4UHJA

Crystal structure of the receiver domain of cpxr from e. coli (orthorhombic form)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
126
structure length
126
Chain Sequence
NKILLVDDDRELTSLLKELLEMEGFNVIVAHDGEQALDLLDDSIDLLLLDVMMPKKNGIDTLKALRQTHQTPVIMLTARGSELDRVLGLELGADDYLPKPFNDRELVARIRAILRRSHWSEQKLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATORY PROTEIN CPXR
publication title Structural Coupling between Autokinase and Phosphotransferase Reactions in a Bacterial Histidine Kinase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 48
structure length 126
sequence length 126
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4uhjA00
1GCGA 3QEMA 1PNRA 1GLGA 4N41A 1DCFA 3OO1A 1E2BA 1C4WA 4Y9TA 3LUDA 3O75A 1JHZA 1EFAA 3HS3A 1JBEA 4QYWA 3N8IA 4S05A 3O21A 3MM4A 4MR9A 3I45A 3GT7A 3N75A 1APBA 4G0MA 3RVRA 1CHNA 4XLTA 4RDCA 4NQRA 1W25A 2QXYA 4O1IA 3UKJA 3GBPA 1GUBA 5EWMB 1Z26A 3ILHA 3BREA 2FMFA 3FDFA 3L6UA 3OLZA 4LDAA 3UUGA 4YP9A 1ZAYA 3N53A 4DADA 1QP0A 5GQSA 1QQAA 4MR9B 2FXIA 1XHEA 4XASA 3RQIA 2F8TA 2IDMA 1LK0A 1RXEA 2PUCA 3KKEA 4Q6BA 1Z16A 3RVPA 4N03A 1QMPA 4MAAA 5JNWA 3GL9A 4Z4HA 2A9QA 4W5RA 2IPLA 1JF8A 4YO7A 4IRXA 3N0RA 1NXPA 2LBPA 3MYYA 1K66A 4DN6A 4IILA 3Q7TA 3MF4A 3A0UA 2N9UA 5IBQA 2HQBA 2M98A 2A9PA 4YLEA 3RVKA 3M9XA 4TLMB 5B3JC 3Q7SA 3OLVA 4ZMSA 4G0ZA 1LJLA 3HV2A 3VNBA 2PUGA 5EWJA 1EWTA 1ISRA 2GWRA 2H3HA 4RS3A 4P98A 1VPWA 3ROFA 1FSPA 4Z9BA 3EQ2A 3RVJA 3GV0A 2B1JA 4MR7A 4G0YA 1FFWA 2QW1A 3I5AA 4F8JA 1TJYA 1TMYA 2ZWMA 3O74A 4FE4A 4WXEA 5F64A 5BR1A 3GWGA 1DG9A 2B4AA 1DBWA 3DZDA 5IEBA 2ZAYA 5BRAA 4EVSA 3HDVA 5BQ3A 3IPAA 3SQNA 3GBVA 5EWJB 1E6LA 4E7OA 1URPA 2I6FA 1RZRD 2E4WA 3CU5A 3OMXA 1A0OA 3QELA 1JH9A 1KGSA 3T95A 3CS3A 1JDPA 1PHRA 2PL1A 3H5TA 2FQWA 4MQFA 4MR7B 3EULA 4RXMA 1DJMA 4RK0A 1GCAA 2IYNA 2RGYA 5C5CA 2IPMA 2FMHA 5JNUA 1T34A 5JNVA 4G86A 3F7NA 3URMA 4GNRA 5TQ2B 1E6KA 4YGXB 3QLUA 4ZPJA 4Z4GA 9ABPA 4N0QA 3NBMA 5HKOA 1KRXA 3RVLA 3OQOA 4Z4CA 3FFTA 1MB0A 3SG0A 1JX6A 1YS6A 2PUFA 3HO1A 1QNLA 3QELB 5CNIA 3OM1A 2IPNA 4YCSA 4MQFB 2MYTA 3IP6A 3HXMA 2A9RA 1L5ZA 3KSMA 4RWEA 1M5TA 2FTKE 1ZGGA 1M2FA 2A9OA 3CFYA 3RVSA 2NZVG 4LE1A 1CYEA 2IKSA 2CWDA 3TO5A 3FMVA 1D1QA 4HNRA 4OG2A 1ZDMA 1ZH4A 3M6MD 5B3JA 5TPWA 5KC9A 3C6QA 3DGEC 4G0QA 8ABPA 3HDGA 1Z18A 5TQJA 1RPJA 4QYMA 1JYFA 4KREA 3KCNA 4FE7A 3C3WA 5FWXA 2PMCA 5IC5A 3FFWA 1BVHA 3T8YA 2FN9A 3QX9A 4ETNA 3O2QB 3LUJA 3TB6A 1DCKA 1XHFA 1P8AA 3H5LA 2JB9A 4KPYA 4YS6A 5DGCA 5TPWB 4RK5A 1SXGA 5CHYA 1ZY2A 2E4VA 3O1IC 2MYUA 1D2AA 1YTUA 2BGGA 1FFSA 5IEJA 4PZ0A 1BAPA 3SNKA 3TX6A 1M5UA 4F12A 5DCLA 5JNRA 2OENG 5FWXB 1F51E 1AB5A 2E4YA 2FQYA 2MYPA 4F06A 4IF4A 1K68A 3ILYA 3FFXA 5EWLA 5TQ0A 1U8TA 5PNTA 2FEWB 1OXBB 4JASB 1E6MA 1BDHA 1Z15A 2FEKA 1NXWA 3QEMB 3EJWA 4EYOA 3N0WA 1YIOA 1YMVA 5KQGA 3CHYA 4LE0A 1QKKA 4H3HB 2AYXA 1TM2A 3JVIA 3IPCA 5IX8A 5TPZA 3IP7A 1ZGZA 2P4UA 1A04A 5CNMA 1JWLA 4W5QA 1DRKA 1DP4A 3DGFC 4OTZA 4NV3A 3JPWA 5KWSA 5EWLB 4H3KB 5D2CA 2CHEA 5TQ0B 1RNLA 1ZN2A 3Q15C 2HJ9A 3SAJA 1SXHA 3DLBA 4DQDA 2FSPA 2WJWA 4XXHA 3DLHA 3KYJB 1YK1A 2LP4Y 4RY0A 1JFTA 3NNSA 5KQMA 3EODA 3G85A 4W5OA 2M1ZA 7ABPA 5IUNC 2RJOA 4RK6A 2Q5CA 2VUHB 4W5TA 1RXIA 3LUFA 5GOTA 3EQZA 3TD9A 3H5IA 4MR8A 2NZUG 4IMIB 4H60A 3DBIA 3S99A 2X7XA 4UHKA 3MA0A 2RDMA 3LFTA 4N0PA 1QO0A 3HUTA 1YVUA 1ZESA 5IUJC 1YS7A 3LUCA 3JTEA 2FLWA 3JY6A 6CHYA 4JB2A 2VYCA 3A10A 1DBPA 1BDJA 3EGCA 4WT7A 1Z25A 2FMIA 1EWVA 3JVDA 3LMKA 1FQWA 4ETMA 4ZYLA 4MRMA 1F4VA 4MR8B 1JLKA 1NTRA 3MMNA 4KK4A 3HCWA 3Q7RA 1Y1LA 4FB4A 2JVIA 1LJUA 2GKGA 2VK2A 1R8JA 3KHTA 3KLOA 4GPAA 4KFCA 5KQPA 4G97A 2QVCA 4JB0A 3NHZA 3O2SB 1P2FA 3CG4A 3QLVC 4Q7EA 3LUAA 4PEVA 4D74A 1LBIA 3C97A 5FBKA 3QLTA 4EYQA 1NXXA 2V0NA 2E4UA 3JPYA 4MS3A 4MRMB 5CNKA 2NT4A 3BILA 3KJXA 2WRZA 4YR7A 2ID9A 3SM9A 1ZVVA 1ZH2A 3BRQA 3CTPA 3C3KA 1ABEA 1JL3A 3KTOA 4KMRA 3N0XA 4F11A 4EVQA 1PEYA 2FMKA 3CG0A 3GA5A 1EHCA 1JYEA 1SXIA 3O1HB 3N6VA 3NNNA 4MS3B 2LUOA 5JNTA 5KQLA 2P9HA 2PAFA 3KYIB 2XDYA 4F3TA 5KC8A 4RV5A 1XWWA 1KMIY 2JVJA 4RK1A 2TMYA 1UDRA 1DZ3A 4MQEA 1JFVA 4MS1A 5TE9A 5JNSA 1VKRA 1U0SY 4EVRA 1EAYA 5JS2A 3OQMA 5BRJA 4RU1A 3EAFA 4XAQA 2LIVA 2NUBA 4TN5A 4Z99A 3HUUA 2GBPA 4P1ZA 2PL9A 4MS4A 2F8SA 4OLAA 1W9HA 5FWYA 1PEAA 2L17A 1FFGA 3CNBA 4LE2A 4MS1B 1MIHA 4MQEB 4QPJC 1QPZA 1USGA 3F6PA 3NHMA 4KK3A 4LZLA 4PICA 3D8UA 1Z12A 2FLKA 3HZHA 1C0EA 3HVRA 2YHBA 1GUDA 4YWHA 5TPZD 3CKMA 3QLVA 2LPMA 3T6KA 3OM0A 5E3JA 1ABFA 2IOYA 3H5VA 3LKVA 2L19A 3LTEA 2WJAA 3CRNA 4HYEA 4MS4B 4QICA 2PLNA 2AYZA 5FWYB 4EY3A 4MGEA 2WMYA 4OATA 2MSLA 2KYRA 3HM9A 5IUKC 3KS9A 1YK0A 3LUHA 4RY9A 1WETA 3H1EA 4G0XA 2L18A 1Z13A 5EWMA 1JFSA 1U2PA 3JS5A 3LOPA 4JOQA 4RKRA 2PJUA 2WWVD 2QV0A 1U2QA 4IGAA 4RXUA 1TLFA 3H75A 3SY8A 2IPAB 3P9YA 4LRQA 3ROTA 1DRJA 1P6UA 4N76A 5DLEA 3RVOA 1PUXA 3Q9SA 2QSJA 5HQJA 1ISSA 4XFKA 1QO0D 4G0OA 3OLXA 4PE5B 4ZMRA 2PKXA 5ED4A 3TMYA 4G0PA 1A2OA 4JP1A 2HQRA 2GI4A 1NATA 2QU7A 4MLDA 2O20A 1Z17A 3A3KA 4D6XA 4EYKA 4TMYA 2RJNA 2DRIA 2PUEA 2CD7A 2JVKA 4RXTA 2E4ZA 4OBBA 3H6HA 5IULC 2FVYA 1S8NA 2VUIB 3H6GA 2FQXA 3QLUC 5I4CA 3LKBA 4MYRA 1QQBA 1Z2DA 4B09A 