQA 3TVTA 1DARA 1U0JA 1YR7A 5G53C 3ZD7A 3RSOA 4S2EA 5BW8A 1R8SA 3TAUA 3CRVA 1EESA 1SVOA 1IN7A 5FL7D 4JJKA 1NVXQ 1WDTA 1Q1EA 1LS1A 4U02A 3M0EA 1KI8A 1IN6A 2RH5A 2O0JA 2GCNA 1RJ9B 2ZI6A 1EFUA 1KI9A 2TMKA 1Q12A 2WJIA 3B9QA 5CIQA 2JJ2D 2HJVA 5EE0A 1JQLB 1KI7A 1BS1A 1A2KC 5CB8A 1OFTA 4A82A 2QM8A 4AYXA 4DC9A 3BB3A 4UQOA 3UMFA 1KTVA 3E1SA 5BWMA 3NC0C 4URXR 1UKEA 2QTHA 1H8HA 4NHOA 2XNSA 1TQ4A 3ECCA 2G88A 4II7A 3R9WA 1CR2A 1KJZA 1VCOA 5FPSA 2UVQA 1XFAA 1SKYB 2DYKA 1OV4A 2ZRJA 2ZRHA 1ZM7A 3B60A 1E0AA 1XJCA 3C7KA 4ZCMA 4YMWA 1T8TA 3H0KA 4C0KA 4Q5IA 5JBQA 4PPFA 2I4IA 2NPIA 4RKFA 1XPUA 2DB3A 4R98A 1K5DA 4JT4A 2BKEA 3RVBA 1FX0A 4UNRA 1HY3A 1NI3A 2W2XA 4EPTA 4TZ6A 2G83A 1AKEA 2JLRA 4D26A 3K70B 2QPTA 1E79A 2OO7A 2NPFA 1RKBA 1DPFA 1IY2A 3QJYA 3D6TB 4E09A 2VO1A 4TMVA 5FFMA 3X1WA 2GEUA 2H92A 4DXAA 3I3SR 5KPDA 1XJ0A 4O2RA 5J40A 2EYQA 4Q4HB 4RVCA 1DE0A 1XF9A 2V6JA 3VU9B 4TYWA 3LO5A 4LBVA 3SBDA 2NZJA 4QBFA 3Q5DA 1Z07A 2OFXA 2AK2A 2WKQA 3K09A 4H9GA 1E2LA 1NG1A 3CONA 1T0JB 4Q4AB 1E1RD 3PUVA 1A1VA 4WVFA 3WNBA 4CEHA 2ZAMA 1GM5A 4HLQB 3BXZA 4B6EA 2GJSA 4WZAE 4FI3C 1A5TA 3SJBA 2VP0A 1ZM4A 1L7VC 3LBIA 4FXPA 5DE3A 4DUGA 1UDXA 1NMZA 3EAQA 4HLDA 1NN0A 1KNQA 1YZGA 2B8WA 1FL9A 3RC8A 3FKSD 2I1VB 1ZIOA 1AS2A 4YDHB 4NL4H 1NY6A 1QHHA 2ZRBA 4NDZA 1WE2A 1VCNA 1W0KD 2V54A 2C03A 2FX3A 1N6IA 5DSZA 2GZDA 4PC2A 5JMTA 1OXXK 2H18A 1IXZA 1NIJA 1K8RA 1Y3AA 3QG1A 3IPYA 5CJPA 3RWMB 2W58A 3EASA 3B7GA 4TSFA 3PUXA 5KUTA 3KUCA 1GILA 3NXSA 4PAQA 1XJQA 3CIOA 2GILA 2UZIR 3LXRA 2J0VA 1KO1A 2G1JA 3OAAA 3QEJA 4Q1CA 4R2HA 4B47A 5IK2D 1N0VC 5FR2A 2O8BA 1QF9A 1ZUIA 1G5PA 1TU4A 1XEWX 1G3RA 3K9NA 3VKGA 1QHNA 3AP1A 4PHHA 1B0UA 2KB0A 4RFSB 2RHDA 4RCZA 4DIEA 3LDAA 4OHVA 1KDRA 2ZPTX 1I4LD 1OKKA 1KK0A 4MKIA 2GK7A 2VQSA 1E2IA 4YXWA 4EIWA 1T8UA 3Q5EA 1RVDA 2BCJQ 4RZ2A 5FUYA 4TYYA 2ZS9A 1F5NA 4JLNA 2IYSA 1A2BA 1YU9A 4JLDA 4TLEA 4P31A 2E9SA 3IUYA 3T1TA 1OH8A 1Q1ZA 3BWDD 4H1UA 1RJ9A 4B2LA 2KBEA 5KTYA 2FGJA 3L0IB 2I1QA 4QJ3A 1Z6AA 5F2EA 4C0QC 1N2CE 4FD2A 1FP6A 5J4KA 1AGRA 1MT0A 1D2NA 2E87A 3QVVA 2Q9BA 4DJTA 2KJQA 1T3SA 4L9SA 1C9KA 4Q7LA 1NSTA 3ASZA 4UXJA 2NTYC 3TSWA 4EPWA 3GEIA 1W2HA 2W2VA 3L0PA 4W9MC 1SXJB 3ZZTA 1XZPA 3IDQA 2WIAA 2HF9A 5KSOA 3P27A 1Z6YA 4LJ8A 4E22A 2GXAA 1E79D 2FA9A 3ZQJA 5SZJA 5LD2C 3AKCA 2CHGA 3FMFA 3G5UA 4LBYA 2CDNA 4LUCA 3QKSA 2ZI3A 1G18A 1MR3F 4TMTA 3BFVA 3AP3A 1JNYA 1XZQA 1DAEA 3DKVA 2G0TA 3MD0A 4N0EA 4V0ME 5DLQC 4WAUA 3BOSA 1E69A 4LHVA 1DS6A 2QZ4A 4P32A 1JI0A 3VNVA 1OIVA 1KSFX 4BFTA 2ZVQX 2ZRKA 4EQ6B 2VP4A 1QZXA 3KB1A 5KNDA 2F55A 2BM0A 3LX5A 3TAHA 1U0HC 3KQHA 2OAQ1 3FFBA 1MRSA 2FEMA 4HYYA 4C9BA 2F6RA 1TF5A 4QGAA 1KKMA 5JI2E 5FL3A 4A9AA 3ZVRA 2V3CC 121PA 4DLRA 4DUGD 2BV3A 5DISB 3LWNA 4Q4HA 3GLFE 3VU9A 