2REXB

Crystal structure of the effector domain of plxnb1 bound with rnd1 gtpase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
176
structure length
171
Chain Sequence
RCKLVLVGDVQCGKTAMLQVLAKDCYPETYVPTVFENYTACLEQRVELSLWDTSGSPYYDNVRPLCYSDSDAVLLCFDISRPETVALKKWRTEILDYCPSTRVLLIGCKTDLRTDLSTLMELSHQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSEKSIHSIFRTASMLCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/lipoprotein
molecule keywords Plexin-B1
publication title Crystal structure of the effector domain of PLXNB1 bound with Rnd1 GTPase.
rcsb
source organism Homo sapiens
total genus 58
structure length 171
sequence length 176
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2rexB00
4TLCA 1Q20A 3DKPA 4IDNA 4WW0A 3H4MA 2ZM5A 4G5GA 2BBWA 1MKYA 5TDHA 4I4LA 3E2IA 1E2EA 4NCNA 2QTHA 2A9KA 3EA0A 4NHOA 5HKKD 1T5IA 2G1JA 3SJCA 3LFUA 1AS2A 3CO5A 1H8EA 2P5SA 3T5DA 1E0AA 4RKEA 3WMGA 4KODA 3RS0A 3VNVA 1KI7A 3PFIA 4IW3B 3U44B 2F7SA 1XD2A 5CLLA 5JSZB 5HE9A 1Z5ZA 2DWPA 1G19A 1WMSA 4ESVA 4I1OA 3RYTC 2XTMA 3ZVNA 4Q7LA 3IEVA 4BQSA 4XWAA 3K70C 1Z63A 2R9VA 1U98A 3THYA 1G3QA 2IS4A 4TT3A 2ZJOA 4Q19A 3NEYA 4E07A 3ZD7A 4FWIB 4LHXA 4A2QA 3QPWA 3I72A 1S2MA 2KI5A 2B8WA 1EGAA 2OZEA 1DAFA 1N3BA 1E32A 3FMPB 4DHEA 1KO1A 4JKYA 4Q1BA 3OIWA 1NLFA 4LBVA 4MDFA 5ANRB 4L5BA 2N42A 5JJIA 2ZRGA 2CCJA 1P7CA 3QKRA 3WBKA 3WYGA 4DEXA 3I8SA 1E1QA 1CTQA 1F48A 1E2KA 2OG2A 1QDEA 4PPGA 2JDIA 3CPJB 4HEJA 2QE7D 4LJ9A 2AD1A 1QHSA 1NLZA 4BUJA 3DO6A 1CLUA 1R5NA 3AKYA 3PR1A 4B6EA 2UVQA 4UNRA 1TMKA 4BLSA 1J8YF 1U0HC 4QJ3A 1GKYA 4BFWA 4BEBA 1E2DA 4DT1B 4ZDIA 2BMJA 1E69A 2GRJA 4IEIA 1KI1A 1KJYA 2GCOA 1JAHA 1YU9A 1G7RA 2ANCA 4Z51A 1T8TA 3F5FA 2XJ4A 5FUYA 2O8EB 4B3XA 1KHTA 1Q12A 2EFEB 4DSNA 2HV8A 2BM1A 3S1AA 3NBYC 3QPUA 3VR4A 1EWRA 3SQWA 1W4BA 2C98A 4HATA 2ZYTX 1II0A 1OH6A 1S4QA 2NG1A 4QGGA 3LBHA 4UJ3A 3EZFA 4M4SA 4M1YA 2AL7A 3I73A 2DFTA 4Q4AA 1GDDA 3N70A 2XB2A 4X8LA 3JVVA 2NO0A 1CULC 1L4YA 4K8OA 4PO8A 4D4LA 1UAAA 1VCOA 4JIMA 5JFGA 1GG2A 2IYLD 3NBXX 4OQMA 3MG9A 1OKKD 2OESA 2RKOA 4KFTA 4Q02A 3RRZA 3HYRA 4LOAA 1FPMA 1XD2B 4V0KA 3ZS8A 4AKEA 3CX6A 1KY2A 1AZTA 4RFSA 4GL2A 5LB2A 1Z06A 1WE2A 2ZRJA 1JJ7A 2SHKA 4WXPA 3ZVLA 3PEVA 1EFTA 4LY6A 3GMTA 3U4QB 4MRVA 4ZPXA 3THYB 5J40A 3AVPA 5HKKA 2G88A 3AB3A 4DCSA 2J0SA 2PLFA 2HF8A 3KKOA 5KO2A 3GLHA 4Q66C 3GLGE 1FP7A 1AS3A 4P3YA 3MLEA 2OSBA 4TN1A 4BZPA 3D7MA 2ECKA 3PVSA 4UJ5A 4HLCA 4TWZA 1DAHA 5FOTA 4P4UA 3QKRB 1XU4A 2LCFA 2QAJA 4A36A 1E0JA 3GLIA 1R0WA 1N6HA 5EUMA 2KWIA 2ZUCA 1KNQA 5FPYA 3CX7A 1EFRD 3K9NA 4LZZA 4YMWA 1TNDA 3LXXA 4CIDA 1FZQA 1Z08A 1G8GA 3KKNA 1BKDR 2J0UA 4M1WA 1U0JA 3SEAA 2NPIA 4N1AA 5JBQA 1ODFA 3T35A 2ZETA 3K0EA 4PO9A 1W7AA 3CZQA 2HYDA 4QFMA 4UNPA 1SXJD 1XCGB 3WNBA 3AM1A 4OJKA 2R62A 4WA7A 5F3WB 3DPUA 4E09A 2V1UA 3S1AB 1XMVA 3IIMA 2R8RA 1YZQA 4KYIB 5AWFC 2JASA 2ZYWX 2Z4SA 4JJKA 1TQ2A 5TMPA 2O8CA 3VR5A 1Z8FA 1HY3A 4HZUA 4OQXA 4U5XA 3WMEA 4IHQA 4WBSA 1M7BA 3RS2A 3ND8A 5GJBA 4LYHA 4MKHA 3T1OA 3LV8A 2X2EA 3K53A 4Q4AB 2F3RA 1YR9A 4X8OA 5LBIA 3CRW1 4R2HA 5KSZA 1G3UA 2ZE7A 1E2IA 2WWHA 1NMYA 1E9SA 1X8KA 3R7WA 2WWWA 1IN4A 3OAAD 4RY2A 2QMUA 3Q85A 4ACBA 1G5TA 2FSHA 2WKPA 4NDZA 4TMTA 3GJ7A 5KDDA 4RFSB 1KSGA 4DBLC 1RE0A 2GAAA 3IILA 2IWHA 1E99A 1XEXA 5FBVB 1AGPA 2FPKA 1W47A 4K46A 4P32A 5EP2A 4DLUA 4PSKA 4LYJA 3LLMA 4BPBA 2XNDD 4HB0A 1GILA 4GOXA 5KNBA 1OFUX 3B1VA 3GLHB 2QRZA 2BCGY 4RCYA 2P2LA 4LWZA 5H1YA 3SBEA 4YDSA 3U3JA 2IYZA 1NN1A 1WRBA 2AN9A 4ZCMA 4TTRA 1G8PA 1OKKA 5H68A 4RKFA 4FI3C 2O8DA 3AF3A 3SJZA 3GLIB 4GOJA 4Q7MB 4IDHA 2CL6X 4L8GA 3VNUA 4RD6A 4IOMA 1NN0A 5DYGA 2VTKA 5FOXA 3OIYA 2H7VA 3HPQA 4HDQB 5C2JB 1KOFA 3LW8A 3A1VA 3R20A 4F7WA 5G41A 3IQWA 4N3NA 3E70C 4JBWA 2J0UB 2A5YB 4D82A 3QQ5A 4R2IA 2H57A 4NCKA 2VLIA 5JMTA 4BFXA 1UBGA 3TH5A 1GAJA 3U6KA 2EYUA 3QF4A 1W0JA 1P2VA 1A7JA 1HA3A 1E2QA 1D8TA 2CNWD 2JLXA 4HUTA 4LHZA 2O8CB 3KJIA 2QP9X 4HZUB 5FR1A 3WMFA 2ZS7A 3CRRA 1HEIA 3VR6A 2BC9A 2GXUA 5AR1A 4LC0A 5SZHB 3SS8A 2PJZA 1GUAA 2B8TA 1SQ5A 4TTQA 3K0FA 3VR2A 2GK7A 1Z2AA 2J0QA 4PHHA 3QE0A 2IXFA 1KKMA 1NJGA 4KV9A 1P73A 4TSFD 2VRWA 4L16A 4URUR 4FW9A 3AVUA 4W5JA 3EA5A 2HJGA 3R7WB 3EAQA 3EZ6A 4TYPA 3GJXC 4PSVA 3THXA 1RIFA 1LY1A 3LBNA 1IN6A 4UNQA 4YMUA 2P65A 1KI9A 2ONKA 2ZIAA 1XEXB 1G5RA 2E1RA 3L2OB 1E1RD 4GFDA 3IIJA 1ESNA 2AXNA 4NCHA 1M6NA 1X1RA 1QHIA 3A1SA 1W4RA 3IIKA 4M1MA 3PUWA 1JBKA 1S9DA 3SN6A 1SKYE 3VHXA 3KKQA 1W5SA 4URZR 3B5JA 3ZVRA 1CU1A 3NH9A 2AR7A 1EXMA 3BXZA 3NH6A 3L8YA 3OAAA 2O52A 1YHNA 4LYAA 5HZHA 1E0SA 3B8HA 2LKCA 2P6NA 4CW7A 3UPUA 2EFDB 2O8DB 2WM9B 1W4AA 4OBEA 4WXRA 1SVMA 3MWKA 1JXOA 3KJGA 5FPTA 4IOKA 1N5LA 821PA 1TU3A 4EPYA 4C0SA 1KDPA 4Q1AA 1ZM7A 5JWHA 1II8A 2Z0MA 4Z8XA 1E79D 4D81A 4QL3A 5BN3A 2OLJA 1XEFA 4JYBA 1MO3A 1II9A 1NI3A 3DZDA 5GADl 6Q21A 4C9BA 1QRAA 2QP3A 4Q1FA 2V9PA 3QF4B 4L9WA 3ZDQA 3ZIAA 3PUXA 1NG9A 4URXR 3V4FA 2GZHA 3QVUA 1OJLA 3QENA 4KYUA 3REFA 4MA4A 1M7GA 1DAMA 2GJ9A 2PMDA 5KNDA 3K0SA 4TZ0A 1XP8A 2WJHA 4D0NA 4AK9A 5LPNA 1P9WA 4WZ6A 1M34E 1IOZA 1ZIOA 1P9NA 3K0FB 2IC5A 1GIAA 4HB3A 4PO1A 2P6UA 5GJWC 1G21E 4JT2A 2YWEA 1MV5A 1NRJB 4TMZA 5L3SA 