4RKQA 1IIBA 2MSWA 3VNAA 4TLLB 2FN8A 2FW0A 3IP9A 5T7BA 1MVOA 2JRLA 3QEKA 3RH0A 3BRSA 1NXTA 2GX6A 4OLBA 4WUTA 3HEBA 3I09A 3FGZA 5KI6A 4KRFA 1M2EA 1BA2A 4KVFA 2JBAA 3HSYA 3C3MA 1J56A 3LUGA 4HNSA 4NICA 4Z0NA 4LX8A 2CHFA 3H1GA 4Z9AA 4RY8A 3HK2A 3CLKA 1NXSA 2HQOA 4KZKA 2W42A 4D6YA 2HSGA 2PE5A 4M88A 4MLCA 2J48A 3D02A 2OQRA 3CZ5A 4RK4A 3RVNA 3F73A 4L4UA 2WB4A 3K9CA 4XARA 5CNJA 4UHJA 2FKAA 4O1HA 5HSGA 1D5WA 4Z4FA 1L5YA 4KQ9A 2WY2D 4N47A 1QP7A 1NXOA 1ZHHA 4Z4EA 1JDNA 2JK1A 2L2QA 2R48A 3IP5A 5T3YA 4JA2A 3RVQA 2JBAB 5DTEA 4YRZA 2R25B 3A0RB 1CEYA 3OO0A 1KRWA 2FEPA 3OLYA 1ZITA 4ZJPA 1DCMA 4YV7A 5TQ2A 4Q6WA 3GYBA 3KG2A 1LBHA 3L49A 4JAVC 3QX8A 4ETIA 1B00A 1MAVA 1PNTA 1USKA 1OXKB 2R4QA 3NNDA 3MQ4A 4KNYA 2QZJA 3OQNA 1SRRA 2PUDA 3GRCA 1VRVA 4HNQA 4KV7A 1D4ZA 4Z4IA 3UK0A 3Q41A 2QVGA 1QP4A 4CBVA 2JCGA 1SD5A 3H5OA 1Z2EA 1EWKA 3MIZA 1NY5A 4PYRA 2H0AA 2R47A 5C5EA 1RZRA 4NCAA 3OLWA 1I3CA 4WZZA 3O1JC 3O2JA 3B2NA 3M9WA 4E7PA 1D1PA 1NXVA 3HJFA 5FBHA 1MB3A 3I42A 1U04A 4RSMA 3T38A 1USIA 4IMJB 3KLNA 2NT3A 4EYGA 3F6CA 1H9CA 3RVMA 4WXMA 4RK7A 3W9SA 1P6QA 1DC8A 4MPTA 4W5NA 5DKFA 3K4HA 1AB6A 2MSKA 6ABPA 1TVMA 2YHAA 3H1FA 1YMUA 4O5AA 1VLZA 3E61A 4S04A 2HPHA 3LUKA 4L85A 4NCBA 4EGSA 3H5WA 1BDIA 3R0JA 4KQCA 4LDZA 4ML3A 4WWHA 3BBLA 4EUKA 2PUBA 5HM6A 3CZCA 3G1WA 1HEYA 2PUAA 5JS1A 3E3MA 2ID7A 3EDCA 2E4XA 1DBQA 3OMWA 3IDOA 5ABPA 4RZSA 1DC7A 3QK7A 2MYNA 2QR3A
chains in the Genus database with same CATH superfamily
4ARVA 1CQJA 1TO1E 1ZD3A 3UTCA 4NPCA 3LGXA 1NUUA 4DWWA 1PKEA 2ZYAA 3BWYA 2ZXUA 4N41A 1X80A 3BYZA 1TT5B 3D3NA 5H02A 2HPAA 4UFNA 1OGYA 2FV8A 3QKUA 3WG9A 3J80A 2YWJA 4JNCA 3PC2A 4BMSA 2O5VA 3H3JA 4I1PA 2J7KA 3LBYA 3TM4A 3DMTA 4CVNA 1W25A 5B6JA 1LI5A 1WX1A 1Y1SA 3HBNA 1TPZA 4FZVA 3EEYA 1PFUA 1UM9A 2DECA 1R6XA 3VTAA 4LHEA 4YCLA 4BU0A 1OI7A 3K6SB 2YOHA 4CMGA 4YV1A 4PGAA 2PY6A 5EHQA 3L6UA 1JFFB 3H2HA 4LDAA 1MRNA 3X1WA 2EWWA 3U40A 5AHRA 1RACA 3IMEA 4Y7DA 3SX2A 4MR9B 2HSWA 2WJVA 2ZTVA 4DLWA 3KQKA 2J6IA 5DPMA 4K0KB 4NE2A 2PFGA 3QNMA 4MAAA 2RK6A 3O3CA 4C6SA 3ETDA 1QOQB 2A9QA 4QXMA 1L5SA 2VR1A 1WB9A 3UK2A 1JQKA 4U1RA 1XR3A 4YO7A 4XI9A 5EQDA 2VXOA 2GJ8A 4EMTA 4DN6A 1PTKA 1G8HA 5B4UA 4HGPA 1W44A 4X8LA 5FPQA 2UZ1B 1H66A 4HAOA 4IILA 1GJRA 4GE3A 3NEAA 3Q7TA 4M1EA 4DZRA 3JQDA 5HUJA 2O5CA 4RQBA 5IBQA 1XD2A 1AQJA 3EGOA 1H6CA 3VZPA 3D4OA 5C7OO 4DG5A 2JHFA 1GZHB 3MBKA 3WFJA 4UTOA 1K88A 3K2QA 4KR2A 1NBMD 2D8MA 1Y5NA 2A30A 2IXTA 3OQPA 3HO8A 5IC6A 3CH4B 2WBLC 3NCHA 1G5RA 2XA1A 1EWYA 1UBTS 3FRJA 3WQSB 4EL5A 4OB6A 3OJLA 5CLHA 5DHTA 1XZJA 3PUJA 1Z4PX 3P2EA 3ZE6A 3MN1A 2BMWA 4MWZA 3GV0A 3H8WA 5DFAA 1UL1X 2K6GA 1QO9A 1R74A 5JCJA 2DQSA 2W4QA 1YIAA 2RHDA 4I4CA 5IF3A 1VPVA 1ZVKA 1SKUA 2AUTA 4Y6OA 3VPDA 4LYDA 1AA6A 1T9AA 4EW6A 4WEQA 1PFYA 3PNKA 2XT9A 3H11A 3KXIA 3MHTA 4KLCA 3MERA 1JH9A 3ZZ1A 1TGYA 2WJPA 3HE3A 1NJ8A 1H2HA 2J6BA 2GEBA 2XHEA 3LPCA 3OT4A 2GASA 2QORA 4FKZA 1DG3A 2HCFA 1GAQA 2BY4A 4LZZA 2CCGA 5LXTF 1SVLA 2X40A 3CCFA 3MTBA 2XNCA 2XYVA 1J20A 4QBKA 3VHRA 2C07A 4QUHA 4BC0A 1G5PA 1XWFA 3VPAA 3BSFA 2PBLA 2W2KA 4G86A 4TZ6A 4QUEA 3OIUA 4XIIA 1R37A 4Z4GA 2RHLA 5ALWA 4DJ5X 4RWZA 1SXPA 5B12A 1LDMA 1XDGA 3E5MA 1IU9A 1ZX1A 1GGNA 1W49A 1W2HA 2ZYTX 3EQ9A 3IDQA 2ZANA 3QQ5A 3UJBA 5KNDH 2PUFA 3OCVA 5ECYA 3ESXA 2K7FA 1G64A 4IDCA 3AJEA 3WP0A 1L7BA 2XA2A 5ICMA 2IEYA 4QNMA 1NLUA 2VNJA 2QUJA 4RYLA 1H3NA 3QFHA 3NOOA 4O2AF 4O2BF 4WFIA 5FLYA 1NRXA 2Q9CA 3U44B 3CMCO 2I4RA 2D2IA 4NS4A 2ZREA 3ESDA 4EI2A 1QDEA 2X15A 5DNAA 1MZVA 1G5QA 5K3DA 4C5CA 1F2UA 3N6RA 1J23A 5FUVA 1L4MA 1VIYA 3FCEA 3MS2A 4IZ6A 2AX3A 3I2GA 1T9CA 5J4LA 3MINA 2C2MA 2G9RA 3BDIA 3GAAA 4FE7A 5TARA 1N1GA 2XB2A 3F5FA 1LA2A 3MJTA 3O8QB 1RCFA 5IDYA 2VAMA 1NJ6A 4AZ3B 4CMEC 2AF4C 2QT9A 3DL4A 1QIGA 2FQQA 3R4CA 5AI0A 1BC5A 5DCYA 2YZGA 3S6JA 3SYMA 3L8YA 2IV2X 1C8BA 2R6FA 3BMQB 4DWOA 4U9HS 1Z47A 2G4LA 1E3EA 1CZUA 2G7ZA 2P2YA 4OAOA 3TZEA 1QCZA 3BMXA 4QGHA 3NFRA 3DLIA 4OL9A 4D57A 5A62A 3AUUA 1S6YA 4AZWA 3ZHRA 2VNAA 1BKSB 3TDNA 1TK9A 2OBXA 3PTAA 6GPBA 2GNOA 1K4YA 2UYCA 2EFEB 4FR5A 2B2CA 3NPAA 2EJUA 2VNIA 4IKEA 5DLDA 5CB6A 4HJRA 3PYXA 5D7NA 5HMLA 1Z4NA 2Z3ZA 2ZE6A 2ZRKA 3HU2A 5DRTA 3OBBA 3WLLA 1C4OA 4BMVA 1M0WA 3HABA 3KV1A 4RMNA 3V33A 1J07A 2X4DA 1TM2A 3FYSA 4FEAA 4E5UA 3O73A 3C74A 5FJJA 3JQ9C 1SXJE 1OWPA 2QRZA 4GBGA 4Z6KA 1UP7A 2WNSA 2P4UA 5KVVA 2D1QA 2QG6A 1TZ2A 1XEXA 1H8ED 3DUFA 3K0SA 3BMCB 5CGZA 5G40A 2CXSA 3RK1A 4JOCA 2FF5A 1E3IA 1ZN2A 3EMVA 4YTEA 1KMQA 3W9UA 3Q8MA 5EFOA 1JT2A 3BRWA 2DWQA 5H5JA 3G88A 3PZRA 4UDYX 4KFUA 5EP3A 2BIFA 1V1MA 1ISPA 2YN2A 2YYAA 1E89A 3ELUA 3R9KA 4G63A 3EZ2A 1T5IA 4NU6A 3LY5A 1DQPA 3ZGNA 2J3LA 4YX9A 2YS7A 3WL5A 4IDOA 2Q5CA 2Y2VA 3CF2A 1ZJZA 4QYSA 3GLGB 4MV4A 1OTYA 4D8XA 3VOBA 4N5LA 3Q3HA 1P3JA 5TC4A 4U2FA 2ZULA 1L4FA 5AJHA 3V97A 1XCMA 2RDMA 5ELLA 3W7AA 3LPAA 1NNLA 2XNSA 3ROKA 3UUWA 3VPBA 4ENWA 2D7DA 1WXDA 3R5XA 4ZZ0A 5SYMA 4CU2A 1HO3A 1M1YE 3DTVB 2RCNA 3M6UA 4XCXA 3E7WA 4ZC1A 1LFDB 9MHTA 4JUCA 2I76A 2ZU6A 1OIXA 1UDBA 3GJTA 1D6SA 4KDFA 3IL2A 1O6GA 2ZR7A 1F4VA 4TYNA 1Z5UA 3UXYA 3BCRA 4H15A 5ALEA 3QGMA 1RE0A 3WWYA 1JEOA 3IXMA 4JYPA 3LLVA 1GTJ1 1LSUA 