2REXB

Crystal structure of the effector domain of plxnb1 bound with rnd1 gtpase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
176
structure length
171
Chain Sequence
b'RCKLVLVGDVQCGKTAMLQVLAKDCYPETYVPTVFENYTACLEQRVELSLWDTSGSPYYDNVRPLCYSDSDAVLLCFDISRPETVALKKWRTEILDYCPSTRVLLIGCKTDLRTDLSTLMELSHQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSEKSIHSIFRTASMLCL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plexin-B1
publication title Crystal structure of the effector domain of PLXNB1 bound with Rnd1 GTPase.
rcsb
source organism Homo sapiens
molecule tags Signaling protein/lipoprotein
total genus 58
structure length 171
sequence length 176
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2rexB00
2RGNA 4D81A 2XSZA 4HZUA 4Q4AA 1GDDA 3Q5DA 1NIPA 1MO3A 4OHXA 4IOLA 3THXA 4AD8A 3VKWA 4Q1EA 1G8GA 1IN8A 2OFOA 3RS0A 2FJUA 2NO9A 4OL0A 4JLOA 3T06B 1FW6A 2UKDA 4LC0A 1UDXA 4C0LA 3B6EA 4IOMA 3NEYA 1SKYB 3U7GA 1HTWA 2PBRA 121PA 3OFND 4QGAA 4TLEA 3SDZA 1XD9A 3SJAA 4DJTA 5BYKA 3C15C 1MKYA 2R6FA 4A9AA 5KPJA 2VH5R 3U7HB 1DAFA 1M7HA 2WMNB 2HF8A 4BRWA 5CLQA 1I4DD 2ZRIA 2VHTA 3CW2A 3K0CC 4S35A 2IF2A 3KJGA 5KPDA 2XTNA 1E6CA 1KMHA 1G1MA 5L3QB 1G20E 3BFKA 1RFLA 4A8JA 1QRAA 1DAIA 3TQCA 3VR1A 1UM8A 4KFUA 1G21E 5JJKA 5BN4A 4M1SA 1MRSA 1AK2A 1IQPA 2VP0A 1E32A 3T12A 1JJ7A 1IXZA 3QKSA 4Q18A 1SKYE 4MKHA 1E2GA 2QL6A 1FTSA 3PITA 4YLGA 4C7OB 1SULA 1P2TA 1J70A 4PC3A 1RC8A 1KKLA 4HAUA 2RGGA 3DZ8A 1NVVQ 1NG1A 4DLUA 3TUJC 1LVGA 4GMDA 2W2VA 5JHHB 1NLFA 3S1AB 5JECA 2BDTA 1RKBA 2EFDB 4FMDB 3RS7A 4GDFA 2ZAOA 4DCSA 1G4AE 3R9XA 3GD7A 3PCRB 4NMMA 1YRAA 4DLYA 2CNWA 1PUJA 4GRAA 4HSEA 3MLEA 5FFMA 1KO4A 2B7BA 4IFBA 4QBHA 4AKEA 1R0WA 3HU3A 1QHSA 2OESA 3N5CA 2QMOA 3U3OA 8OHMA 1S3SA 1RIFA 4AK9A 2AFIE 2CHQA 3PG5A 3ZVNA 3WY9A 1R5NA 2FEMA 2AD5A 3EARA 4JL8A 5GADl 3RANA 4G5GA 3A36A 4LY6A 4P32A 2ORIA 3FKSA 1ZCBA 3BB3A 5SZHB 3K09A 1XTIA 1Z6XA 1LS1A 4IRUB 2H8KA 3QEOA 5H1YA 1XD2B 4LBVA 3B5JA 4ZPXA 5E7IA 3EG5A 3WRYC 4YMUA 1E9AA 4FW9A 1SVKA 4TZ0A 1P60A 4EFMA 2GF9A 4XTCS 3LVQE 2JLVA 2CLSA 4WZ6A 5J4KA 5JWHA 4ASUD 1YZLA 2VRWA 2YJTD 4PC7A 3AV0B 3I5YA 4EIWA 1II8B 1G7RA 3GJ6A 1LF0A 4UNSA 4B2LA 4ZV4A 2G6BA 3AVOA 3M6AA 1E2FA 2OFWA 3Q72A 3CRW1 4TT3D 2IA5A 3FMFA 4TMTA 2GBLA 2VTKA 2H1LA 4QM6A 1DAEA 2WVJA 1G3QA 4LI0A 1P2VA 2IYWA 3RC3A 1ZW6A 1GILA 4PPQA 2W0MA 1KK2A 2DCUA 4Q1CA 4U02A 3U6BA 3GJ7A 2BVNA 3BJIC 1KDTA 5EQTA 1HEIA 4CVNA 2YV5A 1VPLA 5KU1A 2GJAA 4DLZA 3BFVA 1COWD 3K1JA 1R2QA 2ODBA 2BOVA 1T9HA 1SVSA 4TMWA 4DRZA 3M0EA 5DYIA 1PLLA 5CJ2A 4D26A 3PQCA 1XTRA 3QE0A 4RD0A 3ETLA 4TYPA 4N0EA 4Q4HA 4Z51A 3LX5A 3QF4A 2JLWA 3KXKA 4AYWA 5KSYA 1QG2A 4M1TA 721PA 1WMSA 3NKVA 2VHUA 4Q1FA 5JFGA 4NTZA 2XZOA 4LHWA 2DYKA 2WJGA 2O8EA 1GM5A 2ZTSA 3OE7D 1U94A 3THOA 2XZLA 2QGNA 4A2QA 3LLUA 3ZS9A 5TMPA 2D06A 1GAJA 2J1LA 3Q9LA 3F5FA 1W7AA 2W83A 1M7BA 1TUIA 4JYCA 4NE2A 4XIGS 3GLGB 3O47A 3PEWA 2ZETA 5FUWA 2RGBA 1XCMA 1S8FA 4Q02A 1T6NA 4LHXA 3V00A 2XXAA 2H5EA 2EYQA 4TSFD 5FTNA 5BXQC 2P5SA 3SYLA 1JEDA 4C2TA 3EXAA 3F8TA 1KOFA 4DT1A 1OV4A 4D4LA 4D25A 1LNZA 2RGNC 3FFAA 3IO3A 1UBFA 1P4SA 2REBA 3KKPA 2DWQA 2H92A 2AR7A 1R8QA 4PPGA 2N42A 3B1VA 2NZ8A 2CBZA 1TQ2A 2NIPA 2J5XA 3P20A 5KHOC 4QJ4A 3CR7A 1RVDA 1A5TA 4LDJA 2ZM5A 3ICEA 2O8BB 4DC9A 3THWB 2Z43A 3BB1A 3LX8A 3ZLJA 4BECA 3WHKA 4X8HA 4DLWA 5C4MA 2IS4A 4C0SA 1E1RA 2DFTA 3DVLA 1ZNYA 3TW8B 3BAFA 1GFIA 1ZIOA 1UKZA 1KI4A 2W0SA 2J0UB 4E07A 3OHMA 4QNRA 4B48A 5EP1A 1PLKA 4POAA 5G41A 2QGZA 1U9IC 3B1ZA 3CIOA 4Q7KA 4Q4JB 2ZJ8A 2ZU0C 5FR1A 1OB5A 2AXNA 3B8HA 2WIBA 4OK5A 3X1ZA 4A8JC 2XAUA 2IXFA 1G3MA 1T3SA 2ODWA 3VNVA 4C2UA 3KB2A 1JAHA 3NC0C 4ESHA 5L3QA 3SOPA 1K8RA 3FHCB 3HYTA 1DAMA 3O8CA 3B13B 1KSGA 1XP8A 4IEEA 3F0TA 3LQQA 2F1RA 1WF3A 4G5OA 4IDOA 4BFYA 3DPUA 1E2NA 2QY9A 1M7GA 4C7OA 1KDOA 1PZNA 4JKYA 2IL1A 1W4CA 5A5GA 2GKSA 3R7WB 3EZ9A 2OSBA 2MMCA 3S1AA 1CR0A 1UAAA 2GK7A 5EXTA 1G3UA 1MOZA 3GJXC 2H17A 2RGAA 2V7QA 3EASA 2VP4A 2PX3A 221PA 5BW8A 1Z0DA 1CR1A 1TEXA 2ZSFA 5AR1A 2JJ1D 4C0HA 2SHKA 1YZQA 1DPFA 2JIZD 2X1VA 3NHAA 4TMXA 3K09C 3K0AB 1OSNA 2JLZA 5JWOA 2VSXA 4R7ZA 4OQLA 3AQ4A 2C9YA 1P72A 1W0KD 4PANA 3UMFA 1K5GA 1KSFX 1KO8A 3BFXA 3EIQA 3SJBA 4MQBA 4GP6A 5K8TA 3LWNA 3TMKA 2YWGA 1XD2A 1R7RA 4DCTA 3CF0A 4OBEA 3HWSA 2DWPA 4D2IA 3NH9A 2DPXA 1IN5A 3IHLA 3P1JA 2EVWX 1GIAA 3NBYC 4YMSA 1XZPA 3FE2A 2C9CA 3NTUA 1CP2A 1S9DA 3E2IA 3QNUA 2ZJOA 2CK3D 4MGZR 5EXXA 5AUPB 2HT1A 1GNQA 1VCMA 2WICA 3ZZUA 2LCFA 1QBKC 1G8FA 2IYZA 2JJ8A 3QG5A 1II8A 4OI4A 4ZI3A 2GXUA 1A2KC 1GOTA 3IHWA 4RZUA 3P4XA 3WMEA 2QRZA 4PSKA 5LD2C 1YQTA 2WV9A 1RRPA 4ZIRB 2XNDA 2XOKD 2OLJA 1XX6A 1NNEA 4L9WA 3U3KA 4LHVA 2JLQA 1LTQA 2ZIAA 1XTJA 2PZEA 1JR3E 1EFRA 1SVOA 2ECKA 5JSZB 1G291 4NZYA 2HF9A 2WPDD 5EE3A 2JCSA 4TWZA 1XMIA 2ONKA 3I3SR 5EP2A 1YZNA 2QRNA 4DLSA 1NKTA 3TQFA 3QXCA 4LJ5A 2J0VA 3GJ4A 1CLUA 3VR2A 4US2R 1DO2A 2CVHA 3L0SA 4BEJA 5EJEA 2ZI6A 2H57A 1KI3A 4OQFA 1W46A 1ETUA 4KODA 2QMEA 2J0QA 3CH4B 1G5TA 5EZ5A 1XWIA 4BLRA 1ZM2A 4QJ5A 1BO6A 1Z63A 2OCPA 4MRPA 1VKJA 3VHLB 2O0JA 3SBDA 1CR4A 4LCBA 1FPMA 1E9CA 4QC2A 3X1YA 1YRBA 4PR0A 5AJVB 1KZGB 2Q6TA 1KO1A 3I62A 