4BGDA 1SVSA 1OHHD 1L8QA 5TARA 3QSYA 1C1YA 1CS4C 1G1MA 1MABB 1P3JA 4NP6A 5FI0B 3SJZA 4BFUA 1ZU4A 5C4MA 3T12A 3GLHB 5JRJA 2JJ1A 2QY9A 1G8GA 4Q4AA 5L8VA 2CL7X 3I32A 4TL8A 2C2HA 4MQBA 1M7GA 4RY2A 3TJZA 4F93B 5GJVC 2MSDB 1CJUC 2NO9A 1IXRC 1YKSA 3HR7A 4C30A 2WSSD 2VHCA 2IXEA 2RGNA 3IQXA 2OCYC 4Z8XA 3TR0A 5G3YA 2WJJA 1NKTA 2OSBA 4W7SA 4NKRA 1Z5ZA 5FBLB 2AD5A 4LV6A 2DWPA 4JLJA 4JSTA 4JLOA 1R10A 1W36D 1GKUB 1NBMD 3THXB 1T4GA 3OAAD 2R9VA 1EX6A 3K9GA 3QXXA 4L9WA 4JS0A 3HPQA 1E2GA 3DL0A 3WRXC 1F60A 2J3EA 3QPWA 3EARA 4CVNA 3NH6A 3ZZUA 1XB2A 1RPZA 1UBFA 4HI0E 2NZ8A 3NVAA 3WNDA 2IX3A 2ZUCA 3HP1A 4LYHA 4EKDA 1TF2A 1OKKD 1Z3IX 3LA6A 3U6BA 2QNRA 2Z83A 4LY6A 3SYLA 3AH8A 1KSHA 1KIMA 3L82B 3RS2A 1XX6A 3EA5A 1JPNA 2ZM5A 3SE0A 1AZSC 1BOFA 2ZJBA 5TY0A 4BECA 4PZYA 4NTZA 1DG3A 4WOPA 5AJZA 3IEVA 4PSKA 4RFSA 1S3SA 1A7JA 3LBHA 2CXXA 2PMKA 4YMSA 5B64A 3P32A 1X8LA 2W83A 1Z6GA 3B2EA 4KCGA 4M1KA 2F7SA 3FMIA 3W8RA 1Z0FA 1DADA 2IS6A 3NG1A 5E7MA 2BJVA 3EPLA 1U0LA 1YE8A 3PEUA 3WHKA 4EPXA 5C2JB 1ZBDA 1D2MA 2REXB 3HWSA 3MCAA 2G77B 1TQ2A 1OXVA 3H86A 4DIDA 3KUDA 2W0MA 3R8CA 1CJVC 2C5LA 3NBZC 2P65A 3KQUA 1KK3A 4DCUA 1NVUQ 4GL2A 2H17A 4KYIB 2FG5A 4Z54A 2D7CA 4C3ZA 1SVKA 1IQPA 4WXPA 2IYZA 4ZO4A 2DHRA 3PJRA 4YC7A 4JYCA 2XZOA 5DO9A 3CF2A 4XOIA 2P0EA 5FPHA 1S3GA 1OYWA 2GK6A 4Q7KA 4LJYA
chains in the Genus database with same CATH superfamily
3P96A 2BWJA 5JHHB 1M34A 3K70D 1D03A 5DBIA 3AYXB 2H1OA 5IULC 2BONA 4FZRA 1ZOPA 1GNTA 5F1PA 5GQSA 2OQRA 2XCSB 3MMSA 1N5MA 2NAFA 2PBFA 3EOBI 3EZ6A 2OXEA 3H13A 3IP1A 4RH0A 1TYBE 3KETA 4TN5A 3I5UA 2PH5A 4ZK6A 1F3LA 3G3EA 4AYWA 2WY2D 2LW7A 2QIOA 2XLCA 4BUZA 3RIGA 2C2ZA 2QRJA 3IVMA 3EUEA 1ONNA 3OC6A 4D56A 3DBRB 1JHRA 2QM0A 3L7IA 5CM8B 1FUUA 3QPCA 1HE4A 4NS1A 4CDRA 4TLAA 1L8XA 2V7WA 1U6IA 1ENYA 1QVWA 3L7OA 3M6FA 5TF0A 1E2UA 1P1KA 4OKNA 4OMCA 4XWTA 5BOVA 4AG6A 4NV0A 3GN2A 3QW2A 5AWFC 2QRMA 3AEZA 3BIOA 1LS6A 5DP1A 1RRGA 2GWHA 3WQHA 1SB9A 1ZS9A 3AX6A 1F6DA 2J9ZB 3UATA 3I2GA 3AUKA 2ZG6A 4CL2A 4P0TA 3T9AA 4X71A 1QV7A 1KGSA 3AF5A 5KC8A 1XZ8A 2OCDA 3DONA 3EGDB 4IDBA 5GV8A 4LWZA 1UKZA 5DM1A 4N7MA 4W99A 2HBRA 2HF2A 3ETEA 5E4TA 4EHBA 3NAMA 2ATEA 1K7FB 1YH3A 3LKVA 2FUKA 2NXWA 5L3QB 3RNOA 1KPGA 2W8BA 3D1LA 3FMGA 3SEQA 1AMNA 2MSLA 3NYIA 5B2ZA 4EG4A 2GETA 2DPLA 2JD2A 4GLOA 1Z9BA 1TKAA 4K8RB 2ERXA 3WMXA 1KAMA 2W2KB 2J0QA 3AF4A 3OI7A 4OD0A 1FNSA 1NQAO 4HNVA 2FE4A 1PFQA 2PYIA 2ZBEA 5BRAA 1IVSA 1IBLB 1E2HA 2IYTA 2VRCA 2QMUA 3OTWA 1V39A 2C0QA 4MO9A 5E6SB 4CTJA 1T9HA 3RVKA 2BSQA 2CCGA 4M2LA 2ZI7A 1VI5A 5LXTF 1NXWA 4N5DA 3J7AC 1P73A 2B1GA 2HSZA 3BERA 2VK2A 3KM0A 4LX8A 3ZCRA 1MAUA 3AR4A 1WDLA 1P6XA 2Q6IA 2YJ4A 4KODA 1E98A 5FNZA 2ORYA 4CI9A 2JASA 4IH9A 3L7DA 3L0DA 1PEKE 3V2IA 1OZHA 2PXHA 