2REXB

Crystal structure of the effector domain of plxnb1 bound with rnd1 gtpase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
176
structure length
171
Chain Sequence
b'RCKLVLVGDVQCGKTAMLQVLAKDCYPETYVPTVFENYTACLEQRVELSLWDTSGSPYYDNVRPLCYSDSDAVLLCFDISRPETVALKKWRTEILDYCPSTRVLLIGCKTDLRTDLSTLMELSHQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSEKSIHSIFRTASMLCL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plexin-B1
publication title Crystal structure of the effector domain of PLXNB1 bound with Rnd1 GTPase.
rcsb
source organism Homo sapiens
molecule tags Signaling protein/lipoprotein
total genus 58
structure length 171
sequence length 176
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2rexB00
5FUWA 4IEIA 1S9DA 1T9HA 2O52A 3EPHA 3A1VA 2IYWA 1D5CA 3U7FB 1E2JA 1HT1E 1HH4A 1F6BA 1Q20A 2N1BA 4AURA 1XPOA 1G8FA 1GDDA 1QVRA 4KJZA 4P0TA 1OJLA 1ZD1A 4ON9A 1F60A 5L8VA 4C2UA 4D6PA 2IS6A 3TVTA 3IQWA 3U7HB 4HATA 4IFBA 2X19A 2Q9BA 4BFZA 1WQ1R 2CMKA 2O8BB 1G3QA 2WJJA 2ZRNA 5F3WB 1W49A 4C7OA 2GZHA 5BN5A 2AX4A 3IIMA 3MJRA 4BGDA 2P65A 3QKRB 5IK2A 2YKGA 2GF0A 1E9BA 1QHHB 2FX3A 4DIEA 3L43A 4A0HA 3KTAB 1N6KA 3N70A 3U7EB 2DWOA 3B7GA 3MRSA 3X1YA 2F7SA 2YWEA 4OQFA 1JEEA 2A7QA 3AVUA 4EFMA 3MWJA 5GVRA 2ZRLA 2OZEA 4QHTA 1KSJA 3GLGB 3EPJA 1LVGA 2CLCX 1Q3HA 5CJ2A 3O8BA 3UMFA 3RNLA 2YV5A 5CB8A 4K46A 2BEKA 1TQDA 2F1JA 3EAQA 1E79D 1X8JA 4IDHA 3BK7A 1E2GA 2RMKA 3QXJA 1AGPA 1QHGA 1SVLA 3FGNA 5A0FA 2XJ4A 5JWHA 4OYHA 1E2PA 3JVVA 3CM0A 4Y0VA 4RKEA 1OYWA 6Q21A 1GIAA 4C0BA 1RZ3A 2JJ1D 4D4JA 5F98A 3WYFA 2FF7A 4CYMA 1OSNA 2WSSA 3S1AA 2XITA 2ZRIA 2VHUA 5FTNA 1GL9B 3IEUA 2GF9A 3CX7A 5CLLA 2BBTA 4DEXA 1P5ZB 1BS1A 5L3QA 2W2TA 2C77A 5KDOA 1MRSA 3EA0A 3TRFA 2QAGB 4IHQA 3RS7A 3KQUA 1EWQA 3GLIB 1XMVA 3U2QA 3ZH9B 1JR6A 2JDIA 3BH7A 3T1OA 1R0XA 2HF8A 3GJ0A 2XEXA 3KL4A 2QBYA 3BB4A 1Q22A 4L5BA 2DB3A 2I3BA 1KI1A 5J40A 1VKJA 3NBFA 5AUNB 3B1YA 1M74A 1UKVY 2GEUA 2XSZD 3CZQA 1IY2A 1BMFD 2KE5A 4RD3A 3QKSB 2GK6A 5EXSA 3E5HA 4A8JA 3TR5A 1I2MA 2E87A 1U81A 2A5YB 4B34A 3AUXA 2QP4A 1W0KD 2TMKA 3JZMA 4CT5A 3NEYA 1BH2A 5JS8A 1IN8A 1DAKA 5FTJA 1FQJA 4OI0A 2Y8EA 5H1YA 3E2IA 4D80A 4D82A 2EFCB 1E2FA 1NBMA 3LA6A 3MCAA 3ZLJA 4TSFD 4G5RA 3KUCA 3AF0A 5H8WA 2W6IA 3NC0C 1JR3A 2WBLC 1KTVA 1LTQA 3MSXA 3ADBA 4TTPA 4TL7A 3RDPA 1E1QD 2EWWA 1XCPA 2MSCB 2YHSA 1OFHA 5KPJA 2QM8A 1TUIA 4PQFA 2VP4A 2A78A 3OIWA 1WP9A 2R8RA 5DSZA 3IO3A 2SHKA 3CRQA 4PPQA 4R2IA 5CDFA 5JJIA 2OESA 2FDCA 2XB2A 2JIZD 4QOSA 2PT7A 1G4AE 4PANA 5JECA 3DVLA 4GRAA 3P32A 4LHXA 3MMPA 4XVRA 3ZDQA 1XJ0A 2IBMA 2FPMA 4ASUD 4F93B 3BH0A 3GJ6A 4JBWA 3TSZA 4TMVA 2ZI7A 1FP7A 2HF9A 2ZU0C 4UQOA 1EESA 2JJ2D 3GLFA 5C1BA 1II9A 2F43B 4ILEA 4CDGA 2WOJA 3PVSA 2H17A 2A5GA 1LFDB 2CCGA 4HAVA 1OW3B 1MO6A 4NCJA 4M4SA 1HYQA 2J7PD 2VP0A 1GWNA 2J1LA 2GCOB 1E2MA 1Z0DA 1Z6XA 2IYSA 1FUUA 2J3EA 3Q7PA 2ZJZA 4YONB 1PUJA 1L7VC 4JLDA 3OE7D 2H8KA 1XCGB 2G0NA 3AVXA 3WBJA 2HYDA 3GFPA 2ZSFA 4BASA 2X77A 4A2WA 1ZM3A 3I62A 1KZGB 1GITA 4URYR 4M1OA 1ANKA 3FFBA 1D2NA 5EQTA 4C0HA 5K8TA 1Z63A 3B1VA 2DCUA 5C46F 3OIYA 2NO1A 3BFVA 4OK6A 4RZ2A 5CJPA 4EPRA 3IIKA 1W4RA 3U5ZB 4MRRA 1P60A 2OEPA 4AG6A 4P33A 3QENA 4Y0AA 3TUJC 1YZQA 4RZ3A 2HCJB 4PHFA 5FPHA 5CITA 4XJXA 2VSOA 5AWFC 4B32A 3THXB 3IHLA 4PAMA 3SFVA 2QZ4A 2ZR7A 1UADA 1KO8A 4QJ5A 2JLUA 3HU2A 4Q21A 3AVPA 3C15C 1MO5A 2LCFA 2DBYA 3CBQA 1UPTA 1ZCAA 3AF3A 4JSTA 4NYJQ 1WRBA 2H7VA 3W8NA 4JVMA 4EFNA 2JA1A 4DCVA 3OESA 5B64A 3PUVA 4K81B 1VIAA 2WVJA 1G6HA 1KYIA 1QG4A 3QKUA 3HR7A 3FTQA 1J8YF 1G4UR 3SYLA 4JL8A 1S9HA 3TW4A 3W5JA 2J87A 2KSQA 2BHRA 3ZZUA 3I61A 2V3CC 1E94E 1E9RA 2JLQA 4Q1AA 4MYCA 4DIDA 3K53A 3I32A 3MJHA 3OZXA 3FMFA 4LUCA 4M9ZA 4WA7A 1IJFA 4I99A 1N25A 5FL7A 5L3QB 3SJAA 4FCVA 5TXGA 4XIGS 2ZVQX 3EA5A 2O0JA 2JATA 2A3RA 5IK2D 2HV8A 2QGZA 1VCIA 1U2RA 1FW6A 1RYHA 2RGEA 2QBYB 3EIHA 5KTYA 1ZM7A 3K9HA 4C30A 4ESVA 4DLZA 5G3YA 4DSOA 3ICEA 1ZD8A 1BIFA 4QHYA 1VMAA 1YR8A 3IGFA 2GAOA 2IHYA 1R0YA 4M53A 3W3AA 2XX3A 4CF7A 4A8JB 3THYB 4JYBA 1XFAA 1LY1A 4UNPA 1AS2A 4B6FA 1E4VA 2JEOA 2OV2A 2WWXA 3DL0A 3I3SR 5FBWB 4D26A 5KNBA 4A0FA 1CEEA 5C18A 4EDHA 2GAAA 4IJMA 4F4CA 3RS4A 1P2UA 3B82A 1G19A 1E2EA 4W7SA 2D2FA 2D62A 5KNDA 1TU4A 5KUTA 1UM8A 4KVGA 1E0AA 1KDTA 3D7MA 4B71A 1L2TA 1P72A 4LV5B 4GT1A 2O8CA 2YC2C 4G3XA 4AKIA 4M1YA 3VR3A 4QKQA 1X3SA 4DSTA 2WSSD 1FNNA 3VX4A 1XB2A 2QRNA 3GLGE 3OHMA 4EUNA 5KSZA 1KI3A 4NP6A 1MT0A 3L82B 4R2HA 3VNVA 3DHWC 5LB2A 4MUAA 1OB2A 4BFVA 2IYYA 2JDID 3VFDA 4ZDJA 1CR1A 1GAJA 4YMSA 2IEZA 1YZUA 1SVKA 2A9KA 3AH8A 4HAUA 3O8RA 2ATXA 4ZKDA 2FV8A 4EPTA 4JKYA 1LS1A 1KO5A 2DFKB 4KFSA 3TVDA 5J5CA 2D74A 1II8A 2B7CA 3QIAA 4B75A 3EPKA 1IBRA 2JGNA 4Q03A 4MDEA 4URXR 2QRZA 5B2ZA 2GXAA 5FOTA 3W8RA 2QSYA 3BXZA 1YRBA 2DYKA 2FFQA 2CBZA 5ANRB 1G3RA 1FP6A 2CVFA 1BOFA 3B1XA 3EXAA 4Q19A 4MITA 2FGJA 4Q1BA 4A36A 1L4UA 1ZM4A 1DAGA 4HUQA 4B33A 2EW1A 3OAAA 1OIVA 2ZYTX 3C5CA 4NL4H 5HE9A 2ZSBA 2MSEB 2DFTA 2VL7A 3KQKA 1NBMD 1NNEA 3UANA 1Q0UA 3WBKA 1EXMA 2QN6A 4B44A 1SKYB 2W6ID 3Q7QA 4A92A 2A2ZA 1JPJA 1VCNA 2VPPA 2QMOA 2HXYA 1KI2A 3KUDA 4JLMA 1A82A 1TPZA 3AVVA 3CKLA 4HB2A 2GBLC 3TJZA 