4UHJA

Crystal structure of the receiver domain of cpxr from e. coli (orthorhombic form)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
126
structure length
126
Chain Sequence
NKILLVDDDRELTSLLKELLEMEGFNVIVAHDGEQALDLLDDSIDLLLLDVMMPKKNGIDTLKALRQTHQTPVIMLTARGSELDRVLGLELGADDYLPKPFNDRELVARIRAILRRSHWSEQKLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords TRANSCRIPTIONAL REGULATORY PROTEIN CPXR
publication title Structural Coupling between Autokinase and Phosphotransferase Reactions in a Bacterial Histidine Kinase.
pubmed doi rcsb
source organism Escherichia coli
total genus 48
structure length 126
sequence length 126
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4uhjA00
3G1WA 4L4UA 3SY8A 4N41A 1NXWA 4YP9A 4GPAA 3KJXA 2L2QA 1BVHA 2GI4A 1ABEA 3Q9SA 2PUGA 4WUTA 2GKGA 4MPTA 2V0NA 3N0XA 5IEJA 3FFXA 2FQWA 3GT7A 3FGZA 1M2EA 3O1IC 4RV5A 5E3JA 4Q7EA 5CNKA 5EWJB 5BRAA 1ZN2A 1MVOA 2E4UA 2GWRA 3H75A 3OO0A 4WZZA 4IGAA 1BDJA 1D4ZA 5CNJA 9ABPA 4W5RA 1NATA 1ISSA 3OQNA 3HXMA 2JBAB 4G0PA 4RK0A 4P1ZA 1FFWA 2NT4A 2R47A 4RSMA 4Z4CA 4TN5A 4ML3A 4D74A 2QV0A 4MR7B 3RVSA 4RU1A 4H3HB 2FLWA 4WXMA 2FEPA 3N53A 2ID7A 2FKAA 3D02A 1JF8A 1VPWA 5IC5A 2O20A 2PLNA 3KLNA 3FFTA 5HKOA 1D2AA 2QVGA 1E6LA 3CU5A 1QPZA 5B3JC 3H5VA 1KGSA 3LOPA 2FXIA 4JB2A 3DBIA 2VUHB 2MYUA 1DBQA 4E7OA 1KRXA 3D8UA 1LBHA 2JVIA 4KK3A 5KI6A 1ZGZA 2VYCA 3T8YA 3KKEA 4ZPJA 3L49A 1E2BA 1FQWA 4KK4A 4YLEA 2PUEA 3KHTA 3N6VA 3DLHA 3EGCA 5CHYA 3OMXA 4F3TA 2F8TA 2FMHA 1KMIY 1SXIA 3OQMA 4IMIB 3RVLA 1ZH4A 4NQRA 4F11A 5HQJA 1BA2A 2ZAYA 1NXPA 2MSLA 4KRFA 1E6KA 3LUFA 2FQXA 3IP9A 4O1HA 1UDRA 4WWHA 1IIBA 5TE9A 2PAFA 3HDVA 4EGSA 4IILA 5KWSA 3T6KA 3I5AA 1QMPA 4MQEB 3HK2A 2JK1A 4XASA 5IBQA 3GWGA 3DGFC 1JBEA 1PNTA 5DGCA 3M9WA 2RGYA 3MIZA 3RVOA 1BDIA 1FFSA 2MYNA 1BAPA 4MS1A 4G0OA 3OM1A 2PUAA 5JS2A 3KYIB 3EQ2A 4RK7A 4YRZA 1LJUA 1DCMA 1K66A 1Z17A 3EULA 3G85A 3QX9A 4MQFA 5TPZD 1A0OA 5JNTA 1NXVA 3QLVA 3H6GA 2ZWMA 5FWXA 1U2QA 1D5WA 4LE1A 4Q6WA 2QW1A 5IEBA 5CNMA 1E6MA 3JY6A 2FMKA 4RKQA 4EYGA 1DJMA 2HQOA 1DRJA 3CZ5A 3JTEA 3GBPA 2NZVG 3RVPA 3A3KA 2QU7A 3QLUC 3HUUA 1VRVA 4KVFA 2RDMA 1NY5A 3H5TA 5C5CA 2VUIB 3IPAA 4NICA 4N0PA 4RZSA 4W5QA 3C6QA 4PYRA 1F51E 4RXUA 2CWDA 2JVKA 5TQJA 2L18A 3R0JA 4KV7A 5IUKC 3F7NA 5DCLA 3OMWA 2RJNA 4DADA 2FTKE 4G0MA 3LUJA 3JS5A 2B1JA 4W5NA 4QYWA 5ABPA 3JPWA 3H1GA 4LRQA 1M5UA 1NTRA 1Z25A 2NZUG 2R48A 3CG0A 2YHBA 2LBPA 2QSJA 3HEBA 3JVDA 2QVCA 1NXOA 3GRCA 1RPJA 4IF4A 4DN6A 3JVIA 4NCBA 1TVMA 4JOQA 1YTUA 1QP7A 1QO0D 4JP1A 2PUDA 5KC9A 3FDFA 3GYBA 1RXEA 4EUKA 1TM2A 5IULC 3HVRA 4G0YA 5TPWA 4F12A 2PKXA 3I42A 1DP4A 1YS6A 2FVYA 3C3WA 5EWMA 1JYEA 3DZDA 2FEKA 3HM9A 1T34A 5GOTA 4KPYA 5GQSA 2R25B 4MS3A 1C4WA 5KQMA 2WWVD 1EAYA 2AYXA 2MYPA 3IP6A 4XARA 5D2CA 4MYRA 3Q15C 3QK7A 2P4UA 4N76A 5I4CA 4NCAA 4D6YA 3QLTA 2E4ZA 2PL1A 4RKRA 2PJUA 3HDGA 3JPYA 2E4VA 2PUCA 1JFVA 3A0RB 3O74A 4ZMRA 3LUKA 4D6XA 5HM6A 4MR8A 1DC8A 4RDCA 3GV0A 1PEYA 3TB6A 2WY2D 3Q41A 4OLBA 2H3HA 3GL9A 2JRLA 3EDCA 1P2FA 1RZRA 1D1PA 4P98A 4OATA 5KQPA 4MLDA 1Z2DA 4GNRA 4TLMB 4G97A 2IPMA 1YMUA 3LUHA 2FEWB 2LUOA 3A10A 3O2SB 3N75A 5DLEA 3SM9A 5IUNC 1QNLA 4Z99A 3OLYA 2AYZA 2X7XA 3BREA 3W9SA 2A9QA 4JB0A 1JFTA 4LE2A 2DRIA 3LUDA 4MRMA 2I6FA 3NBMA 2FN9A 3HSYA 4YO7A 5DTEA 2FLKA 3S99A 3O2JA 3E3MA 4ZMSA 1GCAA 1YS7A 1GUDA 3NNSA 4RY8A 2KYRA 2WRZA 1W9HA 2BGGA 2PE5A 4O5AA 3F6PA 4RK6A 4JASB 2HQBA 4RS3A 1WETA 2PL9A 3HCWA 3MMNA 4MRMB 1MAVA 2JCGA 3LTEA 4QYMA 3ILHA 1QP4A 2E4XA 4KQCA 1Z13A 3OLVA 1AB5A 3TX6A 3Q7TA 1P6QA 2CD7A 5TQ2A 1DRKA 4ZYLA 4WT7A 3A0UA 3IP7A 1SRRA 3C97A 4HNRA 4KFCA 1W25A 1Z26A 4L85A 3HO1A 1D1QA 2WB4A 2QR3A 3GBVA 3LFTA 3MA0A 1CYEA 1YIOA 4B09A 4TLLB 3DLBA 3RVJA 4MR9A 2NUBA 1M5TA 1B00A 1QKKA 3LUGA 4RY9A 4XXHA 3M9XA 3NNNA 4H60A 4FE7A 4W5TA 3QEKA 1ABFA 3TO5A 1BDHA 1L5YA 2IPNA 3QX8A 1YK0A 3CS3A 1SD5A 3KCNA 5C5EA 4UHKA 4MS1B 3K9CA 4CBVA 3RVNA 3OLWA 1LJLA 4MQFB 2B4AA 1R8JA 1CHNA 2GBPA 3NNDA 4YS6A 3M6MD 2A9OA 5FWXB 3C3KA 3HUTA 1M2FA 3MF4A 4JA2A 3KTOA 5TQ0A 4PE5B 4RY0A 4M88A 4Z4HA 2XDYA 1CEYA 1GUBA 3CHYA 1Z12A 2M98A 4ZJPA 1GCGA 3HV2A 4YR7A 4EVQA 3OLZA 4RWEA 3H5OA 3O21A 4Z9AA 5EWLA 3GA5A 1JH9A 7ABPA 1ISRA 2RJOA 4MS4A 1U04A 3IP5A 1JL3A 5FWYA 1ZHHA 3L6UA 1URPA 1U2PA 3QEMA 4RXTA 2MSKA 1Z15A 4IRXA 3H5IA 3KLOA 3Q7SA 4PICA 4Z0NA 2QZJA 1JX6A 2WJWA 3ROFA 2LPMA 2FQYA 3HJFA 5JNUA 1L5ZA 2HQRA 3CNBA 5JNSA 4UHJA 3BBLA 1LK0A 3SAJA 1FSPA 2OQRA 2A9PA 5IUJC 3OQOA 1YK1A 4DQDA 1EHCA 3UUGA 2R4QA 4LDZA 4QPJC 4Y9TA 3T38A 3RVMA 1JHZA 2YHAA 3DGEC 4MAAA 3VNBA 4EYKA 3EODA 5EWJA 5TPWB 4O1IA 4KMRA 3K4HA 4KNYA 1EWVA 2JB9A 3RVKA 1A04A 3RH0A 2IDMA 5EWMB 1DZ3A 2MYTA 1DG9A 1TLFA 3EAFA 1VKRA 3N0RA 1Z16A 3QLUA 3F73A 2JBAA 1USKA 4MS3B 5CNIA 5IX8A 4Q6BA 4Z4FA 4G0XA 4QICA 2HSGA 1LBIA 4TMYA 1U8TA 1EWTA 1MIHA 4XLTA 3EQZA 1OXKB 3CTPA 4MR7A 4EYOA 1ZESA 5BRJA 3EJWA 3H5WA 3CKMA 2WJAA 3CG4A 3FFWA 4KZKA 3LKBA 1PHRA 4EY3A 3O1HB 3OLXA 1JLKA 1PUXA 6ABPA 1HEYA 4MR8B 4Z4GA 4S04A 3BILA 1ZGGA 1DC7A 4F06A 3B2NA 3LUCA 4LZLA 2VK2A 4RK5A 2IOYA 2LP4Y 5JS1A 2FSPA 4HNSA 2WMYA 3HZHA 5KQGA 1Y1LA 3P9YA 4OBBA 4PEVA 1DCKA 3CFYA 1I3CA 5DKFA 