1LF5A 4UXHA 2RHMA 2FG5A 3FKQA 4TL8A 4ZIRA 3QXJA 1QVRA 5D3QA 2WWFA 1G7TA 5CDFE 5EXPA 2QEQA 5DGXA 2GNOA 4M22A 1NY6A 2CNWA 4A15A 2FOLA 1NVXQ 2E87A 2ZE6A 2EVWX 2RGNC 1W1WA 2HEIA 4V0ME 2WTUA 3OESA 3KZ1E 4DDUA 2F3TA 3SDZA 4AKIA 4BFVA 2Z43A 421PA 4BECA 2DY1A 4LV8B 3OF5A 1FP6A 1TF5A 1GL9B 3NVAA 2QTFA 3UIEA 2J59A 4YMTA 3NBZC 4F38A 3BH6A 4HDCA 4MKIA 4Q03A 4OHYA 1XTQA 4A8JA 1E2PA 3C5HA 2IUTA 2MSEB 3GFOA 3P1JA 1K5GA 5FPSA 3SYNA 2FSGA 3FMIA 4NU0A 4JS0A 1FMLA 1RYFA 2GA8A 2H92A 4XWKA 2OUKA 3K9GA 4Q4HA 1XZQA 1E1RA 5M04A 2IYVA 5A0FA 4W5HA 3B6EA 4PZYA 2GVZC 4LJ5A 5CB6A 1II8B 3WRXC 4L9SA 1SZPA 2VSFA 4M2LA 1DTSA 2IT1A 1VG1A 2ZR0A 4JT4A 3A8TA 1OIXA 2F55A 4F4CA 2ZROA 1ZW6A 1LV7A 2XSZD 4D4KA 2ZRHA 5BXQC 1QHGA 4B6FA 5CLQA 2J41A 4EJSA 3PEYA 1NY5A 2VP0A 4Q5IA 4QGAA 3P26A 1M2OB 2NTYC 1KNXA 3MWLA 2XTNA 4EDHA 3C14C 3BD9A 2IS2A 4RD4A 1FL9A 1YR8A 2BHRA 1YZLA 4MGIR 5FUVA 4LHVA 3GLFA 4RJLA 3JZAA 1TUIA 3SU8A 4R9UC 3I92A 1GVNB 2J0VA 1E79A 3HR8A 3C5CA 2BKEA 4HI0E 2D62A 3WY9A 4AIIA 5EE0A 1XTIA 1VCMA 2E9SA 4V0OA 5L3SB 1AKEA 2XAUA 2RAPA 1OIWA 4B47A 2ZRKA 3K09C 3LX8A 4POAA 4RD2A 5AJWA 3IBGA 5EZ5A 5IDVA 2V6JA 1IJEA 5C1BA 1PVOA 3RRNA 4IRUB 4DCUA 3IGFA 1KO4A 1XCMA 1NIPA 1Z22A 2ZR9A 4OHWA 4OI1A 2UKDA 2ZREA 2O8BA 4X8MA 2BV3A 1HT2E 5JHHB 3ADCA 2OCPA 5C4GB 3VAAA 1ONBA 3LDAA 2QN6A 4ZKEA 1GITA 2IF2A 1CJMA 3B85A 4TMKA 4FMCB 621PA 3NKVA 2DWQA 1Z0IA 1Q1BA 3A1WA 5FH9A 1E2JA 3QXCA 2QA5A 2OCBA 2JJ8A 4C0AC 3WNDA 3T1VA 1AKYA 4CT4B 4A8JB 4EFMA 2FSFA 4US1R 1TPZA 1IY0A 4GMXA 5E7MA 5GJVC 1I2MA 1RPZA 4LV6A 1DVRA 2AFIE 4Q4HB 2PZGA 1RW4A 1QZXA 3HWSA 2EFHB 2C9OA 1DBSA 1WF3A 1Z0JA 1W44A 1ZM4A 2QP4A 2ZRCA 3ASZA 4DUGD 1KAGA 1OYWA 2BKUA 3A1TA 2VPPA 5EXXA 5BYJA 1PLLA 1U9IA 3UWKA 3X1XA 2IYWA 3K1JA 4FD2A 3T61A 4EJSB 2QQEA 1AM4D 1UBEA 3BWDD 4IDOA 4DDTA 1NVVQ 2R6AA 1DEKA 1KJZA 2WICA 4MRPA 1N6PA 4P4SA 1BYIA 4RZ2A 4W5WA 4DLYA 1LS1A 3NC0C 4F92B 4FN5A 1E9CA 3FTQA 1TEXA 1U8AA 5DI9A 3CRVA 4DSTA 1CBUA 1R0XA 3GLFB 5BYKA 1JPJA 4A4DA 4DDVA 4B3CA 1R7RA 2OE2A 2H17A 2FE4A 2YOHA 5FTLA 3FMFA 3TUJC 3GEEA 1FQJA 3GJ8A 4YC7A 1KDRA 2QPTA 2XSZA 3B2EA 2QSZA 3LRPA 4CRWB 4MGYR 3SE0A 4DDWA 2JGNA 2IS6A 3QKUA 1KMQA 2O5VA 1E1QD 3C41J 1KJWA 3BGWA 4ITRC 5DI3A 2ZI7A 4W7SA 3AUXA 3V4RA 2O8BB 1H65A 4I1UA 3LO5A 1HQCA 4LPSA 1E4YA 3KQHA 1NKTA 1T0HB 2FFBA 3KXIA 4B2IA 2D06A 2ZAOA 1KI6A 4XH9B 4CT5A 2ZUBA 4GRAA 1JXMA 2PT5A 4A6XA 4Q9JA 4E22A 3K0AA 3LVRE 2JEOA 5J4LA 4F4IA 2CLCX 2Z83A 3AKCA 2GBLC 3TIFA 3N2EA 1XF9A 4AYWA 2J5XA 5G3ZA 2GHIA 2YJTD 2ZI5A 1IONA 2J7PD 3NWJA 5TY0A 3OEEA 3TBKA 3CBQA 1ZD9A 4MITA 2JLQA 3SI7A 1UKYA 3W5IA 4V03A 1IXSB 4QGHA 3CH5A 1PUIA 2ZJ2A 3M4YA 1G8YA 4NP6A 4HLDA 5FR2A 1C9KA 2DPXA 3CUEF 3QY0A 3ZQ6A 1XPOA 2GDJA 5KPJA 3E1SA 3I1FA 1R6BX 1S0UA 4Q9KA 4TYNA 1QHNA 2PX3A 2XJ9A 3CW2A 1GP2A 1GFIA 4C4PA 1XD8A 3TSWA 4OI0A 1NF3A 3QF7A 1NBMA 2D2FA 2D4HA 4GMDA 1ZINA 4LJ4A 4M9QA 3QBTA 5DIFA 2OILA 1FNNA 1ZYUA 3G82C 4KI0A 3JZMA 1XMSA 4P4SB 3HU1A 4BFZA 2QPAA 4YONB 4KFUA 3B1ZA 2XITA 5DE3A 3TE6A 4ZKDA 2FPMA 4RD0A 4I1VA 1OXUA 2VO1A 2ZJYA 3DOEA 2X8AA 3AF1A 3TR0A 3W34A 1GM5A 2C04A 2CXXA 2PJRA 3BS4A 2ZSFA 1VYUA 3GJ3A 1S8FA 1SGWA 3U3OA 1BMFD 1P4SA 4DUGA 1KY3A 4ESHA 4FMCF 2AXPA 3T1QA 4DB4A 2OBMA 4KSBA 2IYYA 4NE2A 1ZM9A 1XPRA 2F1IA 2ASEA 4EPXA 3QXXA 3UKDA 3AVYA 5DI3B 2CE7A 2ORIA 4PPFA 3VTKA 1Q44A 1ZNYA 2I1QA 2VP2A 5DH9A 3T34A 1TEVA 1X8JA 1Z83A 3LVQE 2ZQ5A 2RH5A 2IWRA 1EWQA 2WWGA 3HYTA 1PZNA 5CK4A 2WJGA 2FDCA 3KJHA 1OXVA 5CYOA 4KSCA 1OE0A 2RGBA 2GEVA 3K0AB 2QM7A 1UBFA 4ABYA 2ZRAA 2ZXUA 4MYTA 2ATXA 3REGA 3B60A 3T1TA 4O2RA 2RGAA 1YRBA 2K5UA 2YWFA 3TSOA 5J4KA 1W2HA 2OM2A 3C16C 1UJ2A 1CJUC 3TW8B 3UG7A 2NO9A 3DZ8A 4Q7KA 1Q21A 3GJ5A 2WHXA 2J9RA 3BOSA 1S96A 5EE1A 1HE1C 3AQ4A 5JRZA 5KUTA 2ZAMA 4XTCS 3SJBA 4EIWA 1IN8A 4GNKA 4US2R 4FINA 3U3KA 4TLAA 4HLQB 3C7KA 5EP3A 3I5XA 1KI8A 3A36A 4QRHA 3TQFA 1ZUHA 4BLRA 1WQ1R 5HPYB 4BLOA 1F2UB 3KJEA 2DB3A 2V7QA 3I62A 3P32A 2J7PA 3CLVA 3LAWA 3FE2A 3ECCA 4O0MA 1G17A 3OE7D 4JLBA 2WIBA 3W3AA 3VHLB 5FOUA 4TQAA 4TL7A 3QEOA 1AK2A 4IVRA 1P62B 2JLSA 3LXRA 3TKLA 3KFVA 3G0HA 2IS1A 3BFVA 2EYQA 2ZJZA 3X2SA 1OB5A 1IM2A 1ZAKA 2N1BA 2VHTA 2WV9A 4M21A 1NL3A 2JAQA 4LBZA 4B76A 3B1YA 2W2VA 4I1SA 1S1MA 2F9LA 1Z6YA 1J8MF 5AJZA 3GEIA 4Q00A 2B7CA 2QM8A 3AKEA 1VDZA 4FCWA 3KQKA 2D2EA 5B2ZA 2H18A 3Q7PA 4NYJR 1G3IA 1GNQA 4JL8A 5FL7D 2JLRA 2DWOA 3QPVA 4YXWD 4UNNA 2DHRA 3IO5A 2GXQA 2OHFA 1CKEA 1N5IA 2R2AA 4HAZA 4A6PA 3GLIE 4TLDA 4LSGA 1G6OA 3K09A 5FOVA 1E6CA 2EFGA 2R6GA 2WAYA 1ZCAA 1ZNZA 2WSMA 3QG5A 3B7GA 3DMNA 1JECA 1Z29A 2A5DA 2ZRBA 2Q21A 2ZE8A 2REOA 2XB4A 2PCLA 3PUZA 1BMFA 2QROA 2WWXA 2ZTSA 2OXCA 1N6KA 4RZUA 3TAHA 3FKSD 2JLYA 2GZAA 2PMKA 2C99A 3LLUA 3ND9A 1W0JD 4Q1DA 1QF9A 4HDOB 3TK1A 2XGJA 5JI2E 5LD2B 4RD1A 2PX0A 3A6PC 4D6PA 2OCYC 2IYUA 4A2WA 3BRWD 3EWAA 4ILEA 4PPNA 4OYHA 1ANKA 2QSYA 5BWMA 3ZZ0A 2EU8A 1QHHA 4GOKA 3RVBA 1MH1A 1V5WA 5EZ6B 1KO5A 4BASA 1PLKA 2YYZA 4HAWA 1GRNA 1FTSA 2WVJA 1BS1A 4US0R 5C4MA 3AP3A 2QT1A 1K5DA 4OHZA 4LGMA 3WP1B 2QORA 5FTNA 2XZLA 4NONA 2GCOB 3ETLA 4D25A 3K0CA 4O3MA 3VR3A 3TUZC 2ZRMA 3RC8A 1E2LA 4B75A 4B74A 2HCJB 2WJYA 2IA5A 3IKJA 3EPJA 5HZKA 3G5UA 