2REXB

Crystal structure of the effector domain of plxnb1 bound with rnd1 gtpase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
176
structure length
171
Chain Sequence
RCKLVLVGDVQCGKTAMLQVLAKDCYPETYVPTVFENYTACLEQRVELSLWDTSGSPYYDNVRPLCYSDSDAVLLCFDISRPETVALKKWRTEILDYCPSTRVLLIGCKTDLRTDLSTLMELSHQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSEKSIHSIFRTASMLCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plexin-B1
publication title Crystal structure of the effector domain of PLXNB1 bound with Rnd1 GTPase.
rcsb
source organism Homo sapiens
molecule tags Signaling protein/lipoprotein
total genus 58
structure length 171
sequence length 176
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2rexB00
1IN5A 1IHUA 4MUBA 5KO2A 1JECA 4O0MA 1GILA 4EPTA 1O3YA 1SXJB 1R7RA 1GNQA 2F7SA 4Q7KA 4JLPA 1KI9A 1G4UR 1FX0B 5FOTA 1Z07A 2W00A 1CXZA 3I1FA 3I92A 5JEEA 3TK1A 4AKIA 4B6FA 3X2SA 1E0SA 1Z2AA 2JA1A 3CPJB 1VYTA 3GJ8A 4JL5A 2CDNA 3KJIA 4BFYA 4LBVA 1NLZA 3Q72A 3SJAA 3IDQA 1XXHB 3LBHA 1AKYA 1CJUC 1R5BA 4RFVA 2BMJA 4ARZA 3A37A 3M4YA 2FG5A 5F9FA 1OLOA 3QKRA 1CU1A 2CHVA 5CJPA 4H9GA 1WMSA 4IW3B 2J1LA 3WNBA 1TQ2A 3RS4A 1EWRA 1R5OA 1ZIPA 1ONBA 2Q0HA 3SZRA 1OXVA 3TIFA 3HYTA 4JLOA 2FPMA 1KYIA 2WJHA 3C4JA 3TAHA 3CNNA 3DZDA 4GMXA 3KQUA 5F98A 3PJRA 5E7MA 1CP2A 4BFSA 4AYXA 1JPNA 3DMDA 3PV0A 2FFAA 4C0JA 2FX3A 5J4YA 4BFZA 2V8OA 2QM8A 2ZXUA 1D2MA 4HYYA 4M4SA 4K8OA 1R5NA 5K8IA 4QGGA 1B23P 3UXMA 4G5QA 4P33A 5F3WB 2FOLA 4NZYA 3TSOA 2WMNB 4OI2A 1X86B 5DYGA 5AR1A 1SULA 3ZVLA 1S1MA 2FNAA 2W2VA 4JLJA 1E98A 2WVJA 1HURA 3TR5A 5JHHB 4R98A 5J4KA 3O8BA 4I81A 1G20E 4LYJA 1FMLA 2ZREA 3I8XA 1GL9B 2N46A 4GL2A 3NC0C 3EZFA 1TEXA 2V1UA 5IRCD 5KUTA 1JR3D 4NCKA 3BS4A 2A5GA 5JECA 2YHSA 1Q12A 1UPTA 3VR6A 2YOFA 3H1TA 4WBSA 1LVGA 2YC2C 2G6BA 1F2UA 1ZM3A 3QKSB 2D2FA 1KZ7B 4M1OA 3EC1A 4WVFA 2GRJA 2BBTA 3B1ZA 2DYKA 5GJBA 3CPHA 4NHOA 3I62A 1U8ZA 1II8B 2IBMA 4QJ4A 4A2WA 4TMXA 5EUMA 1JR3A 4LJ4A 2QAJA 4D4MA 4HAZA 4RD2A 5LDDC 3AF0A 4LUCA 1G41A 1R0ZA 2ZANA 2GF9A 3K9NA 4LK2A 1XJ0A 3EA5A 1G6HA 3RWOA 3LXRA 1NMZA 4C0QC 1UBCA 2ZR0A 3GJXC 1R8QA 2PH1A 3GJ5A 4EDHA 4XVRA 2RAPA 2MMCA 1N6PA 4MA4A 3SJBA 3ZZ0A 4V0OA 4QBGB 2WJVA 1E94E 3AKYA 3GD7A 4QNMA 3PG5A 1W7AA 4MKGA 4X8MA 2WJIA 1D5CA 1E0KA 2YC4C 2ZYUX 2JLUA 1EFUA 2QE7D 3AB3A 5GJWC 1GUAA 1II9A 4D4LA 1I2MA 4Q1FA 1VDZA 5JRZA 1KK2A 4DC9A 1G7RA 1Q1EA 4CEIA 1JXOA 4ARZB 4IEEA 3IGFA 3NEJA 3QKRB 4ZO4A 1AN0A 2GAAA 4IVPA 4HLUA 1KY2A 1AK2A 4OHVA 5L3RA 2H16A 1KNQA 1KK0A 3QF4A 4JL8A 2QAGB 4OL0A 1DE0A 2ANCA 2IYYA 4TLCA 3T35A 221PA 1Z06A 3VX3A 3SS8A 4LRWA 3U3MA 1TU3A 3B1YA 2LKCA 2R6FA 4FXPA 5J4LA 3C41J 4A0HA 2RGDA 2G9NA 4R71A 1KOFA 2Z5FA 2AHOA 3LVRE 3OF5A 1YJ5A 5DNYB 4PZLA 2A5JA 2ZE5A 4MRVA 1W4RA 3C7KA 5K8UA 1W49A 1YQTA 4W9MC 1KI3A 3BD9A 3BH7A 3WMEA 1T3LA 5DSZA 2RGNA 1IM2A 3DM5A 4LJ8A 4LJ6A 1T91A 1MO5A 4XWKA 2ZRHA 4HZIA 5JRJA 1GRRA 3U60B 5FH9A 1ZM2A 3NG1A 3O8RA 4I1SA 2ZM5A 1AKEA 1GM5A 1N6IA 1CKEA 3LX8A 3PEWA 4M9ZA 1XTRA 2WJYA 2BCGY 4DLTA 2QMHA 1GP2A 5SZKB 3GFOA 3T61A 4XVQA 4LHZA 4XIGS 3FOZA 1F2UB 2Z4RA 5SZJA 2FPKA 1E2JA 4KITB 2ERXA 2JLWA 2R8RA 1LNZA 3LAWA 3QJYA 1WB9A 2MSEB 4GFDA 3EWSA 4DB4A 1GNPA 1Z0DA 4G01B 3KQLA 1ZM4A 2ZI9A 3RAPR 4DEYA 1R8SA 2W0MA 1ZU4A 1KI7A 3MCAA 3OAAD 4C7OA 1ZUHA 3BB4A 4PPGA 2FPLA 3LDAA 3GFTA 3LVQE 3PEVA 5EXTA 5AUQA 3OIYA 3RRNA 4B44A 1Q1ZA 5DO9A 3GLFE 3PUYA 2ZJ5A 4TQUS 1E4YA 3NKVA 1P7CA 2CLSA 3Q85A 3CW2A 4MYHA 1OIVA 1TQ4A 3SFZA 2D06A 2DBYA 5KTYA 1CJTC 3CNLA 1S4QA 2ZI6A 5BN3A 3A1TA 4IFBA 1MOZA 2AFHE 1E2FA 2R9VA 3IBYA 3OAAA 4XTCS 1YHNA 3RABA 5JWRA 4P3YA 2CCKA 1P3JA 2JASA 4KBGA 4M9QA 4A82A 3NWJA 1E6CA 4MRSA 1NN3A 5JS8A 1YR6A 4PPQA 4V0ME 3WNCA 1EESA 1ETUA 3RVBA 4CEIB 4AIIA 2ZR9A 1OE0A 4Q48A 1PLJA 2VHJA 2ZJBA 1DAMA 3G5UA 3AP1A 1XCPA 4L9SA 1P62B 3QF4B 1MO4A 4LJ5A 3ICEA 2HT6A 3GMTA 1Z0FA 2VBCA 4LOAA 1KO5A 2JAQA 1JQJC 3A1WA 4FMDF 2VP5A 2BKUA 4ZDJA 5DGXA 2F55A 5SZIA 2ZRAA 4PC6A 4ZKEA 3QXCA 4Q21A 4PXAA 2G1KA 4W7SA 3AF3A 3TVDA 4D82A 4A9AA 3EAQA 1TQDA 2VF7A 3KB2A 4A0GA 3FMOB 4B3GA 3L43A 3PENA 1HE8B 2PJZA 4RD4A 3RHFA 1T9HA 3SQWA 4OI1A 3WP0A 1Q1BA 3WRXC 4HLDA 1XBTA 3LLUA 2BEKA 3VU9A 1NLFA 2IYXA 1W0KD 3THYA 1GG2A 3AKEA 4DB2A 4JIMA 2Z0MA 1RRPA 2ZJAA 1MRNA 3SHWA 3F8TA 3S1AA 1S3SA 1N6HA 3HDTA 2IYTA 4EPWA 2IS4A 4KHZA 3TUIC 2VH5R 4IDPA 5CDFA 4XVUA 2ZSFA 4KLNA 2FZLA 4D81A 1QZXA 2BC9A 4RZ3A 2OLJA 1XD8A 3AVQA 5CK4A 2P6UA 4LJYA 1AJEA 2DWPA 1KJZA 4JVNA 3DDCA 4JL6A 4PZZA 1U0JA 1NMYA 2E87A 2G1JA 2J45A 1E1QD 2FFQA 4PX9A 3L8YA 3P20A 1NL3A 3Q5EA 4HAYA 4P4SA 2ZSBA 1Z28A 3J81k 1OXSC 2ZTSA 1YZTA 4IOLA 2OCYC 2XSZD 5LB2A 4C7OB 1G21E 1HUQA 1N0VC 2F1RA 3PITA 4C4PA 1NVVR 4BFUA 4EUNA 1E1QA 1UDXA 3MUFA 3TBKA 3VR3A 2Q6TA 2FE4A 5KU1A 4PPNA 1PLLA 1HH4A 2BMEA 3WYGA 5G3ZA 4TMKA 1ZC4A 2XSZA 3CRQA 1EX7A 2XNDD 1PV4A 2WPDD 2KE5A 1Z47A 1YR9A 4XOIA 4PTLA 4WZBE 2ZI5A 2WWYA 3AGPA 4B3FX 1XEWY 4QGHA 1F3OA 1RE0A 1XB2A 3SBEA 2Q9CA 5CM9C 1GTVA 1XEFA 4Q01A 1V43A 2V4ZA 4Q9LA 1NIPA 4E22A 5IT5A 1JAHA 3TUZC 4A4DA 3CF6R 4TZ6A 3P4XA 3PQCA 4Q19A 4QM6A 5KSOA 2FGJA 1Z0KA 2XNDA 2GBLA 2WPDA 3VR5A 4YMSA 4DCUA 3VNVA 4M1YA 3LW8A 