1DAHA 2D4HA 5GADl 5AR1A 3Q72A 5ELXA 1F48A 2CJWA 1CTQA 1QDEA 1XMSA 2VLIA 2BDTA 1T3HA 1YQTA 3TE6A 5JFGA 3ZZ0A 2F9MA 2CLDX 4BLQA 2NG1A 2XOKA 3DZDA 2ZJYA 1N5LA 1RRFA 3VX3A 3AM1A 2NZ8A 1H8HA 3DMNA 4GP6A 1KK2A 3B8HA 1ZBDA 3PITA 2OSBA 3K9NA 2PZEA 5TV2A 3U60B 3ZVMA 4MGKR 1W5SA 2Q3FA 4RJLA 4Q9KA 1F3OA 4FCWA 1XBTA 3CRVA 2WMNB 4FI3C 2R62A 3FWYA 5SZJA 1CJUC 2QPOA 3OEHA 3PV0A 1KOFA 4D4MA 1CR4A 5J4VA 3RC8A 5B57C 2GCPA 3PUYA 3QPVA 3DOFA 4DLXA 3QOFA 4GFDA 3EPLA 2ORIA 4WZAE 4DLUA 1ELOA 4Q1EA 1OB5A 1EGAA 1RFLA 3B85A 4NCIA 1NMZA 2G0TA 2HLDA 1VYVA 1L8QA 2AD1A 3I1FA 5GVSA 1GKIA 1EFCA 2OHFA 4IDPA 4AYWA 5JHHB 2NOAA 1G8HA 2G1KA 2WJGA 2V54A 3UK6A 2OFWA 2Q21A 2ZRMA 3SZRA 3P1JA 3GCGA 4PTLA 4V0NA 1GRRA 1X6VA 4I4LA 4LCBA 5EUQB 4TMXA 1AA9A 3V4RA 3V00A 4OBEA 4PSKA 1U0HC 3U3OA 2PBRA 4LJ9A 1CJVC 2QGNA 3MWKA 4HLQB 1U94A 3AP1A 2NO7A 2WMOB 2YVUA 3KJHA 2GESA 1E9SA 2NGRA 3DPUA 3K0EA 4OJKA 3HJNA 1AKEA 2QMUA 4TL9A 4RD0A 3AVWA 1W2HA 4QJ4A 1F2TA 1A5TA 4US1R 4GL2A 5LDDC 2REBA 2B92A 2ZI9A 2QU8A 3NH6A 1GRNA 4JLNA 3RABA 2R6CA 1M34E 2C9CA 5DO9A 2ZR0A 5K8UA 2REOA 1E0KA 4LY6A 2BOVA 3SU8A 1GL6A 1TQ2A 4KO8A 2AR7A 2O0HA 2BVNA 1KGDA 3LLUA 1KI6A 2ZIAA 1OXTA 2VH5R 3KXIA 2XXAA 4LYFA 4CIDA 2GZDA 5DN6A 4AYXA 1G5PA 1JPNA 5CK5A 3RS2A 5HE8A 2RGGA 1A1VA 5AJZA 5FL7D 3K0FA 4V02A 3WNCA 4B2IA 4TYYA 3IIJA 4DCSA 4OKSA 2D2EA 1HTWA 2VSXA 4HZIA 3REGA 3SYNA 2B8TA 1AKYA 2IYTA 3ICQB 5BW8A 4QNRA 5FOWA 5IDVA 4DB4A 3AVOA 3W5IA 4YMVA 2ZYVX 1J7KA 3RS0A 3HYRA 4Q7MB 3LY5A 3QPWA 1II8B 1ZUIA 3L0SA 4PXAA 4GP7A 2FJUA 1P9WA 3LLMA 2HUPA 1J8MF 1LS6A 4OK5A 3TK1A 1NVVR 3LWNA 3EC2A 5FI0B 4BLSA 3K70B 4LV6A 1E4YA 4US2R 4DKXA 1YVDA 3QBVA 4HUQB 2YWFA 4KYUA 4FMBB 1T91A 3O8CA 2W2XA 4DUGA 1XU4A 4CZ2A 4CEHA 1OPXA 3P20A 1H8EA 1E32A 2QTHA 5FOXA 1X8KA 1DAEA 1RYFA 1R5OA 4IXMA 1CJMA 5BXQC 2P3SA 5F2EA 1GSIA 2VO1A 2Z4SA 3IUYA 4QNMA 1Z0IA 3LX5A 1EFUA 5EP2A 1KSGA 3WMGA 3WY9A 3TMKA 3LQRA 1G5RA 2I4IA 1E9EA 1TX4B 2GA8A 1GL7A 2UZ3A 5FL3A 2GVZC 1FNMA 1P4SA 4HLUA 2CJWB 1Q21A 3NHBA 1U8ZA 2W58A 3Q9LA 1XCMA 3G0HA 3U6BA 2H1LA 2V6IA 1MH1A 3GEIA 1X8LA 3FKSA 4DDTA 4JZKA 4H1VA 2CCJA 4M22A 1U8AA 1NBME 1AQUA 4KXFB 1TQ6A 2JAQA 4JLAA 2WIBA 4LYHA 1JR3E 1T3SA 1J70A 4FMCF 2H5EA 4ABYA 1P7CA 3DKPA 3T35A 3K70D 4U02A 4WW0A 1OH7A 5HPYB 4TMTA 1YR6A 4JVSB 2OFOA 1G3UA 4TMZA 2IXFA 1EFTA 2R6FA 3OAAD 1GNRA 1E9DA 4CVNA 5CDFE 3ADDA 4UJ3A 1TNDA 2F6RA 1TADA 4JLJA 1G64A 1TL7C 1G6OA 1U9IA 3L0IB 5JCPA 2J0UA 3QUSA 1ZNWA 4RFSA 1CS4C 4O2LA 4HZUA 4LBZA 1QRAA 2WJIA 5BYJA 4CEJA 4F4IA 2CDNA 1FQKA 4MKGA 1UDXA 5DNYB 2EYQA 2RGXA 3CX6A 1CJKC 1ZM2A 3GLFE 1OH8A 1SVMA 2R9VA 1PJRA 1RRPA 3NKVA 1AM4D 2XOKD 4NKRA 3UXMA 1OKKA 4MYTA 3V9PA 1H8HD 4B43A 2ZEJA 2ZJ5A 4D25A 2Q3MA 2DR3A 4NBSA 2QPTA 2FSIA 2PJZA 1P61B 1W2GA 2P2LA 4NDZA 3RWOA 3T61A 1ZRHA 2RH5A 1KMQA 4EJSA 5G3ZA 2WTUA 3ZD7A 1UJ2A 3FHOA 4F91B 4LBYA 2VEDA 3BERA 4N0EA 4NYIR 2FN4A 3LBHA 4I1SA 4KLNA 2F9LA 2GZAA 5AJXA 2IL1A 2QPAA 3OEHD 3BWDD 3A58B 1GP2A 1Z0JA 4PC1A 2NPFA 1CR0A 4BE7B 1F2TB 3NBYC 2ZITA 3Q5DA 2GTPA 1XDBA 4Q1DA 4G5GA 5EZ5A 1QVAA 1E3MA 1OH5A 3QEOA 3KKMA 3FB4A 4KFRA 1IONA 3CH4B 4A8JC 5HKKA 4CEIA 1VYUA 3IILA 3SI7A 1P75A 5TARA 2QT0A 1E96A 1CIPA 1FMJA 2GXSA 1K8RA 2HLDD 2Q3HA 2IYVA 3PJRA 1KI6B 4IVQA 4PQYA 4UNQA 2XXAB 1EFRA 3CW2A 1G5TA 2YOGA 5FOUA 2J59A 3TQFA 3TUIC 1G7RA 1KY3A 3BRWD 2AN9A 1M2OB 4YXWA 2V55B 3REFA 3SDZA 1E2LA 2EYUA 1RJ9A 4RZUA 1XJCA 3L8YA 3KJEA 3CO5A 3I8SA 4RY2A 3L0PA 5DHFA 2RGDA 4PZLA 5J4LA 3UIEA 4K8OA 1DE0A 1A7JA 3RANA 1CBUA 4HAXA 2YC4C 4U5XA 4HDCA 5DI9A 2IS2A 3D31A 3D6TB 5CM9C 4OI1A 1UAAA 3KZ1E 3T34A 4ZCMA 2FOLA 2YWGA 3BS4A 4TZ0A 4W5HA 1KY2A 3PIRA 3WXMA 2QTFA 4LOAA 2JLYA 1E2HA 4POAA 2OBNA 3HWSA 1NN5A 5CIWA 3QXSA 1S3GA 2W0MA 3WHKA 1C1YA 3AKYA 3FMPB 3IHWA 3TBKA 3K0AA 4DRZA 2ZS8A 4PPGA 3JZAA 2W6JA 1VDZA 4CEHB 2KWIA 5BN3A 4G5SA 3KKPA 3FMIA 1JJVA 4L9SA 4XWOA 1DAFA 4WOPA 5DN6D 1NSFA 2P5SA 3N2IA 2XNSA 4IDQA 4LRWA 5CYOA 2XB4A 3CRW1 4JL5A 5HCNA 3THOA 4N3NA 4B2LA 2RHMA 1N6IA 1ZMXA 2C5LA 4AY2A 1NF3A 3GLHE 1N3BA 1XRJA 4URUR 3R8FA 3UWOA 3PUWA 4B47A 4A2PA 4A82A 5IT5A 3RSLA 3SFZA 2BMDA 2OM2A 2R44A 2C9YA 1QHIA 5IF9A 3R7WA 1G7CA 1ODFA 1OXSC 2FZ4A 1DBSA 4TMWA 5JSZB 4DB2A 1R0WA 1XZQA 1XEXA 1UEIA 4L9WA 3F3YA 4BFYA 3VMFA 2QP9X 1ZYUA 4JBYA 3IPXA 4CT4B 2BM1A 5KDDA 3FYHA 4BWYA 4DUGD 1OYYA 4JMPA 5EXTA 1H8ED 2B8WA 4OI2A 1T5IA 1G7SA 2NIPA 1Z07A 1ZP6A 1LW7A 4W5JA 3SC3A 1G3MA 5JI3E 3K0SA 4FW9A 2OLKA 2J0UB 3I73A 2ONJA 4DZZA 4RFSB 2GEDA 5FTLA 2WPDD 4TL8A 4CEJB 2ERYA 4HLDA 2W2VA 5E7JA 4TYPA 2JLWA 1DTSA 4TLBA 4EQ6A 1IHUA 2YOFA 2NO0A 1GFIA 4OHWA 1M7GA 4CGZA 3NG1A 5KDLA 2IS4A 4ZO4A 2AXPA 1QG2A 1R0ZA 1JQLB 3FFAA 1LNZA 4LBWA 3BBPA 3ND9A 4F4JA 2N46A 3TNFA 2GHIA 3FKSD 4PSVA 1M7HA 4Q00A 1R6BX 1T8TA 4JKIA 3DZ8A 2ZI4A 3BIFA 5CB6A 2GCNA 1OLOA 1YE8A 1DPFA 3FHTA 3PCRB 5FPSA 1YKSA 2CEAA 2VBCA 2YINC 5J4YA 4PSAA 1GG2A 4LYJA 1Z0FA 3SNHA 1RE0A 4ZCIA 4EJSB 1WBBA 4JJKA 4RSGA 4RZXA 2JJ8A 2Z0MA 2G88A 3VR6A 2ZRPA 5FTMA 4ZCLA 4GI7A 2OBMA 4B3BA 2JLZA 4EIWA 1H65A 2GJSA 1F2UA 1E69A 1OF1A 1IY0A 1HA3A 1XP8A 5EE5B 4XTCS 3RS5A 1G8PA 2BIFA 4L16A 1KMHA 3SHWA 4US0R 4HEJA 1KDOA 3SJCA 1L4YA 4MA4A 2ZYWX 2G3YA 