1VL0A 3KC2A 5T3YA 2CLLB 2W6IA 5D6OA 3CUSA 1JR3A 3MYYA 4IZ6A 2Q1XA 5LNK1 1VPVA 2QLNA 1Z7YA 3QVJA 4DE5A 2V7PA 4FCTA 3W9BA 1GYPA 1XMQB 2LKCA 4CRWB 3KHKA 5D8DA 3K5WA 3TPZA 3VYVA 2PBZA 4HQFA 4Y2GA 4PF1A 4MX8A 3DO8A 2JI9A 3WGLA 1HFJA 2P4HX 1M8PA 3D1VA 1FFBA 4KNYA 3PLAE 1EFCA 2W2LA 1HF3A 2WDPA 4TQGA 1KSGA 4DLZA 5GIPE 1AUVA 4MCIA 2VIIA 5DHSA 3WLNA 2V74B 3GEGA 4B3MB 3HLTA 1DBPA 4AZSA 1U8AA 4C0LA 2XUQA 1QKJA 3IIKA 1NVVQ 1PLLA 2WEKA 3KKZA 4HWOA 1MXHA 1JLLA 1R9MA 2B4KA 3E2MA 1SD5A 4N6NA 3EIXA 2YNMC 3FCYA 2H7VA 3AEQA 3HMKA 4LZAA 1A5ZA 1N7HA 3E3NA 2PZ8A 3WDLA 1PT5A 3CBGA 2P6OA 2OM6A 3FHOA 1JYEA 3LLUA 4WK0B 3QUSA 2DFKB 2Y05A 1YR9A 4I1UA 4ZVQA 3RAPR 1ZMRA 2HQBA 3WX0A 4RELA 1A0OA 1A3CA 4GC5A 4IXWA 2C4MA 2O5VA 3FR7A 5EYPB 3UG6A 4ZP1A 3DZ8A 5TQVA 1SVUA 1GADO 4LI3X 2XYHA 1WXEA 4TSRA 4N65A 3F6EX 1D1SA 1UR5A 4YMUA 1Z5NA 3PHBE 2F3PA 2WMNB 3KYDA 2GPWA 1KQ3A 3Q85A 4G2TA 4OKIA 2XYGA 5CX4A 4ZQCB 2OBYA 2YNMD 4GYKA 3AERB 3E6AA 3V1NA 4GGPA 2HLHA 4N18A 4CM8B 4UVHA 3CH6A 3COJA 4MKXA 3BJMA 5EMLA 3VNBA 3ZUPA 2MDTA 4YP5A 3B2NA 5MGNA 3OE4A 4TKMA 5JXGA 2ABWA 2PJUA 3NIDB 1LI4A 2XPCA 1N6LA 3WYCA 4MV4A 1Z4QA 3LHIA 3ZE9A 4XWAA 4LX0A 1QG0A 4JLWA 1HGXA 1J2UA 1L5ZA 5G3ZA 1XNQB 4GSYA 3E84A 2JLVA 2HXYA 2C4UA 2JFWA 1QKIA 1K7XB 4IQGA 4J9VA 4TT3D 3Q8WA 4MZDA 1A1SA 4JLUA 1OXTA 1RQNA 2G06A 4KYUA 3RRXA 4WBNF 1JU3A 3LFHA 2IW3A 2DBZA 3V32A 1V16B 1PJCA 3GA0A 4NBNA 5FWAA 3X2EA 3C6YA 4EYGA 4UE6A 4K87A 4HFRA 1RACA 1PJBA 2JKVA 4B45A 3BD6A 3N7AA 3TUIC 4HTFB 5B3JA 4E2FA 3CNNA 2DE0X 1CZLA 2YHIB 4S1PA 1YA6A 1R0SA 3BTUA 3DE7X 3OECA 2UUBB 1I6KA 4QYWA 5LOVB 4RD2A 2E85A 2B7CA 3AJ9A 3QMMA 2EF1A 2R97A 4D2IA 3G7SA 5L3RA 2JJMA 4L6CA 2C3MA 2D5LA 2HHJA 5AW3A 4MUGA 1EE2A 4EG3A 2RD2A 3ZCUA 2PAAA 3BICA 1NW8A 5EHXA 3GJZA 1R6TA 1XKTA 2FR8A 2VRWA 2QLBA 2XD4A 5D3ZA 3TAXA 2BFPA 4ZYVA 4UNNA 4W1QA 1X77A 2NT3A 4LCJA 3W1WA 4Y7CA 1GSHA 2QDXA 2RSLA 4BDSA 2BY4A 4K8OA 1STOA 2A35A 1UFRA 3PZRA 5A2QA 1SQ6A 3WFIA 2YMQA 4FDAA 2I6QA 2PWZA 1MD9A 3CRNA 3NBYC 4Y2UA 3TOVA 3V1YA 1EB9A 4O8ZA 1HWYA 2CNOA 1GPYA 3ETCA 4OXYA 3GQVA 4MAFA 2WU1A 1GP2A 1E6LA 3H9UA 1JEQA 1WTCA 1D9ZA 1KU0A 1U28A 1E1YA 4XLLA 1VLVA 2O2HA 1H1LA 1QO9A 5IMBA 3J81k 3BIXA 2D6FA 2YV5A 2JCSA 3R7FA 1XEFA 5ELMA 3VVLA 4LSZA 2VYVD 2XGGA 2D2FA 3N74A 3NEAA 3V7FA 5AKKA 3B6MA 4C06A 4BZPA 1I3OA 4E08A 3NTXA 4C14A 1KIAA 1QB8A 2W2LD 1Y0BA 4PG5A 4C6RA 4PX9A 3E5RA 1EDZA 3B1VA 3WDMA 3VMFA 1J21A 2P8SA 3ILYA 4FOSA 1QHHB 2GX6A 3ZZNA 2XRYA 2A8YA 1ICEA 3CCBA 4BXOB 2F00A 2HQRA 1II8A 2DBQA 2QJTA 2JJ8A 3FW1A 4IJMA 3FWHA 3WKBA 3IIEA 3C3KA 3V8NA 1TZMA 3NIBA 4EHHA 2AEJA 2I29A 2SKCA 4IMRA 4QC2A 2ATIA 3L7CA 4HB2A 5F21A 1L5HA 1DELA 2AFVA 1R1DA 1CUHA 2OUIA 5CTAA 3FSJX 4PC1A 4F84A 5JSUA 1G9XA 4L7VA 3ZG6A 4B6RA 