2RGDA 3D8BA 5TB5A 3FWYA 4O3MA 1WCV1 5UKDA 4ZCMA 5P21A 2PH1A 3CF6R 3GLGA 2J7PA 3RYTC 2IHBA 4MDEA 1V5WA 1S2MA 1P3JA 5BN5A 2C04A 4D0GA 2WTUA 3L0PA 3IKJA 1A82A 4P4SB 5L8VA 4MRVA 3K70D 5LPNA 5HPYB 1NBMA 4M0LA 4BLQA 5FOTA 1E3MA 1X86B 1P75A 3TVDA 1H65A 2ZRGA 5EUMA 2O5VA 2C99A 3H2YA 5TY0A 5LB2A 4EJSC 4BLTA 2AWNA 1JBKA 5JEEA 3NH6A 2Q3MA 4RY2A 2D74A 2O8BA 2ZJAA 5DHFA 4B32A 4I81A 3THWA 3ZIAD 3N2EA 3ADDA 3G0HA 1KI2A 3K0FB 4WXPA 1DVRA 4M53A 1P2UA 4LSGA 4JVLA 2WKPA 3QI2A 2C96A 2QU8A 4NPHA 3CR8A 3DOFA 4FIDA 4PHGA 3TRFA 5M04A 3M4YA 3T1TA 1IONA 2ZRPA 3A1VA 2J0UA 1I2MA 1D2MA 2PL3A 3EC1A 1G7TA 3FYHA 3T1QA 4DZZA 1A1VA 3OESA 5L3VA 3B82A 1W36C 2G0TA 3CO5A 2PZGA 4GOKA 4Q4JA 2XB2A 3SJCA 3AP1A 4Q1DA 4A6PA 1ZMXA 4R9UC 3QEJA 2JAQA 4RFVA 1AS0A 1G6HA 4MRRA 4V02A 3FDIA 4AC9A 2Z0MA 3QXHA 4YXWA 3BE4A 1E79A 3CPHA 2VF7A 3ZJYA 1S3GA 2I1VB 1XMSA 5JLJA 2WWYA 5J4LA 2YWHA 5DI3B 1UADA 4JLKA 2ZYVX 2C95A 3K0SA 2OHFA 1XJ0A 1Z07A 4G0NA 4PC1A 1UEIA 1OXXK 4FXPA 1DOAA 4A0FA 4E09A 1OHHD 5CK4A 2WJYA 2W6ID 1OT3A 1VHLA 2FSFA 2ZREA 3B1XA 2ZRMA 3CF2A 2G83A 3CH5A 3TW4A 4DDUA 1U8ZA 2OM2A 4N0DA 1DE0A 1MV5A 3GLHB 3TJZA 2EYUA 2JLRA 3KKOA 3R7WA 1IN7A 2WSSA 3MSXA 1WRBA 1IOZA 2IX3A 1HURA 1MABB 1FQJA 2QP4A 1ZNZA 4BASA 2FG5A 1LFDB 2Z4SA 1Z28A 3PEUA 2P65A 1JR3D 3VMFA 1YZGA 4M9XA 4AG6A 2GK6A 3D31A 3SU8A 2HXYA 1QZXA 1W5SA 1RW4A 2Z4RA 3KJHA 4KYIB 3K0AA 1N5JA 2ZI7A 2P6UA 2VP6A 5KDDA 1DAHA 5CYPA 1N0UA 2KBEA 1QHNA 5SZJA 3LY5A 2FF7A 4DEXA 3NHBA 1AGPA 3RHFA 5LDDC 1FP6A 3PUXA 1X8LA 1A2BA 5TXGA 3ZVLA 5DGXA 1F48A 4W5HA 5CK5A 2OXCA 3LXXA 1W4BA 4D4MA 5HKKA 5HE8A 5J40A 3WYFA 2GAAA 2H16A 4A4DA 3R20A 1NVWQ 1FFHA 4XVRA 4V0NA 1OXSC 2YHSA 3K9NA 4Q00A 3QPUA 1KJYA 2WJIA 1AA9A 5FL3A 2FPLA 1GUAA 2IYLD 2CLDX 2GVDC 2ZROA 3MGCA 4MKIA 5A4JA 5FTLA 3LO5A 4KFTA 1NJGA 5BQ5A 2RH5A 1YR7A 2W6JA 2FH5B 3IUYA 5KSOA 4D4KA 1SXJE 1J8MF 1LW7A 3T5GA 1SVWA 3IEVA 4Q21A 4RKEA 1PLJA 2NPFA 3GJ3A 3TR5A 4XJXA 3SZRA 1M6NA 3LBNA 3OZXA 3KUCA 2DR3A 2GWHA 5DIFA 3W8NA 4ZIRA 2O8DB 2AKYA 3AF1A 1U81A 1Z0FA 2CL0X 3RRZA 5CB8A 4PO9A 1TU4A 4ESVA 1G3IA 2AD1A 1XPRA 1ESMA 1Y63A 2QP3A 3SEAA 1UBGA 5J4VA 1GWNA 2A3RA 3K53A 1EX7A 2QI9C 4DSOA 5JSZA 1K5DA 1YR6A 4B3GA 4PSVA 5FPKA 5C4GB 1T4GA 5GJVC 4B3FX 3E1SA 2R6GA 5JCPA 2R65A 5FL7D 2OBNA 3UATA 1TTTA 3Q8XB 3HPRA 1AQUA 1GZSA 2NO1A 5ELXA 5DSZA 521PA 3AKCA 4P33A 3SI7A 4E5UA 4ON9A 1Q3TA 1E2MA 1QVAA 1YU9A 2I1QA 1D6JA 4URXR 2MSDB 1LB1B 1XF9A 2OAP1 1Z29A 3CUEF 2GAOA 5F98A 1HV8A 1N5IA 3OEEA 1TMKA 4HDCA 4OJKA 4QM7A 1VYVA 1BYIA 2VPPA 1EX6A 4CEIB 1UKVY 3Q7PA 2QTFA 1P62B 4B3BA 3ZVMA 2QENA 3ZGXA 4IOKA 5C46F 3EZ2A 3AVTA 2CE2X 4CEHB 1NY6A 2YOHA 2ZU6A 4KVAA 3GLIE 4M9SA 3RNLA 1P61B 4G5QA 4JJZA 2ZJBA 3CKLA 2F55A 3OEHD 2GHIA 2PEYA 1R0XA 4GZMA 4KFRA 1IHUA 4P4SA 4TYNA 2QZ4A 3GEIA 2G1KA 3A6PC 4O0MA 5CDFE 3H0KA 2QAGC 5DN6D 4CF7A 2WZQA 4XSGA 2AHOA 2XJ4A 1Z0KA 5E4FA 2QM7A 4XWAA 4PC6A 3M1IA 2KE5A 4M1KA 2PLRA 4DVGA 2GESA 2VHCA 4I99A 4DUGA 1TQ6A 2Y8EA 3QIAA 5C18A 1AKYA 1B0UA 3GMTA 4G01B 4FWIB 3GJ8A 1UJ2A 1X1SA 3ZQ6A 1NI3A 1G5RA 1KNQA 4RKFA 1WE2A 4A0GA 1V43A 5JHGB 4EJSB 3K0FA 4BGDA 1FNNA 3TSZA 4NP6A 5TV2A 3AF0A 4UKDA 1OIWA 5L3RA 1KK1A 4B75A 4LRWA 4HB0A 3R9WA 1EESA 2H18A 2IUUA 1XJCA 1E99A 2CL6X 5K8UA 3PXGA 3KKQA 1PJRA 2NPIA 4AG5A 2WSMA 3VHXA 4FWTA 3THYB 4URWR 2YC4C 4F4IA 3AVYA 3E5HA 3TSOA 2XX3A 1VIAA 5AJXA 1W36B 1W0JD 3MUFA 1U9IA 3LA6A 2FPKA 1Z47A 1DTSA 2QG6A 4Q7MB 2CHVA 2V1XA 3QF7A 1ZU5A 4V0OA 4HATA 5DI3A 2BBTA 2GTPA 2G0NA 4QGGA 1Z3IX 1F60A 2WJJA 1ZD8A 3ND8A 3OFNA 2IUTA 4ILEA 2JLUA 1LV7A 1RRGA 3EZ6A 1H8HD 1JI0A 2E9SA 1A4RA 2Q0HA 3AB3A 1NL3A 1EGAA 5BN3A 1SXJD 5DO9A 5A0FA 3D3QA 3C5CA 3GLHA 1U8AA 3RRNA 1CKEA 3OF5A 1BOFA 4NCJA 1OLOA 4M21A 5BWMA 2J0SA 2IS1A 3I1FA 1IY2A 4GOJA 2EU8A 5GJWC 2BEKA 1F6BA 1R5OA 3W34A 3PUYA 1MABA 3AKDA 5B30A 1SVLA 5EE9A 1OPXA 4ZDIA 4QXAA 4KV9A 1E9DA 2GEDA 1NJFA 1XEWX 5AJWA 1FUUA 1E0JA 2VQSA 4PTLA 4A0HA 2OV2A 4HLCA 4W5JA 1QHHB 5FPSA 1HT1E 4RCZA 4FMBB 4H9GA 3RSOA 2EFEB 3T35A 3BD9A 4HLDA 1I4TD 3DMNA 4BLOA 5CITA 3IBGA 4JSYA 3L2OB 1CR2A 2GILA 3FKSD 4XWKA 3CWQA 2BC9A 5IK2D 2VIIA 1U98A 2J7KA 2O8FB 2ZVQX 3CPJB 2RAPA 3FHTA 4K81B 2GCOB 2GXQA 3C4JA 4XSHA 4DLVA 5JCZA 1XEWY 3I8XA 2WAXA 4O25A 3FMPB 3C16C 3ZS8A 4DLTA 5FBQB 1GKYA 4G3XA 1PV4A 1X8JA 1UDWA 4RVCA 1Z83A 2QN6A 3ASYA 4B2PA 1G8YA 3LV8A 5F3WB 3EIEA 2AK3A 5KNBA 1P6XA 1LS6A 2VP9A 4M1OA 2GJ9A 4PFSA 3EA5A 4MITA 2FWRA 2EWWA 4KO8A 3UK6A 5GJCA 1QVRA 1NSTA 3KJIA 4GNKA 2WWXA 421PA 4DCNA 2CCGA 1D2EA 1R8SA 1DBSA 2R6CA 2IYQA 2V55B 1R5BA 2DBYA 3A1UA 2O0KA 1VMAA 4XVQA 1KDRA 4JS0A 2O8DA 3P27A 1GKUB 1J90A 4TTPA 2G88A 3AUXA 3GFPA 4BLPA 5IHPA 2GXAA 1R0YA 4BFZA 1SVIA 3TSWA 2R6AA 1VIYA 4KCGA 4ASUA 2GZHA 2YC2C 5JRJA 3LBHA 1Z0IA 3TIFA 2NGRA 5FPTA 4HAYA 3JVVA 4MKGA 4PPNA 1G7SA 3U3MA 5E7JA 2UVQA 2WWGA 2GEVA 1S1MA 2GNOA 3ADKA 4LX0A 3LRPA 4Q47A 4ACBA 3JZMA 3QY0A 3IEUA 1HE8B 1E9RA 3BERA 1XCPA 4HZIA 1E4YA 2R6DA 4MUAA 3ZD6A 1NSFA 1GL7A 2WWFA 2TMKA 4UQOA 3QUSA 1MR3F 5DI9A 4BFVA 4TQAA 4A82A 1DADA 4IFEA 1GRRA 4BFUA 4IVPA 3PUWA 3AVQA 2PX0A 1X3SA 2NOAA 2IXEA 4Q9HA 1BH2A 1AS3A 2ERYA 2B8TA 2X19A 3IIKA 4Q66C 3DEFA 1EFUA 2CEAA 2BKUA 3UANA 