2ZUCA 4Q48A 4E03A 1DEKA 2GDJA 1NY6A 2OILA 1II0A 1XF9A 4IOJA 5K8LA 3U4QA 4U7DA 4RCZA 3SS8A 4MRSA 4DDUA 4DJTA 3GFTA 2O8DA 1U98A 4IDNA 4PFSA 3N2EA 1OKKD 2IXGA 4XH9B 2PCLA 1BKDR 2IHBA 4TYNA 4IOMA 4S2EA 4WVFA 3RHFA 4XSHA 1W47A 1NVWQ 1G41A 2ZRAA 3B13B 4NYMR 3T06B 3I4LA 4II7A 4BECA 4C7OB 2AWOA 1BO6A 2DFLA 4MYHA 4RFVA 3TSOA 1IXZA 5EUMA 2EFHB 5FBRB 1ZAKA 1CJTC 4C4PA 5JJLA 4AD8A 5CK4A 3B6EA 4M0LA 2X8AA 3TSWA 1GOTA 3K0AB 3ZQJA 3A37A 1YZNA 4PC3A 4M2LA 3TAUA 4AK9A 5HKKD 2O8EA 1P3JA 2C9OA 4B3GA 4FMDF 1OT3A 2QMHA 2YJTD 3CONA 1WE2A 4PZZA 5JBQA 3K70C 1EFRD 2FGKA 4Q1CA 4UJ5A 4JL6A 2WSMA 5E7IA 4YXWD 4OK3A 1MABA 3TGPA 5J4HA 2C8VA 2L0XA 4HB3A 4ZDWA 2IT1A 1Z06A 2ODNA 4XOIA 5AUOB 2JLRA 3FHCB 121PA 3TUZC 3QG1A 1PV4A 4PC7A 2H92A 4OL0A 3R9IA 1XXHA 2ZE6A 3IBYA 1W4AA 3S1AB 1SQ5A 1Z0AA 1JALA 4D0NA 1RW4A 4LPKA 3R7WB 1X1RA 5JWRA 1XEWY 2FA9A 4IOLA 4YLGA 4C0LA 3CB4A 4OQNA 2WWFA 4LJ4A 3AF1A 1XEXB 2Z4RA 2BM0A 1KJWA 1UKYA 2KB0A 2HJGA 3KDSE 4LDJA 4PHGA 2QMEA 3VTKA 3QXCA 5E3HA 5F9HA 1FX0A 1DG1G 4JVNA 5B58C 1YHNA 4MRVA 3LXXA 1CRQA 3AKDA 4E07A 5SZHB 2W6JD 4G01B 5DHAA 5FUYA 1NVXQ 3R8CA 3LBIA 1UF9A 4C0AC 5FBLB 4AIIA 4LYAA 3NH9A 1R10A 1SKQA 1LF0A 3KQHA 2ZREA 3C5HA 4HLCA 2R65A 3KXLA 3IDQA 2IUUA 4A4DA 3NXSA 4DXAA 4KYIB 2ZSAA 3RRZA 4GPTA 1W5TA 4A0GA 1BYIA 3GLHA 4G0NA 3ASYA 2CE2X 4ZV4A 3TLXA 2YOHA 4Q47A 4U00A 1Z0KA 5EP3A 4QJ3A 2HT1A 2ZE7A 3E70C 2G77B 1XD9A 4KFTA 1TF7A 4KFUA 1ONBA 4PO1A 3QJYA 4LC0A 3NEJA 2MSDB 1GKUB 4AKEA 1JB1A 4IOKA 1N0WA 3A4LA 1KI8A 2R6AA 2DPXA 5D3QA 5HZHA 3K0CA 4Q1FA 1E98A 4UXIA 3T5DA 3KKNA 4R9UC 3FOZA 3LDAA 5D3MA 2WWIA 1OIXA 2CCKA 2OCAA 3B1ZA 5TVKA 2RHDA 2D06A 3AVQA 2FEOA 1VHLA 2B6HA 3GJ7A 4PHTA 4DLVA 5FUXA 3TKLA 2J46A 2NO9A 3SN6A 4MKIA 3VR4A 3MWLA 3QVUA 4KU4A 2ZSEA 5JRZA 1G17A 1U99A 2CNWA 1F2UB 2IF2A 2ORWA 4MH0R 4KV9A 2Q9CA 2B21A 4HDQB 4B3DA 4ZI3A 2QTVB 4WXRA 1TEXA 3ZS9A 4OHYA 3ASZA 3F5FA 1KMHB 5JLJA 1DELA 5H70A 2QP3A 3GLFB 4X8HA 1Z22A 2RGAA 2GJKA 3SOPA 5TY0A 4YC7A 3ZGXA 2Z43A 4N0DA 4B48A 4V0KA 2ZRGA 3WNBA 4DCTA 2YYZA 4PC6A 4B35A 3T1TA 4P4SA 3W6OA 1JR3D 4DDVA 2CK3A 1MRNA 1ZU5A 4QG7A 3B5JA 5L3RA 3X1WA 3PUZA 2PMKA 2QROA 4EPVA 1DG3A 4JLOA 5KO2A 4HI0E 1Q3TA 1U0JA 2AFIE 4IEEA 4DEYA 2ZRDA 1E9AA 4JT2A 4D4LA 3QQ5A 4QBFA 1QZXA 4YDHB 1T5LA 3AP3A 4WAUA 4DLSA 3EG5A 4M1SA 2ANBA 4O25A 1XJQA 2LWIA 2QY9A 1LF5A 3IKJA 3UATA 3RRNA 4JT4A 3B9QA 3HR8A 4M9QA 4V0LA 2CXXA 5AUQA 1PLJA 2UKDA 2IYUA 1AZTA 1NKTA 5FR1A 3I5XA 1P6XA 4P3YA 2VHQA 4HYYA 1C4OA 2D7CA 1SULA 1XEFA 2E9SA 1N0UA 5KOYA 4AKHA 2IF0A 2O8EB 4ZIRA 3FMOB 5JEEA 3CLVA 3LBNA 3EZ2A 1ZM9A 3QF7A 4R7ZA 1WBDA 4XTRA 4YDSA 1JECA 2IWRA 1EK0A 5DIFA 2ODBA 4NCNA 2HCBA 3PQCA 4I1VA 2ZRCA 2XZLA 1MABB 3LXRA 2EFEB 1KI9A 4P31A 3M6AA 2Z5FA 2P6RA 4WZBE 4Q18A 5DGXA 5UKDA 5AJVB 2ASEA 1QBKC 1OXVA 4Z1MA 5DLQC 3ZYCA 3AGPA 2KBEA 3I5YA 1ESMA 2IYRA 2MMCA 4Q9HA 1XXHB 2ZJ8A 3PENA 2ZUBA 3HU3A 2BMJA 4TL6A 1Z6GA 2HXSA 4V0MA 1N5IA 2H57A 2BBSA 1M1YE 3MD0A 3PUXA 2WWYA 1XD8A 1TU3A 4DT1A 4HLUC 1R8SA 2QSZA 1FZQA 4A9AA 2JLXA 3LX8A 3DEFA 3THXA 5DYGA 3U3RA 5H68A 3SBEA 4TTQA 2KBFA 2A5JA 1IQPA 4UKDA 1FTNA 1JXOA 1N0VC 1G20E 1NJFA 3MLEA 1PLLA 2OT3B 4TWZA 1W46A 1OHHA 1AJEA 1Z47A 2UZIR 4TYQA 1CU1A 1CR2A 1T6NA 4GBMA 1US8A 1TUEA 2OAQ1 3GLHB 4IDOA 5E7MA 2G9NA 1HURA 3EC1A 5C4MA 5KPDA 5C4GB 2ORVA 4D0LB 4DLYA 2WAYA 3DM5A 4D81A 2ZETA 3ZIAA 5JEDA 1SXJA 3M4YA 1WMSA 4Q7JB 2O8CB 1P2TA 3A1WA 3JVUA 4ZDKA 1WF3A 1U9IC 2P5TB 5KU1A 1RC8A 2WAXA 1DO0A 3LNCA 2X1VA 3P27A 3ADCA 3GQBA 2FEMA 1S8FA 3OFNA 3W6NA 1CRPA 1KO7A 1Z5ZA 3QF4A 4AKGA 4WBSA 4EPYA 2EQBA 5D3MB 4LHVA 3KJIA 4O3MA 4MDFA 3WP0A 3RS3A 2PEYA 4IVPA 3UKDA 1UBGA 4LV8B 5CLQA 1JBKA 2IYZA 1E0JA 2GJAA 2DHRA 3X2SA 3ZVRA 2OG2A 4OQMA 3D8BA 3TR0A 4EJSC 1FPMA 3DDCA 4GZMA 2IYXA 2P67A 4QBHA 3U6KA 1R4AA 1AN0A 1T4GA 4Q4JA 1GRQA 3AGQA 5TMPA 1XZPA 5FPYA 4Z54A 3LVQE 2VF8A 3LW8A 3LAWA 2ZAMA 2ZTSA 5SZKB 1U8YA 1W7AA 3L0OA 4LI0A 2ZI6A 4G5OA 3RLFA 1NMYA 3I72A 4HAYA 5EE3A 4A2QA 1XTKA 2CL0X 2DWPA 1HE1C 3M0EA 2I1QA 1QF9A 2IA5A 3ZJYA 1V43A 1IN5A 3AKCA 1SHZA 3KX2A 3I8XA 2QAJA 5FPKA 2EWVA 4IVRA 3QKRA 3VR1A 3GJ3A 3ZVLA 1HV8A 1ZD9A 2WIAA 1QHXA 3PFIA 1YR9A 4TQ9A 4DHEA 2J41A 4X8OA 1UKZA 2ZJAA 2ZM5A 2RGNA 2F55A 2QI9C 3BJIC 2GXUA 4LK2A 2BMEA 5KSYA 1RRGA 3J81k 1N6LA 3QY0A 2P6UA 2V8OA 2CNWD 4BLRA 1OFUX 2JCSA 5L3VA 1KKLA 3QEJA 1AS3A 1OXUA 5DH9A 3VU9A 3C8UA 2KI5A 1S4QA 2GVDC 3KQNA 4DLTA 3GP8A 2OXRA 1XTRA 5DI3A 5FR2A 1D6JA 1NN0A 1X1SA 2NPIA 2YNMA 1IXSB 3W90A 3IEVA 2Q9AA 3R9WA 1LV7A 4PPFA 4BRWA 2QUZA 1XMJA 2WWWA 1SHKA 1W48A 2P0EA 4RD1A 4B3XA 4HAZA 1Z83A 4GNKA 5HCIA 4I1OA 4KAXA 3W9YA 4C0KA 3IBGA 5A5GA 1YZGA 1WXQA 1Q1ZA 4H9GA 4LJ7A 1A2BA 2CK3D 3OEEA 1PLKA 4Q7LA 2GK7A 1R5BA 1XTSA 2QAGA 2HJVA 3GLIA 3C16C 2QM7A 1B0UA 4KLZA 1E2NA 2J7KA 4HDOB 5JRJA 1KK1A 1DS6A 2GJ8A 3GEHA 2PMDA 4DT1B 1XWIA 3K09A 3GFOA 2CVHA 1ZIOA 4ERNA 5K8IA 3CRMA 2VHJA 2Z83A 1NVUQ 2PLFA 2G1JA 1AIPA 3MUFA 2ONKA 3AF2A 1E9FA 2RAPA 3C14C 3AKEA 4QM6A 1IN4A 2PLRA 3B60A 2IUSA 4TMKA 3DMDA 4FIDA 1QHYA 3SBDA 1GZSA 2F3TA 1MV5A 1G7TA 1OE0A 4BFXA 1E6CA 1IJEA 3PEUA 4Q9LA 2VP6A 1CXZA 3U44A 1Z28A 5AUPB 4JSYA 1D8TA 5LD2B 5FBVB 1US8B 3CIOA 3LD9A 4PPNA 