1YVUA 2NT3A 2QXYA 4FB4A 5T7BA 2MSWA 4YCSA 3CZCA 2TMYA 1ZY2A 1MB3A 3SG0A 3QLVC 5JNVA 4KREA 3RVRA 1USGA 1NXTA 1XHFA 3KS9A 2IPAB 2E4WA 2HJ9A 4LDAA 5TPZA 3IDOA 5KQLA 3T95A 3FMVA 3N8IA 1QQAA 1U0SY 5JNWA 3H1EA 2L17A 2W42A 4LE0A 5JNRA 1YMVA 2PUBA 2LIVA 3VNAA 2GX6A 3BRSA 2IKSA 5PNTA 1SXHA 3KYJB 1ZVVA 3QELA 1ZITA 5T3YA 1ZH2A 4S05A 2E4YA 2N9UA 1PEAA 3H1FA 3CRNA 3URMA 1KRWA 1QP0A 5HSGA 4RK1A 4ETIA 3I09A 4G0ZA 5FBKA 1K68A 1NXXA 3KSMA 5TQ2B 1RZRD 1JDNA 4G0QA 3CLKA 5B3JA 1QQBA 2A9RA 2FN8A 4MQEA 3BRQA 5ED4A 1Z2EA 3MM4A 1DCFA 3QELB 4H3KB 3ROTA 3TD9A 4Z4EA 4LX8A 3N0WA 4EYQA 2CHFA 3F6CA 1P8AA 4EVSA 1Z18A 3MYYA 3RQIA 4ETNA 4MR9B 5BR1A 2L19A 2P9HA 4N03A 1S8NA 4HYEA 4KQ9A 2IYNA 1EWKA 3RVQA 1NXSA 4XFKA 3H6HA 4MGEA 4Z4IA 3O75A 3C3MA 3KG2A 5KC8A 1EFAA 3LKVA 3TMYA 4YV7A 1JFSA 3MQ4A 4G86A 4E7PA 2F8SA 3IPCA 1J56A 4XAQA 2PUFA 4Z9BA 3I45A 2ID9A 3SQNA 1QO0A 2PMCA 1H9CA 1F4VA 1OXBB 4EVRA 4HNQA 1C0EA 1TJYA 2J48A 3UK0A 2JVJA 4IMJB 4MLCA 3SNKA 4W5OA 1AB6A 1RXIA 1PNRA 5TQ0B 5FBHA 2M1ZA 2FMIA 3O1JC 2HPHA 1XWWA 3OM0A 3LMKA 3H5LA 1TMYA 1RNLA 4JAVC 1FFGA 4YWHA 1JDPA 1JWLA 3O2QB 4WXEA 4PZ0A 1DBPA 1JYFA 1APBA 2CHEA 4RXMA 1A2OA 1MB0A 4ETMA 4OTZA 3UKJA 3HS3A 2IPLA 3NHMA 1P6UA 2FMFA 5EWLB 5BQ3A 5F64A 4F8JA 2FW0A 3Q7RA 1ZDMA 4MS4B 4FE4A 6CHYA 5FWYB 3ILYA 2H0AA 3E61A 4N47A 1ZAYA 4OLAA 1XHEA 3QEMB 3LUAA 1DBWA 4NV3A 1GLGA 2OENG 4RK4A 3OO1A 1SXGA 1VLZA 3NHZA 1USIA 8ABPA 2Q5CA 4YGXB 4N0QA 4OG2A
chains in the Genus database with same CATH superfamily
4L4UA 3FTEA 1NXWA 1TT5A 4XUGB 2BFPA 4R1NA 4YP9A 1MPXA 5IN5A 3IEXA 4CN8A 4LISA 1WCXA 3ND7A 3SIRA 3PVCA 2Q3BA 4LF9B 1ABEA 2CLKB 1E1RA 2HSDA 1KVUA 1NTOA 5FFMA 5JS6A 1EGQA 3QVTA 1I6WA 2ZULA 1R5NA 2X3FA 4OXNA 4QBIA 3DLCA 5JCOC 1IIRA 4IIVA 8OHMA 3C5CA 1FDWA 1YU9A 2INGX 3C0KA 4W5HA 4NMHA 2W6MA 4TLAA 3Q0EA 4NCXA 3HU5A 3OX4A 1W0JD 2GXSA 2G4VA 2QI9C 1QGYA 2JFYA 2F64A 3GLHA 4LS3A 4QUHA 2ZYIA 3HXMA 1QDLB 1DB3A 3PFCA 1FYDA 4CCYB 1XU9A 3FA2A 1MO5A 3EVZA 4P1ZA 4IGIA 4JLUA 1SVSA 3KUXA 4Z4CA 3F5FA 4PSAA 1Y6QA 2YHIB 4KQ6A 4ML3A 2QV0A 3Q3CA 3L8YA 2JLVA 3BWDD 5FOTA 3RVSA 4YEDA 5CMLA 5KJEA 3AJEA 2FEPA 2JIZA 1QG0A 3P19A 3TLKA 5HJ5A 3BIOA 2IIVA 2FKAA 4E21A 4P38A 2AXPA 4B43A 4MIEA 2J46A 2CV1A 5C80A 1QPBA 1LRKA 3TR0A 3DA8A 1P80A 1M83A 2I80A 3BD6A 2WIAA 1PNVA 2OCBA 4BNLA 5G0TA 4JB2A 1BNCA 3SF8B 4BNWA 1II9A 3OZGA 3H18A 1JTFA 1G291 3DB1A 1L5GB 3RK4A 1UANA 1YKFA 5E1MA 2JH3A 1RQNA 4QSHA 3TSZA 4I5DA 4R5MA 3HP4A 4F6CA 4B3HA 4ZPJA 5KYUA 4KR0A 4PPQA 1E2BA 4F4HA 3ADDA 2IF2A 3UB2A 3H1PA 4JWKA 3L1VA 3T15A 3A4TA 3SU8A 1M66A 1PYDA 4V2IA 2VP2A 1T1IA 4B40A 1SUPA 3MOIA 2BLNA 2Q2OA 4E31A 4DSAA 4OB6A 3PUJA 4YECA 2HLDA 4Y6PA 4FMPA 2FE1A 3GFFA 3AVTA 3KPUA 1P0PA 5MN5A 1E6KA 3H16A 1QHGA 2OVFA 3H2GA 3O3NB 4R68A 4WBNF 4N6NA 1QIFA 2CW5A 3N0VA 3I2HA 4C5AA 3BXZA 5JZMA 1TF5A 3AEKA 2LXNA 3P0EA 1H6BA 4F92B 2AZTA 4FC6A 1EM6A 5FO1A 3THXB 3HDVA 4Q39A 4IILA 4B87A 1CNEA 3G79A 2DXIA 3T6KA 4BQNA 2LRHA 3EGWA 4OQMA 1L7XA 4LNAA 3BXGA 5LB4A 2CYBA 4KFUA 1V16B 2VXCA 4DAEA 2X42A 1Q5PA 4ARIA 1Q16A 2BEWB 2OZPA 3K0CA 3UUFA 2FW6A 3NAZA 3EFEA 1PUJA 5GP1A 1T5OA 3VZRA 3P2JA 4ZQIA 4K2HA 5T67A 3DTYA 3SXUB 3SYTA 3GP3A 4FMCB 4A1FA 1T5LA 2C59A 2JAWA 2RJ3A 2ZWMA 3QV2A 3C8ZA 6NULA 1U2QA 4WXPA 1UBHS 4TPKA 1MG5A 3TTVA 1AZSC 5EMLA 1WF6A 3QFCA 4CKZA 2W0MA 1HPLA 2GILA 2IZZA 2BGTA 2PXHA 2RKWA 2XE8A 4WNCA 5AUPB 1ONNA 3L6EA 3RVPA 5JPCA 2C4WA 4FWBA 2YV5A 3QKUA 3CF2A 3TDKA 2VT6A 4NICA 3QPWA 5ILQA 3GJYA 4IL5A 1EJBA 5CX1B 1YB4A 5GONB 1NNEA 4RJLA 2JARA 1OVGA 2YJ5A 2O6HA 4UQPA 4XI9A 2GZHA 1T4BA 1AQUA 2HIAA 2QTCA 1H2ZA 4TV9B 2R68A 5D5HA 2C03A 5LYJF 3NJ4A 5D85A 2QZ4A 4M8IA 2FI1A 5A3QA 1A1VA 2NSYA 2I1LA 1U2RA 1DMRA 4NBRA 3CNLA 3FVQA 4IIJF 3BGIA 1OXUA 1LPOA 3JVDA 2CB9A 3DNMA 4ON9A 3QRWA 4JJGA 1WA5A 4GNKA 2FWPA 3AXSA 4IF6A 2OWDA 1ZH6A 2GOYA 3B82A 2LCFA 3C3BA 4FOLA 1HT2E 3N7AA 4OMFG 4BVHA 5E3IA 2J5KA 2WJZB 3DAYA 3GYBA 4XIJA 3AFNA 1TM2A 1JQJC 1A27A 2EXXA 2PZEA 3K53A 4G0YA 2C2KA 1TT5B 2P2SA 2WWRA 4WI1A 5LZ5A 2XAAA 2NYRA 1A7KA 4IFBA 4AS2A 4D82A 5GVSA 4RTQA 1BTOA 3FPSA 1U8FO 3JR7A 3DZDA 1JG6A 1YJ5A 3IAEA 4V1CA 2RGGA 3M5WA 3U7FB 3WGYA 1R6VA 1YQGA 3ZV7A 4NP6A 1UH5A 4N82A 2X41A 3ELUA 3Q15C 2BHNA 2ZUCA 3KKLA 4KLNA 5IT4A 3T5DA 3WOHA 2CXTA 2RE8A 3C4VA 5ER9A 4FINA 4JYPA 1C30A 4X84A 2V7BA 4CV0A 1QX3A 5SYMA 3A14A 3GLHB 1GYPA 2IEIA 2UAGA 4JJIA 4WE3A 1FB5A 2P11A 3B20A 5EXEA 4IICA 1UBLS 2PX8A 3B7WA 2PUCA 3O74A 5F9MA 1WD5A 1X9HA 2JD2A 3VYTB 1Y6RA 4K81B 3AESA 3W77A 4WSOA 4D3FA 3VNVA 1S96A 1M0TA 2Q1XA 4RTRA 4QDOA 3ABZA 1MDBA 3GHHA 4EFMA 2I8LA 3HDQA 1XZIA 4XCVA 1ZAKA 4V3BA 5EKUA 2NLOA 3S40A 5IZ4A 2FPIA 1COZA 3W2IA 5JROA 3U7GA 1H94A 4AY4A 4EHKA 4EX6A 6YASA 3GPCA 4Z99A 1ORVA 1ZWKA 1EK2A 2D00A 3QXHA 2BGGA 3VISA 1WXDA 4LSGA 1BD4A 1U1GA 3K15A 3RRFA 3MWKA 3I5UA 3DBVO 4XQ9A 4MRMA 2QYTA 4H16A 5KYUB 1W5AA 3HRIA 4MKRA 5FCDA 4XFJA 4B73A 4D3ZA 1VA5A 3VZSA 4DHWA 2WK1A 4OLJA 1OQAA 3ZCQA 5TGZA 3W4JA 3O3MB 5KC9A 1VGVA 4RK6A 3VNUA 5CCEA 2BM1A 4BLWA 2G70A 4QJIA 1WETA 3AEZA 1KRHA 3IUMA 3CLSD 2QAJA 3LUBA 4D9IA 2O1XA 4PYOA 4TN1A 3CNHA 4RW0A 2GTPA 4DJJA 1NHGA 1ZGAA 1CDOA 3NTXA 3QVLA 2Y1XA 