4PAOA 1OH8A 4ARZB 1KI1A 5E7MA 4CEIA 1YVDA 3SHFA 1TPZA 3B78A 3VR4A 2OEPA 2BMDA 4ZCIA 2P6RA 4CEHA 1U0JA 4Y0AA 4YC7A 2ZPTX 2GCPA 4RCYA 4PZYA 4TTRA 1UF9A 4ABYA 2NQ2C 2ZRLA 1WXQA 4HUTA 4TMZA 4LOAA 4I1UA 2G9NA 2YINC 1L2TA 2HLDD 1GITA 1LF5A 3A37A 4KVGA 3AP2A 3OE7A 3QQ5A 5DISB 2WWIA 4M1YA 4QHTA 1E2LA 3RSLA 1E4VA 2R44A 3AF3A 2XGJA 1NVXQ 5H70A 4KAXA 5KNDA 2QROA 3IBYA 4DDTA 4L4UA 4FI3C 3UWKA 5B57C 2BJVA 4K46A 2KB0A 3N70A 2A30A 2IYYA 1E2KA 2QAGB 4WXRA 1F5NA 4B47A 3X1WA 1KK3A 3CZQA 2A78A 2ATXA 3OAAD 4DB2A 2ZI4A 2JLYA 4F93B 3HU1A 2FSHA 3ECCA 4LV5B 2ZAMA 3RS4A 1K6MA 4EJSA 1G17A 3PVSA 3MJHA 2Z6VA 2RHMA 4KI0A 4QJ3A 2OBLA 5FI1B 2I4IA 1YE8A 2BHRA 2P6NA 2QPAA 3L0OA 1RJ9B 4NL4H 2D2FA 2X2FA 3HU2A 3HDTA 5FOVA 3THYA 4PAQA 2F43B 3X1XA 1XJQA 4KSCA 4OYHA 5L3SB 3A58B 4NYMR 1W48A 4GMXA 2FFBA 3FFBA 2QBYB 4URUR 1VDZA 3AUYA 1ZBDA 4JT4A 1DS6A 4HLUC 4NDZA 1G18A 2HJVA 2O0HA 4Q48A 3SFVA 4F92B 3EZ7A 3UKDA 1NY5A 3GFTA 5AUQA 3TH5A 3CNNA 4TQ9A 4JLDA 1QHGA 5DH9A 4QBIA 5EE5B 2ZRFA 4OJQA 1F2UB 4Q9JA 1D9ZA 2R2AA 3IGFA 3ONWA 1JR6A 4PSAA 1IN6A 5TVKA 1JECA 2ORWA 1UKEA 1W4AA 3LQRA 2QNRA 1FL9A 4B3DA 2BKEA 4EFNA 2ZE5A 2FOLA 1E9SA 2WBLC 2FZ4A 5CM8B 3AH8A 4ERNA 4KSBA 4C0BA 5GVSA 3HJNA 4FD2A 4IDNA 2YYZA 1XTQA 2BWJA 2FX3A 1EFTA 4RJLA 3RRMA 2VHJA 4G5SA 2FMXA 1QHHA 3AKYA 1W2HA 3GJ5A 1HT2E 4H1UA 1ZM4A 2C2HA 4L8GA 4JLJA 3G82C 1G19A 4JVSB 4WA7A 2X77A 4LUCA 1TF7A 4LJ9A 4G5RA 5TARA 4DHEA 2NO6A 2RMKA 1US8B 3NVAA 1E9FA 4M2LA 3H1TA 1U2RA 1VCOA 1G41A 1QG4A 2F3RA 1EK0A 2O8FA 3LBIA 4V0ME 2ZS8A 5LB4A 2QSZA 2GCOA 4NYIR 2C9OA 2P67A 1M74A 1GTVA 1Z2CA 1UBCA 2IYSA 1JXMA 5IT5A 1E2EA 3SYNA 2JJ1A 3PUZA 1KI6B 4C0QC 2KBFA 3MD0A 4TTQA 4URZR 2BM0A 2PEZA 4AIIA 3BORA 5KDLA 1W0KA 3KQLA 4TZ6A 1BMFD 4WZAE 4JL5A 5SZKB 5FOWA 2ZJ5A 3V4FA 5FBVB 2N1BA 3CNLA 2ERXA 4C30A 4PQRA 4FCTA 1GRNA 2XNDD 4U00A 3QBTA 4ZDJA 3FB4A 1NMZA 1W47A 2KWIA 3BBPA 1L8QA 1E1QD 2CK3A 2CXXA 5AUOB 5JBQA 4XD7D 2BJWA 3OIYA 4CT4B 4AKHA 3ZVRA 3A4NA 1E2QA 1AS2A 5IF9A 2AL7A 5FUVA 4GI7A 4BPBA 2OE2A 3B60A 1DO0A 3LXRA 4PAMA 1PVOA 1HUQA 1KSHA 2FN4A 2I3BA 3O8BA 1PUIA 3BH7A 1D5CA 3U60B 4PC2A 3NWJA 3BS4A 4HAWA 2XOKA 3IQXA 2W58A 4L9SA 4MH0R 4D0NA 3T1VA 1P5ZB 1P7CA 3L0IB 3P4YA 2ZRAA 5CM9C 3VX4A 4DIEA 4HAZA 1YZTA 4A2WA 2LKDA 3QXSA 1T5LA 2WPDA 2JA1A 1ZD1A 4O2LA 4YMVA 1W4RA 4HYYA 2RHDA 5JI3E 3MG9A 1DEKA 1D8TA 1BKDR 3CBQA 2VBCA 2PJZA 4BWYA 1T0JB 2YOGA 1OE0A 2GZDA 4PZLA 5CB6A 2C98A 3QENA 4ARZA 2ZR9A 2FU5C 1AZTA 4Z1MD 4JYBA 5B2ZA 3ADBA 2QT0A 2J7PD 1N0WA 2OBMA 1FNMA 2IYVA 3WP1B 4EPVA 3BB4A 1ZD9A 3ZYCA 4U5XA 4YMWA 2OXRA 2NTYC 4LZZA 1IXRC 1NBMD 4BFWA 3U44B 4AY2A 3CRRA 2HT6A 2ZI5A 4US0R 4IW3B 4A6XA 5K8IA 2JGNA 1E98A 3SN6A 1CULC 1U99A 1N25A 1GRQA 1G9XA 1FX0B 4TN1A 3RDPA 4DBLC 3SFZA 1OFTA 2QAGA 3AVWA 1E2PA 1OFIA 1ZM9A 2HUPA 3QJYA 4EPYA 2Q3FA 2FEOA 3MWKA 3UXMA 2ZVPX 4IEIA 4LBZA 2ORVA 5EXPA 1E0AA 2OUKA 2HCBA 4DDWA 2ZSEA 3TR0A 4KLZA 1E94E 3B9PA 2HJGA 2ODNA 2ZSAA 1J99A 2REXB 1KI8A 4DCVA 4PHTA 1S96A 1NIJA 1AQYA 3VKHA 3DKVA 3CB4A 3V9PA 1NVVR 2ZYTX 1FMLA 1RJ9A 3W5JA 1OXTA 4TQUS 3C41J 2F43A 3QXXA 3Q5EA 2ZJ2A 4HDQB 5L3SA 2FDCA 2VO1A 1WQ1R 3I4LA 3ZIAA 2WM9B 1T8TA 1NVUQ 3KB1A 1U8YA 2QBYA 4AI6A 1E79D 3KQNA 4XOIA 1N6NA 1Z06A 1KI7A 1U90A 4Q7LA 1DELA 2YVUA 1YHNA 2ANBA 4GFDA 4RD3A 2WOJA 5CLLA 1E2DA 1T5IA 4P0TA 3R8FA 1F2UA 1FUKA 2ASEA 3SQXA 2ODEA 3VKGA 2ZR7A 4GT1A 1Q0UA 4EKDA 3U4QB 1CF4A 2HDNB 2NO0A 5D3MB 1GSIA 4LYJA 1AIPA 4B35A 4UJ5A 1T3LA 2EFGA 2F9LA 1DG1G 3UWOA 2ZJYA 1J2JA 1VCNA 4Q1BA 1AJEA 2JJ2D 4NU0A 2C5LA 3CPEA 1VG1A 3KXIA 1CS4C 1XTSA 1JEEA 4PXAA 1ZUNB 1OHHA 4OK3A 1E69A 1C9KA 3AEZA 3PUVA 1ZP6A 1MRNA 3CRQA 3DL0A 3EPHA 3LD9A 1OYYA 3PR1A 1RZ3A 5FOUA 1TL7C 3AP3A 1SXJB 4CW7A 4F91B 4CGZA 4LHYA 4UXJA 3SS8A 1E2JA 1XD8A 2J41A 1MT0A 3PV0A 1US8A 3HR7A 1IBRA 2FSGA 2IHYA 4A1FA 4NYMQ 1GL6A 2C03A 3B85A 3LW8A 4KJZA 3ZQJA 1G8PA 3WMGA 3OIWA 5FTKA 5HKKD 3NDBB 3G5UA 1KO5A 1OF1A 3LFUA 1Q12A 5G53C 4EUNA 1RYFA 3SBEA 4L5BA 2HYIC 2J59A 2WOOA 4JBYA 1SVMA 2FFHA 1JR3A 4TL7A 2D7DA 2Q3HA 4II7A 2OT3B 2CHGA 1KI6A 1N5LA 3KL4A 3KJEA 2PMKA 2LWIA 1Z5ZA 1II9A 2X8AA 4DXAA 3TGPA 4D0LB 3U3JA 4PO8A 621PA 4I1OA 4E03A 3ZD7A 4UXIA 2MMGA 4JBWA 2WJVA 1CJMA 4LBWA 1EFHA 1AN0A 1W2GA 2Z83A 1TEVA 3JZAA 4RD2A 4TLBA 4JLBA 1JJVA 2FV8A 3B9QA 3VR6A 4M9ZA 3ICQB 821PA 3NIBA 2ZEJA 4KBFA 3RS2A 5FR2A 4KU4A 2J87A 2JDIA 4RZ3A 3SC3A 1HH4A 2PT5A 5BYJA 2QP9X 1J7KA 3KQUA 2BCJQ 1R6BX 4OHYA 2OG2A 2VYFA 4YMTA 3EWSA 2CMKA 4CEJB 5HTKA 2A5GA 3WHLA 3B1YA 3EPLA 3TUZC 2OFXA 2J45A 1VYTA 1OW3B 2IBMA 3Q7QA 3GCGA 1KHTA 4BEBA 1TQDA 3DKPA 1Q44A 4JLAA 3VU9B 2FFQA 3CNOA 1XPOA 4B6EA 1P2SA 3IQWA 5HZHA 2F9MA 4B76A 5IRCD 3GLIB 3VNUA 1ONBA 3KQKA 4NYIQ 1H8EA 4OHWA 4Q9LA 5B64A 1FTNA 3A1SA 1Z22A 4BLSA 4Q5IA 3NBXX 4DSUA 1W1WA 4KFSA 1AM4D 2IWHA 5G3YA 1QDEA 3BIFA 1CBUA 1TUEA 1KNXA 3H4MA 1OKKD 1OYWA 1E9BA 1NN3A 5LBIA 2V8OA 3DM9B 2QPTA 1GG2A 1TU3A 1JB1A 5DNYB 2A2ZA 1IJEA 1IAQA 1S1CA 5HCIA 2ZRJA 1W5TA 4GOXA 4IDHA 5HE9A 5AJYA 1IY0A 2QE7D 2A5YB 2V1UA 4BFTA 5EE0A 4YDHB 3U7FB 4WVFA 4HLQB 4NYJR 3TVTA 5AJZA 3TNFA 1XTKA 1EWRA 2ZS9A 4RD4A 4URYR 2CCKA 2BV3A 4A92A 4D82A 1KZ7B 4WIAA 2VLIA 5C1BA 1ZUIA 5K8LA 2KJQA 