1QIMA 1I4TD 2Y4NA 4JYZA 2B4YA 3RROA 2DFKB 3STYA 2WOOA 3H4MA 4KFCA 3DBLB 3Q3JB 5IS2A 4P3YA 1YOBA 1Q2XA 1KY5A 3D6VA 2WFAA 3FCYA 1T8UA 2R8PA 1UT5A 3PDJA 3DBHB 4BEVA 2W2OA 5FBKA 3QLTA 3JQ9A 1JG6A 4PZUA 4B6SA 3OY2A 1Y1PA 4QPZA 4KWEA 4NABA 4OLFA 3OJXA 3QUQA 4HR7A 2XF2A 3GI1A 3SM9A 2WJIA 4PSKA 4GPZA 4S1PA 2ZRIA 4FFNA 3C3KA 2REQB 1JL3A 4J0QA 1ULZA 1C2YA 3O8NA 4M8IA 2W6IA 4ZA2A 3U0VA 2DEUA 2CWWA 3NWBA 3LRTA 1WHSA 4KIGA 5C35A 4C6HA 2DHEA 1MB9A 4MS3B 4OREX 1VJ0A 1C9NA 4NDNE 3FSGD 3W34A 4GYWA 3PNBA 5LZ8A 1ISJA 5DB4A 1JXMA 2QQFA 2ZAMA 1UT8A 2GNAA 5HBRA 4RK1A 3PQFA 2Y27A 3PF8A 4FYJA 4WCFA 4BNLA 3KUXA 2Z9DA 1YWGO 2DLDA 4O63O 2XKKA 4MS1A 4FZJA 4PZCA 2RB4A 3D4LA 1JIIA 2W6QA 2HDOA 1PGQA 3L7OA 3Q85A 5LM3A 3V1LA 2DR2A 2B8WA 4XAQA 3G0HA 1FP2A 1Q7GA 2DG2A 2XT6A 3ORYA 3PEWA 2O2DA 4IVNA 5C53B 4URXR 1JIXA 1MV8A 1HTBA 2JCXA 3M4JA 3VZBA 2B7CA 1QVVA 3N3AC 2ZBGA 4I6EA 3TIFA 3AY0A 4E5VA 5CB4A 3AHHA 3PL1A 2VDOB 3KNZA 1M1XB 1ULUA 2QL5A 3AP1A 4QG7A 3UB3A 4HEA1 3Q10A 1E6WA 1W88B 4TL9A 3F6PA 5F1KA 3GXBA 1BX3A 2JGKA 5L53A 1HEUA 1U81A 1DQYA 4FLMA 1I0LA 2VHZA 4PICA 2XNKA 2G8NA 3KDAA 4YWHA 1C1XA 3EE6A 4LCJA 4ID3A 4PX5A 3KJZA 1MT3A 5J5AA 1KDYA 5LUAA 1ABFA 3VYUB 1GEGA 4MS4B 3R9WA 2ZJYA 3C1OA 3SHWA 2Z95A 3OFVA 3KP1A 4WI1A 4WZBE 4RTJA 1K5GA 1RWXA 3DOCA 3O8BA 2KYRA 4JBXA 4KI0A 4CUZA 4K8OA 1AK1A 2B3DA 1XL1A 3NWJA 4L4ZA 4YHBA 2X2PA 5IUKC 2B7LA 2DETA 1EFHA 3A9RA 1O9BA 4HNHA 4ZALA 5K5EA 3RK0A 3THSA 3NHRA 4FYKA 2XMRA 1JZTA 1X7YB 2I7VA 4RJIA 1U2QA 4D99A 1U0HC 4KQFA 1KH1A 2LCIA 3JD4A 4Y30A 4EG3A 4R71A 5M04A 3CW2A 1B1CA 1BD3A 3V4RA 1TT7A 4HDNA 1WVIA 2JI6A 2IHNA 4Q24A 2P9CA 3LKZA 3FOCA 5TQVA 5IJ0A 5BSUA 3F0TA 3FDZB 1WXFA 2EP5A 4UHHA 4ZMRA 2I91A 1J8VA 1DEKA 2RK4A 4H17A 4L5AA 2YFYA 4L95C 1I3KA 2AFHE 3E7XA 1GAXA 4JR0A 2YJ4A 4KJXA 2BMAA 4QUKA 4D79A 5JSZA 2XZLA 4ZKDA 4QBIA 1CDZA 3ZDYB 2IBMA 4OBBA 2XRMA 1JVBA 3HXOA 2I4MA 2NVUA 1JECA 1ATZA 4IJWA 1QG0A 4ZAYA 1FMFA 4MVJA 3MCVA 4UUAA 1EDOA 2FN8A 1P9WA 4MCJA 4NZZA 5DLYA 1N0UA 2VDNB 4KBGA 3H6KA 4NG5A 1KJQA 2BDTA 3DZCA 2HRZA 2QX6A 5JSQA 2JJ1D 3W1VA 3OE7D 4RVFA 4CG0A 3BKXA 1M83A 2V1XA 4EKIA 1DC3A 1ZN8A 1J56A 2AE2A 2GMWA 3LUGA 3AIIA 4PLGA 3S2FA 4LXGA 4B32A 1JJFA 1QGYA 2CVOA 4RY8A 5DWDA 4FTWA 1Q0ZA 2ZE5A 4IAOA 4ZI7B 1T1SA 1ZJJA 3FWYA 3PU6A 4G5SA 2VXBA 3EVFA 4M88A 6PFKA 3D02A 1RXUA 2P4EA 2ZS8A 4I1SA 1B41A 4AMBA 3HTXA 1QWOA 3HP7A 1CDEA 1GPYA 1L5YA 1QB7A 5HX7A 1Y8QA 2PTHA 3PDWA 1E1KA 1K0FA 4ZAGA 3PJRA 3GLFE 2BM9A 3OZAA 1XSEA 1P1JA 1PNQA 4ONEA 4JLWA 2WWHA 3F5DA 4RHTA 4JMLA 3J7TA 5C5DA 1FC0A 1PT6A 2JC3A 1SA0B 1YBVA 2VK4A 2QX9A 3PFBA 4OBWA 1MW9X 4ZVLA 3B5EA 3TDMA 1AVTA 1F5NA 2VUSA 1SOUA 3EG9B 5F52A 5DGDA 2RH8A 5TGZA 1Q0PA 3BQMB 4KLAA 3W0LB 2ZBPA 4ER5A 1XLUA 4TT3D 2QDKA 4FU0A 1D09A 1KAHA 1VRVA 1YHNA 2JKYA 4HNQA 1J2JA 1JA0A 4FEGA 1N3YA 3R3HA 4LJ8A 2X41A 1R5OA 4RPGA 1DKUA 2H2GA 2P3SA 4L8VA 2UZAA 2X23A 4U2BA 1R0LA 1GFZA 2G08A 4ZI2A 2G4CA 4YAIA 3P0HA 4LCEA 4PYRA 5H0IA 2YRFA 3CH7A 3ELYA 2H0AA 5C7IO 5C5EA 1EDZA 4FILA 5J2UA 3MD9A 1QC5A 2EKLA 3BK7A 3LNCA 1NUHA 1VJGA 1T0PA 4REQA 3VH2A 5B3KA 3FOEC 4U6SA 1ZD2P 5FBHA 4XD7D 2Q62A 2WMOB 1CUIA 2Q28A 4NE7A 5DK6A 1K1EA 3DMDA 3GH1A 5K0NA 3UFXB 1ETHA 4BATA 3KSAC 2E89A 3F6CA 4JI3B 4ILKA 1H0SA 3JSXA 3QU2A 1ODIA 2XA9A 1FBTA 3FB1A 4CF3A 2GZ2A 3ZTWA 4XH9B 4MYCA 2Q8NA 3K4HA 1P61B 4A73A 2IDKA 3QFCA 3EHDA 3SBXA 4DW8A 2VXCA 4UASA 2A88A 3ND7A 2CUNA 3SR4A 3G2QA 4DA8A 5C8ZA 1P4GA 4TYWA 1OR8A 4B47A 4MUHA 4YQYA 1BGXT 4ME6A 1TLLA 1G42A 2OXFA 4HP8A 4OOEA 1OBCA 1JKXA 1HEYA 3GEIA 3UMVA 1V3QE 1FU7A 3ZY4A 3BS4A 3F8SA 5NLLA 1GPKA 2PBRA 4Q82A 4PBTA 3JVEA 1QRTA 1XG5A 1V1RB 4EUEA 2WINI 2DBRA 1FS4A 1K8ZB 2G0NA 3BWCA 1U3FA 3FJOA 4KGDA 3SLRA 5E1OA 3TZ6A 1BJKA 2D1SA 3M3HA 4ZAFA 1DEOA 2XCSB 1QTIA 2YJNA 1E2BA 1N5LA 5C1OA 2QE7D 5IYZA 4BJ6A 2HXSA 2WG1A 4KXWA 1ZAKA 3HS3A 4JGIA 4CF7A 1JBEA 2CF5A 1RXCA 1FPQA 1IWPB 3E0XA 1HI9A 2TMGA 2YICA 3C5EA 4G0MA 4Y98A 5EMLA 1KYWA 2GPBA 3S2YA 3QYPA 2IE0A 5HTKA 4NFHA 3MWGA 4K05A 1NQVA 3VGPA 1Y5RA 5IAGA 4AG6A 5KX5F 2X2OA 3FHJA 3LG2A 1XD8A 4UEKA 3O5AA 3DZGA 3DMYA 4RHYA 1BMQA 3RTGA 3BREA 3B82A 3K35A 1E5LA 2BVNA 1IQ0A 2LVBA 3BERA 1RZVA 4I1IA 4P8RA 2HGZA 5F7XA 1AZTA 2HSDA 2QAGB 4U8GA 3WB0A 4RA6A 3HJAA 4PS0A 3SFZA 6LDHA 3GJ0A 2XKAA 3VSCA 4REOA 4X3OA 4F97A 1OVGA 4O6VA 1R0XA 4YYEA 1QSGA 4CUKA 2WG0A 5A4DA 2QMZA 5A0VA 4MH0R 1SMKA 2JZNA 4C4XA 2GF0A 4L3WA 4CU5A 4W5RA 3EEIA 2YUTA 1L1FA 3TSWA 5FH9A 2C97A 3K1AA 2V7UA 4CL0A 4HZUB 3PQ7A 1AK9A 1JG1A 2COEA 2ZJ2A 1T5LA 4HDKB 3GEDA 4CLOB 1FU8A 5IM5A 1GUFA 5HRCA 1TTQB 4F0JA 4YDHB 2ODNA 2DWCA 4LI3X 3GJ8A 2WABA 3M1LA 5AVVA 2FSGA 1LJLA 4F9FA 2XOXA 5E4JA 1E58A 1F60A 3SZ3A 1SB8A 3ER6A 2ZYRA 4R1SA 1JFRA 2VWPA 10MHA 2HREA 2H3HA 2VJMA 3JVUA 4KQIA 1MAAA 3AH8A 1PV1A 3ROFA 1FSPA 4PZLA 3AO0B 4PXAA 3RUIA 1A82A 1SVNA 2IYQA 1GPWB 2NV2B 1UZUA 2PLAA 3UC5A 3CT6A 1TJYA 3UXHA 4YXWA 2CXOA 2C0QA 2CFCA 3B9RA 4XVRA 1PJ8A 1NC1A 3ND5A 1Z5VA 5CAEA 1X8LA 2GEUA 1NNEA 2ZAYA 2WV9A 4EVSA 2WMDA 5BQ3A 1TMGE 3DULA 4BPRA 4E7OA 4OH1A 1II0A 4H0NA 3RYCA 1BYUA 3JQGB 4IQ8A 2F90A 3OMXA 4DDMA 1XZCA 2G9QA 2GCIA 1OBHA 4GI7A 4GMDA 3HLKA 1TC2A 2FQWA 