3TLXA 1S1CA 1D2EA 1E2HA 2P6NA 2ZS7A 4XH9B 3VHXA 3ZGXA 3AF4A 4URZR 3SDZA 1COWD 4B33A 2IX3A 4GOKA 1N6KA 4URVR 3X1YA 1E2PA 1QHGA 4CGZA 1G8PA 1M34E 1QRAA 3WYFA 2P0EA 3P26A 2CNWD 1L2TA 2YWGA 4FCVA 4LYFA 1HEIA 3U44A 1P2VA 1JNYA 2A5FA 5P21A 1UKEA 5CIWA 2J59A 1KDPA 3BE4A 4OK6A 4PO9A 4DXAA 3C16C 3VU9B 3THYB 2J46A 1R2QA 1SKQA 4TLDA 4TYYA 3GJ7A 1COWA 4IVQA 2GZDA 1W36D 1P6XA 3S1AB 2PLFA 2W2XA 2V6IA 2WKQA 3KKQA 4TMWA 5JZVA 3IHWA 1GRNA 4JLMA 1DEKA 1OXTA 4POAA 4B3XA 1UF9A 3QI2A 1Z83A 2CNWA 2RGCA 3AH8A 1KZGB 4II7A 3A36A 2IXFA 3R20A 4JLVA 5AJYA 5BXQC 1R10A 4AC9A 1WDTA 2QAGC 1TX4B 4PZYA 1IN7A 3W8RA 4XWOA 4ITRC 5KYKA 4KJZA 2XTMA 2P5TB 3IILA 4TMTA 4A8JA 1QF9A 2QQ0A 3KUDA 4P4SB 8OHMA 4IXMA 1ZD1A 1RKBA 5UKDA 1ZMXA 4DRZA 2OG2A 1XWIA 2F3RA 1E0JA 2OEPA 4PC1A 1XMIA 1Q1QA 3E2IA 2XEXA 4XSHA 4D80A 2QM7A 3SFVA 1K5DA 3QIAA 4OI0A 2A30A 2R6AA 1AS3A 2EFGA 2GNOA 1ZCBA 2FV8A 3EIEA 3LXXA 1FUKA 2VIIA 1DO0A 4JVLA 4MYCA 1Q57A 1Z29A 3FKQA 2B21A 4CVNA 2ZRFA 3ND9A 2O8BA 2AN9A 4ZDWA 2W58A 4M1KA 5AK0A 1KDOA 5JSZA 4KCGA 2GJSA 1DARA 3DKPA 3T5DA 1SQ5A 4OQXA 3L0OA 3DZ8A 5BWMA 2WHXA 1E99A 5EE9A 3LWNA 3NH6A 3UMRA 2GZHA 2QNRA 3E1SA 1J70A 5J4HA 2OSBA 4OK5A 4W5JA 4JLKA 1T5IA 1Z0JA 1RW4A 2SHKA 3IQXA 4GPTA 1W47A 1WQ1R 2OFXA 4GDFA 1I4LD 3WBJA 1TF2A 5GJVC 2QPTA 4FCWA 5GADl 3BAFA 1OXUA 4KAXA 3KJEA 4HAWA 3F0TA 3K09A 3H0KA 1E69A 3GLIE 4GNKA 4IRUB 3W90A 4HB3A 1A82A 4JYCA 4L16A 5AUPB 1B0UA 3EPKA 3JVVA 1G17A 1KJWA 2VP2A 3EIHA 4DSNA 5KSYA 4P0TA 3WHKA 5AJZA 3U44B 4P4UA 1E9DA 2AWOA 5JI2E 2JATA 1DPFA 3G0HA 2RB4A 3SJZA 3N70A 3FHCB 1GL7A 2TMKA 3SOPA 5M04A 2QGNA 4NPHA 4AKEA 3HU2A 4R9UC 4HAXA 4UNQA 4BASA 4YONB 1SVIA 3X1ZA 5K8TA 4ILEA 1SVKA 2WSSD 2IYVA 1XZPA 2F9MA 3EW9A 4OHWA 2GEUA 1NJGA 2RHMA 1K5GA 3REGA 4HLUC 1DADA 2RH5A 1SGWA 4QBIA 5EXXA 2HYIC 3IO5A 2ZRNA 4HLCA 3B5JA 4JSYA 3KJGA 5KSPA 3KQHA 4Z1MD 3KB1A 4GRAA 3NBFA 2NO6A 1E2KA 2H5EA 2XAUA 5CJ2A 4EPXA 1W36B 2JJ1D 2YNMA 4NMMA 5TV2A 5FOVA 621PA 2IYUA 4A8JB 1ZU5A 4YMVA 2WSSA 2QT1A 4R7ZA 2NMVA 3PUZA 1FFHA 1TAGA 3AVXA 4DSTA 1IQPA 1DG3A 1W4BA 4TZ0A 1S9HA 2B92A 2VEDA 3EARA 2R2AA 3AP3A 4KV9A 2B7BA 4DKXA 1X1SA 1HA3A 1CEEA 4F7WA 2PMKA 4Z1MA 1VECA 3GLGA 2DPXA 4UKDA 2JJ1A 4KYUA 1T4GA 4LJAA 1OF1A 3CH4B 2C5LA 4LGMA 1KI6A 4D4JA 5HKKD 2O8BB 1KMHA 1OSNA 3MD0A 2J87A 3W3AA 3W3ZB 4IHQA 2ZS9A 5JSZB 1CJKC 1GAJA 3T1TA 2YV5A 5BW8A 3LA6A 4M8NE 3MRSA 1OH8A 3GFPA 5HCNA 1P2TA 3FHOA 2R6GA 2WTUA 3T12A 1Z63A 1OYWA 4A92A 1FW6A 5FI0B 2QRZA 5HKKA 1UFQA 4OHZA 1KO8A 3OZXA 3PXGA 3TVTA 4AI6A 4D0NA 2G3YA 3TRFA 4LX0A 5CITA 4Q9HA 1UKYA 3MSXA 2YOGA 3GPLA 2JLSA 1YKSA 1GKYA 1U9IC 1ZD8A 1NN5A 1TL7C 1OH6A 1DS6A 4BLRA 4OJKA 3QUSA 2BEJA 4MRRA 4XD7D 1EFCA 4JT2A 4KXFB 3QBTA 5EE1A 4EPVA 1NIJA 1DAKA 3ADCA 4TYWA 1XMJA 4DJTA 3O8CA 1FZQA 4C30A 1XD9A 2XZPA 3FFAA 3U7HB 2OT3B 4XWAA 3THXA 1O87A 3ZDQA 1WP9A 3K8YA 3QVVA 2G77B 2ZROA 2G0TA 1XTJA 4JBWA 5IF9A 2ZRIA 4FW9A 4UXIA 3C15C 4XD7A 3ONWA 3PIRA 2H57A 4QRHA 1E0AA 2P65A 2ZYWX 5KPJA 4UXHA 1VG1A 3W5JA 4Z8XA 2ZI3A 4KFSA 3HP1A 2V54A 4RCZA 1KI2A 1KDRA 3B7GA 1A4RA 1QVAA 4TLBA 4TSFD 3U6KA 1WCV1 1VHLA 4HZUA 4PAQA 5GJCA 4BE7B 4LSGA 5FTKA 1HQCA 1W0JD 1ZUNB 1CJVC 5EE3A 5EJEA 1VCNA 4BZXA 3JZAA 4RKFA 5JJKA 1OYYA 4KFTA 4QHSA 2ODEA 1P9WA 5FBVB 1OKKD 2V6JA 4TSFA 5E95A 1NSFA 1WA5A 1F6BA 2ZR7A 3V00A 5JJLA 4PANA 3F3YA 1DO2A 1M6NA 4MUAA 1SVOA 4C0SA 4NCJA 1UEJA 1W0JA 2EWWA 3WYAA 5JFGA 1G8HA 2YWFA 1TU4A 3CH5A 2WWIA 3L0IB 1D9ZA 4Q1EA 4RD0A 4TTPA 5DHFA 3UK6A 4DLYA 1OKKA 4AYTA 3TW8B 4NCNA 1E3MA 1AS0A 1I4TD 1KMHB 4PO1A 2HEIA 2J9RA 2L0XA 5TMPA 3TSWA 1UBEA 3BOSA 5AJXA 2ZRDA 3AQ4A 4GSYA 3SHFA 2VA8A 1GNRA 2ATVA 2ZRMA 2XJ4A 3NVAA 3QXSA 4M9SA 3U3KA 1E79D 1XTSA 2I1VB 4DHEA 1OPXA 2NIPA 3SNHA 2V1XA 4OQFA 2B8WA 1SVWA 4JBYA 5EXPA 3FKSD 4UXJA 3K70D 2GWHA 4DDVA 5BN4A 1UDWA 3WHLA 5HR5A 2NGRA 4QG7A 3L0SA 1T0JB 3VR2A 3IEVA 3GLHE 2RGBA 3MG9A 2N1BA 1E79A 3BORA 4ZCMA 4LYAA 4BLOA 2XZLA 3AVOA 3FKSA 4W5HA 2UVQA 5HTKA 2ORVA 4A1FA 4AKHA 4BLSA 3QF7A 2QPOA 1E2DA 2AWNA 1VCOA 4LBWA 4B34A 3ZD7A 1HE1C 3THXB 3QVUA 2WBLC 1KSJA 4Z8YA 5EUQB 5EZ6B 4FMDB 821PA 1SZPA 1KAOA 2XZOA 1BH2A 4M53A 5DYIA 1ZNWA 4FN5A 1E9RA 3PR1A 3Q7PA 2AD1A 3I73A 1U0LA 4D6PA 2OXRA 1RJ9A 4D0LB 1W2HA 4PSAA 3NDPA 3H2YA 2VPPA 3U5ZB 1YZKA 4AKGA 2CEAA 3U3RA 2NOAA 3K0SA 1AA9A 2ORIA 2PEZA 3U2QA 5F9HA 4URXR 4JS0A 2QBYA 3KJHA 4Z54A 3CF2A 1G291 1XEWX 2WKRA 4HZUB 1BYUA 3LQQA 5FTLA 1IN8A 4C0HA 2ZS8A 5HE9A 5TXGA 1FQKA 5LD2B 2GBLC 2NO9A 4OKSA 3TE6A 4DIDA 1M7BA 3KDSE 5KNBA 3KXLA 2J5XA 2VP6A 4ZKDA 3SYLA 2F1IA 4JJKA 4PO8A 521PA 5L3QA 1KI1A 1T3HA 4DLSA 5JBQA 4B73A 4NKRA 3N5CA 1DTSA 4ZI3A 3K0AA 5AUOB 4JKIA 4TYPA 2X1VA 4US1R 2DHRA 2XTNA 1VHTA 3UANA 4UNSA 4NYMR 2QENA 2HDNB 4FMCF 3OHMA 2C04A 4NYIR 4Q7JB 4TTQA 3VQTA 3ZS9A 1YZLA 2LKDA 3MJHA 3B9PA 5EQTA 1MRSA 4AD8A 2AXNA 3CZPA 2OE2A 4I99A 1K6MA 5CM8B 2VHTA 3REFA 5J4VA 1GL6A 1PJRA 2BBWA 2WAYA 4Z51A 2GETA 2IYLD 3I32A 2FMXA 1J7KA 3NBZC 3ZYCA 4DT1A 1BYIA 1T3SA 2A5YB 1XPOA 2UKDA 1QHXA 2P2LA 2A3RA 2CJWA 5HZKA 3D31A 4WZAE 1Z0AA 2C98A 1MR3F 2HXYA 3IUYA 1W36C 2PX3A 1P60A 4IKEA 1X8LA 4A8JC 3FMPB 1JJVA 5FPTA 2XXAA 3CIOA 1LY1A 3QXHA 1DELA 5JCPA 4IOKA 1KGDA 