4FYYA 2WI8A 4QQFA 3VSDA 1DKOA 3U3XA 4AJLA 5I4IA 3JQFA 3MFQA 1H5QA 2GEKA 1R9NA 4KMSA 1CEEA 2ZRGA 1M1UA 3AEKB 4W9RA 4KZPA 4J0EA 3DEFA 3U56A 3HO1A 5FTJA 1DHTA 2HHJA 2BMDA 2Y05A 2IW3A 2XB6A 4WN9A 2VC2B 4MUEA 2HWYA 1ACMA 2XBUA 1IMJA 4V0RA 2GSWA 1QJ4A 4OHRA 1KH2A 3H3JA 3KEQA 3LLMA 5HFNA 1DQSA 2YWBA 3HYCA 4FGJA 4XB1A 3UC9A 4ZO8A 3O8LA 4G0UA 3H2SA 3VH4A 4TTPA 2Q9BA 1AQIA 4GZ6A 4BNNA 2JFOA 3R3XA 4UBJA 1E98A 2OBFA 3FMPB 1TM4E 2B0CA 3F78A 5SY9A 2QTAA 3WIVA 4WCFA 2PRIA 3GFOA 3GA7A 2DPMA 4PGHA 3E5NA 1U1FA 3E84A 2BMAA 4LZOA 1VLJA 1R6UA 4E30A 4BEWA 1AGPA 2JHPA 4EZBA 1Z73A 4JA2A 4Y2SA 1N3IA 4PE5B 1KAMA 1RHRA 1UK7A 1X7YA 3CX8A 3KT6A 1X9IA 4MKXA 4BJHB 1BWPA 5JD3A 2ERXA 4X6YA 5INTA 5ADVA 4LJ7A 2FFJA 4PG7A 4BO9A 1E1YA 4L07A 4BWGA 3HCEA 4K9KA 2YIJA 1OX4A 1PBNA 2O3RA 1VLMA 3PNKA 4OI1A 1XV5A 3K8QA 1PL8A 3LT4A 3GA5A 3KSBC 1G7CA 1N0WA 1Z5PA 5B7NA 1NYQA 1W0JA 1E2IA 3U6KA 1LPBB 3O4IA 4TV8F 4M2LA 3EEYA 3PC8A 1ZSNA 3U2QA 3KB2A 1JI0A 2QXTA 1PT9A 3OPMA 1CIJA 4JBLA 4RXTA 2ZSHA 1G20B 3SHWA 1P39A 2PH3A 3A6GA 1S9DA 4C88A 1MJGA 4RTLA 4KDEA 4ZT6A 2JFQA 4LX0A 3X2SA 4C5BA 1ZBQA 5JNUA 4E1AA 4C03A 4RX1A 5CURA 2FMUA 3WIDA 3FVTA 5CDFA 4PYQA 2BJHA 4MYTA 3SD7A 2EP5A 2RONA 2W93A 3RNLA 1JIQA 3QI7A 4JJAA 3WB0A 3JWGA 1ZD8A 1Y7TA 3DL7A 1I4DD 5ALWA 3VJRA 4H0NA 2X4LA 2Y77A 1R4MA 2HAEA 4D79A 3O4FA 3OPYA 4JC4A 3VPCA 3CVXA 1OWNA 3C3AA 4BMZA 1I1QB 3DBRA 2DSNA 3HBAA 1BOOA 4XX1A 5COBA 2QRNA 3W05A 4V1CB 5IRCD 1FE8A 4EH1A 5BSWA 2ZIUB 3R9IA 3Q1LA 1E64A 1Y1TA 4MJXA 3QFSA 4RENA 3UQZA 4OXKA 5FV4A 4BFVA 3HR4A 1G2PA 3MZ0A 3HNPA 1H0HA 5EKSA 3EZ2A 3CLHA 3ZHTA 5BY2A 4CM7A 2OCPA 1C30B 3ZE0B 1G5QA 3G5TA 3IUEA 5DO9A 1EUQA 3ADKA 2XGGA 2YWHA 4FI3C 3BXOA 3VTKA 3I52A 2ZUDA 4X3OA 1H65A 1Z9BA 2DULA 3WLIA 1NF8A 1PYGA 4B3RB 4MAFA 3AESB 1ZGGA 2WT8A 3AMVA 4Z8XA 4AQYB 2P4SA 3IDZA 4CW7A 3ELWA 4HBZA 5JALA 2I6TA 1CUWA 1SC4A 2VHJA 3KXLA 1G8AA 1OI7A 3NRCA 4Z9FA 1J39A 2WP8J 1C7FA 1RCTE 1RLTA 1M6YA 1D03A 4YP0A 5ILGA 4FB4A 2XYQA 4UMFA 2RHCA 1MUUA 3QVGA 4NH0A 1P7ZA 3RVRA 3U3KA 1J2UA 4BUJA 5ALMA 1SCNE 2HV8A 2IOFA 4DCMA 1YJQA 1UMBB 2ZBQA 3QEJA 2O2GA 2DT8A 3MJDA 1GEGA 1Z37A 3FMVA 4FS8A 4O4LF 5D1NA 1RYDA 4XWKA 1EP1B 4DV5B 4D6PA 2OT3B 3A11A 4IQGA 2EIXA 3V4VB 3G0CA 3U3ZA 2H4FA 2XVMA 3BE8A 4M60A 2ZRKA 2X5JO 4Q02A 5H83A 3H2HA 5KOHA 1EZ4A 2IGTA 1AUOA 3DZJA 4R1MA 1JV2B 4L51A 3X0DA 4LRUA 1E94E 2NXCA 4JLWA 2E18A 2H16A 1FOEB 1Z2EA 4CVNA 1W36C 3OZEA 1I5EA 1QLJA 3LHDA 2A5FA 1JZSA 1QV6A 2ZT7A 1LRLA 3SJCA 3W2GA 5FXMA 4S1OA 1ISGA 5EPUA 4WN9B 2YZGA 2ZJ0A 5J5AA 2HDHA 1K9VF 1T0UA 3RSCA 3SQWA 3MK31 1Q7EA 4FNAA 1DE0A 3QMMA 2B5OA 3F3YA 5F7ZA 5FUVA 1JZQA 3AK4A 1NOKA 1DEXA 1PL6A 2ZDHA 4GI5A 1E7RA 5JFTA 3C3MA 3TH5A 2WG0A 5KREA 4D9NA 3VSCA 3PNVA 3IPCA 1Y89A 1J56A 1IJKA 3N2NA 2R3SA 3DBOB 2PMCA 1UK8A 4F56A 3S1LA 3CC8A 1BIFA 3CCCA 1EYZA 3PYMA 5LU9A 2DTXA 1Q6YA 3B9PA 3WHIA 3AILA 4BU1A 5JASA 4DNOA 2BHSA 2VUSA 3QU9A 5F7OA 2HGSA 1DIGA 1U2GC 4YBZA 3DVAA 3NHLA 2VA9A 1X7YB 3I58A 3OM0A 3BKWA 3F96A 3R7LA 2G8LA 4MV8A 2NZXA 1BHJA 4UMDA 1A2OA 1TTHA 2XNKA 4ZCIA 5WRFA 3W5HA 3WK8A 5F4ZA 5KVQA 4DIKA 1ZLYA 2BMJA 5BQ3A 3GO4A 3H2YA 5MFZA 3PUWA 1KJQA 3FHLA 2YZ7A 3I6MA 4BS9A 1P5RA 4UNSA 4DW8A 3ZE9A 5KJCA 4NESA 1KYYA 2KX7A 1P4SA 2OENG 3MB5A 1PGNA 5T4FA 4LNUB 2OV1A 3S28A 3ZWQA 4F9TA 1KNXA 1G9XA 4DDVA 1K2WA 2JFHA 2YX1A 1QV9A 1YE5A 3BH7A 2A0XA 3VPSA 3OA0A 3ORHA 1HNNA 3MRSA 2ID4A 5ECGC 3SY8A 1YDWA 4L0CA 1CUVA 1RJDA 2P0EA 4AB1A 4BIIA 5I7SA 2Z4RA 3KJXA 4D41A 5AUQA 1I33A 1Y3CE 4ENRA 4II7A 1JLSA 4ZVMA 1AVTA 1CUUA 1VCOA 2HZ7A 3WQHA 1ITZA 1HBJA 4ZT3A 2G9QA 3N0XA 4M1YA 1ZM3A 1MQ8B 4O2AA 1UQUA 5A7HA 2HX1A 2I4IA 2OVBA 3BE4A 1C7EA 1R50A 1R4MB 2F90A 2IYOA 3NHWA 4ZYTA 3OPYB 1OJ7A 1RWBA 4W5RA 1PNOA 2IYWA 4YJ3A 2FEOA 2O8EA 3DBRB 3PCTA 3ZGZA 1ZVQA 3C5EA 1NU6A 3NM6B 4TMXA 2RIPA 3L8MA 1OBFO 3PXGA 2GKOA 4JGIA 1X87A 4QEKA 3R5SA 2R47A 5ALJA 3HXLA 4DC0A 3PNLA 1WP4A 1DZIA 2OORA 3SSOA 2RH5A 3LXXA 3SZRA 1IPEA 1KJ9A 4FS3A 1EPUA 1EVQA 2OPBA 2PXCA 4WXMA 5C0OE 1NN5A 2DKFA 3KU1A 4HN4B 5TEVA 2VZ9A 3V7WA 4AMYA 1FW8A 1C0KA 2PLNA 1W5FA 2PRKA 4E2XA 4MEAA 3AGPA 4IIEA 3C2QA 3CU5A 1X15A 3L0ZA 3ECSA 3TSYA 3KSDO 3EPLA 1AH2A 3TI9A 3ZW7A 1M33A 2E7ZA 4K88A 3BICA 4L2IA 2C8JA 4LK3A 1UFKA 2JJMA 3ZHVA 5F2NA 5D7NA 1FUEA 3NIWA 1PLJA 3DKKA 3PS9A 4WLEA 4YMVA 1PUIA 3ZOZA 4E03A 2ZZMA 4NPHA 2XH8A 2KM1A 4G56A 2WAOA 4MQ6A 5IKPA 4ARZB 4QKQA 1CUGA 3AI1A 3CNOA 3HWX1 4BWFB 2UYCA 3E7FA 1XK7A 5H02A 2TECE 2OGTA 5JQWA 1GPKA 3C14C 5E6SA 5JWOA 3ZVMA 2ORYA 2RGNA 3MS2A 2YICA 3B13B 3HVUA 4XTCS 4BQSA 3SK0A 1KAGA 3RTBA 4P0TA 5I9NA 2FRDC 2HLHA 1NMSA 3CVYA 4UW9A 2ZTUA 4X9XA 1K7EB 2Q4TA 3SDSA 4Q3DA 1O95C 2IHZA 3ZE2B 1QP8A 1H4TA 4MPPA 1SC6A 3OETA 3OWOA 5CXSA 1U81A 1RABA 3HA5A 4Z8YA 3HWWA 4ZRDA 3VNQA 1NUAA 2NXEA 3DMTA 1EHIA 4ZPXA 1MHTA 5AKKA 8GPBA 1QHIA 2XTZA 3KXDA 4WCDA 3L0IB 1DINA 2GQ0A 4W7IA 4PV7A 5CFQA 1YI1A 3DUFB 4C14A 1DUVG 3IR6A 2IDJA 1LI4A 3BH6A 4G0OA 4MV6A 5C34B 3GEGA 1Z8HA 4TTTS 1DPGA 4BX3A 5JSFA 5JNTA 3TQOA 1HL3A 4BECA 3PI6A 3WGMA 3WS7A 4HQ0A 3L4SO 4N8DA 3SR4A 3KHSA 4AJPA 3H6GA 4J75A 4BRZA 1FDTA 1XSEA 2JGJA 5CT8A 2POQX 3ZJVA 3HDHA 3GMDA 2DHQA 3IP3A 1J8DA 