2HYIC 2WWHA 4ESHA 3CF0A 1NG9A 1P2VA 3TQCA 1U0LA 821PA 3BOSA 1XTJA 1G8YA 1SXJB 1FUKA 3HPQA 1P73A 1HY3A 2CLSA 4QGHA 5EP4A 3RVBA 4Z1MD 5JZVA 2BC9A 1Q44A 3HDTA 4V0OA 3VNUA 5FPTA 1DAMA 3LH5A 5E95A 5EXXA 2F1HA 3QE0A 5LB4A 5G40A 1ZNXA 3K0FB 1S3SA 3QF4B 5EE1A 4LSGA 2FFAA 1O87A 1GUAA 3BD9A 4M9SA 2VHCA 4NONA 4F92B 2RCNA 2ODEA 1MKYA 4FINA 2WKPA 3Q3JB 2AK3A 2ZU6A 1YZLA 2GRJA 4XSGA 3EX7C 4TLDA 1KDRA 4Q02A 3KFXA 4W5WA 1OHHD 5BQ5A 4BLOA 1Z2CA 4XWAA 4DBLC 3CX8A 1E0SA 2H16A 3F0TA 4PR0A 1K5DA 1W4CA 3W6PA 2WJHA 4PZYA 3L8ZA 1AGRA 4Q5IA 1XXHE 3BB1A 2GCOA 4Q4JB 1CLUA 4BZPA 2ZE8A 1VHTA 3CNLA 2XTNA 3PXGA 4AI6A 1EG7A 3A1TA 1SGWA 2X2EA 4XVQA 2XZPA 4TLCA 3ZIAD 2WJYA 2PX0A 1SXJD 5LBIA 1VPLA 2PH1A 1OV4A 3EWAA 4TQAA 3BFKA 5JJKA 4Z51A 1HQYE 2IK8A 4S35A 3UG6A 4KBGA 2FZLA 3DM9B 4LHYA 1UBEA 3H2YA 3KB2A 5FH9A 5L3SA 5HR5A 3BGWA 3OFND 4PO9A 2J9RA 5KSPA 3KKQA 5JMTA 2C99A 2J0SA 1VG8A 4IXNA 1SVOA 4RKFA 3VAAA 4TZ6A 1NIPA 1M8PA 2RKOA 4KHZA 3FVQA 1Z3IX 1ZJ6A 2QORA 4QBGB 4TTRA 4C0QC 1KSHA 1N5KA 4DWJA 4PQRA 2WICA 1IN7A 1MOZA 3SE0A 3VU9B 1ZC4A 1W36B 1KDPA 5JI2E 2WKRA 1Z8FA 5M04A 3HU1A 2FFBA 1R5NA 3ECCA 3NC1C 5DI3B 3ZS8A 4B3CA 2O0KA 4D4KA 2UVQA 2WKQA 2ZYUX 5J4KA 4M8NE 1XD2A 2QQ0A 3C4JA 3TH5A 4B76A 1EWRA 3A4NA 2D7DA 1XTIA 3E1SA 4R71A 1KSFX 4D0GA 2VQSA 1VIYA 3QKTA 1NSTA 4L15A 4BUJA 3MGCA 5IHPA 1VCMA 2C04A 1SZPA 3VKHA 1E1RA 3HYTA 3UG7A 2Z6VA 3GJ8A 3UPUA 1M7BA 1VTKA 3NBXX 521PA 4PX9A 1YJ5A 4L8GA 4Q7KA 1IOZA 2WZQA 5BYKA 3CNNA 1VG0B 2FNAA 1AK2A 1N6OA 1OXXK 4HZUB 1PZNA 4Q4HA 3K9GA 1KZ7B 1NLFA 4BFTA 2ZRBA 3AV0B 3BORA 1N6RA 1Q1BA 2QG6A 1HUQA 3BFXA 2CHVA 2OBLA 2VTKA 1Z2AA 2IUTA 4FXPA 4LBVA 4NHOA 4KSCA 1KO1A 1Q57A 3GJXC 4KBFA 2ZRHA 4X8LA 1GILA 1RIFA 4F7WA 1JXMA 1W0JA 4HB4A 3THYA 1G21E 2DWQA 4CW7A 4MKFA 1DOAA 5B30A 1SVWA 3CH5A 1T8UA 4KSBA 3H1TA 3B78A 2VHTA 3TIFA 1KAGA 5P21A 3CPHA 4TT3A 1W36D 5DYIA 2EVWX 2ATVA 2OCBA 3H0KA 4LX0A 2WJVA 4NZYA 4NH0A 1IN6A 2DFNA 3B1WA 3CZPA 3U44B 4QHSA 3BAFA 5BWMA 1NMXA 5GJBA 3NVAA 4GOXA 3BH6A 5AJWA 1AQYA 3UWKA 5JCZA 2V4ZA 4DDWA 4LJYA 3CF2A 2C98A 1DADA 4C3ZA 3MAAC 1HE8B 4FN5A 1IM2A 2BBOA 3LFUA 4CEIB 3OEED 3RC3A 2WWGA 4C9BA 2XJ9A 3A1SA 3KQLA 2F1IA 3AVTA 1CKEA 4OQXA 1BYUA 1TF2A 2GILA 4NCHA 4WIAA 4OHZA 1RRCA 1VG1A 3LRPA 5GJVC 3RRMA 3T5GA 4PO8A 4UNSA 4MUBA 1NVVQ 2VA8A 4G1UC 1F5NA 1RJ9B 1NRJB 2AXNA 3QI2A 1Z6TA 1G9XA 4BQSA 2EFDB 3UMSA 2LKCA 2ZSDA 3KXKA 1VG9B 2ERXA 4GDFA 1WB9A 3K0CC 4P32A 3U3MA 5CM8B 4BFSA 1P2SA 3H86A 3A8TA 4BZQA 1E2IA 2IX3A 1RVDA 4R98A 4DCUA 2E1RA 2C96A 4ZKEA 2ZVPX 2QA5A 3TAHA 3L2OB 1B23P 3VQTA 3EARA 4V0ME 3AUYA 1ZINA 2ZR9A 3GJ5A 4WXPA 3ADKA 5EE0A 4LJ5A 4HUTA 1IY1A 3EZ6A 4IRUB 1XX6A 4GZLA 3T15A 4TQUS 1E9CA 3ZQ6A 4HB0A 4H1UA 4MQBA 3P26A 2V6JA 4URVR 2IXEA 1D9XA 1T3LA 2WV9A 3H84A 1GNPA 2A30A 1UEJA 4Q66C 4DVGA 2VP9A 1D9ZA 2O5VA 4JLVA 1FMLA 4TYWA 5L3SB 2FH5B 4Z8YA 1T0HB 3QNUA 1TMKA 2XTMA 3VHLB 1FOEB 4UXHA 2AFHE 4EKDA 1C9KA 3U3KA 1S1MA 3V4FA 5DE3A 2IEYA 2YWHA 4DC9A 1KJYA 2NZJA 2XTZA 2NQ2C 4QBIA 4PAOA 1SXJE 2O8FA 3SEAA 2IS1A 1TF5A 5TB5A 1KJZA 3VR5A 5SZIA 1E2QA 4FWIB 3A4MA 3MG9A 4EFLA 2PL3A 3RAPR 4LJ6A 1XD2B 1PVOA 4URWR 4BFWA 1JNYA 2RB4A 1KKMA 721PA 2OCPA 2AKAB 1YRAA 2ZUDA 2J0QA 3OIUA 2R2AA 1NG1A 2N42A 3GEEA 4JLKA 4QGGA 621PA 5EJEA 3X1XA 4XD7A 1NI3A 1I2DA 2WHXA 2V7QA 3LW7A 3GD7A 5FBQB 4FMDB 3Q85A 1NN3A 4JJZA 1TAGA 2W00A 4LPSA 3NDPA 4P4TA 3EWSA 4Q4HB 4JLPA 3SQXA 1T0JB 1NLZA 4NYIQ 1NL3A 4OJQA 4EQ6B 1ZUHA 2BKUA 4DLRA 1W44A 1ZNYA 3VKWA 1I4TD 3THWA 1G18A 2V1XA 2FSFA 1YZTA 3TW8B 3AP2A 2CL6X 2ZRFA 2VYFA 1N2CE 5JWOA 2QE7A 4JBXA 3WMEA 2HDNB 4HAWA 2FWRA 4NCKA 8OHMA 4NPHA 4F38A 1FFHA 3LV8A 4Q4LA 4UNRA 4NE2A 4I81A 3U61B 3EZ9A 3KFVA 3VR2A 3PEYA 1UKEA 2G83A 2VIIA 4B74A 2FFHA 2JASA 2ECKA 3M1IA 3BE4A 1OH6A 1UBFA 3EZFA 1D2MA 2BCJQ 3LO5A 4DCNA 2D3WA 3SYKA 1YZKA 1E1RD 2CHGA 2A5FA 1EX7A 2ZI3A 3AEZA 4D2IA 4C2TA 3AF4A 3NIBA 2IC5A 1RPZA 2GEVA 4YMTA 4Q4AA 4MGIR 5LD2C 3NHAA 2VRWA 2AL7A 4ITRC 1XTQA 2F1RA 2ZANA 2XGJA 3ND8A 3CPEA 1FTSA 4DSNA 1ZW6A 3U4QB 4EPXA 1XMIA 4NU0A 2BBWA 1SXJC 1UBCA 1HQCA 2PZFA 2QENA 2O8DB 4UNNA 3FE2A 2VP2A 3WMFA 1W0JD 3DKVA 5FOSA 1CP2A 1E2KA 1S0UA 4MRPA 4J0QA 1DVRA 2FE4A 2GKSA 5LPNA 1S2MA 4KITB 1VCOA 4TT3D 3O47A 5GJCA 4AWXA 4A6XA 1DARA 2PT5A 4RD6A 1K6MA 1AS0A 2ZS7A 2EFGA 3GLIE 4GOJA 3RWMB 5FUVA 1P62B 5C2JB 1Y63A 2ODWA 1KNXA 2FSHA 5HZKA 1GNQA 3CR7A 4TN1A 4Q9IA 1ZU4A 5DISB 3QXXA 3QG5A 1G3IA 4Q9JA 4E09A 3KJGA 4MGYR 1ZCBA 2R6GA 1XNJA 3R20A 2ZJBA 4QGAA 2PEZA 3NTUA 5J47A 2OAP1 2OXCA 4IKEA 2FSGA 1CULC 2AKYA 2QQEA 3F8TA 1JQJC 4QRHA 1Z6YA 1KK0A 1OIWA 3MWYW 3K1JA 4GSYA 2G6BA 3PEWA 2A5DA 3P4XA 3RSOA 2BEJA 2XZOA 1NY5A 4XWKA 2ZJ2A 5FI1B 2NMVA 1IAQA 1W1WA 1G291 2AD5A 4JYCA 2XNDA 4GOKA 4JS0A 1N6PA 2DY1A 4PHHA 3LVRE 4V03A 2CE7A 1COWA 3Q8XB 2O8FB 1JJ7A 2Q0HA 4JIMA 4WZ6A 5F9FA 1WCV1 2ZE5A 1IXRC 1ZUNB 1HT2E 1X86B 2GETA 2KJQA 3G82C 3WRYC 1G8GA 4AG5A 2RGNC 4DSUA 4OHVA 4ARZA 4UXJA 1XEWX 3WNDA 5JS7A 4LHZA 4LWZA 3ZD6A 1MO3A 3K8YA 2ZI5A 3EIQA 4QC2A 1JI0A 1A4RA 3QVVA 4Q01A 1VECA 1QHNA 2OO7A 1FX0B 4B2PA 2ZRJA 3BC1A 3T1QA 4BRUA 3FKQA 4N1AA 2PX3A 1XPUA 1W36C 1N6HA 1ZIPA 3K9LA 1GTVA 4I1UA 2AHOA 4YMUA 5EE9A 1KO4A 