4PHTA 3C5HA 2AL7A 2IWRA 3QG5A 3GEEA 1EFTA 4XSGA 4OHXA 4C0AC 1N6RA 2BM0A 3R9XA 4HEJA 3K70B 3DOEA 2CXXA 2ZRGA 2LCFA 1G5RA 2H17A 4LPSA 1QHYA 4OQLA 2EWVA 3HPQA 6Q21A 1FL9A 2ZSEA 4L4UA 3UIEA 1KI4A 2REOA 3TSZA 4AWXA 4V0LA 1NI3A 2FJUA 2DCUA 1RJ9B 1W48A 2QTHA 1N6NA 4LDJA 1JEEA 2JDID 4LHWA 4RZUA 1QVRA 4YQFA 1NJFA 4DCSA 1SHZA 4GOJA 2NZ8A 1J90A 4Q4AA 2QBYB 1HTWA 5G40A 1U0HC 2IWHA 2VQSA 2WOOA 3D8BA 3BXZA 1U94A 2MMGA 1OFHA 3HYRA 1AQYA 5CYPA 1J2JA 2FF7A 3K09C 4QBFA 4CT4B 4FIDA 1IY0A 1A2KC 4EIWA 1IJFA 3BH0A 3AUYA 5ELXA 1OFUX 2JDIA 4HAVA 4DLVA 1OB5A 2Q3MA 2VSXA 2W83A 1NBME 2GILA 2QP3A 5F2EA 4XJXA 5L3QB 5B2ZA 1HT1E 2RHDA 3BFKA 3NTUA 4KI0A 4PSKA 1TUEA 1YZNA 1NN1A 2X2EA 3K0AB 3LW7A 4QJ5A 4JZKA 4GP7A 4EPYA 2YWEA 4KFRA 3K0FA 2QTFA 4RD6A 3QOFA 1BO6A 4QOSA 4DDTA 3DMNA 1ELOA 5FPKA 2HLDD 4B3BA 1G64A 1E96A 2RCNA 2VSOA 3CUEF 4LBYA 5EP4A 2C9YA 3BJIC 3TH5A 2O8CA 4HI0E 3CR8A 3CLVA 3RNLA 1N6LA 5FPYA 4ZI2A 2QP9X 5FBLB 2X2FA 2DY1A 5H1YA 2KBFA 4PC7A 5TDHA 3AVPA 4LV5B 3W9YA 3HU1A 4DT1B 4KU4A 2W6ID 1DBSA 2ZJOA 3VTKA 1E9BA 1F2TA 3OEHD 4RSGA 2NO7A 3RC3A 2HLDA 2ODBA 4AK9A 4A2QA 1IN4A 1G5PA 1SXJC 2CJWB 2GAOA 4R2IA 3DKVA 4TWZA 5FOSA 4C0BA 5B30A 1UBFA 2PBRA 3EA0A 3TGPA 1D8TA 2IS2A 4Y0VA 3KKMA 3FE2A 2ERYA 2V55B 2XXAB 1M8PA 5JJIA 1DG1G 1T0HB 4PHHA 4F92B 4JLBA 5FUWA 4P31A 2W6IA 3CR7A 5FR1A 1H8ED 2V9PA 3OEHA 4HDOB 4MQBA 4WZ6A 1T6NA 3BH6A 4DLXA 4DSOA 2CE2X 3A4LA 5DLQC 2IW3A 3THOA 4ZV4A 3QQ5A 4BFWA 4YDHB 3BFXA 2O8FA 1KIMA 4Q47A 5JLJA 3B2EA 2H1LA 3VKWA 4B35A 2AKAB 2BKEA 3M6AA 4EQ6A 4M1WA 4B43A 1G16A 1M74A 3SYNA 3THWA 4BRUA 1H8EA 2QMEA 3Q8XB 1OHHD 2I3BA 4RZXA 4YXWD 4TYNA 4LCBA 3B6EA 1OH5A 3QPWA 4MKFA 1F48A 2EFCB 2WV9A 1VG9B 2GZAA 3IIKA 4GBMA 5H68A 4I1UA 2J0VA 3GLFA 4HLQB 1DAIA 1ZIOA 3LNCA 2QU8A 4BFTA 5A0FA 4HB2A 1EXMA 4Q4AB 3AVYA 1EFRD 3ASZA 4GZLA 3BBPA 2JLXA 3NXSA 4DCVA 4FMBB 4JLNA 3BFVA 1OHHA 3T1QA 5J47A 4YXWA 4E5UA 2A9KA 2QT0A 3EIQA 3TQFA 5TY0A 2VTKA 2WICA 4V0MA 121PA 2OCBA 3QPUA 1GVNB 1XDBA 1GITA 2CLCX 3I4LA 3ZJYA 2BBSA 1R0WA 4NYMQ 1EFRA 1VTKA 4DWJA 3JVUA 4NYIQ 1OW3B 1FNNA 4CEJA 3K0FB 4ACAA 4N0EA 4C0LA 2D4HA 4LV6A 2KB0A 3RC8A 1FP6A 1ZNXA 3FMFA 4Q00A 1QBKC 1A1VA 3K0CC 2O8CB 1Z6AA 1QHSA 2X19A 1TNDA 1PZNA 3VMFA 3KQKA 1DAHA 4CEHA 4V02A 2ECKA 4P4TA 3W8NA 5BYKA 3WP1B 1RZ3A 2EYUA 1FNMA 3FDIA 3M0EA 1QDEA 4ESHA 2ZI4A 3ASYA 4A0FA 2O8DA 1RYFA 1F2TB 1PUIA 2KSQA 2YWHA 3U61B 3SE0A 2OLKA 1EWQA 2PZFA 3KFXA 4BWYA 1N6OA 1RRFA 2OBMA 3VHLB 4PR0A 2IS6A 4PAMA 4UJ3A 4EPRA 1UKVY 2ODNA 2E9SA 3IEUA 4IVRA 4TL6A 4IJMA 1E2QA 3BGWA 2A7QA 4RJLA 3TR0A 1VIAA 2J7PD 3AUXA 4TL8A 2ZYTX 3H4MA 4QHYA 2C8VA 4IDQA 3AP2A 2QN6A 2ANBA 4CRWB 2O0JA 5L3SA 1E2EA 2GF0A 3NEYA 4RY2A 5TVKA 1SKYE 1ZM9A 1GZSA 3EXAA 3L2OB 3NHBA 4EFLA 4MDFA 4Q1DA 2NO1A 2FEOA 2O8FB 3RANA 1IXZA 4ZIRA 3KL4A 5D3QA 5J5CA 3MFYA 3GP8A 1G9XA 2J7PA 1ZC3A 2FU5C 3EC2A 2IUUA 4OYHA 2GHIA 2R6DA 1ESNA 4EQ6B 1I2DA 3THWB 1IOZA 1D6JA 1TF7A 1YE8A 2ZU0C 4IFEA 2QRNA 2RMKA 1CF4A 1UEIA 2C9OA 4PQRA 1BIFA 1VCMA 5FI1B 3QEJA 3IIMA 1IY2A 1CS4C 2ONKA 2R65A 5TARA 1CIPA 5H70A 3GLFB 3K53A 5HPYB 4FD2A 4DLRA 4LHXA 4Y0AA 2FSHA 1G3RA 2AFIE 2G0NA 2IHBA 1JEDA 1T8UA 2UZ3A 3LQRA 4OK3A 4W5WA 1NSTA 1ZAKA 1NNEA 1KMQA 1CLUA 2F9LA 1N5IA 3IKJA 4JSTA 2GXQA 3SI7A 1QHIA 4G5SA 2OV2A 2ZRCA 4TLEA 4O2LA 5JWHA 3EX7C 1A5TA 3LO5A 2ZJ8A 1G7TA 4N1AA 2X77A 3ZH9B 1E9EA 2VL7A 3K70C 2IXEA 1KK1A 2F1HA 1QHHA 3ZVRA 4A6XA 3B82A 1XPRA 2BMDA 5FOWA 5G3YA 4NBSA 1GOTA 4TL7A 3SBDA 1SXJE 3FMIA 1KNXA 1AM4D 4CEJB 2F3TA 4KO8A 4B3CA 3FWYA 3SC3A 3A1SA 1XTQA 3ZQJA 3UPUA 4LC1A 1GFIA 2Q3HA 4F38A 1E9CA 5CLLA 1U90A 2NO0A 1LF5A 1RRGA 1W46A 1XJCA 4CEHB 4CZ2A 1VIYA 1UM8A 4NONA 3ECCA 1UAAA 1XXHE 2W6JD 4I4LA 2YYZA 4MGZR 3IPYA 4LC0A 4PQFA 5GVSA 3OESA 5C4MA 1RPZA 2O8DB 3LY5A 1Q22A 2EYQA 3HR7A 5BYJA 1OFIA 5KNCA 3MGCA 4ERNA 5FL3A 5C4GB 2XTZA 5FTJA 3SEAA 4DUGD 4CDGA 2B8TA 3FYHA 3ZZUA 1XX6A 3IBGA 4M9XA 3RS0A 3DL0A 4JMPA 3UWKA 2EFHB 2W6JA 4CIDA 1C1YA 4MRPA 4HUQA 5FBRB 2PJRA 5AJWA 2ONJA 3HWSA 5AJVB 2QA5A 4ABYA 2NPFA 1F5NA 5L3SB 2GXSA 2VHQA 3H84A 3MLEA 2P6RA 2YVUA 1R4AA 4Q7LA 4DUGA 3EZ6A 1RFLA 1ZVQA 2A78A 4K81B 3V9PA 1R0XA 3PVSA 3CRRA 4ZIRB 3ZQ6A 4LYHA 4K46A 3NBYC 4IOJA 3UATA 1LS1A 1C9KA 2FSGA 3LD9A 1CR2A 4BRWA 1NVUQ 1ZP6A 1AZSC 2BVNA 4ASUD 1Z6TA 5IHPA 2DFNA 1YR7A 2IYWA 2GXAA 2ZRBA 1P73A 1KY3A 2VRWA 2DFTA 4PAOA 5H8WA 1W1WA 2C96A 4A6PA 2Z43A 4RCYA 4EJSA 5EP2A 1WBBA 2RGEA 4LV8B 4ZCLA 5J40A 1KHTA 5HE8A 2DWOA 3A4NA 3A8TA 3VNUA 3ADBA 4M2LA 1TTTA 2D74A 1GWNA 1AIPA 1VCIA 4ASUA 3QXJA 4O3MA 4RFSA 2PLRA 1R0YA 1S9DA 3RRZA 4MGIR 4LY6A 1ZUIA 5JEDA 2RGNC 1R6BX 3DOFA 4E07A 4KFUA 3I5YA 2FDCA 2JCSA 3IQWA 3T34A 2AK3A 2EFDB 1IY1A 2ZVPX 3C5CA 3R8FA 2Y8EA 1IN6A 1SVSA 3U4QA 1SVMA 2D3WA 2ZRJA 3UMFA 4B2IA 3RRMA 3AVUA 1ZBDA 3CWQA 2VP9A 1HV8A 1FOEB 4NP6A 3KUCA 4RD1A 3MWJA 2CCJA 2GCOA 1S3GA 1JXMA 3GLIA 1IONA 2NQ2C 1E2LA 3MWLA 1TMKA 2IHYA 3WRYC 3U6BA 2GK7A 4FWTA 2QY9A 4LBZA 1Y63A 1NLYA 2YINC 3RS5A 1G3IA 2XB2A 5CIQA 4QC2A 4YDSA 2REXB 1QG2A 5EZ5A 1KDTA 3AEZA 5BN5A 3EZ9A 3OFND 3HPRA 3L8ZA 4LI0A 4FMCB 4URWR 3CX6A 4QXAA 4PC2A 2ZQ5A 3D7MA 3I5XA 2ZRLA 2W2TA 3BWDD 1CTQA 4F91B 3D3QA 1CR4A 4Q4LA 5B57C 