1XIVA

Plasmodium falciparum lactate dehydrogenase complexed with 2-({4-chloro-[hydroxy(methoxy)methyl]cyclohexyl}amino)ethane-1,1,2-triol
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
318
structure length
307
Chain Sequence
b'APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALAHAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase
molecule tags Oxidoreductase
source organism Plasmodium falciparum
publication title Mapping the binding site for gossypol-like inhibitors of Plasmodium falciparum lactate dehydrogenase
pubmed doi rcsb
total genus 114
structure length 307
sequence length 318
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2004-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1xivA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1xivA02
3INRA 1T1SA 1ADGA 3F5SA 2PY6A 3OJFA 2EF1A 3EGOA 4A5OA 4BKRA 4UUNA 4WLEA 4ND3A 1EUDA 3I9MA 4ROSA 2JAHA 4PN3A 5IDQA 3P2YA 1XG5A 1ZK0A 3MJ4A 3IKVA 4JXKA 4BO1A 2DPGA 3LT2A 4CMBA 4BNMA 2J8ZA 5TF4A 4YRAA 4D0SA 5JC1A 1K89A 2B4QA 4IBOA 1HE4A 4M86A 4U0JA 5ILOA 1IPEA 5HRUA 1X15A 1BXKA 3M1AA 1IY8A 2FY8A 2WE8A 3ZWCA 2IRWA 4XB2A 5HWSA 2ZKLA 2NTNA 1E6UA 2QX7A 4L4XA 5IN4A 4YAGA 3NGXA 5H82A 3FNEA 4ID9A 1ZVMA 4CMJA 4DYDA 4CM4B 1IOLA 1IZ9A 1HDZA 2BI7A 3ICPA 2D5AA 2XF8A 4RF3A 4B7CA 1GTMA 1XCBA 3SC6A 1A7KA 3AUUA 3DHNA 4CQMB 3FF4A 4LMRA 2EGHA 2HK7A 2DLDA 3BXXA 3I52A 4GMGA 4OGWA 3WLFA 5TX7A 1KETA 3DAFA 3JQDA 4HFRA 4F6LA 1SB9A 2EKPA 1LDMA 3WSVA 5THKA 4BO9A 4EW6A 2CVZA 4CM7A 1XA0A 3WFIA 1BXZA 1EVIA 4FGWA 1VL0A 2VYND 3PYLA 1YS4A 1KVSA 3HJAA 2IEDA 1A9YA 3F5QA 2O3QA 3VTFA 1C1XB 2UDPA 4J91A 2H1SA 1K5HA 3D4PA 3U62A 1UH5A 1PL7A 2XAAA 4YRDA 3U4IA 8LDHA 4A10A 1GCUA 5C7OO 1IHXA 4C4OA 1I8TA 1PS8A 2Q1UA 4DRYA 1F8GA 4OKNA 3ZCXA 5TNXA 1ZZEA 2OBNA 4J4BA 1DLJA 1YB4A 4UAGA 3PPIA 1YDWA 1E92A 1TT5B 1WW8A 1UR5A 1FDVA 2OL4A 3RU7A 2P4QA 3UHAA 1X7HA 2WD7A 5T64A 3LK7A 1B8PA 2V65A 3I6IA 3F9IA 3WGQA 3PJGA 1CWUA 3UXYA 1H93A 3AM3A 1YQDA 3D3EA 3PHLA 4CLRB 2GCGA 4J1TA 4E2YA 4XRGA 1KY4A 3CMMA 2J5RA 2E37A 3ZWOA 1NHGA 4NPCA 4BNTA 1Z82A 3KO8A 5JMWA 3RC7A 4CODB 3DZIA 4BO0A 4GL4A 2DC1A 3BMQA 3C7CB 1NXQA 1TEHA 1Y81A 3WGZA 3I9NA 4HKTA 1VC2A 4MOWA 3EY4A 4YVFA 1NVTA 4WCFA 2EG9A 3E8XA 3AUAA 5C7LO 2CMDA 3ZV3A 1HDCA 4UVHA 3SVTA 3ZV4A 1RM5A 2Y68A 5ILGA 3V1UA 4IIUA 1B14A 1BGVA 3RC2A 2W2KB 4E2XA 2JKVA 4XYMA 4TRJA 1M67A 2HMWA 3FI9A 4OQZA 1KEWA 3EC7A 3KEQA 1HLPA 3TQHA 1DIAA 4B4UA 1R12A 1AHIA 1UDBA 3JQ7B 4L75A 3AI2A 3AFNA 1IL0A 1JLLA 2F1KA 4QFDA 1ZJYA 1HL3A 5KJFA 3GH3A 5EQFA 5EN4A 2EKLA 4G5HA 