1DAKA 4QGFA 4YLGA 5B58C 1TQ4A 1YQTA 4HZIA 2BEKA 1CIPA 4LBYA 3GLGA 2TMKA 521PA 2G77B 3HPRA 1G8FA 5P21A 2BM0A 4MRRA 3FFAA 2REBA 4RD3A 4IEEA 1E96A 3UG6A 4QXAA 1IN5A 1SKQA 3H0KA 4XTRA 3I8XA 1G6HA 2WJIA 3K70D 1GKUB 1SVKA 2GEUA 5SZKB 1SVLA 1YZUA 1JR3E 5B57C 4D4JA 3QVVA 4OI2A 3IPYA 4ZCLA 4PFSA 1Q3HA 1WCV1 3OE7A 5FPHA 2YINC 1NVWQ 4V02A 1RFLA 3L43A 5KU1A 1ETUA 4LJ8A 1E3MA 1NSFA 1SVWA 3EARA 5IRCD 2IXEA 3Q5DA 4JSTA 3PENA 1NKSA 1PUJA 2AK3A 2GCNA 4PC7A 5FTJA 3LY5A 2ZRFA 3L0SA 4DRZA 1VECA 4DLSA 1XJQA 3H1TA 1CF4A 5FI0B 1U99A 3HU2A 3QKTA 4LV5B 1OXSC 1M74A 1QHYA 4JL5A 1P61B 4M9ZA 1D5CA 3BBPA 4J0QA 1J90A 3TSZA 4DB2A 4P0TA 1AA9A 4JLPA 4Q9LA 1Q22A 5FFMA 1S3GA 2DFKB 3OIVA 5FL7A 2HLDD 2QGNA 3FWYA 4YXWA 2HT1A 3ZIAD 2A3RA 2ZSBA 1KK3A 2GBLA 4ZI3A 1XEWX 1ZD8A 4DLZA 4CGZA 2J46A 2VHCA 4Z8YA 3BFXA 4B3GA 2FSIA 2ZJ5A 3FHCB 2D3WA 2IHBA 1OFHA 1F6BA 3U5ZB 3AP1A 2XEXA 3CPEA 1QHHB 3P4YA 3RRYA 4B43A 4CF7A 4GPTA 1FOEB 3ADKA 3RSOA 3IUYA 1VKJA 2VHQA 1XXHE 3FKSA 4XWOA 3QXHA 2R6CA 3BIFA 3W6OA 2VEDA 3A4MA 3WXMA 3KUDA 1SXJE 5IF9A 2JLUA 3Q72A 5E7IA 1CJTC 5EUQB 3TVTA 2X77A 1X6VA 4GP7A 3TR5A 2HT6A 1XTKA 4AY2A 2WMNB 2J87A 5BW8A 5CITA 3CF0A 4EPTA 3L82B 4G5SA 3GLGB 3NDPA 3D31A 2AWOA 1ZD1A 5JEDA 1KZGB 1XNJA 2ZS9A 2VHJA 2WAXA 3IDQA 2A2ZA 3UANA 3UK6A 2GJ8A 5JRJA 4B3BA 2GXSA 4IOJA 2O0JA 4LJ6A 5ELXA 4M53A 4QBGB 2V1XA 2W6JA 1KI3A 1IN7A 1W2GA 4H1UA 3RRMA 1DELA 4IXMA 1ZC4A 4FMDB 3U3RA 2AKAB 4ZO4A 1P75A 4GSYA 4CYMA 3SQXA 4EUNA 1Z6TA 4BFSA 1AN0A 3LX5A 4OQLA 1TADA 3QKSA 1UF9A 2PEYA 3EIQA 4C0KA 1JI0A 1G8HA 1WP9A 2YKGA 1G64A 4RVCA 3CWZA 1A5TA 2PBRA 2QPOA 4HAXA 2NO6A 2V6IA 3PITA 3R8CA 1GNPA 5AUOB 5DN6D 5JHGB 2GCPA 4A0FA 3KQLA 4OK5A 2AKYA 2W2XA 1CEEA 1S3SA 1RRFA 1DARA 2WMOB 1XTRA 1YKSA 2QNRA 2QZ4A 2ZJBA 5JCPA 1CP2A 4C0HA 1DOAA 2NO7A 4XOIA 5C18A 3OFNA 2AFHE 4C2TA 2XNSA 3CX8A 5L3RA 1NMXA 1T91A 4BLQA 4QKQA 1EESA 3GFTA 1FTNA 2OEPA 4PHGA 5KYKA 4PSAA 3JVUA 3L0PA 4ARZA 1JALA 3A58B 3AVVA 1LS6A 4AYXA 2F1JA 1RRPA 2QAGC 3VU9A 1VHTA 5GJCA 5FL3A 1DS6A 3WHLA 2P6RA 2HLDA 1GNRA 1KI4A 1HTWA 4FCTA 1Z6GA 1TAGA 1DO0A 5J47A 1CR1A 1GSIA 4UNSA 3SC3A 2IYQA 1Q57A 2BDTA 4A9AA 4ZDKA 1UPTA 2JATA 1CR0A 1E9BA 2YVUA 3E5HA 2I3BA 2XTZA 4TL9A 4TZ6A 5JI3E 4TMWA 4UXIA 5E7JA 2IEZA 2QMEA 2QENA 4KLNA 3U3MA 1ZIPA 2IYSA 3F0TA 2MSDB 3Q7QA 4JLDA 1B23P 1Q1ZA 3BAFA 3P27A 4PZLA 2OFOA 2ZI9A 2CHVA 2ZEJA 1R0YA 3QBVA 5KNCA 4G0NA 4JBXA 3THXB 5AJYA 1FFHA 2DBYA 4A92A 4LI0A 4Q4JA 5HCIA 1VPLA 1ZM2A 4UKDA 3R9WA 4B71A 3ADDA 4TMVA 3CM0A 4PTLA 5KOYA 1FNMA 4HSEA 3Q8XB 1G3RA 2ERXA 1T4GA 5A4JA 2C77A 3QKSB 5JJKA 1E94E 4MRNA 3V00A 4IVQA 5G40A 4Y0VA 5J4VA 4S35A 4HUQA 3R9XA 2CJWA 3SFVA 4YDHB 2ZSEA 3K70B 4NMMA 5FBWB 1OT3A 1HH4A 1TF2A 2QI9C 4A1FA 4NCJA 3MJHA 1JPNA 1G7CA 3FVQA 4DLXA 5JECA 3AV0B 4C30A 2GXAA 1N6RA 1OHHA 3ZZUA 4JVNA 3FMOB 2CHQA 2VL7A 2V55B 3O8BA 4HLUC 4IKEA 1U8YA 3I4LA 4BFYA 2GTPA 3EWSA 3FFBA 3AVQA 3WYAA 1Z3IX 3SHWA 1K8RA 5HCNA 1PV4A 3OEHD 2ZITA 1W49A 1G3MA 2ZPTX 5JJLA 1ESMA 2VP4A 3AVOA 5CDFA 4YMVA 3GJ6A 1N0UA 4BLTA 4OQNA 2PH1A 3DMDA 4ARZB 4BRWA 3PXGA 2X19A 2CLSA 4KHZA 4OKSA 2QL6A 5DN6A 4U00A 3VU9B 3PQCA 3ZGXA 2D74A 4FCVA 3H86A 4ASUD 2WZQA 2ZR7A 2AWNA 4V0MA 1IAQA 2V54A 4FMDF 2X1VA 2AHOA 3D6TB 1KK2A 3PUVA 4IFEA 2XX3A 4MYUA 2IYRA 4AKGA 1DAEA 3TJZA 1UBCA 1WXQA 1M1YE 2RGDA 3NHAA 4LHWA 2C9CA 3KKPA 1UFQA 5CM9C 2OXRA 4DLTA 5B64A 2ZJ8A 1EX6A 1E2HA 3EASA 2RMKA 4ZIRB 2UZ3A 1OLOA 4BZXA 4DCVA 3OEED 2WIAA 3WRYC 3DVLA 1IY2A 4Q9HA 3LBIA 1XJCA 2ORWA 1XJ0A 4NKRA 4Q4JB 4CEJA 3W3ZB 2JJ1D 2VHUA 5DYIA 5HE8A 2B21A 1ZM3A 3CNNA 2J7KA 3ZQJA 2J3EA 4DCNA 5IK2A 2HJVA 3CB4A 4JVLA 4DC9A 3VKWA 2HDNB 4E03A 2Z6VA 1YVDA 3FB4A 1UKVY 2JJ2A 2RGXA 4H9GA 4JVMA 4TYQA 3Q5EA 4CEHA 4NPHA 3ZJYA 1R2QA 4PQYA 5KSYA 4HUQB 4C7OA 2CJWB 3D3QA 4I81A 1NBMD 4Q21A 4BRUA 4WIAA 3FPAA 2GWHA 1TX4B 1KYIA 1GTVA 1XTJA 3MAAC 1E9FA 2B6HA 4QBIA 3X1DA 2XXAA 4GZMA 5KHOC 1OYYA 1BO6A 1VHLA 3AP2A 4R71A 2ZSDA 4R7ZA 3A4LA 4JJZA 1ZCBA 4MYHA 4A0RA 4PANA 2VH5R 2O0HA 3VX4A 2BCJQ 1Z0KA 5J5CA 3OHMA 4M1TA 1QVAA 4QNMA 2WPDD 1TF7A 3EPLA 1RYHA 3VR1A 1F3OA 1I4DD 2ONJA 4LPKA 2XZOA 1U2RA 2H8KA 3HDTA 3OZXA 3H84A 3UWOA 2KB0A 3B1WA 1A2KC 2QTVB 2ZRLA 3NEJA 3ZYCA 3CKLA 4DLWA 3CR8A 3SYKA 3X1WA 1OFTA 1Z0FA 2QQ0A 3AGQA 1VMAA 4EAQA 2VBCA 5GVRA 5AUQA 3IO3A 1Z2CA 1E2NA 2NZ8A 1OW3B 1N6OA 2C96A 4LRWA 4Q18A 3KB1A 2FA9A 2YWGA 3OEHA 1OH8A 1D2MA 1W4CA 1YZNA 4NBSA 4Q01A 5CYPA 1TQDA 4G5OA 5FBLB 5G3YA 1VTKA 1IXRC 3BH7A 1PLJA 3GFPA 4MH0R 2WKQA 2WWYA 5JS8A 2CVHA 4KXFB 5D3MA 1T8UA 4EFLA 4ASUA 2G6BA 3MWYW 1WB9A 4TTPA 4CEJB 1W0KA 4OI4A 4JBYA 4PAQA 3RNLA 4KFSA 1O87A 3GCGA 4IOLA 3VKGA 3AF0A 1JEDA 2PT7A 1IHUA 3U61B 1HURA 1A4RA 1MRSA 4GI7A 4FXPA 5EQTA 2AK2A 2MMCA 3CNOA 5EXTA 4CEHB 4M8NE 4C7OB 1CJKC 2G1KA 3C8UA 4G5RA 3WNCA 1LW7A 1OV4A 2A5GA 5EP1A 2Q0HA 1W48A 4PC6A 2V7QD 1MO5A 2WBLC 4HYYA 2QY9A 4D0GA 4URYR 3UXMA 1B0UA 2MMGA 2ZRPA 3KTAA 5AUNB 2XXAB 1VG8A 1P6XA 1EFUA 2JJ1A 5JCZA 1SVOA 2I1VB 1MO6A 4XVQA 1Y63A 3F3YA 3W9YA 4F4JA 4PX9A 4DVGA 4ZDJA 2A5FA 2DFNA 5LB4A 3PG5A 2N46A 1ZVQA 2CMKA 1DADA 2R6FA 4WZBE 3CRQA 1KSFX 1MRNA 2QMOA 2P3SA 4NYMR 4RCZA 4XD7D 5DISB 1ZU5A 3TLXA 4YQFA 3FGNA 3NDBB 