2YRFA 4ZO6A 4HZUA 1NC1A 3B3FA 1V1RA 2IELA 1ZVVA 3P9CA 1J22A 2HRCA 1PS8A 2HPZA 2W8ZA 5C2JB 2BFWA 3HCAA 2VHEA 3K73O 1KJYA 2O0MA 3HY3A 3A3KA 3VOTA 2PBFA 5DB4A 3W1VA 4M6WA 4LF6B 4LEIA 4QFCA 1M1YE 1MO6A 4WOKA 1NY5A 1XZFA 1ZU4A 2VUIB 4KX3A 3RTEA 5KWIA 4YV1A 3LUPA 3RAEC 1P1HA 3DVAB 2D2EA 1GQQA 2MHCA 3C6QA 1BXZA 3HDJA 3N7UA 3N9IA 3I9FA 4Z2YA 3TDNA 3LDUA 1KJNA 2HFJA 4GH5A 1ESCA 1LY1A 1A8UA 1TUIA 3GB9A 2FSFA 3KU4A 4NYIQ 4ZC8A 1UBOS 3F7NA 4YB8A 4PTYA 4UTXA 4GDMA 1YUNA 1Z34A 2PKQP 2WSSD 2ZIAA 3G2OA 3WP0A 1QRTA 5AW2A 3K2EA 3WK9A 5JRZA 4GKKB 3F5MA 3G6KA 2VDUE 4DARA 3VDRA 5ABPA 4I8IA 2NTVA 2ZU0C 3VOSA 1M5UA 3KAQA 3V9AA 1NVUQ 4XVUA 2XADA 3L6DA 1XMXA 2II6A 2HTFA 2WR8A 1AN9A 1RPJA 3FB4A 4Q7JB 3LSYA 3N3AC 1PT7A 1JHYA 1DU4A 1AS0A 2Z0MA 4MPDA 3K8OE 1G98A 3OUZA 1G19A 1TYDE 1SVUA 3IXLA 5AHXA 4EG5A 1F38A 3HVRA 5AOCA 4FKMA 5AR1A 2G9VA 2UYOA 4YASA 4EATA 3H5NA 4S1VA 1KZ7B 5FA6A 3D3KA 2F3RA 2VR1A 3AFMA 3WLEA 1RQLA 4M1QA 2O2YA 1H4QA 1PRYA 1KQOA 4LV5B 4O2AB 3BFXA 2GKSA 1ULZA 2ZU6A 4F3RA 1XOIA 2PVSA 4MVJF 3QK7A 5HNKA 4YJ3B 5JU6A 2JEOA 3FMIA 3RFXA 1Y82A 3I04M 1QVWA 3DB2A 1A5BB 5HKAA 2J0SA 2VPZA 3KVYA 2HL6A 2N75A 1JQBA 3LCMA 4UCQA 2JAQA 3CCFA 4Y2QA 1NVEA 5HM6A 3O2NA 4RDCA 2CNWD 4M8SA 5FHQA 3DE6X 3C6BA 1L9KA 5KHOC 2HNAA 1UFRA 5HVNA 1FFCA 1ONPA 1RKXA 3FH0A 4FEEA 1XDUA 4KBYA 4M54A 4ANFA 1MC4A 4FCCA 3GFGA 4WFJA 2VOEA 4J91A 3I9KA 4UE2A 4R98A 4LSZA 2J6IA 2VEDA 3UT0A 1UODA 3WXMA 1WF3A 2JLUA 2Q6IA 1ZC4A 5HILA 3W2TA 4WVLA 1ZICA 2R66A 4INPA 3AYXB 3ZQ6A 3M34A 2GFHA 4ZGWA 5EJ6A 2F3SA 1J4AA 4BQEA 2XVAA 2AW5A 1NF3A 3HBMA 4U0KA 1WUHS 3CV3A 4FFPA 2DBZA 4L2IB 5EJEA 1ID8A 2A9QA 1J8MF 3IB3A 4J94A 4JB0A 2XUQA 2Y1WA 2ONZA 2AA3A 2BTOA 4YO7A 2D2IA 3GLGA 3BB4A 1FQOA 2FLKA 3NRJA 4MDYA 1S4QA 2PH7A 4XWOA 3MGGA 4MHTA 2JGRA 1YZQA 2XHZA 2YWGA 1DQPA 3GRKA 2XIJA 4CIDA 3DXFA 3MCZA 5DHSA 4BNVA 2I6GA 2WFAA 1SCDA 4I1PA 4ZC1A 4DOMA 1DOAA 4EJSC 4PTLA 4DLVA 3BXPA 4JUCA 2RHTA 5E6SB 1V3UA 4IDBA 3WNQA 1PE0A 5LUBA 1DAPA 4CT5A 4F4DA 1PFQA 3QWIA 5BWBA 1PR0A 1Q92A 1PGOA 4H7HA 5TT1A 3WL3A 2C5FA 4R05A 2WVGA 2IHVA 2Y6VA 4RJIA 4TMZA 3PQ4A 2ICAA 3ZK7A 3N8DA 3V4SA 4FQ7A 2WJVA 2CYAA 5BRNA 1ND5A 3BCRA 4B09A 3K70C 5LA6F 1BHO1 1BH6A 1PWYE 3K5PA 4OHBA 3AETA 3M9XA 3ZY2A 2O2DA 1NVDA 1GA6A 2P77A 1B8OA 3ICOA 4JU9A 3PGA1 5HIMA 5BOVA 4AX8A 4X00A 5HUHA 5KNBH 5BQPA 4QGHA 1XHLA 4LN1A 3CVUA 1JG2A 3A4LA 4RIHA 3EUWA 4CM8A 3P0RA 1NBMD 3ZKWB 4D9JA 1UBKS 2QT1A 2J30A 2PZKA 1DKLA 2GCEA 4HLUA 4K46A 5HS6A 1E1QD 3U39A 2F1JA 4Y1EA 1VYTA 4DMKA 2I0FA 1GSHA 1FDIA 1NVFA 1MNAA 1NJSA 3CLRC 3U0VA 1UBTS 2J3LA 1P9OA 2YH2A 1UKZA 1T6NA 2QZZA 2R87A 5EUQB 3I4FA 4P7JA 3BWEA 4M9ZA 4BX8A 4CKBB 2QM0A 1DAFA 3HG7A 4INAA 1ESZA 2CSUA 3IMKA 4HZUB 4CM3A 3N2KA 1V1RB 1AIPA 1XYGA 2GB4A 2LW7A 4A2PA 3FOEC 3DWIA 1UEJA 1O7JA 2D5LA 4QDKA 4HFMA 2I03A 1UT6A 2Q9CA 2VSXA 1A4IA 3R1IA 1E3DA 4NG4A 3LLCA 2I78A 1Z0JA 2VF8A 4M6WB 4DBZA 1GCUA 3I0MA 4MHSA 4I5FA 1GPYA 3SF0A 5FUYA 3FPCA 5EIFA 2AI1A 3LC1O 2OGZA 1A72A 1KS2A 1R0SA 1PV2A 4RVDA 4Y18A 1OAKA 4YCNA 4XB6B 2PZAA 3NP7A 2PT5A 4RGQA 4BDTA 2O2CA 4RTPA 3U3JA 3RYCA 2I7VA 4UCFA 3CPJB 2GN0A 3DQPA 2WJWA 1F20A 2DCUA 1R15A 2OHOA 2HUNA 3B3QA 4ZVNA 3WGZA 4ZZ0A 4QO7A 4TM8A 2XKJE 4M98A 5AJXA 3L6CA 1EWYA 4LVCA 3LYUA 4M4SA 5KYYA 4X0EA 5JHGB 3O26A 3FZNA 4ND7A 2PMBA 4BMOB 1LPPA 2FPRA 1V3VA 4N5IX 1RPAA 2B30A 4LTNA 4YNBA 4YFVA 1XTIA 2GNAA 4COKA 1ZEJA 1CUSA 1LZLA 1UWKA 2FEXA 1H2YA 2AOTA 2FSSA 2ZS7A 1NJ6A 3DGEC 1TECE 3NFYA 3WNCA 4C0XA 1L4UA 1DDGA 3Q3JB 1OGJA 3P97A 4IQ4A 1QF6A 1P9NA 4LDPA 3W8RA 3ENNA 3RIMA 4ARAA 1EWVA 4HATA 4JWTA 4OIMA 4MUHA 1FTSA 4QU9A 3CPEA 1JPJA 5G0SA 2BHTA 2H7VA 4QGGA 3TG2A 3STTA 3AR4A 3MWEB 1X13A 3I1YA 4Z4FA 5FDFA 3S81A 4ZAVA 4ZIRA 1J20A 2FQ1A 3RJ9A 2WT4A 2C54A 3AJ8A 3ZCRA 3E3LA 3D1VA 2REBA 1AMUA 1EWTA 3FSRA 5E1BA 2JAXA 4I1UA 4D3YA 1JXAA 2XTMA 1VM6A 1W4AA 4DCSA 4HGZA 4D8YA 4DA8A 1TAQA 3CG4A 3WRVA 1SD2A 2H1RA 4KN9S 5FLXA 1H9BA 2ZI3A 1CZRA 5H68A 4OHMA 4N8SA 4JCCA 2Z9DA 3F6EX 1WHTA 3TIFA 1HEYA 2W2PA 2FKNA 4BMPB 4Q7LA 5BOSA 2QTGA 3LUCA 1XTSA 2VPYA 3KKKA 4CCAA 5B2EA 4D99A 1JXMA 4BP8A 2NNWB 3AIIA 4OBBA 4DBLE 3GXOA 1DCKA 3MCVA 1N3LA 1EINA 1NL3A 2VHZA 3IILA 5DKFA 2NVWA 3CVWA 1SVIA 4ODIA 5KKAA 3I61A 1ZIPA 2C5HA 4J0HA 4V1CI 5K45A 1KP2A 3LT5A 3HZZA 2Y92A 1EE1A 5JNVA 3KE8A 1WDWB 1DDOA 2V0CA 4I1OA 4LPKA 3ZHSA 3PTZA 1MV5A 1Y34E 2V7TA 1XZHA 3FZGA 3NASA 4LXHA 3UMJA 4ZJYA 5CVVA 2BGKA 2CL7X 4M76B 4PPFA 4EG8A 3QIVA 4RZXA 4MWSA 3CSSA 3G2QA 2UUPA 3IUYA 3BORA 3Q3VA 5A05A 2DECA 3FTPA 5T8KC 1ZMRA 2IYLD 2WLSA 2BW0A 2JPDA 4DJAA 3VO1A 3STVA 1HQDA 4N01A 1BWSA 1X39A 1ZUNA 3LT0A 4W5WA 1RYNA 1S2GA 3B6JA 1S1CA 1Z06A 1Q21A 3IV7A 5JEDA 4LMAA 4IWXA 5F1YA 1UADA 1OC2A 2ACWA 4YRLA 1FEZA 3GMIA 1P33A 3QWBA 1VZ2A 4HDQB 5IJZA 2EDCA 2VRBA 4RLQA 2PKWA 3LPCA 1ZCBA 2A30A 2MR5A 1JWAB 1JEQA 2VUTA 4FDVA 4COOA 1E9CA 2K6GA 2A78A 2DUJA 2X0IA 2WHQA 3KUUA 4K0KB 1Z4KA 2W2LD 2CNNA 2WSSA 3CW8X 4MI6A 3AETB 3PU6A 4INZA 5FR2A 2P6OA 2DJ5A 1IDOA 3ZEIA 2XUGA 5KTTA 1GZ5A 1T9ZA 2OGUA 3PNMA 1BEEA 4YAEA 3H6HA 3IALA 4GQBA 3H0CA 3UATA 3ND8A 4CM8B 2VPWA 1EFLA 4XRRA 3ELDA 4FFOA 4G86A 4MPJA 2PWPA 1XU7A 3JD1A 3N2EA 