2WYVA 3WNVA 2FPPA 4BO7A 3AM5A 3VKVA 2ZJ0A 1R66A 5TGDA 5BSHA 2G1UA 1OOEA 5DCWA 1MFPA 4G65A 2QQ5A 3WGHA 1GD1O 2YUTA 4HBGA 3RUFA 2O3UA 3C85A 5EESA 2X9GA 1BXGB 4CMKA 5DOZA 4IQ8A 1P1JA 5CDYA 1MFZA 5IDWA 2YZ7A 1R0KA 2B35A 1LDYA 2AEMA 1Y5MA 3IP1A 1IPFA 1NVGA 1XYGA 4I9HA 1K3TA 2X9VA 3H65A 5F21A 5THQA 1P1IA 2ZQZA 1ZXBA 4IPTA 4LCJA 1WMAA 5TS3A 3T7EA 4EEZA 3A4VA 4ZQHA 1E6WA 4FFRA 3W6ZA 4D46A 5U9CA 2BH9A 3WGTA 4FOSA 2ZTLA 5COQA 5CDGA 5TT1A 2EWMA 3CPSA 4IZHA 3QW2A 1PZHA 3WNQA 4ZQFA 1QYXA 4ZU3A 3ETEA 1KEPA 4P4GA 3TOXA 4BNKA 1K0UA 1NWHA 3KYDA 4R1NA 1UP7A 5G0UA 2B4TO 1F8FA 1BRMA 4UEKA 5KTKA 1ONOA 3PQEA 3LC7O 2FP4A 4ILKA 3DHEA 4QEDA 3O4RA 4R3NA 2X22A 3ZHYA 5KVQA 4YXFA 3FR7A 2EP5A 1TLTA 4NK5A 1HYEA 4ALLA 1O9BA 3E5RA 5EPOA 2EHDA 3HDJA 3QHAA 4CMGA 3EDMA 4MVJI 1UZMA 3KVOA 1XU9A 3C7DB 5JNLA 1HDXA 1JAXA 4CM9A 2DTDA 3O9ZA 2AE2A 3DZBA 3GOHA 4IDGA 4CM9D 4WPGA 1HTBA 3JYQA 3MTGA 4BKOA 3AJRA 4ALNA 4A73A 1LLCA 2CUKA 2WM3A 3GVPA 3GZNA 1OZAA 1EQ2A 3OECA 2W2KA 3FN4A 2OZPA 3GLQA 1SMKA 1RYEA 2BGLA 2Y1OA 1PGJA 3MJEA 4I5FA 2OOSA 4GAEA 1SCUA 1E5LA 3N58A 1O8CA 2OP0A 2FOIA 4HP8A 4O63O 2GSDA 3MJCA 2Z1MA 3OQ6A 1ADBA 3HDHA 1N8KA 1GCOA 4W9NA 4EJMA 4YACA 5KJ6A 1Y6JA 3JQAB 2PKRA 1N9GB 3DC2A 3CTMA 1V3UA 4WLUA 1F17A 3PJFA 2CD9A 3E82A 4IJUA 4OM8A 2OUIA 5L4SA 1T2AA 2ZB8A 2PV7A 5L7TA 1T24A 4HNGA 2I65A 1M6HA 2W8ZA 1M2WA 2VWHA 4TRMA 1LSUA 1XR3A 4YAEA 1WPQA 5FI3A 4XYLA 3GY0A 3LLVA 4NBWA 1IHYA 4MVJP 1XELA 2GR9A 2PGDA 1ENPA 4XQCA 2GN8A 1U7TA 4MKZA 2EKQA 4YAIA 3S2EA 4NFSA 1I01A 1DC4A 1EK6A 2ZCVA 4Q3EA 1UDCA 4D45A 4B3IA 2OHXA 4E5NA 1OMOA 3E6AA 1WDMA 1C1DB 1MUUA 1ZK4A 4A27A 3GFBA 2WYWA 3ASUA 4TVBA 2O4UX 3KV3O 4BS9A 5F1KA 5L40A 3COSA 1P3DA 2J3KA 4FOOA 2QG4A 4TROA 2GN4A 4PVDA 1MC4A 5DCYA 3SLKA 1I2ZA 2WEKA 3UFXA 3RFTA 4MVJF 4PZEA 3KTDA 4M54A 2W90A 1M75A 2B36A 1C0KA 1FDUA 2HK9A 1XU7A 4YT5A 5G4LA 3B1FA 5T8KC 2OGUA 4LRSB 5FF9A 3BTUA 1B0AA 3SJUA 4DUPA 1QYWA 5CDTA 7MDHA 1PQPA 1PGNA 3H4VA 3MWEB 3A28A 4O1MA 5FWNA 1E1KA 5JCJD 4M89A 1W73A 4AVYA 1O94A 4AL4A 2X6TA 3G1TA 3OHSX 3ITDA 2VZ0A 4R9SA 1E7SA 2Y67A 2PZMA 2VYVD 4CUJA 1MGOA 3DBVO 5MGBA 1I3LA 3JQAD 4GKBA 4BL5A 3RUAA 1PL6A 4RZIA 5CEJA 1HKUA 3DFZA 3D1LA 1V0JA 1W4ZA 4EUEA 1JKJA 1A5ZA 4L4RA 3ZNQA 4J1SA 1X13A 1Q0LA 4BNJA 2JFFA 5KIAA 4AJ1A 4PLWA 3EVTA 1Q7CA 1HYGA 1UP4A 3JQCA 3LT1A 3JTMA 3PQDA 4IM7A 2TMDA 5COAA 3VH3A 4D0RA 4PLTA 3LC2O 1U3TA 5A9SA 3GK3A 3QLJA 4MVJD 4CR6A 4E0BA 4TRNA 4NMHA 4UEJA 4QO8A 3ULKA 1KBZA 1PR9A 3TJRA 2GZ3A 3AWDA 4BKUA 1B8VA 2AG8A 4IXTA 2ZQYA 3WGYA 3F46A 2PZKA 4Y6PA 2RHCA 3GN2A 1V3TA 3TOZA 1CEQA 