1XIVA

Plasmodium falciparum lactate dehydrogenase complexed with 2-({4-chloro-[hydroxy(methoxy)methyl]cyclohexyl}amino)ethane-1,1,2-triol
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
318
structure length
307
Chain Sequence
APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALAHAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase
publication title Mapping the binding site for gossypol-like inhibitors of Plasmodium falciparum lactate dehydrogenase
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 114
structure length 307
sequence length 318
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2004-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1xivA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1xivA02
3WGOA 4DVJA 2A94A 3P19A 1QXSA 1YXMA 3QQPA 5EQDA 1QRRA 3BYZA 4XDZA 4NJOA 2GCGA 2E4AA 2BRUA 1PGNA 1XHLA 4OKNA 3SLGA 2ZYDA 3PDUA 4IJUA 5IN5A 1XKQA 3JQGB 2IXBA 4FPXA 5AXBA 4ZA2A 3H5NA 4ZVVA 3H9JA 4CM7A 3JYOA 2GD1O 3JYLA 3W4KA 4CQLB 2O3TA 3BA1A 3FNGA 3QWHA 3U9LA 1VL6A 3ZGYA 2GPTA 1U3WA 1RPNA 2IZ0A 4JNKA 4NBUA 3GZNA 4Q3CA 5F21A 2G1UA 3QY9A 4NBWA 2Z5LA 5CDUA 1NXQA 5CG1A 3QSGA 2J6IA 5TC4A 1HTBA 2OGUA 5I7EA 4PLGA 3DB2A 5LCXA 5TNXA 1E1KA 4F45A 2YJZA 1WXDA 3I9NA 1H6DA 5KIAA 2I99A 4R3WA 1XR3A 2FP4A 2FSVA 3DOOA 1SPXA 4CLHA 4BO5A 1YBAA 2Y1DA 1LU9A 3I83A 1R37A 1IUKA 4IUYA 2PKQP 2OO5A 1QORA 4BO1A 4YJGB 1UXGA 3T4EA 1QYVA 4Y6SA 3DZBA 1CF2O 1PS8A 2PZJA 3E82A 3TWOA 4CMCA 4E2YA 4GPD1 2DQ4A 1ISIA 5GZ1A 2YZ7A 1E1MA 1U28A 3D3WA 2RAFA 1LLUA 4YDRA 4Z0TA 1SMKA 5MDHA 1KYQA 5I9MA 1ZJYA 2AG8A 1WNTA 3C1TA 4NBVA 4Y6PA 2JCXA 4WLVA 4IS3A 1Y8RA 3L07A 4DWVA 3LSYA 5LC1A 3K73O 2EW2A 1Z75A 2JD1A 1V3UA 5L9AA 1PQPA 3GPDG 1DPGA 2QG4A 5CG2A 1B8UA 3G1TA 3D5QA 2CDCA 4R1NA 2X7HA 3PI7A 1N2SA 1GV0A 1SOVA 2CUKA 3ZCXA 4BNKA 3L6DA 4M87A 3ZH2A 1M76A 1VSVA 3DBRA 1O95A 5GY7A 3KVOA 1UAGA 3BMNB 2JD2A 4H3VA 4J1SA 5JCXA 1BGVA 3WYEA 5TQVA 1ISFA 1MFZA 2DT5A 3IOYA 3ETGA 4PG6A 2G17A 1I3LA 5EERA 4ALNA 4J4HA 1C1DB 1YB1A 3E03A 3L9WA 1VE9A 1GU7A 4INAA 3VH2A 1TA4A 4DRYA 3VPHA 4J6FA 4CV1A 1KC1A 2Z1NA 1GV1A 1KERA 4CM6A 4WCFC 4N5NA 2VHYA 3MOIA 3OIGA 2A35A 2QYTA 1DB3A 1ADFA 1EEHA 1QSGA 4HFMA 4R1TA 2EV9A 5JDCA 4CMBA 2Q45A 3K2BA 2NU8A 3TL2A 3WFIA 4YAIA 3PLNA 4GWGA 3FR7A 4Y98A 4P8RA 3CTMA 3DXFA 3PYLA 3GDGA 4MP6A 4PFJA 4O63O 4EDFA 3O8QA 2PZMA 3I9LA 4WNIA 2C5EA 4Q39A 1SEPA 4UEJA 4IIUA 4GI2A 1T1RA 4GAEA 1ZSYA 2IZ1A 4IQ8A 4ALMA 3HNPA 1WMAA 1I3MA 2XOXA 4UVEA 5DP2A 4J0FA 4IXTA 1M66A 1DAOA 2B4QA 3AUSA 4MINA 2GASA 1AUPA 5ADHA 4L9RA 4A7PA 1DIAA 4GVLA 5L51A 4AFNA 3VZQA 1WZEA 3TNLA 2HJRA 2I66A 1LSUA 1T1SA 2G0TA 3GEDA 5A4DA 5JW6A 3D64A 1YS4A 3UICA 4XYMA 2YV2A 5JXWA 1PIWA 1Q7CA 2HSDA 2OBYA 1NFQA 2EG9A 4S3MA 1MP0A 5L4SA 5CP8A 1ZMTA 1PJ4A 2D4AA 1EVIA 4RVHA 4NBTA 4D42A 5B37A 1EK5A 4MIEA 3RASA 2NSDA 4XQEA 1AE1A 5JMWA 2ZATA 1Y9EA 2NLOA 3BHMA 1OAAA 5A9SA 3IKTA 5C37A 1DJNA 3ZWOA 1EQUA 5DZSA 1GQ2A 3S2FA 4B8WA 3EUWA 1UZNA 4XDYA 4FN4A 1PS0A 5DBGA 5KJFA 2Y1OA 4QX6A 3IP3A 4UUMA 1B14A 3WQQA 2DKNA 1DJQA 3FTNA 5BSGA 2EF1A 1VJ0A 3EHEA 2OFPA 4IZHA 1O0SA 1AGNA 2VQ3A 2YUTA 5JCJA 3RJ5A 3I9MA 1X13A 4BQPA 5T57A 4YAEA 5DP1A 2DBZA 3IJPA 4CMEC 1X7GA 4XEHA 3BTVA 4FBGA 4YR9A 3NRCA 2Y05A 4PZCA 4JLWA 1MG0A 3ANMA 4A2CA 2Q2VA 3UAGA 4OQYA 3M2PA 4NJMB 3U62A 1E6UA 4BB5A 4N54A 2GLXA 4EUHA 1PR9A 3ZW9A 1N5DA 3RUFA 4J90A 5B1YA 3F4BA 3RKRA 3K8ZA 3WMWA 3PGJA 1OBFO 1UDAA 3DZJA 4ROSA 5JAIA 2O4UX 2X22A 3BAZA 4IM7A 1IZ9A 2XXBA 3VH3A 1C0IA 3QWIA 4TRNA 4C7JA 1Z82A 1PQWA 2BGKA 3QRWA 3WGHA 3NTRA 2UV8A 5KKAA 3SLKA 1NTOA 4Z3DA 2BI7A 3OH8A 1KEWA 2VWHA 4OOEA 5JDIC 3H4VA 2BMAA 2GF2A 1SZJG 1ZK0A 2ZIZA 2GN9A 4KOAA 4AJNA 4E2ZA 1E3WA 1FDTA 4L74A 5C3MA 3GZNB 5EJ2A 1T2CA 1L7EA 4MJLA 4XGKA 4AJ2A 1E7QA 1HDRA 4OMUA 1ISJA 2EEZA 2FMUA 4JK3A 4J4BA 3JTMA 2WD8A 1IL0A 3H9GA 3VHRA 2XAAA 1JVBA 3F5QA 4Z3KA 1PU2A 3NTQA 4JJIA 5JAZA 3GDFA 2RIRA 4WCFB 1NFFA 2VWQA 3CH6A 2V65A 3LC2O 3RU7A 3KETA 3VPXA 1U3UA 4L75A 4R5HA 3AOEC 2VNSA 1BXGA 4XKJA 4YB8A 3VPGA 3WIDA 5J23A 1DFIA 3EAGA 2P4QA 4BKRA 1Y1PA 3ORFA 2UYYA 3RBZA 1R0LA 5BNFA 5ILOA 3MJ4A 4PG8A 1U3TA 1KETA 2DAPA 3ONEA 3PJGA 2D2IA 2P68A 3OJOA 1LSJA 3G3EA 4J43A 4W99A 1E3JA 4CR6A 2VRCA 2YHUA 1DIRA 3JD1A 4MVJE 5I9LA 3DMTA 4ZN6A 5BSEA 4L0QA 1DLJA 4RORA 2Q1SA 3MTGA 5G0VA 5L40A 4EEZA 2DBQA 3ANLA 4D45A 3L4SO 3O9ZA 3F47A 3KSDO 4HBGA 3S2GA 2BHLA 3LF2A 4CR7A 1QYWA 1O8CA 3QVWA 4LMPA 5THQA 1GAEO 2E49A 3P2YA 4J1TA 1CDOA 4G65A 3ONDA 4NDNE 1EVYA 4FC6A 4BNMA 2H5LA 5IZCC 3Q3CA 5L7WA 5JSFA 1ZK3A 1QR6A 2WJPA 1UAYA 2WE7A 4LK3A 3IS3A 2HMWA 2RCYA 4RF4A 3B1KA 3DHEA 4R69A 4F6CA 2O2SA 3FBGA 1GYQA 5FWNA 5F5NA 3GR6A 1Q0LA 2Y1FA 4CLRB 5ILGA 4QEDA 2X5JO 3LF1A 3EMKA 2NNLD 3K5PA 1YOVB 3WGYA 2B35A 2IZZA 3JD2A 4BGUA 3O38A 4JBHA 1E92A 1HYEA 1P45A 4WLOA 3JQ8A 3IC5A 1W4ZA 2VUUA 3O4RA 1NAHA 2J5QA 3P2OA 3OA2A 3WGIA 2J3IA 3DEYX 4RLSA 3FWNA 3U3XA 1UXHA 1Y6JA 2FHSA 3HB4X 4MVJF 3UHAA 2WSBA 3FN4A 2PY6A 4DMMA 3MJVA 3K96A 3VKVA 1BHSA 1KS9A 4W9NC 4OGWA 3JQ9A 2O7SA 3RC7A 3FNHA 2QW8A 3PQFA 1L1FA 3ZU4A 5GZ6A 1PTJA 1U4OA 3U0BA 3H9QA 1NPDA 1PWZA 3DZIA 4Z0PA 4I5FA 4FJ1A 4ZJUA 1P33A 