4B5LA 1WLSA 3KJHA 4KU4A 5FTMA 3B9BA 5SZKB 4JI7B 4D4LA 2J09A 4RO0A 1YQWA 3T5GA 2G09A 3LMKA 4B73A 1T2VA 2JH9A 4DCTA 4EO9A 1QIHA 2CBXA 2I3AA 3LGSA 4AIIA 4KQFA 4Z9BA 1OREA 2XV1A 1ULBA 3CWCA 4HDSB 1GZ4A 4WXRA 3L7AA 5BW6B 5LMCA 4DR4B 3LZCA 1ZH2A 5F3WB 4ES6A 2Z9BA 3U7QA 2YOGA 3CFYA 5AMXA 2I8AA 3GJ4A 5IXJA 4B9AA 1R4NB 4J76A 2X7HA 3BE4A 5F5NA 4CMJA 3HO8A 4G24A 4BX9A 4DNQA 3A1TA 2HH9A 5CCBA 3QVXA 3IURA 4G9GA 3C41J 5L3SA 1TA0A 3TLZA 2VT2A 2PGOA 1IE3A 2FEOA 2JVKA 4OHWA 3ZS8A 4PX5A 1PGOA 1J06A 2JGKA 3I8XA 3JYOA 4FTWA 4YIKA 2QBYA 2WWXA 1C7JA 3O4GA 3T3NA 1PKXA 3K9QO 3A6ZA 1MQ8B 1TUIA 3E05A 4H7PA 4NZNA 4L3WA 4GOMD 1O03A 1OYVA 3KZVA 4RSRA 1N6PA 1NP7A 1BMDA 1PVVA 4KRGA 4EENA 3DLAA 2UXCB 3QKRA 3L01A 5DBHX 5K2MA 3HDHA 3BC1A 3RYHB 3KE8A 2FMIA 2Y1LA 1O6ZA 4F12A 4ENSA 3CKLA 3NBAA 5DULA 3B6EA 4J8PA 4QM7A 1CY1A 3ZZMA 3IV9A 3KDPA 2PLAA 3V9PA 1ULUA 3M1IA 4UBIA 1I6LA 2Y0DA 4N0QA 3W7BA 5JS8A 2Q8QA 1JQAA 4HSGA 3WMRA 4DBLE 2Q3CA 1R8XA 4KK3A 1TK9A 3WWOA 1I01A 1O08A 2QUKA 3SHWA 1U8TA 3B70A 5HNKA 1BCSA 4A36A 3BK7A 3U4QA 1KBQA 3QE4A 5G40A 3NDRA 4H3SA 1XZGA 1YQXA 4BAUA 5CEEA 3ORYA 4MTLA 3IVGA 4QO7A 1MX1A 5I9TA 4FKBA 2P4UA 4H31A 2CYBA 4Q3CA 1CXZA 4IG4A 5K4AA 3RQSA 5I8WA 4BO6A 1EIWA 1TA9A 2HRDA 3ANYB 4Q9DA 4YB8A 4B3BA 1E1MA 3AKZA 1WX1A 2BH9A 1AD2A 4GXTA 2RGCA 4JYPA 4L51A 1ULSA 4EJFA 3DLHA 2QVLA 5IHXA 1GR0A 1SCBA 2ZYUX 3EUAA 4QOIA 2AFHE 4GX1A 4NAHA 1A8IA 3A1NA 4BVGA 2OLEA 3GJ3A 3SC3A 5KOJB 2AMYA 3QU4A 1HQCA 3BYZA 3KT8A 1U2GC 3PG5A 3W1EA 4B75A 2FFQA 2FXIA 2EVWX 3OTQA 1XTBA 3IPLA 3OU2A 4A8JA 2OC4A 3WL8A 3PC3A 1VHLA 2EZ8A 5JH7A 2OKCA 4B44A 4DQUA 5ECYA 2NU9A 2QGZA 1NX9A 1Q1NA 1SXIA 3B8HA 2XWQA 3PA6A 4KNWA 4KRXA 1NBAA 4LF4B 3T4EA 2QLTA 3BB1A 4P81A 5JSFA 5CVVA 3L0OA 5IJAA 2PT5A 1NAHA 1K9SA 3I0ZA 2ECQA 2GAAA 3ENNA 1H2HA 4MTCA 3IXMA 3LKZA 1G8HA 3ISVA 3OUZA 1DJLA 3UH1A 4CU2A 2XEXA 2DERA 3TS1A 1QG2A 1VE9A 1EX1A 4JJZA 3GBSA 1R6AA 4IOLA 4RV4A 5G02A 2SECE 1EM8B 1GKLA 1RWQA 2FN3A 2C2XA 2I4NA 2PFSA 1W2WB 3DLBA 2GCOA 5FUVA 4RY8A 1Z35A 1Z36A 3QX8A 3R0IA 4TLBA 3OLQA 4C4YA 4EB6A 3UT5A 3OOSA 3U1BA 4JL8A 1XYVA 1Z4MA 4WDQA 1N33B 3MGCA 3PE3A 1WF3A 1RYYA 3GVIA 1TIKA 3AHGA 3TBHA 3D7KA 4P36A 1MU0A 3PT9A 4LF5B 2PSEA 4A92A 1C9MA 4BE9A 4NBRA 1E9RA 3NWJA 2FWRA 3I28A 5C31A 1QX3A 1GCGA 1P0FA 4RADA 4PSAA 4F56A 4LYGA 4FEGA 3WNVA 2XAUA 3SIXA 4RX1A 1HRKA 5EHZA 4I6JA 3HU5A 1I6MA 1KDPA 2RI0A 4NMWA 1ZMBA 2FZGA 3AG6A 4IW3B 5AI4A 1XRRA 4WGGA 2CLMB 2VR1A 2GNAA 1K1EA 2GA9A 2VATA 1U9IC 2J3DA 2VI5A 1OWLA 1LI7A 1PO7A 1TADA 3GG9A 3K1AB 1AQYA 1JSCA 2PL1A 2VS1A 3KOOA 3DQQA 2CL5A 5JQGA 2O1WA 1I7NA 3LIIA 3PCXA 3HKDA 4YV2A 2JLUA 4KDEA 2RGRA 4R0MA 1USVA 3CJTA 3KRTA 4N01A 1DAIA 4CF5A 3PNPA 5GOTA 2HMUA 3BD9A 5FTKA 1BFUA 1QONA 2IF0A 1T91A 