3C3DA 4CDRA 4A36A 2XVXA 3GT4A 5J5CA 1JLHA 4MJ3A 1KK3A 4HEJA 1C1HA 1IAVA 4HMPA 4RTNA 4HNQA 1TA9A 2J3QA 3WLAA 2QT0A 2I2BA 4AO6A 4I3HA 1AA6A 1KEWA 5JZ9A 1AB6A 1RXIA 3FVVA 4YQFA 1YAJA 2YXLA 2EBHX 1NFFA 3EEFA 2D5AA 2JIBA 1XTRA 4JL5A 1ZUIA 1A97A 1E5DA 2QTFA 3L4BA 1MDFA 1FFGA 2P2LA 4KE8A 1JKXA 5AJWA 5JZOA 3QI2A 1WDMA 5CCXA 3PUXA 5LQDA 3JSXA 3GJXC 2OOKA 1D7OA 1V8BA 1NURA 3BIWA 5DMXA 3W34A 4EHAA 1X14A 4WKNA 2Q2WA 2NN3C 3C4JA 1J8VA 5D84A 5CCDA 4YALA 4ALKA 2Q07A 4QOFA 5NULA 1PJTA 3V1UA 1K7SN 4JJZA 3F7MA 4KITB 4MB2A 1NNLA 3FB1A 2PGAA 5CK4A 4KQ2A 3NP9A 2QNRA 3IJRA 4IIUA 3T5AA 1PSWA 1TZBA 3RYCB 3NU1A 1MXFA 5B1YA 2CNWA 1W1WA 1BE1A 1SZJG 1SG0A 5B1HA 3H9QA 5I9BA 3RF6A 3S0JA 4PZPA 4TT8A 5CEJA 3EEOA 4FGLA 4GKVA 4R7ZA 3EZ6A 4EPTA 3D31A 4UUBA 5CXUA 4P4UA 3NB0A 3MJCA 1RQPA 4J3JA 1DTEA 3A2KA 3O4JA 4MPTA 1M1XB 2NVUA 5HIIA 1YZNA 1MZPA 5IEJA 3ZHCA 1O6ZA 1HDXA 4ER7A 3THSA 1KK0A 1TC2A 5CNKA 4UUNA 3ZN2A 2Z6UA 3UQYS 3S3TA 3KOXA 3V48A 2I2XB 4UD2A 2O19A 2R6CA 4D9MA 5EQJB 4Z0TA 3F47A 3HC7A 5EUBA 1T6XA 1ZD1A 2O8DA 2JIRA 3DR3A 1JG3A 1UFQA 2WOOA 3ZCTA 4CZ2A 1RHMA 3KR1A 4UHDA 5EXXA 4ZIRB 5LP6F 1NUQA 1FFWA 2P5YA 5AW3A 1N7HA 3TI7A 3DPUA 3HB1A 3V33A 2HHAA 2GAFA 1QGAA 2O2SA 3M33A 3PIDA 3F5DA 5AVVA 4J1SA 4YAOA 1G64A 1ZD3A 4BNJA 5CXQA 2HHLA 1ZRSA 3D02A 2PMEA 4D4LA 1WUKS 3FLMA 5SZKB 2BFAA 3FMFA 3DO5A 1WHTB 2XB8A 3L02A 3L8ZA 2G1UA 4H7EA 3RUCA 1K3TA 1LTKA 2IUTA 1ZBDA 4URZR 5BOSB 3QPBA 2Q5FA 4BFUA 4R9UC 3X1XA 5LZ4A 1XG5A 1EWRA 2PVCA 2VUHB 3PWTA 3QOFA 5BW5A 1KRXA 1SBYA 3K6KA 5CXXA 3OSZA 2ZFUA 1CVRA 1G8PA 3OPYI 4MEJA 5A9RA 1FQJA 4ZANA 1NOJA 4OAQA 1B41A 3AJRA 2VKQA 3K2QA 4H7FA 4IUYA 5E6RA 1NBMA 2G8NA 2XD4A 5B5SA 5KVAA 3EPKA 3ASZA 1E1QA 4G26A 2C0QA 2DWUA 3OQMA 1GRVA 5ESXA 3A2NA 1AF7A 1ILWA 1XZPA 1CJSA 1RW4A 3LCJA 3ZS8A 4PM4A 1R5JA 3HYLA 521PA 4AZ0B 5A4FS 1PTJA 1IRIA 1VE1A 1ZCAA 2DQYA 3B1VA 2KS6A 3WMRA 4ENWA 1JDJA 4G9BA 5C46F 3UUWA 5IT9A 4CMIA 1UDRA 1G3MA 4LF5B 3GOHA 1ZUNB 2BBSA 1E2KA 2IS2A 1ULSA 3AEYA 5TNXA 1I32A 1HYGA 1YSCA 3EUAA 4JT9A 2WWFA 4BZQA 1JSXA 4LDNA 3K35A 3M6LA 3SZGA 2Q27A 5C1DA 4ZV7A 1CF4A 2H54A 5IBQA 3EIFA 2PG3A 3V8VA 1YL7A 1V5IA 1JEQB 2UU9B 1I14A 4D0GA 2GSDA 3LCCA 1SBHA 4PFSA 2OXTA 5FJJA 5FLYA 1GD1O 4NAVA 5EHZA 4KYVA 3EULA 4OYHA 3WGLA 4D45A 2VAVA 3OZCA 2FZGA 4Q24A 1LVGA 2JAPA 2VHTA 3T12A 1WEKA 2HA2A 3UUEA 3WOVA 2YYZA 5DSZA 1OLUB 3FCUB 1DWQA 4EGFA 2PX4A 1W5TA 3N2GA 1JJ7A 2ODTX 5KWJA 3LGSA 4Q6WA 2BLLA 2OZEA 2PS9A 4CYMA 3ZQKA 2MR6A 1AC5A 3K3PA 4BVJA 4JV5B 2CE7A 3I53A 3B9BA 1AOXA 2I3ZA 2QTHA 3FTQA 3STHA 1P7VA 4WOCA 2BKVA 3B1WA 4C0JA 2D13A 3V2HA 3ZXXA 2J5XA 3WLMA 4DSTA 4AL4A 2QU7A 2Z83A 3HCCA 3I23A 5ALUA 4NJOA 1GAEO 1GJRA 1T15A 1E3WA 3SWWA 3VKVA 3RHFA 2YS6A 4XFDA 4TWZA 1MB4A 2FZ5A 2Q99A 3H42B 1SOVA 1WSWA 1FDVA 5FBWB 4ARSA 4PQFA 1P74A 1DFGA 4KGDA 2JVKA 3JD4A 2QJTA 2HBZA 3M4ZA 1NJGA 3FI9A 4CQLA 2GXQA 2ID8A 3I6ZA 3RTAA 1T36B 2VHXA 5DJ5A 5AM5A 2QRUA 5E4FA 3TBFA 4GT1A 2K4MA 4BUCA 2FTKE 2Q1WA 2ZQ5A 3EF0A 3G8CA 4GXNA 4HGRA 3TGWA 4EITA 1IEWA 2I2CA 3JPWA 1TU0A 2I6UA 1EZ1A 4J49A 2H5IA 1Z25A 4K9QA 5IP5A 2VK1A 2RD2A 2FUKA 1OWLA 3PBKA 4IDHA 1E3IA 3RHSA 5AW6A 5J3JA 3HEBA 3TLAA 2WC1A 1O0CA 3W0LB 2Q1UA 4ZQGA 4JIMA 4F4JA 4EENA 4L16A 1XAJA 2TMGA 3KFLA 2QKYA 1E3QA 4PS1A 1NQWA 5B2ZA 5HQTA 4KAFA 3UBMA 5IULC 3ZYZA 3TGLA 1EX1A 1GZ6A 2ZWAA 3IBSA 2JF0A 1BDBA 2CFIA 1FNBA 2QVBA 4AJIA 2PGIA 1TCAA 5BQXA 2WUDA 2CK3D 3Q8XB 4LRYA 4F3KA 3PFFA 2E6UX 1DIRA 2BAGA 2X3UA 2NVUB 1V3QE 3D6JA 3NH6A 1D8AA 3R8FA 3VV3A 4G25A 5K01A 4KRXA 3WNDA 3UT5A 1W1IA 1AKNA 1C7QA 4Q15A 1JHAA 1RKVA 2D8MA 1VB5A 1ECGA 3DOCA 4G4JA 2QVLA 3LIPA 3IPRA 5K05A 3KXIA 4NCAA 3ZS9A 3ICEA 3PV0A 4EA8A 3PQDA 2GEDA 3GGOA 4UVGA 4EF4A 2Z1NA 5TRTA 4PC2A 3ZBTA 4D6XA 1JVSA 1T43A 2ADOA 3R3VA 2BR3A 4US0R 1H6DA 3JASA 3SMVA 4XEUA 3O6VA 2PEYA 4ZTUB 4ALIA 4DLXA 1G38A 2DWPA 5IFLA 2FOXA 1M54A 4Q4AA 2J08A 3AUKA 3PGVA 2PBRA 2QD5A 1RP7A 1ECLA 3D43A 1H2EA 4ZRMA 3C3PA 1EUDA 1HXHA 2HMSA 5FBLB 3UEOA 4G97A 5IVKA 3AHHA 4LYDA 3RWOA 3K31A 4M0KA 1UQRA 3ROPA 2CLMB 1O97C 2XEXA 4LJKA 1NI3A 3WSTA 3AF2A 6AT1A 3RBAA 3SSMA 3LDFA 3G0BA 1CZUA 1SHUX 2HDWA 3GOQA 2JKYA 2W2LA 3KR9A 4U2EA 5GJCA 3W5IA 4LYGA 3NBMA 4U0JA 2W70A 2VDVE 3WK6A 3ZW9A 4DZRA 4HYQA 2M1XA 3TJZA 3QYJA 2DETA 1RLUA 1N0UA 2A0KA 3OJ0A 3TLEA 1EFVA 5E6RB 3TOSA 5CM8B 4CMBA 1P19A 1GDTA 4KVZA 1SGWA 1LJ8A 2A35A 2QRGA 4ACBA 4ZK2A 5LD2C 3TRHA 4UM8B 1GDHA 4AJ2A 3VH3A 3TX6A 4AS1A 3TQTA 2WYOA 2X5OA 4HLCA 1UJNA 4JELA 5HUQA 1TZCA 2B2CA 1P9LA 3BXEA 1ID1A 1UJ2A 4G0NA 3UXHA 3FPAA 1OWPA 1JU9A 3LDHA 5H59A 3KDPA 1PFWA 4CMIB 1TLLA 1W6UA 2MCFA 5LJIA 1NVVQ 4KFCA 1X2EA 1T3SA 5C1PA 2V3WA 1U1CA 3VXKA 1T4MA 4JJKA 2M6SA 1JHXA 4Q3OA 2A67A 2HSZA 2VCEA 1T4DA 1Y5LA 3BK1A 1J2JA 2W7TA 4KDFA 4FZVA 2JANA 5JADA 4RHXA 4R1OA 5I9TA 2QE6A 4OXXA 1C4OA 3D5TA 1UBGA 2JL1A 3W7AA 2A33A 2F1RA 3WZMA 3H2ZA 3JVUA 4L50A 4RYLA 2CV0A 1M2VB 1NRJB 3ZWOA 5IDXA 4U9IS 4L5BA 1E1KA 3AVUA 2H29A 1ZOSA 3UXYA 1BZYA 3RVNA 2P3QA 3S68A 3GAFA 3TINA 1X7XA 3LX5A 3ZVRA 5JFOA 2C5AA 2C42A 2XUDA 4RIFA 2Z8YA 3Q40A 3NV9A 3N2GB 1RSZA 3EDYA 2EIHA 3AR3A 1ST2A 4A27A 5TQ0A 5LSAA 2B7LA 1AHHA 4UPDA 2VPQA 2YZ2A 3GEMA 3NGXA 