3BB3A 4DLWA 1KI7A 2BV3A 1D2EA 3AQ4A 3D3QA 2MMGA 2H18A 4CRWB 3SQWA 1JAIA 2K5UA 4OI4A 3X1DA 2GNOA 1Q1QA 1GKYA 2AWNA 3QXHA 3GPLA 4E22A 4M1TA 3X1ZA 5FFMA 2C78A 4JVLA 4LZZA 4ZDIA 4NMMA 1R7RA 2V1UA 5TDHA 1FL9A 4PAQA 1S1CA 3THWB 2V9PA 2B7BA 1Q12A 4RCYA 2VSFA 2QAGC 5AK0A 3CUEF 4EAQA 2J5XA 4ZPXA 2RGBA 2OUKA 2BWJA 5FOVA 4A6PA 3ZVNA 2ZQ5A 3MFYA 4QM7A 2IW3A 2ANCA 1KAOA 1WA5A 1OFTA 4ACBA 2ZJOA 4W9MC 2HT6A 3K09C 5BN4A 4LJ8A 2J0VA 3OF5A 1P9RA 2CHQA 1G1MA 1I4DD 3WP1B 5G41A 1NP6A 1RKBA 4QL3A 3QBTA 4M1WA 4MRNA 1Z6AA 4OQLA 2REXB 4BEBA 1YR7A 2ZAOA 4XD7D 1ETUA 4B6EA 3RYTC 2EU8A 2FG5A 2GBLA 2V7QD 3C7KA 4M1KA 1J99A 1E79A 4KI0A 3ZZTA 4AYTA 2I1VB 3Q5EA 2BMFA 4FWTA 1TQ4A 4EPWA 3U7GA 1UDWA 2BKEA 2RGCA 4Z8XA 3NDBB 421PA 2BJVA 3OIVA 2IYQA 4Q4AB 1NIJA 1Z08A 4NYMQ 3CNOA 4YQFA 1U90A 2VP5A 2JJ1A 4MKHA 4E5UA 4HSEA 5KYKA 3KKOA 1ZNZA 3KB1A 1ZC3A 1O3YA 2FPLA 4P4SB 3DO6A 2J45A 2O8BA 3HPRA 3IO5A 1SVIA 4ZI2A 2QE7D 3SHFA 5KHOC 1KHTA 2AK2A 4ACAA 3QPUA 4URZR 1LB1B 1WDTA 1QHHA 2W83A 3CF6R 2LKDA 5IRCD 3KTAA 4AC9A 1E2DA 4A15A 3WYAA 5GJWC 1NJGA 2QL6A 2QNRA 1R2QA 1Y3AA 5EXPA 3WHLA 1I4LD 4TLEA 4MYUA 4O0MA 3SJBA 4BPBA 2OFXA 2PZGA 1N6NA 1P9NA 2XSZA 2FU5C 3B9PA 3GLGA 1JAHA 1BMFA 1M6NA 4LGMA 4X8MA 4M9XA 2NO6A 1KNQA 1EX6A 4FCTA 3EASA 3N5CA 3DOEA 1Q1EA 1KK3A 1G16A 1W0KA 2WPDA 4RVCA 1A2KC 4KCGA 3CRRA 4GMXA 3PG5A 2C03A 5CIQA 3T12A 3U3JA 5AJYA 4TLAA 2HEIA 2CL7X 1PUIA 4ZIRB 2OE2A 3VKGA 3PEVA 5HTKA 4BLTA 3VHXA 2R6DA 2ZPTX 2BCGY 3I92A 4KVAA 4LJAA 4TSFA 2BJWA 1ZVQA 3SR0A 1UFQA 2ZS9A 2W0SA 3B2EA 2IWHA 2JLVA 1AZSC 1CF4A 3NBZC 1XPRA 1E1QA 2C2HA 1V5WA 1GVNB 3PR1A 4NTZA 1MR3F 2GXQA 2WM9B 2C95A 4NYJR 1OFIA 4LHWA 5JSZA 3G5UA 4BZXA 2NTYC 5A4JA 4M1MA 5EP1A 3R9XA 1JEDA 1VYTA 3UMRA 2JIZA 1TTTA 4RD2A 3QSYA 5G53C 1E99A 2PCJA 4ARZB 2P6NA 4YMWA 3NWJA 1KI4A 5FTKA 4ASUA 3EW9A 2XAUA 2GJ9A 3ETLA 3EIEA 3QKSA 4OHXA 1J90A 3O8DA 3CWZA 4A1FA 3WRXC 4QXAA 4BLPA 1SVSA 2QT1A 4P4UA 3W3ZB 2JJ2A 4PC2A 4O2RA 5CYPA 2ZXUA 5EZ6B 4QGFA 1KIMA 1TEVA 4BFUA 3RRYA 5KSOA 2X2FA 3CWQA 4FMCB 4KODA 1NKSA 2VF7A 1GM5A 3AVYA 3C41J 2J7PA 2IYLD 4A0RA 4XVUA 1YU9A 3ONWA 4LC1A 4GMDA 3IQXA 3OE7A 1ESNA 4B73A 3HP1A 4IW3B 1K5GA 1N5JA 2ZROA 2XNDD 2FMXA 4C0SA 4IFEA 1SKYE 1HEIA 3GJ4A 1MO4A 3A6PC 3EZ7A 3W34A 2WOOA 4G5QA 1Z29A 5JHGB 3LQQA 5E4FA 5KNCA 4M21A 1COWD 3A36A 2JLSA 2QEQA 3CR8A 1S96A 3CPJB 4JLBA 4B3FX 1NN1A 2F3RA 3GMTA 3P4YA 3A1UA 1DAIA 3FDIA 4L4UA 2PJRA 2FPKA 4FD2A 1QHSA 2YZ2A 1EFHA 2GWHA 3WYGA 2OLJA 1DO2A 4QFMA 4RD4A 3H4MA 4MGZR 1W4BA 1J2JA 221PA 3T1VA 1NLYA 2F43A 2ZRKA 4BEJA 3FPAA 2Q6TA 3IPYA 3SJZA 4C0JA 2OCYC 1R8QA 3AB3A
chains in the Genus database with same CATH superfamily
4IEIA 3VZSA 1T9HA 1UT6A 3NUZA 4KBYA 4N5NA 3FJOA 4R8SA 2I3DA 4MUNA 1E2JA 2HHCA 2PR7A 1X1DA 2VAWA 5BV0A 3NI2A 1VPDA 5CVEA 1XPOA 4KJZA 1QVRA 1V7QA 4LRQA 4DTIA 1BN6A 1OJLA 2L82A 4YUAA 1ZD1A 2D2VA 4ON9A 4QATA 4DV0B 1TGVA 5L8VA 4ZEWA 5SY6A 3OZCA 4AY6A 1HSOA 2PG3A 5TF4A 4D6PA 1H5QA 4Y6LA 3TVTA 4PBTA 1DKQA 3U7HB 1AURA 4KKVA 4HATA 4IFBA 1GCIA 3UMJA 1WZUA 3DD1A 1GV1A 4YALA 2CMKA 3KXPA 2O8BB 3EZLA 3GARA 3A6GA 2G0AA 9GPBA 3FZGA 2W6NA 2HLNA 4QYWA 1GR0A 4R0VA 3AUUA 4F85A 4KXWA 2VBIA 2JAPA 5AW1A 2C3PA 5C7IO 3QWHA 3C3MA 4JZYA 2FP3A 1J0DA 4GRDA 4CMGA 2Z5VA 3AR2A 1BH6A 4DIEA 4NZMA 1MNAA 1JHZA 1DU4A 3ZD9A 1F7UA 5HEKA 1T9CA 1X7ZB 1Z9BA 3B7GA 4KXLA 3OJFA 2F7SA 4GWKA 2QPLA 1GLNA 2GB4A 2YWEA 3FWNA 1JEEA 2XNJA 4RVNA 3QFTA 5CGQB 1GAEO 1UC4B 1UM9A 4QHTA 4FDTA 1MGOA 3EPJA 1NXWA 1LVGA 4ED9A 2B3DA 2DETA 3QE4A 2CDBA 4UTPA 1XZEA 1Y3CE 3E3LA 3O8BA 3KKLA 1KRHA 1IDOA 1E8DA 2BEKA 5F9MA 2ZBGA 4GPEA 3QYFA 4IDHA 3TZHA 3ZOZA 1HR0B 1J2RA 3PQ4A 1E2GA 2O9JA 3Q6IA 4FD3A 3BA6A 1QHGA 4MTLA 5D5HA 2IYAA 1W4ZA 2JKZA 1Z7EA 4LMAA 5DOVA 5JWHA 4C4ZA 4QYXA 4IZHA 3PX2A 2IZ1A 1BXGA 1T3TA 2VH2A 3EYAA 4TQGA 3GLVA 6Q21A 4KRYA 4C0BA 4GXQA 1P0MA 1RLJA 1SEPA 4U39A 2C3OA 4E11A 1ZD3A 4MJXA 4Q3DA 1KMNA 1C3OB 3EXG2 3OQVA 1WV0A 3S1AA 2XITA 5HJEA 3S81A 3ZW9A 1AKMA 1GL9B 2GF9A 5CLLA 1BS1A 1C9NA 2C77A 3LBYA 5KDOA 4JVOA 3OQJA 4U9UA 4ZZ2A 3X1KA 5IVHA 5CDUA 1TMOA 1H4VB 3GLIB 1XMVA 3U2QA 1DWOA 2K2QB 2HF8A 4PG7A 1PL7A 3D6AA 1GGEA 3UJ8A 3ZIAD 4CKCB 3R9XB 2I29A 1QF6A 5K6AC 3TTXA 3COZA 1O5OA 2AOTB 4UDXX 2D0IA 3G7UA 3MWEA 3NU1A 3GPCA 3LQ4A 3X1JA 2XKKA 1CZLA 1OTYA 5AUNB 3B1YA 3NIFB 3CZQA 4GMHA 1WX1A 3JQ9A 3NHMA 2Q2NA 1IY2A 1T3ZA 3L84A 4RD3A 4A8JA 2GK6A 1Y98A 1G55A 3DAFA 3E5HA 3QWBA 2GN0A 2FR1A 4KQFA 1O0BA 3WWPA 4GWGA 2Z9DA 2A5YB 1Z2DA 3AUXA 3FMVA 4NF2A 1W0KD 2C8KA 4KXYA 1ZNQO 4YP1A 4JK3A 4TN5A 2UU9B 3FVVA 1SIOA 1FQJA 3GCZA 1Q92A 4OI0A 2Y8EA 4J94A 5H1YA 2FQYA 2O7VA 2ZJ4A 4I4TF 2EFCB 1M6YA 4IYRA 4UBLA 1OWMA 3DOCA 1PN3A 5IPFA 2PHZA 3L1UA 2EQAA 3N76A 3N0WA 4TSFD 3SFTA 1K86A 2P35A 4IH9A 2CXHA 3WXBA 4ARCA 4YAIA 1DWPA 2C2WA 1LTQA 3MSXA 3DTVA 5I5GA 1NC1A 2MTBA 3P9RA 4XWGA 4AJLA 2XUJA 5KVAA 2RI1A 5K0GA 1ZJWA 3LIIA 3CJQA 4PLGA 5BT9A 4QO7A 3O2SB 5DSZA 4LF5B 5AM4A 2JH9A 1LLCA 5CDFA 1HQKA 5JJIA 2KS6A 2KW5A 2UYGA 3B7WA 2OESA 1RYBA 1W93A 3H16A 5BMOA 2N75A 1EJ2A 1T2EA 1GZUA 2JIZD 3WKAA 3H7AA 5LQAA 2PUEA 4LIPD 2EKLA 5BSMA 4GRAA 3ITEA 4RDHA 1GXSA 1AB6A 1XJ0A 3GUUA 1QIKA 1U7DA 1A8UA 1YZHA 