4J2OA 4BKQA 5CEEA 4WE3A 1GEGA 4Z0HO 4J2HA 4KMSA 4M1QA 4OJNA 3HQ4O 4FJ0A 1MB4A 3F6YA 2CF5A 3FWZA 1JKFA 1AXEA 2HMSA 1ONPA 1P0CA 4LRTB 3ADOA 4GVLA 3VH1A 2CDAA 1KC1A 3TZQA 3CXRA 3QWAA 4XR9A 5IAAA 4MO2A 5JDIC 3UF0A 4UULA 1UUFA 3L4BA 4K28A 1P9LA 3OIDA 2LDBA 3Q3CA 5G4KA 4FD3A 1TVEA 5B37A 3PI7A 1NM5A 2B5WA 3SJ7A 4O59O 1O95A 1W8DA 3O26A 2VZ8A 2PR2A 1LEHA 2EW2A 2JD1A 4RPHA 5EINA 2X0IA 2QZ9A 5F3RA 3S2GA 3ZWBA 2BFAA 3KLMX 1OC2A 3PYMA 3GNSA 1R0SA 5TLSA 1GZ6A 1EVZA 4XGIA 3AK4A 5AXCA 5JO9A 3VZRA 3ZWNA 5KNLA 2JD2A 2GGSA 4A26A 3G79A 2XPCA 3I5MA 2PGJA 2NV6A 1QLHA 3PFFA 4CV2A 2HKIA 4ZN6A 4CM8B 5ER9A 1IULA 4IQGA 4DIBA 3BMNB 4F45A 4RQTA 1PJ4A 5AOVA 2AEJA 3JQFA 4FFLA 1QYDA 1QKIA 1U1IA 3D4OA 3L4SO 2HU2A 2G0TA 3PP8A 4QT0A 3RUEA 4EZBA 4XDZA 4MINA 4WLNA 4AJ2A 1F12A 1E3WA 1E1NA 5EL0A 4BQPA 4FJ2A 4C7KA 4BUCA 3ZNNA 1XEAA 1B26A 1O5IA 2NNLD 1R4MA 1EUZA 3KLPX 1U5AA 2X4GA 3CINA 4Y67A 1JWAB 1U4OA 1E6EA 5DBFA 2WD7B 1DC3A 1CRWG 3HG7A 4NJMA 4CMIB 1UZNA 2JHGA 5B4VA 4CLDA 1F06A 4QFCA 3RWBA 3IKTA 1Z6ZA 4Y8VA 5ADHA 3KSUA 4RPLA 3RUHA 3ANLA 1NFFA 4BNYA 4I5EA 4XYGA 3PHIA 3U4DA 4OYRA 2ZJ1A 2R00C 4UUMA 3DR3A 3W1VA 1U2DA 3FNFA 4GX0A 1VKNA 3JQBC 1IE3A 1WZEA 1WLYA 1HEUA 2B83A 1KYQA 3DOJA 4OMUA 4AJ4A 3IUSA 4FJ1A 1JW9B 1WXDA 4DBZA 1CQIA 4URFA 2JL1A 3VVBA 2OXIA 1PZGA 4TQGA 3OA2A 3RCBA 4BV9A 1B8UA 5GZ6A 2EIHA 1XKQA 2ZYAA 4MPDA 2C0CA 1PWZA 2VRCD 5EERA 3ZWMA 3JQEA 1ZIDA 3WMWA 5EIOA 1A72A 5JDCC 2VWGA 3FTPA 4O0LA 1NPDA 4YT2A 5L7WA 4UVGA 4OL9A 4DVJA 3HFSA 4JROA 4BNIA 2TMGA 2JFGA 5A1TA 1HYHA 1Y5RA 3KXDA 1R0LA 1TI7A 2RH8A 2QYSA 4KOAA 4CV1A 5JW6A 1Y8QB 5BNTA 1GYQA 3MOIA 3Q1LA 2GUGA 1N5DA 4RPKA 4QX6A 1WDKA 4ZQBA 1GV1A 2FZWA 2VWPA 5G0VA 3ITKA 5TC4A 3ZWXA 2HJRA 5I9MA 4ZJUA 1NFQA 5JO0A 3RFXA 2Y66A 3WGGA 1YJ8A 1DFGA 3D5QA 2P4HX 2D3TA 1OBFO 4S3MA 3CZMA 3BMOA 4RVSA 3GEMA 3V2HA 3O8QB 4NBRA 1WDLA 1NYTA 3NTRA 1E7MA 3BHMA 3OJ0A 1ADCA 4CLOA 2C2YA 1EEHA 3VH2A 3FR8A 4LK3A 5BR7A 1XSEA 3E9QA 4BGIA 3TL2A 3VPGA 2ZYDA 2RIRA 3JQ9C 1E7RA 1TXGA 3EUWA 3HFGA 3DZFA 4Y9DA 3V2UA 2EXXA 4NU6A 1DJNA 5TSDA 5KJEA 5KVSA 2CVQA 1LSOA 2RAFA 3INTA 1S6YA 2IXAA 4CMHA 3L4BC 4D42A 4CUZA 2NACA 2IZ0A 2EGGA 3QWBA 3WTCA 1GEEA 4CMEC 5ER6A 1E7WA 2GPTA 5F1PA 1N1GA 4PLYA 3KYDB 3WBFA 2YQ5A 1I36A 4YA6A 4BB5A 4IDDA 1ISIA 3ZGYA 4TWRA 3S1LA 1BDBA 4CQMD 3PJDA 2ZB7A 4J43A 1P44A 4E5MA 1NNUA 1P0FA 1HDOA 4P38A 4N5NA 1BW9B 1YJQA 2DBVO 4KZPA 2D0IA 3ZZNA 5JFOA 2B4RO 4R5HA 3EW7A 5IXSA 3STHA 4N5LA 4XX0A 1S7CA 3L6DA 1OFGA 3K31A 5U1PA 2FWMX 2GF2A 5DP2A 3FHLA 1M76A 1U28A 1A7AA 1LC3A 3DZHA 1GDHA 4PLGA 2ZTUA 1T25A 1ZBQA 