4ND4A 3RROA 1J5PA 2CY0A 3TSCA 4AJOA 3IL2A 1R66A 4FQ8A 2EP7A 4HFJA 3E6AA 5A5EA 2C54A 3E9MA 1E0DA 3OIDA 4IGFA 2HQ1A 5H83A 5CDYA 1GPJA 4RVDA 3KEQA 3IIEA 4QECA 4HNHA 4LGVA 4MIYA 5CAEA 1C0PA 4XWYA 2ZYGA 1P0FA 3GNSA 5AXCA 5IZ4A 4KUHA 2GSDA 2HK9A 3GHYA 4AL4A 4HUJA 2DTEA 3ROQA 2OXIA 4YJGA 3W8EA 1H2HA 3PP8A 1Z74A 5B4TA 4II2A 1ZXLA 3OMLA 1B7GO 2R6JA 4C7KA 2PH5A 1PWXA 4MDHA 5AXDA 2XF8A 4GGPA 4OOFA 3I9KA 3P7MA 1FXSA 3ZHXA 4A26A 2IODA 1G0NA 1I5RA 1PS9A 1TVEA 1XU7A 2J3KA 1YL6A 3TZCA 1C14A 1NWHA 1R6DA 2NU9A 5IDXA 4FD3A 1IY8A 3V2GA 3GUYA 4NIMA 4BS9A 4YJHA 3G79A 2X1HA 3GA0A 1U2GA 3GMDA 3MJCA 3PHLA 4LCJA 1A27A 4O6VA 4BNYA 1VM6A 1UDCA 3FRJA 1NVTA 3F4LA 3PLRA 4MVJM 3D4NA 3VDRA 1UZMA 4Y9DA 1RWBA 2W2LA 2PGLA 4D44A 1M6HA 3RWBA 1DSSG 4DTIA 3AY7A 4DQXA 4ALJA 4R68A 5C7IO 3V1TC 2GYYA 3AY6A 1YH3A 3WGQA 5L7YA 3F5SA 2Y0EA 4O5OA 1U8FO 1FDSA 3BMNA 4IXWA 2CVZA 4ND3A 1E3SA 3CMMA 1E77A 1C1DA 2A4KA 1YGYA 3UCFA 4IJKA 4N18A 2ZB4A 4O0LA 4P38A 4J91A 4W4TA 3AK4A 4BL5A 1T4BA 1V3VA 4YJFB 2PR2A 5H81A 3IKVA 2Y66A 3CKYA 3EK2A 1U7HA 3OA0A 4JBIA 1E7SA 4K26A 1J6UA 3I5MA 5C7LO 2VTEA 5HA5A 4RZIA 2DFDA 3S55A 3E48A 2NWQA 3B6ZA 1NR1A 4NH4A 5AVOA 1VRWA 4FFOA 3IUPA 4LSWA 4IPTA 1DAPA 4UUNA 4BKUA 1E3WB 4BNZA 4DBVO 1LTHR 3ADOA 1CIVA 1NHGA 4YTEA 3WJAA 1BVRA 3D4OA 3A1NA 3HDHA 4B3HA 4EYEA 3VVCA 5HTOA 4Z6KA 4YACA 1GPDG 4MPDA 3RUEA 3OM9A 3G1UA 1ZK2A 4PG5A 4KDEA 1OFGA 4Q9NA 4XGNA 1GCOA 5G0SA 5G0UA 2NU7A 4Z9FA 5DF1A 3RVDA 5TLSA 3ZZNA 3EVTA 5EL0A 1KVQA 4BNLA 3UVEA 1QP8A 4P22A 1ZFNA 2ZTUA 2HMVA 4HFNA 1ENZA 3ZWYA 3HDYA 1E3IA 4G5HA 2D5CA 4I9HA 5DULA 1T24A 1NPYA 1P77A 3FBTA 4LSMA 2C7VA 1EUCA 1E3LA 1MFPA 3DFZA 3S8MA 1H6CA 1ZXBA 4OSPA 4ITUA 4DMLA 4E5PA 1HF3A 4WEOA 4YBZA 3H2SA 1RYEA 3VTZA 4DREA 1EBUA 3KUXA 5KNLA 5EMHA 5IN4A 2W2KB 3G0OA 2VYVD 2PNFA 4AJEA 3ENNA 4BO6A 4ONEA 5T8KC 2CFCA 4WPGA 4D3DA 1AHHA 3C7CB 3WSWA 1LRLA 4MOWA 1U8XX 4FFRA 2D8AA 3MZ0A 4NK5A 4J7UA 3V1UA 4IGEA 3GN1A 4PG4A 4WLNA 1GUFA 1XEAA 4MVJD 1RM4A 4YT2A 3PJFA 1B0AA 3MWDB 1VKOA 1IPEA 1U5AA 1F0YA 3IQDB 3LC7O 2DLDA 5BNIA 3WLFA 4EJ0A 2BKAA 3GGOA 1ULUA 5L45A 3WLEA 2PGDA 1SOWA 3GLQA 4CPDA 4DPLA 5L95A 1GZ3A 1EVZA 1LC3A 1M67A 1ZJZA 3PK0A 3WYBA 4U8GA 1J49A 1PJQA 4CM9A 3OBBA 1FK8A 5U4QA 2HAEA 3R1IA 3NUGA 1DIBA 4I5DA 2X86A 4H16A 4OXKA 4S1VA 4YXFA 4XGIA 3ZU2A 3EYWA 4PRKA 2P2SA 2ZTMA 3CEAA 2C07A 2VWPA 1JWAB 4WLFA 1VL8A 2HRZA 1RM0A 3WX0A 4B7CA 3FPLA 3AM3A 5U9CA 2LDXA 4BVAA 3V5NA 1PJSA 4GL4A 5DOVA 3W8DA 1AHIA 3HADA 3G17A 3QVSA 4FFLA 4XR4A 3DAPA 3ANNA 4CUJA 4DPMA 3LC1O 5G0WA 5AXAA 2HLPA 3ABIA 4HNGA 2NM0A 2GN6A 4XQ9A 4A03A 3PZBA 1D3AA 4HX5A 3CE6A 5T67A 3ROKA 4BKQA 1B3BA 2VT2A 4E5YA 4WJZA 1VJTA 2I3GA 2C5AA 5A1TA 4ALIA 2FOIA 5G0TA 3U4IA 4LMRA 4PCVA 1A72A 2X9GA 2X5OA 2QYSA 2OORA 3FNEA 4CM5A 4WCDA 2NVUA 4UVDA 1NNUA 1NVGA 4ESOA 4WCFA 2YY7A 2O3QA 4QT0A 2LDBA 4R54A 5ICSA 5CPFA 1DEHA 3QW2A 1GR0A 5ES3A 1T2DA 2V7PA 3Q1LA 3JQFC 3BHIA 1GFSA 4JN6B 1PGJA 1EDOA 4FJ2A 1J4AA 1O6ZA 3OETA 1HE2A 1K89A 1ISMA 2NACA 3DBVO 1IE3A 4IDFA 4RF3A 1T2FA 2V6MA 3PZRA 2FZWA 2DTXA 4IDBA 2PKQO 1PX0A 4A10A 3UN1A 3TRIA 5I7VA 3CUKA 4XR9A 4BNGA 4E4YA 5KCZA 1ISHA 3KOUA 1JKIA 4YJHB 2VNAA 2BELA 4NFYA 3B20A 2H9IA 1YRLA 4Z9YA 3PJDA 3Q9UA 2Q2WA 2Y67A 3WBFA 1ZSNA 1I36A 5A06A 2GZ1A 4DLAA 2Q2QA 4XJSA 1IB6A 4L4SA 1I2CA 1KBZA 2JFGA 5KJEA 1HDGO 2GNAA 1Z7EA 1YL7A 1EE9A 1AXGA 4E3ZA 3TFOA 2HRBA 1ADBA 4FW8A 3FHLA 1LDMA 1V8BA 1S7CA 3GH3A 3PEFA 2O23A 1E7RA 1SO8A 1PZEA 4NU6A 1GADO 4J16A 2ZB7A 4B4UA 1FMCA 3RAJA 4AJJA 1H94A 3RFTA 2W98A 4CLRA 3ITKA 4CMIA 3INGA 3BMOA 5A9RA 7ADHA 4WE3A 4RGBA 4MKXA 5DCWA 5A5FA 1YOVA 4NG5A 1A71A 2J8ZA 4YQYA 2EW8A 4TROA 1U2DA 2YHIB 3VZRA 1ORRA 4E21A 3D0OA 3KTDA 3DTTA 3N58A 5A3VA 4CQMB 2JAHA 2X9VA 2QHXA 2CZCA 1KVSA 2O3JA 2EJWA 3NTOA 5JYDA 2ZCVA 3QHAA 5MGBA 4RQUA 2B37A 3JQAB 3U4DA 3RU9A 1CQIA 4D46A 3U5TA 1JTVA 3GDOA 4PLCA 3WWZA 1TLTA 1FJHA 1NFRA 4E5MA 3RUHA 1LJ8A 4CMEA 3K30A 4L73A 1EZ4A 1HT0A 3WIEA 1BTOA 1ZCJA 2BFPA 2VN8A 1P74A 2JHFA 4BO3A 1JDJA 4NHEA 3PRJA 2J5KA 3AM5A 4XIJA 4MVJP 4EITA 1JLLA 1W6UA 4BNFA 4PLZA 4DC1A 2FWMX 1ULSA 3LVFO 4RDHA 1LLQA 3GOHA 3EW7A 5T64A 2VTDA 1U9JA 1ZKMA 9LDTA 2C2XA 4ZQBA 2Q1UA 3Q0EA 1XQ1A 2NTJA 3QWAA 4Q3DA 2CD9A 1LUAA 3M6IA 3X2FA 5EQFA 4PLPA 5JAMA 3ZHZA 3IAHA 3ZV6A 2NVWA 1K6XA 3TL3A 3I1JA 1N7HA 3EDMA 4R1SA 5TS3A 4DLLA 5JDIA 5JMPA 2PD4A 3R3JA 3RJ9A 3HUDA 3GAZA 2QIOA 3D4PA 5JO9A 1UJMA 3GC6A 3I4FA 4J4TA 2ZJ0A 3JQBC 4CLOB 3C7DB 1FF9A 2A92A 2BLLA 4BMVA 1FDVA 1JKFA 2YYYA 1GYRA 4NNJA 3R3SA 2NQTA 4TWRA 4IMRA 3Q2IA 2DTDA 4J0EA 4CLXA 3PFFA 3RC1A 4CM1A 4Y6RA 2JFFA 4MP3A 3GUCA 2X23A 4FR5A 2WWRA 4A0SA 5HWSA 3KM0A 3OHSX 4XRRA 3FWZA 3FI9A 4L4XA 4IJVA 4AJHA 4E30A 4I9UA 1Q0QA 1C0LA 3RFXA 3DQPA 1HDYA 4ND2A 2OL4A 4QQRA 3AOEA 2YQ4A 5JCJD 4PGFA 4BGIA 4QO8A 3LLVA 3NEPX 3AUTA 2OMEA 4K9DA 1I0ZA 4UVIA 3KV3O 2ET6A 2B36A 3E5MA 3DHYA 4BNHA 4JX8A 1W8DA 3VPSA 2O2YA 5JPIA 1DBVO 4ALLA 3PHJA 1JWBB 4B4OA 3PTZA 3T7EA 3LZ6A 2IE0A 4XCVA 3NT4A 4RQTA 3I4CA 8ADHA 1GCUA 4D0RA 4YJFA 2C0CA 2FR8A 4D41A 4DYVA 4FGSA 1EK6A 3INTA 3JD4A 4J7CA 3MJTA 4RL6A 3VDQA 1VC2A 1I33A 4RVSA 1P1JA 3W4JA 2BGLA 5IZCA 1MV8A 5L3ZA 1CWUA 3S2IA 