2R66A 1RZ3A 1FMTA 3EIXA 1YJ5A 1IONA 1QAQA 4M6WA 2IZ1A 3CH5A 2FMHA 4XM2A 4EHLA 3A2KA 1O7JA 3GRYA 3JTMA 1P17A 1Z6AA 2CBZA 4QJBA 3ZGVA 4EUHA 1U8UA 2Y3IA 3LC2O 4JH0A 2GT1A 4MA0A 4YGXB 4LNUB 1IATA 3OZFA 3CC8A 2O3RA 2IY8A 1UWCA 1Z0DA 3EWNA 3PC7A 4G07A 3PUVA 4MYHA 2J5QA 3TG8A 1E59A 2G1KA 1YS6A 2CK3D 1JIQA 1ZH8A 1SQ0A 2FWMX 2VP9A 5CNIA 1LPNA 1YH3A 4TZKA 1E9CA 1PZNA 3HVKA 4MQFB 1HBJA 2JJQA 1U9IC 3EQ7A 5GV7A 1U8ZA 3FTCA 4PBSA 2JIQA 1XJ5A 1M5TA 1YS9A 1MT0A 2Q0SA 5ALVA 1J1UA 2JPDA 2UVQA 3GRZA 3CZ4A 3UT5A 3TRIA 5ADWA 2WIAA 4UDXX 2GZDA 4MWGA 4N7MA 3RT9A 3ZX5A 4DNFA 4B17A 3M6MD 5DYTA 1YDHA 1ORRA 2ZRCA 2H00A 3NHAA 4FJ0A 4G0QA 4EA8A 4EM6A 4WGGA 3TK1A 1W5FA 3HI4A 3DKIA 4UBJA 1G21B 2XMZA 3PDUA 4RFSA 4XFJA 1NVVR 4PTZA 3DWIA 2OBNA 3GEGA 3E2MA 1G19A 1LLDA 4GYKA 4Y6QA 5EPUA 1KKMA 3P8ZA 2OAEA 2GPYA 3T8YA 1IN6A 3OJOA 2VC2B 1ZLXA 1LD3A 1DCKA 4G37A 2OQ2A 2ZB7A 3ETHA 4KLRA 4KPYA 1ND5A 4V02A 5DMXA 3KOXA 2Q8PA 5JAHA 1IHYA 2MYUA 1TF2A 1WZCA 3FAZA 4MV7A 1YRWA 4MKRA 5IEJA 4HBGA 4N8DA 1NV9A 1QF9A 4FMPA 1XKLA 4DC0A 3EEOA 2HRBA 4EY7A 2AEMA 1SC6A 2XKJE 1T13A 3M0EA 4FVTA 4LOKA 2ZB3A 1JIKA 4Q02A 1WDKA 2QRUA 2FZLA 1XMXA 5C51B 1N2HA 3HFJA 1X87A 3ILYA 1KTIA 3ESCA 1T3SA 1RWOA 5CJ2A 4J2TA 3SKXA 4UEWA 1N2GA 2B1RA 1E6MA 4L6IA 3LCUA 3OT1B 5DI3A 5L7WA 4IXWA 2J8ZA 2FEKA 2JHGA 3FVQA 2Y0PA 2WAYA 1IJBA 2YIDA 2XWPA 4IY1A 2POQX 1U0GA 4WACA 3DAGA 4XB1A 4P3OA 5ELXA 4INPA 3I0ZA 4NOJA 4OQXA 3QXSA 4WBNB 3VTZA 3M82A 4V0SA 1KIAA 5CNMA 2W6ZA 3OLCX 1U9IA 4CV3A 1PQ4A 4KQKA 2IYSA 4BU1A 1NY6A 1T8WA 1AHNA 1Z9BA 5EWLB 1XRMA 3ZDXB 4CMIB 2GGSA 3SQOA 1G3RA 1WMFA 3BJIC 3PCTA 4IDDA 4IH4A 5LBIA 1SBZA 3RRNA 3DLHA 2QZSA 5IFLA 2I6TA 3CH6A 2C83A 2DUMA 3KELA 3AGPA 4OMUA 5KQMA 2FPLA 1JIUA 3OQIB 2OILA 1RQXA 1P2UA 1BVYF 4NOLA 3UWOA 2QSZA 4X63A 3LHDA 2E55A 4WLVA 3S99A 4UHKA 1XZHA 1UBOS 3L82B 3GPCA 2IOFA 1M0TA 2QN8A 1ZESA 1P18A 2CXRA 3H4TA 4LHSA 3GX1A 4U3JA 3QPWA 6CHYA 3U39A 3A10A 3ODGA 3QVXA 5LVAA 4YT4A 3ZGYA 3MVEA 1K2VN 2ZCJA 2O2XA 2WT4A 1Z25A 1FP6A 1IXSB 5AK6A 3VUFA 4XWKA 2GVNA 3D6NB 3FMIA 3I2FA 4JJIA 5JHGB 2GZAA 1F8YA 1L4HA 1M1NA 1P7PA 5FA8A 4R41A 3T12A 3V6MA 4DSOA 2YWDA 2Z1DA 1KDVA 5B1EA 5IAAA 4ND2A 2J6HA 4FDLA 3JV7A 3INYA 5E7JA 3KT3A 1EZZA 4RLSA 2OCDA 3KFVA 1JMKC 2HIMA 1YVPA 3L18A 5A3VA 2RJ3A 4A8HA 1FQKA 4GKAA 5J63A 2RHTA 1X15A 2HJVA 3H2JA 4L0CA 5LDHA 1IVSA 1N6RA 3PNOA 4AX8A 1DCTA 1U6JA 3WGHA 3P9CA 1IN1A 1YVDA 2C4NA 2QTWB 4DUPA 1W0JD 2HNAA 2A8YA 2R1TA 1KI7A 1PLJA 3HJUA 2VSNA 4J0EA 5FCDA 5M2QA 2AR9A 4FM9A 1Z37A 5I4IA 1E8MA 1VPLA 2JGAA 5T4FA 4HNTA 1JHRA 2WHXA 5JZ9A 1ZNYA 1U4SA 1Y9EA 2A78A 1I13A 4HQNA 1MAHA 3IPXA 3TOVA 3OU6A 2H48A 4MB2A 4I5DA 5BSRA 1LUAA 1T5HX 5AOAA 1KI2A 2G40A 4EJ6A 1FY2A 1GKUB 3ZXYA 1CK4A 4P0TA 3WLJA 4DQKA 3CRZA 1Q11A 2ODBA 3N28A 4QGSA 3NNNA 2DTXA 2AUNA 4OYRA 1MX3A 2QUZA 4O4HA 4OUDA 1AXRA 1RPTA 3DJFA 3QZUA 4XWOA 2NV6A 1WSWA 1A8QA 2ILVA 3N2GA 4Z9YA 3ON5A 4ZYUA 1FIUA 2Z2IA 3MRSA 3U0BA 4F86A 4RTRA 3HO6A 3IVAA 1RAGA 3AF5A 5JNSA 2Z2ZA 1PJBA 1U8EA 2Q3MA 2YN0A 4XYEA 4Y2QA 3RYHA 3KYBA 1YDWA 3WL7A 1YFJA 1J09A 4CTKA 5JCXA 5BRJA 1RYBA 2NNWB 3V8QA 4O4LA 1MQSA 1PJQA 4MKHA 5E9JA 2JGNA 4G5OA 3N2IA 2GXAA 4KE7A 5G1NA 3CBQA 1XZLA 5ADUS 2C9CA 1K5PA 1UJ5A 1IXYA 1UOQA 3GCWA 2VAPA 2G72A 2UUPA 1IEVA 3R3UA 2HF9A 4LC9A 2HHHB 1U0BB 4A0GA 4QOSA 5C18A 2ZYWX 3G2NA 3ASUA 4CNBA 1XRRA 1O6CA 3FTDA 2EATA 3GRVA 2Q6LA 3KJGA 4BP3A 1HG0A 3JALA 2OBLA 3D8UA 4C7XA 2LW7A 3X1XA 3V9PA 3J81A 1TJ4A 4AAYA 2FOLA 3LKVA 4RY2A 4ZZ1A 2WA2A 3EF3A 1K6IA 4K9RA 4R51A 3W3AD 1ZBDA 5AVWA 3KBOA 4X5OA 1UJNA 3KKNA 4DY6A 4EY3A 2UYHA 3FH0A 3DYIA 1A71A 4RO0A 1VZ2A 1F8FA 4S1VA 5KNBH 1GQFA 1AOXA 4RY9A 2WFLA 5IANA 4QOJA 3AKDA 1YA4A 2J9FB 5D6NA 3CONA 1WBJB 1WZNA 3L01A 3QV2A 1SHZA 1C29B 4DLSA 4RKFA 2ZT8A 4ND8B 3PR3A 1ZK3A 4UNNA 1ML4A 4IP0A 5SY6A 4N76A 1YE3A 1A69A 1P1FA 1KDTA 3NHSA 4OFWA 3RSGA 1JVSA 5FTWA 4K87A 2HSJA 4B80A 2PT5A 4IPTA 4NMWA 4XFKA 1DAIA 3AL0C 4NOMA 1I5EA 3A6FA 2IYPA 2FZCA 1T1JA 5EIFA 1M6HA 4GX2A 4ZT4A 3UJNA 2J33A 3WGOA 1TZBA 4AIIA 2XBMA 4WLEA 1BWQA 4P5EA 5IARA 4A2PA 5EP2A 4NOKA 1IEXA 2OP1A 1Z4QA 3AFOA 4JUDX 4C4PA 5A9TA 3G8DA 2ABWA 2OV6A 4HEQA 2PGOA 4JLDA 4PYKA 3U7RA 4LC1A 5BSMA 1AD2A 1W30A 4Y2JA 4P0PB 4DB2A 3K70C 4B6EA 4D4JA 2NNLD 2WUEA 1SZDA 3PWSA 5KAPA 4CCYA 4ZGWA 3GN2A 1DJNA 5I4CA 5DHFA 5JDIC 3U7EB 3BJEA 5I9BA 4G9EA 3TLYA 4LFAB 2MSWA 3FCXA 3U4GA 1EJ0A 2IK8A 4AULA 1Y48E 1JFLA 3RH0A 2N1BA 3PHCA 4TXNA 5IASA 2HZBA 1IZZA 2B0JA 2C2HA 2BDEA 3KKZA 3ZCSA 4INAA 1ZCZA 3DP7A 3WXMA 1ZOOA 2IH4A 2BPOA 4KRFA 1ZMRA 5ECDA 3NAQA 1O77A 5JYCA 3PGA1 2W58A 1OV4A 3HYCA 5K8UA 1HZJA 1A4UA 1DLIA 1KMCA 3AQ4A 3FMPB 3PI7A 4UAVA 1EVJA 2YZNA 5AI8A 2FPIA 2RKWA 3U4HA 3IEMA 3FDIA 4XR9A 2HSGA 4QJ5A 3TFOA 1MN6A 1MC5A 2HJHA 4G4IA 3IRVA 5E38A 3TLBA 3UJ8A 3GEEA 1G3UA 3DAHA 3BULA 1QP7A 3PFHA 4YDSA 4AY6A 5IT9A 2C7GA 1YRAA 2XCLA 1H2XA 5FF9A 2C7PA 3H4IA 3PWTA 3G89A 3NHPA 5EKXA 5H9VA 3IDSA 4P4SB 2CXPA 2GEJA 3A1CA 3AU9A 1FTNA 1ZITA 1YD7A 2ZUSA 3D6TB 1NQ5A 2XWBF 3VPGA 5CFQA 3KOMA 1DCMA 3A1EA 3THWB 1LPAB 3OVMA 4NNPA 4YI5A 5AXBA 3TINA 1ADYA 3E22B 3GYBA 1LBHA 3RS3A 3RUCA 4YR9A 1A4XA 2XCOA 1TUIA 3R24A 