4TKLA 3RQSA 4DQVA 4JLWA 3KYBA 3UCEA 1U3WA 1YQGA 1DDOA 2CFCA 3UAGA 1H2BA 1G1AA 3DB2A 3GMSA 1GUZA 1JVSA 2YY7A 3SC4A 5DCUA 3GDFA 3VDQA 1J6UA 5G0WA 1YGYA 3UKOA 4HUJA 1LSJA 1XWFA 3H3JA 5AXDA 3RBZA 1DIBA 1P45A 4FC7A 4Z9XA 3BHJA 5F5NA 4FB5A 1NASA 1DLIA 2NU6A 3ROMA 3UOGA 3DBLB 3K96A 4CV3A 2VRBA 5KVVA 1N7HA 2YV2A 5HS6A 4KTVE 2NQTA 1PJSA 2FR1A 4XGKA 4J4HA 2I66A 2C2XA 5KOIA 4ZQGA 1T26A 4NU5A 4IS3A 3N74A 4J1NA 3P19A 2BGMA 3WYBA 1T2FA 2Y1CA 1AUPA 1A9ZA 1JTVA 2XXJA 5B1YA 3D64A 1LDGA 1ISGA 5IN5A 5KCZA 1ZJZA 3CZRA 4HXYA 4BMNA 4XZ3A 5AXBA 4CR8A 3L9WA 4EUFA 1W0CA 4Q3DA 4QUKA 4JJIA 4CM5A 2Y1DA 3ETDA 4MVJE 1GQYA 4J9UE 4Z3KA 1H6CA 3NJ4A 4DL9A 4E13A 3WIDA 3EK2A 4XIYA 1DOHA 4ZQEA 3KYCB 3GDOA 4EEXA 3I9OA 4GKVA 2AQIA 1DXYA 4TSKA 2Y1GA 3F3SA 1IB6A 3FNGA 3FWNA 3NAQA 4OXNA 3VHRA 2YFHA 4RZHA 4OXKA 1CYDA 3ROQA 1PTJA 1P77A 2UUPA 1YRLA 3JQFC 4PLCA 3KRTA 1XIVA 2C7GA 5IJZA 1QXSA 1H6DA 3KBOA 1ZEJA 1HZJA 3KZVA 3PJEA 3BTOA 1I2CA 1J0XO 2CDCA 4J6FA 1B3BA 3K73O 1I3NA 2Q46A 3PWZA 1JWBB 2C20A 5T6BA 3C8MA 5JE8A 3I23A 4CR7A 2Q1SA 1C0LA 3L6OO 4GBJA 5CHEA 5BNFA 4KP7A 1SEPA 2BMAA 2HQ1A 2PKQP 2YDYA 5C37A 3H9UA 5HTOA 3IIEA 3V5NA 2YV1A 2OBYA 1ISMA 3C1AA 4QO7A 5KJCA 4HADA 1PJLA 1VI2A 1O89A 4WCFB 3P5SA 1U5CA 1JA9A 4L76A 3GUYA 2DBZA 2JCVA 3GN1A 4UEOA 4WOKA 4CM8A 1H94A 1I33A 4L8VA 3WGIA 4QSMA 1O6ZA 2AA3A 4CLEA 3D5TA 4OXYA 4LCEA 1T2DA 4AJOA 3M2PA 4JBIA 5TIIA 4BNWA 3BMOB 3GRKA 4R1TA 5DULA 5G0TA 1H2HA 4IUYA 3B1KA 1JVBA 4YB8A 5U4QA 2PKQO 4E31A 1R37A 2Q4EA 2IYOA 3KUXA 3M2TA 1YDEA 3D3WB 4BKPA 1DSSG 4RDIA 1ISJA 1PX0A 3F4BA 2HK8A 5I7FA 5ITWA 4JIGA 3ORFA 3LYLA 2H5LA 3ZNOA 3DMTA 3TSCA 3OM9A 4DWVA 5CDUA 1EDOA 1UXIA 4GQAA 3VKUA 2NVUB 3AU9A 4YT4A 1H9AA 2X0JA 1F14A 2EERA 2CVOA 1YOVB 5CPBA 1ZXLA 1R15A 2POQX 3ENKA 1C3VA 2O48X 1NP3A 4AJJA 1HE3A 4XR4A 1NQ5A 1SAYA 2LDXA 4W82A 1KVRA 1D8AA 2FPGA 3OMLA 4WLVA 4RJTA 2P5UA 1GZ3A 2H63A 1E7YA 2R6JA 4WEQA 1T1RA 1DPGA 3R0IA 2PTGA 1DC6A 1ZK1A 5L53A 3MEQA 2D5CA 4W4TA 1LLQA 4ESOA 7ADHA 4WLOA 4OKIA 3H7AA 4AJIA 2HO5A 1QP8A 2QZZA 4ZICA 4GLOA 1PSDA 1QLJA 3HB5X 1QG6A 4E3ZA 4CQLB 2YV3A 3NUGA 4P8RA 1Z74A 3TRIA 3CE6A 1Y7TA 1WAMA 4GGPA 3WOHA 1LTHR 2QHXA 1ULUA 3VC7A 1LUAA 4UVEA 4J7XA 4IGEA 2IZZA 3DTYA 2WDZA 3U3XA 1NPTO 1I30A 1GUFA 3WG9A 3UVEA 5KJ1A 4MP3A 4GH5A 2NLOA 3PGJA 3EHEA 1D3AA 4YJFB 2P9GA 4R68A 3JYLA 4I8XA 5F1OA 3ASVA 3GG2A 4I9UA 1YL6A 2C5AA 5BSEA 1B3RA 1ZMOA 4PLHA 4QECA 1O0SA 3VPHA 2ZK7A 4QTZA 3WLEA 3INGA 3PHHA 2GN6A 5A02A 3QQPA 1K2WA 1H5QA 4DIFA 4INAA 3QWHA 5TQVA 2EEZA 3DQPA 3GHYA 3JD1A 4RPJA 2ET6A 5L7YA 5F5LA 4KUHA 1C0PA 3FCOA 