3L82B 2A9KA 4R2IA 1QHXA 2XZPA 4P4TA 4MDFA 1NG9A 3RS3A 4JVNA 3OIVA 3AVXA 3ADCA 4LJ6A 3QG1A 5KSPA 3U44A 1XXHB 1CRQA 3QPWA 3VR5A 3KXLA 1WP9A 1TADA 2RCNA 3IPYA 1RYHA 2XNSA 4C9BA 4D4JA 1N6KA 3O8RA 4W7SA 2O8CB 3KDSE 2XSZD 1FX0A 4EAQA 4HB2A 2XTMA 3AF2A 5KOYA 2VP5A 3W9YA 1EG7A 3FMOB 3K70C 1XMVA 2MSCB 2YKGA 2FNAA 2OCAA 1XBTA 1KDPA 5JJLA 2JASA 1QF9A 4QG7A 4F38A 4HEJA 3SE0A 3TLXA 4B74A 3WYGA 2PJRA 2CDNA 1G3RA 2ZYWX 1M34E 2B7CA 4JJKA 4MUBA 5DN6A 2FA9A 3RS5A 4QNMA 1W49A 4YQFA 1XXHE 3U61B 1WBBA 3AVVA 1FQKA 1WA5A 2NG1A 1ESNA 1OIXA 1BIFA 3BGWA 4ZDWA 2RGEA 3ASZA 4OQNA 2WWWA 4BUJA 4C4PA 2XB4A 4E22A 5JWRA 3QKRB 4Q9KA 4FN5A 1UKYA 1HQCA 4RZ2A 1R4AA 3TAUA 5EXSA 2ZUCA 1DAKA 4NH0A 4OK6A 4A0RA 3RLFA 3K9LA 4LPKA 2CVFA 2JEOA 3SR0A 1SGWA 4GZLA 4JKIA 4QGHA 2ZRCA 1XEXB 2OCBA 1XCGB 4HLUA 5G3ZA 1OIVA 2B21A 2D4HA 1YR9A 4G1UC 4B3XA 4ZKDA 3SJZA 3E70C 5FBWB 3BH6A 1VYUA 3UPUA 2IXGA 4LJ8A 1X1RA 1ZAKA 2DFKB 4Q4LA 4QGFA 3W90A 1Q21A 1TQ4A 4X8MA 3U4QA 5F9HA 3SYKA 4U7DA 3NBZC 1HYQA 2GDJA 1N6LA 1UPTA 2QT1A 5D3MA 5FOXA 3WNDA 4BZQA 1XMJA 1SZPA 1Q1BA 1QHYA 1W0JA 2K5UA 2ZANA 2ZS7A 2QUZA 1JQLB 3WRXC 3K9HA 4UJ3A 1G6OA 1M2OB 2FE4A 3LVRE 3AVUA 2CNWD 1IY1A 2ZRHA 4YDSA 3MAAC 3EA0A 5GVRA 1KAGA 1FMJA 1CJVC 1H8HA 2E87A 2NZJA 3NEJA 1B23P 2PLFA 2F1JA 4RFSB 2V4ZA 1ZC3A 2ZJZA 4DEYA 1SXJA 4DKXA 1MO6A 4XWOA 5J5CA 1GKIA 1I4LD 4IXMA 1NKSA 4CYMA 3RC8A 1XNJA 4Q9IA 3D7MA 4P4UA 4TL9A 2EFCB 2VA8A 4HI0E 2FFAA 3BRWD 4JIMA 2G3YA 3P26A 2AXPA 5JS7A 4IOJA 4FCVA 3K8YA 3GEEA 1A7JA 3J81k 2ZRBA 2N46A 4LWZA 3PEYA 1CIPA 3GJ0A 3O8DA 3U3RA 5FBLB 3FPAA 2ZE7A 2A5FA 3EPKA 1N6OA 4LPSA 2AK2A 3Q85A 4NCKA 3AKEA 2RB4A 2QQEA 2GZAA 2W00A 4HB3A 2W2XA 3EAQA 1JNYA 2LKCA 2WKRA 2HEIA 5CYOA 4BQSA 2JLXA 2RGXA 1CEEA 3LAWA 2Q21A 2V54A 5IK2A 5J47A 4AYXA 1JAIA 2DWOA 3DMDA 4PO1A 5GJBA 2VSFA 4M1MA 1ZNWA 2D7CA 3IILA 3RVBA 4BFSA 4OI2A 4NBSA 5KTYA 1CRPA 4B73A 3KQHA 4WZBE 4MGIR 2HCJB 1Z2AA 4JLVA 3FMIA 4CEJA 2ANCA 2PCLA 2IWRA 3UIEA 1BS1A 1G64A 3NXSA 4LHZA 1YZUA 2MSEB 4US1R 1CJTC 4MGKR 3R9IA 3EWAA 4KITB 3TBKA 1SQ5A 2IEZA 4MYTA 3RWMB 3VU9A 4IHQA 3U7EB 1XFAA 1C4OA 4CDGA 1NRJB 4MKFA 4D6PA 1D9XA 1X6VA 2BMEA 2BIFA 2IUSA 2XJ9A 1KGDA 4V03A 4DSNA 3GLIA 1S0UA 3KKNA 5HR5A 3ZH9B 1T91A 1U0HC 4KBGA 4TLDA 3CZPA 2V6JA 3MRSA 3W5IA 4Z54A 3L8ZA 3AM1A 2IEYA 1XPUA 5CDFA 4JLMA 4LBYA 1COWA 3EX7C 1YR8A 1VTKA 2YOFA 2D3WA 3W6OA 1ZCAA 4KXFB 4QL3A 1QHIA 3A1WA 3I73A 2DY1A 4MA4A 1XEFA 4LJ4A 5EP3A 4HB4A 1U0LA 2V9PA 1N0VC 1FOEB 3EIHA 4LC1A 2AX4A 2OILA 3OIUA 3IIMA 5KSZA 1SHZA 4CZ2A 5JS8A 1YZKA 3LLMA 1R0ZA 3GLFB 1TF5A 4ZKEA 4B34A 3P32A 3I8SA 3WXMA 3T61A 1XXHA 3MWYW 2Q9CA 3RRYA 1Z0JA 2OLKA 3CWZA 1NN5A 2ZXUA 4NHOA 3NBFA 4EPTA 2JLSA 2O8CA 4PHFA 1XDBA 3REGA 3VTKA 5JZVA 2L0XA 1OH6A 1IM2A 3WNBA 3FKQA 3NC1C 3H84A 4AKIA 4HUQB 3EPJA 4JMPA 3CM0A 1ZUHA 2AWOA 4M22A 4A15A 4LYAA 4TSFA 2JATA 3UMRA 2HLDA 1WBDA 2IT1A 4OKSA 1Q1EA 4DDVA 3K70B 1E1RD 2GJSA 4LV6A 3WP0A 1E2HA 2R9VA 4W5WA 5FUYA 4EFLA 3GLFE 2GEUA 2XTZA 3MFYA 1Z6TA 4K8OA 1EFCA 4OQMA 4NYJQ 1D2NA 2AN9A 3T5DA 4OI0A 2KSQA 1XU4A 2HV8A 2W2TA 1OJLA 5H68A 3GLGE 3OAAA 3QKRA 1L4YA 3ZZTA 1W36D 1IN4A 1XZQA 2GRJA 1BYUA 1KO7A 4HAXA 4P3YA 3TK1A 3I32A 2PZFA 3UG6A 1NN0A 5KYKA 5FPYA 4TYQA 3L8YA 1NP6A 1EWQA 4V0KA 4LJAA 1NBME 4Y0VA 1TAGA 2HYDA 1YKSA 4XVUA 1TNDA 1XEXA 4I1VA 4IVQA 4QBFA 5TDHA 3GEHA 2GETA 1JQJC 2EQBA 2YWFA 3DZDA 3KZ1E 4LYFA 2OO7A 1P73A 2P0EA 4FCWA 4PZZA 1KIMA 4CIDA 5B58C 2PCJA 4JL6A 1KSJA 1OFUX 3PFIA 1P9RA 1SHKA 4TYYA 3DHWC 3MMPA 4B43A 1AZSC 3SNHA 2IYTA 1N3BA 2V7QD 4L15A 4UNRA 2FGJA 4F4JA 4RD1A 1KY3A 2IW3A 3ND9A 4MRSA 4WOPA 1G16A 1SXJC 2WJHA 2ZRKA 5ANRB 4EPRA 5EE1A 5JI2E 2F6RA 4Q7JB 3WMFA 3QSYA 3W3AA 2ZE8A 1MH1A 1GNRA 1S9HA 1KJWA 1GP2A 2AKAB 1JPJA 4Q03A 3WBKA 2ZYUX 4RFSA 1JPNA 4HDOB 4NONA 4R98A 4F7WA 2FSIA 3AGQA 3KFVA 2QPOA 4TLAA 1O3YA 2ZSBA 1N6IA 1II0A 2A7QA 3C5HA 1OXUA 5F2EA 1NLZA 4EPXA 3DO6A 1KY2A 4BZPA 1AKEA 2ZI9A 2FGKA 2ZUBA 5FTMA 3GPLA 2REOA 1UEJA 4UNPA 2ZE6A 3AVPA 2B6HA 1JXOA 2VL7A 2QTVB 2JIZA 1L7VC 2Z5FA 2FZLA 4AYTA 2A5JA 1LY1A 3FHOA 1E0KA 2Q9AA 2VP2A 3B1WA 2BMJA 2BCGY 4MYHA 2GJ8A 4LYHA 4WBSA 2X2EA 4CRWB 3U6KA 2RKOA 2B8WA 3CONA 2BM1A 3NG1A 5HCNA 4B44A 2ZRNA 4TMVA 3FTQA 5AUNB 2J46A 2QQ0A 5F9FA 3C8UA 1IXSB 2ZSDA 4NKRA 5DE3A 3SQWA 2YNMA 3CX7A 4JBXA 1M8PA 1N2CE 2WWHA 5EUQB 4YONB 3LDAA 1EFRD 3NDPA 4C3ZA 1GL9B 4B2IA 5FTJA 3CX8A 5AWFC 2KI5A 5FH9A 3F3YA 4GP7A 2GCNA 2GBLC 4IXNA 2G1JA 3I92A 1BMFA 4M1WA 1G4UR 2Q9BA 2WHXA 2QTHA 1Q22A 4AWXA 4B33A 2ATVA 3GP8A 2ONJA 2CJWB 5DHAA 1R10A 3QBVA 4BRUA 4MRNA 1RRFA 4WW0A 3RWOA 1M1YE 5C2JB 1N6HA 2O52A 4GL2A 3EZFA 4TLCA 4JZKA 2VEDA 5FI0B 4OHVA 4N1AA 3W3ZB 4EQ6B 1E1QA 2XEXA 1F2TB 3R8CA 4Z8YA 4V0LA 4XD7A 3BWDD 1F3OA 4MYUA 2P5TB 3DM5A 3H86A 2E1RA 4UXHA 3WNCA 1I2DA 1NF3A 5G40A 1HQYE 3D6TB 3DOEA 3KTAB 2BBWA 3WBJA 4DCUA 4NCIA 1SKQA 3PEVA 5H8WA 1AGRA 1KKMA 4P31A 3W8RA 2OAQ1 4UNQA 4OHZA 2F1HA 1CXZA 2P3SA 5E95A 4DLRA 2D62A 5JEDA 4KYUA 3TKLA 3QKTA 3GLFA 1MO4A 4IDQA 2VSOA 1ZIPA 2ZQ5A 2BEJA 3CX6A 2A5DA 4QHSA 1CJUC 2CLCX 4IJMA 4Z1MA 2GA8A 4GPTA 1DARA 2XITA 1ZINA 2P2LA 2EWVA 4OQXA 5HZKA 2UZIR 1ZM7A 3HYRA 3QPVA 1ZM3A 2ZITA 4HUQA 3PENA 4J0QA 