1EVJA 1ISGA 4GGOA 3WICA 4ILKA 1EMDA 2JL1A 3ZWPA 5FF9A 1UZLA 3WGZA 1YVEI 1YQDA 4RPKA 3ZNQA 2HDHA 3ASVA 4XIYA 4QFDA 5F1OA 2D3TA 4TVBA 4OJNA 5I8ZA 1HSOA 4HV4A 5JAQA 2PZKA 1V35A 2VZ0A 2QZ9A 3COSA 4DXHA 1XCBA 4IDEA 2UVDA 1M6WA 2HK7A 4JROA 4R16A 5TT1A 5DOZA 2NVUB 5B4UA 4HXYA 4TKMA 3PPIA 1HYGA 2RH4A 3L6OO 2GN8A 4NR0A 4E31A 3V2HA 1W0CA 2JCVA 3JSAA 4OKIA 5FI3A 2IXAA 2G82A 2X0RA 3C85A 1DO8A 1LI4A 2OUIA 4A73A 3DOCA 3F1KA 2F1KA 5CEFA 2GR9A 4FS3A 4W9NA 3F6YA 1GD1O 2B5WA 2DPHA 3QVTA 7MDHA 1LDBA 2YV1A 4UVHA 1EUDA 4BO0A 5JS6A 3ETEA 3JD3A 1DIGA 1A5ZA 2F00A 3TQHA 4Z9XA 2FR1A 3KZVA 1O9BA 5DDIP 1YQGA 4GX1A 4U0KA 4M55A 3W6ZA 3ZWWA 5I7FA 1LEHA 4UVGA 2W2KA 5TJ9A 2WM3A 2PTGA 4EUFA 2GUGA 1E5LA 2Y68A 4W7HA 3HE3A 3L0DA 4M89A 3HHPA 2YDYA 1XGKA 4PRLA 1NR7A 1LA2A 3WNQA 2CSUA 5IJZA 2VRCD 1JW9B 4AJ4A 3W1VA 1IULA 1XQ6A 4PLFA 2DBVO 1LDEA 2C29D 2Y99A 4L8VA 1OC2A 2EJVA 2IYPA 3WMXA 5DCUA 3GT0A 1H9BA 2DUWA 3V2UA 5C7OO 4D43A 2RHCA 1HZZA 1CERA 1PGPA 3PQEA 5FYDA 4CMIB 3BMOB 3TZHA 4BGEA 3BXXA 1WVGA 4WKGA 1NP3A 1JAXA 1DC4A 2RHRA 2GZ3A 3HDQA 3QV1A 2PD6A 4D3SA 1LXCA 3ZWBA 1BW9B 2FPPA 2BF7A 5CDGA 4BO4A 1N7GA 1C3VA 3K92A 3GVIA 1YBVA 3LQFA 2BFOA 5LDGA 2E6UX 1ZNQO 2OP1A 2TMDA 4CUKA 1GUZA 3TDKA 4BB6A 3MTJA 1I2BA 2FSSA 2I6TA 4MIOA 5BSHA 1X0VA 3F3SA 5DNAA 5B4VA 4D79A 1JKJA 3GF4A 2X0IA 3DDNA 4MVJH 1Y5MA 4DBZA 1CJCA 3PWKA 1I3NA 2DC1A 3OEWA 1ZIDA 4XX0A 1WDMA 3DR3A 4IQGA 3PIIA 1PGOA 2VRBA 4JP3A 3B1FA 4PLTA 3LT4A 1K3TA 3AI3A 4DPKA 1H0KA 3DHNA 3IJRA 1PJBA 5ENDA 5FFFA 4JBGA 5F5LA 5ITWA 4OQZA 5ER6A 1DHTA 1PJ2A 3HN2A 3JQ7A 4EJMA 1VKNA 4OL9A 4BNWA 3ULKA 3OJLA 2Y1GA 2IEDA 5TSDA 3GVPA 3TZ6A 3OP4A 3OSUA 4CMAA 4E32A 2X5KO 3BMCB 1TT5B 2B4RO 4ALKA 3NYWA 3O26A 4NZ9A 5KVQA 3F9IA 1P1KA 5CEJA 4ID9A 2O7QA 3RKUA 1T2AA 1GZ4A 1UP7A 1KOLA 1PJCA 1ZEMA 2VHXA 1V3TA 5B12A 4GVXA 3UCXA 3GFBA 3DTYA 4U5QA 4CLDA 4FB5A 3WG9A 2AQHA 2HO5A 3RBVA 4UEOA 5A3JA 3T4XA 2BFMA 4E5NA 1B16A 4AG3A 3KEOA 2NV6A 4YQZA 4DYDA 1QKIA 4II3A 1GUYA 3W6UA 1C1XB 3TPCA 4OH1A 1MXFA 1YJ8A 1CYDA 3D3EA 5EIOA 3SX2A 1MUUA 3I6QA 4RVFA 3H5AA 3TFQA 4NMHA 3UUWA 3WGGA 5CHEA 4R01A 1JA9A 2NQ8A 4R4JA 1PJLA 3OJFA 1R4MB 3NDIA 4N7RA 3ZNOA 4BO8A 3U09A 1BDBA 1GEGA 4FJ0A 2OP0A 2Q3EA 4Y67A 1Y81A 4JCOA 3ZWCA 2WYVA 4BO7A 4DA9A 2D5AA 5IFLA 1Q1NA 2P5YA 4CMJA 5K9ZA 1LLDA 1VL0A 1OZAA 3AY3A 3BHJA 3PHIA 2P9GA 4GSKA 2W2LD 5DT9A 5JFOA 3CIFA 5ENVA 1Z45A 2HKIA 3ZV4A 4WEQA 4ZHSA 5BR7A 2WYUA 1TXGA 4UEKA 3SXPA 3UF0A 1K6JA 3R6DA 4M49A 4C4OA 2D59A 2ZK7A 3NJ8A 1XSEA 5JY6A 1E7YA 1RM3A 1NX6A 1E1NA 5DCYA 4AJ1A 3GG9A 2YHIA 4TQGA 2VHWA 4L76A 4EGFA 1VLLA 5T8KA 3VH1A 2R00C 4AJLA 4PLVA 4CQMA 3B70A 1AN9A 3QLJA 2PZLA 5JBIA 2RBEA 5TGDA 3HN7A 4O59O 2WTBA 3KSZO 3DC2A 3JQAA 1E1LA 1HE3A 3SEFA 1L7DA 3D1LA 1UP6A 4IJWA 2FZEA 3H9UA 3QWFA 3C1OA 4YRAA 1YDWA 1BRMA 2UUPA 4IIVA 5ICMA 1WP4A 1UXIA 1I10A 4TZTA 5KWEA 4YCAA 1A9YA 3NGXA 3PQDA 3UOGA 2Y1EA 4RJTA 3L9XA 4HP8A 2VYND 3NKLA 1MG5A 3ETDA 2NTVA 3NGLA 5H82A 4X54A 5JC1A 4KZPA 2Q46A 1T26A 4BGVA 1N92A 3EGOA 4CV2A 1ID1A 4EEXA 3I9OA 1FDUA 1NAIA 1GTMA 2RH8A 2NADA 4KQWA 4K1LA 3RUDA 1SBYA 1MB4A 3W4IA 1HLPA 1O94A 1Y8QA 2ZKLA 3ON5A 3N7UA 4JQCA 4BV9A 1N9GA 2QX7A 4RF2A 5TJHA 4OAQA 5FEUA 3I52A 3DZHA 1P3DA 2Q49A 4YT4A 3FF4A 3LK7A 1V9LA 3HFSA 1HDOA 4ND5A 4CMHA 3NT2A 4P4NA 1GQYA 1YB4A 2CVQA 1QMGA 2NUAA 2I76A 3WS7A 3WDSA 1H2BA 5BNTA 3AI1A 3PYMA 4MKZA 3PIDA 1EDZA 4PZDA 1B8PA 4CLOA 5T6BA 3AFMA 1E6WA 2X9NA 1H9AA 5JNLA 4AVYA 2EGGA 3BIOA 1KC3A 1XA0A 1Q7GA 3PVZA 1BSVA 3PDJA 2P9CA 2WD7A 3FD8A 3KLPX 4BMSA 5AQ1A 4Q3NA 4J49A 4PVDA 2FN7A 2C59A 2ZQZA 3EZLA 3JQEA 4WUVA 4FOOA 4WGGA 4MVJA 1LX6A 3A14A 3I23A 4JP2A 3WWYA 3K2EA 4PG7A 3JQFA 4M8SA 1OC4A 2O3UA 1DFGA 1J0XO 4DIOA 3PJEA 4QO7A 2EERA 3WB9A 1I30A 4XB2A 3SJUA 1S6YA 1IOLA 1B3RA 3OQBA 4A27A 4XQCA 3GRKA 2P5UA 2H63A 1QYDA 2NVBA 4J7XA 4YA6A 3TZQA 4BHTA 3ADPA 4EW6A 4YWJA 5K6AC 4CM9D 1ENPA 1ZK1A 3DBHB 2JHGA 2AEJA 2V6BA 4EI2A 3FR8A 5CDSA 4D0SA 5I9NA 5DN9A 1V6AA 2EKPA 2VOJA 1KIFA 2DVMA 3C3XA 3E1KA 4OSOA 5F3RA 4B3JA 1R4NB 3AJRA 2C2YA 3NAQA 1GDHA 1XELA 1CRWG 3Q9NA 1PL6A 1UXJA 1P44A 3R0IA 5HM8A 3RC2A 1IPFA 4YAGA 3N74A 2FPGA 2AE2A 1TEHA 1DC6A 4XA8A 4CM4B 5L4LA 3ZHYA 4TRMA 4A5OA 3ZU5A 1R16A 2G76A 2IDZA 3WJ7A 4CJXA 3VOSA 3FNFA 3LYLA 4R5MA 5DBFA 3RUAA 3JQ7B 1U5CA 3ZI0A 4XYLA 3DL2A 1SB8A 4FOSA 4GMGA 2W8ZA 3LT0A 3A9WA 2POQX 3HZZA 3MEQA 2AA3A 1K5HA 1Q7BA 5ITVA 3GK3A 2Q1TA 5EESA 3E8XA 5EPOA 1BVUA 1G1AA 1LRKA 2HMSA 3B1JA 3UXYA 3ENKA 4ZQGA 3DAFA 3ZU3A 5I7SA 2B83A 2C20A 3DFUA 5U1PA 1HEUA 2ZB8A 4IDDA 3NV9A 1MX3A 3NDJA 1F8GA 3EY4A 1DC5A 1B26A 4RPJA 4XD2A 1DFHA 2UUOA 2HCTA 3EC7A 3WGTA 4U6QA 4DC0A 4B7UA 4MVJI 3L4BC 5TIIA 3X2EA 1DRUA 2O3SA 3LT1A 3ROPA 2EKLA 1MA0A 2D0IA 2IRWA 3E18A 4LRSB 1QG6A 4WECA 4E13A 4CL8A 2AEFA 1HWYA 5IG2A 1X1TA 3H8VA 3KXDA 4KTVE 4ZD6A 1OMOA 4TRRA 1Z7BA 3WTBA 3FCOA 1ZBQA 2FR0A 1D1SA 1ZSVA 3QVXA 1I3KA 3QWBA 1DHRA 1PSDA 2EP5A 4R3NA 2W4QA 4IMPA 3GZ4A 4ZRNA 4HADA 2ZCUA 2B4TO 3ZV5A 3F46A 3HB5X 3UH1A 2HUNA 4ZQHA 4AICA 2YV3A 4IDAA 1R12A 1P9LA 1PR3A 1XLTA 1JVSA 2Y1CA 4J1QA 4KP7A 4K6FA 2VOEA 3VAZA 1T2EA 4NU5A 5JYEA 4ZRMA 5JC8A 5HRUA 1XYGA 4FCCA 1V0JA 2R2GA 1PZHA 4P4LA 