4GX5A 4K6CA 4U0KA 3TZCA 2NWQA 5A4DA 3JQAA 1N7GA 5L3ZA 1H6AA 3FSRA 3PVZA 5KKCA 1DO8A 4W7HA 4CM6A 4W99A 4P4LA 3U5TA 3OSUA 4N18A 4IY1A 1FF9A 2BKAA 4Z9YA 1Y9AA 4YJHB 1NQTA 1GY8A 1XQ6A 1G0OA 2VUUA 3PLNA 3QVTA 2O2SA 4BNUA 4BO5A 5IZCA 1DHTA 4LVCA 1D1SA 4Z0TA 2I99A 3AW9A 1YOVA 4WEOA 5JXWA 8ADHA 4XGNA 3TPCA 3AY6A 5AQ1A 5I7SA 1A27A 3T4EA 1EMDA 3GGOA 1PQUA 4EYEA 3JD2A 2NVWA 3LDHA 1V35A 2FSSA 1I3MA 1P1FA 3Q2IA 2AW5A 5ICSA 1NR7A 3RUIA 3ROKA 1LNQA 3QA9A 3BTSA 1AE1A 2C29D 4I1IA 3ZHBA 2C59A 4DIOA 1EVYA 1V3VA 2FR0A 1PGPA 4KWHA 1SB8A 5A06A 4RVGA 3U9LA 3BZUA 3F47A 3UCXA 2I3AA 3WWZA 4CL8A 4E6PA 1ULSA 4UVDA 3RROA 3I83A 2W2LD 4BQRA 1GU7A 3R3JA 4RQUA 1CIVA 5CAEA 2QRJA 4GX1A 4IJVA 3ZDFA 1QORA 4YAKA 2ILTA 1R6DA 1RJWA 4K9DA 1Z45A 1Z7BA 3JV7A 3W4JA 2QRLA 4NIMA 4FFMA 3ANMA 4PG7A 3ZWYA 4K26A 3HDQA 4IJWA 3RVDA 4RGBA 3LF1A 3ONDA 1GYPA 5K6AC 1L7EA 1P1KA 1XHLA 6LDHA 1PJCA 4CMCA 4WKGA 1ORRA 4DLAA 4E5KA 1E7QA 1HDYA 2AEFA 2PNFA 1HRDA 1ML3A 1EVJA 3PWKA 2WTBA 4PGFA 3S2IA 3AY7A 3JD4A 3H5NA 3GPIA 3JYOA 1VRWA 1P33A 4J49A 1JDJA 4BO3A 1E3EA 2FHSA 4KDFA 1PJBA 3G49A 3WXBA 1BDMA 4JGBA 4Q3BA 1WP4A 3JQ8A 3D3WA 4DLLA 3V1TC 1TT5A 3NJ8A 1I24A 1ZUD1 3E9MA 2EJVA 1LJ8A 3JD3A 3HHPA 2D2IA 3PWSA 5A9SB 3SX2A 1BG6A 3ZNPA 4DBVO 1HF3A 4Y6RA 3O03A 2SCUA 4HFNA 2FMUA 4Z3DA 4DYVA 2EJWA 3HUDA 4JJFA 4JBGA 1J4AA 3DOCA 4E2ZA 3P2OA 1PJTA 1ZFNA 1EQUA 4CJXA 2GZ1A 4WUVA 1X0VA 1Q2XA 4WECA 3PIIA 3HE3A 4RVDA 3C7AA 2PZJA 4OIMA 2ZIZA 5EMHA 3K6JA 2I5PO 4BNHA 4D79A 4D3DA 3H2ZA 4J0FA 5L4LA 5DP1A 4DC0A 2D4AA 3V1YA 2E49A 2ZATA 1U8XX 3GA0A 4BNNA 1XDWA 4XIJA 4BGEA 3X2FA 1ZSYA 4PLFA 2X0NA 2BHLA 5FYDA 5T8KA 1MX3A 4PRKA 3H9EO 3VH4A 2PGLA 1DAOA 1G0NA 5BQFA 1GUYA 1I2BA 3KHUA 4E30A 4GSKA 5A5FA 1LLDA 2G82A 5BNIA 2UAGA 2W4QA 4PFJA 4JBHA 4YBZA 1P31A 3H2SA 4DREA 1DC5A 2IODA 2P68A 3OQ1A 2XXBA 2VOEA 1ZK3A 5JS6A 1QR6A 2VOJA 1LI4A 2CF6A 3W8FA 4R1UA 2P91A 1N2SA 4I08A 4E33A 4OAQA 4YJGA 3DL2A 2GNAA 3B20A 2FZEA 3QVSA 3MTJA 3QVXA 4LISA 3NEPX 1NFRA 4KUEA 4K6FA 1A71A 2VCYA 2VYVA 3K9QO 5GY7A 2IZ1A 1SOWA 5GZ1A 3VAZA 1YVEI 3RUCA 2X5OA 2QYTA 1U3UA 4KQXA 1RPNA 4CUKA 1YONA 5BSFA 3RKRA 2YYYA 1EFKA 1J49A 3HDYA 2YHUA 4BGVA 1N1EA 2Q99A 2Q1TA 1I3KA 4GLLA 3DZGA 1V8BA 4I9NA 4F46A 1I32A 1DJQA 1NWCA 2A94A 2VTDA 4PCVA 4RLHA 3G17A 1T4DA 1ISFA 2HCTA 2VQ3A 2YJZA 1Q7GA 5ENDA 3UCFA 4G81A 1MXFA 4ALJA 3OICA 4FC6A 1LC0A 3ZU4A 1ZKMA 3A1NA 1NAHA 3CH6A 5AYVA 1ZSNA 1HSOA 3TNLA 3OH8A 3BTVA 5JPIA 5JCJA 3G3EA 3HZZA 2X5JO 4R9RA 4TZTA 3H9JA 1LBEA 3GAFA 4TKMA 3PZBA 4YDRA 5KVCA 5I9NA 4GGOA 4PG4A 2A9FA 2PLAA 1UAGA 3DMTC 2BFOA 2RBEA 