1ANKA 2CL7X 4Q19A 3VFDA 4A36A 4QBGB 2GXSA 5EP4A 4C0JA 2QORA 1G8HA 2EFHB 3LNCA 5CJPA 2IYRA 1ZNXA 3B2EA 4LV8B 1CJKC 1E9EA 1MO5A 1G5PA 2WMOB 3MJRA 2BBSA 1TX4B 4HZUB 3I72A 2ZRDA 3QOFA 1UBEA 4Q4AB 3L43A 4B6FA 1JALA 2YZ2A 3FVQA 4ZDKA 2VHQA 2IK8A 2QMHA 2DFNA 3THXB 4BE7B 2F3TA 3DDCA 4QHYA 1KAOA 4NCNA 4TMKA 4YXWD 4DIDA 1ELOA 3C7KA 4LJ7A 1Z6GA 5KDOA 4DB4A 3QXJA 4KHZA 1HE1C 3W6PA 3BK7A 1FP7A 4X8LA 1KYIA 1W44A 4EDHA 1HA3A 3IO5A 4GBMA 2QM8A 2WAYA 5CIQA 2QEQA 3U5ZB 3A8TA 3IDQA 3HPQA 1VG8A 2OCYC 1HY3A 2R8RA 1DG3A 5KUTA 4V0MA 2WSSD 1KMHB 5DYGA 2C8VA 2V6IA 3IPXA 2H7VA 4A2PA 1N5KA 4A8JB 2QSYA 3IIJA 4OI1A 2AFHE 1ZU4A 2OZEA 1FZQA 4AURA 3K0CA 1VECA 4L16A 1Z8FA 1X8KA 3I5XA 1OFHA 3A4LA 3VR3A 5D3QA 1IJFA 3K0EA 3QKSB 3SHWA 4XH9B 1Z08A 3EC2A 3K9GA 4FMCF 2W6IA 2IC5A 3BH0A 1KI9A 4R2HA 5KO2A 2CE7A 1C1YA 3A1TA 3CRVA 1Q20A 3GFOA 4GSYA 1E0SA 5IDVA 1Z0AA 3A4MA 2FPMA 4BZXA 4C0KA 1N6PA 3QVUA 3JVUA 1Q3HA 3RAPR 1RE0A 1J8YF 3T1OA 2UZ3A 3X2SA 2V3CC 4LJYA 2JJ2A 2NO7A 2QA5A 5SZIA 3Q3JB 1OB2A 2BMFA 3LW7A 4TL8A 2CCJA 1EXMA 2IF0A 2QAJA 3ZDQA 4H1VA 4PHHA 4KLNA 4ACAA 2GJKA 4DLXA 1CU1A 4ZO4A 4Z8XA 3LH5A 2W6JD 4S2EA 3CLVA 1Z6YA 4UNNA 5CIWA 4N3NA 1T8UA 2IYXA 3GLHE 5FPHA 1O87A 4D80A 3WYAA 3RABA 1OH5A 4M4SA 4FINA 2ZI3A 4Q1AA 2JDID 3TAHA 1XRJA 2NMVA 1G7CA 3KFXA 3QVVA 1VG0B 2J9RA 2VF8A 3EW9A 2IYUA 1Q57A 4XTRA 4I1SA 1KK0A 3N2IA 3QKUA 3BOSA 2YWEA 1ZJ6A 3VQTA 3X1DA 3PIRA 4ZCLA 2EW1A 4TT3A 3T34A 3AGPA 3BC1A 1XB2A 4M9QA 4B71A 1TF2A 2WIAA 3MCAA 3KX2A 2D2EA 2RGCA 4EPWA 1P9WA 1NN1A 5JJIA 2CJWA 1E2IA 1H8ED 3HP1A 3U2QA 4CT5A 1ZVQA 3AF4A 1DAGA 4RD6A 4QFMA 4QOSA 2F7SA 2GF0A 2WKQA 2DHRA 1E96A 4DSTA 3W6NA 5LD2B 4M8NE 4IVRA 2DB3A 5FUXA 1VHTA 1YJ5A 4EQ6A 1Q1QA 4JLPA 1F2TA 1KTVA 2BBOA 2ZUDA 4JVMA 2R62A 4QKQA 4TYWA 1VG9B 1Q1ZA 1T3HA 5E3HA 4F4CA 6Q21A 1RPZA 2IS2A 1ZC4A 4ITRC 1GVNB 3I61A 2F1IA 3OEED 4PPFA 1NMYA 2DFLA 4QRHA 5JMTA 2HXSA 5FL7A 4R71A 3MWLA 4C0AC 5FBRB 1RRCA 3PJRA 4IKEA 3B7GA 4Q4HB 3KUDA 3QF4B 4LGMA 1WB9A 1N6RA 1ODFA 3ZZ0A 3FOZA 1CTQA 3KTAA 3TE6A 4FMCB 4DWJA 1ZRHA 4PQYA 1S4QA 4AKGA 2O8EB 1OKKA 4MGYR 1Y3AA 2QMUA 4LK2A 4I4LA 3UG7A 4TL6A 3UMSA 3VX3A 3VAAA 3REFA 3T15A 4FMDF 1KJZA 2PT7A 4JSTA 1UFQA 2C78A 4MYCA 1KMQA 4NCHA 2IS6A 3C14C 2B92A 2QE7A 3TUIC 2ZR0A 5AK0A 4IDPA 1ZYUA 2PMDA 2G77B 3MWJA 1L4UA 3BXZA 4WAUA 1WDTA 4PX9A 4DUGD 5KNCA 4HAVA 2XXAB 3CRMA 5J4YA 1VCIA 3HR8A 3V4RA 1OH7A 4W9MC 2GVZC 3KKMA 4RZXA 4BFXA 4O2RA 4URVR 4PQFA 3OEHA 4ZI2A 4JT2A 4DT1B 4Q01A 4X8OA 1NMXA 5DLQC 4JLNA 4RSGA 3GQBA 5JRZA 2C77A 3FGNA 4B3CA 1Z6AA 5EZ6B 1GNPA 1T0HB 1NLYA 1P9NA 5J4HA 1OXVA 5FOSA 2J3EA
chains in the Genus database with same CATH superfamily
2GN2A 4H3SA 4BKUA 2XSZA 5B6JA 4V2IA 1TO2E 4X97A 3I6YA 1MO3A 2HWXA 2PUJA 4RKYA 1P2GA 1V37A 5C8YF 1I3KA 5DTRA 4RU1A 1QYRA 1E8DA 3KPUA 2IV7A 3THXA 1X2EA 5ESWA 4WK6A 3VKWA 5K0SA 1A50B 1IN8A 1G8GA 3OHSX 4I50B 3IAM1 3IAXA 1LXCA 2LW7A 4G97A 4MYSA 4RXTA 1SXHA 1MAHA 5KBYA 4CQNA 4PCVA 1ZMBA 4C0LA 4Q9NA 1QKKA 3NEYA 2EJBA 1SKYB 4DF3A 2PBRA 4NBWA 121PA 2DZDA 4QUBA 1KF0A 3W5VA 1XD9A 2GPNA 3C15C 2UV8A 2P1RA 1OTXA 5KPJA 1YZ3A 1WCIB 3K0HA 3CY6A 4LE2A 3WYCA 5C7IO 4B3RB 2I6XA 1LI7A 4QDTA 4OU5A 1PV2A 4QX6A 2HF8A 3L6RA 3A9VA 3Q3CA 3ZY5A 3OP4A 1I4DD 5CLQA 4EGSA 2ZRIA 3CW2A 1YD7A 2O2JA 3K0CC 4FLEA 1BTOA 4JB8A 4QEZA 5JTUA 3DT8A 5KPDA 2IPXA 1KMHA 3G2IA 4RAQA 5K0NA 3D8HA 4R2MA 2DT5A 4INAA 3FUCA 5KKAA 4DA7A 4A8JA 1QRAA 1DAIA 1N8KA 2BI7A 4QQFA 4XPIB 4ENPA 1G21E 5I8PA 4WJKB 1K6EA 4CMEA 4DILA 5MHTA 2FWBA 2ROQA 4ZO8A 2JIDA 4Q18A 2CLEB 2OV1A 5JROA 2ESRA 5JV5A 3P4UA 5T57A 1KH2A 2D1YA 1SULA 1P2TA 3OZTA 1HL3A 1CPYA 2EBWA 3TXAA 2RGGA 2P0AA 1FRFS 3DZ8A 3MCUA 1NVVQ 1EGVB 2J5BA 3NGXA 3MQFA 3F49S 4GPAA 4KN5A 5IKEA 1Q83A 2H2IA 3P9PA 3LPDA 4ZVPA 5JNWA 2VPXA 3S1AB 4NRDA 1TCCA 5JECA 3HABA 4W5QA 1RKBA 3T6KA 2EFDB 1N34B 3QPCA 4PIVA 5DP2A 3VC2A 1G4AE 2FQQA 2WP8J 3PT5A 4IF6A 1EBUA 4RS3A 1XJWA 1X14A 1SCKA 2CNWA 1L4KA 2CD9A 1L7OA 1ECFA 1FSSA 3MLEA 2AMVA 3LJKA 3OG9A 1OI4A 4QBHA 5EL0A 3U37A 4AKEA 4JB0A 4D44A 4IRMA 2AX3A 3FKJA 3QYPA 1S8NA 3N5CA 2WM2A 3R0QA 1S3SA 2VRCD 2YJ6A 1RIFA 2BCEA 2AFIE 2BE9A 4J49A 5LXTF 4DA9A 3EUFA 4F4CA 5KQMA 2FUEA 1JEYB 1R5NA 4DV7B 3EARA 4JL8A 4K6CA 3A36A 3PGMA 1YB1A 1O6ZA 2A88A 1O0SA 4N18A 1K0UA 2NQTA 2MR5A 1VLZA 1VHQA 2ORIA 3C1UA 3FKSA 4MRMA 4E5YA 4HTAA 1JG6A 1CUEA 5K0CA 5LA6A 1N1EA 3C5WP 4TKVA 1VKNA 4JROA 3BRWA 1XD2B 4LBVA 1FXWF 1TE2A 1ZQ1A 4YPVA 4ZPXA 3NRJA 4MUMA 3VM6A 1ADFA 2Y92A 3I45A 4MPDA 1U7HA 3DTYA 1KGSA 4OHUA 3H7IA 5E7IA 5HFAA 4Q05A 5LWHA 2ZAIA 2R7KA 2VJKA 1VP3A 2GF9A 4OLHA 3EDCA 1T2AA 3BHJA 5IJ0B 4CM8B 1HT3A 2Z56A 5JWHA 2Y76A 1XNGA 1B2RA 4EIWA 1II8B 2C92A 5C8YB 1ZS9A 1VE7A 4E7PA 5KCZA 3HV0A 2NU9A 1U1IA 3U7QA 3UEOA 1LF0A 4HWKA 1NW4A 3IJPA 4DR3B 1RLJA 3A0RB 3IRVA 2OFWA 1E3WB 1QWOA 4PX2A 2UUOA 1J2YA 1WXXA 2QTBA 2GBLA 3FMFA 4TMTA 4WKBA 4D79A 4KKXB 3NIGB 3SOZA 1PFYA 2E55A 1Y1PA 1O6GA 2WVJA 4KPUA 4NIMA 5CH8A 1M5UA 5I9IA 4J7XA 4HTFA 2LP4Y 3CZ4A 1KK2A 1OWMA 4ZOEA 4BKPA 1I2ZA 3GJ7A 4W8OA 3BDAA 2WG2A 1RI2A 1ECBA 4TUYA 4ER5A 5MN6A 3QKIA 4CG1A 1QC5B 1UBOS 1CRZA 1CY4A 2YR0A 2Y1CA 2PQ0A 2WNHA 3K2EA 3GFBA 2W8BA 5E6SA 5BNIA 