4E5KA 5C5IA 4OHUA 3RI3A 1IHYA 5DBIA 1PZGA 5IDQA 2Q99A 1BW9A 3JQBA 4XZ3A 4DIFA 4CV0A 1BG6A 2VZ8A 2UAGA 1Z73A 2PD3A 5COBA 3GEMA 3K9QO 4F46A 3LT2A 1RM5A 1ZZEA 2Z1MA 3STHA 1W73A 3KYCB 3C8MA 4GH5A 1NVMB 4CUZA 2E82A 2CDAA 3D5TA 1ZH8A 3DMYA 5A03A 1UR5A 1BWSA 1X7HA 3UCEA 4IINA 4HY3A 1NQOA 2PLAA 1B2LA 3AFNA 3JV7A 2CMDA 2PFGA 8LDHA 3A06A 1KY5A 1CEQA 4YAJA 3TN7A 4E0BA 1I01A 4URFA 3JCZA 3P5SA 4ZQEA 2IYOA 3H3JA 1SCUA 2CF6A 2PGJA 1NASA 1F06A 3UFXA 2GDZA 3C24A 1I8TA 2EIHA 3VVBA 3ST7A 4UUOA 3ICPA 3OICA 3FTPA 2I65A 3E5RA 5CFZA 5G4KB 4CLEA 3MJEA 1D8AA 1UH5A 2ZB3A 3JD0A 3V8BA 1MLDA 3CSDA 2YFQA 4YT5A 3TOZA 4XYBA 1EUZA 1KEUA 1YJQA 1ONNA 4NFSA 2O4CA 4RF5A 1E3EA 2X0JA 3BMCA 1TT5A 1Y8QB 2VT3A 1G0OA 2Y0DA 5TT0A 1N9GB 1H6AA 3H7AA 1BXKA 4PIVA 3RFVA 1H93A 2EWMA 2Q1WA 3QJ5A 3SJ7A 3M1LA 4FFMA 2P9EA 3U4HA 3WQSB 1A4IA 2HMTA 4RLHA 4RCVA 2J3JA 1Z6ZA 1F14A 1F17A 3VZPA 3ZWAA 4B3IA 1Y7TA 3DZFA 4ZGWA 2Q4BA 2AEMA 1DXYA 4CM8B 1YKFA 3GGGA 4XRGA 2GO1A 5CEEA 4R41A 4KDFA 1Q0HA 4RVGA 5IXYA 3MWEB 1DOHA 4E33A 3BMQB 2I5PO 2OBNA 3ITDA 3W8FA 4BMNA 4BQRA 1C1XA 3DONA 4GKVA 4CODB 2OZPA 5JY1A 2WD7B 1Q2XA 4Q3EA 1D7OA 4GQAA 5THKA 1PJTA 1X15A 2O3RA 2YDXA 1P31A 4R9SA 3GN2A 3RC9A 1R4MA 4BNIA 2BGMA 4EUEA 1Y5RA 2ZYAA 4YAKA 1I24A 4ZICA 3DWFA 2VHZA 4I5GA 2VUSA 2XXJA 3OJEA 4D7AA 4E6PA 1ARZA 3GRPA 3I3OA 4PN3A 1DRVA 1ZK4A 5JDCC 4DIBA 3MJSA 4IQ0A 4E12A 3UGKA 2A9FA 2PA3A 1NWCA 4R51A 3CZRA 4K6CA 2AQKA 4KWHA 3KB6A 4JJGA 1LDNA 3GAFA 4XQGA 2AHRA 4JIGA 1H6BA 2HMUA 3ZN2A 1E5QA 4J2HA 1P0CA 3VC7A 3DBLB 5KJ6A 3PGXA 3GY0A 4XYEA 3KYDA 4EZBA 3HFGA 2CNBA 3RUCA 1QLHA 3PHHA 3IP1A 3QIVA 4AJIA 1NBOA 3INRA 3AW9A 2H1SA 1YBMA 4UAGA 3WFJA 1BXZA 1PGQA 4WLUA 3C1AA 4Z0HO 5K0ZA 2FRDA 2JCYA 5KKCA 4GX0A 2WDZA 1GEEA 3CMCO 3JYNA 1HDXA 1PJ3A 1KVUA 4J9VA 3JYPA 4JXKA 1GZ6A 2HU2A 1P1HA 2ZJ1A 3VPFA 2EGHA 4TSKA 3UW3A 3HWRA 3WBBA 3OQ1A 4TKLA 1ONPA 3OFSA 4IDCA 3PHGA 2CDBA 1E7MA 4U7WA 1ZUD1 3KBOA 1WZIA 4FC7A 1N8KA 3ASUA 2QRLA 1X14A 4LN1A 1HE5A 1TB4A 3OEYA 4I8XA 1ML3A 1UDBA 1K0UA 1XU9A 2TMGA 1CETA 1SB9A 1ZMOA 4TZKA 5A02A 4OYRA 3L77A 1HE4A 3SVTA 5HBRA 5A9TA 4QUKA 5BSFA 1QLJA 4FDAA 4NFHA 2GERA 3MOGA 4GWKA 3C7AA 4KTTE 1LQUA 2DBRA 4KWIA 4FFPA 5TX7A 1RKXA 3LDHA 1C0KA 3WYCA 3A4VA 4KMSA 1OI7A 4HWKA 4BNJA 2EKQA 1K2WA 4GBJA 1RYDA 2EHDA 3FPCA 1DC3A 4IZIA 4M1QA 2Q4EA 1U7TA 3TZKA 2VUTA 4GLOA 3S2EA 3WTCA 3HJAA 4WLEA 3GVXA 4YVFA 2V6FA 3GGPA 3VKUA 4BO9A 5G4LA 1O89A 2GN4A 2W90A 4IBOA 2O48X 1U4SA 1IHXA 3GQVA 4PLWA 3QVOA 3JYQA 4N5MA 4P4GA 4D3FA 4I9NA 5HS4A 5G2OA 4G81A 1D4FA 3SBOA 4RVUA 3K6JA 1KVTA 2I9PA 3D3WB 4KUGA 1M75A 1UP4A 1E7WA 1WMBA 1WDKA 2QRKA 4J2OA 4R9RA 1AXEA 3I9JA 4F3YA 1EE2A 3M1AA 4AJKA 3GG2A 4JGBA 2GGSA 4BNUA 1NHWA 2NTNA 1HSZA 4PLYA 2E37A 4WASA 1Y8RB 2WEKA 4H15A 4LVUA 4PVCA 1GYPA 1PZFA 1XDWA 3BZUA 2CF5A 3WNVA 4ZQFA 2BFAA 3NDRA 1JN0A 4RPGA 3QE3A 5EN4A 3QA9A 3AOGA 5IDYA 5KVSA 1LSSA 1HDCA 2ZTVA 1MGOA 3KO8A 5JLAA 3OJ0A 1SEVA 3AM4A 4I08A 2GRAA 3KRTA 3IDSA 2DM6A 3L6EA 3PWZA 3WOHA 4DLBA 1KEPA 2AQ8A 3AUAA 2OHXA 2CVOA 3OF2A 3DBRB 4E2XA 4Y8VA 3M2TA 2Z95A 1A7KA 1I2ZA 1O5IA 2NU6A 3IUSA 3DBHA 4NI5A 1YWGO 3T7CA 1RJWA 1K6IA 4OXNA 3BTUA 4BKOA 3UKOA 5KOIA 3IMFA 2FPIA 1BDMA 3K31A 1LLCA 1N1GA 4TMFA 3ZW8A 4G2NA 4CV3A 1R4NA 2VZ9A 2J5RA 1MC5A 2PKRA 4OO3A 5I8WA 2X58A 3TOXA 1HZJA 3U4CA 3V1YA 4CM4A 1X7DA 1SNYA 1NPTO 3PYXA 4TRJA 2DPGA 3FSRA 4FIZA 3JQCA 4RPHA 1WAMA 4LCEA 5ER9A 4YPOA 1PEDA 4RV9A 3RQSA 4YEDA 1GL3A 2WYWA 3H5RA 3HG7A 4J9UE 1EQ2A 3GEGA 3LLSA 4BNXA 3JQDA 4N5LA 2JKVA 3BTSA 5GZ3A 3HQ4O 4LW8A 2AQIA 3KLMX 1E6EA 2P91A 3O8QB 4OIMA 1TT7A 3HDJA 4B7XA 2ZTLA 2P4HX 5KJ1A 3ZHBA 3GFGA 3JQGA 4UUPA 5T5QA 2R00A 4AJPA 2WE8A 1DLIA 3KHUA 2YQ5A 4YRDA 1LDYA 1IYZA 4R1UA 2JD0A 2XPCA 4FFNA 4W7IA 4CQLA 3DMTC 2OOSA 3H3FA 1GY8A 1VI2A 3CXRA 4NBRA 4WOKA 4OM8A 3PWSA 2Y93A 1HLDA 1PL8A 1ENYA 2AMFA 1ZO8A 3Q2KA 4RZHA 1JU9A 1Y9AA 2I3AA 4RDIA 1JAYA 3ZWXA 2J3HA 3WR5A 4WK6A 2PWZA 1R0SA 4UREA 3TF5A 5TF4A 3RBXA 3I6IA 4U6SA 4GLLA 1EFLA 2QZZA 4H7PA 1LBEA 3TJRA 3ZDFA 1HXHA 5JE8A 2O50A 1DDOA 2QRJA 3S1LA 1YDEA 3ZWVA 1WPQA 1UUFA 4LRTB 3RCBA 1XIVA 2QQ5A 1P1FA 3GNQA 3ZNPA 1KEVA 5A9SB 1PL7A 5IAAA 3RD5A 5JO0A 4JJFA 1NQTA 4KQXA 4BNNA 4M54A 2FY8A 3WQRA 3DOJA 3DZKA 4YRBA 5COQA 5LDHA 4J3FA 1D1TA 1NQ5A 5IDWA 1GQQA 4CL3A 1PQUA 3PFWO 3Q11A 4PLHA 4DGSA 4LVCA 5A04A 1QV7A 5L53A 3VTFA 1ZW1A 3RIHA 3ONFA 4WNCA 1ONOA 4BV8A 3AUUA 2PV7A 4HFRA 1XG5A 2H6EA 4XJTA 1HDZA 3H2ZA 4MP8A 4RO0A 3AU8A 3JQ9C 4B4VA 3ICCA 3A28A 3GNTA 1YQXA 3MCVA 3KYDB 3NT5A 1R0KA 3GMSA 2C7GA 3H9EO 5F1PA 5AOVA 4F6LA 3GHHA 1BMDA 4I1IA 3OIFA 3ZWNA 3KYCA 1DRWA 3VH4A 2PK3A 1WDLA 4QSMA 1XWFA 3H6KA 1ADGA 1HL3A 4CQMD 3RUIA 2B0JA 1P1RA 1KVRA 2DFVA 2X8LA 3CZMA 3O03A 1JQBA 4GKBA 4E2WA 1WW8A 2SCUA 1T4DA 2X4GA 3JQAD 4CR8A 5KTKA 4CMGA 4Q3AA 4FSHA 4BNVA 4GX5A 3G49A 4XYGA 1YE3A 4BKPA 5KVVA 5L7TA 2PH3A 2E48A 2YFHA 1N1EA 4W6ZA 2X6TA 4YYZA 4NPCA 1A7AA 3D7LA 1U3VA 2WMDA 4KUEA 4DL9A 4CMKA 3Q6IA 4J1NA 4MKRA 1U1IA 5TRTA 5KJCA 1SAYA 4GX2A 4PZEA 1UXKA 3RSHA 3AU9A 2VYNA 5G4KA 3WSVA 1WWKA 2C82A 5K6AA 4IS2A 1LRJA 3GPIA 4Q3BA 3NJ4A 4EBFA 3CPSA 3EZYA 9LDBA 1LNQA 1LC0A 1FDWA 4BNTA 4B4WA 1IZ0A 4XB1A 