4K3VA 3ZU2A 3PFKA 4MJXA 1OXKB 5EHXA 1E2HA 5TVGA 4TMFA 3G5TA 4LNHA 2RGWA 1E0KA 4AROA 3IA7A 4XE5A 4FZ3A 4DQ0A 2C96A 1TF5A 2X58A 3NUGA 4EFKA 2DXIA 1C3LA 2C9DA 4PC3A 4TLAA 3U31A 3ZV3A 1I3OA 2NZXA 2Z5LA 4DLPA 4KUHA 1CE8B 3F7TA 2EFHB 3O1JC 4OMDA 4JJKA 1UPBA 4QU8A 4KOAA 1D1PA 1E0DA 3R74A 2V6IA 4GOMD 2FPMA 3THXA 1E9VA 1ST3A 1P1BA 3LBFA 4OL0A 2C9YA 4K40A 4CTNA 3RV4A 2PKQP 1E4VA 3KLNA 2PANA 1FFXB 1UC5B 1Y5LA 3GGOA 4L7VA 1QYCA 2CUZA 4WXMA 5A71A 4BB6A 3T0IA 3WNQA 1U11A 4G9GA 3LI2A 1FRVA 4I4LA 1H6DA 1BGVA 1RYNA 1B26A 2EFYA 2QTNA 1K27A 2RONA 2YMPA 1W0KA 1IM5A 2R2GA 3F8WA 2Y05A 5KO2A 1M2OA 4DM3A 3QVUA 1P73A 5KDOA 1G8GA 3H9JA 3ZY5A 1J9ZA 2I6UA 2M2IA 2DSNA 3KRTA 4KAFA 2ZWIA 3RYIA 1WHTB 1I4LD 1WULS 1E3MA 3M6XA 1B0PA 2BGJA 4RM3A 2YY7A 3EDRA 5CW1A 3H18A 4UUNA 3O4VA 3LTNC 3HADA 2V6MA 2XNDD 5AO9A 1KQGA 5CLQA 1SCIA 4IICA 3B8EA 5MN6A 4ZCIA 2JI9A 2WKRA 1FNNA 2XYGA 1LLCA 5CDYA 3GJ5A 1GLGA 2R97A 1GT6A 1RYEA 5YASA 4DSZA 1C4WA 1OCEA 3D6JA 4ZOQI 1I3MA 5CIYA 2OWEA 4FR0A 4G1VA 3GCDA 4YJGA 3TW8B 3VTFA 1EX9A 1LQ2A 1YR7A 2PZEA 4TZTA 5A4MS 1M6NA 1P44A 4W63A 5EUCA 2Q46A 1PSWA 3O95A 3E3OA 4Q39A 2EEPA 4O1IA 4QUGA 3SC3A 1OFGA 2JH3A 1SHUX 3OKAA 5JNLA 2JD2A 5JU6A 5AW6A 4KMMA 4MAMA 3IVMA 4WZ6A 2EDAA 3MRVA 4Z49A 2MR6A 3WBFA 3S44A 4N6NA 2R8YA 2P2NA 1T0BA 4JVSB 4PG4A 1EE2A 5KYUA 4B8ZA 2GCPA 2PWAA 1K3FA 2XGOA 4IWXA 5BV8A 4M8KA 2G1PA 4NE9A 3ZEAA 1NRWA 2IIQA 1E3DA 1FU4A 5FFFA 1PF7E 4BFVA 4DADA 3BXOA 1ACJA 3E9YA 3I34X 4OU4A 3CRMA 2WM8A 2BAGA 1R88A 2PFKA 5K0EA 4N3CA 3DR3A 1TCBA 5JNWA 1PD1A 4I55A 4FN4A 4PAGA 1PX0A 3KSZO 5A5EA 2LDBA 1NKVA 3L93A 1FVOA 3FRIA 3BGIA 1PWYE 2Q5HA 4DCJA 1TOAA 2PH7A 1CRWG 5JQGA 4LZWA 1IM8A 2IIBA 4IHJA 4NU5A 4V0OA 2JFOA 3LDFA 4GQIA 2HU8A 4G8BA 5A6SB 1HE1C 1RM5A 2HBZA 4DUGA 3ZJ4A 1VLVA 3EXHA 3L0PA 3ONNA 3QEAZ 5DXAA 3BB4A 3WKAA 1WXXA 1FSSA 3KXLA 3ND8A 4FFLA 4K86A 4Q19A 4TLMB 3DO6A 1KJNA 3DAOA 4KPFC 3EGDA 4TQUS 4DCMA 4D4HA 3ZU3A 3PICA 1V0JA 3S1AA 5EWJA 4NZOA 2D1TA 4KQMA 3OP1A 4DMUB 2G25A 3TOXA 4O1MA 1NQAO 1XD9A 3T5AA 2OSBA 2AG8A 5FB3A 3P4UA 2VVTA 3V42A 5BMVF 4MR7A 4QXOA 5FEUA 2B8EA 1WF6A 2VWHA 1Y9DA 3OSZA 1KRWA 2BFBA 2QNIA 2WUFA 4WXEA 4Q37A 3RGGA 2Y0CA 5AIAA 2GZHA 2O8DA 2YCBA 1H93A 1NHWA 4DLLA 1E2PA 3K09C 3K0FB 3ZE7A 5L4SA 4BXOA 1EXNA 1U3WA 1U3DA 5E0KB 2JLAA 3I9JA 5IDQA 5FOUA 4X3PA 3ROXA 1DTSA 1NM5A 5HRAA 1UMBB 2J07A 3S5UA 4IJMA 1H2YA 1Q7EA 1I6LA 3HRHA 3T52A 4DSTA 3HMKA 1A50B 2VHJA 3H5TA 2KWIA 4FDAA 1EK5A 1T0UA 3P1JA 5C52B 2A35A 4ZXFA 3ZQ4A 2ZU0C 1R8SA 1NBIA 4JVLA 4Q9DA 4PLHA 3LYLA 5AT1A 5F7OA 5KNBA 2W8BB 3PC8C 4MYSA 4GNRA 5FORA 1L4KA 2A7QA 4X90A 5HWSA 1EFUA 2I4IA 1LI4A 3PKIA 5HKOA 1S96A 1V16B 3ROMA 1OPXA 1O95C 4E6PA 1JX6A 1W5BA 3MCWA 1GARA 3FGPA 2VNHA 3VQTA 4ESEA 4Q3KA 2R2AA 4UHEA 1P2GA 2EU8A 1VL8A 2Q9AA 3WNZA 1UT6A 2GN2A 3CW8X 2OYCA 1ZYUA 3EGWA 1XU4A 3X43A 3K9BA 1IBSA 4S2UA 1BXRA 1H4VB 3CFYA 2NXWA 2C9ZA 1IUPA 3BA6A 3IVGA 3JAWA 3DMGA 2YZ7A 2Z8YM 5ITSA 1ZRNA 4B3GA 4TVSA 4YAGA 1RHQA 2G1JA 5E7MA 4MB6A 4QM6A 3I04M 1WXEA 1QANA 3ZVLA 1SEVA 4BFUA 1IPFA 1S5PA 4FWBA 1G55A 2ZCUA 2O7SA 2Z4RA 4X41A 4AXBA 4M0FA 5FWXA 2WVAA 4CLHA 2X14A 2ORVA 4GOOD 3T4EA 3QW2A 1PYOA 5JIBA 5IM4A 2YXBA 2V7TA 1BG6A 3HWRA 2R8ZA 4ECEA 1XHFA 3PDIB 1CP2A 2YV3A 3E1GA 1P0CA 4G4GA 2SKDA 1DDIA 5CCXA 1F3OA 3IP3A 4JJ8A 3WGVA 4YYZA 2R8EA 4M7PA 4MX8A 3WGMA 5ESWA 1A9ZA 1FFSA 1FLAA 5JH7A 1TVKB 1U2EA 1KMHB 4PZ0A 3UPDA 1LPMA 2RGXA 2G63A 1M5UA 3B7GA 4PANA 4D4IA 3T4PA 4GWGA 1CJCA 3K4PA 1GWNA 1EXWA 4JT2A 4XM1A 5ANRB 3RABA 2E4YA 1E1YA 5F78A 5JY6A 3SQXA 1EMDA 1U7OA 1YASA 4XUCA 3WYFA 1JQAA 4YMLA 1NMEA 4IIJF 3E18A 5G0WA 4LWOA 1L7NA 3MSCA 1AKRA 1RPAA 4YJ2A 3KKKA 2F3RA 5H3HA 2WM2A 2V7GA 2OE2A 3I8OA 3PGXA 4LJSA 5B53A 4EYOA 1JQEA 2YRWA 1GTRA 2GETA 1GADO 2IW3A 3RS4A 4PNEA 1YFLA 3VHXA 4MVYA 2X2FA 2WAMA 2B36A 3GVXA 3WV5A 1MXHA 1OQAA 1VMEA 3VX4A 1ZGZA 2OGSA 4L07A 4KQ1A 3X44A 1JU9A 1GCUA 2WIGA 2ZIVB 3EQ6A 4U02A 3R7WA 4Z3KA 3W8NA 5F2NA 1CQXA 2C2GA 4MIYA 4JSRA 2VJYA 2DB3A 4F5WA 4FNMA 4MINA 5FNVA 3SAJA 1U2DC 2ORED 4NFLA 1E7WA 3OEWA 1FDIA 2BR3A 1H2EA 2AG6A 5DTQA 1N2CB 5AXDA 1G5FA 1QQTA 2X5XA 3AEQB 5LU8A 1A98A 4CF6A 4EPWA 5L6MB 2NU7A 1ZRMA 3KQMA 4ENPA 4EH1A 3DKPA 1MHTA 3LUFA 5BSHA 2JAWA 2ZKIA 5ALZA 1PJSA 3ECAA 5EHIA 3RS5A 2ZJ7A 4IDAA 4LJAA 4NZPA 1NI3A 1V2HE 3U3ZA 4EARA 1MAWA 4B4DA 2PKCA 3LFTA 1SBIA 5CEEA 5IXJA 1G18A 1EVKA 4X97A 2OG2A 3JQ8B 2GF2A 1YA8A 4LYHA 2ZTMA 5ELMA 1VSTA 2FUEA 2VYCA 4KQ2A 3ZD8A 3RTAA 4CV0A 3ETNA 2B7BA 3H65A 3R8CA 5I9LA 2PH3A 4JQOA 4YRTA 2Z2KA 3I64A 2QQ0A 5F2EA 3A6JA 2L0XA 1JEJA 3TR5A 3WFZA 1FTGA 1VE3A 2HCRA 5K0CA 3TGPA 1NX6A 4OJNA 2RHOA 4OO3A 2I80A 3OTHA 5JE8A 4RADA 4RA9A 4XJTA 2JVIA 1JSCA 3N5CA 1EUDA 4LVNA 1EHIA 3WHPA 5BQFA 3E3LA 3NUZA 1P4SA 2H06A 3S8EA 1H2WA 2VF8A 2PL5A 4GZLA 4R4JA 2GFIA 2YXLA 4KRXA 4MV8A 3UK6A 4HWKA 4BIIA 3SICE 2GZSA 3L8HA 3Q0EA 4C88A 2WTMA 1KY2A 2Y0DA 4LISA 4BE9A 2EQAA 3PBKA 2BMEA 1EVZA 4LUCA 1UP4A 5KNCH 2NTEA 3DCYA 3NTXA 1I6MA 5L3ZA 4QLBA 5FKJA 2BONA 1UC9A 4YR7A 3DF9A 4XEUA 3S70A 4A8JB 4EB8A 3IQWA 2BMDA 1VECA 5CT6A 1C80A 1U2DA 1YQ9A 2Y1FA 1JJBA 3U6KA 2J0UB 2A4MA 3DHVA 4U7TB 4CLRB 2WIDA 4QYXA 3GGCA 4LTNA 