1SVSA 4IMJB 3C6MA 3OSUA 4TMWA 3FNRA 5M29A 1NYRA 4TRNA 5CJ2A 1FVHA 2YIJA 5KHLB 3QE0A 1SKUA 4RXMA 3P8ZA 1KAEA 3GJRA 4RV4A 5KSYA 1QG2A 1ISRA 1UBSB 721PA 5I7UA 4Q1FA 2XZOA 1JHDA 1TJPB 1X7XA 4RK1A 5IJ9A 1FSZA 2WJGA 1TQHA 3LT2A 1USWA 2WD7A 3FY4A 4HAOA 2J9XB 1JWBB 2PUFA 4K6KA 4PSCA 1TYZA 4A2QA 1QQBA 1Z7YA 2D4AA 2ZGVA 1OAOA 1NPTO 3PC8C 1LPNA 3PQ4A 3ZS9A 1JSRA 4MR7B 3W6ZA 3I5AA 2JFOA 2XCQA 1KEWA 3K6SA 4EVIA 1SVNA 5E9WA 3RVSA 4BNVA 1EM8B 3QU9A 3PEWA 3DAPA 3C6KA 3OX4A 5FUWA 4C1BA 3O90A 3VZCA 1O9BA 1S8FA 3OJWA 3V00A 5BPHA 1VIMA 4D9JA 1F2VA 5LXTB 1M1ZA 2H5EA 5JG7A 4DR2B 2EJVA 1JMKC 2OCXA 2FG6C 3R0XA 3SYLA 4OOFA 4E1VA 1SVUA 3SEQA 1ESZA 2VJMB 3D6AA 1VL6A 4PZCA 4ZJUA 1OV4A 1XAIA 1ZDMA 3UV6A 4D25A 2R4TA 1KA9H 3IO3A 1KY5A 2WDPA 3BGIA 1UBFA 2REBA 3KKPA 3MFQA 3KRTA 4XYMA 3ZGYA 4BBAA 2F62A 1THGA 3ENKA 5CFMA 1A7AA 1C1DA 1IDN1 4NLLA 4E30A 1DKPA 4IGEA 1DC8A 3B1VA 3VYWA 4UHFA 4HHEA 1EGHA 4KRYA 4RACA 4D8UA 1A5TA 3FPKA 2CEKA 3DQPA 1RDFA 4R2KA 1U6KA 2XB8A 5AI6A 5JE8A 3THWB 5IBPA 3QPAA 2NSHA 1OXBB 4X6XA 3JALB 5JY6A 4BECA 3T7DA 3ZLJA 2J08A 5JAIA 4DLWA 1L8AA 1I2AA 1E1RA 1F0PA 5MFPA 1PR3A 3BAFA 3OC6A 3VU1A 1ZIOA 1UKZA 1QYCA 3G9UA 3SSMA 3RU3A 2J0UB 3DYBA 3VZPA 1X7WB 4O3FA 5IZCC 3BGDA 4POAA 3UFBA 4NCAA 5TPWA 1YO6A 1VI5A 1WM1A 1Y5LA 1T34A 3CIOA 3F8WA 4H6PA 1QZ3A 4MRAA 4PYNA 1U0EA 3NJ4A 4Q7KA 5AI4A 4Z5XA 2AXNA 4Z0NA 2OV8A 5DNCA 3VNVA 3KB2A 4QPPA 4E46A 4EKGA 1QP0A 1ZISA 2P2SA 4RA9B 4ESHA 2A33A 2LCQA 1Y7LA 3FPHA 5JIBA 4OHPA 4B7UA 4ABTA 1V5EA 2VPIA 3B13B 2PU5A 1KSGA 1XP8A 2AZTA 5ERGB 5DIZA 4G07A 3CSUA 3LQQA 5ESRA 2AFIA 3OE1A 2JFQA 1QIKA 2BM9A 3A7DA 3EISA 3K2BA 5TE9A 3KKEA 1IBMB 1NTRA 4QQKA 3DCIA 1RC0A 2XMPA 2CF5A 3JWIA 4HWSA 1PR5A 2HSZA 2AR0A 1ST2A 3IP9A 4NU8X 4ZYWA 1FP1D 2IL1A 4ZVLA 3DTNA 3K72B 2CLOB 1I4EB 1OAAA 1JG4A 1MJGA 3KD2A 2IH2A 2Y1OA 3VBCA 4RSMA 5ICSA 3R7WB 3ST7A 3EZ9A 4YT4A 2MMCA 2XVAA 1HX7A 3OQIB 3D3EA 1U2DA 5EXTA 5JSQA 4X6UA 1RT9A 4WMLA 4JFRA 2WYOA 2CMFA 5IUKC 3JQDA 1UP6A 1ILEA 4DL9A 3DXZA 2DR2A 4GSKA 1NXTA 1Z35A 4I8IA 1DX9A 2OBBA 1TKRA 3C2QA 3FGOA 4MX8A 4TKMA 1H2HA 3KDPA 3QVLA 5AR1A 4JI1B 2X5JO 4C0HA 1M2NA 2PBFA 2P2DA 1SB9A 4FNAA 4EP1A 3EPPA 4IIUA 4TXLA 2ZM6B 1Q0PA 1Q6YA 2R97A 3PKJA 4HGZA 3CLRC 4R7ZA 5B55A 4CLRA 1KAHA 1Z0UA 3AQ4A 4OQLA 2OXIA 1OI3A 1AQJA 3H6GA 4LNHA 3VA7A 3B9RA 4PANA 3SZ3A 3TBHA 3EUAA 3OPNA 1H0KA 1XVLA 4UBMA 4INZA 1SKAA 4OJNA 3QBJA 2R1VA 5IJZA 4X60A 2PJUA 4DCTA 3STWA 4OBEA 1K6JA 4RM2A 2WUEA 2M6KA 4HR7A 4D2IA 5LM3A 2DPXA 1E0DA 1XDUA 3DLCA 3P1JA 2DVMA 5HZGA 2BUCA 2EVWX 5KTTA 5DBGA 3HBJA 3NXKA 3DF7A 5AKHA 4BNDB 3H2KA 3U62A 2C9CA 1SH7A 1S9DA 1IUNA 3NTUA 1MVNA 1SNYA 2JI4A 3AUSA 4FFMA 5AUPB 3AIOA 1GNQA 1VCMA 4RF2A 4PZ9A 2IYZA 5TT0A 2BL4A 5HYVA 4TXHA 2AF4C 2P6MA 3OQVA 1CUBA 1A2KC 1KEUA 4RLHA 1DLJA 3NT5A 3B48A 3DUFA 3PK0A 2COKA 1GV1A 1K0FA 2HPVA 3D6UA 3DDNA 1XROA 3R3UA 4IP0A 4JJEA 1J1IA 1W1UA 4EYSA 5BWOA 5HS4A 2XOKD 5HS6A 2F1OA 2OD9A 1OX6A 2Z3WA 3A1CA 3QW2A 2JLQA 1LTQA 2ZIAA 4JJ8A 4MWCA 3VOSA 2PZEA 4KC0A 5KYVA 3HO6A 4ND1A 5JSZB 4NZYA 2WPDD 2ZDGA 1Q7RA 3V8VA 3P7MA 5IKOA 2ZWPA 1F7UA 4PLZA 1L5ZA 1V4NA 5B7PA 1XK6A 5KQLA 2ONKA 2D0IA 3W1WA 3L1IA 1SBYA 3QJGA 4ZRNA 3T9AA 4KWCA 1JFFA 4LJ5A 1KJ9A 3I9LA 3GJ4A 1CLUA 1A8PA 1EFKA 5ARBA 1DO2A 4US2R 1WHSA 4MVXA 3G2QA 3QK7A 5ULLA 2H57A 4KV7A 3LDHA 5F7XA 1ETUA 3R7AA 2PD4A 2QMEA 2Q2NA 1AZWA 1L4GA 5F5XA 4BLRA 4QJ5A 3JXEA 2NU8B 3ORFA 5BSMA 1NUAA 1KZHA 5TT1A 1VKJA 1Z73A 4J16C 1TYEB 2AW3A 1PQUA 3RF6A 2XR1A 1WXDA 3BIJA 3VHLB 4F9EA 2HRCA 5LUAA 3K71B 4LCBA 1FPMA 1E9CA 2CXSA 4NF2A 3UHAA 4YDQA 5AW9A 5BSKA 4X3OA 3HI6A 4CF5A 5K1ZA 3FWYA 4O3MA 2BONA 4IZIA 5UKDA 4ZCMA 1RC1A 1RQRA 5P21A 1BEZA 2PFSA 3BL5A 1YJAA 3AEKA 3N8GA 4IIJF 2FFRA 4CM5A 1BDJA 1GG5A 5EWJB 3RYTC 4XR4A 5EEHA 2BMWA 2CZCA 3HUUA 1Y7PA 2FPIB 5F3RA 4UMVA 2I4MA 4EGQA 1Y6FA 4J1TC 1PJCA 3E82A 5C32A 2ZSKA 3AWDA 4XQ9A 3SKYA 1TI7A 1THMA 3MM4A 3NHSA 2XUDA 2P41A 3HI4A 1CDDA 3DCYA 4BO8A 1UZLA 3PR3A 2TSYB 5F9MA 4ENTA 4L6IA 2YS7A 1SQGA 1LC3A 5D2CA 2C9BA 3FPJA 3GEBA 3I3OA 3A6ZA 3E3NA 4QUEA 3NP9A 5B3JA 1X86B 3JRWA 3TVDA 4B6PA 5DHQA 2FSUA 2VKTA 1JE1A 1NRIA 1PR0A 3LFTA 1FY2A 4NICA 3U9TA 5LB2A 5AFSA 1UDBA 1FUEA 4BLTA 5DEOA 5JSKA 5JEEA 3BF8A 5IDXA 3ZZMA 3U13A 1T1GA 2CBGA 4B32A 4I81A 3IVRA 3ZIAD 3N2EA 4Z53A 3ADDA 4M7RA 1DVRA 4N82A 1NFRA 3FDZA 4HEA6 1QQ6A 5EFZA 3FR8A 1MNAA 4L8YA 1HDEA 3IOBA 3QI2A 4C6HA 1XVVA 1OA1A 4GM4A 4NPHA 1KVRA 4KX5A 2HRZA 3CR8A 3PRYA 4FIDA 2JCXA 3TW8A 4TMYA 3UHPA 3WMWA 4NEQA 1FYEA 5AJHA 1XL0A 4J0HA 2JAXA 2ZRPA 1RXIA 5FFFA 3UO8B 2IXAA 2PL3A 3EC1A 3FSJX 1USKA 1PX0A 4J9VA 4BIIA 4EA9A 3BEOA 4GGMX 2NUPB 2Q6OA 1N77A 3RTAA 2IDJA 2PRJA 1QFSA 4IH4A 3N59A 3EH1A 3QHAA 4JP5A 4MPRA 5ITZB 3FVTA 2PMCA 3A9SA 4IDFA 3UH1A 1PVVA 2X0JA 1N2JA 1PP4A 4RNDB 3FDJA 3DZGA 2Z0MA 4KWEA 3DQQA 4K2AA 1FRNA 2OQ2A 2JFYA 2I1VB 2MR6A 4HMQA 4L2IA 2YZMA 2INGX 3MQ2A 2YWHA 1W85A 1UADA 5DI3B 2C95A 2UUPA 2EZ4A 4PLYA 4MB0A 1Z15A 3NTLA 4G0NA 2GEFA 2FYTA 1W9HA 1DOAA 4YREA 1OHHD 3FSEA 3HUFA 5LP6C 1L8LA 2DPHA 1K7SN 2W6ID 2X8JA 3LC7O 3N2LA 2ZREA 5FAXA 1NXQA 1PD0A 4OD0A 3FPBA 4AF6A 1U8ZA 2OM2A 1DE0A 3MXTA 1BC5A 1MV5A 1R1DA 3GLHB 3M6LA 