1NM5A 2GZ2A 5EINA 1LSOA 4CM3A 5CDTA 1A4UA 3DZGA 3KSUA 1B15A 4GSLA 3AI2A 3CINA 3OECA 4WOJA 1WLYA 2JFHA 4OXYA 1QYCA 1HRDA 1KY4A 2AXQA 3OQ6A 2BI8A 4YJDA 4DQVA 5KVCA 2UDPA 4CM8A 4HKTA 3U49A 1G6KA 6LDHA 4K28A 3VZSA 1BXGB 3BMQA 1P1IA 4W82A 2AG5A 1LQTA 1CQJA 4O1MA 4GMFA 1SC6A 5COAA 2G5CA 1ENOA 1YB5A 1HYHA 1R15A 5CPBA 2VYVA 3WXBA 2AE1A 2ILTA 3SC6A 2JJYA 2BD0A 1TI7A 1YO6A 4LISA 3NX4A 4IY1A 4QTZA 1B8VA 1I32A 1MC4A 4QXMA 4DUPA 3BTOA 1DIHA 4IDGA 4EJ6A 1MXHA 1VJ1A 1X0XA 3E9QA 3JQ6A 5HS6A 2IEBA 1VPDA 2HK8A 2DU8A 2ZQYA 3AWDA 4U0JA 3SC4A 4FGWA 5F1KA 3GVHA 1T25A 3DAGA 4NQZA 1HKUA 2B5VA 2Q50A 3L4BA 1EFKA 5BQFA 4BO2A 2VHVA 4ND1A 4RPLA 1YONA 3KYBA 2V6GA 3F1LA 5IXSA 1H5QA 4L4RA 2B69A 4B8ZA 4BOYA 3E9NA 3GVCA 3PXXA 5BT9A 1LDGA 5A05A 4B79A 3DBLA 3H65A 2JAPA 1NYTA 3LU1A 2I67A 2VCYA 4YT8A 4MVJG 1QYXA 1NQAO 2DUUA 3EVNA 1HETA 1QV6A 3DO5A 5AYVA 1X1EA 4BIIA 1ZEJA 3QP9A 4BUCA 4ZU3A 4NJMA 3ZWMA 1M2WA 1A9ZA 4MO2A 1ADCA 1F12A 1VSUA 4TVOA 6ADHA 4M86A 5L4NA 1YL5A 3ZNNA 4NK4A 4DQUA 3JQ8B 2YW9A 4QFCA 2EXXA 5FI5A 3ZV3A 2X0NA 2D1YA 4UULA 4I5EA 5GMOA 1ZVMA 3HSKA 2HJSA 1F8FA 2VWGA 1EBFA 2BH9A 2Y0CA 5IF3A 3ROMA 2AW5A 1OOEA
chains in the Genus database with same CATH superfamily
4I3GA 3WGOA 4WIAA 1UK8A 3SC3A 5L8VA 2QX6A 3RRZA 1CQZA 3BCHA 4C0JA 1W49A 5KYXA 3VMFA 3MS7A 5EQDA 1SBTA 4TTRA 3BL8A 3SX4A 5LZ9A 1CIPA 2WOOA 1QOZA 4E2FA 3OKPA 3IE2A 2O2XA 3MFYA 2BRUA 2QAIA 1SOAA 3SLGA 1WPXA 4HAYA 3TLBA 5F51A 5IN5A 1J33A 4QKQA 3VJRA 1XKQA 1XKLA 4FPXA 2QD5A 4YLEA 1TUIA 4ZQIA 4CM7A 3OM1A 3JYLA 1C3LA 2EFCB 2QJWA 4MNTA 1K68A 5LMNB 3AEKB 2IXDA 3KUCA 2IZ0A 4FM9A 4RM2A 5JSZA 4LDRA 2OXFA 1U04A 5BVHA 5F21A 1CUJA 3L8GA 4BCCA 2Z5LA 3NH9A 1NW7A 1EWYA 3LH5A 1X39A 5TC4A 4N4AA 2G67A 2P9YA 5IKMA 3DB2A 2GXQA 1DTEA 4OVKA 4L57A 2ZS9A 4F45A 2UYGA 1JRLA 4DNFA 2ZUSA 221PA 2I99A 3I5AA 1RADA 3K0CA 4FYPA 1K0FA 4BO5A 4Q02A 3FPAA 1AUXA 1HFKA 3I83A 3QXSA 2JFXA 5H1YA 1SCIA 4EABA 3MYRA 1K4KA 1FYDA 4YJGB 5JBQA 3OPVA 5KTPA 1NYLA 4WL0A 2Z4TA 3NETA 3T4EA 3LY8A 3K0HA 1G2PA 4LZLA 1CS0A 2O2IA 3UOAB 1PS8A 2PZJA 1FVFA 3C3BA 4PR0A 1MBZA 4QULA 5AKHA 3RK4A 2DQ4A 4EFKA 4QJ3A 5GZ1A 1NVXQ 3GYBA 5DM1A 2ZWMA 1GZ7A 3D3WA 4YDRA 4Z0TA 1SMKA 4R8LA 2CVPA 2YN2A 3E4DA 5MDHA 2FK7A 4X63A 3ZEIA 4Q03A 1XRJA 4NBVA 4Y6PA 5GV8A 5HIIA 2JCXA 4KXVA 4CHTA 5KU1A 4IS3A 3COJA 1JMKC 2WVGA 1FU4A 4AP5A 3WQHA 3LSYA 4DT1A 4BAUA 2JD1A 3TQFA 2CLMB 5L9AA 1PQPA 5JAHA 4WZZA 3LQKA 1RACA 3LV8A 2XOEA 1R27A 3UJDA 4AUMA 5CG2A 5JXIA 4JBXA 5BYKA 3ABQB 4OQXA 2VDPB 1CHDA 4TT3A 3WK8A 3T5GA 3G1TA 3AZQA 1JH9A 2ZDQA 3PDIB 1WQ3A 1RYBA 1S1CA 4V1CI 1XZQA 4JSRA 3ZCXA 4C76A 3L6DA 1M8PA 2ROQA 3QI2A 1M76A 2ZI3A 2PRKA 4QXRA 1S0UA 2Z6UA 4O3FA 1TZCA 4ZARA 2PMWB 5BV1A 2PT7A 4OREX 2Z8XA 5FTMA 5DV9A 4ZZ2A 5TQVA 4PG6A 4G85A 1Q0SA 1ECCA 5EERA 3V1LA 2J67A 4ALNA 2EQBA 4EEKA 3KV1A 3WL3A 4CCSA 4HH4A 4DKXA 2O1EA 2D1SA 1KU0A 1VE9A 1GU7A 1QRUA 3VH2A 4ZT6A 5LP6C 2QTBA 2NPOA 2NZJA 4A92A 2D3WA 2VNIA 1KC1A 2VDUE 2OORC 4CV1A 3KQTA 4KVGA 2OLJA 1GV1A 3QFFA 1F9EA 3W77A 1KERA 4O29A 3ZX5A 2WLSA 2YN4A 1GCIA 1V37A 3LVRE 2I8LA 2KW5A 2ZUVA 4I66A 3T7DA 5KOYA 3HB7A 4ZV7A 5BW5A 3K2BA 2GBFA 4PXSA 4TWAA 1TJ4A 3BREA 2OKGA 3A4NA 1CEXA 4GWGA 3FR7A 2Q5JA 1AKVA 3PUWA 1ZIYA 4Y98A 4P8RA 4Q1AA 3CTMA 3GJ0A 3W79A 1QOPB 3UHJA 4CIXA 1U1FA 5KZMB 4Z3OA 2KLBA 4MP6A 3DTNA 2GTHA 1L7OA 4RHFA 5G4LA 2ZG6A 1L4KA 1WKBA 1I6WA 1ZD4A 2P7IA 3HA3A 2AJLI 3WK7A 1E8DA 2BBTA 4JC0A 4DY4A 3I9LA 4WNIA 4CVNA 2C5EA 4DNXA 1IXYA 2DWOA 2H48A 4TM7A 2OQVA 1E62A 2CXPA 4S2UA 4GZLA 4L1KA 4LNAA 4CEIB 1PNOA 4OJTA 5CCXA 2IZ1A 3H42B 5AM5A 3KVNA 4HDMA 4ZU6X 1N0VC 3MLBA 3ILSA 5IAOA 3FWHA 2NU7B 1JF8A 1I3MA 1ZWLA 3AT1A 3KPJA 3N7TA 3OFND 3MCWA 4J0FA 1GN9A 1B0PA 2GASA 2WSIA 5FP0A 3HKCB 3GFTA 1Q0ZA 1KORA 3L0CA 2XUDA 3AF5A 4G0QA 2H11A 3CB4A 3T1YB 5DM60 3RF7A 4X94A 3VU8A 3HDTA 1VPTA 3L1JA 4H7IA 2BP7A 4MCIA 3EXAA 4KNYA 5IKEA 2YV2A 5HVNA 3D43A 1DMRA 2HSDA 4I46A 2EG9A 2ZAOA 1MP0A 5L4SA 3Q85A 1VIDA 1TQ4A 1XV5A 2IUUA 3TR6A 1QCCA 3O9MA 4RVHA 2IP4A 4EPTA 1T6BY 1EK5A 3RASA 1RVV1 2ZR0A 2NSDA 4XQEA 821PA 3A27A 3QVLA 4OUKX 2IBSA 2ZATA 3RVOA 1JHVA 1SHUX 4UPDA 1NN3A 2H1IA 1Y1KE 4LWZA 4TQ9A 1DJNA 1Z6PA 4RWZA 1TF5A 3X1YA 2G6BA 4NZOA 4XDGA 5AKZA 4RKFA 4B8WA 3K9BA 1RI3A 1PSWA 1WZCA 4DCGA 4ETWA 3A70A 5DBGA 2Y1OA 4RKQA 1W87A 2JEOA 3V9PA 1S2DA 3C6YA 1G17A 3DCIA 4TUYB 4G5YA 5JWOA 1IOWA 3BUSA 3DV0B 3FTNA 3HYRA 4XWAA 5BSGA 5IMSA 1I7SB 2OFPA 2SKDA 4QOJA 2VDWB 4TT8A 4ES6A 2BGTA 2GCOB 3CCFA 4IZHA 3WWCA 2VQFB 2WQZA 3RJ5A 3RSLA 1X13A 2CBGA 5A3QA 5T57A 5DP1A 2DBZA 1YACA 1P8AA 5FUMA 4LQCA 2NNWB 3AVYA 2GXAA 3TIIA 3AEYA 1BXRA 4M9UA 2J9ZB 3ENQA 2FXVA 1J1UA 1NUTA 4JI5B 1DNPA 3EGCA 2R6AA 3UAGA 1HTWA 1K7FB 2JGKA 4TXJA 2XUZA 4CF4A 1T5LA 5HQ3B 3KWFA 1G7CA 3BF7A 2VPWA 3T6KA 2V4MA 2V55B 1Y3AA 1JYEA 3AF4A 1E6UA 1XZNA 3N3BC 5K8CA 1YS7A 2HA7A 3QKSB 4P54A 1DS6A 4IJQA 1RCTE 3CR7A 4MWCA 1PBNA 3RUFA 4J90A 3WLTA 3ROEA 4YP5A 3F4BA 3G5AA 2QE6A 3RQIA 1C5KA 3F6RA 2QN3A 2R0QC 2C1XA 2HSGA 1XLVA 3ROFA 1UDAA 3DZJA 4XUEA 1JDZA 5K0FA 3H1EA 3H2HA 3ZGXA 5BVGB 2ADMA 5ALOA 3ZCVA 2PUTA 2WSSA 1CZKA 6Q21A 4TRNA 1B23P 3G9TA 2AFHE 3NG1A 4D81A 4I8DA 2BGKA 