1YU9A 2OM2A 1ODFA 2OZEA 1E2MA 5HZHA 3UKDA 3BC1A 4JJZA 2F6RA 1ZRHA 2ZSDA 2IA5A 2FFBA 2IS1A 3PUXA 3OFNA 3U7EB 4B2LA 4M22A 1QG4A 4U7DA 1XFAA 3A58B 3U3JA 3K9HA 2C03A 3OIWA 5DI9A 2GXUA 4H1VA 4HUQB 1XMSA 1Z6XA 4UNNA 4JVMA 3CF0A 4KVGA 1NG9A 1EG7A 1U8AA 2QPAA 2GKSA 4TL9A 4LWZA 3UG6A 3KKPA 3E5HA 3AM1A 2OAP1 2A2ZA 2WIAA 2OESA 1LV7A 1E2GA 2ZRPA 4Q9IA 2BWJA 3WY9A 1J99A 2MSDB 4JYBA 5LB4A 3BB3A 2IEYA 2OCAA 3FVQA 2F1JA 2CHQA 2OILA 1VKJA 2G88A 4BPBA 3CRW1 3W34A 2ZETA 4C3ZA 4EJSB 1I4DD 3O8DA 4MYTA 2VLIA 1T5LA 4RVCA 4B3DA 4CF7A 3BRWD 1L4YA 2JLRA 3RRYA 3ADKA 2GK6A 2Z83A 4BFVA 2HT1A 2D62A 3AGQA 3CONA 3RS3A 1TEVA 4RFSB 4MDEA 3GLGB 2QSZA 2P67A 3CM0A 4JKYA 3B78A 2WAXA 4QGAA 4AG6A 3KX2A 2J7KA 5DN6D 2HUPA 2CVHA 2PZEA 1KI6B 2FH5B 3AKDA 1N0UA 2MSCB 2WWGA 3QKTA 4WXPA 1FTSA 2HXSA 4D4KA 3U4QB 1HT2E 3KXIA 2ZPTX 1KKMA 4G1UC 1L8QA 1JR3E 2OBLA 2X8AA 5KDOA 3DHWC 2NTYC 5E7IA 2EQBA 4ZCIA 2VP0A 4TLAA 4KLZA 3F5FA 1YRBA 1YRAA 3LV8A 2GCOB 1G7CA 2FSIA 4Q4HA 1TUIA 3GLIB 5DN6A 3I8SA 2IK8A 1Z0IA 3FGNA 4KSCA 4M21A 3V4FA 2BMFA 2FWRA 2ORWA 4AYWA 2VHCA 4BEJA 1AGRA 1N5KA 1OXXK 2CCGA 4Q66C 1P75A 4R2HA 1JALA 1XD2A 5EP1A 2QAGA 1E2NA 2CL0X 4TQ9A 1IBRA 1Q3TA 1KK3A 2OCPA 4X8OA 3VR4A 5C46F 4IOMA 2XITA 1TQ6A 3K9LA 5KHOC 3N2EA 2F43A 3GJ4A 4L15A 1KO7A 4URYR 1CR1A 2Z4SA 2ZSAA 5DHAA 4CW7A 4KVAA 3WMGA 2E1RA 5LBIA 3FHTA 2R62A 1BKDR 1EX6A 3W6PA 4HUTA 3FFBA 3RSLA 4D2IA 2R6CA 2QUZA 4BUJA 4NE2A 5FUVA 4AY2A 1Z08A 2N42A 2DFLA 1X3SA 4C0KA 1JPJA 3PUWA 5HCIA 3SYKA 2AXPA 4MH0R 1RYHA 1Q44A 2XB4A 4M1MA 1GRQA 1AS2A 1BS1A 1CJMA 4G0NA 4KYIB 2BJWA 5BQ5A 3CB4A 3RLFA 1KSGA 3TUJC 1W4CA 2RGXA 1S0UA 3ND8A 3WNDA 4M1TA 5FTMA 1FP7A 2I1QA 1WF3A 2GJAA 4H1UA 1U99A 3EPLA 2KI5A 1P2SA 5FFMA 4DCNA 1VYVA 2ZYVX 3OIUA 1P9NA 3Q3JB 1G6OA 3TW4A 2ZEJA 1K8RA 1GDDA 4MGKR 5EXSA 4L5BA 2FSFA 2PT5A 1GSIA 1UKZA 3DPUA 5E3HA 5G41A 2OFOA 2HF8A 4U00A 1N5JA 1MABA 2IYQA 3W6OA 3AF2A 1VG0B 3WBKA 5E4FA 1E9FA 4G5OA 1CBUA 1FPMA 3GQBA 2VSFA 2OUKA 2AD5A 5FPHA 1M2OB 1ZNYA 4CT5A 2KBEA 2CMKA 3GLHA 4GOXA 4LJ9A 3CRVA 4Q4HB 3NC1C 4HDCA 3N2IA 1OFTA 3A4MA 3AKCA 4RZ2A 3RSOA 4GZMA 5SZHB 5C2JB 2HV8A 4BGDA 421PA 1RIFA 2IL1A 3GEHA 2ASEA 3T15A 2ZITA 3X1XA 4DBLC 2J0UA 5DISB 4BQSA 1XD2B 4WA7A 1VPLA 2CVFA 3SQXA 2QE7A 1XRJA 4Q1AA 4C2UA 5DIFA 2FFHA 1II0A 4TMVA 4YC7A 4EFMA 3KQNA 3CWZA 2YOHA 1FTNA 1MKYA 4FWIB 4HB0A 1D2NA 3PFIA 2F43B 1Z6GA 2OFWA 3BIFA 1KSHA 2O0KA 1LS6A 3DEFA 2WSMA 2V3CC 2HCBA 3AVTA 2YJTD 1FQJA 2ZUDA 2JEOA 4JT4A 5EP3A 1U2RA 3FPAA 1Z22A 2O0HA 1KKLA 1IXRC 2DR3A 2H8KA 3EPJA 1ANKA 2IXGA 1A7JA 3RS7A 2RGGA 5KOYA 4NYJQ 4Q9JA 3Q5DA 1WXQA 4Q9KA 3NDBB 2BJVA 3NH9A 4MITA 3UWOA 5B58C 4TQAA 3GEIA 1G19A 3C14C 3P1JA 1M1YE 1T8TA 1JBKA 1L4UA 4FCTA 5TB5A 1W2GA 2Q3FA 4Q4JA 2O5VA 1FUUA 1X6VA 5CK5A 2ZE7A 1EGAA 2IYRA 4A15A 4M1SA 5KNDA 3X1DA 4M0LA 3B1XA 5CDFE 1OH7A 3CBQA 2BCJQ 5D3MA 2QORA 3PCRB 1OJLA 3IHLA 2WWHA 1U9IA 2O8EA 5FUYA 4S35A 4MKHA 3B8HA 1EFHA 3ETLA 4GMDA 3ZIAD 4B6EA 4BECA 1JQLB 2HJGA 2ZI7A 2IF0A 2OO7A 1MABB 4F4CA 3RS2A 2D2EA 2HF9A 3SJCA 4DDUA 4PPFA 1OV4A 3MAAC 4OQMA 4D0GA 1SHKA 2V7QD 4FI3C 1H65A 1VG8A 2GVZC 4ACBA 2I4IA 2PCJA 3K0EA 3EZ2A 1N5LA 3T06B 3VFDA 1S96A 4ZPXA 3ZIAA 4QKQA 2EW1A 3NIBA 2ZU6A 1XCGB 3GLHB 3SN6A 3QPVA 1Y3AA 4D25A 2BV3A 1XJQA 2DB3A 5FOUA 1HYQA 4C2TA 2V7QA 3R9WA 2Z6VA 3MWKA 5KDLA 4EJSC 4A36A 2J0UB 2DFKB 4X8HA 4I1OA 3FB4A 1M7HA 4OHYA 2LWIA 1NKTA 4FINA 3BK7A 5C1BA 2Q9BA 3DVLA 1DOAA 1P5ZB 1XTKA 2WKPA 3K9GA 2WIBA 5CB6A 2CL6X 3ZLJA 2C2HA 5IDVA 4ESVA 1P4SA 2GESA 1LW7A 4DVGA 1Q21A 1J8MF 1CRPA 2JGNA 4N0DA 3WMFA 4QGFA 5KSZA 3ADDA 1NBMD 4MRNA 1G7SA 1DVRA 2CLDX 2QTVB 2WMOB 4BFXA 2A5DA 2QEQA 1AQUA 1D9XA 1YR8A 3B13B 4URUR 1RVDA 1XZQA 2GEVA 2PT7A 1TADA 4OBEA 3KXKA 4NCIA 1XTIA 1Z6YA 3EWAA 4TTRA 1FMJA 1LB1B 1Q0UA 3I3SR 1DAGA 2O52A 1DAEA 4GP6A 4LZZA 2EVWX 3HJNA 4V0NA 1NBMA 1XCMA 4UNPA 3B85A 3OIVA 2QI9C 1X8KA 2QROA 5KPDA 4UJ5A 3I72A 4YMUA 4TT3D 3PUVA 2HYDA 2C99A 1EK0A 4PFSA 1OIWA 4DLUA 1W0KA 1JR6A 4Q4JB 4WOPA 1M7GA 4MYUA 3LLMA 1PUJA 5C18A 5A4JA 1XEXA 3GJ0A 3LBIA 2P3SA 5CLQA 4BLTA 3KTAA 1G3QA 2B6HA 2AX4A 2OBNA 2NPIA 2H7VA 2XX3A 4Q18A 1ZJ6A 4Q1CA 5JCZA 1MT0A 2BDTA 3T1VA 2IYSA 4DCTA 5D3MB 2BM1A 3IIJA 3P4YA 2ZUBA 4US0R 4G5GA 4TT3A 5G53C 2O8EB 3H86A 3AVWA 4BLQA 1G8YA 2OXCA 2NG1A 1MO3A 4HATA 2YKGA 4HDQB 2QZ4A 3LH5A 1NMXA 4MGYR 1UBGA 4J0QA 2FN4A 2JJ8A 3DM9B 3W5IA 1YZGA 2ZE6A 1P72A 4TMZA 4F4IA 4DZZA 1JI0A 2EU8A 1PVOA 1KO4A 2REBA 1NP6A 2K5UA 1NF3A 2OHFA 3O47A 1JB1A 4QHTA 5AUNB 4LJ7A 3P27A 1YVDA 1Q20A 2IUTA 2NZJA 2WM9B 4OQNA 1CRQA 4PHFA 1PLKA 3B60A 3IPXA 1NKSA 1XMVA 5LD2C 1V5WA 2ZIAA 3P32A 3TMKA 2GJ8A 4V0KA 2QP4A 5JWOA 2WJJA 5JHGB 1N2CE 2VP4A 3E70C 5JI3E 4HB4A 1JAIA 4LHYA 4JVSB 4F4JA 2C95A 4GI7A 4PHGA 1LF0A 1VMAA 1AZTA 3NHAA 4YMWA 3MWYW 1WBDA 3GJ6A 4B2PA 5FBWB 4NL4H 3KFVA 4B71A 5KDDA 3CNOA 4JBXA 3Q9LA 3C8UA 3FTQA 4PQYA 3V4RA 2GCNA 1U98A 2ZJYA 2W0SA 2FA9A 2PMDA 3U3OA 1TPZA 1KSFX 2QGZA 3AF1A 1XU4A 4WXRA 1QHNA 1E4VA 4AG5A 4DEXA 2BOVA 1XP8A 1IJEA 2JLZA 4L8GA 2JLYA 1G8FA 3ZVMA 4XTRA 3WXMA 1H8HD 3VR1A 2C77A 1HQYE 3VKHA 3IO3A 1X8JA 2ZUCA 3QENA 3ICQB 4ON9A 5E7JA 3UG7A 1XNJA 4TN1A 3VKGA 4TYQA 3KKNA 1W4AA 1BMFD 