4NV1A 3SIRA 3TJZA 1BZYA 1E8MA 1R3UA 1RWKA 3KKOA 5IN4A 1IN7A 2II6A 2VDOB 2WSSA 3MSXA 1N1DA 5TQ0A 4U6SA 1K1EA 3VZQA 5U9CA 5KTNA 2IX3A 2JLVA 4RORA 1MABB 2C58A 2PUWA 2O9JA 4NU6A 1YS1X 4X61A 1QGED 2QL7A 2QP4A 4LX8A 3V33A 1DCFA 3WB2A 1I7DA 3DV9A 3I6MA 4L0MA 2PZMA 3QLVC 1QQTA 2RGUA 4B46A 4P08A 2JG3A 2X0KA 5AHXA 3VMFA 3N3AC 4DLBA 3L8DA 4AG6A 4IIJB 2GK6A 1HDIA 2EHDA 4A8HA 1OQAA 1W5SA 1XU7A 2I1LA 3K0AA 1N5JA 3FUTA 1NBWB 2P6UA 3WDMA 3KSRA 4XCXA 1N0UA 5HK9A 3I53A 4XPZA 1YDWA 3SZMA 5HKOA 1L1QA 3NHBA 5LDDC 1CJSA 2OUIA 5K0TA 1FP6A 4JGGA 2E49A 1O95C 5KQRA 1JFVA 1F48A 5DGXA 4LISA 1L7BA 1ZD2P 2C20A 3S8EA 3NATA 1W4BA 1EFPB 2Q7OE 3HGTA 5G4KB 5DNDA 5HKKA 5J40A 3IV6A 3WYFA 1TU0A 1L5NA 1M2VA 1XRQA 2FLWA 3ZTYA 4FUTA 4CUZA 1ADGA 2WWRA 1ZGZA 3TPCA 3UC5A 4XVRA 3HJUA 1YDEA 2A1UB 3BFJA 4X54A 3W5UA 3DV0B 1B8OA 4N54A 1QOQB 4JEUA 5DNEA 4OTZA 1O58A 1KJYA 1AA9A 3OQJA 3R3JA 3AFOA 1GUAA 2HLHA 2ZROA 1IK4A 1CHNA 2GVDC 3MGCA 2PLWA 3GEDA 1JYEA 1SU8A 4LDZA 1XCJA 1NJGA 4HNAA 5SY4A 3UUFA 1SWVA 2CD7A 2FH5B 1UQUA 4YAEA 2HBQA 4C4ZA 2V59A 1J8MF 1LW7A 1SVWA 2PA3A 5EZQA 3A3NA 4HN4B 5IU6A 3AY7A 3HSSA 1Q0ZA 4S04A 4XCQA 1F8GA 1SO8A 4DVJA 1P6UA 2EC5A 2V7PA 4IHJF 2VZ8A 3OEWA 3W8NA 1JLRA 2AKYA 1U81A 1Z0FA 2FUG6 2QZJA 3WJ2A 5CB8A 2FDRA 1I32A 1G3IA 1XPRA 1ESMA 2QP3A 2BD0A 3C3CA 4FFSA 3T3OA 3O4GA 1LSUA 2C83A 2R86A 2QI9C 4OGLA 1IB0A 1VSUA 4W8HA 1K5DA 4K05A 3JAWB 3LIPA 4K9PA 5KJCA 3EEYA 4CCWA 5C4GB 5FPKA 2GPAA 3WV4A 1PR9A 4BC0A 2R8PA 3IJEB 1T4GA 1X15A 4GI5A 5T6MA 2GD2A 4Y2UA 3WYDA 2HM7A 3GAMA 2R65A 4DLKA 2FN3A 1WD7A 2LNDA 2OBNA 3RJ9A 1X3LA 4M9UA 3ZHZA 2CSXA 1IFXA 3KELA 4ZYYA 1RXCA 5DSZA 3AJRA 1YC5A 5AH0A 1R6XA 3E18A 3G8DA 5DP1A 4E5UA 1VP9A 4RFLA 4EX6A 4PXSA 1NW7A 1QVAA 3C70A 1D6JA 3I9KA 1V16A 4Q12A 2BJHA 5DLDA 2YWJA 3E7WA 5IBRA 5DM2A 4D46A 4P7FA 5K4HA 2OAP1 4GKJB 4R3WA 4TS9A 2MSNA 5BN1A 4JB2A 2XF2A 2JGLA 4I2NA 2Y1EA 1N5IA 4I1RA 4KLCA 4U8GA 3LU1A 1LPAB 1T4CA 3GC6A 4PZUA 2Z98A 1EX6A 1I7PA 1LSJA 3CKYA 5FUBA 1OXKB 3K1ZA 3WAKA 2QTFA 1JKJB 1RWWA 4FONA 4IOKA 3EZ2A 3ILYA 2CE2X 3AVTA 4BNWA 4CEHB 3A6LA 2ZTMA 4PGAA 5CDTA 2XDAA 4MYDA 5EJ7A 1YBHA 1SG9A 5HM6A 2JCVA 3B6IA 2GKGA 2PA0A 2DP4E 1N2IA 2GHIA 3OEHD 2XQGA 3OZBA 2PS9A 2Z9CA 4JYZA 2N75A 3OKCA 4DIMA 4KFRA 1IHUA 4TYNA 3HJRA 2J3HA 4W99A 3IQHX 5DNWA 4F3TA 1TW2A 2ZULA 5GWXA 5FWXB 3NAGA 4RAOA 4BVAA 5LMUB 5DN6D 3TTXA 4LDAA 4WNAA 1WV0A 2Q4OA 5KHAA 5KYXA 2G63A 4FYMA 3P97A 5E4FA 3VDQA 3V8MA 1WXFA 2JVKA 3M1IA 4MCHA 1JR2A 4HQFA 3I23A 4M1KA 4C5AA 5JSHA 2PLRA 2QN1A 1YBMA 1S2DA 2WKWA 2VHCA 3FPGA 4DVGA 4JUDX 2YJ5A 5C18A 2DEUA 1HZZC 3PRJA 4EHDA 1IATA 1IE3A 3GJ8A 1GQRA 2UZ1A 2ENWA 4EEKA 2A8YA 1X9GA 4IDGA 4JI5B 5B4UA 3OZUA 4W82A 1G1AA 2FPWA 1G5RA 1GQ2A 4BYGA 3EVAA 1V43A 5JHGB 4IL5A 3LPAA 1DV2A 3K0FA 5I4BA 4M0EA 4NP6A 3IT0A 4BNZA 1B3RA 2PTHA 3EEIA 4DA4A 4JGIA 4UKDA 1EP9A 1OIWA 4B4WA 4EY5A 1KK1A 1ZJZA 2H1IA 2G9VA 7MHTA 4IHJB 3IUEA 5IG2A 2IUUA 1C80A 2CWDA 4CFZA 5EJGA 3F3KA 3ZI7A 1GN8A 1YS6A 1OBHA 3KKQA 2ZB3A 3FNQA 2NPIA 4AG5A 3BSFA 5JY1A 3HADA 1MZVA 4URWR 4DTIA 4AQ7A 3HXKA 2Q5LA 3VKVA 3BUSA 3E5HA 1UBTS 3FFTA 5A3SA 5JDIC 2EKBA 2WNSA 3VPGA 3CA8A 4J90A 3CZ5A 2QD1A 5IZCA 3IVCA 4GMKA 3D8TA 5AJXA 1W36B 3MUFA 1GZ7A 3IEXA 4J0KA 4QDZA 1X1EA 2HV9A 4RTLA 3S28A 4YI5A 4F2WA 1ZU5A 3OPYA 4REQB 1FPQA 2EBUA 2BBTA 4HATA 4O5OA 1ZN2A 2DECA 2GTPA 2G0NA 2YWBA 1KP9A 3LSTA 3MF4A 4HQ6A 1F60A 2CNOA 1ZD8A 2WJJA 3GR6A 3SQNA 2R7LA 4B81A 4DUYB 1V7ZA 4XGKA 4AULA 3HKEB 2I3ZA 1G8JA 1SIWA 5E9QA 1RRGA 3EZ6A 5FWDA 3JQCA 2E9SA 2HZBA 1XAJA 2IY9A 5TF4A 1A4RA 5H4GA 1RQ7A 3FNEA 3JYQA 1EGAA 3CLHA 4OH1A 5BN3A 2AEMA 1GGKA 1ZK2A 1QG6A 2IHUA 3I4CA 2JL1A 4IRXA 3N6RA 4WLOA 4YJGA 4LFCB 3H0CA 3AJAA 5A5FA 3FROA 5D8DA 2EFYA 5FFNA 2AN4A 2VNKA 3AR4A 3FF1A 4M21A 4JZYA 2IS1A 1OLSA 2EU8A 3DYVA 3PUYA 1QIMA 3OIFA 4CIWA 1OPXA 2I7TA 4BMDA 2BUAA 4B6RA 4WJLA 3F3MA 5BO5A 1XEWX 2IP1A 3ETCA 5JDCC 1RJWA 2VQSA 3PXDA 4W5JA 1OOEA 2QR5A 1QHHB 4RCZA 1FSGA 4FMBB 3ZWAA 1HNXB 1RAEA 3EZYA 3VMMA 1OY1A 2EFEB 1Q5PA 4UBOA 4HLDA 3L6DA 5EPOA 2LGJA 1I4TD 2G17A 1UK7A 5KYGA 3IBGA 3DOUA 5CURA 4F2PA 3L2OB 1CR2A 4I3GA 4LHEA 2R6JA 4P3OA 2IOYA 2Q6IA 4FBLA 4JI8B 3UENA 2QHXA 2O8FB 3KD3A 4X7PA 4COOA 1LK7A 1E3SA 4MWDA 2HSWA 2GXQA 4LEIA 1PYGA 2BPOA 2ZJ1A 3G0BA 1XEWY 4B5KA 3I8XA 2OB1A 3LCRA 4DY6A 1W35A 4U7JA 2OV3A 3C16C 5IFLA 4XEHA 1P5JA 4DLTA 5B7GA 4CM7A 4G3XA 2OECA 2XDQB 5CA1A 3MS7A 1Z83A 3N0TA 3KLOA 4G26A 3A14A 2BF7A 4UM9D 3S2FA 1LBQA 3V7YA 5CEEA 2OV4A 5KYYB 2BTOA 1KPGA 1LS6A 3O84A 4PR3A 4FHFA 4F97A 2QRVB 1J8VA 2JHFA 2VS1A 5DBOA 5CDSA 4EY8A 1I4OA 4R2JA 2FWRA 4FC7A 3UT5A 3UVEA 3UK6A 1GR1A 2WT4A 1NSTA 1NW3A 3H1BA 1O5TA 2PKWA 4FYKA 3UAYA 5E2IA 4MI1A 2IBSA 3Q2OA 3MLAA 2FWNA 2VDWB 1P33A 3A1UA 1VMAA 1MQSA 1X1TA 3Q7IA 1EVEA 4TTPA 3WB9A 4DQDA 4HX9A 4ECAA 4IIYA 1L1FA 4GR4A 2OC9A 1YBVA 3E8MA 3FHJA 3VI4B 4ASUA 1VIYA 5C35A 4M9CA 2XXBA 2YC2C 3CEMA 5E2AA 3LBHA 1OVGA 4RHXA 1COZA 1Z0IA 3QPBA 4OGGA 2R0QC 1MJ5A 1QDUA 1X80A 4HAYA 4I4CA 1HO3A 2QX9A 2R85A 5CYFA 1AKUA 4TKLA 3L6BA 1U9YA 3TNLA 1S1MA 4AY5A 3AIMA 3LRPA 4WCFC 4NECA 1HKUA 3QY0A 2AG8A 3I0ZA 1E9RA 3NANA 2E4WA 5IC5A 3FYUB 4UQOA 3L8FA 5T3YA 3DBHB 