9LDTA 1UXJA 1FDSA 3Q2KA 1Q0HA 2DBQA 1D1TA 1QSGA 4R54A 4AJHA 2VWQA 2Z1NA 1EUCA 3CIFA 1PU2A 3I9LA 1J5PA 3F1LA 1VJTA 3GF4A 2DBRA 3IJRA 2IYPA 3QE3A 4WOJA 3UUWA 4J7CA 4NBTA 4YTEA 3WWYA 3FBGA 3W4IA 3NKLA 4Q3CA 3A06A 2YDXA 1GV0A 3G1UA 5JLAA 3DZJA 4J1QA 1E77A 3LLSA 3VOSA 2ZYGA 4BO6A 2NU9A 3MOGA 4MVJM 3WMXA 2WSBA 2QIOA 3NDRA 3WDSA 3W8DA 1MLDA 3X2EA 1KC3A 2RCYA 2O3TA 3OIGA 3PQFA 3GFGA 2J5QA 3EZLA 4KWIA 5DF1A 3WIEA 1KY5A 4IINA 1LX6A 3C3XA 2Y93A 4RL6A 3LVFO 3R6DA 2X1HA 1FJHA 4Y98A 1MA0A 1ZCJA 3DAGA 4B4WA 3AFMA 3Q9UA 2BFMA 4FR5A 3V8BA 1UAYA 2NM0A 2Y0DA 2GASA 5DN9A 3UGKA 1SBYA 4XJSA 1LU9A 5HS4A 2HMUA 3D4NA 4W9NC 3H5AA 2IE0A 2WD8A 4Y6SA 2DTXA 1U4SA 3HNPA 3WBBA 2BRUA 1GL3A 1CDOA 1IYZA 1CJCA 2V7PA 3E18A 5DNAA 4NNJA 2DFVA 3GVIA 3BIOA 1E3SA 1UXHA 4GSLA 1PIWA 3QVWA 1HT0A 2E6UX 3SBOA 3RASA 4FGSA 2B69A 2BI8A 4IZIA 4NQZA 5HA5A 3FTNA 3RU9A 1K6IA 5DDIP 2ZTVA 3BYZA 1KIFA 2HAEA 4R4JA 1Q1NA 1EK5A 2VHYA 3OFSA 2EP7A 3S55A 4R51A 1G6KA 1GPJA 2BD0A 3ZH2A 1Q0QA 4E21A 3B70A 3W8EA 5TJ9A 4AG3A 4LW8A 1XGKA 4YJFA 3PFWO 1U3VA 3L07A 5TJHA 1HE5A 3HN7A 1QYVA 2Q2QA 4BOYA 4NFYA 4ALKA 4FBGA 4ND5A 4ZD6A 4RCVA 4YPOA 2YW9A 1EBUA 3PZRA 4IDFA 5L95A 3P7MA 2GN9A 1P74A 2AQ8A 3FPLA 3GNQA 1U2GA 5I7EA 2DM6A 4EDFA 1WNTA 3BMNA 1VL6A 2AQHA 4ZVVA 3DFUA 3GVCA 3JQ7A 5EQDA 5G0SA 1YBMA 1R4NB 1RM3A 1E1LA 1EE2A 4II2A 2BF7A 2Q3EA 3ONFA 4O5OA 3V2GA 2DAPA 4S1VA 1RYDA 5JSFA 2WWRA 3GPDG 3LZ6A 1T2CA 2YQ4A 1AGNA 1R4MB 1V6AA 4O6VA 1YBVA 5H81A 1LDEA 1JAYA 1BTOA 3RSHA 5FEUA 4FFPA 4RVUA 4YJHA 3S2FA 1XQ1A 3KB6A 3Q0EA 5C5IA 9LDBA 5C7IO 3L6EA 3AI3A 4CMIA 2WMDA 3K92A 3ZHXA 3QRWA 4Q9NA 1HDGO 2PD4A 1PS9A 1L1FA 2YFQA 5I8WA 1YXMA 1H9BA 4PG6A 3ZW8A 4PZCA 4R01A 4JNKA 1LRKA 4WGGA 5IXYA 2BGKA 4FQ8A 1WWKA 4HNHA 4OSOA 1E3JA 4CL3A 1EFLA 1VKOA 1HDRA 3QJ5A 4DXHA 4PVCA 2P2SA 3LU1A 3CUKA 1SO8A 2Y0CA 1EE9A 1EZ4A 4AJNA 3SXPA 3VPSA 3RBVA 4NK4A 3U4CA 2I9PA 1DHRA 4GWGA 3ROPA 5DOVA 2UYYA 3CKYA 4RORA 3JQGA 4JK3A 3QSGA 4PLVA 1RWBA 1TB4A 1TA4A 3GRPA 4U7WA 2Q50A 3JQ9A 3E03A 4YWJA 4BMSA 4BHTA 4RO0A 4CQMA 1B2LA 2X23A 5B4TA 1U7HA 4YYZA 3VZQA 3K30A 3GVXA 2C82A 3OEYA 4FIZA 4TMFA 2VUSA 2JAPA 1R16A 4CMEA 3DEYX 1HSZA 1WMBA 4DGSA 3GT0A 4FN4A 5JMPA 3NRCA 1YWGO 1ZH8A 3GEGA 3M6IA 2W2LA 3BHIA 1DIGA 3K5PA 4J16A 4XKJA 2C5EA 5ENVA 4EJ0A 3GZNB 2X58A 1LRLA 5CG1A 3IOYA 3K2EA 4H3VA 4D3SA 1E3WB 4LSWA 4Z9FA 1Y8RA 2VYNA 5A9RA 2C7VA 4FDAA 5DBGA 2HMVA 3TFQA 3ZV5A 2DVMA 2O7QA 2Q2VA 3VPFA 3I6QA 1JQBA 3GMDA 3JQ8B 2Q4BA 5C3MA 4WCDA 1KOLA 3WQQA 4U6SA 1ONNA 4DPKA 4NG5A 3OQBA 1R4NA 2HLPA 2O3RA 4LMPA 4RDHA 1X14A 5JCXA 4NFHA 3ZWAA 1EBFA 