1UF9A 3OICA 3PD0A 4HC4A 5A3VA 3V6LA 3TF5A 1N0HA 4G4IA 4MGYR 3GVPA 4OF4A 5L53A 3H4MA 2Q5HA 4DR7B 3A06A 3N8NA 1RC0A 3R40A 5ALRA 1V7QA 3L43A 2IX9A 3PX3A 1LPBB 2VAWA 1E4EA 4Q9HA 3SIRA 4FPXA 4S04A 1PHRA 4LG1A 5G0WA 3JWIA 4ZI7F 4YRSA 4PBSA 1AZWA 5K05A 3VAYA 2XGMA 4MR8A 4TUYB 3HNOA 1XCLA 3DV2A 3THSA 1P75A 1MAAA 5C8XA 4JELA 1O54A 1QQ7A 3UGQA 3LPDA 1O9GA 3DLTA 2Z2IA 2IEYA 5H70A 1QHEA 1YVUA 4JI5B 3SICE 3TUJC 3T1HB 4EJSA 2RAFA 4EL0A 3EXHA 4E1AA 5EXSA 2X58A 3ZQUA 4HNRA 3KHTA 2BM9A 2JIBA 3O95A 3R24A 2EL9A 1DEOA 4G1MB 2KBFA 4NDNE 4X20A 5H82A 3RRZA 4HGQA 4BKQA 2JAXA 2PHZA 3AOEA 3DTTA 4AN0A 4C20A 5BSRA 5JVDA 1J2EA 1L7AA 3MA0A 1FP7A 4B6JA 2DF8A 1JG2A 2FFJA 1VFNA 1WSBA 1PJ2A 3HE3A 1JNXX 3D6AA 4EGAA 4OV6B 2NADA 3C6MA 4CU5A 1WDKA 2V65A 2Q5EA 1YB1A 1U7UA 3M33A 1FZTA 1GCIA 1MB9A 4AP5A 5EIWA 4GSKA 4OQXA 4MVJF 2R84A 3UCFA 4UKDA 2IOFA 4YPFA 1Z74A 3Q0IA 4PPQA 1NQUA 1XTJA 4ZO8A 4QDOA 3LP5A 3ZHZA 4BYMA 3GNLA 1A72A 1IUNA 1L9KA 2YRXA 4OPMA 1AV6A 3FPCA 3K2QA 3RE1A 3SVTA 4BMNA 2IT1A 2IZ0A 3H5AA 1LBEA 2NMVA 1GZ5A 2Y27A 4P4LA 2WJ4A 4FFDA 2C9DA 2H9AA 2ISQA 2C8VA 2YJZA 1K86A 1KYVA 1OFUX 4GC9A 4BZZA 4D9BA 1J70A 3IDAA 1JEYB 1TA4A 4C04A 1EMDA 3HXOA 3QXJA 4C01A 1LGYA 2XA9A 2VZ0A 1M8FA 2L82A 3LVRE 1R5NA 1DDIA 3UQZA 5KKCA 3OTOB 4CBVA 4OREX 3FDZB 1T9GS 1Q22A 4B3DA 3ICVA 1EWQA 2NYAA 3A1WA 4Y9DA 5B58C 5J3JA 1W36C 3RRJA 5DK6A 3D6JA 3H0CA 4K3VA 3KZ1E 1A4UA 4RVHA 2VCYA 3OTIA 4Z8YA 4Y1GA 5IC4A 5C8ZA 3ZGXA 4DQLA 1XVVA 1KVQA 1E2QA 2XUGA 1HSZA 3JSAA 3LYUA 4JQOA 3KB2A 4B80A 2UYQA 1OIXA 2WZDA 3NHWA 5F3DA 3RU7A 3ZCVA 3FWPA 4FMCF 1U2RA 4UQPA 1BD3A 2Z09A 1FYWA 3UAOA 3IAM1 4OUDB 4LRXA 3WB2A 1S7CA 1JECA 5H81A 3MCWA 1EBFA 4YJFA 3T54A 2JHCA 1QLJA 5FEUA 3NP7A 1G21E 4ADSG 3BK2A 1AZTA 2NM0A 2QTBA 4XE5A 3CB2A 3ENQA 2YUTA 3M3DA 3KVVA 2P41A 1G8YA 4L8GA 3VSAA 4XWGA 5T5QA 1WUJS 2OGWA 5FLYA 1T5HX 5AR1A 4NMHA 5CW2A 3G0HA 3V7YA 1Q7GA 4I5IA 2FSGA 1YL6A 2CZQA 2P90A 4AMYA 4RPCA 2PL3A 1Z2EA 1AHHA 4CEIB 3FTNA 1XQ6A 4TL7A 4BO2A 1NIPA 1E3DA 2J41A 3H3JA 4QU0A 2R5WA 4XASA 1NXOA 1E0DA 2WFAA 5CDYA 1JF8A 4R8LA 5CW1A 1N9GB 2H08A 1HH4A 3CPEA 4GHWA 1G7TA 3QHAA 4YXWD 5JSQA 10MHA 4PZAA 2X19A 1WXFA 1M1NB 3IMFA 2DHCA 1PTKA 5BV8A 1IZ9A 5I7UA 2ZR9A 3V4VB 4D99A 3DDHA 2WPDA 2IHYA 5LWQA 4JU9A 5E6UA 3KTAA 1VKRA 2P7HA 4N5LA 2OB1A 2BGGA 4BMDA 2BEJA 3GVXA 4G36A 4ZPXA 4DSUA 4AJOA 2OB2A 4QG7A 1GA4A 1Y4SA 2VHUA 4H17A 4ZARA 5CEFA 5AKJA 2I2DA 3HKEB 1T6ZA 2XNHA 2Z04A 3CX6A 4IUDS 3TQRA 4BLSA 1QF7A 4G01B 4AFNA 1MDBA 3O3CA 5TMEA 2B61A 3CH7A 4HUQB 1E5LA 1MOZA 3GLIE 2AOVA 2KQUA 3LAWA 4I0WB 1KFBB 2FPKA 1G0OA 1K2VN 1P0IA 2X9NA 2ZJ0A 3MN1A 3TXYA 2QN7A 4ZGBA 1V41E 4J16A 1DG9A 1MOSA 4BNJA 4XVCA 2Q3DA 4X7BA 3T0GA 4EFMA 1WKBA 4YH1A 4L95C 5D3MA 1VHDA 1E7WA 5EKUA 5KYNA 