1X1RA 1G3MA 3W6NA 2GCPA 3ZD6A 3SR0A 1RC8A 4G5RA 3DO6A 2IEZA 2AR7A 1H8HA 2QMUA 2ZRKA 3LX5A 4HAUA 1US8A 2QG6A 1P61B 4NTZA 3RWMB 5FUXA 4DIEA 2IYZA 1Z3IX 1LTQA 3NBXX 3HU3A 4EKDA 4Q7MB 2JLQA 4YLGA 1XEXB 1ZINA 3TQCA 3A1VA 3D6TB 3GCGA 3KTAB 1AGPA 1BMFA 2H18A 2GEDA 1NY6A 2IC5A 4US2R 4KSBA 4HSEA 2JLVA 721PA 3CKLA 2VF8A 3CO5A 4UQOA 3EASA 4L9WA 5B64A 2PX0A 2YZ2A 5FL7D 3VX4A 3KZ1E 4CYMA 4NDZA 2J41A 2BBOA 4A2PA 5L8VA 4IXNA 2IT1A 4WW0A 3ZS8A 3CX8A 2OAQ1 3BERA 3R9IA 1ZW6A 1UADA 1KJYA 2IUSA 2WZQA 2ZVQX 4BEBA 4U02A 4I1VA 4B48A 4OJQA 4N3NA 4ZDIA 4O25A 5ANRB 5FL7A 1P9RA 3A1UA 3EZ7A 3QG1A 4KBFA 3L0PA 2XJ9A 3GLGE 5DI3A 1DAFA 3BB1A 3KKOA 4Q03A 4G3XA 1ZNZA 1Z2CA 4QJ3A 3I61A 3CRMA 4B75A 4X8LA 1S8FA 5FR2A 1UJ2A 3GJ3A 3EPHA 1Z5ZA 2B7CA 2ZAOA 1TF5A 2ZJZA 2CL7X 1OT3A 4MKIA 1NRJB 1XF9A 4V03A 5FPSA 2KJQA 2QL6A 3QNUA 3QE0A 4WAUA 4LPKA 4S2EA 1NG1A 2QQEA 4QM7A 2WWFA 1XPUA 1NY5A 1MO6A 4WIAA 2BHRA 1HY3A 3U7GA 3MMPA 4U5XA 2HJVA 3EG5A 3R8CA 3CZQA 2CHGA 4B76A 2XOKD 4GT1A 1CR0A 2PCLA 4O2RA 1U81A 1Z8FA 1KO1A 4Q02A 4BZQA 3LRPA 1WRBA 2DWQA 4RKEA 2Q9AA 2J0QA 4E09A 1SXJD 1CULC 1SVLA 2RGAA 5IK2D 2KWIA 5LPNA 1E1RD 1G1MA 4B32A 1G18A 1NVWQ 2C9CA 3R7WA 3PEYA 2FZ4A 2GJ9A 3OEED 4QNRA 1ZM7A 2D7CA 3QSYA 1LFDB 2XOKA 2D7DA 5L3VA 1N25A 3QXXA 4B74A 1US8B 2R44A 2ZE8A 1ZCAA 2HCJB 3Q7QA 5EE5B 3TKLA 1GIAA 4EFNA 1SXJA 4DDWA 2J3EA 1NVXQ 2CBZA 5IK2A 1N0WA 1FX0A 3G82C 1E1RA 4QL3A 2G83A 2XGJA 3OEEA 4A0RA 4UNRA 2CK3D 3T5GA 1QHHB 3OE7D 4Q1BA 3M1IA 1J8YF 4NCHA 4QFMA 4IDOA 5K8LA 2GTPA 3JZMA 1NVVQ 2VO1A 3SU8A 1XXHA 4C9BA 2J0SA 2P5SA 1RRCA 2QSYA 1G5TA 2UZIR 5GVRA 2VHUA 3ZZTA 3QY0A 1YZUA 4D26A 4YMTA 4IDHA 1N3BA 3AV0B 2WWXA 3B9QA 2PEYA 3X1WA 4BZPA 2CK3A 1YZQA 3OE7A 4NH0A 1IAQA 5AWFC 3RDPA 3TJZA 3CPEA 2ZAMA 1KAGA 1W5TA 5DH9A 3TAUA 2WOJA 1F60A 1NN0A 1Q3HA 5DI3B 5FOXA 2GVDC 4Q5IA 1MH1A 2H92A 3CX7A 2PL3A 4P32A 4DSUA 2WWWA 1W5SA 1GKUB 2BIFA 5CB8A 1P2UA 3QBVA 1ESMA 3A6PC 3RYTC 4PSVA 4JLDA 1SKYB 4F93B 4QBHA 3U7FB 1E9SA 5CYOA 2IF2A 2QMOA 4ZDKA 1GKIA 3TNFA 1OB2A 1E32A 1OIXA 2XNSA 4EAQA 3AVVA 1VYUA 1KTVA 3K1JA 4DLWA 2AK2A 4KODA 2ODWA 4RD3A 4DLZA 3QEOA 1E9AA 5JS7A 1G3UA 2FGKA 4B47A 5JMTA 2PZGA 4NU0A 1C4OA 5EE0A 1S2MA 3L82B 2JJ2D 4BLPA 1G8GA 1ZD9A 1ZYUA 1IXSB 1MV5A 3MJRA 2EFEB 3LBNA 3UMSA 1E2IA 3QKUA 4NYJR 4IEIA 4PC3A 3HR8A 1BOFA 5A5GA 3VAAA 2JIZD 2ATXA 3T1OA 1KI8A 1A2BA 3PEUA 1G4AE 3LFUA 5FBQB 1U8YA 1W44A 2C78A 4AURA 2ZJ2A 5DE3A 4E03A 2VYFA 2Q21A 2CE7A 2RKOA 2JJ2A 3QKSA 2GDJA 3K0CA 2AKYA 3R7WB 1JJ7A 1WE2A 2FEMA 3B1WA 4OI4A 2WJGA 1L7VC 4LHVA 5FTNA 2GA8A 2GJKA 3ZVNA 4IDNA 4JLAA 3B1VA 2JIZA 1II8A
chains in the Genus database with same CATH superfamily
4LRQA 1WPXA 3D8SA 2FN8A 3F4LA 1JT9A 4AZWA 4N5DA 1QOZA 1Y3BE 1SXJB 1R7RA 3JD3A 4J4HA 4K88A 4JLPA 3SFTA 1NU8A 1XT6A 1JSLA 3CVVA 1IZ8A 1BNCA 1Z07A 4NICA 2W00A 4JUBA 1OWLA 3I1FA 3PHCA 5AUQA 5JEEA 2IZ5A 2NO5A 3TK1A 4ZYUA 1HE4A 2OENG 4EY4A 1NV9A 4R9NA 4CMEC 2XE6A 4WNAA 5T64A 3CPJB 4DGSA 3LTNC 4CLRA 3C4VA 4RK4A 1MHTA 3KAJA 5CD9A 1L5YA 5JC8A 2PUAA 1SD2A 2O2YA 2VDPB 4M7WA 3ZK8A 3ULKA 4ER5A 1JEOA 1CUVA 1VMEA 3AFIA 1T4DA 3V4VB 1NW9B 1XXHB 3FOEC 3H9CA 3NYQA 1KRWA 3BDAA 2BMJA 3VGJA 4KO3S 4TLLB 1X9IA 4FC7A 5B3JA 5IVKA 1R8YA 4IL5A 2J5BA 3B3GA 3H5WA 1X14A 2QR3A 4H9GA 4U63A 5DK6A 5HOQA 1WMSA 1RPAA 2B25A 4D46A 2G5GX 1J0EA 2CDRA 2J1LA 4NECA 4X1KA 3RS4A 1R5OA 3STHA 3WO1A 1J5XA 4H35A 4OHFA 3FPKA 5LYYA 1Z26A 5TGZA 1KYIA 1XTUA 3C4JA 1P6UA 4HS9A 5F98A 1W4LA 4Z2YA 1ZQ1A 3DEHA 1YVEI 5E7MA 3FYSA 2SCUA 5H5JA 1GADO 1UJ4A 5H82A 4BFSA 2QX6A 5DNVA 1JPNA 1PD1A 2IPAB 3M34A 5JROA 4BDSA 1NM5C 2FX3A 5J4YA 4DJ5X 4G8BA 2QM8A 4WECA 5GZ1A 2V0NA 4KE8A 4A6DA 3D6VA 3H42B 5HNKA 3B48A 3ELDA 2AN4A 3G5LA 4ZMRA 5J43A 5TRTA 4QGGA 4P3PA 2WAOA 4G5QA 5HKOA 3Q0EA 3R23A 3VR6D 1NVGA 2WLSA 2TMGA 1XHLA 3G6KA 2WT9A 3QGMA 4OGKA 5ALUA 2P9TA 5DYGA 1SULA 3FLMA 2YVKA 1FU8A 1S1MA 5AR1A 4GQBA 5FNZA 4JLJA 3EK2A 2WVJA 4BO8A 1HURA 4D7AA 1CT9A 1W52X 1SKBA 2I8LA 3ETHA 3S68A 2QTRA 4EUSA 4XX0A 4GE0A 4I81A 1KU0A 3AR8A 3FNHA 4I5FA 2JCBA 2A33A 3I8XA 1Y3HA 1ST2A 1VIMA 1KYQA 2HU5A 5DSTA 3C48A 4KAFA 2BGMA 1ONPA 2G67A 3PS9A 1T3GA 5A9SB 5IRCD 2Z1MA 3O8QA 3BSFA 1Z18A 3FPHA 2PXXA 3G2IA 4WCFA 3GUZA 5AHOA 5TS3A 2QLBA 3IALA 1NHGA 4ZI5A 1UPTA 2FPSA 2YOFA 5G0TA 1N77A 1NW6A 1CRWG 2WHQA 3ASVA 5KJ1A 1YGPA 1ZESA 2G6BA 1MU0A 1VL6A 3QKSB 1U3TA 1B6RA 3CW9A 2HQBA 3EFHA 3ZTWA 5FA8A 4AU1A 2ZRQA 4ZVUA 4QXMA 4WVFA 4PZPA 3GPDG 1QCZA 5FULA 2P2NA 2VDQB 1II8B 1X39A 1Z4NA 3N2GB 5D51S 4CG0A 4LJ4A 1L9KA 1JHMA 5LDDC 1PZFA 2QZJA 2ZANA 5IZCA 1UWKA 4PFQA 1E0DA 1HNWB 5KVCA 1UBCA 3MZ0A 3ZU4A 5LYJA 1LH0A 3GJ5A 5G1OA 5KU7A 1R0KA 3LX4A 2VC2B 1C80A 2MMCA 1MIHA 1CUGA 4CCYA 3JAKA 1FNBA 1A0OA 3M81A 4QBGB 2WJVA 2YCBA 4RH0A 5FCDA 4DCGA 4DY4A 4JV5B 3AKYA 2VF5X 4RVHA 1W7AA 3QMWA 4DGQA 4BQFA 4HX9A 3FTNA 6ABPA 1UJNA 1Y7LA 4W8GA 3G49A 3L7KA 4D4LA 5I8PA 1I2MA 2WYVA 1I3KA 1U2EA 1KK2A 5F51A 1ZWKA 4CEIA 4JI1B 3FRIA 1H69A 3CCCA 4QQNA 1NDQA 5CBPA 1IU9A 2IZ7A 1P0MA 3LBAA 5AXBA 1H5QA 2OP1A 3AHGA 1NVDA 5KTMA 5CAEA 1O0BA 4DABA 4IIUA 1LDGA 3N74A 1DE0A 4MVJD 1LLQA 2AOUB 2FWNA 4W1QA 4RU1A 2ZJ6A 1VLQA 2WAAA 1Z06A 2HR1A 1S8AA 3SQMA 