1VPEA 2TRSB 5DNCA 1IDN1 4YRQA 4GEGA 3OFJA 5JXGA 2FFJA 3FGNA 3COJA 1ORTA 1RMYA 1TEVA 2P11A 1YRBA 2G80A 3HKEB 5B1SA 4TUYF 4PSVA 2LUOA 5L4LA 2VHEA 4DBLE 1GUYA 1WDLA 1MP0A 5A5FA 2JGFA 3WGKA 2QVLA 3JASA 1XWWA 2CXUA 4CIYA 4ICIA 3RAGA 1IOWA 3NAMA 5IDVA 1INLA 4QUJA 2EBFX 4BQNA 1FDVA 4KLNA 1XDZA 2AA3A 3GGJA 3S2SA 1PLKA 2O0LA 1Y1RA 3TLKA 4BFZA 3FA2A 1L5GB 5JBIA 3RB8A 7REQB 1S8AA 5L7TA 1K6MA 3N7UA 3L0OA 1D6JA 2O48X 4TN5A 2FNAA 3FNHA 5EJEA 2CXTA 3AXSA 4IMPA 2HO4A 4TTTS 4ZV7A 3COWA 3E4CA 2E18A 4FFPA 5IJAA 4JI1B 2FSHA 3VXKA 1GZ3A 1II8B 4G23A 2ZT6A 4Q15A 1XCGB 1NPTO 3CX7A 3W5SA 2RIRA 2XUHA 4PF1A 2CEKA 5LZ4A 1YCHA 4DV2B 3KVRA 4L50A 5EFZA 1NKSA 1LBEA 1Z7EA 4KO2S 4NBUA 4XRGA 2IDZA 4AKIA 2DBVO 3LSTA 3VYSB 4I5GA 2FLKA 4YECA 2PS0A 3LPNA 3T1QA 1JBKA 3UHAA 3QG1A 1K86A 1IB6A 1GFSA 4KIFA 1ODSA 3NT5A 4B6OA 5KYWB 5FOVA 1Q17A 2VAWA 5E3JA 1W85A 3LTEA 1VG9B 1BH6A 3W5HA 4C4YA 1JEAA 1PR5A 3UKOA 5F23A 3GLHE 5B3AA 4KHPB 1TTPB 3NM4A 2PV0A 4GH5A 5AWFC 1ZXXA 2H9AA 3OOHA 1LDYA 3KSDO 1WSAA 1ULHA 3IO5A 3MT7A 4JP3A 4ECAA 1QFXA 1V8ZA 2HHJA 5IJ9B 1E98A 3UMBA 4ETWA 4PLTA 3ER8A 3GFGA 4TMTA 2AJBA 1WEHA 3DTVD 1TFRA 4COOA 1BCRA 2PJUA 3RWOA 2QUBA 3UB2A 1A2QA 1T8YA 3GVIA 1QCYA 1KK1A 1DAPA 1AHIA 4J0JA 4LQ4A 4EG7A 1E92A 1R12A 2IP2A 4C76A 3PCXA 5CYOA 2O1EA 4LY3A 2Y71A 2PO5A 3GCGA 3D6FA 2XQJA 1U1FA 4ITUA 3OLXA 2NV0A 2PJZA 3BRCA 4LGVA 1BEEA 1K6XA 5K0LA 1PS9A 4PE5B 5ED4A 1GL7A 2PRSA 3OPMA 4G0PA 3RSCA 1XU9A 5CMLA 1V7PC 1CVRA 1MPTA 5EZYF 2VHQA 1MEOA 4ZK6A 4Z7QB 4M76B 1CJUC 3T41A 3EISA 1KEEA 2O20A 3UQZA 3SHQA 3FM9A 3HJHA 1VE9A 1P45A 1T91A 2FPGA 2RJNA 3IV7A 4BNHA 4EYKA 3EUAA 1RE1A 4YFYA 3AILA 1ZCAA 4OV6B 2Y1CA 1F8GA 4DDHA 1P1RA 1QYXA 2XQVA 2CZGA 3C16C 4N39A 2Q21A 2JKZA 5HYVA 4X1YB 3ETLA 3P9ZA 1AUXA 2WYWA 4TLLB 4DIMA 5CLJA 4CEJA 1FXWA 1T3TA 4GLFA 3T5CA 4BQPA 2H57A 1EFPA 1NXQA 4BWFB 2C9MA 3QNUA 4JZKA 2ST1A 5DYNA 4LBYA 3RC3A 4ZVRA 3Q8LA 3FR8A 3HL0A 2WYUA 2YHIB 3LC7O 1HRKA 5JHHB 1P75A 2HXGA 4K9QA 1R6DA 1T2UA 4EZIA 2X1LA 5IXYA 2AE1A 3DKVA 4PGGA 1V4NA 2Q2VA 3HK2A 3URKA 4M1OA 2W6MA 2PE5A 2ZRDA 3RVDA 1RWPA 3P4XA 4RK4A 2I22A 1BJRE 3NGMA 3EF0A 5LQCA 5HSGA 1Y80A 4PZPA 3IOCA 1AGXA 2O2ZA 2PM8A 3ISJA 4I1OA 4KQ9A 1TF7A 2QTTA 3LT4A 3QOFA 1TQHA 1OV6A 4G9BA 1IEQA 3EY4A 3BZBA 2QPOA 4LMRA 1EI9A 2LKCA 5EYPB 2JBAB 4DNXA 3DWEX 4YRKA 5M5BA 2QGZA 3ZOKA 1XN4A 3Q72A 4XRRA 3TLGA 4E5NA 4G0VA 4LF6B 4HPJB 1ZK4A 1NBMA 4XWAA 4C29A 2AYYA 5B57C 3A1WA 1MIOA 2Q1UA 3AR2A 3KFXA 4QE3A 2ZRHA 1ZO8A 3EWAA 1RXYA 3QX8A 1CUUA 5HM8A 1G8AA 1YL5A 1Z6XA 2RB5A 1EBFA 3GQBB 1IEWA 5LUBA 1JB1A 3QKRA 4IKOA 1KHTA 2PG3A 1DINA 1WOYA 2C2KA 5AVOA 2GXUA 2PKQO 2WLSA 4RSHA 5KYTA 4AUNA 3WISA 3H1PA 1ZMXA 2AFIE 3VR5D 4WNAA 2B8JA 2JRCA 4WA7A 1VCIA 1G3IA 4ZQBA 3TW4A 4BMYA 1MA3A 1X1BA 4EPXA 4BO2A 2NUAA 3ZZNA 1S01A 3CNNA 4YRRA 4G1MB 2IS2A 2ZBVA 2CZCA 2PZJA 1NNI1 1X7HA 2R6AA 3JQ7A 2GJ9A 4MIOA 4HDSA 3GRUA 1JHAA 3LDUA 2UUCB 4NYIR 4OSEA 3OOSA 1J0AA 4J7UA 5AOCA 1NR1A 1JEEA 1HLFA 2DKOA 1FNDA 3R5SA 3VNSA 1LTKA 1Z39A 4DR5B 5FOWA 4ARZB 2R84A 3CWZA 4LXYA 2C7OA 3AVQA 3H2BA 4ZDKA 4QDZA 2X9QA 4QU0A 1UDAA 3L04A 4M1SA 4R1QA 3VC3A 3FW1A 1IE3A 4GC9A 4Q4HB 5L8VA 2V3CC 2CNNA 3DXYA 4OQMA 3PGVA 4S1OA 2PYZA 3U9SA 6ABPA 1XZEA 1RJEA 1QIIA 1T8TA 2RGDA 2P62A 4IFBA 4JXKA 4OHPA 4UJ3A 4CT5A 3T5PA 2CJWA 2RH9B 3K72B 3D2BA 4O5AA 2A0UA 4ARCA 1IUKA 1NVGA 4DCCA 4XA8A 4V0NA 2W11A 1XYVA 4NAHA 4AMUA 2VP5A 4WWHA 4NEGA 3BORA 3PGLA 1AJEA 2V8BA 4GC5A 4IO1A 5CVVA 1GHTA 4DABA 1NQUA 3RGWS 5CVTA 5DN9A 3T7JA 3K30A 4GAEA 2BE9A 1G59A 4KACA 2XE8A 1J0BA 3LD9A 3UMGA 1YF3A 3SE0A 1E9FA 1JXAA 2DOKA 2OHVA 4QBGB 3PLAE 4RZSA 3ZZUA 4EELA 1XHLA 5LB4A 4L4RA 1JQLB 4ALIA 4E5DA 1MENA 3IB3A 4O4IA 1F9AA 5EP4A 3SZLA 4BO4A 1NGSA 5EIEA 1U5BA 2OHJA 3U60B 2ZSFA 2FOIA 2ZUVA 1V35A 1D7OA 1OE0A 2WE8A 2FZGA 2Q7OE 4BN0A 1N2SA 3N8IA 4CI9A 2AVDA 1Z8FA 4TXMA 5ES4B 2D62A 1F2TA 1GRCA 1APBA 1LK7A 2GXQA 2IEBA 3ILVA 3NV7A 5FOTA 1TYCA 4US1R 1ADBA 1MHPA 1CUXA 4M89A 3SJCA 2JFXA 2WJJA 2IW1A 2QTVB 3NVMB 4ZGBA 3LHKA 4TROA 4Z7OB 5IKEA 2ZZMA 3FE2A 3ZHCA 3VNRA 4ZVVA 2Q2NA 1TKCA 3GIDA 3EXIB 1UJMA 3BMNA 3F6BX 4Y2PA 2C20A 3LRPA 4MNTA 3L7DA 4YJHA 3DNMA 4QELA 4BNNA 3HCPA 4HD8A 1LNQA 5ADHA 2YMLA 1AV6A 1YR2A 1K08A 2BGNA 2DFDA 4BNDB 1C0IA 1YJAA 3C6XA 3V1UA 1RXEA 4ARSA 1MU0A 5D85A 1F8XA 1P5FA 2TS1A 3EUFA 4BLQA 4E3WA 4WZAB 1O9GA 3IHTA 5DLPA 1VIDA 5ISMA 2DLCX 4CL8A 1PQYA 2IEZA 1OZ0A 5LXTB 1IOVA 1FP1D 2PGAA 3AM5A 2PH1A 1ESNA 2D13A 3OM8A 5E6RA 3DE3X 4Q48A 3GGGA 3QF7A 5HF8A 4LDRA 4FB5A 3REFA 3KPJA 3N2KA 2CFRA 1H8EA 2CYBA 3C48A 5ARCA 1S2LA 1W96A 1ZNXA 2X1HA 4H1UA 4C4RA 1XCLA 4H4DA 4HH4A 1Q50A 5JPDA 2OGUA 2V7XA 3AONB 3E81A 4H1VA 4II2A 2NO5A 1KPGA 1QQ7A 4UPVA 1OASA 3K8OE 4PZDA 2ZSAA 4O2AB 1CUJA 3GGSA 4O2BB 1EWTA 2HWYA 1T9BA 3T7IA 1ECCA 3ZNOA 4JS0A 4CF4A 3SDZA 5J47A 3AEKB 3JZAA 4F5DA 5HNKA 1EQ2A 2P5UA 1QZUA 2PR7A 1U65A 3E70C 1OAKA 4Q3DA 5MF6A 1KEKA 3QY0A 2Z8ZA 2FPPA 2LR0A 4TSFD 5DBIA 2G9VA 3FCCA 3IAS1 3N7TA 3QSGA 3WE7A 2WHRA 2QQGA 2B25A 3BJMA 3SEZA 3LNTA 3QENA 1KH2A 2XHZA 3R3SA 4X44A 3RTBA 2XRZA 1HDOA 3WC4A 1TM5E 1KP2A 2E4WA 3P0RA 2DTDA 2AHRA 3FPAA 2X5OA 4WLNA 3TLCA 4EG4A 5GIOE 