5DNYB 1HNXB 1ZICA 3UMJA 4MARA 3RSSA 1KZ1A 5DXAA 3A3PA 3ROQA 4F6RA 1YDMA 5BYAA 5HPYB 2DPHA 1GG9A 3T4PA 4L5BA 4Y1RA 4JB3A 1Y9ZA 3GQBB 1C8KA 1F1BA 5KWEA 2V7QA 2AZTA 2GPJA 3CZCA 5IBPA 4RJTA 1UC8A 2VDVE 4EKYA 1DDGA 1F4PA 1UINA 1U31A 4OXQA 4EPVA 1OIWA 2NO7A 1I2AA 5HKBA 1Z6PA 3ESZA 3RT1A 5IMSA 5D7BA 1AQUA 1QHSA 1NQ5A 1JFSA 1A27A 1RQRA 2EBFX 2M6RA 3C4JA 5LSAA 1ZVVA 2LCIA 1M5RA 4C4ZA 5I7SA 4WERA 1PFVA 4O29A 4WBSA 4IIXA 3DTNA 1LNSA 1EWYA 2VAVA 1KH2A 2JGFA 2JJYA 3DDCA 3FMPB 3GLVA 3ED1A 4FXOA 4GVPA 4NR0A 4RMHA 4UBMA 5FI5A 3WIBA 5LXTB 3V7UA 4P5EA 2DQKA 3N5KA 2V9CA 2I7DA 2I03A 2OZLB 4X3OA 5TQJA 4M7OA 4BJ3A 2IBMA 1ZSVA 3EA0A 1CNEA 1S2NA 4J9UE 3W2GA 2DXIA 2HREA 4UNPA 3WHIA 4P3YA 3ZDDA 5KYWA 4MP3A 4QUAA 3DVAA 4KREA 1DCFA 1B16A 1RKQA 2ID9A 3RIMA 2O8DB 3M3HA 1YA8A 4CHTA 4JGBA 3N5CA 2P7IA 2TMDA 2YWGA 3KZXA 5AVYA 5DMHA 3IOMA 3L0ZA 2QN9A 1Y89A 1YZNA 4JXXA 4Y2YA 3AVVA 4TTPA 3PNLA 2YXBA 3QGMA 2C4VA 4RVOA 4YRKA 2B2XA 4FFRA 3R5KA 4OHKA 5FUBA 3AGPA 1S6YA 4XFKA 3GU3A 3CO5A 4GPTA 5KTKA 4RA9B 4GO1A 4HQLA 3ET5A 4JVLA 4LC1A 5C37A 3UJ9A 2Z8YM 3K0HA 1TM4E 1NJ1A 2PV0A 1DAKA 4ILKA 4MKGA 1K0FA 1Q1BA 2NVWA 3R7DA 4B40A 3NOVA 4QXRA 5EQDA 2Q3LA 2NTNA 3X43A 1J0XO 1BD4A 1CRZA 5F9FA 4FCCA 3DBHA 4RVFA 3LY5A 2JRCA 1FVHA 2XYRA 4Z7OB 5LWHA 3E1KA 3ZWVA 13PKA 2RGDA 1PAUA 5F78A 2BUCA 3R9XA 2AA3A 3MRTA 4J91A 1RWWA 1UEXC 5F64A 3LY8A 3DZFA 4ZVOA 4KITB 1WV0A 2EKBA 4NU0A 3FVQA 1SA0A 2YJNA 5DYIA 2IYYA 1TX4B 621PA 5FLXA 4GKKB 2O2YA 3O26A 1V5FA 4R1QA 4AJEA 2FKAA 2IPAB 2OP1A 4XUCA 3M49A 5L4NA 2C00A 2ZIWB 1BQ4A 1LKZA 1L1EA 3M6WA 5LLSA 4G0OA 4P4GA 4CIVA 3CW9A 1Z5VA 2C1ZA 2HEIA 2P9JA 3EIFA 2VSQA 2WPDD 5CNKA 5EWMA 2ZM6B 2GN9A 3DD1A 4L2IB 3FX2A 1RAGA 1UBKS 1KHHA 2ACKA 1OYOA 4B17A 3HJAA 4WHMA 2AK3A 3E0XA 4FQ5A 2M6SA 3RGWS 1RXYA 3JQFA 5J2UA 5BV0A 4HZIA 3HKCA 2PUEA 4URHA 1J33A 1P6QA 2QV7A 2YMPA 3CZPA 1VRWA 1Y80A 2OD7A 2PZAA 4PIPA 3VYTB 4EGSA 2B0JA 2R44A 3EXFA 3DWEX 4TV8A 4B33A 2W6CX 4AKHA 2F4NA 3DL2A 2FWIA 3CRQA 1Y5IA 3WZMA 5KOHA 3G88A 1P33A 1QGZA 5F1YA 2BBTA 3FGOA 3E48A 1PQ4A 2OGTA 2HRBA 3C5CA 3O93A 2X8JB 4FOPA 4GKVA 4R3UC 2FMUA 5CVEA 2PX0A 4MRRA 5SICE 3DNPA 4WBNB 2H85A 2IKQA 3H97A 3EAFA 4QECA 5B37A 5E3HA 2W4MA 2XMBA 1YS1X 4YK7A 1V11B 1ISPA 3HQ4O 3E9CA 4NBTA 5I4CA 1C30B 2B1RA 3GRRA 5IM5A 4ZCRA 2V7QD 3QXHA 3E9QA 3FSEA 1N0WA 3D54D 4QZVA 1QFYA 2A57A 4J2HA 5CT9A 4ERXA 4ZOAA 2B35A 1A8QA 1XDWA 1RAEA 3B1WA 4QXPA 1CIPA 5FO0A 4BMYA 4P92A 3GYBA 2HQ1A 1C3OA 2B82A 3I09A 4IVNA 4Z0TA 3W6NA 4DQVA 1NLFA 2GFQA 3HHPA 1Y1SA 2Z0MA 3H5TA 4PLPA 5DHPA 1B6SA 4JU8A 1OTYA 1Z33A 3GFQA 4R9UC 5ICMA 2QD4A 5F33A 4EFLA 4MVJG 3TCXB 4A8TA 2Y1GA 2PAFA 4ZZ3A 4JUBA 2ZE6A 2WYIA 3DWIA 3FD8A 2PGJA 3N2KB 1EDEA 4NK4A 3AEKA 3DBIA 2PRIA 2LE0A 4N49A 4C7XA 