3QRWA 4L5YA 1XTUA 3JVDA 3U37A 4DR3B 2UV8A 3MB8A 4KN5A 3SLKA 4B6JA 1QJCA 2IV2X 2GYVA 5DYGA 1W2HA 4OOEA 5K51A 2VDQB 4HYEA 3QIAA 5K6TA 5JNWA 2BMAA 3WOVA 1E89A 3MN1A 1WEHA 1EDDA 3LX8A 5EPEA 4L3VA 4IWNA 1ZK0A 2E87A 1A3CA 3NBQA 1E3WA 2BEJA 1FDTA 4OJQA 4JMPA 4E4TA 1T2CA 3IYLW 4YO7A 2AZTA 4J07A 2H4YA 1RPAA 4MJLA 4QGHA 4AJ2A 4NE2A 3PKIA 3OI7A 3RVRA 1V8DA 4ATNA 4HRXA 3ADDA 2VSXA 3LQ1A 2R87A 5P21A 4F85A 4AM8A 3H9GA 5HZGA 1WUJS 2XCSB 3DKRA 2EX4A 3BGOS 2MSEB 4P81A 1PU2A 5JAZA 3GDFA 4WCFB 3JZFA 4N49A 3CH6A 1BKYA 2FF7A 1X1AA 3D4BA 3GLHE 3SF8A 1HOTA 2VAPA 4RC9A 1PDVA 2E4ZA 1BQEA 3CRW1 4MPPA 5DHAA 2FDRA 3HZOA 4ER5A 5I9IA 1AO0A 2ZS7A 3A9VA 4CCAA 3AOEC 3VPGA 4P5DA 1UPBA 2WTEA 1CS0B 3WIDA 3ER9A 1T3GA 3Q0TA 5IHPA 3UAWA 2G4CA 1W581 1XROA 3P9SA 3AWIA 5BNFA 5FRDA 1W0KA 1LWNA 1YZLA 1Z2CA 3OEHA 1U3TA 1U0FA 3FWPA 3WZMA 8AT1A 3PJGA 4ND8A 3SN6A 3FDXA 2ZIFA 4WFQA 2FW0A 5F9FA 4J43A 4UNNA 4I14A 3IP8A 2JJQA 2F4NA 3NTXA 3EXIA 3FM9A 4MB0A 3WP1B 4DT1B 1ZGZA 1IK6A 4NZPA 1XEXA 4BFLA 3D0KA 4YUYA 4ZN6A 5BSEA 4OJMX 1COWA 3B7PA 2PSHA 3MTGA 2G40A 2JH9A 4RORA 2XW6A 3AF6A 3EMBA 1RQRA 1T0HB 4WXHA 2JLSA 2FN4A 1Q1AA 2ZJ2A 2BHLA 3KXLA 4JWTA 4WW0A 5H7XA 1U8TA 2P1RA 4CR7A 1O8CA 1U9CA 3QVWA 2EL7A 1N2CA 4JA2A 5EMLA 3GWZA 2C9OA 3UC5A 2WBLC 4PNPA 4YRPA 3VYSB 4B3MB 4BNMA 4PQRA 3Q3CA 3R5KA 3LHFA 3NHLA 1EZZA 1SUSA 1RRPA 5ALFA 1QR6A 1PR2A 2HMAA 1UAYA 4LK3A 4V0QA 1QZXA 3IS3A 3KZ1E 3CA8A 5CYOA 4QU9A 3W5CA 3B8EA 4RF4A 2BKUA 1Z5UA 3ZLVA 1APBA 1CRPA 1J0DA 3UK7A 4F6CA 3ICQB 3UMFA 5K0SA 1U0TA 2R1TB 5GGXA 4QG7A 1P4RA 2ZRGA 2EJTA 3GR6A 3SM9A 4CLRB 1HQKA 2VP0A 4EHDA 2QM8A 2X5JO 1VZ3A 1KI3A 2OHGA 3S29A 3F4KA 4IILA 4IHQA 1LFAA 4MXDA 1L1QA 1YOVB 4X5OA 4Y9RA 2Q0XA 3PTAA 2HLNA 2B35A 1RXIA 2IZZA 3KCNA 4H7DA 3LUGA 4WFIA 4BFTA 2JIOA 3O38A 1RKBA 4BAZA 1HYEA 4C2BA 3ZX4A 1IRIA 2QTRA 3D6FA 4M0CA 1LQ2A 1SQGA 4JIMA 4ERXA 3IQEA 2X14A 4O4JA 2J3IA 1E9CA 2F3PA 2XYGA 1UXHA 1E66A 1HGXA 1KK3A 3QXHA 3EOZA 3C39A 3PWTA 4JD5A 4QRIA 5CH8A 3UHAA 2I1LA 3B1XA 1X3SA 1P6UA 5GJWC 2PVPA 1U7ZA 1E5DA 4KFRA 4RZUA 3MJVA 1VXOA 2IPLA 3NV7A 3VKVA 3W6PA 1U2QA 4OGWA 2IY8A 5EJ5A 4FEEA 1SVIA 2O7SA 5CA0F 2F3RA 1QANA 3FNHA 1WV1A 3OAAA 5IASA 3IR7A 1CRZA 2EKZA 2GXSA 5IM4A 1H9CA 3I01M 3RSOA 5EJEA 1XQVA 3BH6A 5DM70 1J0BA 1NPDA 2HSJA 3PFIA 2UUBB 4OX9B 1AKNA 1JR3E 1W2WB 5BSKA 1S2MA 1P4HA 1JLLB 2YVKA 1XA3A 2OHIA 4RYDA 4D4IA 4U02A 2V7XA 2QUKA 1JEYA 2YMLA 2EFEB 4WH0A 3JVUA 3OHMA 2CY0A 4NC9A 5A0TA 3BD6A 1JFLA 4QM7A 1IM2A 2Z2ZA 3LO8A 1IVNA 3ML1A 2I0FA 3CX3A 3G68A 1BC5A 1E0DA 2P2ZA 2B6NA 3E9MA 1TQ8A 3KJGA 2HSWA 4IGFA 2ZAYA 3A36A 2YNMA 3PSAA 4JODA 5CDYA 1DZIA 4RVDA 3KEQA 3IIEA 1B0UA 2GHTA 1KO8A 1W76A 1II8A 1Y82A 1CTQA 1E1YA 2GWHA 3GI1A 3VM6A 5BWLA 1FJXA 2PJRA 1UFVA 2QTFA 4ER3A 1BO6A 3LYHA 4M9XA 5IZ4A 1Y6GA 4KUHA 5ITZA 4S1NA 3VNRA 2IJGX 1T3TA 2HK9A 2JRCA 4U1RA 2FA9A 2C9MA 4C2TA 1TUBA 1H2HA 3PP8A 1ISPA 2VEDA 3PNPA 4K81B 3TUJC 1DQYA 4II2A 3KKOA 1FFBA 2GK6A 4EVQA 3OMLA 4BP9A 3U31A 4CF5A 4EY6A 1H4TA 4D57A 2AOTA 2H2AA 4C7KA 4DN6A 3FYUB 3ELYA 2H2HA 4HDNB 4MDHA 5ALLA 5AXDA 4XVHA 2XF8A 3VNSA 1DC7A 3ETJA 3I9KA 4MYSA 4OOFA 3ZHXA 5JCOA 2JLWA 3HL0A 1X1DA 3WKAA 3VYRB 1JHOA 4Q37A 3TZCA 1OLXA 1R6DA 3FOCA 2PRZA 2MMGA 2X6QA 4YRQA 1N5MA 2AFIE 3E70C 3T5MA 4UOZA 4W5QA 3O75A 2WWHA 4YJHA 2W4MA 2WTUA 3E2IA 1OI3A 4HX9A 3D2CA 3NVKI 4IVNA 1EWVA 2C5LA 4LCJA 4BNYA 1GPBA 3TL6A 4M3NA 4B3XA 2QRVA 4MVJM 1GRNA 1SPBS 3VDRA 3P1JA 3IT2A 4LTNA 3SHFA 2ZIEA 3T9EA 2W2LA 2F6RA 4CW7A 2PGLA 3OU6A 4D3YA 1M6HA 1S5PA 3HBFA 1XNGA 4WWHA 3IBYA 1VB3A 3EGVA 4MQEA 1IUNA 1FB5A 3LKBA 4DQXA 1QU3A 4N8EA 4RS4A 3V1TC 4FVTA 5BRAA 4DUYB 1M2NA 5KYUA 1BU8A 1YH3A 1GLGA 4MYTA 2Y0EA 3T5DA 2XGGA 7ABPA 2WPNA 1FDSA 1NSTA 1QKKA 3A1WA 3HJUA 3HJHA 1KSFX 4IGAA 4ND3A 1DDIA 4LOJA 5TMEA 4Z2AA 1D1PA 2JFUA 4AMUA 1UT8A 1T3HA 3H0KA 1IM5A 2VF2A 3HBJA 3OESA 1RD4A 2YVLA 4KQCA 2E4XA 2Y92A 4ZEXA 2G88A 3TOCA 3W5IA 4KR2A 1QZUA 2LNDA 1T8SA 4P38A 5G41A 3ZJ5A 5HJEA 4DLWA 4BL5A 2OE2A 1ZA1A 2HC9A 2X77A 1T4BA 3NHWA 4JASB 4ZYTA 4YJFB 4CKBB 4LFAB 1QHHA 3VMMA 3DPSA 2UUAB 1T36A 2Y66A 1W5SA 2WI8A 3EK2A 3IBTA 3N70A 1E7SA 3HV2A 3OQVA 4LE1A 4CDNA 3M9LA 2M6LA 2O5RA 3I5MA 4M1TA 1SVKA 3DS8A 4RZIA 4I55A 2ATIA 3D4LA 4M0KA 4QJ4A 3S55A 2O0MA 2OENG 1JEOA 1NR1A 2YXPX 3BXEA 4JOBA 8MHTA 3KALA 1VRWA 1EI9A 1RI1A 4JJ7A 4MQ5A 5AVWA 1WJGA 4IPTA 4NV3A 3E7WA 4L5IA 1JAIA 1E3WB 3HKDA 3IAM1 1LTHR 1OBOA 4UUNA 2RAUA 2ZSEA 2PANA 3JQPA 5EKTA 4DLSA 4YTEA 3FOZA 1GAJA 1KTVA 1FPMA 1ULTA 3A1NA 2IUTA 1YZHA 2JFBA 3N2LA 3LOUA 1TQ6A 2L42A 4LYJA 2QVBA 2YFKA 3MUOA 1GPDG 4X71A 4Z6KA 3RUEA 4DLXA 4F4JA 1FFHA 1Y3BE 1GGFA 1IN7A 4HEA1 1RXSA 4P82A 4PG5A 4Q9NA 4XGNA 3ZIAD 3RVDA 5JZOA 2HA5A 2B9VA 4EKNB 3ZZNA 1OE0A 3R8CA 4GQIA 3VYUB 5K3AA 1AKUA 3SF8B 3UVEA 3QE4A 5CVCA 5JH7B 2ZTUA 1P6XA 3SXUA 5CT5A 2JI8A 2JIMA 3OWXA 4AMYA 2CK3A 4QNRA 3MJDA 2RONA 2W2NA 3NEAA 4XSHA 3D8HA 1NPYA 1P77A 2BFDA 4E5DA 1EUCA 3U26A 3WLRA 2RG1A 2I4TA 1PUIA 1YDHA 2CNWA 1FX0A 5FL7A 1X38A 5AHOA 4KO8A 5CXXA 4YV0A 2R8BA 1TPYA 4ITUA 4PX5A 5HBGA 3R7FA 4E5PA 2IKSA 4YBZA 3Q3EA 1QU2A 1CQWA 4ND8B 1QJ4A 3VTZA 2H57A 1XZEA 5EWLA 1Z88A 4X61A 1KJZA 3EXIB 2YWCA 