3AZPA 3A2KA 4PHCA 5GV7A 1U2GA 4OHMA 4LJKA 2P2SA 4NQRA 3GJ6A 1MFPA 4O2BF 1WUYA 1FP7A 4ZV7A 1RTKA 2JJ2D 3A06A 3A9SA 2GDZA 1B0ZA 4H2DA 2NTVA 1B7GO 2G9QA 1OBFO 4ILEA 4C22A 2A5GA 1PF7E 3NJ8A 1LFDB 1RYNA 3DTYA 2AHRA 1ZI9A 1MO6A 3L46A 3Q3HA 4HAVA 2X9VA 4BV8A 2RD2A 5F52A 2FQQA 2VP0A 4ALNA 2C0PA 3HFGA 1E2MA 2WMYA 2WU8A 1Z6XA 2IYSA 3QUAA 1LW6E 4X20A 1HKHA 4LFBB 4RH0A 3Q7PA 1SOAA 3F3KA 4BX3A 1L7VC 4RMHA 5JZ9A 2VF4X 2EX4A 2G0NA 5KOJB 1EINA 3CLTC 2DG2A 5EIEA 1KH1A 2DPHA 3M34A 4BASA 2O3SA 1IHDA 2G5GX 4A2WA 2IXDA 3E4DA 1ZM3A 4P86A 1OX4B 4M37A 1QONA 1CNEA 4WXMA 3R5XA 1IOWA 1SM4A 4R9NA 3REOA 1IDN1 1AD2A 3PPXA 1OROA 5K8TA 3B38A 4QQ8A 2B98A 3GVPA 5CJPA 5IMBA 4PZEA 4YI3A 1I2ZA 3IIKA 3K1AA 1J0EA 1NF2A 1R3UA 2G04A 1SUAA 2DP4E 2QMYA 4DLAA 4ZCRA 4XR9A 3QENA 3TUJC 1UP7A 1H6AA 1YZQA 3VSDA 1Z38A 4TUYB 2C7OA 1K6XA 1U63A 1DL5A 1NASA 2PYZA 3P2MA 2VF5X 4HTAA 2O8VA 2VJDA 2VSNA 1TA9A 2PS1A 5ALZA 3CXRA 3FTFA 3K0BA 1UADA 1E77A 1QFJA 1CQWA 4WE3A 4BX0A 4XX0B 1UXGA 1E7WA 1QYIA 3OP4A 3GCDA 5FX2A 1O8BA 1UPTA 2GZ1A 4ZAYA 1WRBA 3VV3A 5FWXB 4JVMA 1SY7A 4QJBA 5A5EA 5KQGA 4DCVA 3PUVA 4K81B 3Q7TA 2H5LA 1KYIA 2Z58A 1DB3A 1FFXA 2Z6AA 1YCHA 4TZKA 2OHJA 1QH0A 2Z2ZA 4JL8A 4K26A 2X22A 5EIBD 3TW4A 1S5PA 5AW7A 1DKLA 4MVWA 3L79A 1K8QA 2BHRA 1Y8QB 5C34B 2V3CC 2Z3WA 4UUPA 4LYEA 4MYCA 3ILSA 3ZE9A 2X2OA 1QP7A 1EJ6A 3I32A 1M5RA 4WLVA 2V0GA 4ZVMA 1IJFA 3DFKA 1IWBB 4WSOA 3IP3A 4MDYA 1NMEA 4P7JA 1SO8A 2JC3A 2ZVQX 3IQZA 1ZN8A 2A3RA 5D3KA 1RWPA 1OWLA 2QNBA 1FW6A 3M83A 1Y1KE 3JWGA 1YOVA 3PJGA 4I50F 5KTYA 4OP3A 3PHJA 4BEWA 1XNGA 1FFSA 1V39A 4DSOA 1TCAA 3HDVA 3MLBA 1VMAA 3NUQA 3ZU4A 5I8PA 2B83A 3W6UA 1ABFA 3JZIA 4R5MA 5ED4A 3SLKA 3R1IA 2QUAA 4M53A 1N92A 1OXMA 3THYB 4MP3A 3PZRA 1L4BA 1TLTA 1AS2A 1HL7A 1WD7A 3GK3A 3HXTA 3DL0A 3ENZA 3NEAA 4MGEA 2NU8A 4PXYA 3WGZA 4WOCA 3WLAA 2H59A 5B3LA 5KNBA 5FUQA 1CEEA 2FQXA 1N36B 4F4CA 5A4AA 1G19A 4JOQA 2D2FA 1N78A 5E2IA 3RTGA 1N8SA 4OLAA 1QV7A 1DZIA 1UM8A 4MUFA 3F6SA 1I0IA 1JLLB 4EHBA 4PZAA 3R4VA 1KDTA 1UFOA 4JAVC 2BKVA 2Q8PA 2BPOA 4GT1A 1T6YA 1YRWA 2KYRA 4FYIA 2B4TO 3QX8A 4G1BA 2E4VA 4M1YA 3EY4A 1VMIA 3FWHA 2IE8A 3G2PA 4JB8A 4DSTA 5JFTA 3JWJA 4YP9A 4OYYA 5LA6A 2A9OA 1RYDA 2AOUA 2VNJA 4MVJE 1JYFA 2BSQA 1U2QA 3ZWBA 1T9KA 2HC9A 3GLGE 1GCOA 2OBXA 5J2UA 5KSZA 3PC2A 1KI3A 1O97D 1SA0A 2Y1CA 3AJDA 2IZOA 2ACKA 1KP3A 3CEHA 2I6SA 4L72A 3VNVA 3CUKA 1IQRA 4LJRA 4ZDJA 5DMHA 3OOWA 4G1VA 4BCDA 1CR1A 2FFJA 2GBPA 4XPZA 2P2CA 1X7YA 5IUJC 4ZVNA 4N3AA 3O8RA 1GTL1 3H9EO 1YACA 2RBGA 4MUXA 2WTNA 4JKYA 4KFSA 2H5JA 5J58A 4KE7A 3QOWA 2AVNA 3RU3A 1OC4A 2JGNA 4MDEA 1MA3A 3FD8A 3CUWA 1YQ9A 2G1AA 4LZOA 5B2ZA 2WT8A 3S2FA 3GLTA 4RVHA 5BV2P 5DHUA 4JIGA 2OAEA 3W8RA 3BXZA 2P9GA 1YRBA 4RDCA 2G5PA 3MB5A 3SC2A 4GR4A 5ANRB 1U3FA 4R69A 1BOFA 1LI4A 4Q19A 5B1DA 4UOZA 2FGJA 4WN9B 4DDKA 4A36A 1Z6QA 1Z4OA 1DAGA 3I6MA 4NL4H 4J7AA 4X84A 1Y8RA 1LI5A 3FOAA 3E1KA 1PL0A 3BG5A 2ZJ1A 3GGOA 3RVMA 1NNEA 4L22A 3W4KA 1FU4A 2JL1A 3L7CA 2J3JA 3GGGA 4EB0A 2W6ID 2VJOA 2REQB 4P3OA 4JY7A 3W4JA 4GIBA 4ZHQB 2AEEA 2W11A 3Q2IA 1SZDA 1BW9A 1BN7A 2AGVA 1EA5A 1JPJA 2ISQA 2HXYA 2VPPA 4JLMA 3OJEA 1A82A 4HB2A 1JIXA 5TT0A 4F8EA 2LP4Y 3QYAA 2AQ8A 3EEBA 2II6A 2WIJA 3ST7A 5AR1A 1E18A 5IJWA 1TA4A 2CJWA 1GQQA 4L4ZA 4S1WA 1T3HA 1YQTA 1YI0A 3H3JA 1JWBB 2PANA 3EVNA 3RKSA 1JHAA 2NG1A 5IT0A 1UP4A 2XOKA 5T4HA 1N5LA 5FPQA 2O3QA 1BFKA 1Q0HA 2NZ8A 1KFBB 2X8BA 3R0VA 1H8HA 3BF8A 2H07A 4DGSA 4EYSA 2DEUA 2HX1A 2DULA 4G4SO 4GP6A 4Y2UA 1NQXA 4QXOA 5TJHA 4BPRA 1XCBA 3PITA 1FY2A 4RF5A 3P0EA 4BVFA 3HZRA 4X6YA 3A05A 1L5KA 2P9EA 3ODPA 3IDSA 4P4GA 3HCAA 1V95A 4F46A 2RG1A 3NCHA 1VGQA 1ZXBA 3C3YA 3CRVA 4AICA 4EFDA 3FWYA 3UJBA 3WAJA 4LOLA 2YX1A 3IUSA 1P6UA 1T4DA 4D4MA 1CR4A 1DBWA 2FWBA 3R6WA 3RC8A 3OJWA 1BVRA 1MB9A 3DG9A 4V0QA 2Q7DA 3BA1A 4IZIA 3OWXA 3C3KA 1KP9A 4PXSA 2WE7A 1TIBA 2ORIA 4DLUA 3A6EA 1ELOA 1XQWA 1H2HA 1PS9A 1XZMA 4ND8A 1SCAA 3PYLA 2LW7A 2WI8A 2BM8A 1GD1O 4IG4A 1NMZA 5DXJA 4E3WA 3GUZA 6NULA 3ZG6A 4CNQA 3I1FA 2A94A 4C2AA 1JWAB 1M2JA 1ZZEA 2QTNA 4NQZA 1OZ0A 4UOQA 2OHFA 1IVNA 3KJNA 3EGIA 3FA2A 4DPKA 5I4BA 2NOAA 2VK4A 3RSCA 3PQ7A 4XB1A 1L7RA 4UBMA 3QLTA 1RQRA 2OFWA 1YF3A 2Q21A 3WZMA 3PQ2A 1F8XA 3Q0IA 2EFYA 2VJKA 4PTLA 1W6UA 3KXDA 3JQDA 4PYNA 2P9QA 3DULA 4GSKA 3V2UA 3IUPA 4ARUA 1U3DA 3ZXIA 1GPUA 3V4RA 1KOLA 4RA9A 2VR1A 3CVOA 4OBEA 4PR3A 5DKFA 1OMOA 2PBRA 2ID4A 1AU9A 3CZ4A 4R54A 3AP1A 1JE1A 1JSCA 1ZGAA 5DX0A 5IUKC 5SV2A 1BWSA 1PJZA 1RI4A 1YB6A 4OXNA 5EIAA 2XB6A 4GM0A 4H3SA 1E9SA 1NVGA 1Y5NA 3DWFA 4A16A 3K0EA 3VNBA 3RH0A 1M1ZA 4OJKA 1TEZA 1AQ6A 1AKEA 2OZLB 4TTIA 4LZAA 4KR7A 2HIMA 3UENA 1NVEA 1ZIYA 3IVXA 4QJ4A 1A76A 2ILTA 1Y9ZA 3MXTA 3M3DA 3E22A 5LDDC 1BDHA 4GL2A 3HVHA 1T24A 2XGMA 2B92A 2ZI9A 3LFHA 3NH6A 4JP2A 1JAZA 4Z4CA 5ICMA 3BCUA 3PL5A 3ZDYB 1G1AA 3TJRA 3K20A 4OA8A 5DO9A 5I3ZA 1X80B 1E0KA 3TLCA 5F1YA 1I7LA 1KHHA 2Q3BA 1AXEA 4KO8A 1QIHA 2JFPA 1R8YA 2O0HA 4KQ9A 5EWMB 3SX2A 2ENUA 2VH5R 4DADA 1L7BA 3A11A 1RWQA 2DUUA 1JPNA 2J9XB 4O4IB 2IRWA 3WJ1A 4OIMA 3T7IA 1ZOIA 2PSSA 1M2OA 2QX7A 3IA2A 1LK0A 3EBPA 3K0KA 3LMKA 5D1NA 3SDSA 3UHFA 2PY6A 1AKWA 1PW5A 3HUDA 4HRYA 4B2IA 3WNCA 3KR0A 2FQWA 