5JJIA 1G6OA 2VT3A 2HRDA 3RKSA 4BPBA 3A6LA 3HYNA 2YL2A 1V9SA 4RULA 1HLPA 2M98A 2PANA 1N2EA 2HT6A 1R10A 3RODA 5EFZA 4EKGA 1P7CA 4NU8X 2D5CA 5EZYA 1UKEA 1LFAA 4UDXX 4PRLA 3RDPA 4IIDA 4NV0A 1KVTA 3FTFA 2I3AA 3I3SR 5FX2A 3SS8A 4TRMA 4G1CA 2R5WA 3IP5A 5EUMA 2C5GA 4EO7A 5JDIA 5JTUA 2XWBF 1VHLA 4EX7A 5EZSA 4CQLB 1U2PA 5LP6C 4H4DA 3G2MA 1DAKA 2RH9B 1Z0AA 4RJKA 2YS7A 3CUWA 3WGOA 4I4CA 2DGDA 4Z3KA 5I4BA 1P7PA 3IODA 3EA5A 4WUVA 5DSXA 4ZHQF 1PF7E 4NBTA 1GEEA 1HGXA 2ZBDA 4LJ8A 1A5SB 1OAOC 5K0ZA 5F5XA 1HEUA 4XD7D 2OPHA 1JXOA 1M1NA 2F67A 4MWGA 4D0RA 2QLTA 3OQOA 3UAXA 2HRBA 1MENA 1XMVA 3WSVA 4A26A 1VHQA 1ZRMA 2VF5X 3E7XA 2RGCA 4LDZA 4L0MA 4FEGA 3HR7A 4YAIA 1FDOA 1Z0IA 3F2VA 2P4EA 4JMLA 5T6BA 5K0SA 3IOCA 3WLRA 3GLUA 2E5LB 3EODA 1RJGA 1XALA 3DVQX 2AG0A 3AFHA 4KMRA 1YDGA 4K6GA 2XZOA 1NU8A 3ISVA 4W4TA 2IQIA 5LKAA 1DZ3A 4FFLA 2A58A 4MP8A 3TPCA 1ZVMA 1E9SA 3TSAA 3K8YA 2ODBA 1UXGA 1O6BA 3M70A 1XNHA 5H70A 1HDIA 4X45A 2JI4A 1IQ0A 5FEMA 5LMZA 1W35A 3EARA 3KYCA 3EF3A 4UE6A 1KHTA 4KDRA 1RM4A 1NMYA 2G7ZA 3CJRA 4PR3A 5JAZA 2OSVA 4QTZA 1AKVA 1V3TA 3OX2A 2X0RA 1YS1X 1OZ0A 2B9VA 5H9WA 2FNAA 1COWD 4TWJA 3ZX4A 4EY3A 5IJ0A 3OLXA 4Q5IA 5IYZA 4FIZA 4KYIB 1PUXA 1PKXA 1U7DA 5TT0A 3UHAA 3JASB 2ZATA 3IS3A 1T6BY 1GL7A 2GJKA 1RRCA 2WSBA 3CY6A 2P78A 3NDRA 4ZZ2A 4Q4AB 5ULLA 3UGTA 2YIDA 1U2EA 3QKTA 4XW2A 3WL5A 4B7ZA 2YZMA 3PHLA 5DEOA 1IC6A 1V95A 3RBVA 1X3LA 2N47A 5TQVA 3CEJA 4DFDA 1ZC3A 3BGOS 1YOBA 5COQA 3TXYA 1YVUA 1GA4A 4ZXPA 2HCBA 2J9ZB 3GVHA 1GILA 4YCSA 3M5CA 4QU5A 3WXBA 3WAGA 2IU6A 3L4KA 4KGZA 4W99A 4GS5A 2BMEA 1WVIA 2VK8A 3JAKA 1HNZB 1IB6A 3AW9A 3COYA 3FNHA 1GGNA 1YFKA 1I2CA 2IS6A 1GSOA 2WVJA 5ICFA 1SXPA 2HN9A 4TYPA 1K8XB 1V8DA 5EXPA 1GGVA 3H2IA 4NABA 4UUQA 3WA6A 1OZAA 1Y3AA 2XECA 3GJ7A 2NPOA 3H7IA 3USES 5MDHA 2GX6A 2XZLA 4G07A 1VFNA 3IJPA 4NMLA 4N40A 2QTNA 5PNTA 3ZPXA 4HDCA 1S2OA 1KJJA 4QOSA 4UHBA 2AHRA 2IE0A 1PG2A 2J3EA 3H17A 3L7IA 3M1LA 5DF1A 2Z6VA 1PEAA 3H1FA 1N1MA 4NE7A 1BCSA 3DF9A 3URMA 4ETIA 4LXUA 2GBIA 2LIPA 4P93A 1G21E 4O02B 3L1KA 3AYZB 3VHQA 1QQBA 3JWPA 1KYWA 2XT6A 1K8RA 1OOEA 2AC4A 2OC4A 1Q2UA 3TD9A 1YMQA 2EU8A 3OM9A 3UH1A 2H1FA 5C7YA 2RGEA 2PZBA 2ODQA 2V7UA 1IB0A 3KFXA 4KXUA 4MUBA 2CLOB 3UHPA 1R0YA 1I2DA 4GBGA 1VB3A 2P3OA 1D6MA 4O59O 3V1LA 3Q7PA 4L27A 4DRYA 2YBEA 2PSJA 2AN9A 2AEFA 3HNRA 4V0QA 4MDFA 2VDWA 3FJ1A 3U13A 1UZMA 1P2VA 2E5WA 2WM8A 2ZI7A 4WEOA 5B57C 3B6IA 1NXSA 2BL4A 3UJ3X 2F1KA 3FVRA 4C1NA 2CB0A 4PC7A 2WWIA 3KDAA 4DG8A 1P1BA 3MS7A 1ORTA 3NTRA 3LKVA 5FKJA 4K3UA 4P53A 2F8SA 3MAGA 4BNXA 3A9VA 1QVAA 1H2RS 3DO8A 5CR9A 1X7XB 2BCJQ 4AF6A 4EPXA 1H9CA 2QLLA 1YQUA 3OCVA 5GONF 3VKHA 3W4KA 1DV1A 2AQ8A 1LPNA 3MLEA 2RSLA 4YAUA 3NX4A 4TV9F 1E9VA 3D7KA 5TQ0B 2J3DA 5E9QA 3V97A 5JRDS 4LXGA 2CK3A 1XWWA 3HEAA 4Z54A 2XB4A 2YHSA 4IH1A 3DEIA 5GZ6A 3WBJA 1YE8A 3B48A 2W6ZA 1FTYA 4WXEA 2GXAA 4RXMA 3VAZA 2QTTA 2V55B 3UKJA 1OX6A 3IEIA 4XQGA 5EZYB 4LKRA 1AQYA 4MTLA 5C31A 4BN5A 1N34B 3OE1A 3ER9A 1SB9A 3AB8A 4C7XA 3EDQA 4A91A 2ZK7A 3ABIA 3W9BA 2GRUA 3Q3EA 2R00A 3EASA 1Z2OX 3ZWVA 4C3UA 4C89A 4Y2PA 5JXIA 2FG5A 4KW7A 1ANKA 3K1JA 4E5VA 4NCNA 3SHVA 1QCCA 4PLWA 1UWLA 2WNIA 2HEGA 5AVYA 4DA4A 5E9WA 4DYHA 4IX1A 4UBLA 4AJ1A 1NBEA 2W2NA 1XZMA 1ATZA 1F4LA 1AO3A 1PZMA 4IGFA 5CLIA 1M1NB 5K2OA 1IVSA 1SUWA 4C0WA 1KDYA 5DTIA 2RHDA 2CCJA 2GM5A 2AG1A 2CJFA 2O7RA 3KUKA 3LVRE 4I8XA 1QIJA 2EGHA 5GVRA 1IZYA 3AIMA 3HYRA 1KEEA 1IBKB 2FEAA 2NADA 4HRVA 5JJBA 1N8TA 2GZSA 4MI1A 1UXIA 3Q3HA 1A7JA 2E4UA 2G1JA 1OT3A 3I05A 1EDBA 3E2PA 4KH0A 1CB0A 5EXDA 3ONFA 5FUMA 1U02A 2WM3A 1J99A 2YFHA 5K2MA 3K6JA 3BZBA 5P21A 2GCOA 3TVTA 1Z75A 1ODSA 3M6XA 4QBKA 2P62A 4TQAA 1XMOB 3KPYA 2QQ5A 1EXDA 5BMVA 2LKDA 3JW8A 2F17A 5FL7D 3RJZA 4ZOEA 3WLKX 3ADCA 3G8AA 3KVNA 4PPGA 4UU8A 4XUCA 5ALPA 2EX1A 2X9NA 4M0DA 3DDNA 4YAJA 2QE7D 5FFNA 2YJ4A 3T1TA 2V4ZA 1NUHA 4TKVA 4GZMA 2FP4A 3OU2A 1MD9A 3QPCA 4PQEA 4EW1A 5IJ0B 3TCXB 1N2HA 4C7VA 5IYZB 4IGKA 1N5IA 2RGDA 3OKPA 4MUXA 4JXXA 1F0KA 4K5QA 3C8DA 2H2HA 3NYQA 3E8SA 3H5VA 4MUFA 4X1OA 1NVXQ 1U1IA 3QW2A 4QTTB 1KPIA 3EPHA 5COAA 1GPUA 4KGVA 5KJFA 2R6DA 1ODIA 3K2IA 5F78A 5JAMA 4L3WA 1CRPA 1XAHA 2ZUEA 4UOQA 4DSNA 5A5DA 1SKYB 4OM7A 3EXIB 2IH4A 2ZB8A 4EUNA 4G9EA 2C77A 1HE4A 1P1FA 2NO9A 3ZD8A 1HMYA 4ITVA 3VVBA 4NBLA 4AYWA 1E2PA 4ZYVA 4JVNA 1UIMA 1PDVA 4QUGA 4MKHA 2O57A 3OPXA 1L4NA 1TJ5A 4JP3A 2BFBB 4BV2A 1EGHA 1J1IA 2XX3A 1MHPA 1P0MA 1SXIA 2KJQA 3A1FA 2CYCA 4GG1A 4HVTA 3RHTA 3BAFA 5K4GA 1BA2A 1MRNA 3H8JA 3MTJA 3SVTA 1X7DA 1FUKA 2GBCA 2ZRCA 1GKUB 3ND6A 3QVWA 4KYUA 4C4OA 3UO8B 4EKEA 1MH9A 2F6RA 5ICSA 1GUAA 2BSQA 1HSOA 2Q3MA 4DJFC 1WKVA 4NYJQ 5JBIA 1HZZA 1P91A 2HFKA 1FL9A 2RB4A 3DONA 4ZYYA 1YJXA 2VAXA 1BCSB 4JNCA 4KHPB 1VSVA 3JWEA 1WZ2A 2XKBA 2ZEJA 3I39X 4GKJB 1IM8A 1QMPA 4AURA 4B1FA 2JK1A 2GUGA 1CUEA 2O4CA 3LECA 2Z56A 3F3KA 3CURA 1RACA 3I37X 3P52A 1WL8A 4CIXA 1U4SA 3EFHA 1VL0A 5THKA 3T5GA 4L6AA 3LQRA 1QHFA 4KMMA 4R1SA 1GZDA 3U37A 3AW8A 1DCMA 4KIFA 1K5HA 2VDWB 3G85A 2BCEA 3I4CA 3OTWA 4V38A 3WWCA 4DXDA 2ZIXA 1ZHOA 1NJFA 2ONJA 1T1SA 3WB9A 1IXKA 1XX6A 2XNSA 2XYGA 1XL1A 1FS5A 2K2QB 2I9PA 2JKVA 3OH8A 1QV7A 2C94A 4LHSA 1VLVA 5KDLA 