1XE3A 3TVYA 4BMYA 4NDZA 5C4IA 1XEXB 1TZBA 1ZONA 3ESXA 3GRFA 1DCTA 3O74A 2OOKA 2G1KA 2VYVD 1JWLA 1ZMBA 1FS4A 4RZ2A 4BO6A 2CFCA 1TEVA 4JLBA 4NNPA 5LPNA 2VTBA 4NK5A 4FFRA 1G21A 2D8AA 3FVRA 4J7UA 4OHFA 1JIKA 4YUAA 2O8CB 3S27A 3OJXA 2UZIR 3L8EA 5EKSA 5BP7A 5EUBA 3KCQA 5JD5A 1XEAA 4MCJA 1YBHA 4YCNA 4X8LA 1B0AA 5FOWA 2R6DA 3MWDB 4B75A 1F0YA 3LC7O 2F67A 5TMDA 2C4NA 2XQGA 4LRQA 5BNIA 3V48A 3CVYA 1QTIA 4D92A 4EI7A 2Q9CA 2PBFA 1ZQ1A 4URXR 4URUR 2OQ2A 3CGGA 1GZ3A 3NM5A 4Q6WA 5M34A 3FPBA 1GG5A 3TZLA 3L6BA 5KQRA 3HH8A 3HHEA 1JFVA 3IQXA 3WYBA 3EGIA 1OA1A 3SFVA 5KBYA 3AESA 3B13B 2WMYA 1O08A 1CY1A 3NHRA 1TDJA 1SIOA 3T9AA 4BFCA 2J5XA 4LJ8A 2RSLA 2P0AA 1DIBA 1RLJA 4IDNA 4G4IA 5HKBA 3CW2A 2Q5EA 3KKQA 2PX3A 4PRKA 4D8WA 1D9ZA 4O4IA 2APJA 2R7MA 3CEAA 4O4JB 1P9NA 1QK4A 2C07A 2VWPA 2QLBA 4MIKA 2B9EA 3RKSA 4AKTA 3WLPA 1VL8A 5EXTA 2HRZA 2WM2A 3CRZA 3AM3A 1J7KA 1FC0A 1WCXA 3OF3A 1K92A 2YCBA 2PO5A 3H5WA 3LBIA 3N75A 3P5BA 2NV2B 5DOVA 3VR2A 5M29A 3A1FA 4LYDA 3DCJA 2XCTB 4US0R 4XR4A 1IUPA 1VGVA 3ANNA 2C4UA 4IVPA 3O3CA 1RJGA 3BRWA 2XE4A 4JVMA 1THGA 1UK6A 3HR7A 2WKQA 2OLEA 2GN6A 1IBRA 1PUXA 2SBTA 3PZBA 4S24A 3HUUA 3MMZA 2ONKA 2W0SA 4HX5A 3FDZB 4NCXA 3PNMA 3REQA 1B3BA 2VT2A 2WNHA 3VI3B 4EGCB 4EG8A 1VJTA 3RT1A 4JYCA 4EJ2A 5IW8A 4OK3A 1W96A 2GEFA 1Y7IA 1OH5A 2CMHA 3IKMB 1RBYA 4Y0AA 4LMRA 5LP6A 1VA4A 3CJRA 3WFZA 2X5OA 4PXAA 3EEBA 4JXZA 4G0NA 1JR3D 2EP8A 2OORA 2Q6VA 4CM5A 4WCDA 3U9SA 4O08A 4CIYA 1GFWA 1DJMA 4YDHB 1QGUA 4YLGA 3UY4A 2FSIA 5CW2A 2A33A 1Z0FA 2O3QA 1YDMA 4QGBA 1GP2A 4N6NA 3ZYCA 1Z4OA 1R0CA 5CPFA 3QFCA 5ES3A 5ITZB 1E99A 5LUAA 1LJUA 4X3OA 4UNPA 3S7TA 3AJAA 5HZKA 3JQFC 1DJLA 3ZVLA 1EUQA 1EDOA 1LWOA 2Q7XA 2OYCA 4PQYA 2AOTB 1WCYA 4TWJA 1H1LA 3DBVO 1RZVA 4OFXA 2I91A 1BH2A 1DINA 4KFSA 5FO1A 2K5UA 3C6MA 5KPJA 4M60A 3CF0A 1XT6A 3NDPA 4PIPA 3UN1A 1E2JA 2I34A 5I7VA 1QNFA 4P4SB 5KCZA 2KJQA 1JKIA 1T15A 2JGNA 3KR2A 2GNOA 4PGMA 4YJHB 4D02A 3CF6R 5A1JA 1RXYA 2A3RA 3B20A 4M1ZA 2H9IA 1RDFA 3Q9UA 2Q2WA 3WBFA 5ESXA 2WC1A 3QLUC 3U5ZB 2IF0A 4P9NA 4D9EA 4QUEA 1U2ZA 3U40A 1QVWA 1N4DA 3OQJA 4RTOA 1UC8A 3LC0A 4B6PA 2JFGA 5KJEA 2GNAA 3SGLA 2XAUA 1EE9A 1AXGA 2ZI9A 4YCLA 2YMMA 2D74A 4B43A 4WBNA 1WXIA 2IYFA 1F5NA 3F98A 3Q8WA 1V8BA 4FW8A 4H0NA 4MQEB 4WN3A 5GAJA 4F21A 1Z36A 3GH3A 3ZCUA 5BUZA 4M0FA 3EISA 1E7RA 1C7IA 1R0BA 1SO8A 4B4DA 3MVEA 5DXJA 5EJMA 2YWBA 4AWXA 2YXBA 2YWDA 3EA5A 3NB0A 2ZB7A 3VOTA 1FMCA 3GLTA 3K8YA 4YY3B 1H94A 5ECDA 1KJ9A 4Q9IA 4YWHA 5GADl 4Y1EA 1AUVA 4AC9A 2P3OA 4E09A 3BMOA 2QN8A 3HKEB 3WLOA 5A9RA 1UF9A 4AF8A 1O95D 1YTUA 1JR4A 3UK2A 5BQXA 3RW9A 3GCXA 4NG5A 4YQYA 5JBNA 2EW8A 2YHIB 1RAFA 3GLVA 1GVNB 4FGKA 3VZRA 3ZUPA 1F8UA 3ZXYA 4XCXA 5CFPA 4DDVA 4CQMB 1T36B 3FKJA 2JAHA 4MKGA 3RU2A 2X9QA 1PT7A 1KPIA 2ZCVA 1J2EA 2XB8A 4DR1B 2EDCA 4ZVSA 4TPKA 1Z39A 2W6PA 4L51A 4P4UA 4B8YA 2QL9A 4UZEA 2DEUA 4QDUA 3AL0C 1WOMA 1G5IA 4KO3S 2P3LA 2D2XA 2RK6A 3CO5A 1R00A 4A91A 1QQTA 1BTOA 2AOVA 3Q3IA 5IPFA 2BFPA 3UJ8A 4D97A 4EUKA 2VN8A 3IIMA 4OJKA 4BZXA 3PRJA 1Z37A 2HA6A 5J2UF 1VDZA 3AQ4A 3U3ZA 3L7JA 4ZDIA 5HDBB 3IDFA 2A0YA 1NI5A 2B8TA 4BBZA 2C5BA 1QYIA 1DQRA 1FLVA 4BNFA 4PLZA 4DC1A 4TV9F 4RDHA 2VDJA 4OHCA 1R6UA 2ZJYA 4NNOA 5T64A 5JEEA 1XU4A 4C9BA 1NBMA 1PQ4A 1AB6A 1PAUA 2Q07A 4LQ4A 5EJAA 1S3IA 4YJ2B 3ASYA 1U7DA 2NTEA 4ZVNA 3RHSA 2ZI5A 2CDNA 3LUFA 3ZBPA 3NYIA 4DZZA 3LAWA 2I29A 3OCCA 2BFDB 4P3NA 4D96A 2QTCA 2NTJA 4LDNA 3GEIA 3DOIA 3L05A 4M8NE 4NP6A 3ZG6A 1EYZA 1N5IA 5LQMA 4OL0A 3L0ZA 3M6IA 5EWMA 1PK9A 4ICIA 5TQJA 1TLLA 1N7HA 2MYTA 3G8BA 3I3SR 5H70A 3EDMA 1XEWX 4M8IA 5TS3A 4D9BA 1C4KA 3W5DA 5FOVA 1QH8A 1SG0A 2GLTA 3MTDA 2IYQA 3EZ2A 5EWLB 3TTUA 4Y6LA 2ZT6A 4US1R 3FTQA 4QXQA 1KR2A 3FSGD 5JO9A 4MUMA 1WCWA 4HEJA 1R74A 3GC6A 2Y6VA 4RGVA 3I4FA 2BL4A 2YJNA 2ZJ0A 3JQBC 4G0MA 3C7DB 3D7MA 3JAMA 3UHOA 1T34A 2YYYA 3TQOA 1PR0A 2WTMA 3R3SA 5K8JB 2CNNA 4IMRA 1P2VA 1IZYA 3PD1A 2DTDA 3Q2IA 1TQDA 4CLXA 5LLDA 2H54A 2HF2A 1F0KA 5HKLA 5I48A 3HKBA 3I0NA 4HGZA 1A2OA 2LUOA 4JT2A 1UPUA 1WPRA 1L7RA 2WWRA 4C29A 3HM9A 3FWZA 3KKMA 3FI9A 3G7UA 3A9UA 1P4JA 3KEGA 5ICEA 9GPBA 4QQFA 3SJAA 3X1MA 1N36B 4JYPA 3DMFA 4ND2A 3VBCA 3KQLA 1MTOA 5E9AA 3AOEA 3UAYA 2OZLA 2YQ4A 5JCJD 5DWVA 2Q6OA 1NW4A 1P29A 2QMYA 1OYYA 2XUQA 3AESB 2F4VB 2C78A 2DFPA 1KZ6A 3L8YA 4BGIA 4UOEA 3IQFA 3G8AA 4HB2A 2W70A 4K9DA 3BT7A 2FOXA 2J07A 3CH7A 3DVRX 4KC0A 1U3FA 3KSRA 3LWDA 4RZQA 4X7RA 1ZS9A 5LFAA 1NSFA 3KT8A 4PWZA 4R2HA 2Q9BA 4XWWA 2P3QA 3T4PA 2VATA 2DUMA 2DY0A 3R7WA 1W8DA 3GJTA 3WLLA 1T1IA 4ALLA 2ZXUA 4IZOA 4PHHA 4EOGA 1M2JA 2VA8A 2WWXA 1AO3A 2WRZA 3PXEA 4ZYLA 4NAVA 2ZRKA 3LPDA 3FVQA 5E4FA 3P0JA 3JRNA 4G1BA 4DYVA 4GPAA 2IW1A 1G8AA 2FAXA 3EEQA 4UCXA 1WS6A 4J7CA 1KAHA 3MJTA 2CNOA 2O57A 1VC2A 4HXEB 3TS1A 3W4JA 3AKZA 4MGIR 2BGLA 2XD4A 4UCQA 5HZHA 5L3ZA 5JANA 5K8UA 4JYZA 1EVJA 2ACEA 1YCFA 2V58A 3AX6A 4ZO9A 3ZWPA 4MTLA 1CCWA 1R50A 3VDNB 1P7WA 3WGZA 5JNLA 5E2AA 4ANFA 3DJYA 4M6WA 1UKAA 2IHUA 3PE6A 5JG7A 3THXA 5CHYA 3BQ9A 4XIYA 2A0UA 1R6VA 1IZ7A 3OLWA 5ALHA 1ECGA 2PZKA 2CFRA 1ESNA 2VZ0A 4FFBA 4DXHA 4C3UA 4IDEA 2QVZX 1YR9A 3ZK7A 4B6OA 4FGJA 4R16A 3M6VA 1M2FA 2R68A 2DR3A 3DBIA 4LDJA 2FFQA 1U6KA 