2FJUA 2Q9BA 1G16A 1RJ9A 1AQUA 1N6IA 1Z28A 3B78A 4X8HA 3DOFA 3T12A 3W8RA 2C5LA 4KITB 1AIPA 2JIZA 5FBQB 4B3DA 1BYUA 2W58A 3LD9A 4ZCIA 1Z0AA 4NH0A 2HXSA 1A1VA 2LKDA 3R8FA 1F2TA 2CDNA 2G0TA 2GKSA 4EPVA 2W0SA 2ZVQX 4TLEA 2A5JA 2YNMA 2QAGA 1X3SA 3KUCA 2R6DA 4FIDA 4M9SA 5L3QA 1R8QA 4JMPA 1G291 3QEJA 3SFZA 2REXB 2ODEA 2BBTA 2WOOA 4A82A 2WPDA 1J70A 3UMFA 1OSNA 1HV8A 2BVNA 4D2IA 4IJMA 2H1LA 3T5GA 4QHYA 5J4HA 4WVFA 2FZ4A 4QJ5A 1E9EA 5D3MB 2GAOA 1JR6A 1KO8A 5JZVA 4HAUA 2WSSA 4NYIR 3CF6R 1JQJC 5EJEA 1N5JA 3BB1A 2ZU0C 5F2EA 1E9RA 1SXJC 1YRAA 1U90A 2OBLA 3BERA 4KO8A 2W6IA 3U7EB 1VG9B 2IF0A 3BORA 5FUXA 2HYIC 2QRNA 1DG3A 1KI6B 3Q9LA 5JLJA 5FI1B 3LQQA 4BGDA 1E2MA 5J4YA 2FX3A 5CIQA 3CZPA 2RGNA 1XMIA 2RGGA 1DO2A 3CWQA 2KBFA 4U02A 2WJVA 2VP5A 1N5KA 4TYWA 4M1KA 4R98A 5EE3A 2IHYA 4E5UA 1YJ5A 1YR7A 4MKGA 1G20E 3BH0A 1EX7A 1T3LA 1W5TA 1X8LA 2MSCB 3KTAB 5EE5B 1RRGA 2FFAA 3TQCA 4HAVA 3P4XA 3ZLJA 3U4QA 121PA 2WWIA 4URVR 2BJWA 4JLKA 1JNYA 4JSYA 3AVTA 1A2BA 4NZYA 2NZJA 2F43A 2PL3A 2VQSA 4NYJQ 4Q48A 2CL0X 5EXSA 2OO7A 2ZI6A 4JLNA 5E95A 4Q9IA 3KL4A 1QBKC 2GK6A 1I4TD 1C4OA 3GD7A 3ZD6A 1UEJA 4D4MA 4HLUA 4GZLA 2ZRIA 2BMDA 1RKBA 1RJ9B 2FGJA 4WAUA 3KQUA 4CDGA 4QM6A 4OQFA 5A5GA 3LWNA 4PAOA 2C78A 2I4IA 3W90A 5CM8B 3AUYA 4LBWA 2P5TB 1F2TB 4B2LA 5E3HA 4IDPA 1FMJA 2QAGB 1P2UA 3EZ7A 3N5CA 3J81k 5L3QB 1T9HA 3W6NA 4B48A 2JLWA 1E4VA 4BFTA 3O8DA 1L8QA 4C0LA 1UM8A 2OFXA 2GETA 4XD7A 3BB3A 1ZBDA 3GLHE 1VCIA 4B44A 3I61A 1DAGA 3TRFA 1N25A 1LF0A 1OXTA 3BB4A 3BE4A 1OB2A 1NN5A 2ORVA 3EZ9A 4KVAA 1KO7A 2O8FA 1Q1EA 2V8OA 4MYCA 2JCSA 3SHFA 2FNAA 5H8WA 4XSGA 2EWVA 2W83A 2JA1A 1IXZA 3T06B 2XOKD 2FH5B 2O0KA 4AG6A 2NGRA 3EPHA 3P20A 1KZ7B 5DNYB 1JR3D 3SYLA 2BIFA 4MGZR 1D9ZA 1EFCA 1GL6A 4BEJA 3RSLA 4LJ7A 1MO4A 2ZANA 3BJIC 1J2JA 3HR7A 1SHZA 2ZS8A 3K8YA 4IFBA 4FMBB 3ZZTA 1LB1B 3UATA 3CR7A 4OHVA 5LDDC 2XZPA 1M8PA 2Y8EA 3CPHA 2BWJA 1VYVA 1SULA 3RS7A 1QG2A 1OF1A 2F43B 4A8JC 4B3FX 4LDJA 3SZRA 1KIMA 2KJQA 2X2FA 4TMXA 3ASYA 1X86B 5AK0A 4QBHA 4EPWA 3ICQB 4H1VA 1UKEA 1T3SA 2CHGA 2WKRA 4MKFA 1TTTA 1KK1A 2V4ZA 4K81B 4AD8A 3D8BA 5K8TA 5AUPB 2ZUDA 4XVRA 4C2UA 1P2TA 4RFVA 3L8ZA 1W36C 4B35A 2W6JD 1LTQA 3LA6A 3KXKA 1NP6A 1G18A 3NXSA 1JAIA 2QMHA 2W2TA 4PC1A 1KKLA 2ANBA 4AWXA 5F9FA 5FBRB 4CEIA 2IYXA 1KMHA 2G9NA 4EJSC 5JWOA 5CK5A 4PPQA 4JZKA 4D26A 3TUIC 1RRCA 1XRJA 4M1OA 2DR3A 4JKIA 4Q1EA 2Q3FA 1N2CE 2DCUA 2FMXA 1JJVA 2IK8A 3IPXA 3VQTA 5SZJA 4UQOA 4KBGA 4RZ3A 4B2PA 4TYYA 5DO9A 4TLBA 1U0LA 1PJRA 4EPRA 2Q3MA 4QNRA 2J1LA 4C0BA 3X1ZA 4JLAA 1X1SA 3I3SR 3F8TA 2OBNA 2NOAA 1BOFA 5DSZA 3L0OA 5KSPA 1DE0A 4NCIA 3UMRA 2QE7A 3CRMA 5CIWA 2O8FB 4JL6A 3GQBA 2BEJA 2GJAA 4DIEA 2FGKA 1Y3AA 2C95A 1ZC3A 4N0DA 1CXZA 3OFND 5EP4A 4B34A 3Q3JB 2EW1A 3HJNA 2PZEA 2YOGA 5F98A 1ELOA 1F60A 4ZV4A 2A78A 5FOWA 2YZ2A 2Z5FA 4DKXA 3AF2A 2BMEA 5L8VA 3CF2A 1NNEA 2Q9CA 2QGZA 4L4UA 3A4NA 4C0JA 3W6PA 1XFAA 2GVDC 1XZPA 4QOSA 1CRPA 1ZRHA 4LJAA 3IHLA 5DLQC 4PQFA 4WOPA 1XPUA 4O25A 1TU4A 2OT3B 3CONA 3VMFA 1FUUA 1Z0DA 1ZU4A 2BMFA 2F1RA 2VSXA 3WHKA 2XOKA 4PAMA 1IJFA 1E9DA 2NQ2C 4RSGA 1OXXK 4IXNA 4CZ2A 1E9AA 1JR3A 3EW9A 1OH7A 1L4UA 1ZJ6A 2QBYA 3QJYA 4O2LA 5FUWA 2G0NA 3SJAA 3ICEA 2FFQA 5K8IA 1EK0A 1CRQA 4MRSA 4DSUA 2A30A 2VSOA 1QG4A 1WDTA 3KDSE 2QUZA 2ZU6A 1QHXA 1U9IC 5H70A 2ERYA 2ZVPX 1P3JA 3KKMA 3QI2A 3NG1A 3RS4A 2HXYA 3ZH9B 4CEIB 1KMHB 1RVDA 2FN4A 3DDCA 3N2IA 3RWOA 2GJKA 5SZIA 1XEWY 2FFHA 2VF7A 4ZI2A 4KFRA 4QHTA 1P9RA 4L15A 1AGRA 4MDEA 3EIEA 2F6RA 1NIJA 2GEDA 3MUFA 3VFDA 4GBMA 1TUEA 1FUKA 2Z4RA 2PZFA 4QBFA 2UZIR 3U2QA 4DXAA 3PIRA 4XSHA 5IT5A 3M1IA 2QU8A 3M6AA 5K8UA 2YC4C 4U7DA 2H5EA 3EZ2A 1A82A 1LNZA 3CIOA 3NBFA 3B1XA 3R9IA 1M7HA 2CBZA 1OHHD 3NIBA 3C15C 3QOFA 1O3YA 1US8A 1JEEA 1EFRA 1YE8A 3U7GA 3U7FB 1WBDA 3AKDA 3MMPA 5TARA 2Q3HA 3MSXA 1E2GA 2B92A 1XXHA 1ZNWA 1CR2A 1EG7A 2PEZA 4KCGA 2YHSA 4F91B 2ZRNA 4DCTA 2AD5A 2WJJA 4G3XA 3ADBA 2HCBA 2DFLA 2IXGA 1SXJA 2C03A 2ZI3A 2YV5A 2P67A 5BN4A 4LCBA 3V9PA 2HF9A 3KB2A 2IBMA 1KTVA 3FHTA 4DZZA 2R65A 1F5NA 3IQXA 4JLJA 1N6NA 1KI2A 4LJYA 3AH8A 2ZYUX 4OL0A 5TB5A 2JLZA 3NC1C 3DM9B 1JQLB 1IQPA 2GF0A 3M0EA 1VYTA 1W36D 3C4JA 2QG6A 3B13B 1P72A 2BJVA 3QXSA 2IEYA 2P0EA 3AEZA 5KPDA 5CB8A 4OK3A 1J99A 3SR0A 1OH5A 2VYFA 2D7DA 4MUAA 4EFNA 4Z1MD 1BH2A 4LK2A 1AZSC 2QBYB 5FOSA 4GT1A 3DEFA 4D0LB 5FPKA 4PZZA 1T0JB 5DHAA 3X1YA 1R5OA 221PA 3MFYA 3THWA 2A7QA 1UADA 3A1UA 4BE7B 1I2DA 4Y0AA 1DAIA 2GESA 4ON9A 3B82A 3MRSA 2XNDA 3AF4A 4GP6A 5TVKA 4AG5A 4B32A 5IK2D 3NTUA 1K6MA 1MOZA 1R8SA 2ZJAA 4PC3A 2ZRDA 2CVFA 4HAYA 2Q9AA 4ACAA 2JJ2D 1U94A 1KGDA 4G5QA 1XTSA 4ZDWA 1FX0A 5L3VA 4B73A 1Z6XA 1CS4C 1SHKA 3EPKA 4BLPA 1GWNA 4XIGS 2OV2A 4II7A 4RZXA 1R5BA 4Q1CA 5BN5A 3WYFA 3QIAA 3BC1A 1AS0A 2GJSA 3MCAA 1US8B 1HQYE 3DL0A 2NO1A 1VCNA 3BFKA 2QT0A 1XXHB 3TVDA 4XVUA 2J45A 5B30A 1BIFA 2RGEA 2CEAA 1SXJB 5K8LA 1UEIA 3KFXA 1CJVC 1ZUIA 3SNHA 4JLMA 3PEUA 4QJ4A 2GZDA 5FTMA 4YMSA 4FWTA 3RAPR 1J7KA 1N0VC 2OLKA 3PCRB 1D2NA 2FU5C 2OAQ1 2CK3D 4PC2A 3RHFA 5HR5A 1XDBA 3LQRA 1XBTA 3B9QA 4M9XA 3SOPA 3GLFE 1OFIA 5HTKA 3MJRA 3TGPA 1IY1A 5LD2C 8OHMA 4DLVA 5TXGA 3O8CA 4TSFA 4PQRA 4W9MC 3EC2A 4JLVA 3CNLA 