4LRWA 1SUSA 4I3HA 1NVMB 5L4NA 2YFQA 4HQKA 1RIIA 3B1YA 4C5AA 4N12A 1UPUA 2P9FA 3OH8A 3TZBA 2RGDA 4HDSA 1IVYA 5GY7A 1M0EA 4PNHA 1F9AA 2JFPA 4PZLA 1W30A 2A5JA 5CT9A 4HWTA 3C7KA 3QLJA 1W49A 2ZTLA 1F51E 2FWMX 3C45A 4UM5A 4PYJA 1E3TA 4W9MC 2Q28A 1XK7A 3BH7A 1ZGBA 2VWGA 2H7YA 4O6VA 2ZJ4A 2Q3CA 3C74A 3DM5A 4AMUA 3CBGA 4LJ6A 4BQEA 3A10A 1T2DA 1LSOA 3ZQUA 2JCGA 3S6JA 1O95A 3GNSA 3K6SA 4DPKA 5JRJA 1K4MA 4H7IA 4MVXA 2IY8A 3S5UA 1E6MA 2P9EA 4BZWA 2PUHA 3BCHA 3M89A 3DT8A 1ZM2A 4KEAA 5CGZA 5TJHA 2IDMA 1Z73A 4AXXA 4Y9SA 4DNQA 5CFQA 5KOHA 1ORDA 2J33A 3NFRA 4AULA 4XVHA 1OGYA 2HDOA 4EI2A 3SEQA 5HBRA 3VPAA 2A9OA 2WTNA 4D6XA 2EP5A 3RIHA 1PNQA 4XGRA 2D1SA 1CKEA 3LX8A 4EG1A 2HO4A 2WJYA 3NCHA 3D6HA 4MRMB 3NW9A 3C43A 3WRYA 2XIQA 2YDXA 1EI9A 5SZKB 4UAGA 3KEGA 3HA2A 5EIFA 2Z4RA 3GJTA 3KYDB 1NXSA 3HDGA 4ZQIA 5SZJA 4Q7QA 1E2JA 1BHQ1 1LVUA 3QPAA 3T7RA 2XUIA 1DZ3A 4HWPA 4EVRA 2JLWA 1WB9A 1L5VA 4RDXA 4GFDA 4UMFA 1TGYA 5B7GA 1LBTA 1Z0DA 2I8CA 1H0RA 3K30A 4G01B 3RI3A 3WL7A 1MCZA 3KQLA 3HGMA 1R8SA 2W0MA 2FG7C 1PVDA 3MCAA 4BO6A 2A1TR 5A6VA 2NVBA 5EQFA 3BB4A 3U5TA 3II6X 4J91A 1A3CA 1E8MA 4K9PA 2JIRA 1QGZA 5EKTA 2FWIA 2BTOA 2HX1A 1PNVA 2FPLA 3LDAA 2OD7A 5EXTA 4NY1A 4JP5A 3IE0A 1JPVA 4AJIA 4JLAA 3DDUA 3H9GA 3JVIA 5F1PA 5FPPA 3CMMA 5KNDH 2DBYA 2P79A 1SBCA 3CNLA 3E2MA 1S4QA 5CVTA 5JNVA 5J3JA 4PYIA 5DGDA 2G1UA 2L42A 1Z35A 5BN3A 3KWJA 3SXPA 4IFBA 3TIVA 3I9OA 4XTCS 1GSAA 1RXUA 1D2CA 4FJ1A 4P3YA 1KDVA 1QLJA 2C4KA 2FPPA 3GXBA 4D4GA 3P7MA 4RL4A 4F4DA 1CJSA 1CZNA 2NU7B 2DF8A 1K3FA 2P1RA 3ZV5A 2YR0A 4MEJA 4L8YA 4H59A 1OE0A 3EXHC 4NOJA 1DAMA 2A4KA 1E18A 1C3VA 2FZKA 3G5UA 4L9SA 1EP3B 5EC8A 4ZANA 1AQJA 2ZK7A 5JNTA 2IY7A 3NP7A 3ICEA 4LOAA 2XWBF 3DXZA 2JAQA 3EPPA 4Q4CA 5LZ2A 1JKJA 3LS2A 2QLLA 4YACA 2VRBA 1FP1D 2VP5A 4ZDJA 2FAXA 4IEFB 3WAGA 2D1QA 5SZIA 1T5TA 3GMIA 4GIBA 1MOSA 5K4HA 2V58A 1OI2A 2HCFA 3DJYA 3TVDA 4E5DA 5ALVA 1R00A 4F6RB 5BSFA 1HETA 1GXSB 3D2CA 3KB2A 5DTEA 4A0GA 5HKAA 3OSZA 1R0CA 3L43A 4JXJA 3GFQA 1TKAA 4RVOA 1YJCA 3QA3E 1LK7A 1T9HA 1RKUA 4O2BB 4OFBA 5JZMA 2BGJA 3IP1A 2EJVA 4IJ5A 1VLZA 3OUZA 3WRXC 4HLDA 4CR7A 1ADCA 1W0KD 2OGUA 3FM9A 1PG2A 5SY4A 1YCGA 3S3TA 2ZJAA 4G4JA 2O8BB 3TZHA 5CPFA 3G2HA 2Y1FA 3EDOA 3JR3A 3S1AA 3ZWYA 1KWKA 5KYXB 2IYTA 2DGDA 4HY3A 2IS4A 4KHZA 4R8MA 4W6ZA 3CURA 1FLVA 2VH5R 3LDFA 3SX4A 5CDFA 4TOIA 3TUIC 1TA9A 3UA4A 1TGVA 2QTMA 3WNZA 3TOCA 2FZLA 4D81A 3ZDDA 1BVYF 1U4SA 2BC9A 1B42A 3KL2A 2OLJA 5NLLA 1EH5A 1T9KA 1VHWA 4YRKA 3C3JA 3FWPA 3ZXIA 4RTRA 1PYDA 4JVNA 3RLIA 2SBTA 1NXTA 2ZYHA 2I22A 4Z86A 3D2AA 4E2ZA 3QUQA 2G1JA 3TM4A 1KPIA 1BVRA 2ADFA 1WHTB 4JEHA 5CCBA 1NURA 3UCFA 5BR1A 3VR3D 1LBHA 1A95A 2ZSBA 1FUIA 1Z28A 4ICIA 5LP1A 4MV6A 2PRYA 2R11A 4IMJB 2BFFB 4HF7A 5LC1A 1G8SA 4AMZA 2GPTA 4YP5A 2VAXA 4RH3A 5E8RA 1OUMA 2C4HA 2HA5A 2XUFA 1EUQA 4C7OB 1G21E 3CRNA 3KE9A 3UT0A 3TQIA 4DCMA 5KKAA 5H16A 4HFJA 4M8LA 4A7PA 3RVMA 1WCIB 4BFUA 1LTHR 4L74A 4EUNA 1E1QA 2VP3A 4KZKA 3TBKA 4DDMA 5KWIA 4MUHA 3TJMA 5A4KA 1V3TA 2FE4A 1XK6A 1H2AS 4TS9A 5KU1A 2AUNA 2QRUA 1PLLA 1DFGA 2BMEA 4F8EA 4K9NA 3I2GA 3JQAB 1MDFA 3P9ZA 5E6RA 1LKZA 1W2WB 3L6OO 4G0UA 4A03A 1Z47A 5JAPA 1RI4A 2ZI5A 5FWXA 4V1CB 1NF9A 2GN2A 4RVDA 1KERA 4QUAA 3ANMA 2AHRA 5I9BA 1F3OA 2R68A 4PZUA 5FV7A 2Q50A 1Q95A 2Q9CA 1FS6A 1ZVMA 4Q01A 2V7VA 3ASUA 3O1JC 4QEZA 5H4GA 1NIPA 2JL1A 5CEFA 5IT5A 3TUZC 2OCDA 3DWFA 3MLBA 3CF6R 1YAJA 3P4XA 3B7PA 2CXRA 3PQCA 5BSEA 5KSOA 3RFFA 4LFCB 2FI1A 2GBLA 2WPDA 3FDFA 3KWMA 3MIZA 4X6XA 4M1YA 2Q5OA 3BEDA 1VJTA 4YREA 4ZQFA 2CNKA 2ZBVA 3GRUA 2OZKA 1E5TA 3NDRA 4JP3A 3OF2A 4GH5A 4X0EA 1J20A 1E3EA 1BD4A 3SDZA 1COWD 1TMOA 1AX9A 3LDHA 1KEKA 2IU3A 3K6KA 2R97A 4GOKA 1QOQB 1SC1A 1E2PA 1QHGA 3EGEA 2NQTA 1G8PA 4CGZA 2GBIA 3GVPA 2VOEA 4LKRA 2EKDA 3OHSX 4CKZA 3PQ5A 5CIWA 2J59A 3L01A 3QVXA 1QF7A 4KI7A 2YHIA 3QTBA 4RUKA 5ALQA 4OK6A 3W6UA 4PO9A 4HH1A 1I1NA 2EGGA 2C8LA 1OYVA 3VU9B 4NULA 3THYB 2J46A 1AKTA 3EEIA 1Y89A 5ILOA 2Y1LA 2WR8A 3BA6A 3EZYA 1P6XA 3QU9A 4N18A 5IJ9B 2PLFA 1HPLA 2V6IA 3KKQA 1JAZA 4J4BA 2WYHA 1GRNA 3IHWA 1DEKA 4XE5A 1JFVA 1YU6A 3M4ZA 3THRA 1Z83A 3ZOKA 3OZTA 2VBFA 3FYUB 5HIAA 2BAGA 3DUFA 4II7A 9LDTA 2I87A 1N2ZA 3R20A 5HIJA 4EJFA 3OMXA 5BXQC 1R10A 1H6BA 1RMQA 3IP3A 3OX2A 4GECA 2BD0A 5JAHA 1XTTA 1QQBA 1TX4B 4PZYA 4ZAGA 4DUPA 2ACKA 1ZOOA 3F96A 3TIIA 5IAJA 2JEYA 1V4BA 2E89A 4KJZA 4HCJA 3WYCA 3O95A 4ES6A 2VDWA 4AN1A 4YYEA 1KJ8A 2NV2B 4BVKA 4E1VA 2OB1A 4TSRA 8OHMA 1GLVA 1ZD1A 2EGUA 1YA4A 2JHPA 3HADA 3QU5A 1A7UA 3GJZA 2IU0A 3RQIA 2OG2A 2ZG6A 4RF3A 3ZWNA 1XWIA 5HVNA 3MIIA 4HNHA 3ZXXA 1E0JA 2OEPA 3BRQA 2HL6A 2UZAA 1T29A 3E18A 3R0QA 4PC1A 4E5VA 2PNFA 3E2IA 4JQYA 4LOJA 1CHDA 2NUAB 2OYCA 3HBNA 1EE9A 1RYBA 3DV0A 1YL7A 3QIAA 1G6Q1 3D3EA 4FHDA 4PFKA 1ZCBA 3EIEA 3GRKA 3KOUA 1RR6A 3NR2A 3MUEA 4Z9AA 4P4GA 4JVLA 4MYCA 3WJAA 1Z29A 3O90A 4ZT6A 2ZRFA 5AK6A 2PAFA 4KV7A 4B3JA 2ZT7A 3EOZA 2XD4A 3JSAA 1YIOA 1E6EA 2PZAA 3D4NA 3ANXA 4MMXB 4UEWA 4W5OA 3U9LA 1EGVB 3IXLA 2AF3C 4RGBA 4E5SA 4KUHA 4PIPA 2I34A 4B4WA 2AQIA 2BEUB 4X85A 1SQ5A 3A6KA 3L0OA 5BWMA 1J9ZA 1M10A 3H9JA 5SY9A 4G5YA 1Y3IA 3V42A 4EEZA 3UMRA 1I3CA 2IPLA 4WCFC 4A3SA 4AJLA 5JYBA 4PCVA 