4RF5A 3WGOA 4AJKA 3I9KA 4ND2A 3WYCA 3T7CA 2RHRA 4NDNE 1BXGA 5JAZA 1ZEMA 2G76A 2X9NA 1YB5A 4U5QA 3OEWA 2IDZA 1GPDG 2DPHA 4KUGA 1ZSVA 4D44A 2YHIA 3WYEA 2J5KA 1V9LA 5A9TA 3TN7A 2GYYA 1TT7A 2D1YA 2V6FA 2ZB3A 4MVJG 4EI2A 3KYCA 3U0BA 3RFVA 1X1EA 4BMVA 4CLRA 1VM6A 3RUDA 1U9JA 3KEOA 2DFDA 3NYWA 5LCXA 4A7PA 5T57A 4EGFA 2GLXA 3I4FA 4MKXA 5CPFA 2E48A 4BVAA 3TFOA 1DRWA 4BNFA 2X8LA 3RD5A 1UZLA 3E5MA 5JYEA 3AOGA 4NBVA 3ZW9A 4MP8A 4JCOA 5L45A 4XQGA 5ES3A 1YQXA 3CEAA 4JX8A 5CP8A 2AMFA 2A4KA 4DA9A 4JQCA 4HWKA 1OAAA 5TRTA 1NPYA 2DQ4A 4J90A 4R3WA 3AOEC 3KETA 4RF4A 3DBRA 4G2NA 4FFNA 1KVQA 3LT4A 3DBLA 1YE3A 4BNGA 1P1HA 1GAEO 3D0OA 3DWFA 4BNXA 1DBVO 1YL5A 3SEFA 4FSHA 4HY3A 3NTQA 1ADFA 1C1XA 2OP1A 1C0IA 1HZZA 1X0XA 2V6MA 3PEFA 4BV8A 4M55A 2PFGA 3I1JA 4CLHA 4MVJH 4B8ZA 4PG5A 2O2YA 4YRBA 3WB9A 4XDYA 2X7HA 5J23A 2DT5A 3AUSA 1ENZA 3GNTA 1UDAA 3UICA 2G5CA 4FW8A 3GUCA 3H5RA 4FS3A 2NTVA 3OF2A 1LDBA 5H83A 3NDJA 4YQZA 4AICA 4BB6A 4GWKA 3W6UA 4ZGWA 3TZKA 1MV8A 4L0QA 4DQUA 4I5DA 2R2GA 4WNCA 5JC8A 2O4CA 4KQWA 4MP6A 4IQ0A 3FNHA 4UUOA 4YJDA 1PJ2A 3A14A 3LQFA 4HV4A 1PEDA 3KM0A 3CSDA 4IMPA 4B3HA 3IQDB 4L74A 5ICMA 1PZEA 4B4OA 4Q3NA 4WLFA 4EUHA 2PD3A 3FRJA 4OOFA 1E0DA 4YQYA 1C1DA 6ADHA 1P1RA 4XA8A 4FFOA 4BO4A 3DDNA 3VZSA 4BNVA 5ITVA 4F6CA 1Q7BA 1LXCA 4NR0A 1NVMB 4H7PA 3WICA 3GVHA 3ANNA 4B4VA 2P9EA 4N54A 4P4NA 2C07A 3HN2A 3MJTA 4NH4A 2JFHA 2OO5A 3NT2A 4QXMA 4RVHA 4JJGA 4ONEA 1MG5A 1LQTA 3PTZA 1PJQA 1DFIA 3OETA 3JYPA 3WX0A 1QYCA 3BMCA 4GVXA 1PQWA 2WE7A 5I7VA 4OO3A 3RC1A 2W98A 1VJ0A 4A0SA 4E12A 1A4IA 2ZTMA 3G0OA 4YT8A 4IJKA 4EBFA 1BVUA 3AU8A 3UH1A 3RC9A 1DAPA 3HSKA 4UUPA 5B4UA 3QP9A 5JAMA 4IMRA 3JQ6A 2V6BA 2HMTA 2O50A 5I9LA 2NTJA 2GO1A 3IL2A 2BELA 2CSUA 2E82A 1VSVA 2ZB4A 3DHYA 3ZV6A 3DBHA 3H9QA 3IS3A 1DIRA 2FN7A 2I6TA 2GDZA 3IUPA 3K2BA 5HM8A 3FPCA 3EVNA 1NBOA 4PLPA 3SLGA 5L9AA 3PIDA 5K6AA 3DTTA 4PG8A 3TL3A 5LDHA 5TT0A 5A04A 4E2WA 1D4FA 3AM4A 3U4HA 4TRRA 2PD6A 3KSDO 3R1IA 1FXSA 2BLLA 4L73A 1ENYA 4H16A 1SOVA 2VHVA 4E5PA 3JQBA 3WS7A 5B12A 2X5KO 3VTZA 3I9JA 4XRRA 2QW8A 4NI5A 2I3GA 2Z5LA 3GEDA 3QWFA 4KDEA 2C54A 2VUTA 4PIVA 4X54A 5JY1A 3OBBA 3N7UA 2VT2A 1PL8A 3ZN2A 3H6KA 1BMDA 2PH5A 5DBIA 3QVOA 1BHSA 4FPXA 1CQJA 1FDWA 4A03A 1GR0A 2Y0EA 3PYXA 4RPGA 5A5EA 4I5GA 3GC6A 4J9VA 1GFSA 3I4CA 1H6BA 5CEFA 2HRBA 5HBRA 1DRVA 1ZW1A 3VDRA 3ON5A 4CQLA 3DAPA 3PDJA 2HSDA 3GGGA 1YB1A 4TZKA 3CMCO 4EITA 4PLZA 5T5QA 4WNIA 2OORA 3M1LA 4L4SA 1ENOA 3IAHA 4PZDA 3H8VA 2HJSA 1KERA 1YKFA 2J6IA 2Y1EA 2H9IA 3L9XA 4BIIA 4FCCA 4XYBA 1YBAA 1A4UA 3IJPA 3KSZO 4TVOA 2G17A 1PZFA 