4BFUA 1KK0A 2W0MA 3PV0A 4WZAE 1ZMXA 2VA8A 3OIUA 3THWB 4QHSA 2C8VA 1NMZA 1NN3A 1GRQA 4UXJA 4A0GA 4JVSB 1U8ZA 2BBSA 4QM7A 2BOVA 1W0KD 2EFCB 1VG0B 5BQ5A 1I4LD 4Q7JB 4EQ6A 1Q1QA 2NIPA 4JLOA 3AVWA 4MQBA 1D9XA 1SKYB 3PEWA 4OJQA 2YC2C 2ODNA 2YWHA 2EWWA 1H8HD 1XX6A 4AI6A 3DHWC 3FDIA 1Z07A 4XJXA 4P31A 5AJXA 3RABA 3KX2A 1YR6A 4Z1MA 1SVIA 1FX0B 1HUQA 2EQBA 1XD9A 3O8RA 1MT0A 5KDLA 3EX7C 1OIVA 4B33A 5JWRA 3L0IB 4G01B 1UKZA 3QG1A 1GOTA 4LYFA 4IVPA 1ZNXA 2NPFA 2RB4A 2ODBA 3RS5A 2ZE5A 3MD0A 1G7SA 4MGKR 4AKHA 3EXAA 1YZTA 2KBEA 2W00A 4TQUS 4Z54A 1AJEA 1TQ6A 3T15A 1KDTA 1RZ3A 1NVUQ 3EIHA 1GL7A 3GP8A 1EFHA 5EE9A 3QNUA 2H16A 4PHTA 3QSYA 2RHDA 3U60B 4AURA 3H2YA 1KAOA 1VIAA 4LX0A 4DLRA 2KSQA 3FYHA 1Q0UA 4D80A 4BWYA 2ATVA 1P60A 1GKIA 1T3HA 1G4UR 4OHXA 4S2EA 4AYTA 4OK6A 3HU3A 1DG1G 2FPLA 3K9HA 3LH5A 3MGCA 1AQYA 1KSJA 4KVGA 1E98A 1UDWA 2FV8A 2JIZD 3VX3A 5KTYA 4A2PA 4HB4A 1G41A 3IEUA 2PCJA 1C1YA 1V43A 1LFDB 1VIYA 4URWR 3IBYA 4QG7A 1YZGA 4C3ZA 4DWJA 5DHFA 1COWD 4DIDA 4PHFA 3DM5A 1XCPA 5GVSA 4JYCA 2AX4A 4BZQA 3AGPA 3PUYA 2OCAA 1T5LA 2OFWA 3LNCA 2G3YA 1XMJA 1FQKA 5JS7A 5IHPA 5CJ2A 1OPXA 1MABA 2IW3A 2OAP1 3TW4A 3ZVMA 3I32A 2F1HA 2WSSD 4HB2A 1CR4A 1GZSA 1P2SA 5AJVB 5E4FA 1W46A 3RDPA 2CK3A 4EQ6B 4GDFA 2L0XA 4Q47A 2W6ID 3K0CC 5KSOA 721PA 1W36B 1U81A 2IL1A 4KJZA 4P4TA 3EC1A 3BK7A 3O47A 1N0WA 3UMSA 5C46F 1H8ED 4M1SA 1IBRA 3B9PA 1KSHA 4TQ9A 3IHWA 3GEHA 3MWJA 5UKDA 1E2FA 2FWRA 2VIIA 1R0ZA 5CJPA 1Q3TA 2BBOA 2ODWA 1HT1E 4NTZA 3RWMB 1ZUNB 3TNFA 4N0EA 1D2EA 1WA5A 2YOFA 3TMKA 3W5JA 4CVNA 1G4AE 4V0NA 2F9MA 3A37A 3RC3A 3ONWA 3WP0A 4NYMQ 4PXAA 4DSOA 1RC8A 1E0KA 1WBBA 1Z47A 4Q4LA 1YZKA 1G5PA 4TT3D 5G53C 1KDOA 1R10A 2KE5A 4KLZA 3EG5A 1R4AA 2ZSAA 3SBDA 4KU4A 2HUPA 3RLFA 3GPLA 2V3CC 1H8HA 2NMVA 2IUSA 1NSTA 3GJ4A 3PJRA 1JB1A 5F9HA 1P5ZB 3KXLA 1HE8B 1TL7C 1Z6AA 3NHBA 5FTKA 2RGCA 4KBFA 1ZP6A 4IDQA 5KDOA 4ERNA 1NBME 1GRRA 2VF8A 3U44A 1UDXA 1G1MA 5JSZA 4LC1A 4AC9A 5TV2A 2JLVA 1MR3F 2JDID 2PLRA 4P33A 3CH4B 2FEMA 3ZS9A 2CLDX 2FF7A 3RS3A 1S1CA 2ZI4A 2D7CA 2WOJA 2R44A 4KAXA 1XWIA 3VKHA 1G9XA 1NJFA 3FHOA 3HP1A 4F93B 1N6LA 1NVVR 2C9YA 4NYIQ 2FZLA 3KQNA 5JEEA 1NLYA 4V0LA 1DPFA 3LW7A 3WBJA 3THOA 3AVXA 4TL6A 2Q6TA 4I99A 2VP9A 4MUBA 1S9HA 3FOZA 2B7BA 4DJTA 4LHYA 1NG1A 4DEYA 4NL4H 2IX3A 1MABB 1L2TA 2G83A 4M0LA 3QUSA 2IYTA 3U7HB 1LVGA 3TAUA 3I5YA 3W8NA 4QC2A 2CE2X 2CCKA 2GILA 1L7VC 4C0QC 2IUUA 1XB2A 1T6NA 1COWA 2FEOA 4A0HA 3U6BA 2CCGA 4DT1A 2VP6A 3DKVA 4EKDA 2C2HA 2LWIA 3K9LA 1HYQA 2RCNA 1F2UA 3RANA 3GJ0A 1FW6A 1D6JA 1SVSA 2DYKA 2GF9A 2ZYVX 4G1UC 4LUCA 4PR0A 2O8EA 2CL7X
chains in the Genus database with same CATH superfamily
2F67A 5ALUA 3DVAA 2H63A 4B4UA 3DKPA 1SOWA 4IDNA 4GP9A 4WW0A 1PGPA 2JFNA 2WC1A 4YT8A 3TTWA 3MTIA 3QMMA 4IQ8A 3JWEA 3UHJA 2A9KA 2J33A 1VHDA 2PBZA 2W4MA 4WMLA 3OCWA 4WZBA 3JYOA 1DB3A 3SJCA 3LFUA 5L4LA 5DXFA 3OPYB 1KVRA 1AS2A 3CO5A 1H8EA 2P5SA 5GV7A 3DV0A 3E1KA 4LZLA 2R7AA 3KZMA 2ETVA 3T5DA 3VKFA 1N5DA 2PVSA 2JI6A 3KOXA 5F51A 1KIAA 1E0AA 2WF6A 3G2PA 4BVJA 5FAXA 4I4IA 4KODA 5EL0A 2ZBGA 3WMGA 1GZVA 2HSEA 1GD1O 3PFIA 4IW3B 4MQFB 2BMAA 4Z4FA 1R8XA 4I55B 3U44B 3ZY4A 4H6WA 3VPGA 1QORA 4I66A 2DWPA 2DZDA 2MYPA 2PN1A 4YNBA 4JR0A 1OGYA 4I1OA 1DT5A 2HWKA 1Y9JA 4OXXA 3WWCA 3IEVA 1DJPA 1V7ZA 4FD3A 4XWAA 5JSYA 5HK9A 1PJSA 1WXIA 3K70C 1Z63A 2RHLA 2IS4A 3DMHA 4TT3A 2JFPA 4Q19A 5EZYB 5ALMA 1GT91 4LRSB 4M89A 5K3BA 2AMLA 3LPCA 5LQRA 2OZEA 2PKRA 3U7IA 1W87A 5I7EA 3R76A 2JFXA 1X7YB 2DFVA 1UMBB 1SG9A 4DGSA 2EGUA 2N42A 3ESCA 1YULA 3O82A 4L5BA 2AX3A 4DEXA 2LD4A 2BFFB 3QKRA 5L9AA 3I8SA 4H27A 5HOEA 4ARCA 4BO1A 4HXEB 4ZVNA 4FT2A 1E2KA 5J5AA 4OU5A 1WD7A 4B40A 2OG2A 2R97A 1QDEA 3TBFA 2JDIA 4H6PA 5FQOA 1EJ0A 3MAJA 3MS2A 3TKAA 1M66A 4B4DA 2AD1A 1QHSA 1ENZA 1YQDA 3NDIA 4BO7A 4NXNB 1TMGE 4MMYB 3AKYA 4MR9A 1DJMA 1VPDA 1WPGA 1QZZA 4LXXA 1J8YF 1U0HC 1NXSA 3M9LA 5TPZA 1GKYA 5EG5A 1EFVA 4QJ3A 2Q41A 1DHRA 3D3WB 4HWTA 2NUTA 4BEBA 2BMJA 3WGOA 4JUIA 4IEIA 1GGFA 2FN3A 3DMFA 1UBKS 2EJUA 2GCOA 3R6WA 4MB2A 1KE2A 3CBGA 1O95A 3HHEA 4XJSA 3ZX4A 4DXHA 4Z51A 4C2BA 3CYFA 3F5FA 2O8EB 2I4MA 4ZVKA 4DG8A 3KOUA 1P1FA 1XDGA 3EVCA 1UFKA 3PJEA 4RF4A 4I6JA 2HLNA 4GXTA 5DBFA 5I7UA 4FS3A 4BBJA 2XZDA 1GGJA 5JV5A 1KETA 4N0MA 4BVBA 3WWZA 1WXFA 1II0A 4X91A 1POXA 2JGLA 3NUQA 2OECA 3LBHA 4UJ3A 3EZFA 5LP6F 3OUUA 4M1YA 5ENDA 1TA9A 3VI3B 5EJGA 2DFTA 3EC7A 2O05A 4DJFC 1NNUA 2WU8A 3JVVA 4K8OA 4OHRA 1NVFA 4D4LA 4PO8A 1U04A 2PU5A 1GG2A 2IYLD 2M6SA 3NBXX 3NDJA 4MW6A 1U2ZA 4OXRA 1GGHA 5AW0A 3UKJA 4LGYA 1YJCA 1OAKA 4ZV7A 1D4AA 2RI0A 1U6KA 4KFTA 4BTEA 1O6BA 3RRZA 3KRTA 3HYRA 4LOAA 3MS4A 4GBJA 4Q9DA 5A02A 2ZFUA 5DBHX 1KY2A 2W6PA 2HL6A 1VBFA 2X8JB 3ROXA 4F3YA 3LC2O 5CLJA 2HIGA 2I3AA 4IHAA 5COBA 2DFDA 4DUZB 3QX3A 4WCFC 3G0GA 4LY6A 1KJ8A 3H8SA 4PZDA 1NVTA 3UJ9A 5KQGA 5HKKA 4X1KA 2G88A 2QTBA 3AB3A 2XCUA 4DCSA 3KLBA 3NTOA 3T99A 4CTMA 4OO3A 2IEBA 3AZQA 3HVRA 3O74A 2GBGA 2ZIWB 4Q66C 3P9PA 3KETA 3GLGE 4P3YA 2OSBA 5JCJD 4BZPA 3PVSA 4P7JA 4UJ5A 4QLOA 1S8AA 3V4LA 1FFSA 1H1TA 4P4UA 5J58A 2ECQA 3OD5A 4DW8A 3EVBA 5LDGA 3RKRA 4RFLA 2ZUFA 4R0VA 4HEA6 4YMIA 3UYKA 2ZUCA 1JDBB 1KNQA 5E9AA 4WLVA 1FSFA 