1KYZA 3BC1A 5FADA 3T95A 1PV4A 1GLVA 2VCYA 5CCBA 1JDVA 1DJMA 4UZFA 2VRWA 4HLCA 4CG1A 5AW3A 2O2JA 3G2PA 1XFDA 1SG6A 4CDGA 3DO8A 3TQFA 3GA0A 1XELA 1C41A 3ICPA 6ADHA 2J4CA 3FMOB 3QLUA 3RNOA 2BKVA 4ZPJA 4QASA 1UZAA 2Q4BA 2G6BA 3N58A 3VZRA 3RVLA 1D2GA 2OV8A 1SUEA 2OHHA 4LHWA 2NXCA 2CLFB 4J7XA 4YASA 3RSZA 4POOA 3C41J 5K99A 1IOZA 1YXMA 1DBIA 1EE9A 1XKQA 4E2FA 4LOAA 3A4NA 3FDJA 3HO1A 3KK0A 5E4FA 2B0CA 3RSLA 3QHQA 4BS9A 2XCTB 5BN1A 1CRZA 4MARA 2QPLA 1R8XA 3B6IA 3G23A 1ZGGA 1F2VA 1GOTA 4R1TA 3HZOA 4KE9A 1L4GA 4YAFA 1PFWA 3NJRA 3EOZA 1WKVA 4QA9A 2ACKA 3TNFA 4E1BA 4BDTA 4D9JA 3KPYA 1EUCA 4N1AA 2VTBA 3UJ7A 3TG2A 1Z5PA 3VAAA 4JP5A 1MX9A 1KAQA 3A4YA 3PA6A 3KWLA 1BWPA 1EESA 4BGDA 3KM0A 3UYLA 1NN1A 2RHRA 2PT7A 3WL8A 3SI7A 4F2DA 4UTZA 3D4BA 3I05A 1DTEA 5JECA 5CLLA 4K6OA 4C3VA 1CS0A 4Q4LA 2WEKA 4UUOA 3FSGA 1CY4A 4J9VA 3VJMA 4HNVA 1KA9H 3C39A 4ETNA 3KALA 3GLUA 2EWVA 4FMBB 4LY6A 4MW0A 2ZSHA 4AN1A 2F1KA 2JA1A 3TW0A 3GD7A 5K8VA 2F1IA 2EEZA 3KKPA 3QHPA 3DF7A 2OMEA 1EH5A 4MGZR 4B7UA 1IHPA 1O97D 2QVZX 2P35A 2R1VB 5FLEX 4F7WA 2QGNA 2ZRPA 1KDRA 4P3KA 3TRDA 4FHCA 3ZD6A 2BKXA 2IYEA 4KPGA 3VZQA 4R2JA 2VRCD 2Z8XA 5THQA 2C57A 1DBSA 1HDCA 1BKYA 3G79A 1MNAA 3RWMB 4YONB 1T5OA 3FN4A 2ACWA 1J49A 1A8SA 3DDUA 3OPYA 4R2IA 3KQVA 3OP4A 3WIOA 1U8TA 2RARA 2YWRA 4CM8A 1KJJA 1YJXA 3A4TA 2HXYA 3USZA 2AZDA 4E03A 1JHXA 5LWQA 5IVDA 4AZ0A 3CHYA 4ER3A 3THYA 3RASA 1R6UA 4LOHA 3EXEA 3W4JA 3ETCA 1SXJC 4Z7JA 2O06A 4QIHA 1EEHA 2A4KA 3UWSA 5BNTA 1EBUA 3QTBA 3OM9A 1C9JA 3SBDA 2GESA 4E33A 1JP7A 4JA0A 4MPPA 5E4TA 4TKVB 2O50A 4OGLA 5EVJA 5A4AA 2ZB8A 2QM8A 1JWLA 4G5FA 3RFXA 4CFZA 2JNWA 5E1DA 1XAGA 4B7CA 4EGJA 5GJVC 3QXJA 2D2EA 3OQ1A 4XYBA 3SP1A 1ECLA 1M9NA 1Z35A 2FE4A 2H92A 2IHBA 4FYIA 3JYOA 2P9EA 3UJ3X 3A1VA 2DF8A 1SCNE 2PR2A 2BCJQ 4ZVPA 1NQOA 2W0SA 3SF0A 5JI2E 1L4BA 5EE3A 1B74A 1GVNB 4XOIA 4BO5A 2X5KO 3S0JA 1ZLYA 1TE2A 1A8IA 1J8YF 2F9LA 4JU8A 2P9TA 4LV6A 4BAGA 5CUQA 2XUGA 1FX0B 3SJUA 3WO0A 3LQKA 3NHUA 3IODA 1P2SA 3FHOA 1H05A 1Z0AA 3Q5DA 4J16C 2C5FA 2OO5C 3HUFA 3K8QA 1XEWY 4JUAA 1QYVA 1ZINA 3WDLA 4EABA 3CO5A 1QTRA 1DAKA 1XNGA 4CQMB 3VX3A 4JYMA 4LDJA 3ADBA 2UYOA 2QMQA 1E96A 3JTEA 1EZ4A 2B34A 1VE1A 1WUHS 3GEHA 1NF9A 2JH9A 1B3RA 1JU3A 1S89A 1AGPA 5DYGA 2YVLA 3C8HA 3DHEA 4OQ4A 4WT7A 2FMIA 1EQUA 4R0MA 2XMCA 2HL6A 2D7JA 4JLVA 4XOUA 4MR8B 1JLKA 1KQNA 3ROQA 4NYJQ 3UJ9A 5C9ZA 3YASA 4MQ6A 4DARA 2I3ZA 1HA3A 2H85A 3IDZA 1HYBA 2CXQA 3CTMA 3QW4B 3AOEC 3TMAA 1G1MA 5EJ2A 3NHBA 4ZT6A 3CZAA 3UC9A 1MFZA 3NHZA 4ZARA 3PDHA 3DEFA 4LN1A 2V6JA 4EF6A 2WAOA 1K9SA 4I66A 3TKAA 4PEVA 2E49A 4IJ5A 4KQXA 2AJTA 1TUBB 5LQMA 3AI3A 2JJ1A 4JI7B 4DYHA 3HKBB 1E5VA 3JPYA 3OE7A 3AKCA 4QDOA 4YP6A 4J2OA 1BCSB 3BILA 1E6EA 4Q4DA 1KI6B 2VS1A 1TIKA 4Y0AA 3B52X 2NAPA 2A6PA 5CBKA 5GAJA 1HE2A 4B3CA 2A9FA 2H16A 3BRQA 5KSWB 4PRZA 4DJJA 2X9NA 5FFMA 3CZQA 1J33A 2P2CA 3KL4A 1T24A 4HDMA 1UXGA 4ZMBA 5A04A 5J59A 4CIDA 1N7JA 1YCDA 2LTAA 2YQZA 3CG0A 4YAWA 4HT3B 1G3QA 5JCZA 1WEKA 3KOWA 1T0HB 4KBFA 2ZIGA 3DHYA 3RRYA 3GHHA 1DJLA 1E5QA 2Q27A 4LYAA 4DEYA 4EL0A 2FP4A 2VZ0A 4PC1A 4D81A 2EOAA 1KMIY 3TCXB 4IW3B 4J16A 4P3XA 2OO5A 3F3KA 1CR1A 2HWUA 1U02A 2CXHA 1Q5PA 5LA6A 3SHOA 3SS8A 1RYHA 5LN1A 4FHFA 1FMJA 1O96A 1SCQA 2WU1A 3CRRA 2KBFA 4GKVA 3Q8XB 2KE5A 4H59A 1NT4A 2PBZA 3BD6A 3OPQA 4GYYA 4GX5A 3WDKA 2IJGX 2QRGA 3R20A 4DGQA 4DDKA 4G1FA 1L8AA 4RF5A 3ENQA 3IV6A 4TT3A 1Q16A 4I8IA 3VU3A 4QGBA 1H94A 3X1ZA 3KVVA 2XCRB 3GFBA 2J45A 1KQ3A 4PTYA 1M5RA 1KARA 4PG7A 5CVUA 1SEPA 2W8ZA 4C4OA 3IAFA 4BFSA 3IPLA 2QVBA 3MWDA 3GNQA 3BMOA 3FPFA 1C4KA 4IJUA 2A0FA 3BKWA 3P97A 5LR6A 1LK5A 2EHDA 3H8SA 2XWSA 3AEUB 1VKJA 3ILXA 4URFA 4XD7A 5P21A 3RRFA 5HZGA 5HIIA 5IHPA 1FLVA 1PX2A 1VHJA 2Q6IA 4X8HA 3T6KA 3NXKA 2X0RA 3KEGA 1QGOA 4DLAA 1NQXA 1VRCA 4QICA 4UNRA 2I4OA 4JLKA 3FOBA 2CDBA 1REQB 5K3FB 4EPTA 3BAZA 3ITNA 1OW3B 3WR5A 2ZTUA 4B3IA 3EXFB 5G4KA 1WETA 1SQ5A 3ITDA 1UANA 4G0XA 5FLKA 4AZVA 4MRNA 1Y9JA 4TTQA 1U2PA 3SIXA 3T1NA 2I2WA 4C21A 4PR3A 2K2WA 4RUKA 4FB4A 4ARIA 1RI4A 1TLFA 2XIJA 3H75A 3KAPA 4PFSA 4B7XA 1JIVA 1KDPA 2R44A 3S7TA 3SSMA 3SVZA 1GPLA 2UUOA 4P08A 2FSUA 1ISSA 3S68A 1VHDA 3V55A 1ODTC 4R1NA 4G0OA 2EW1A 2AX4A 3QOWA 2FUKA 2KBEA 4JSYA 4YCMA 3C1TA 4RD6A 2PVCA 5C46F 3OCUA 3V4PB 2FAXA 5CLFA 3NDRA 3DMRA 2OZLA 4EVIA 2QE7A 5CFZA 3IOBA 3I9FA 1R15A 1V3UA 2QMYA 4O02B 2GTPA 3A3KA 5LQAA 5FTLA 3EH1A 2IHKA 3IBFA 4UBIA 1GVHA 1E2LA 4IX9A 1IZYA 3AHIA 1VLMA 2BP7B 1PG0A 4Q5IA 3FUVA 3DV0B 1FCJA 3NAZA 3WHLA 4EY8A 3SF8B 1DHRA 3ZE8A 1A5TA 2VBFA 1RP7A 2XF8A 4GPBA 1X77A 4JNKA 4LGYA 4NK5A 3PFIA 4RKQA 3U9LA 5DNWA 3QXGA 3ZGLA 3AKEA 4PHTA 1VG1A 1YC5A 3CWQA 3BRSA 4X85A 3E27A 5DNVA 1Y7PA 4QDXA 3U17A 4OLBA 1QZXA 1HM5A 3R8FA 4X20A 3H17A 5KYYB 1SBCA 3ILSA 2ZI6A 3EC1A 2P65A 3ENZA 2AKAB 2Q6OA 3Q1KA 1E4EA 1JNYA 4MAFA 1SGWA 3HSYA 3MT0A 3PNMA 2BI7A 3D0QA 2V45A 3OHMA 4OKIA 4WVFA 4WZBA 4URHA 4B2IA 2WWFA 3QX3A 3X1JA 1QUEA 2FB9A 3QKIA 3DFIA 1E7MA 1XTRA 4L3OA 4PRLA 3SC6A 3ED1A 4R3WA 1YU6A 2R7LA 2PZ8A 3G2MA 4F6RB 2OBMA 3E48A 4OXIA 1WPRA 2GR9A 2QXUA 4TLBA 1Y8RB 1NV8A 3FBWA 4UU1A 2AHOA 5ALTA 2OYRA 1SZCA 4F21A 5MGBA 1JYSA 1G8SA 2JK1A 4GW3A 