3R0QA 1CG6A 1QE3A 4QOEA 5K0BA 4Q39A 1HTWA 4L6IA 1GL3A 3TVYA 4KN5A 3GV0A 4NATA 4RY9A 1THZA 4BYGA 1JVBA 4URHA 4BVJA 1K88A 5BW8A 1TFRA 2VDPB 1FFAA 4NX2A 4EMTA 1J0XO 2ODAA 1CUAA 2ZYVX 1J7KA 2WTAA 4CI9A 5JE8A 4OY3A 2BMAA 4Q7MB 2NPOA 1II8B 2XBLA 4PLYA 3U4DA 3UJCA 1K6EA 4GP7A 1U80A 3BMNA 3JPWA 4FFPA 3ZXSA 3VPDA 4R8RA 5BYBA 1Y9JA 1AN9A 1J09A 3A04A 4U2DA 1FXUA 1BJTA 1CYDA 2HPZA 4RV9A 4EARA 4UVGA 5REQB 3QHPA 4YR9A 3K70B 1GQFA 2Y4NA 3B5IA 5HQ3A 5EGSA 3A6LA 4QUIA 4DKXA 1YVDA 3QBVA 4FNOA 4KYUA 2SCUA 4LXUA 1T91A 2DF8A 4HQ0A 4QYTA 3ICWA 3QA9A 4DUGA 4CEHA 2ACVA 1MF7A 3P20A 4CUKA 2PKRA 2PH5A 3P97A 4DCCA 4RGQA 1UJ6A 4BGVA 1DAEA 4QT4A 1RYFA 1R5OA 4X7MA 2P3SA 2Z8YM 3S7TA 4E14A 1GSIA 2GYWA 2XNCA 2Z4SA 3BZWA 3MMZA 4LI3X 5EP2A 1LDMA 3WMGA 1FNBA 3F97A 3FVRA 1EG2A 1AK9A 3OQ6A 1Q7CA 2UVDA 5IP5A 3TMKA 1PWEA 5I7UA 2I4IA 2G09A 3CT4A 4W5QA 1X1BA 1C3EA 3IMKA 4EBFA 3NTVA 3JQCA 1ZSYA 1JHYA 1VA5A 3DMPA 1P4SA 1QGZA 3KNZA 3NHBA 3PNQA 3T7TA 2IYEA 4KLCA 4E94A 2I66A 4U7GA 4Y67A 2HHAA 1NJ6A 1AKTA 1Q6YA 4KQMA 3M89A 1C9JA 5FWYB 4D9FA 1SIBE 3OY2A 4AP9A 2JANA 2CCJA 3U7QB 5IYZB 3WBBA 2FPOA 4JNCA 5FOQA 1IK6A 2WK1A 3MEQA 3DEAA 4R8VA 4ZJYA 5DHSA 2AJ8A 4G4JA 3STTA 3OMXA 2H5EA 4OQ4A 3DKPA 3KQQA 4DA8A 1KQNA 1JEOA 1GSHA 3CR3C 4OAQA 4CM4A 3GB9A 4DJ5X 3HLKA 2OFOA 5IKEA 5A9RA 4B5LA 2B8EA 2QVLA 2WU1A 3B7PA 2RE8A 4Z7NB 4KX5A 4BJ1A 3JD1A 1E9DA 4CVNA 5CDFE 2Y77A 3EPRA 3PNMA 4LZLA 1HLPA 4S0ZA 1ST3A 4UJ3A 4FSDA 2V74B 4RIGA 3C3XA 5BRAA 2F6RA 2JFFA 1V35A 4KXQA 3I1YA 3KSRA 2AFIA 3OD1A 1F2VA 1KJJA 2J0EA 3BSWA 1MGPA 1WIWA 5ESXA 5JCPA 4EBBA 5LUAA 3ANSA 4RFSA 5AVVA 1N77A 1GNSA 4O2LA 5MGBA 4CEJA 3QLVA 4J0HA 4F4IA 1E2BA 2B1RA 1W8DA 1UDXA 1XKTA 1BX1A 1XNHA 3C1TA 4Q05A 2HJRA 2QY6A 2D0OB 2X9NA 3OZBA 3L7JA 4MW7A 2ZIXA 1UBHS 3LU1A 4O8ZA 1P81A 1SVMA 1Y48E 2JFYA 1SWVA 4JP8A 4KAJA 4O1HA 4EW2A 5K99A 3ZX4A 2V7EA 4GC9A 3VH2A 3GGJA 5JNLA 4HDNB 2JFWA 1YB5A 1PZMA 3G5MA 4Q3EA 2ZEJA 4OBXA 5TS2A 4B43A 1PJBA 1ZK1A 2Q3MA 3CYFA 3M6UA 3ADPA 1T5SA 2IP4A 5EXDA 4BNMA 5JBNA 4K40A 1SB8A 3L6CA 4JI6B 2Q8NA 4PSUA 1H3FA 3HV2A 4N0EA 1D03A 2QLTA 3LBHA 4I1SA 4KLNA 2F9LA 5AJXA 4AZ0B 3M6VA 4WHMA 5BPHA 2L42A 3RHSA 1WZEA 1JG3A 3ZI7A 3A58B 3V46A 4QUBA 4D45A 3K1YA 1BKSB 1Z0JA 2NPFA 3BUSA 3JV7A 3IKLA 2P69A 3NBYC 4R31A 4D9MA 2ZITA 2DWUA 5C5CA 4L8FA 4ALIA 4I6GA 3RFVA 4LNUA 2JAUA 5EZQA 1O0SA 1QVAA 1T13A 3QEOA 3ZWWA 1OH5A 1E4EB 2M6RA 4KFRA 1RJGA 5DRTA 2CWDA 1I6MA 2SNIE 2JFBA 5ALHA 3TNDA 2CEKA 1K27A 1EWKA 2H9YA 3FOWA 3SI7A 5TARA 1U3VA 1M1YA 5KB3A 1E96A 4NU5A 3INNA 4PCAA 2Q3HA 1K8RA 2IZZA 4GRIA 4YCAA 5ALWA 1KI6B 2FW0A 2PNJA 2F59A 1PWZA 4AX4A 2XXAB 5H02A 4CDNA 3AWIA 1G5TA 3HN2A 5FOUA 2J59A 3PGA1 2HAEA 4FI3F 1KY3A 3TQFA 1ZA2A 4L51A 5DLDA 3FYSA 4L76A 2AN9A 3CN9A 5CH3A 2PRJA 3OPNA 3PNKA 2ON6A 4KWCA 4IIGA 3REFA 4RK5A 2I2BA 2F8SA 3DBIA 2W2PA 4OG2A 1G20A 4C6RA 1ZJZA 2H00A 4XYBA 4QDTA 5BW5A 1L8LA 3VDQA 3I8SA 3OT4A 5DHFA 5E4YA 4MVJF 1XVVA 1QRUA 5KJCA 3KJZA 4WLNA 3INGA 4JI2B 3G2OA 3JTMA 4J9UE 1DCKA 1QDUA 4K8OA 4B09A 4NVRA 2HY7A 1OZHA 2P4HX 3NTQA 5IEJA 4HAXA 4U5XA 4R3NA 4IKPA 4HDCA 5DI9A 3IVMA 3H2JA 5CM9C 3D7NA 3A7DA 2FOLA 4RO0A 5JSYA 4WX2B 5HMLA 3LCMA 4UVIA 5B36A 4C6HA 2A9QA 1W8IA 1S8OA 1P29A 2W2OA 1DEHA 1KY2A 2AI1A 4HXYA 4KIUA 2YICA 4OQPA 1JEJA 3R7LA 1N5MA 4OBWA 3WXMA 1PFGA 1A8IA 1FRQA 4ZQIA 2OBNA 1HNNA 3E7FA 3KZNA 3TW0A 1NOJA 2ONCA 2VHEA 1C1YA 1DTWA 1DQZA 2W0MA 3AKYA 3K0AA 4M1EA 3WHKA 3AC0A 4HQ6A 3BIOA 2IYOA 3GW8A 2W6JA 1VDZA 4I5FA 3Q3IA 2E49A 3N59A 3IT0A 3WGGA 4G84A 3T3OA 1XVUA 2BAGA 2F1KA 4HDMB 3UAXA 4PY2A 4AMYA 4ZDKA 2M98A 5J2TB 4Q15A 4P0QB 1NSFA 4CCAA 2G1UA 3CCFA 1D5WA 3NHKA 1NXPA 3PKIA 2ADMA 2PGNA 4DTCA 5JADA 1JH8A 5KYTA 1V5GA 3CGGA 3CRW1 3DCJA 4XUCA 5HCNA 4CM7A 4HNUA 3BMQA 4TVBA 1Q0RA 1AQJA 3GVHA 1Z8DA 3FLMA 3DV0A 3GLHE 4I6EA 3QNWA 1SK9A 2AZMA 3OPMA 3IMGA 1I24A 3PUWA 4LK3A 2JLCA 4B87A 4A82A 5IT5A 4QODA 2CFIA 1H4QA 2R44A 1JI3A 4BFCA 2M6SA 2VDKB 2BEVB 2JI8A 1G7CA 3I6YA 5K6RA 2IIPA 3UV7A 2Y2UA 4MTCA 1DBSA 4HADA 4TMWA 3R7DA 4EA7A 5JSZB 4INJA 2JNWA 2Z3ZA 1X7WA 1R0WA 3E7DA 1XZQA 2AI2A 3B89A 2CNDA 2C7RA 5TC4A 2DMRA 1UEIA 4L9WA 3F3YA 4UU8A 1UBRS 4TGLA 4NRDA 2ZB7A 5BQ3A 2PUJA 4BQRA 3LT4A 4E4YA 1I1OA 1CEXA 1RLIA 2BLLA 4U0KA 3L4BA 4KWIA 4EY6A 5KDDA 2VYQA 3TX6A 3RSSA 3KYDB 1OYYA 2CZQA 2F62A 4JMPA 1TT7A 1Y5IA 4OI2A 2ZSIA 3VPAA 2ZUUA 5DX8A 2VXOA 4CQMD 3RUEA 1ZP6A 4HDSA 1AF7A 1ECCA 2ID7A 2Q2OA 1G3MA 2W2QA 2X8JB 3THSA 2J0UB 1CY6A 2ZQYA 4WK0B 3TLGB 5G4KB 2ERYA 4HLDA 3RSHA 4XARA 1EVLA 1OY1A 3AHFA 4DM7A 2GPJA 3FDJA 1DTSA 3VVBA 4LE2A 2YOFA 3USES 3NO4A 1YUMA 3TPCA 2UVPA 3WDLA 2O3TA 1LNZA 4F3NA 2J3MA 3ND9A 4WK4B 4E2XA 1RD4A 3TNFA 3AIIA 2GHIA 4KQKA 4TS1A 2IEAA 4P7BA 5BMVF 1RYMA 1T8TA 2IIBA 3MWFA 4GI5A 1Z74A 1EA7A 2VXYA 3A6ZA 1PGPA 1OLOA 3G0GA 1HG0A 1YE8A 3W5UA 4E5SA 2J6IA 2CEAA 4FBLA 4MWDA 4EF6A 5M3BA 1GG2A 2ZZMA 1Q0PA 4LYJA 4B3IA 1UKBA 5B6PA 3TSYA 3ROQA 1Z0FA 2Q9UA 3F9IA 3GBVA 2EJCA 3NIWA 3Q2KA 4H1HA 4ZCIA 4FYXA 4RZXA 2GPYA 3VJKA 3ZJ4A 5B1EA 4ZZ1A 4ZMBA 4JT9A 2OPBA 4CIBA 3VR6A 2W42A 1I9CA 3U39A 3QVWA 1OI2A 1D6MA 2NZWA 2RDMA 3D7LA 4W6QA 4YWHA 4B3BA 4O4HB 5HWSA 3ND6A 2XVAA 1M0WA 3NLLA 3GA0A 