4Y2XA 3VR6D 3HJRA 1DCKA 1OWOA 4KNWA 4LZZA 1V4VA 3LXXA 4XSVA 4YMWA 1Z08A 4CIDA 4L4SA 1NVEA 5A04A 1JFFB 1V96A 4GOOD 3SEAA 1U0JA 2D1QA 3ZHBA 4Y1RB 1ODFA 1Y1LA 2R7MA 4PYRA 3CZQA 3HBLA 4G6ZA 5EZSA 1Y5NA 3AM1A 4E3WA 2WUFA 3D3EA 2A0KA 2YXLA 3LKZA 1RE1A 1VIDA 5JNUA 3T3EA 2GN1A 3II6X 1O03A 1XMVA 4XVHA 5C5EA 1RAIA 2H06A 3K8OE 2OBBA 4I55F 1RR6A 3L4SO 2Z4SA 1TQ2A 1W93A 4A5OA 3VR5A 1Z8FA 2ORED 1F3LA 2Z5VA 4IGAA 5LKAA 2O8CA 2VR1A 2XBLA 4IJUA 3SICE 1M7BA 3RS2A 2DKFA 1DKNA 1KXZA 1TECE 3ABQB 4PZCA 2FWPA 1BS2A 1HQDA 3S3TA 3T1OA 4B5KA 1BXRB 5KU7A 1GGEA 2PXCA 1M6YA 4G9GA 5EZYF 1YRHA 2X2EA 4Q4AB 2JBWA 1RU3A 4IHJA 4WINA 1LBTA 4X7BA 3RH0A 4E2WA 1FZTA 2ZE7A 5AHKA 3Q41A 4CT0A 1BVYF 3CFYA 2VQFB 1ZCFA 1NMYA 4HJXA 2R8XA 3UJPA 3OAAD 3Q85A 3HRKA 4ND7A 5DHPA 1G5TA 2FSHA 3FYSA 1JA0A 3H0EA 3DFUA 3GJ7A 4NDZA 3MILA 2VXYA 1HT0A 4RK0A 4DBLC 3IESA 3OY7A 3IILA 3H19A 3KIPA 4P32A 4I1PA 1V0JA 4PSKA 2JBAB 3A3OA 1XZKA 2OQVA 3A2NA 2SCUB 5CNJA 1ZCZA 1QIJA 2FX2A 1ZGCA 4HB0A 4ID9A 4MGEA 3ASVA 4EA6A 5KNBA 4JGBA 1OFUX 3NOVA 3E8XA 4HYTA 5K6AA 4JDUA 2J3KA 4C3VA 5JCOA 5CEEA 3ZCXA 1GZ4A 3PD7A 4P83A 1BVUA 2GPAA 3IVMA 4WEQA 1DV1A 3GZTB 4BKQA 1NN1A 3BL6A 3BD8A 4AS3A 4TTRA 1G8PA 3P52A 3P9SA 1X1EA 4PX5A 4V2IA 3C3DA 3E05A 2WZDA 3BZWA 3RSSA 4FI3C 5F3DA 3AUJB 2O8DA 1XP5A 1TZMA 1NLMA 2DKNA 3BJMA 5CDYA 2XGOA 3W06A 1PKEA 3AMVA 3PPIA 4QOJA 1E3SA 3GZJA 5K20A 4IOMA 2N1MA 4TMYA 2VTKA 3FH0A 4ITVA 5FF9A 1VFNA 5KAPA 2WTXA 3ETHA 3FW1A 3R20A 2GRAA 5G41A 4XVCA 3IAAA 3E70C 4JBWA 2DX7A 4J76A 2LBPA 4KDFA 5IWAB 1QIIA 6ADHA 5B6PA 4GM1A 1OTYA 3N8KA 1T9CA 2B4QA 3H83A 4HG2A 2EX4A 5DW3A 5JD4A 1JE0A 2YY5A 2H52A 4JAVC 1T6YA 2LIVA 3EH2A 3QF4A 3W5BA 4KZPA 2XCQA 4LY3A 4DV1B 2O2GA 1TT7A 1NQXA 1HA3A 1M6VB 1EVIA 4ALJA 1R6VA 5CX4A 1SOMA 1T8YA 4BGVA 5JY1A 2JLXA 4HUTA 3M1AA 1A9RA 3PGXA 3QSYA 4YJKA 5FR1A 3AR5A 1HEIA 2F90A 1JZSA 2Z95A 2Z3WA 1O6FA 5IJWA 1B2LA 1IHXA 4PVDA 3W7VA 3U09A 3L4JA 3L4KA 1LA2A 2FZEA 2VQ3A 2B8TA 3I01A 4ZQBA 5EGSA 3NHJA 2XD4A 3VR2A 5K0LA 5CFNA 2J0QA 4PHHA 2IXFA 4RTOA 4KV9A 5AM5A 4HV4A 4BGEA 3GHYA 2VRWA 4MAMA 4QTXA 1RADA 3L7CA 1DINA 1Z26A 2DTEA 4FW9A 5IDXA 2CDCA 3EZ6A 3GJXC 1W5BA 4PCAA 4ESEA 4WOKA 1XZCA 1RIFA 2HMUA 4TQGA 2R4QA 3LBNA 4YCMA 2ONKA 3KXPA 5G0VA 3BMXA 2W2OA 3AI1A 1TAUA 1B8NA 3C7DB 4NCHA 2LTAA 1SC4A 3PC4A 1P77A 4NU5A 1MIHA 1QHIA 3WTBA 3A1SA 4E6PA 4TWBA 1N2CB 3IIKA 4CMIA 1E3WB 1JBKA 2B5OA 3D2LA 3EG9B 4P7BA 3E23A 3ZDYB 3KWJA 2ZZMA 1UL1X 2YS6A 1EUCA 2I7TA 1THGA 2ZB8A 3B5JA 1CU1A 1P2FA 3MWFA 1JW9B 1V1RA 1XDZA 1UK7A 3DYBA 1VBMA 2G17A 3LCVB 5EUBA 3USES 2YJ4A 3BXZA 3EOZA 3NH6A 4LZJA 2PA3A 3LKBA 5LA6F 4BAZA 1G2IA 1RQ2A 1SQ0A 2RH9B 3B8HA 3LFHA 1JHXA 4OD0A 2EFDB 4CW7A 1XJ5A 3UJ8A 1NXPA 1WPQA 1DWOA 3BWEA 1TM2A 3WLHA 1PO7A 2O1XA 5KJ1A 1JXOA 1Z4QA 1C3VA 1KXJA 2JIRA 1I36A 2QYHA 1IJBA 1RI3A 3G17A 3H5VA 3HUEA 4IOKA 4RPJA 5DM60 4EHHA 5HUJA 3KUKA 5AJUA 4K0RA 1JT2A 1AMOA 5KYVA 1VJ5A 2EAUA 1HDGO 2O1EA 4JX9A 3VPHA 3P19A 4XM0A 5A3JA 3L0BA 4QL3A 1JZTA 2OLJA 2QTZA 4YH1A 5JDIA 4EW6A 2VWGA 3H8JA 1YR3A 2FXIA 5GADl 1RAEA 5EFZA 4C9BA 1WB6A 3GYBA 2LPMA 1QRAA 2IXDA 2QP3A 1WL8A 1WNFA 4OMDA 4AWBA 4ZQFA 1PS0A 1L8OA 3TQQA 4NBUA 4FUQA 4L9WA 2R7NA 4RA9A 3T9AA 2ZJ1A 3ZIAA 3PWSA 4FSHA 1KQFA 1MCZA 5AW1A 1LDNA 2JFYA 2E0IA 4DMFA 4CODB 2GZHA 2H9YA 4I8DA 1T1SA 2H1RA 2ID9A 1VKOA 4YUYA 1LWNA 2VJAA 1O08A 3IR6A 2EKPA 1M7GA 2J4FA 3NALA 1LX7A 3I45A 1UZNA 5I7FA 1ZI6A 4D0NA 3O2NA 5LPNA 1USVA 1NXXA 5MN5A 1DIRA 1GNVA 1M34E 1IOZA 3VJKA 2IC5A 3PNBA 2H4HA 3KOYA 4HB3A 4HWKA 5EHZA 3L7IA 2YWEA 3WKCA 2EZ9A 1MV5A 4TMZA 4C0XA 2C61A 2JRCA 2C94A 3OPMA 2YRWA 3BGSA 3CC8A 4OYYA 1THMA 1Z33A 2RHMA 2ZUVA 4FEGA 1J49A 4N82A 4ZIRA 3QXJA 5KINB 4IJVA 1VL2A 5D3QA 1UXKA 2WWFA 5CDFE 3SVTA 3GR6A 3VGPA 1IBSA 1ZVVA 4E30A 2GNOA 4BXOB 1DBWA 1NY6A 2CNWA 4A15A 4L72A 4AS2A 2CXQA 1NXOA 1NVXQ 2E87A 5F4ZA 2ZE6A 2EVWX 2QUIA 2RGNC 1CVLA 1KEEB 4XCQA 2G25A 2WUWE 2W48A 1KEUA 2FEKA 3OQVA 5F1KA 3DQQA 3A06A 1WUIS 3ZBUA 5IT4A 2DY1A 3N74A 3IJ5A 3OF5A 2NO5A 1OXBB 5EYPA 5CFRA 3UW3A 1OILA 1FP6A 4R6XA 1EDBA 3NVAA 4ZU3A 1TVKA 1ZQ9A 1SIOA 2HTFA 3RUFA 2A88A 7GPBA 2AC7A 4MKIA 1NJ2A 5FEMA 1XTQA 2Y0CA 5ECDA 4EKIA 2DQYA 5C8DA 4GR4A 3SYNA 5K0SA 2FSGA 4P08A 4EVQA 2H92A 2GA8A 4V39A 4L4RA 2K87A 5K0EA 4U6QA 3ELWA 4UM8B 5AYVA 1IL0A 2OUKA 2YIJA 3HG7A 1CX9B 1QIKA 3DBRB 5JS1A 5AM0A 1XZQA 4B3SB 1Z74A 3RRXA 3B2NA 5FHQA 2IYFA 4D4GA 1ULBA 3PHLA 2IYVA 4QG3A 4ZC8A 1YL7A 2AUNA 1IWOA 3ZJ4A 1II8B 3WRXC 4M2LA 1C3XA 5EHXA 1VG1A 4FHEA 5CCXA 3A8TA 1OIXA 3IQEA 1U3WA 2WP0A 1TPYA 5A4IS 5DP1A 4UCFA 2NVUB 2VJBA 3ENNA 3T3DA 4F4CA 4HDNA 3SGLA 4X95A 3C8MA 4LE0A 5HIMA 4X62B 1IEXA 3PUHA 4X5OA 1QV9A 5JNRA 4EJSA 1YO6A 1NY5A 1UC4B 1NUHA 1P7YA 4F60A 4GKKB 2NTYC 3HWX1 3OTQA 4KNVA 5AQ1A 3ZK7A 4DA0A 4EDHA 2IS2A 3AL0C 3EDCA 1FL9A 3FGOA 2JFUA 1NRXA 2RGRA 1BMDA 4LHVA 1EVEA 5C5IA 3JZAA 4OIFA 4WN9A 3QFSA 5ADUS 2WU1A 3PXAA 4FFDA 4COOA 5L6MB 1GVNB 3CHYA 5MN4A 2WNHA 1HDIA 1M6WA 3HR8A 3K6JA 2E9SA 1VCMA 4WZAA 1RP1A 5L3SB 2C59A 2XAUA 1L8LA 1G8SA 1RLTA 2XT0A 5CNKA 2VT6A 1OIWA 2A57A 5CLGA 1ZBQA 2CNLA 3IBGA 5EZ5A 3UAXA 2V6JA 5C1BA 1CK4A 1QG0A 3H11B 2A33A 4TKZA 5HFJA 4ZO6A 