4KN9S 4L51A 5BO5A 5IFKA 4REMA 1DADA 1EVLA 3WDSA 1X7ZA 4C7OA 5GJBA 2AG1A 3L7YA 1K6JA 4P35A 5BQ5A 5LP6C 3U4CA 1QG6A 4ZO8A 4HC4A 4AWBA 5LP1A 4D3ZA 3W7BA 1LDGA 4LRTB 5KYGA 4N18A 4FGZA 3NNDA 4KNYA 4IWNA 1J2UA 3ZLTA 2QZJA 1SRRA 1GD1O 3OIWA 3JW8A 2O3QA 3CR8A 4Y9RA 3GJ7A 2P9BA 1U7PA 1AURA 1XE3A 2G1AA 3PI6A 4KQJA 2JCYA 3SHTA 4TRRA 1LZKA 2O14A 3C0KA 4CBVA 1JR6A 4UE3S 3ZDDA 1N8KA 1RM0A 1M0EA 4JC0A 5ARDA 2EARA 4ES6A 4EG8A 1NVBA 1B2LA 5DI9A 3O8DA 4U9IS 5KYUB 3I2KA 3UM9A 1XCPA 1A88A 1VYUA 1Z0KA 4IUYA 1JXQA 1XLWA 4GPIB 4D4GA 2GZ3A 5C1IA 2VT2A 4YMTA 1DJQA 3OZCA 4P3NA 3WGIA 1T36B 4I81A 1SC9A 4C4ZA 4EMBA 5BSFA 3INNA 5AQ1A 5KX5B 2ZBEA 3E15A 1SCJA 2BC9A 3L46A 4MUMA 2YOFA 2E37A 1XK7A 1FUIA 3NIDB 3ACCA 1P6QA 2AKEA 4B8YA 4JXXA 4O3MA 2FG7C 4LBWA 2JGEA 4Q21A 2WPDD 4DCGA 3Q2OA 1CDDA 1NYQA 3LX8A 3KOOA 1QS0B 3TB4A 1U98A 2CK3A 3LBHA 1CBUA 2PLRA 1H69A 1Y8CA 2PO7A 1SBQA 2HTFA 4GKBA 3H1FA 1GFIA 3A31A 2H1WA 4RVSA 4RPHA 1KIMA 3A4MA 3VR4D 5DN6D 4NCBA 3BZUA 1U8CB 4MROA 3KD3A 4ML3A 4Z0HO 4BMPB 1RRPA 3R44A 3TGLA 3G1WA 3NEPX 5LZ9A 2NYVA 5G0TA 1MB4A 4H7EA 1NJGA 3ZHUA 1JR2A 3ISTA 4MP3A 3EDOA 4PU0A 1D0SA 1HMYA 3MOIA 3JR3A 2Q99A 5CM8B 1HG1A 3V3TA 1TYDE 1SUPA 3VPSA 3FSEA 2J0QA 1RMTA 3IO3A 1JKFA 2BGUA 3JR7A 3PUIA 2QRQA 5KCMA 4M0UA 4G2TA 1X0VA 5CX1A 3MIIA 4BKPA 1KVTA 3DZHA 3ZWVA 3NHLA 3MM4A 5HFNA 3I45A 1PL7A 3N75A 4QQKA 4WIAA 3ICWA 1CHNA 4PIMA 3HUEA 4W8GA 2Y93A 1KI1A 2BEUA 4JI6B 4ZYWA 3LVBA 2HA6A 4C03A 1G20B 1E7QA 3JZFA 4OJKA 5TXGA 4CMHA 4Z1MD 4DA4A 1IULA 1NR7A 2FMFA 3E23A 3ZV7A 5ALRA 3JATB 4MCAA 3OLZA 4S3MA 3RCBA 2EYQA 4UDNA 3TQOA 4E31A 2R1ZA 1A76A 1ORVA 2E5WA 2QM0A 1P5HA 1VGQA 2ADOA 3E8XA 4IM7A 1DQRA 4MVJG 4ZAXA 1M2HA 1Z2OX 1ECPA 2OOKA 4QTUB 3I92A 2PA0A 4BNZA 4Y9SA 3RVPA 3W3ZB 1DIBA 1A5AB 1T4CB 3QMPA 2PMBA 1I8TA 4X94A 3JWIA 1JE1A 2Q3DA 4PGHA 3LCMA 2R86A 3V8NA 4CM4A 3RANA 3UCFA 3I01A 1UM8A 2C2ZA 3KAQA 3N0RA 3PHGA 4RH3A 4AI6A 1QPGA 4HGNA 5KBYA 3P9QA 1FQJA 2XE7A 5U1PA 4GL4A 1SQ6A 5H70A 1YRYE 4ZVNA 1XXLA 4HF7A 4RTQA 3VU8A 1VL0A 4PSCA 4ZANA 2IS6A 1SOWA 2R65A 2QTFA 1R4MA 3MCTA 5AXCA 3OIVA 3DBOB 5HILA 4F8EA 2RHMA 1THMA 4UZEA 1GGEA 3O84A 3ZIUA 1XNQB 4Q9JA 1YZ3A 3ZWBA 3D3WB 2V1UA 3T06B 3E6AA 2GWRA 2HUNA 3UHFA 1TCUA 1S2NA 4PVDA 2A67A 1W36B 4RZ2A 4DIFA 1E0JA 1M10A 1KKUA 2EJVA 2XI4A 2IHYA 5IMBA 3U1TA 2J0EA 1CC1S 2C5BA 4DEVA 1A95A 4EI7A 5BUZA 1GUZA 2NO4A 3GU3A 2N46A 5FBQB 5JDCA 2GPTA 1QZTA 4RCZA 3FGOA 3SQNA 4BQIA 2Z5GA 2NO0A 3PXXA 4QLAA 2I6FA 2W4MA 4J3FA 3T9AA 1RZRD 2GZ1A 2UXBB 5ILOA 3DE1X 3QELA 3U4IA 3U7IA 3HBAA 4M60A 1JDPA 4M0DA 4RXMA 3JQEA 4ZIRB 1JPUA 3TMKA 3JYNA 3R2JA 1MOSA 4HUQB 3F6EX 3AK4A 4K9LA 3BCUA 5KDLA 2YY6A 3LXRA 1PP4A 3BFKA 3P9KA 4UXIA 1VSQA 2X19A 5I8PA 3OQOA 3RJZA 1M75A 5FPPA 1CUDA 4L2IA 2QX7A 1MCZA 2CMGA 2EZ8A 3K8YA 8AT1A 1H4SA 2MYTA 3IP6A 1W0JA 1XT6A 2DFPA 1KFKB 5HCNA 3F2VA 1IBLB 4OK6A 1Z73A 2NO6A 3N76A 1FSGA 2EX0A 2FG6C 3AF2A 3I58A 1EZ1A 3Q0TA 4MVJP 3K1TA 4NL4H 4OB7A 4EB0A 1CYEA 2MIIA 1R4NB 4D8WA 2C04A 2CWDA 2H4XA 3JXEA 1X7XB 3LX4A 4JBLA 4YJ3F 3U26A 4DJFC 4FZ5A 4OHZA 1CYDA 2WHEA 1PR0A 3E7DA 3HM2A 4PWZA 3D9QX 4TM8A 5I7WA 4XIYA 4NTZA 4E2YA 1X92A 3HP1A 1NW9B 2NPOA 5AHOA 3NGXA 5EGSA 2AWOA 5D3QA 1R50A 3ME5A 4IQFA 1DC6A 5EIBD 1U2GC 1U1DA 2BFCB 3FYDA 4KQWA 4RQUA 2FDCA 1X7GA 3OCXA 3ZHVA 1M2NA 2JB9A 4KOEC 4TYQA 3VO2A 4C0BA 5TPWB 2I1WA 1EAMA 1YBHA 1ZJ6A 3O4JA 4W6ZA 3PFWO 4BYGA 3ICQB 2AN5A 4F3NA 1ZBQA 4MVJE 1K75A 3V8MA 3B6EA 5K3SA 5HKKD 1FFHA 1L7XA 1NBEA 1R1DA 4C6TA 1CY2A 1S3IA 3RFTA 3K1YA 3BN3A 3D6AA 5AJTA 2DP4E 1UPAA 3BL5A 5AR1A 1MX5A 4YXFA 1DB3A 4L8WB 5KINB 4GMKA 4K6GA 4L76A 4P84A 1P31A 3C2QA 1K3UB 4HZGA 1KBQA 4LRSB 4EQ6B 2B35A 4HTFB 5LL6P 2Y9PB 3DZJA 5EINA 1GSIA 3BCHA 1RVDA 5CURA 1HE4A 2J6CA 4PCVA 5HCUA 3ZWWA 1L7PA 4E51A 1YB6A 1MAUA 3BX1A 3UGJA 2P1RA 3LUBA 3OICA 4QTXA 2KSQA 4PO1A 1QB8A 2IZ5A 2MJLA 3HWSA 1TYBE 1QKKA 2EF1A 1H2RS 3GD5A 5BSGA 2QJOA 2XECA 4OUKX 4A8TA 3B53X 4MW6A 4A26A 1RPZA 3TLAA 1UFOA 3C15C 1BFUA 2OCAA 3BH6A 3M2PA 3OUTA 4UM8B 2OB1A 1E9DA 3D7SA 4NV3A 3JPWA 4DS3A 3W3AA 3BE6A 1TYEB 2CNBA 5TNXA 1RNLA 5TQ0B 2O3UA 3UG6A 3RC8A 2Y4OA 1CUFA 1G7CA 1SXHA 2NPFA 2OUIA 4B40A 5L9AA 3IKTA 3ZDAA 1XROA 3CVUA 5TX7A 4XYGA 1PJRA 2KJQA 3ZS9A 3UBTA 2FW6A 2OOSA 2QN2A 2ZDQA 4LHXA 3VR6D 1WD7A 4YT2A 1X3LA 1Y9AA 4CEHA 1FPMA 2X7HA 2WJ3A 2XQKA 1MJ5A 1UJ2A 2WU3A 1IB0A 4IO0A 1K7EB 4J4HA 2GBGA 3LVFO 4O29A 1WOMA 2VJOA 2M1ZA 2YV4A 5CR9A 2Y66A 1DKOA 1KSJA 2G5CA 1A9OA 1T1GA 5GTDA 3GG2A 4UHBA 5DISB 4QC2A 3NM6B 2I3BA 2NX2A 1XTZA 2Z6UA 2CLHB 3Q5EA 2CLSA 5HK9A 3H9QA 3REQB 5IKXA 2G28A 4IDHA 5IAJA 2OB2A 4KWHA 4NU8X 1WM1A 2XZOA 3TE7A 3UA3A 4B3HA 4C2UA 2E85A 5JLAA 4BMOB 3IAAA 4WESA 4KFTA 3ZXXA 4LVUA 1USUA 4EGQA 3TCNA 2XJ9A 4ZCMA 5GONF 4UHCA 4HBZA 4N0MA 4UM7A 1XD2B 1EWVA 3JVDA 5DGHA 2GJKA 4OLHA 4ZYLA 2JDID 2ZTHA 5J4YA 1EUQA 1UK8A 5BNZA 1ZWLA 4K9MA 4PCAA 4CNQA 4FNOA 2FFRA 2ZRGA 2WVJA 4HQFA 5CJPA 4CTMA 4MW7A 4LCBA 2FZVA 2DHRA 2NUPA 1BE1A 1QAOA 4CFYA 3F78A 3JQCA 4H7FA 4B43A 5KQPA 4FN5A 5BNWA 1KR2A 4ZREA 2FR0A 3VOTA 8GPBA 2DHCA 2J32A 1TEXA 3CG4A 1UOPA 1DQSA 3LT5A 2H4JA 4OJQA 1LBIA 4TTPA 1XRNA 1MBZA 2OUKA 2CLIB 3ZI7A 3SD7A 1NP6A