1CUIA 2WZCA 4GOXA 4DL9A 1P2VA 4J4TA 4REMA 4W1RA 3SHOA 5FJIA 5M7EA 1TUEA 4I1PA 3PFBA 3OLYA 1OPXA 3NIWA 1II0A 2PGDA 1SVMA 1I0IA 2OILA 4IDQA 4L0MA 3IBSA 4IIUA 3LLVA 4G65A 1AHIA 4Y2PA 4FR2A 1VL8A 4P86A 2ZJ3A 3TYXA 4K28A 2A4KA 1XQYA 5IVIA 4Q66C 1SOWA 4E3ZA 5LUAA 4HL6A 1DOZA 2XI4A 2WSYB 2GARA 5COBA 4DKXA 2ERYA 3DOIA 4HXGA 4CCWA 3K0KA 5BSHA 2FSVA 3EXEB 3OCYA 4L7QA 1JKIA 3B3JA 1XZHA 3UXMA 4XEUA 1TTPB 4LGCA 4GX5A 3RBXA 3K0FA 1YE5A 1GLVA 2YDYA 4QNMA 2XDWA 4B09A 4AO8A 2B0CA 5BT9A 1G19A 4GMDA 3OHPA 1E0SA 5EMMA 4UQLA 1VIDA 2R25B 4IXDA 3FOEC 3AHHA 1YJCA 4YCBA 1A9QA 4LZLA 3AUXA 2FPUA 3TWOA 3M1AA 2J5KA 2A5LA 5H3LA 4F3RA 5T8KC 4EH1A 4I6GA 3DTVA 3KWMA 3NEPX 1EK5A 2H1WA 4P7KA 5DV9A 5BN5B 3UKJA 2VBGA 3FLMA 3WBFA 1V9CA 3NTUA 4ND5A 3HDYA 1KTIA 1AUPA 4TYQA 1BMTA 4ZAWA 3DPSA 2WAYA 4OHPA 1YCFA 4G1FA 2W98A 3C3WA 3P2OA 2H2HA 3QXGA 5CH5A 5GP1A 3RKUA 2Q9CA 3Q72A 4GP7A 3RSZA 3U39A 3ZXYA 1V6AA 4DJAA 5JAOA 4H0FA 3TRKA 2Z57A 3MS4A 4RU1A 3F78A 3AB8A 3I04A 1V8ZA 5JC8A 4PZZA 3SF8B 4X85A 1LBSA 4CFSA 1OD6A 1X14A 4N41A 4G5XA 1QAQA 2Y2UA 2J9YB 1E9VA 4UD6A 2O8CB 4HLCA 2GO1A 3DP9A 5LYYA 4MUAA 4QBTA 4BGIA 2O7QA 2OV2A 4JLPA 4K6KA 1GPDG 1NOKA 4KFTA 4RW0A 2WF6A 1W9HA 4MNTA 1MV5A 1E2NA 1AM4D 2A5JA 5TQ2A 3VV2A 2HWXA 4XFJA 5HA5A 4P22A 5TMPA 1GUZA 4RSGA 3PFNA 4WKCA 5LU9A 2GVDC 4QX6A 3QENA 4DLLA 2WV7A 3BD8A 2BTEA 4HAUA 5G4KA 1RLUA 3C4VA 5C7OO 1TMYA 1N2HA 4NAVA 4AM8A 2OECA 4IIHA 3SOZA 5MN5A 5BSFA 1MQSA 1ND5A 1Y4UA 2IS4A 4RHXA 1VL2A 2PRSA 4S1OA 2OZPA 3I9LA 1Q1GA 2X0NA 4H7EA 3FWNA 1J9EA 4D25A 4LXXA 3HJTA 3PDIB 4WKPA 2DULA 3T3PB 3NT4A 1MIOB 5BQ5A 4G5RA 3GP3A 3R5SA 4ITRC 3RHFA 2GVZC 1B3RA 3PQDA 2AE1A 5F3RA 1BXGB 1N32B 3BSWA 4IFTA 3WL4A 1TCCA 5EPEA 4JBIA 4ND4A 1H4TA 2EZTA 3VU8A 3WQQA 4YMTA 4XVQA 1G0NA 2QQ5A 2NYRA 1FP2A 1ISFA 3VX4A 4BJ5A 4KBYA 3ZDQA 1SU4A 3I1IA 1WB5A 3A10A 1CRWG 2RHGB 1QZUA 1GL9B 3ZWQA 1WXIA 3E2IA 2CMKA 2EQBA 4PTLA 4FGLA 4OJQA 1COZA 1X7ZB 4QULA 4ZWNA 4OX9B 1BQ3A 3ZDEA 2EWMA 1I8TA 1NBWB 2BFOA 1C1XB 3DHWC 3F3KA 4NE9A 4WN9B 1QRRA 2C61A 3KSUA 2A5GA 3WLHA 3H4IA 2GZHA 1JA1A 2PRKA 3JQ6A 3TKLA 2ZSDA 4KIUA 3L9XA 2ZROA 3D3WB 3G9TA 4WGFA 5EN4A 5FD8A 3V8MA 3ZU2A 1GA1A 3HPRA 1NP3A 4UM9D 3U3ZA 4ZEXA 1GSAA 5FX2A 1IAVA 1G4HA 1KJWA 1XVAA 1TM1E 3C6QA 3HBFA 3QP9A 4HXYA 3ZK8A 1DQZA 3GT3A 3PC8C 2VUTA 2BD0A 5BV1A 4QOHA 2PCJA 3PWSA 3DH0A 1W0KA 4NBUA 1T3HA 1UEJA 1NQXA 4UVDA 5BMVF 1CEEA 3FYHA 3OURA 4M8IA 4OK3A 4LCEA 2R7NA 4NZOA 4GD3Q 2WG0A 2OXFA 3VH4A 3ZN2A 4BX3A 5FV4A 1ZI8A 2O0LA 1NJ5A 3R7SA 4MGHA 3Q7RA 4X66B 4AU1A 3OOYA 1V1RA 4YI3A 1JIVA 4EGFA 2Q5IA 3A1DA 3JAKB 3LF1A 3EA4A 3PPIA 5BR8B 4EUHA 3HXTA 3GG2A 4Q4DA 1J07A 2CZCA 5EESA 4E5KA 2BEUA 1UCFA 1RI2A 3IERA 3HB0A 3LQKA 3PR3A 4J1NA 4K9OA 1BN7A 4LVCA 4YCAA 4X60A 