4MUXA 4TKMA 2A4MA 3URMA 4D9HA 2ZRBA 4UHJA 3GUHA 5I6DA 1GGKA 1IXSB 2HLDA 1W0CA 4OKIA 4LNHA 2EC5A 3IOEA 3D2AA 4HK4A 4DCVA 1LI4A 1QQ5A 1H42A 2BZSA 3H2IA 3ESDA 4PZZA 4TM8A 4ZAYA 5A7GA 4A73A 1SU4A 4G67A 3UK6A 5EHIA 1J2TA 1V2GA 4DQDA 4GHWA 4KFTA 3HXQA 3PF9A 4FDMA 5HYVA 4U2EA 3W2TA 2B5WA 3CTPA 7MDHA 1IEWA 2J1LA 4JU8A 4G2TA 4BO0A 2V7UA 3R5SA 2HI0A 3JD3A 3GLGA 2F00A 3FIJA 4KV9A 4O2RA 4Z9XA 1PW5A 1XAJA 2QLLA 4FYJA 1HORA 3B60A 4CEJA 4DB4A 3KZVA 4C5CA 4IWXA 1DBPA 4H4EA 1L4BA 3KZOA 4GX1A 1RRKA 2QNIA 4M55A 4Z8XA 3CPJB 4GE0A 3ZWWA 1Q21A 3EARA 6REQB 1FNMA 4KLZA 1IPHA 1E5LA 4HUQA 1XZGA 4F6RB 4CI0B 4RZXA 3DVSX 4BFXA 1IK4A 3DXXA 1AM4D 4PRLA 4YMWA 1GKUB 1C3OB 3HP1A 4Q7LA 1CDDA 1S4MA 3VR5H 2JLAA 2J3MA 3P27A 4X65B 4QUIA 2IYPA 4WKOA 2E3JA 4HB4A 1KXZA 3GWGA 1DUVG 3G2OA 2VDMB 4CGYA 5C7OO 1HE1C 5E3JA 2HM7A 5J9FA 5IBCA 2B30A 5KS2A 4B0OA 4UMFA 2VL7A 3R44A 1J42A 2PGOA 2VKTA 2OV1A 2ZIXB 2VH5R 3BMOB 3TZHA 5FJIA 4BGEA 2QTTA 4AX8A 2O2CA 4JP8A 3JALA 3ELUA 2JFOA 1DC4A 3GRRA 2GZ3A 3HDQA 4UTRA 4D3SA 1LXCA 1NJ8A 1BW9B 1W9HA 2H1HA 2YY6A 3RHTA 2BF7A 3PQCA 5EJ9A 4Q15A 2DFLA 3QG5A 3KUDA 5FWAA 4QTTB 2JATA 1I7LA 2OP1A 3MMPA 1OVGA 4CUKA 2YH2A 4I19A 1Z8NA 1PFUA 3MTJA 3DPUA 1I2BA 1UJBA 4M7WA 3B36A 3GJ3A 2B0CA 5FWXA 4FYKA 3LMKA 3DFFA 4IUBS 4BJ3A 1MPTA 4ARZA 3CVVA 4NBSA 1WMFA 4MVJH 5IH3A 3DV2A 3NW9A 1SJ9A 1ZIDA 3VPDA 2GQ0A 1A9XA 4BVKA 4J29A 1B6RA 3RJTA 4BUJA 3DKVA 4YMSA 4PLTA 1YJCA 3JPYA 1K4YA 3CN7A 3DHNA 1R5JA 1NJ5A 2Q28A 4NOKA 3RRYA 4Z7NB 3R5FA 2FH5B 2QSZA 3MRVA 4OQZA 3V1NA 5A7FA 4CI9A 3V4OA 4MW7A 3JQ7A 5BRJA 2H2DA 3O3MB 3VR0A 3OCVA 1VKNA 3O8OB 4L07A 4N0DA 4BNWA 2LPMA 3ULKA 3G7SA 5LLSA 4UM9B 2Y1GA 4RFSB 4I4TA 3GVPA 3OP4A 3OSUA 2CBZA 3QI7A 4OU5A 2HEGA 1M34A 3Q10A 3U3KA 4E32A 1E79A 5GONA 4L8GA 2X5KO 1K8ZB 3DBOB 1CR2A 5ICFA 3ZS8A 2B4RO 5CLQA 3IE0A 5KVQA 1YMVA 4RPIA 4ALKA 4LF4B 1QHSA 5CH3A 1E2HA 5G02A 2PRSA 5CEJA 1XZJA 2YN0A 2O7QA 4Q1CA 4WZBE 2ZI7A 1FSGA 3RKUA 1QPZA 5B7QA 4WTOA 2DFKB 1UP7A 2WB2A 1D09A 5IAJA 4I4IA 3T99A 1L7AA 2VHXA 4M1MA 4ECEA 1V3TA 3E0XA 4G1CA 2P4SA 5C31A 2DB3A 5FXMA 1QH8B 2GEVA 3DL0A 3DTYA 3K0FA 3VVLA 3SYNA 2PMFA 4U5QA 4DR6B 3AY0A 4FYVA 3A2LA 1P2UA 1Z2EA 1DXOA 5DHRA 3WG9A 4FB5A 3SQDA 4UEOA 4L22A 1B6SA 1I2DA 5EIEA 2BFMA 1UK7A 2H0QA 4HQOA 1N7IA 1OKKA 4YQZA 5JQGA 4Q1DA 3M6WA 3NHSA 3W5HA 4KXNA 5AESA 3RRFA 3KEFA 1RHJA 3TPCA 4HNUA 2GPSA 2B78A 3GCWA 4MR8A 4OH1A 1KDPA 3K16A 2YRXA 1P3Y1 1MXFA 4ZD6A 3G0BA 5C8ZA 1MUUA 4RVFA 3NCTA 1WPGA 2ZSHA 3UUWA 3WGGA 3ZIUA 4FCVA 4EW3A 2QTVB 4IXNA 5E95A 1O57A 3G0HA 5DM4A 1UWCA 2QVLA 3SDSA 5MN6A 4DV0B 2O5EA 4JUFA 1C4XA 4A2WA 3ZHRA 4ZEMA 3T1TA 1Y81A 2H8GA 2OZLB 3BGSA 4JCOA 5K0NA 3SVLA 3ZWCA 2RKOA 3WMGA 1Q11A 2WYVA 4BO7A 3M5CA 2OHJA 2PEZA 5IFLA 1G4AE 5KVAA 2JARA 3PC2A 5K9ZA 1TX4B 3PHIA 3EIFA 3S8EA 1CVIA 3QMWA 5BR7A 2HKIA 2QZJA 1UT6A 1P9RA 2X2FA 4I3FA 3SXPA 1NG1A 1TA9A 5AICA 1NUAA 5EJ8A 1U99A 4M49A 2QS9A 2PSJA 3QY0A 1RM3A 3ENZA 1OAOC 5DCYA 2HFJA 4TQGA 2WV7A 1M3SA 1QGYA 2A9RA 3GA7A 4EYKA 5CXQA 3K0AB 5HCUA 2G8NA 3U4MA 2N3ZA 2R8ZA 1QFMA 2OAEA 4PO3X 4NL4H 4W8GA 1NVVQ 3LYUA 4X92A 3T9FA 3R7BA 3VZCA 1AN9A 2HCFA 3V8RA 4DCMA 5JBIA 2WVHA 3R9WA 1JIUA 2RBEA 2VBGA 3V33A 2GSWA 4WBSA 4PCAA 1CYEA 4WQMA 1Q12A 3JQAA 5K5EA 1L7DA 4MRVA 4BPRA 4INOA 3TNDA 4IJWA 2VTKA 3C1OA 4X6UA 1YDWA 4N0EA 4D5GA 2ETXA 5HFJA 4FXPA 4YR7A 1WP4A 2CCKA 2RHOA 3GJZA 3O73A 5BMVA 2EGUA 4OI1A 1SD2A 3THXB 4IFEA 4YCAA 5G3ZA 2PL1A 2ZRMA 1BE1A 2R751 1JDPA 1JSXA 1R3UA 2FCRA 1WE2A 3L9XA 3NI2A 4HP8A 3R74A 4FFBB 3EIWA 2FPLA 3KDSE 4F0JA 1KF0A 1MG5A 1NOKA 3KB8A 1NLUA 2ZAMA 4MW4A 5JVDB 5GOZA 2UZ1B 5H82A 1OU0A 4DLYA 3EDYA 3MGGA 1XZPA 4LXHA 1Q20A 1FU7A 1FDUA 1NAIA 3I9OA 4KN9S 1OXXK 4DMFA 5C5DA 5TMPA 1JG6A 2XWBF 1XOIA 1Z6XA 2I6UA 1SBYA 1UINA 3TLCA 3E9YA 1ML4A 3VR5A 1NVEA 2ZKLA 1G41A 3LUHA 1O8BA 2FVXA 2XNCA 3ON5A 4GKAA 4LXGA 4CFZA 3C3YA 4OAQA 5FEUA 3HV0A 5FUVA 3I52A 4TLMB 4Z1OA 1UBOS 3EE6A 4G41A 4YT4A 3LK7A 1V9LA 3C3KA 3HFSA 2GHRA 3IUMA 3GLGB 4ND5A 3QXGA 4MULA 5ESWA 5DN6A 2XRFA 1Y6RA 1RQXA 1VB5A 2CVQA 1QMGA 2NUAA 2PZGA 3L8CA 2QZ4A 1KFJB 2QN7A 3WS7A 2XOKA 2BHRA 3TZEA 3D7RA 4ZCIA 3PIDA 2Q6IA 4RGYA 4BLSA 1FTNA 4DR2B 5T6BA 1VMAA 4HUQB 2XDYA 2CSXA 2FW9A 4JLKA 5REQA 2RGRA 3PKZA 3QBDA 2WTNA 3NM4A 2ZE6A 1PG5A 1KC3A 4B6FA 1DO2A 4PTZA 2B8JA 3UMMA 5AQ1A 2NZWA 2QG9A 4M1WA 4GMDA 2FWAA 4J49A 2IPNA 3GFSA 2FN7A 3S2SA 1X7YA 4IRUB 4TL7A 2DT8A 3EZLA 3T3HA 1N75A 4E3WA 1A8HA 1BWPA 2UZ0A 4FOOA 1TCUA 1S2OA 4XWTA 1SA0A 4MVJA 1LX6A 4GKJB 4NMLA 5AVXA 1P0MA 4FUQA 3I23A 4OUDA 3WWYA 3K2EA 2DXIA 2VQDA 1Z25A 3JQFA 3PIRA 1LX7A 4M8SA 2ONJA 3VHLB 2G71A 3PJEA 4IRXA 1BU5A 3JALB 1FQWA 4YP7A 2LE0A 1SIWA 4KRFA 1ZC4A 3R7SA 4CCYB 3QTLA 1P2GA 3GRKA 3I34X 1K8RA 2NVBA 1Q1QA 3CB2A 4QPCA 3FTCA 2ENWA 4KAAA 4YWJA 1WG8A 4YMTA 1G19A 1CRLA 1G38A 1NMSA 2NU6B 1ENPA 1PT5A 3DBHB 2D5LA 3P2EA 5IVHA 1RQPA 2FW8A 3M89A 2V6BA 4C0WA 4GOLD 1Q7EA 1DBIA 2VF5X 4DJJA 5CDSA 2JIQA 5KTYA 2HADA 2KYRA 3OOJA 5DN9A 3O2QB 2VJKA 1GKIA 2X40A 3LZDA 3QLUA 1KE1A 1N33B 4OSOA 4MVCA 3RVSA 1T0UA 3PFGA 4QC2A 3AJRA 4MV3A 3NAQA 1JIVA 4XGRA 4AS1A 2QL5A 4NTZA 3T94A 2O8DA 1JE0A 2AE2A 4CM4B 3OT1B 2ZZNA 3FTFA