1UBOS 1XZDA 2OSBA 4W5JA 1TEHA 1CQIA 1KZYC 2VDLB 2D0DA 1RW4A 2SHKA 1P9OA 1IEVA 3IQXA 3OZRA 4AG3A 3NM4A 3OCCA 5JR3A 2Q49A 4XIJA 1K5PA 5AMXA 2BTQA 1C8BA 3DE3X 4AF7A 3W79A 4P3OA 4EX7A 4RABA 2PQ2A 3BAFA 1A9QA 3LYHA 3H6HA 1G98A 2ZXFA 3K09A 1R6DA 5C5DA 3D7LA 5AIAA 2O2SA 3ZK9A 1ZHFA 3C6YA 2XNJA 3CC8A 4KXQA 2B35A 1LV8A 3VHXB 4EQZA 2Q7OE 4UU1A 4Z9XA 5AKYA 3INRA 1GZDA 2HA0A 5IZCC 2GD0A 3M4XA 3G2LA 2GM3A 2PGOA 4U9UA 4BQNA 2GBFA 1G17A 2GYYA 3DG9A 3MK31 5K9ZA 1JYEA 2BJHA 2VP2A 3UJ7A 4DSNA 3BZBA 2O6HA 5KSYA 4MXDA 1EM8A 1YI1A 1BKSB 2HM7A 3ES9A 3WHKA 2JZNA 2VEOA 1CHNA 3HJGA 4P4UA 5AJZA 5IDXA 5JI2E 2JATA 1DPFA 3L6EA 3FNIA 5A2GA 2OBFA 2NP6A 3RTCA 4C7BA 3SJZA 3W7VA 4D41A 1GL7A 2QGNA 4HVTA 4WKBA 2WSBA 3OTOB 1T5OA 3P96A 1FQWA 4BASA 2BFAA 2O2ZA 2F2TA 3LGSA 3WIOA 1Z88A 2R60A 2I66A 2PQ6A 2TMYA 3ET4A 4ILEA 3UGKA 4C4RA 4ER6A 1U6JA 3ORFA 4GNRA 1XZPA 2F9MA 4O33A 2X86A 4I6EA 2GEUA 1T9GS 4ARZA 2CXOA 2FW7A 4WXEA 1DADA 4YAOA 5BSUA 1JR4A 4KH1A 4QBIA 1QIHA 4LS3A 3WIDA 2HYIC 2WTAA 2X7HA 4FSDA 3ORSA 4JSYA 4YAIA 5JTTA 3H4TA 3KQHA 3JRXA 2RHLA 3TRHA 3FZQA 4NFYA 3HRIA 4MV1A 1SBTA 1E2KA 2H5EA 2HA2A 1Z8NA 2XAUA 1MTZA 1NDHA 2JJ1D 2YNMA 4QLAA 2HWYA 3DW3X 3OE5A 1ZU5A 4YRQA 3GAMA 1AOXA 2PO7A 4YMVA 1TCBA 1GGNA 3C3PA 2EJTA 2HPZA 5I6DA 1RYEA 3AVXA 4DSTA 1IQPA 1DG3A 3KDAA 4TZ0A 3DNPA 4GYJA 2D2IA 3HJAA 2B92A 4O29A 2ZZNA 3ZGLA 2R2AA 3AP3A 4KV9A 5KSWB 4M49A 1CEEA 4W4TA 2IEAA 3PKJA 4KC0A 1PHPA 4MUNA 2OOSA 4PYMA 1NVKA 3O94A 4LY3A 2V4MA 2DPXA 2XTJA 3OPNA 1N9ZA 4UKDA 2CXPA 4ADSG 4LJAA 1M2KA 1WW3A 4RIFA 1U7XA 1SIOA 4JSRA 3TW8A 5F1YA 4C06A 2B37A 1O95C 3W3ZB 1YK0A 2CUZA 3H2HA 4P81A 2ZS9A 4QFBA 4EYEA 1CJKC 1GAJA 3GEPA 2H1OA 4JI2B 5L95A 5BW8A 3P2MA 4MR7A 1KEUA 1WJGA 4L95C 1HNXB 4ROTA 2ID7A 1XQWA 3I01A 3LVBA 1JGTA 4XWTA 5K3EA 2JD0A 2A35A 3FA2A 4ZT4A 4BX8A 1GSOA 2VYNA 2XBUA 2WTUA 5AK3A 1RP1A 4BBAA 1ZQ9A 4MQUA 4EB3A 3PHIA 3ZWDA 4A92A 5FI0B 1T1JA 3I45A 5D86A 1ZGAA 2X7XA 1A5AB 5BVHA 3ZCUA 4WNYA 1Z5GA 3PXGA 1UZNA 1OQAA 4FOTA 4ZCTA 2JIQA 3KPYA 2QK4A 3P9CA 4D0NA 4AI6A 5CITA 4LX0A 1XYYA 1SPBS 1W88A 2XUAA 1ORRA 2E4UA 2BUAA 2VUIB 4EI7A 1NN5A 4LJRA 1IIBA 1L7PA 1PR2A 2GMWA 2NZYA 3AOGA 4WKNA 2BEJA 2CDBA 4GC5A 4MRRA 1EFCA 5C37A 3H5IA 4JT2A 2YMQA 1H93A 4WI1A 3ADCA 1DAKA 1P4GA 2IDJA 1XMJA 3CUVA 3TI9A 3U17A 1NQUA 1FZQA 4N7JA 4DJTA 3TE7A 3HNPA 3V1MA 4LKOA 1ECCA 2ILTA 1E1NA 1O87A 3DE7X 3I5AA 4R40A 3QVVA 1SBNE 2G77B 1OASA 2VKTA 3PEEA 3KUKA 4JBWA 3B53X 3BRSA 4UVIA 5D84A 5HS6A 5ALEA 3GA0A 4AUKA 4RPJA 4UXIA 3UJ9A 2EX0A 1MJNA 3PIRA 3LUJA 4GLOA 4CG2A 3J7TA 2R7KA 3GWGA 4Y30A 4ARSA 1GGMA 1PR6A 4UXHA 1DKLA 3W5JA 5BQPA 4Z8XA 4D8VA 2ZI3A 4KFSA 3HP1A 2AC4A 4Y1GA 1PEDA 1O8CA 1KU6A 4YCCA 2NXNA 4I9NA 4TSFD 5FDFA 3NP9A 5ENVA 4O63O 1FBTA 5K8CA 4ND5A 5JU6A 4L73A 3LP5A 4PAQA 2IYFA 1TW2A 4IX1A 1E89A 5J2TA 2HBRA 1ISMA 3MELA 4YAEA 1PQWA 2ZPAA 5FTKA 4H3SA 2VDJA 2J3KA 3ZV7A 3WNQA 1N7IA 2WA2A 4BZXA 3JZAA 4EHAA 2HO5A 3MWDA 2DBZA 3KKLA 4RKFA 1V48A 1Y7HA 3H75A 3ZDFA 2ODEA 5IH3A 3SP1A 4E3ZA 8ADHA 4AY5A 1FYWA 1AHIA 2D13A 3BPSA 4LZPA 2YJGA 1F6BA 2QVXX 4MGEA 3G2KA 3GUCA 2GYWA 4V24A 3FX2A 4PANA 3R5SA 1X1QA 1FFSA 2Y1WA 3ZWVA 1ZXXA 3KQPA 5FLKA 2C61A 3CLRC 3MTAA 2HMUA 1VLLA 1W0JA 2COUA 2EWWA 3IV9A 1V25A 5CH3A 3RADC 4UMDA 4XCXA 4RSMA 1X7DA 2YWFA 4X6YA 3D6FA 1TU4A 3UK6A 2WWIA 1C50A 4TTPA 4AN4A 1EZ1A 4WLUA 3WI7A 3CMCO 1OKKA 2I67A 1XZFA 4LE0A 3M3DA 3ZHOA 5AVRA 1I4TD 1VE7A 4GQIA 4MJXA 4PO1A 2Q7DA 2L0XA 1C5KA 3NOXA 1LK0A 1QUFA 1UBEA 2DWCA 4JJ7A 5F2NA 1CEXA 3I5UA 2BKXA 3SHFA 5BSGA 2RGUA 3EEYA 2ZRMA 1ZDMA 3CUWA 1R9JA 3NVAA 4U9IS 2FE1A 3S1SA 1TK9A 1DHRA 1RXIA 1XTSA 4P3NA 4D4HA 1V41E 3WBBA 3E7XA 1H5NA 4TTVA 4BMYA 1QIJA 1JQ3A 3ILXA 4CFYA 4KGDA 4JBYA 1L3BA 1V1JA 4JJAA 5EXPA 1Z33A 4J3JA 3K70D 1IPEA 2WJ3A 1KC3A 1SC9A 1U2GA 1CUDA 3ISJA 4HFRA 3COYA 3F97A 5IJAA 1P2FA 1RQGA 1DCTA 3OOSA 3H7IA 1N2XA 2CGEA 2MSNA 3L0SA 4QG7A 2A9RA 5TPZD 3ZDCA 1OLUB 2G1AA 4R16A 5HA5A 3F7OA 1QC5A 3BORA 2OBXA 4XQ0A 5BSRA 4ZCMA 3NYWA 3C8ZA 4LYAA 2HPAA 4ENPA 1PSWA 3H1FA 4RYDA 5K2MA 2Q0SA 3UENA 3L5OA 5FP0A 1BU5A 3W05A 4BEWA 4LZNA 2UVQA 3QBJA 2HPVA 2ORVA 2V9CA 3QF7A 4IIVA 3WDKA 1G5QA 2AWNA 3OZCA 5D6OA 3TQTA 3THXB 1G8KA 1VSBA 2WBLC 3QRWA 4BO1A 4Z8YA 2JBAA 4LC9A 2PKXA 4BL5A 1XN1A 2XZOA 1BH2A 4AX8A 3L1VA 3VUEA 4Z7NB 4DNOA 2QX8A 4BVLA 5IG2A 1ZNWA 4OYRA 5FLYA 5GV7A 5LYJF 2OHOA 4LQ4A 1I9CA 4D6PA 3ZCVA 1G66A 4KPGA 3FNGA 4B7ZA 2DR0A 2PZLA 3BTUA 3IDSA 5EJ5A 1YQQA 3ABIA 2VPPA 1Z6PA 2VJPA 3OM1A 3QLTA 3PGLA 2CEAA 3FOWA 4WLOA 2XUJA 3K0SA 3OBBA 4GUDA 4PN3A 2JHCA 4UEQA 2IITA 3BK2A 3C39A 3KJHA 4NI5A 5JDCC 1C0KA 4HZUB 4JUDX 4L4RA 4LYGA 3AL3A 2ISSD 3LQQA 4Y6LA 1UK6A 5DCUA 4DRYA 5TXGA 2OCXA 1JPUA 2GBLC 3G8AA 2DUWA 3E3LA 4OKSA 4YRRA 4H6PA 3UMYA 1M7BA 1B8PA 2Z3WA 3TSCA 5KNBA 1AMNA 4IHJA 3N75A 521PA 2AW3A 3D4BA 1HFKA 1KI1A 4M0DA 4DLSA 3AUJB 3EPRA 3NUGA 5LBTA 1CIVA 1OXBB 4D5EA 1LLUA 3K0AA 3UY4A 4JKIA 1UT5A 1NOJA 4S1TA 4US1R 2VS1A 2ACVA 3ABZA 1ZPDA 3CLUC 4UNSA 2QENA 2PH5A 1NRWA 4TXMA 1EQ2A 2J5RA 4II3A 4C87A 3ZS9A 1T35A 5KYUB 1DMRA 3MJHA 2QUAA 3B9PA 1K6IA 4W7HA 5EQTA 2NYUA 3CZPA 2PZJA 2EW8A 3TLGA 3ZGNA 3KB8A 5CM8B 3REFA 2OY0A 2DPGA 4G1CA 