4BLSA 2IEZA 4YRQA 2R6JA 1U9JA 2HY7A 2CUTA 3Q0IA 4I08A 1B14A 4M55A 4NU6A 4XD7A 5DM2A 2YVQA 3STYA 1N0IA 3OA2A 2ZUWA 2FMKA 1H1LA 4ICIA 4GEGA 3DDUA 4OXYA 3DLIA 4AZVA 4G5GA 5AW0A 2ZS8A 3JTEA 1J42A 4MW4A 3H97A 1O5OA 1OIVA 2A14A 3C6ZA 3INTA 4BFLA 4XWGA 4QLBA 3FOCA 2AQIA 5JAOA 4R2HA 4ZVQA 5KU7A 1H2HA 5DLYA 4R41A 3KSAC 3T3PB 2ZDQA 4PQYA 2EW8A 5AKJA 4KN8A 1I5RA 3JQBC 3R0JA 4MWDA 3T5BA 1GRNA 4IIHA 2HV9A 3UMCA 3RGGA 4IHAA 2IYVA 3TZBA 5AESA 1PJ8A 1B7GO 3JS5A 1V11A 1L8QA 4AMZA 1G17A 2H1WA 2HCTA 2AR0A 1OKKD 2DH6A 1NLZA 1MFZA 2YNMC 3KIPA 2A0FA 4HH0A 5CTJA 2ZJFA 3ZDFA 3BZUA 3KJIA 1GTJ1 2JCBA 4WA7A 3CG0A 4CQJA 3JQQA 4E2ZA 1N36B 4GYYA 1JJIA 4LV8B 1COWA 1YS2X 4GMDA 1G9SA 3OC6A 4LYYA 3HMKA 3MFYA 4QLOA 4NCBA 1R0BA 4ZI3A 1QO0D 5IH7A 4JR2A 2R65A 4NDAA 2BELA 3BSSA 2OG2A 4HN9A 1KY4A 5GOZA 5JXGA 1Q74A 4BV3A 1KMCA 1OYVA 2A0UA 2C7VA 3NXKA 3LL4A 3IV9A 4JBHA 3HYTA 4NARA 4EJMA 1Q1ZA 1QRAA 3GGGA 3KZ1E 3MUNA 1M6NA 3T5CA 2X1HA 4EPRA 4G4SP 1OV6A 3WQBA 4BCCA 2QORA 5FBZA 3I64A 4F2WA 1KEEB 3EYWA 1M2WA 3PXDA 3WTCA 1ZWLA 4D57A 2ISCA 5D2CA 5C5DA 5LP1A 3KQSA 4OSEA 4PZYA 1DAGA 4DJDC 5B2FA 3PF9A 2YWRA 1XNGA 2O1EA 3GEHA 1NLFA 1R0ZA 3L8CA 2IT1A 3OZVA 4WNAA 1VSUA 3OUTA 2QN8A 1I0IA 1XZEA 5C53B 4X94A 3CE9A 2NW6A 1YKSA 2PJUA 3HDGA 2O8VA 2GCOB 2PT7A 3IMEA 4ZOLF 3PEYA 3NTQA 4BRWA 2EBUA 1HT0A 1TTPB 2Q3EA 3DHWC 3MNFA 3O3CA 5BMVB 3GV0A 3GRPA 3MRVA 1VJCA 1XZNA 4BO7A 1ZIXA 4NKRA 3T4XA 5IHXA 1FJGB 5E6UA 3BL5A 3BMNB 3ONDA 3T0GA 2JD1A 2P5TB 1N78A 1RRPA 2OSBA 4GBJA 1F2TB 2FP4B 3NEAA 3T3GA 2IU4A 2V59A 1D1PA 3MQ2A 4G1MB 3OIWA 2F62A 3F7OA 2D2FA 3AFGA 2FSVA 2ZSKA 2RHJA 1OTXA 3EZGA 4HEA1 1W30A 3LK6A 2LUOA 3KLMX 1CRWG 1RM0A 5J58A 2H8KA 2ZB3A 4BAGA 1OSNA 4HUQA 3NEPX 5L3VA 3LW7A 2B5VA 1SVOA 4KXXA 1WOMA 4C5CA 5BMOA 4YRTA 3BREA 1Z33A 3E3NA 4S1PA 3LUDA 3UW1A 3A9TA 3MS4A 1DELA 1U3WA 2O52A 2ZTHA 3L8FA 2FN9A 4J7CA 2OBNA 3URKA 1X7ZA 2ZROA 1SC1A 4IV5A 4J2OA 5IPFA 1U0HC 5AVXA 4HEHA 5IXJA 3KZXA 3PTAA 4NOKA 3KZNA 4RLFA 2PE5A 2WSMA 1FDUA 1TQHA 1XR3A 3PF8A 5FNVF 2AOXA 2PCLA 4HQRA 4RD3A 4RS3A 3WYBA 2I6QA 1XDGA 4FCWA 2TMKA 3RF7A 3G0IA 5KYVA 4WNIA 5EI5A 1D2GA 2QN3A 5B6IA 2WABA 1TMKA 1PO7A 4IOMA 3PDCA 4P2BA 2CLHB 2WAYA 5J5VA 4MUIA 5LU8A 2QRPA 1YL6A 2YUTA 1CW2B 1LDGA 1IU9A 4HMQA 1OTHA 1RZ3A 3I0NA 3IP7A 2AH5A 4OGWA 1BMFD 2V58A 4AVYA 2HIMA 4XQ0A 9GPBA 1PWZA 2LR0A 4GO1A 1W25A 2BHRA 4DSZA 2IX9A 2Q8PA 3HCRA 1CDEA 3LFTA 3NHKA 2R62A 3H1AA 5BURA 2VZLA 1YIOA 3DLBA 1XAGA 3AUTA 2EHJA 1M5TA 4RIIA 2NZJA 3VC1A 2IODA 1PZXA 3DTVB 1Z74A 4ZODA 5JHHB 1UJ5A 1DT3A 2EFHB 1EAMA 1Q3KA 1BDHA 3BUSA 3UICA 1AE1A 1J0XO 3PQFA 1E6UA 4BMCA 3BXHA 3M82A 5C5EA 1N2JA 1M8GA 3UN1A 1NZFA 3EK2A 4NFSA 3HA2A 2ONKA 4NQZA 5C9ZA 1B23P 2PMFA 2XMSA 2IZ5A 2ZIXB 1YOVA 3KHUA 3GX1A 1BE0A 5BV8A 2C4UA 1NLMA 3QYAA 2IEAA 3NAQA 1Z88A 1ZJJA 3FRIA 5KQPA 4PLHA 3PFHA 1P62B 3RRYA 4C2AA 3LFUA 3DFZA 4RY0A 1F7VA 5KCMA 1PFGA 4Z4HA 1X94A 1T9HA 4BGVA 1H1LB 2VJDA 1GUBA 3GT3A 5I7HA 2FPPA 1NZJA 3AKYA 2EF1A 4RVNA 3ZBUA 4AMUA 5CD1A 4RKFA 1AT1A 3O93A 2PUJA 1PQPA 4A5OA 1C7IA 1NF2A 5BUQA 4YX9A 3ABOB 1XKXA 1VHDA 3R6DA 3EG9A 3PPVA 1HEIA 1UPXA 1ISRA 2RJOA 5CDYA 4MS4A 1OA1A 1XLTA 2FGKA 2G3YA 4BO0A 4KQ1A 2DEUA 5JECA 2XHEA 4ISBA 3U62A 5JAHA 2ODAA 3V1YA 2MSKA 2BDTA 3VMFA 1ISPA 2FZCA 4Z0NA 1OAAA 1V11B 2QZJA 1JX6A 2JRCA 4PIPA 5FL7A 4FK8A 3MAAC 3ZDRA 2JEZA 4C3ZA 1M8JA 1MX9A 4LXQA 3WL8A 1ZQ1A 4BQOA 2E37A 4O4JA 2QE7A 1PJ2A 3BT7A 1UM9A 4Q34A 3LW8A 3BHIA 2XUHA 4E5NA 5TS3A 3PQCA 4LZWA 4O08A 5C1OA 5C18A 4R2IA 5AW9A 4BIMA 4H77A 1EHCA 2GZ1A 2YOFA 1XC7A 1NASA 2VPTA 3MTDA 3U1VA 1OBCA 2JZNA 4D2IA 4IDPA 3I92A 1WXHA 4KE9A 1I1NA 4NS4A 5DLQC 3RC9A 3N76A 1Y3IA 2C9MA 2AUMA 2JB9A 1Y9EA 4QGFA 2QN7A 3ROZA 5I7VA 2J45A 4RH3A 2YQ4A 3CEAA 2Z1DA 5L3ZA 1TLFA 1K75A 3EAFA 3QLUA 1QFSA 1SZCA 1R0CA 4N0DA 1J25A 2XNDD 2C4HA 5SY6A 3RYHB 3HPQA 3V2GA 3PRJA 5CDSA 1LBIA 4K1XA 3RRNA 1EBFA 4PFQA 4IAOA 3GPDG 4BQQA 3B1XA 3P0HA 3DM5A 4KJXA 3GEPA 3LY8A 1Z39A 2P9QA 1PD0A 2J32A 4WNAB 2J4DA 3DL0A 4MVWA 1CVLA 3YASA 2Q5LA 4I9UA 3MG9A 1EG7A 3DV0A 4HH1A 2MSEB 3WYFA 1EA5A 1E8NA 2VNSA 4NZPA 1QDUA 2JATA 4H1VA 3C39A 4RFLA 1ZGHA 3E0XA 1JR3E 3M1YA 4BNDA 2FFQA 5K3DA 2GCIA 1BYIA 2QG4A 4RD2A 4XDZA 1DIOB 4RZ3A 3HKEA 3E9NA 4RDIA 4RL6A 2I2AA 5E6UB 3OWHA 3TTTA 4M8LA 3CRMA 2HXYA 3WDMA 1OLXA 1VGQA 2LP4Y 1VDZA 2W43A 1F60A 4K9SA 2B2NA 2WMYA 2AQHA 4HNSA 3NWOA 4PSDA 3K0CC 5A5FA 3RFFA 2G17A 2REXB 2Y9PB 4UC0A 3P0JA 4LZJA 1XTBA 5EERA 1JW9B 2V9PA 1A2KC 1HWYA 1Z4JA 3MCTA 3T7JA 4C0HA 1DKMA 2Z5GA 3FYUA 4HUQB 3AY6A 3FAKA 4OQPA 1GUYA 1B1AA 1MN6A 2DZDA 2I29A 4I1IA 4MRAA 2V4UA 3R7DA 3WB2A 3X3HA 1JZTA 1MVNA 1RXSA 1NXTA 2HMVA 2XQVA 7YASA 2IEYA 3NC4A 5CJPA 1KY2A 2E4WA 3AFIA 3PQ6A 4U4AA 3IDOA 3T4PA 3AM5A 5DGDA 4Z4QA 3N2LA 2CL0X 1X7ZB 5IT0A 1G0OA 1W1UA 4XR4A 3WKDA 1WSBA 2L17A 1T8PA 5JW6A 3TNJA 3SYLA 1ADYA 4GWGA 3BC1A 5AJZA 4C0BA 1R7RA 3WWZA 2VG8A 3RC8A 3VHLB 3IQHX 5T3YA 3IEUA 4EEZA 4OQYA 2OTCA 1XDDA 2N9UA 2GETA 3DAPA 2GRAA 3TTWA 3HUDA 5HG0A 1WPRA 2OAEA 3O8BA 3OURA 4P3YA 4YRRA 3UZUA 3BBPA 4ZVVA 4C08A 2H8GA 5ICGA 4ND5A 2H6EA 4YCLA 2ZOSA 5BPHA 4DLBA 3WWPA 3IJEB 4BFTA 4Z3OA 1Y9JA 3A37A 3IAS1 4QL3A 2NO6A 