5HDBB 3WIDA 1TNDA 1UJMA 1JHYA 1W52X 1T24A 1WHTA 3H9BA 3MG9A 2R6R1 4GNKA 4PHTA 5JBNA 5TIIA 3V7WA 1O5IA 2B30A 2VKTA 3CVJA 2FK7A 2G82A 1YE3A 1ENZA 1ZL2A 3TW0A 3WKDA 3V2HA 1DO8A 3GX1A 4X1IA 3AESA 3OEED 2NV6A 3OY2A 2R79A 1E1QD 1AU9A 2FP4A 3ETHA 5AK0A 3T5MA 2MR5A 3H2IA 4QUHA 5IDXA 2WRZA 2CKMA 4CI0B 4OQQA 1PGNA 4I2NA 4M38A 5KHAA 4DUPA 3K16A 3AB7A 4YT5A 2CLDX 1RYEA 1TCBA 4P54A 4TTRA 5EHQA 1E4VA 1TU0A 1T36B 1UAGA 1QE5A 2FSFA 4H7DA 2I6UA 3M4XA 1ZH0A 3S4YA 4F6RB 5C8DA 5CB4F 4P0PB 1OWPA 3A6JA 4FFBB 3NNDA 3NYRA 4ZIRA 4W5TA 4JZKA 4L28A 5LYJA 3QUQA 3FYUC 1DRKA 1GT91 2ZSBA 4YJ2F 1R74A 1TPYA 3LLCA 1P81A 4OK6A 5CYGA 4PN7A 3VVBA 3QU9A 4P4SB 1E6KA 2HNAA 1EK1A 1HDRA 3MJVA 3BH7A 2C20A 2O07A 3NEJA 2PUGA 4MDEA 2M2IA 4B48A 3LFUA 9ABPA 2KI5A 1PL0A 1UEIA 5J63A 3OFKA 1S8FA 4PHCA 4ZOLF 2O7VA 3VDMA 4Y2RA 4AKSA 3RJTA 1DPGA 2ZE7A 2HSEA 2LDBA 3REQA 4CCYA 2C84A 5BURA 1BDBA 4MW7A 1NA5A 4WCFB 2RKOA 5LQNA 4C2UA 1E3MA 1ZUNB 2WKRA 4S35A 4ZI7B 1OBOA 4JCCA 1S4QA 2FLWA 1VIYA 3ZDRA 4U7JA 4XRRA 5LA6F 1PUXA 3HCDA 2RK3A 4ZAFA 3QOXA 4NC9A 3UJ8A 1N0IA 2AMVA 1E1LA 1ACMA 1X39A 3E1GA 3NJ8A 3SC2A 2PMWB 4HQNA 2RCYA 3RW9A 1DAOA 3NKVA 4TPKA 2DPMA 5IX8A 1U8EA 3GEEA 3V4ZA 1P8AA 3X0DA 5C7LO 1TYDE 3I58A 1U5CA 5B55A 3O73A 1SB8A 4LRQA 4V02A 1OLSB 1RTTA 3FA2A 3ZC3A 2Q0XA 1JKMA 3KTDA 3EDOA 1YI8A 2NTJA 3EXIB 2Q0HA 3IQIX 2O1SA 3EGXB 1YAHA 2I4MA 3I01A 3OPVA 3NBXX 2B1QA 3A4YA 1E3QA 4K6CA 1W30A 2D7JA 3F49S 4HG2A 4B8ZA 2HWUA 1ORWA 3JTEA 4IJUA 1NRIA 3WJAA 2VHWA 1G55A 3PEFA 1I33A 4A6XA 2WVAA 3C2QA 2OV6A 2WD9A 1Q0ZA 2HA2A 2QUZA 3BT7A 3KAQA 1QIJA 2QA5A 3TLCA 2I76A 3L1IA 4EYSA 1CU1A 3UJPA 4D82A 3HB1A 3S2GA 1TI7A 3VPGA 3SDZA 3ZI0A 3MHPA 1HFWA 5TB5A 1WCV1 5TNXA 2QTTA 5IJ0B 4B74A 1T8SA 4QGGA 5CUQA 1GRQA 3M4YA 2YW9A 1P9NA 4DDVA 3M9XA 3IO3A 4L85A 4DQ0A 2C7OA 4EYEA 2JAWA 1BXRB 4H4EA 1L3BA 4I14A 4ENUA 2E21A 2YWCA 2IELA 2X7JA 2Z1NA 4Y9UA 3KJZA 4J29A 1VTKA 2G28A 1IJBA 2UXDB 3IVXA 4NHEA 5EQTA 1E2DA 4EI7A 2F8LA 5BV7A 2HTFA 4HEJA 2XCLA 4W5JA 3GJ5A 4GM4A 3CGWA 2X1MA 3NGXA 1YHNA 1NBMA 1O87A 3OH8A 3OZXA 4ZEWA 1CUAA 2I0FA 5DM4A 1GAEO 2NO0A 1ML3A 5IUKC 4BRUA 4FW9A 4WCDA 1GL3A 4HN9A 1FRVA 2ZBDA 5TGDA 3N53A 2FMHA 1XZCA 1N9KA 2PLFA 4OJKA 2ZSJA 3FNIA 1LDYA 1KHTA 3EISA 2EJCA 3G0IA 2BKVA 1N9ZA 4BGUA 1LPMA 2VHVA 4ZYWA 4FMCB 3BF8A 1CE8B 1CR1A 4JT2A 4DN6A 1OAOC 4C29A 4BMCA 5PNTA 4IOMA 2BEVB 4TTIA 1M1YE 3N2GB 4CCSA 5FWYA 2VXYA 2D3WA 4MGIR 4ABYA 4MYCA 2DBRA 1NJ8A 3DMFA 3QTBA 1QTNA 2R8RA 4M60A 3ZR4B 2QUIA 5FOTA 4PXAA 3SVLA 1IWOA 1N6NA 3COPA 3EZXA 4L16A 1W59A 1QR6A 2PN1A 3IP7A 5GJCA 5A9TA 3GRVA 4REQA 3SN6A 1V95A 1VI2A 4D4IA 1OQAA 2FV8A 2ODWA 2RCNA 3D59A 3GNSA 3T5BA 4AJKA 4ZV4A 1E0KA 1TTTA 4GVXA 4H0NA 5ALFA 1H5NA 4MA0A 2GXUA 2B25A 1YFLA 2YIMA 1ZVJA 3II6X