1TB4A 1AKQA 3PP8A 1Q16A 2PFGA 4Q3KA 5IBPA 1HNNA 3WDMA 4N4AA 4DA4A 2GETA 3IYLW 4CU2A 3N2KB 2C7OA 4OX9Y 3ZYCA 2FB9A 4HNQA 1PEAA 1PKEA 3C8MA 5GINE 4GDMA 4DV2B 2BDUA 3TJRA 4DPMA 1AUPA 3OICA 4BX2A 1PL0A 1ACLA 2DC1A 2CJPA 2WSYB 1VJ5A 4HBZA 4KQ9A 5TQJA 5BYBA 3TZ6A 5EWMA 1YF3A 3IUYA 1W36C 3HKBA 1ML4A 3ZIDA 1X8LA 5BN4B 3FMPB 3S2GA 1DCFA 3CIOA 1G20A 3ROGA 3N8DA 3F4KA 4CMAA 1SBIA 2VH2A 1DELA 4NU5A 4OKIA 1NTRA 1XDUA 3FROA 3R3ZA 4IOKA 4PHTA 1XLVA 1AT1A 3QG5A 1MEOA 4JUIA 1OI7A 1BVHA 4ZFNA 5JAIA 2VPTA 3PLAE 3A2KA 1WZCA 1K63A 2CLKB 3RARA 2QD3A 4HGRA 4CT0A 3FOCA 3K94A 1DRWA 2YWRA 4G5HA 2BR5A 2Q6VA 3CFYA 4I6JA 4I8DA 4P3XA 3O91A 4A27A 5LSAA 4KPEC 4LPSA 1QPBA 3C3XA 4KE9A 3B5IA 2NAPA 2VCHA 4HDAA 2A59A 4OQLA 2BFWA 4PLHA 2XAAA 5L3ZA 6Q21A 4L4UA 4RHUA 4Z5XA 2O6LA 3O92A 5C7IO 2GAFA 4WBNF 1BA2A 2Q5LA 3CLSD 3P4UA 3OE4A 1C7FA 4HN9A 1NI3A 2OOKA 1FTQA 2DCUA 4EY5A 1RJ9B 4RGVA 1Y81A 4U2CA 1ZSYA 1N6NA 1F4PA 5F4BA 1EK6A 4LDJA 4XJTA 1JHRA 1HYEA 2RC6A 2UVPA 3BL8A 4MWTA 3V1NA 3PFGA 4II2A 3OOHA 1KQOA 1H85A 1E8NA 1KPHA 4YQFA 5JD6A 5IUNC 4Q4AA 4CFSA 2QBYB 4M1QA 1VSUA 3BHIA 4I4TB 3BF8A 3FH0A 1MGOA 1J7JA 1WU7A 3C7AA 3G2MA 5CP8A 5EHZA 1OFHA 3OJCA 3L49A 5CYPA 1FJ2A 3K09C 4L75A 1K2WA 3F2VA 4MWBA 5K05A 4JEUA 3VM6A 3BH0A 2DFPA 4O59O 1O96A 2UYGA 2VSXA 4YCAA 1R5JA 1NBME 2GILA 5L3QB 2VZ8A 1OX5A 2CDAA 1WPGA 1OVGA 3KQMA 1CR6A 3O2NA 5B2ZA 5HUJA 4D8WA 4Z3KA 2Z95A 5CLHA 3DDNA 2FP4B 2EEPA 2X2EA 3JASB 4QJ5A 2PG3A 3O2JA 1CZUA 1XKQA 3WLJA 2R8OA 4OX9B 1CRLA 5DTJA 3RTAA 5IS2A 1BO6A 3DMNA 4MICA 5EVCA 3CLKA 1C3EA 3DV2A 3LC7O 2HLDD 2IYPA 1G64A 4HPJB 4Q3LA 3GLRA 4FBGA 1B6SA 1EXNA 3RIMA 5ALLA 4BGUA 2XDAA 1DQYA 1NKVA 3LHDA 4CM9D 3DCIA 2DECA 3LMKA 4Y6QA 5A06A 3UV7A 3CLVA 2QRGA 5B6IA 2NTJA 4IICA 2P5YA 3RNLA 1M5UA 1Q15A 2X2FA 3SPXA 5FNVB 3AW8A 4EEXA 5KTOA 5KYTA 4KDEA 3UUEA 1QTQA 3GGDA 1UIRA 4LV5B 3HU1A 3PNKA 1UXGA 4ND8A 3M5WA 2XCLA 5JVDB 1L4KA 4BNIA 5EXDA 2CJWB 5FOSA 3DKVA 4JT9A 5ITWA 4Y18A 5B30A 2PBRA 2IP1A 5DLDA 3W8FA 3H11B 3BF7A 3HUFA 4X90A 4KQEA 3AKZA 2VTBA 5MHTA 2YNMC 1QF6A 2IS2A 3TO5A 1OZHA 3F46A 3KKMA 1LLCA 1U0RA 2V55B 1IRXA 5FLXA 5HHTA 1GUFA 5A0TA 1SO8A 1ODLA 3PL1A 4ZQBA 3Q87B 3HYNA 4J1QA 5THXA 1E5DA 4X7BA 2EV9A 5FR1A 2W6QA 4MQBA 1CD5A 4H1WA 4DSOA 3A4LA 2AOWA 7AT1A 1IQRA 4C21A 4KLRA 1FVFA 4WPGA 4NAVA 3THOA 4S1VA 4Y2JA 3QQ5A 1DP4A 2OVFA 4RZSA 4XFKA 3PKZA 4AMBA 5A4MS 2ZIVB 3ESQA 1QQ5A 3S70A 2A9FA 4BP1A 4DLBA 1IK6A 5JLJA 1EQUA 3WGVA 1FDTA 3B2EA 2H1LA 3VKWA 2AKAB 3TDNA 3MQ4A 4NRDA 1ADFA 2IZ6A 3M6AA 1E7WA 2R25B 4B43A 4ER7A 3ESYA 1G16A 3R6WA 3RU2A 3PLRA 1QE5A 1NOKA 2F8SA 3Q8XB 3TZLA 2I3BA 4MPJA 3QVGB 1FP4B 3P97A 1TQHA 3ETGA 4NMWA 2AMVA 3ZVNA 5JD4A 1K88A 1A1SA 4QXPA 1KIAA 4AQYB 4GBMA 4P83A 3GLFA 1PSZA 1DAIA 4O4IB 1DTWB 2QU8A 3AVYA 5A0FA 2P9QA 2WT8A 4GZLA 3WISA 1NUAA 2FPRA 3NXSA 2IUYA 4LXXA 2C0PA 4WRRA 4LEIA 4EG4A 3T1QA 1EBFA 5J47A 3SLGA 2OZVA 5IH7A 1KAQA 5EL0A 3NV9A 5EUCA 1TVCA 4U0KA 3TQFA 5FBHA 5FUBA 2RSLA 1PQYA 5EIOA 1T9BA 3BD7A 2QTGA 2QM3A 3DEKA 2A1UA 3VZDA 4CE6A 5T4FA 4N47A 4Z3OA 5ADVA 1J49A 2BBSA 4WJKB 4NYMQ 4G4IA 4NAHA 2OQ2A 3JVUA 4JI6B 1M0WA 2UUPA 2GZ2A 4B7UA 4FNAA 1FNNA 4HNSA 4CEJA 3GDWA 4IDEA 1JFRA 3RYFA 2M6SA 1EDOA 4N0EA 2QG9A 1N9GA 3IOYA 4LV6A 5KQPA 4YO8A 4DZTA 5C53B 1UDRA 3RC8A 4W7IA 3T3IA 4QLOA 4EY6A 3CE6A 4QYIA 3FMFA 1C9EA 4PE5B 1B3BA 3PE4A 3QWHA 2O8CB 5KTSA 3PQ7A 1EGMB 1XHEA 3RC2A 4FDMA 3ZWXA 4CEHA 3RBZA 2OZLA 4P22A 3W7BA 4U7GA 3B3FA 5K99A 1XZNA 1RZ3A 4I1PA 1PR0A 1IHOA 4E6EA 1A7AA 2ZI4A 3IDAA 4BO5A 4K9MA 5FYDA 1ZO8A 2VA9A 4QU8A 1JKMA 1PUIA 4C0WA 4N3GA 3IHKA 1CEQA 5CPBA 1XZIA 2VK2A 3Q8MA 4NOLA 3ZWOA 2OLKA 4GMKA 3BJRA 3KFXA 1N6OA 2XD9A 4BWYA 2Z2XA 1AB5A 2IS6A 2QV0A 3OQPA 3DHNA 1H0HA 4UJ3A 1TVEA 2Z9DA 3TYXA 3G23A 2ODNA 2E9SA 3IEUA 4U7FA 4MKRA 5J59A 4RHFA 4Z9YA 1HORA 5KDOA 4A2WA 4FN4A 3D1JA 2J7PD 2OK7A 4J3NA 2J3IA 2JH3A 3L1IA 1BCSA 3V8MA 4NMLA 4DMUB 5FV4A 3AP2A 4NE7A 5LKAA 3I9LA 3JAWA 3FF1A 3KPVA 1OILA 2O0JA 1KEVA 3VR5H 4IO1A 1GCOA 3UFBA 3QBDA 5L3SA 4FYYA 1E2EA 4RY2A 3V7FA 4DR5B 1SKYE 2Y9MB 1GZSA 4P7GA 3L2OB 4R6WA 2JLBA 4UARA 3IP9A 4KQFA 2JZOA 1CNMA 4EFLA 3HXOA 3DAGA 2O8FB 4J49A 3GUHA 3DCNA 4ZIRA 5CDYA 3CTPA 2WZCA 4O5OA 4HVLA 5DT9A 4EYSA 4J9UE 1XCBA 3EC2A 4DLKA 2IUUA 3LT5A 1Q7BA 1G8MA 4KPUB 3S55A 2C00A 4TRJA 1I2DA 6YASA 3THWB 5EFOA 4C20A 4DBZA 5K1ZA 5CXUA 2ZU0C 4IFEA 4KR6A 2QRNA 5A03A 2RMKA 4OXIA 1V8FA 1CF4A 2C9OA 2DKOA 1EVLA 3AR2A 3B6MA 5BUQA 3IRVA 1BMDA 1X7WB 3QEJA 4HDMB 3IIMA 4L4YA 2I3GA 1CS4C 2ONKA 3R0JA 2JHGA 4O1IA 3TL2A 4BO2A 1RI5A 1HXHA 4BTVA 2FSHA 2JK1A 3I2KA 2XB6A 4DV0B 3N7UA 3KUUA 2C88A 2P41A 3EXIB 1KMQA 2Z08A 1X2BA 2X8WA 3A2MA 2Z2IA 4ZN6A 3ANYB 1M73E 2ZRCA 4MHTA 1MPXA 3NBAA 4O2LA 5E4JA 2D8AA 5JWHA 5FFNA 3EX7C 2WYIA 2BW0A 1TRHA 3MMSA 3MLAA 1OAAA 3BTSA 2ZJ8A 4CLOA 2CBXA 1Y5LA 3IE1A 1JLSA 1MC4A 1KEEA 4D56A 1YQ9A 1E9EA 2ZIGA 3BXHA 3ZH9B 4RTJA 2F1HA 1CZLA 4N8EA 1ZD3A 4HWGA 1FP2A 4XOUA 4A6XA 1HG1A 3KNZA 4C1NA 2CJYA 4Z7JA 4URHA 1U0BB 3KSMA 2K6GA 2VDMB 3NIDB 2IU6A 4M99A 3RKUA 3HJRA 4KO8A 3KCQA 4B3CA 1S2LA 1ZN9A 1YTUA 3UT6A 2JS7A 3ZQJA 1EHYA 4ZTBA 3UPUA 1GFIA 5ICCA 5JJBA 1AA6A 4A2CA 1E9CA 2DUUA 1FRVA 4MWZA