2P1DA 4UM7A 4PBTA 4AT1A 1V4VA 2V3VA 4OHWA 3R3HA 3DCYA 1ECFA 1U3DA 4URXR 3V4PB 3L3BA 4RPHA 3W78A 1OKKA 4BQPA 2OQIA 1GFZA 1RXVA 1EK0A 4P83A 1Q7GA 4XKJA 1HFKA 3WNBA 4DDWA 4F2PA 1JFSA 1EXNA 2JLRA 2A9VA 1ODLA 5JDCC 3HVHA 3SHFA 4ZKDA 2O0HA 2Y99A 3EVBA 1BQEA 1LLDA 5IMBA 3B70A 1M2NA 2OC9A 3BA1A 3CIOA 4O1MA 1DX9A 1QO0A 3AU9A 1YOVB 3PUZA 4TTQA 2UZ0A 3SIWA 2UVPA 3A4MA 3VZDA 4M7OA 5LDGA 3ZU5A 3C3EA 4FSDA 3ZUGA 3C74A 1E2GA 4DMHA 2C3OA 2IYEA 1OYWA 3L40A 3LKDA 1FRZA 4HHEA 4MEBA 1F1BA 1XKTA 4P3OA 5AK3A 1GN8A 1OZHA 2M6LA 1KY5A 4RELA 1LEHA 1RNLA 2AWNA 2CDCA 3WL7A 3K9HA 2FPPB 2QYSA 3PXUA 4IZOA 5FPKA 2Q6OA 3Q88A 1E0JA 1VG9B 3E58A 1MB0A 3ML1A 3H99A 3KC2A 4DCNA 4L28A 1NJ8A 3TMKA 2RI0A 1CLUA 3NS7A 3F5SA 4EEXA 4MV7A 3R40A 1M0EA 2JFFA 2GZ2A 2YJNA 4Z1OA 3UWOA 3L7BA 3P2EA 3F3MA 4QUKA 4MS4B 1OF1A 1TD1A 4WZBA 4BV9A 4C1BA 5LQJA 4NCIA 1DDIA 3CRZA 2A9JA 2B5WA 4P22A 1K8QA 2NQTA 5CITA 5SY4A 4FT4A 1UXJA 4PFJA 2UYYA 4YCAA 1PZFA 4CR8A 4N41A 1I4WA 5K5EA 1IK4A 1J9GA 1K4YA 1I8TA 1SWVA 2B3TA 1R74A 3QXGA 4O4JB 3EWAA 5IVHA 4MARA 1SD1A 1D1TA 3FCEA 3IAS6 4O2AF 4QYTA 3GPIA 2GARA 1W0KD 2R6HA 4PHHA 3A4NA 5DNYB 4H08A 2CL5A 1C29B 2NSLA 3F97A 1II0A 4L8FA 2WD9A 4MV9A 4UMEA 3GT7A 3OBBA 4ZO9A 4MW5A 4JQZA 1DBVO 2GK4A 4Q7EA 1ISMA 2IWHA 1P2SA 3DV9A 5M04A 4OGFA 1TU3A 1SC3A 2PX3A 5EP2A 2I2WA 2R97A 3C24A 1EUCA 2I22A 1BVUA 4ZVTA 3LYHA 1Z7GA 3DZGA 4DM7A 1LDEA 1JJFA 2AZMA 3QBVA 4MP6A 2QGNA 4LV6A 2B4TO 4TMFA 3PFKA 1GV1A 4BQRA 1JQDA 2YOGA 1HFJA 5FL3A 8AT1A 1UUFA 1ZD4A 3JQFC 5HEKA 3AT1A 2AFVA 4I1YA 4TMVA 3VJLA 5KNLA 2AZXA 3UAGA 3DV0B 4DQXA 5TGDA 1ABBA 3MWDA 2FH5B 3D5EA 5L6LB 1TTTA 1WKBA 2I54A 4UARA 1VPWA 4G37A 2Q2NA 4I5EA 4BNDB 3HA7A 3FFTA 1YJCA 4CF4A 1XZCA 1TVEA 1JRLA 1TE2A 2VDRB 1BMFA 5B3JC 1KGSA 4OHXA 2FCRA 3HKEB 1UPCA 1ORDA 3WGKA 3KALA 2G7MC 1W19A 4JLSA 3K9NA 4M0UA 5J59A 1OLXB 3M89A 1ZO8A 2B61A 5LWHA 1CR2A 4DQLA 4U2KA 3F0TA 1TGVA 3H8WA 1A2BA 5I5GA 3CXRA 1IPHA 4MSUA 4ER3A 4LW8A 2QTWB 1VI2A 1NMZA 1MIOA 4JDUA 4M9XA 1ZI6A 3FYUB 3T9FA 4ESVA 4NLLA 1EP2B 5K6AA 5DGTA 1TO2E 4CL2A 2R6GA 3EIEA 4KCGA 4BZXA 4UJ3A 2BH2A 4G5XA 1P9WA 3JWHA 2QRQA 1M2KA 2PYDA 4TKUA 1OH6A 4FT2A 5J4KA 1H6AA 3N58A 3KETA 4EM6A 3MQFA 4L8LA 1ELOA 3IMFA 3NCHA 2PTHA 2G63A 1XF1A 4YPOA 3CPHA 4B79A 2EJBA 1NLYA 4QNMA 1U90A 2FVXA 2VQFB 1K7FB 4S3MA 4BUZA 1N7GA 5KDDA 4WWHA 2XKAA 4FQ8A 3Q8KA 3K16A 5KS2A 4F1WA 1K7XB 2VPIA 2GJ4A 3GRUA 5DNEA 1PKEA 1JR6A 4AG6A 3FZYA 3I30X 1VMEA 4P4SA 1TO6A 3PC8C 4EG7A 3AO0B 4MKZA 1CK4A 1L5MA 1ZXXA 2DWQA 4QA9A 4EF5A 1KEKA 3JZMA 4TYNA 1NP6A 5B6PA 4BV8A 1TVCA 2DBQA 1YCHA 1NVKA 2ON6A 3JU3A 4ES6A 4IS2A 5C3UA 4WBNB 4F72A 4N4AA 3FKQA 4TYMA 4TS4A 3OLQA 3O47A 4B0OA 8ATCA 1LJUA 2P8JA 1KC3A 4NTZA 2BTQB 5K8IA 3VOAA 2GEBA 4GC9A 1ZNWA 4YT8A 1D9XA 4DF3A 2SECE 4JC8A 4MKFA 3R8XA 4J3NA 3RPEA 3VC2A 2GVZC 2PD6A 4GX2A 4LE1A 1NQUA 1Z68A 2VHCA 4ZZIA 4WV3A 5IEBA 1X8XA 4BE9A 3THWB 1XPRA 4RD4A 5CX4A 3BH0A 2PLAA 3GGPA 2GD2A 3OJXA 4RVHA 5JZBA 1M8PA 4PLYA 1DJMA 5E1OA 2YIMA 2C83A 2Y67A 3FPJA 3GBPA 3MW8A 4LY9A 5IAEA 3HUUA 4ZGGA 4GOOD 4WH0A 5B1EA 1S1MA 1PJCA 1IBCA 1TT7A 1DBSA 4RXUA 1E2MA 2ZWVA 1Z3CA 2XNDA 4BBJA 4ZZ1A 4EHFA 3BWMA 2JHFA 4FXOA 1GQYA 3IR7A 3SJ7A 2GZDA 1C1XA 2UZIR 4R2LA 3B53X 5DASA 3QVSA 5J47A 3OZBA 3UH0A 1JQ3A 4WZBB 2GLUA 1NX6A 3ADBA 3WBKA 3AIKA 4Q03A 5DHQA 2VQEB 1V1MB 3OM8A 3GRCA 3RS7A 3NC1C 3EVTA 1MEEA 2HJSA 4DN6A 3KEGA 4C6HA 1FLNA 4TV8A 1RWMA 2GBLA 3RAGA 5EZ5A 4X62B 3U3RA 3C5HA 2HR1A 1HTBA 4FBLA 3E35A 4S2UA 4C4PA 1G2IA 1RXEA 4GR9A 4OSOA 3CUYA 2G4LA 3EZYA 4NRDA 4UU1A 1UINA 3VAYA 5LYJB 3HU1A 2JJ2D 4QXOA 1E3SA 1DEHA 4RD6A 1WPQA 2Z58A 4F5EA 5BO5A 4QTYA 4JBYA 1YXMA 5H8WA 1G5TA 2R25B 4IIJB 4MS3A 5E1DA 3OAAD 4LSMA 1EAYA 1TM3E 1UOEA 2DUUA 3D1LA 4XARA 1P77A 5A4MS 4ABTA 2E3JA 4AO8A 3NVDA 1BKYA 3A3PA 1EUCB 5KQRA 1AKEA 5A04A 3C8UA 3KHKA 1AHIA 1Z35A 4MMZB 3DULA 4IQFA 3R0QA 3WYDA 2OAP1 3R3UA 4C78A 2ZPUA 3DC2A 5K0GA 1XVTA 5F73A 4OHOA 3WLPA 1RQXA 1NWCA 1JNXX 2WPDD 4TTJA 4K8OA 3VTAA 3DH0A 4UBNA 3HYSA 5DXAA 5EXTA 3UXEA 1IY9A 1LDMA 3Q41A 5ADWA 4E2YA 2PZMA 1PP4A 3KEFA 2VRCD 2GPTA 1CJBA 3AF4A 3CT6A 3GL9A 4N6OA 3MWDB 3EDCA 3F4LA 3NKFA 4PGAA 4PW0A 1UPUA 3D8TA 3GLHE 1VL8A 3PYXA 4DRXA 1R3DA 4TLMB 4GPD1 5DLEA 1GVHA 5ESRA 3RTDA 4LYAA 4P80A 1XF9A 1INLA 4YQYA 3LBNA 1QK3A 1HNWB 1T5SA 4XVRA 2JAHA 5JH7A 2XTNA 2EDAA 3R7AA 2R8ZA 3BEOA 5AKEA 1K27A 2E48A 4LTDA 2FFBA 1DG1G 4XA8A 5CRIA 5DFAA 1OBOA 4KPFC 5KTSA 3A1TA 1NNUA 3FCXA 3GNTA 3EDRA 3KO8A 3HSYA 4RJ2A 1K3UB 1NE7A 2JJQA 3GUHA 3PRHA 4GVXA 1O5TA 1FJHA 4H7DA 1ARZA 1R8SA 2O3SA 1MIOB 4MULA 4RPGA 4FGWA 3T54A 1YS7A 2EG9A 2H17A 3NVMB 4NE9A 1C9MA 1JEEA 3EXEA 1IJFA 1TUBA 2AN1A 2GK3A 1V2GA 3BERA 3NJRA 4NV1A 4QVGA 5L7YA 3N6RA 3GPLA 1XPUA 4II3A 2JCGA 3AJ9A 4TKUB 3A7DA 1F0YA 1SIWA 2A5JA 2CZQA 2AUTA 5EYPB 3UPUA 3OHMA 5AD1A 3VM6A 4XYBA 2G06A 2QVZX 3AUUA 4NMWA 4GPEA 2WKQA 2FLVA 3V55A 4DHEA 4ZI7F 1KO1A 4OI4A 3E9ZA 1AMOA 3WQQA 4GFDA 3OQ1A 3PEWA 3IDFA 1AXRA 1UDCA 3MA0A 3NUQA 3EPJA 1P4RA 2ZDGA 1EVYA 2C07A 2RFLA 3CMMA 3WX0A 4LQDA 3W6OA 4XXHA 3WGTA 1YJAA 1SVWA 4C43A 1V9LA 1MQ9A 4P4SB 3WGIA 3SZUA 3AEXA 1GTVA 4HQLA 3QEKA 1JJVA 5DCYA 1CPYA 3WLQA 4ADSG