1VRVA 2PSJA 2GSWA 4K1LA 1DADA 3RIYA 5DM60 3IT3A 4IGIA 3AETB 3ZU4A 2AUNA 3SJ7A 4BFUA 3D6NB 3JVEA 5A3VA 1PS9A 4OAPA 2IXEA 3PD1A 1AS3A 1SK9A 2PV0A 2X19A 1I2CA 3JYPA 2FZGA 3PF8A 4FYWA 4JWKA 4Q66C 3BSSA 3OPMA 5CJJA 2G08A 2PX2A 2P35A 5HUHA 1TB4A 4TSKA 1DZ3A 3N2GB 3UKJA 1UPCA 4CEIA 1GCOA 2H4ZA 2IXBA 4MJ7A 3VU3A 1XA0A 3G13A 5JVDF 4JI3B 4YTEA 3HZZA 4A1OA 3PNYA 4GGPA 1B41A 1JDZA 2AEFA 4G24A 1HLDA 4Y0AA 1FDUA 1PSZA 1N92A 5F76A 3RSGA 4YT2A 2HJ9A 4K87A 4M76B 3D3WA 3IP7A 4ABYA 1Z0SA 2ZRLA 1DXHA 1RMQA 4I1UA 4Z49A 2YINC 4B9AA 1JQ3A 2HLDD 1LF5A 2GCEA 3A37A 4KVGA 4OQQA 1RQNA 1VFPA 4AM8A 2PUEA 2WWIA 1UOEA 4O4IF 2A9JA 4M1YA 2BFDA 4XIIA 4DNXA 3JD2A 2OBXA 2R44A 5GV7A 1GUZA 4OCZA 1OB2A 5JQWA 1VSVA 3I76A 1ZONA 4KAXA 4MW6A 4IS3A 4ETWA 1AGNA 3LLSA 3IBYA 3PL5A 3SYMA 1Q0LA 1C4WA 2OY0A 5BRNA 5B57C 2BJVA 4R41A 3GBSA 2B1GA 2IRWA 4GX2A 4N47A 3QEMB 1CF2O 2A30A 3JASA 3R5FA 5BSFA 3UJHA 2XKAA 4WXRA 1J33A 4K3UA 5EIFA 1KK3A 2GPJA 4AZ0A 4IQ4A 3CZQA 3QM1A 1TCBA 5KVCA 3OAAD 3HVJA 1JTVA 2H4JA 4TTJA 1J0BA 3GJSA 4XQGA 4YNBA 3TQHA 4HVCA 3ECCA 4LV5B 1DUVG 2O2EA 1JLLB 1DJPA 2UVDA 2ZAMA 3KJXA 1NXSA 3QLEA 4CL2A 1K6MA 1OZAA 1QTIA 1G17A 2D0DA 3LRTA 4DMCA 1ECJA 1FXSA 1F8FA 2HNAA 3L9WA 1J49A 1XZIA 3STUA 3E9EA 2RHMA 3HXQA 1EWYA 1OC2A 4KI0A 4PNHA 5HA5A 1VXRA 4I08A 2I4IA 5FPQA 4BCDA 1YE8A 1U0OC 2QMZA 4IQGA 3GCZA 2QPAA 3L7LA 3L0OA 1PWEA 4NL4H 2H2AA 3HU2A 5DT9A 3HDTA 2VJNA 1U28C 1TCAA 3THYA 3PHGA 2GS9A 4PAQA 4KSCA 4GLOA 4Q6BA 3X1XA 1ECPA 2YJ4A 4CE6A 3GVIA 1RLMA 4KO3S 1W48A 4BVBA 3CGGA 2PAFA 2QBYB 2YH2A 5CFQA 3AUYA 1ZBDA 3AV3A 4HLUC 4JT4A 4NDZA 1RPNA 4Q48A 2OZVA 4LJSA 1R9GA 1NR5A 4B3HA 5EJ9A 3RVDA 1NY5A 3GFTA 3M4NA 5AUQA 2PGAA 3Q98A 1VCHA 3DKIA 4JEHA 3TH5A 4JLDA 1QHGA 2ZVDA 4JHXA 3SHTA 1F3LA 4XW2A 4LK3A 4JQOA 1DC7A 4HDNB 2VYQA 2R2AA 2AHRA 2PX6A 3GGGA 4WDQA 5CU7A 4A2CA 4KQJA 4UE2A 4UUAA 3OZFA 3NIDB 2X7JA 3KQMA 2HBRA 4FOOA 1YCHA 2P9EA 4GYJA 3PDCA 2TMYA 4FGSA 1W4AA 3CU5A 3RUCA 2QNRA 4LXYA 4H7KA 4B3DA 4N5NA 4EFNA 4DCJA 2WBLC 2V7EA 2FZ4A 5A05A 1J20A 4NQRA 3LP6A 4ERNA 4KZPA 4F46A 3CUUA 1IVNA 1NUQA 3CXRA 3UC9A 4I5GA 1I7SB 2YHBA 1HRKA 4Q7EA 4KWIA 1YFZA 4MQUA 1KFEB 1LLDA 2OM6A 4MI9A 4G5SA 3RRMA 4UTNA 3ZBUA 3R6DA 2X4LA 2BF4A 3QRWA 5JVDB 3ZU3A 4XWKA 1ZM4A 1DV1A 2C2HA 3GT3A 4IV0A 1G19A 3WWZA 3QFSA 5KQSA 1MJHA 3W7VA 4FYXA 5JO9A 3E9YA 4LJ9A 5J59A 5TARA 4AZ3B 1RWPA 2C3YA 2NO6A 1D0IA 1GSOA 2GNPA 2RMKA 2HA7A 3AI3A 1CY2A 3HXLA 1JHPA 2R8EA 5AKJA 3W3AH 2W6QA 4Q7QA 5HJ7A 1H4SA 1WUKS 4I9GA 3AT1A 2PZJA 1EK0A 4O4IB 2QTWB 4Z4EA 2C5SA 3B89A 3GI1A 1B73A 4WCDA 3A3OA 4RK6A 4J7AA 2GCOA 1FVFA 1ST3A 4OVKA 5EWLA 3T94A 1S6YA 2X41A 3A31A 3NNNA 1O95A 3KOXA 3BTOA 3UF0A 2JJ1A 1PK7A 3PUZA 4RQBA 3HLKA 3ET5A 1VGVA 2XE8A 3AEYA 1REQB 2D5LA 1SELA 1IIRA 2OGZA 3HB0A 3M6VA 3QFHA 4C0QC 2G9ZA 3TX6A 4DMLA 4MW0A 4TTQA 1BH6A 3MT0A 1CWUA 5KDLA 4TZ6A 1W0KA 3FTDA 4YCCA 2PWBA 1VPEA 5LYJA 2JGFA 2POQX 3D4NA 2SCUB 3AXSA 4WZAE 4JL5A 1IU9A 4B9EA 1Y6RA 2OR3A 1NQOA 1SUPA 3CNLA 4WY5A 3RYHA 4BMPB 2HCTA 1K75A 3EDOA 2OYCA 1GRNA 1XMQB 1NJSA 2HRBA 3Q7EA 4IZ6A 2FRDC 4U00A 4QKQA 1PWHA 5IS2A 1V41E 1M1UA 1JJBA 3B20A 1ZVJA 3AR5A 2BGMA 4LRTB 2KWIA 1DEHA 2ZOSA 1L8QA 5DOZA 3I34X 3UJBA 1E1QD 2CK3A 2ZRQA 4RSRA 5JBQA 2BJWA 4MTLA 3E15A 4G0MA 1QBGA 3ACCA 3EGXB 4P35A 4CT4B 4AG3A 3A4NA 2EEZA 1EJ0A 1AS2A 3AHHA 5IF9A 1SCUA 1Z56C 2C8KA 2YWXA 3A3PA 2Y0BA 3EHDA 1R4MA 5FUVA 5HGXA 4ZCSA 5ESDA 3KCQA 1SD2A 1N7GA 1W88A 2DUMA 2PPVA 2RBGA 4F1WA 1HNNA 4YMIA 2AG0A 2PH5A 3BH7A 5JMPA 4PC2A 5TRTA 2YCBA 2XMCA 4Y6LA 4HAWA 5TSDA 3HJAA 4BQQA 4L9SA 5HRAA 2O0MA 2YV4A 3DULA 4R8VA 3W2GA 3L0IB 1P7CA 1U1FA 5T3UA 4OB7A 4DNOA 2J6HA 3P4YA 1Z4KA 4YJDA 3P9QA 4NCXA 3UAGA 4BKMA 5IKMA 2IYOA 3TTWA 4I5EA 2ZK7A 3SC2B 1ZD1A 1L5FA 2XECA 1QRUA 1CY7A 1NZDA 4W1PA 1GLNA 4A26A 4PGHA 4G0ZA 2VUIB 4NZ9A 4Y1EA 3CBQA 3I2FA 1FC0A 3JYHA 4BWYA 4U1RA 2CY0A 2QZSA 4C1NA 1OE0A 2GZDA 1VJ1A 5BNTA 1HTBA 1WDLA 3H13A 3NPAA 4RF3A 4JJFA 4E14A 4X62B 2FU5C 1AZTA 1PZEA 1JHAA 1XZMA 3OZEA 5B2ZA 3ADBA 1LDGA 2J7PD 3C1AA 2J3LA 3LUFA 2VTBA 4NNPA 1JHZA 1P0QA 1B8VA 3JQ6A 3S5UA 1KBOA 1NUUA 4JC0A 4G86A 1X92A 1AKMA 2HB6A 2IKQA 4YMWA 2OXRA 1H3EA 1RTKA 1EUZA 1WB4A 1C3OB 2AIRA 2ZT8A 3A1FA 4U39A 4DLPA 3U44B 3HG7A 3WK9A 4O0LA 2VBGA 3CRRA 2HT6A 3DL7A 2Y1DA 4FUQA 4IW3B 5H80A 1H5UA 1K3FA 3F4BA 3N53A 2JVIA 4A6XA 3FOEC 4UTOA 1DDOA 4REOA 1IWBB 4FC6A 1U99A 1N25A 4R05A 3DBRA 2IPMA 5KAPA 4J0IA 2AB0A 5HCUA 2V0GA 1F8UA 3SFZA 1OFTA 1IAVA 1JU4A 2YY5A 3COWA 4QYWA 5CD9A 5DYYA 1OFIA 1ZM9A 2WE8A 4DABA 4EPYA 1SOWA 3W77A 2CV0A 2WG1A 3LYLA 3WNVA 4RTQA 1R0KA 3RYIB 2I99A 3OE5A 4ZHSA 4P92A 2OUKA 2HCBA 4YCNA 2QN3A 2XRFA 3ED5A 3LC2O 1P6QA 4BO1A 1GU1A 1JX6A 2W6ZA 1RAHA 4KLZA 5DF1A 3AB8A 2JIMA 3B9PA 1WB5A 2HJGA 4ZZ3A 2NZYA 4G23A 4OMDA 4MHOA 1BHJA 2ODNA 4TQGA 3KJQA 4A5SA 2C4MA 3KU4A 4OEHA 3SDBA 3USCS 1J99A 5KNLA 3DB1A 3HXOA 2QQ5A 4PLHA 5AKZA 4DCVA 3S2YA 1SOVA 2D5CA 3RC7A 3VOAA 3BMOB 3PI7A 4HFRA 3U3ZA 2AYYA 1OC4A 2PUBA 1FMLA 1PK9A 1PNTA 1OXTA 4NBRA 3C41J 4CKEB 1CZRA 1N57A 1E4OA 3TQQA 3PQ2A 1U3GA 4HDQB 2ZJ2A 2FDCA 3X3HA 3I4LA 4IO1A 1T8TA 3QPDA 1D4ZA 1WUHS 4K1XA 1E79D 1TK9A 3QV2A 4DUZB 3KQNA 2OGSA 3K9WA