3TDMA 4DCUA 1DG9A 1Z22A 3CZRA 3H13A 4GPIB 2YV4A 2UKDA 2ZREA 4RMGA 1SVNA 3CH6A 4X8MA 2B3DA 1HT2E 1U1GA 4N76A 4CBVA 2I1WA 3OKPA 4D9IA 4ENWA 3VAAA 1CQIB 1QFZA 3D54D 2AC4A 2UUBB 4NC9A 4UCWA 3ZW8A 4D41A 1GITA 1CJMA 4I3FA 1ZCJA 4G0OA 3BDIA 2W42A 3D4LA 4N9WA 3FFTA 2RHJA 2ZJ3A 5FH9A 1E2JA 3QXCA 2G9QA 1LD3A 1DXHA 5DKFA 3NHWA 4RPHA 4RGYA 4AJ1A 2KYRA 3WNDA 5FUQA 3T1VA 1RTTA 5E6RA 3TTVA 2SNIE 2D5CA 2PD4A 1TPZA 4UHCA 2BEUB 3L6BA 3DONA 5E7MA 4YMGA 1Y81A 4P80A 1KQOA 4KDCA 1RPZA 4R7TA 1UANA 3OU7A 5CBPB 3N2GB 4GPBA 2QXTA 2RI1A 2Y67A 3FOAA 3TO5A 4QQRA 3P2YA 5L51A 4CM9D 1RW4A 1TA0A 4ETNA 1RYBA 2WJPA 5EJ9A 3KSMA 3N8IA 4UE6A 2IHVA 5EJ8A 1PWZA 4DBVO 1ZM4A 5I8ZA 3UPUA 3ASZA 4DUGD 3AZPA 2Q4TA 4RSRA 1BDBA 5BYJA 1IPFA 1HKUA 1OLSB 3KE8A 4HFRA 4N5DA 2VFAA 3UWKA 5KOHB 4J1QA 2C31A 1GG5A 3K1JA 3TW8A 2PKWA 1GDTA 2HBQA 1ZHOA 4EW1A 3IRVA 2QQEA 1UBEA 2VWPA 4OFWA 4Z9BA 3OUZA 5IAAA 1DEKA 2Q2NA 2WICA 1N6PA 3F6RA 2BT4A 3CY6A 4GYYA 3WADA 5A0VA 1C3JA 4DLYA 4HQOA 3NC0C 1FFBA 4DM7A 2F8TA 4FN5A 3PFBA 1E9CA 3IUBA 3OWXA 3GLFB 1TEXA 4DSTA 5DI9A 3CRVA 3RSFA 1CBUA 3OQJA 1WW3A 1VHQA 4LE2A 1G0NA 4MR8B 4IH4A 1LJ8A 2BSQA 4DDVA 2FR8A 3A9SA 2OE2A 3K2IA 4B3CA 4ENRA 5CT5A 1G5FA 2H2GA 5IM4F 1FFYA 2H17A 2I71A 2P9YA 1ZN2A 5FTLA 2FZKA 4BGUA 1J09A 5KMGB 4C04A 3EXFA 2CLHB 3MIZA 3YASA 1M2VB 2BH9A 1K98A 1CQWA 4G84A 3VOSA 4ECEA 3TG8A 1GFZA 2VXBA 3V2GA 1KMQA 1AUQA 2O5VA 3C41J 2XVAA 1ABFA 4CUJA 4DPMA 2O8BB 1N8NA 2WNIA 2KHZA 3OF2A 4G5YA 4I1UA 1TK9A 2GS9A 3ER9A 1E4YA 3KQHA 1NKTA 2JEYA 4AU1A 5HHTA 1W6UA 2D06A 3T7TA 2YXEA 4LJLA 4JGGA 1T1GA 2CJYA 4GRAA 1NE7A 3KR9A 4HL6A 1KZ9A 3T1NA 1KRHA 5IU6A 1FJXA 3A4IA 3E58A 4Q9JA 4E22A 3HKEA 2RAVA 4DA6A 4EFDA 3OCJA 1TFUA 3LLCA 2XAAA 2HK7A 2Z83A 4JT9A 4WBNF 3QY9A 5AP9A 5DW0A 3N2EA 1N2BA 1XF9A 1JDJA 4LXHA 2FZVA 5BQPA 1VDMA 4AYWA 1ZAYA 2AMYA 2V97A 3IMKA 5B2EA 2QIPA 4QTTB 2Z9DA 5KVQA 3LCRA 2VDOB 2PRIA 3TBKA 4S12A 3SI7A 1J5XA 1XVUA 4FX2A 3PHBE 4INZA 4UAGA 3T41A 1OAAA 1Z36A 2M2IA 2WD8A 4PX3A 1PUIA 1NQWA 1UFOA 2Q4DA 3A27A 3FJYA 1T5OA 1B26A 3R5KA 2H6EA 2PQMA 4FQ8A 1C9KA 3CUEF 4M46A 5D51S 5FBKA 5A9TA 3ZQ6A 3ED1A 2GDJA 3UJHA 1L6IA 1DC6A 4IIGA 4B7ZA 3I1FA 4KP7A 1AUXA 3IXLA 4K9DA 3CT4A 2DUJA 2R87A 3G7NA 1GZ6A 3KXDA 3QHPA 2BTQA 4HBZA 4IL5A 3PF9A 3LRTA 4TYNA 1QHNA 2J5BA 2PX3A 2XJ9A 1ECGA 1GP2A 3AR6A 3PQEA 1VIVA 1JIJA 3OKAA 4CTKA 1XE3A 3H5OA 3C7AA 1NBMA 3FDXA 4WD3A 4C43A 2D2FA 2OBFA 1DIHA 2D4HA 1CZRA 3CLRC 4PZUA 1GAWA 3QBTA 5DIFA 2OILA 3G82C 1ZYUA 4KI0A 2GLUA 4RIHA 3L6CA 1A1SA 4Y6PA 3RQSA 4AY3A 1XRMA 1G63A 4H1TA 1T9GS 3UXEA 4P4SB 4PRZA 1M2EA 4BFZA 1K08A 3AEXA 2N9UA 2JRLA 4D1YA 1WS6A 1ISMA 2XITA 3B1ZA 3H3JA 4I9NA 1HPLA 4LY9A 4MIEA 2VO1A 2ZJYA 1HF3A 2E18A 1U7UA 3OE5A 2XZTA 3NTLA 1IZ0A 2Y1KA 3A28A 3RU3A 1OA0A 2NX2A 3L4BA 2W90A 1S89A 2E4ZA 1TJNA 2XMPA 3FGPA 1U02A 3VNRA 5AM3A 2PJRA 4FPXA 3EGEA 4BMDA 4K5QA 3U3OA 5JY6A 4ESHA 1CUAA 1TYDE 4DL9A 1BDJA 3VPDA 1NYTA 4X3OA 5F7JA 4AWAA 4G8DA 1JWLA 2Q4OA 2X1HA 5JSUA 4MKZA 1XPRA 2OFFA 3ZV3A 1H6DA 4HNSA 3RTEA 4K2AA 1BHO1 3QXXA 1EE9A 2CE7A 3DE6X 2ORIA 1F0YA 3ZWCA 4C1BA 2VUSA 2X9GA 4PPFA 1P5FA 3VTKA 4CG3A 4EYKA 3VZCA 2I1QA 1E3DA 2FHSA 2II6A 2ILVA 2O14A 4NICA 5BNTA 3LVQE 5CH3A 1PZNA 3PPXA 3RWBA 5CYOA 4EM6A 4FFVA 4NR0A 1P2DA 2GEVA 2HIAA 3QLVA 1A9OA 5JXGA 1JA9A 1Z5WA 4MV7A 4ABYA 4BNVA 4MWSA 2ZRAA 4LF4B 3DWEX 2PVCA 3CW9A 5ED4A 1P33A 1WLSA 4K9MA 3T1TA 2IOQA 3NIFB 3R3YA 4JA0A 5A71A 1GLVA 1XA3A 1YRBA 3GY0A 3TSOA 5FLXA 3PA8A 3C16C 4MQUA 4OLAA 3RR2A 1JHPA 3FYUA 3DZ8A 2GN9A 1PWHA 2WI8A 4R31A 3F98A 1ZZEA 2JD2A 8GPBA 2J9RA 4LRTB 4M36A 5EY5B 4MUFA 2FCAA 1S96A 2AT1A 3AQ4A 3PD1A 1F14A 1UJBA 2RG7A 1Y7HA 5LU9A 2CL5A 4WVLA 3OQ1A 3ANNA 4GNKA 5HBRA 2FW7A 4FINA 5D1NA 4AS1A 4GQBA 3GH3A 1B2RA 4O4LB 4NZOA 1MN6A 4RKRA 1CRZA 1LWOA 3HXPA 4IJWA 4QRHA 1ZUHA 4BLRA 5M5BA 3GGSA 3NHRA 2O2HA 1QGDA 4HHEA 2DC1A 4BLOA 2QB5A 2V7QA 3FCEA 2C88A 1YI1A 1G20A 4GWLA 4HMQA 1KPGA 1QOPB 3W3AA 1EMDA 2DEUA 2NXNA 3I6QA 3WLNA 3VHLB 3E3AA 1SC9A 3IUPA 5FOUA 4YIKA 4RTMA 1P62B 4JJGA 5HF5A 2IS1A 4LVOA 3E53A 1CVRA 1M2WA 2QR3A 3CN7A 3ESQA 3IYLW 2FX5A 1J0EA 4QRIA 1YQQA 3I30X 3BM5A 3KL2A 1O97D 3RYHB 1TUBB 2N1BA 2B61A 3LL4A 1B0PA 4MRMB 5E9JA 2WV9A 4KX3A 4M21A 5FULA 4LBZA 4RTJA 3B1YA 3CLKA 4DSZA 1X7HA 4FOOA 1JWAB 1WSDA 3ZCRA 5HQTA 5CFZA 1T2UA 5I7VA 2F9LA 1Z6YA 4L7VA 1J8MF 3B7PA 3GA0A 4FOTA 4UMVA 3SG0A 4EUSA 5J9FA 1VI2A 2J08A 3SHOA 3AKEA 1OX4B 2JGKA 1RNLA 2D2EA 4PYOA 4X92A 3KYDB 2HZBA 3DE1X 3NOXA 1J42A 3OHSX 4BPRA 4CUZA 3WLLA 4UNNA 2G36A 3AY7A 2R47A 4YUVA 3OP1A 3BBLA 2VSYA 4NEGA 5U4XA 2Q2QA 5ALOA 1SK9A 3OTWA 3BWYA 5K05A 3UHPA 1KZ4A 1E6CA 3T9EA 2EFGA 2WAYA 3ONVA 1XR3A 1U0SY 1ILEA 3N6VA 3OICA 4FLMA 1JECA 9LDTA 1Z29A 2WG0A 3FKJA 3NYIA 2A5DA 2RAFA 2CVZA 2Q6OA 2R4UA 4X6XA 2PCLA 3NJRA 3PUZA 4OJNA 5JAZA 4KQ2A 3KT0A 3ZCVA 2WWXA 3BXEA 2ZTSA 3LWZA 3QVGA 4RZUA 3ZEAA 3RUDA 5HCUA 1S02A 5BVGA 1LBIA 1J5PA 3DDHA 3X43A 1C0EA 1CRLA 1WNTA 2C99A 3TQHA 2CLLB 3B52X 3F6EX 3PPWA 5U9CA 1J8FA 1PSWA 2R8ZA 3QEMB 5JZBA 4R8RA 1GJRA 4I50B 3TK1A 3IUNA 3WHIA 1R0BA 4YREA 4BBZA 5JI2E 3WYCA 1SKAA 3A6PC 2XGJA 4TXNA 1C1DA 1VHWA 1F38A 2OCYC 4G2NA 5HGJA 2IYUA 4A2WA 5A4DA 