3C87A 3L40A 4YRQA 1XRLA 1NZJA 3RADC 1GFZA 2HRBA 3RS5A 3U62A 2QUIA 4L16A 5JXGA 1HNXB 4PCLA 4NOLA 4R01A 3GHHA 3O7MA 4YX9A 1L4YA 5FJJA 5AVTA 5LOVF 2FPGA 1WPRA 1NXVA 3IVCA 2G3YA 3CJTA 1QC5A 1RAFA 3ZZNA 4E03A 2P3OA 4N3CA 1NY6A 4HT3B 2H0RA 4MV7A 4QPJC 3RC2A 1II0A 3OC0A 4IOJA 4IIJA 1LDNA 1PNOA 4MRSA 4FGSA 1LBEA 3GIWA 2BGTA 3KD3A 2XHEA 3KR9A 2BHSA 3VVMA 4IDNA 4PFSA 1UZAA 2G5TA 1K7XB 4FGKA 1QPZA 1FTGA 4ZCPA 3L7DA 3FNFA 2IHBA 2V7PA 1X9IA 3DAHA 4IOMA 4WVFA 4OQEA 1MU0A 4D9IA 4AJIA 1BG6A 1NRXA 3EMKA 2H2GA 1JQEA 4N49A 4B4VA 2PR2A 1WKBA 3I4LA 3GI1A 4NU6A 4WCDA 4II7A 3ZE8A 5LJLA 5B12A 3LUJA 4M8KA 4P7GA 4BECA 3Q7EA 2FN7A 1Z7YA 3VGPA 3L4JA 4QGSA 3G6KA 3TSOA 4AJPA 4C4PA 1ZAKA 3JASB 4IGKA 5A3JA 1Y9AA 4W8HA 4YB8A 4EFMA 4M87A 3TSWA 2IHJA 4CLEA 1C2TA 1CS0A 3LOUA 5J9FA 5CB0A 2P2ZA 3GDFA 1E3TA 2YXDA 1KYQA 2XT9A 2FI1A 1I13A 1E5TA 1YI1A 3BCHA 4C0XA 1SUCA 3EVAA 2IUFA 3LDHA 5BN3B 1UM9B 2G4LA 2O8EA 5ENVA 3VZRA 2N3ZA 2Y9PB 4FMDF 1TT5A 2I99A 1QVZA 3K70C 3JRNA 4TMFA 2LZ0A 2IXBA 1ZL2A 2D54A 4Q1CA 3I42A 4JL6A 1R9JA 3RAEC 1RXIA 2NUAA 3MBIA 1TM1E 2RK3A 2XRMA 4HB3A 2VYNA 4ZDWA 4D4GA 5C35A 1HPLA 2FJ0A 1C81A 4MVJH 1K6IA 3E7XA 4NU8X 1KC3A 4MQ5A 5JAHA 4AF6A 4ZTZB 3FG9A 3ACDA 1PV4A 4PC7A 2H92A 1BE6A 2GZMA 3NVKI 3RROA 2ZE6A 5TF0A 4U63A 2UZ1A 2NUPB 3S1AB 1XRQA 3WIVA 1WETA 4LPKA 1C8LA 3DBRB 4DN6A 1Y3BE 1NM5C 4EJMA 1X1RA 3O9MA 4IS3A 4LJ4A 1JJBA 4HGPA 3AF1A 1A3CA 5JISA 2Z4RA 4LDJA 9ABPA 3Q11A 5E3HA 2HJGA 3GAZA 4YT4A 3VTKA 2QMEA 3U4MA 3QXCA 3GFVA 4NMLA 5ALSA 1THTA 1WKCA 4MWSA 5B58C 3RFCA 1ECLA 3LXXA 1VL5A 1RCUA 3AKDA 3BTVA 2E85A 1FS4A 2ARKA 4L6AA 2B94A 1T9ZA 2QTTA 2AH5A 3F6CA 4P08A 3MXOA 3C74A 2H3HA 2Z8YA 4RU1A 5EG5A 4E3ZA 1VJ0A 3U3ZA 4WQMA 3PI7A 3KQHA 3C5HA 4DXAA 5IKPA 3IDQA 4YJ2A 3DFFA 5MF6A 3EIXA 3FFXA 4QICA 1JQAA 3PF8A 1BYIA 5J5VA 3PXUA 3NZEA 3OPXA 1YZVA 3ASYA 3D43A 1T35A 5KI6A 4DIOA 2YOHA 4QJ3A 2HT1A 1NU8A 2ECFA 2OQIA 3E70C 1CUGA 3EFOA 4PO1A 2EIHA 1D0VA 3QJYA 3H6KA 2W4MA 4DC1A 3CF4A 3PZBA 4Q3AA 2A67A 4FGUA 3CEAA 2GYVA 3MRXA 2V4UA 1J0BA 4LAFA 1RPNA 2UUCB 4X65B 2FEAA 1KI8A 1L4LA 2DPXA 2ZULA 3OETA 2IDZA 1ZIDA 1Y3FE 4DJJA 1PAUA 4L8WB 3EGCA 4Q6WA 1GDTA 3PGXA 4F6LA 4ZYYA 2CV2A 4G41A 2XDQA 2XE6A 5CIYA 2YY5A 3KKNA 3PLNA 2HCTA 5T4FA 3RYHB 1X9HA 3LDAA 1KDYA 1CZOA 2YWCA 3G17A 4D44A 1Z62A 5TVKA 3GD5A 3AVQA 3I2JA 1D0SA 4DLVA 2P9JA 5FUXA 1R4NA 5CW1A 3TKLA 2CYAA 5CVTA 4A3SA 1CZKA 1OCEA 1H42A 4EX6A 2QTRA 1Q0QA 3H8WA 2ORWA 4MH0R 3C5EA 4NS4A 4HDQB 1MEJA 4RJIA 2EOAA 3N87A 4KNWA 1QMGA 2AE2A 2WW8A 1DELA 5H70A 4OJMX 4YCDA 1YFJA 1UXOA 3BT7A 2QP3A 4J4TA 1YR1A 5ARCA 4CLHA 3OU7A 3VUEA 4MCJA 4YV0A 3KYJB 2COEA 2QGFA 1PDOA 2Z43A 4N0DA 1E6KA 4V0KA 4C14A 2Q46A 2QF7A 2XCLA 3DHNA 1UFRA 4WINA 1QP4A 2VFAA 4HX2A 1UP6A 2FXVA 1ID8A 4E08A 4XPIA 2BN4A 2XZTA 4MRMA 4G1EB 4B35A 9LDBA 4P4SA 1ODKA 4R1QA 1NE2A 3W2HA 2I2FA 3KQMA 3FY4A 4V3BA 4E6PA 2A35A 4DDVA 5KYYA 1H2ZA 3NFYA 4IQFA 5C5EA 2PMKA 1ZUD1 1DBQA 4RV4A 1WMFA 2JCBA 4EPVA 4GWLA 1DG3A 4Z4EA 3VU0A 3JQAB 2ZQZA 1GZ3A 3PBKA 4INOA 2AFIE 1U0JA 1FJXA 4BZWA 5IM4A 2ZRDA 3UV3A 4JT2A 2ZM6B 4LDZA 4WAUA 3AP3A 4MUEA 1Q1GA 2BTQA 4M1SA 2TMYA 4TYMA 5JVDF 4OQZA 1QYRA 1R8JA 2G4CA 1B14A 3K1AB 4MK4A 3B9QA 2GS9A 4AMVA 1VIDA 2NSDA 2ZGVA 4J7XA 2PSHA 3DR5A 2RH9B 3G5LA 1AZTA 2G17A 5CURA 3W5DA 2FR8A 4D8TA 4P3YA 4DR7B 2X0NA 3NBQA 4HYYA 1UINA 2INGX 6LDHA 2E9SA 4PCVA 3JD3A 1FP1D 2IF0A 1OI4A 2QWXA 4YACA 4ZQHA 4ZIRA 5AIBA 3FMOB 3LBNA 3HL0A 3KDAA 4KMSA 3QF7A 4R7ZA 4MW2A 1QE5A 2R84A 4JA2A 2IWRA 4DVJA 1VE6A 2XGSA 3GRYA 3HGQA 3JSXA 1EK0A 5EMNA 5KNLA 2HCBA 1MABB 5KVVA 1CV2A 2Z5FA 5CA0B 2F64A 5AJVB 4W5TA 3HQ4O 1Y3HA 2C31A 1ISIA 4R2MA 3DDHA 3I9OA 3NT2A 1OXVA 2B4QA 4RGBA 3WE7A 4DREA 3WB9A 1NURA 1SCDA 3INYA 2WWVD 2KBEA 3LP8A 2IYRA 2MMCA 4Q9HA 1Q1AA 1XXHB 3QK7A 3PENA 4ZOLF 4CU2A 3MGAA 3W7AA 1KYWA 4ONEA 2HXSA 1KYYA 2Q0QA 4TL6A 2WJWA 4V0MA 4GL4A 4LDPA 3V32A 1DKMA 3L6DA 1P2BA 2H57A 4PTZA 1KZ9A 1DTEA 1M1YE 4UBIA 5IBRA 3T7EA 3WWZA 3L41A 2I2DA 4D5EA 2P2YA 1IZ9A 1RQXA 2GASA 3QVJA 3ZNPA 3U09A 2WF8A 1VLVA 3RNOA 2GHTA 3THXA 5CMLA 3L6RA 5J1SB 5F78A 1M5TA 3GO4A 4J8PA 5KYXA 2KBFA 4X7PA 2MCFA 2RIPA 1N0VC 2CLMB 1G20E 4F9GA 5ESRA 3ZNQA 1PLLA 4TWZA 1TTQB 2IOYA 1BDJA 4ZRDA 3SBXA 1HSZA 1OHHA 4CKCA 4F3CA 1IBLB 4DBVO 3P8ZA 3JATA 2DPLA 1CU1A 2GLTA 5F1KA 4X61A 3RYIA 1JIJA 1CR2A 3ESYA 4NBRA 1Y6QA 5GP1A 2GYUA 3C70A 2Q4TA 4C7JA 2AFHA 2AI3A 4EY7A 5JD6A 1KVRA 2OAQ1 3GLHB 4X7BA 2GZ2A 2C2GA 4W9NA 3H2BA 1GGKA 4FHGA 2G9NA 4P58A 3AERA 1NGSA 5C4MA 3CQ9A 3G5TA 1E8NA 2ORVA 4DLNA 3OQMA 2H63A 3W04A 3T52A 5JEDA 3EAFA 1XR3A 2H1IA 1TGYA 2GK3A 3M4YA 1P74A 1P2TA 3INTA 2O2JA 3A1CA 3JVUA 3C6XA 4YECA 1ZLYA 3EXEA 1DX9A 2P5TB 3K0HA 4LWOA 1KAHA 2O6HA 4QLOA 3TIVA 1TQHA 5DTEA 5LA6B 5DSTA 4F45A 3IURA 3K15A 3DZKA 1LBSA 1K75A 1DO0A 1IPEA 2W2LA 2WAXA 3IMFA 4ZGBA 4KH1A 3C3CA 3ADCA 3GQBA 4YHHB 4OBBA 5J2UB 3SKYA 4PNZA 1KO7A 2QVCA 1ZISA 5A4DA 4WBSA 2EQBA 2D1TA 4LHVA 5CBPB 3KJIA 4B7CA 1ZR2A 1JAYA 5JNWA 4NXMB 4R1TA 4C89A 4DA4A 2GTIA 3R75A 1XAGA 4N6OA 4QTYA 1JLHA 2PBFA 1H2XA 3L8CA 1YVRA 3GFGA 3UKDA 5B1YA 5C1IA 2IYZA 3OE5A 3NBUA 2HBQA 3TOXA 2GR9A 2RB5A 1DFIA 4MPJA 3X2SA 1Z18A 2OG2A 3UJ6A