3EXEA 2WF5A 3LJKA 1GPDG 1LXCA 4DMHA 1P0FA 3EY9A 3MTDA 2QSYA 4CR7A 4HQRA 5EWMA 2A58A 5BWMA 1AGNA 1P5HA 3AUTA 5LC1A 4FONA 4M88A 2G70A 4UBIA 2A3NA 4Q9NA 1CRWG 3WAJA 2YYZA 3CISA 1PJ4A 4I1YA 3PZBA 1BEEA 1FTSA 2WVJA 2C2YA 2BONA 2PUWA 3AP3A 2QT1A 3FZYA 3GJQA 1R0KA 3L07A 4OHZA 1O8BA 2XA2A 3PE6A 3WP1B 1N3YA 3ELDA 2IZ1A 1BJKA 2FUG6 3TUZC 5LLSA 1ZI8A 3EVDA 5K0ZA 1D2HA 1IHYA 2CXHA 3HDHA 1G5QA 2WJYA 4B74A 1FRZA 5IVHA 4W1PA 1O5IA 2YMQA 3G5UA 3GRFA 3DBOB 2Q7OE 3MS7A 1DAKA 1LBQA 1JHZA 16PKA 4U3JB 1YQTA 3N7UA 4EB8A 5EIBD 3ZOKA 2KLBA 3DSRA 1HYBA 4V2UA 4RY0A 2CB9A 2OHJA 1G8FA 2VUTA 5EEHA 5P21A 4HUJA 3ZG6A 4N41A 4X44A 2HC9A 3ENQA 4RD3A 4IQ0A 3UG6A 1IDN1 1YQXA 1IN5A 4QXAA 1PWEA 5JDCC 3PDUA 3DEYX 3ODGA 5DHUA 3G9TA 3K70D 1GKUB 5IJAA 3DBHB 5J2TB 1V5IA 1JR3E 2Q5IA 3MF4A 2CYAA 3GP3A 4OI2A 4ZCLA 3WL3A 4BNIA 3O95A 4JEMA 2IGTA 3WO1A 1JDNA 1P9OA 2GPWA 1GQFA 5ALQA 5KU1A 2DETA 2C58A 3PI7A 1NSFA 5IRCD 2IXEA 4N7JA 4HC4A 3CKYA 1FTWA 2CMGA 2PXHA 3B3FA 5BOVA 1WQ4A 4PYJA 1PUJA 2GCNA 3E9YA 2GAFA 3LY5A 4XB1A 2X0JA 4AECA 4RPKA 4DRZA 1MC4A 2QD2A 3G49A 3H1TA 1NM5C 1U99A 2VK2A 2YHAA 4L57A 1OXSC 4LOIA 2XT9A 4RTKA 2BFCB 4ER0A 4Y2UA 2JJYA 2OOKA 2P0AA 4O4LF 5AVUA 1F8UA 3JQBA 4QYMA 5CURA 3TR6A 3TSZA 3LX4A 3EGDB 4YJ2B 1K1EA 3TNDA 4P0TA 3BG5A 5C1PA 1CHNA 2HJ9A 1VE9A 1T6BY 4JLPA 1NA5A 1Q22A 4Q9LA 1S3GA 1K5PA 2RGWA 4GW3A 5FL7A 2OD9A 2IY8A 3PPVA 5CLHA 4CF6A 4MV3A 3TLGB 1I1HA 8OHMA 1NUAA 3D02A 1E8MA 2RDMA 4EGJA 4XLZA 3OH8A 1JRLA 3F46A 2GCGA 3WHPA 3BFXA 1Q17A 3AV3A 4EGSA 4CGZA 4B3GA 2D3WA 2F17A 4EI2A 1F6BA 2HMAA 1DXOA 3B3AA 4MS4B 3OQBA 3ZU5A 5KNDD 2XEXA 4CF7A 1QHHB 4IYJA 5KCMA 5LYJB 5A4AA 4UMDA 3Q7EA 5FORA 4N8SA 5DT9A 3ZD9A 5HDBB 4IXWA 1T9DA 4F1JA 1MB9A 3JRXA 2FMKA 1C0KA 1EIZA 2C4TA 3CUUA 4FOPA 4WDQA 3BIFA 4DV7B 4IYRA 2FRXA 3KR2A 2ZJ7A 3PDCA 3WXMA 1F2VA 5IF9A 4V0RA 1CJTC 3OEWA 3TVTA 2X77A 1X6VA 4G41A 4BNJA 1WZUA 2QPLA 2HEGA 3C3EA 1J00A 3ZCQA 2R6HA 1NR7A 3RVKA 3BEDA 2J87A 2QVGA 3L0YA 5TT1A 4YT2A 2WFLB 2I6QA 3BRWA 1Z6PA 4N6NA 4GE0A 3FPJA 4EPTA 4E5DA 3AR3A 1VRVA 3Q0IA 4LMPA 2H2FA 2CV1A 3ZV5A 1GEEA 2AWOA 4JUFA 5KTMA 1XSEA 3PZRA 4PLFA 1KZGB 1XNRB 1O6ZA 1Q14A 3AEYA 2VWHA 2AOWA 1BAPA 3M6WA 2VHJA 2NTEA 2X0EA 3BQ9A 5CFQA 2X76A 5DK4A 3UK6A 5JRJA 4B3BA 1VLQA 2GXSA 2XWPA 4IOJA 4LJ6A 5WRFA 1W581 1BEUB 5AI6A 5LP1A 3FFWA 1FXWA 4BB0A 5E2AA 1VI6A 5HQ3A 2HF2A 1ORWA 1IN7A 3AY6A 4I4CA 4UBKA 1DELA 5JARA 4IXMA 5DLPA 3HJBA 1MH9A 4FMDB 3TIGA 3ZHYA 2Q62A 2JIDA 1CY1A 3GNSA 4I50F 4W6ZA 1IMOA 3V97A 1PV2A 3N8HA 3RSCA 4UMFA 1O94A 6PFKA 3SDSA 2D6FA 1AN0A 4ZQCB 4WERA 2HHAA 3K16A 5JISA 1TADA 3EIQA 1JI0A 3IUMA 3HCNA 4FLEA 1L5GB 1A5TA 2HQOA 3OLZA 1IIBA 5J43A 2WQ6A 1QP4A 4ZGGA 4HAXA 1QQ7A 2NO6A 5HZGA 2LNDA 2W2PA 5AUOB 3M6UA 4N0PA 2CNBA 3CSDA 3FCCA 2AOUB 2GCPA 3DOJA 2BR3A 1XCOA 2P6OA 3KTFA 3ROGA 1HR0B 4OK5A 3JQ8A 1YB4A 2GZMA 2H2HA 4I4TB 4UAJA 4HO1X 2AYZA 4LE1A 3MRXA 1RRFA 1P81A 3T4UA 4G1MB 1T15A 2EBUA 3AG5A 3VR4H 4ZZ1A 1XTVA 4RTLA 1Y8RB 3QZUA 4G97A 1BDMA 2OZKA 4QYIA 3PA6A 3F8SA 5BVHB 4C2TA 4RVFA 2XNSA 3F49S 1YD7A 3S2GA 3IC5A 3R7FA 4E5YA 4Z7JA 4RSMA 3WMRA 1YZVA 1R27A 2B0CA 4QKQA 1LBEA 1EESA 3GFTA 2FPGA 2VTDA 2JKYA 3LA8A 4MHOA 5L7WA 3UGJA 3CIFA 4RPCA 1D4FA 1R12A 1GEGA 2H0AA 4Q3NA 5AQEA 3A58B 3DHYA 2O19A 1W8IA 2W9XA 1VHTA 2NM0A 5J2TF 4HPJB 4JLUA 4TRMA 4XGNA 3WHLA 3N28A 2HLDA 4QWMA 4WTOA 1HTWA 4B31A 5TMPA 2HWUA 1OZHA 3DA8A 1UMDB 2EG9A 1DIAA 1CB0A 2GBPA 1WZNA 3QW2A 4I5GA 5HGXA 2XQFA 4GC5A 4UNSA 3SC3A 5J47A 4LF7B 1JLKA 2I62A 2P90A 4GOMD 4MVJA 1ZG3A 1B42A 2VAMA 4DQ0A 1E9BA 2YVUA 2HBYA 5EUCA 3LUGA 4FR5A 5BMOA 1SA0B 3ISJA 1I1QB 3HVJA 2IEZA 1KYZA 3QA3E 5C8ZA 1D7AA 2ST1A 3NNNA 3IP9A 5IKXA 3PQ4A 2IHUA 4DYDA 1Q1ZA 2CF6A 3P27A 4PZLA 3H5TA 4AFNA 2OFOA 4B84A 1UBTS 4MR7A 1R0YA 2QZ9A 3KM0A 2TMDA 2DBYA 4GS5A 4DA9A 3JALA 4UKDA 5LCXA 2QQ5A 4ICIA 3LHDA 1EK2A 3IUSA 4TMVA 3CJTA 4KWTA 3ZWDA 3ZWKA 4YP5A 5KOYA 1DC8A 1SY7A 3MJEA 4PTLA 5ICGA 1I1NA 1RWVA 5LM3A 2BN4A 1PQYA 3K0BA 3R44A 3FI0A 4G4SP 4DMKA 2H4XA 1E94E 3FD8A 4MRNA 4YLEA 4OB7A 5ALIA 1GUZA 2EHJA 4Y0VA 5LYJF 5AVSA 1WQ3A 3T7CA 1LDYA 2ZSEA 3HN7A 1L5NA 3K70B 4KYTA 1WLYA 3P9IA 2GN0A 2Z5GA 3NYRA 3U7QB 4JA2A 1HNWB 2A9VA 2HWXA 1MDBA 2JGAA 3FOWA 1JPNA 1KYTA 1Z16A 2AZDA 3AK4A 3R3UA 4YQEA 3AV0B 1PS9A 2Z8XA 3ZZUA 4JVNA 4EHBA 2CHQA 3ZWNA 4DR3B 1J39A 1AB5A 2W6QA 3AIMA 4IKEA 3NNDA 1U8YA 2AHRA 4UDXX 3AVQA 3G2JA 2NTVA 4PXYA 1G21A 3UOGA 3MMZA 2PG3A 4MQMA 1V71A 4KGVA 1OMOA 1SD5A 3OEHD 4PIVA 1E3LA 4R1MA 3WGUA 4EEZA 1G3MA 2XIJA 4ZEOA 4YV1A 1ACJA 2G9ZA 3AVOA 1E2UA 1VE1A 1QO0A 1M33A 3D0OA 3FSEA 1AKRA 2XMQA 3GC6A 4H08A 4YMVA 3LM8A 2PH1A 3WIUA 3GG9A 2DQ4A 3RU9A 1E6KA 4BRWA 4OKSA 1AHIA 1HMYA 1V95A 5DN6A 5CVTA 1UJ6A 3MGKA 3VU9B 3RAFC 2D74A 2QTVA 3FDZA 2WZQA 4U0KA 4V0MA 4M87A 4KN8A 5DTQA 2YBEA 3NFRA 5GGXA 5HIIA 3RUPA 4FMDF 4CMEC 1T6ZA 3ANMA 3PUVA 3ZNQA 4IFEA 2C8KA 2XX3A 5HUQA 1ZN7A 2IYRA 3D4BA 1XKTA 5HZMA 5F12A 4BNTA 1UBCA 2NSJA 3QEBZ 1PTJC 4LHWA 5AHRA 5FA5A 5TR9A 1O0CA 3ZNOA 3KKPA 2VK4A 2EIXA 1IAVA 2QY6A 4DLTA 4U63A 1CZHA 1ZH8A 1QNLA 5AW7A 4PLGA 2VVTA 2I6GA 4BMSA 5C0OE 1TZBA 1YCDA 1ISJA 5LR6A 3MTAA 2CFSA 1OLOA 3FY4A 1JJFA 1B8PA 3FCAA 4P7FA