5IZCC 1PWXA 3JSAA 1GZ4A 1IZ0A 2DU8A 4ND4A 1H0KA 3DBRB 3PLRA 4CPDA 4J7UA 5A3VA 1Y8QA 1PGQA 1WZIA 4OSPA 5A3JA 2D59A 3Q9NA 3ABIA 2Y99A 1ZNQO 1DRUA 1Y8RB 1RKXA 1HXHA 4CLXA 1BSVA 3OJOA 3Q11A 1SNYA 2P9CA 3DXFA 3OJEA 3ONEA 4YEDA 1GQQA 5A05A 3ZWWA 3PDUA 5T67A 2Q49A 2VHWA 4XQEA 3JYNA 1PJ3A 2O3JA 1MG0A 3VZPA 4XCVA 2JCXA 2FR8A 2NVUA 4GX2A 1VL8A 3QWIA 4PRLA 2Y1FA 1VSUA 4W7IA 4Q3AA 3UW3A 1Y9EA 4ALIA 4D3FA 5FFFA 4GMFA 4JP3A 3L77A 2X86A 4MVJA 2B37A 3LC1O 4OOEA 1FDTA 3WR5A 4U8GA 1OC4A 1ZO8A 3E1KA 2YHIB 3NDIA 5DT9A 3MJVA 4UVIA 4CM1A 1LSSA 3AOEA 2VHZA 3ZWPA 2VN8A 1HLDA 4HFJA 1FMCA 3IP3A 3WSWA 1X7DA 1D7OA 2AHRA 5IFLA 2CY0A 2NSDA 5EJ2A 1Z7EA 2UVDA 5JDCA 3RJ9A 2AG5A 1ISHA 2RH4A 2AE1A 3NX4A 4CV0A 1AN9A 3TZHA 5JDIA 1ID1A 1T4BA 3C1OA 3PXXA 1DFHA 1N92A 3ZWVA 4Q39A 4IXWA 4BO2A 4AJPA 5IDYA 1HETA 3EYWA 1W6UA 3DO5A 5G4KB 3RAJA 1ARZA 2GERA 3FD8A 2V6GA 1SPXA 4D43A 5KWEA 1K6XA 2Q45A 4MDHA 5FI5A 4CM4A 3U09A 1VPDA 4II3A 1M66A 4IDAA 3BMQB 1NR1A 4AFNA 1NTOA 2VNAA 3QV1A 4ZHSA 2VT3A 3UN1A 4AJLA 3IMFA 2J3JA 2A92A 1HE2A 1NAIA 4RLSA 3MWDB 3E9NA 4L9RA 5DZSA 2DKNA 5I8ZA 5IDXA 2NADA 4DC1A 2NQ8A 3EMKA 4F3YA 2HUNA 4XYEA 5AXAA 5JY6A 3EZYA 1QMGA 2CDBA 3S8MA 4RV9A 2JHFA 3WJ7A 1MC5A 3VPXA 1DEHA 2OMEA 2PK3A 2O7SA 2Z95A 3OJLA 1EDZA 3O38A 4IDCA 3LSYA 5K0ZA 4ITUA 2NVBA 4XJTA 3C24A 4YJGB 1K6JA 3H3FA 4DMLA 2Y05A 1L7DA 2JD0A 1GQ2A 2NUAA 4M49A 3RI3A 3ICCA 4RVFA 3IDSA 4ND1A 4IGFA 3RIHA 1T2EA 1NX6A 2DUUA 2EV9A 4JN6B 5LC1A 4IS2A 4EJ6A 1BWSA 1NHWA 2R00A 3AI1A 3HB4X 5JAQA 3DZKA 1VE9A 3Q6IA 3OP4A 4QQRA 3I3OA 4NJMB 1KVUA 3DOOA 4B3JA 3B1JA 1AXGA 4MJLA 1DIHA 2UV8A 4KTTE 4Z0PA 2J3IA 5JYDA 1U8FO 3RBXA 1I5RA 5CDSA 5IZ4A 3QY9A 3GGPA 5G2OA 2ZCUA 2B0JA 3GHHA 3MZ0A 3GZ4A 4J0EA 4OH1A 4BGUA 4YR9A 1KS9A 5K9ZA 3FBTA 3DONA 2BFPA 1LQUA 4WASA 2VZ9A 5A03A 3C1TA 1BW9A 2Q2WA 2NU8A 3HADA 1UP6A 2A35A 4WJZA 3WTBA 3PHJA 3ZU5A 3NTOA 4LSMA 2IEBA 5JAIA 3GR6A 3PK0A 1RM0A 1ZK2A 3BA1A 2VNSA 4OQYA 4D41A 1C14A 4B8WA 1QV7A 3AY3A 1MXHA 1XLTA 1JN0A 2VRCA 5L4NA 1I0ZA 3GDGA 2DUWA 2EW8A 2PH3A 3GG9A 4N5MA 4ZRMA 3TZ6A 1MP0A 4CMAA 1LDNA 3F1KA 2JJYA 1KEVA 1NQAO 4NBUA 2I67A 5AVOA 2CNBA 1LRJA 4E32A 1E3LA 4DQXA 3QIVA 1B7GO 1GYRA 1NQOA 3MCVA 3RJ5A 3ZI0A 1KEUA 1VJ1A 3DMYA 5CFZA 1B16A 4JP2A 1LLUA 2HDHA 4ALMA 3D7LA 4K1LA 4DPLA 4A2CA 5IF3A 1Y1PA 5GMOA 3OIFA 4UREA 2FRDA 3TDKA 3HWRA 2AXQA 3DBHB 3GQVA 5GZ3A 5BSGA 2HRZA 3TF5A 2X0RA 1DB3A 3OA0A 3O8QA 1AHHA 4MIYA 4AJEA 3ZU2A 4C7JA 4LVUA 3LF2A 4BO8A 5JBIA 2AQKA 4XB1A 2GRAA 1PS0A 3EAGA 1Z75A 4XD2A 1VLLA 1OI7A 1Z73A 2FSVA 2Q1WA 1N9GA 4R5MA 1PGOA 2GZ2A 1X7GA 3L0DA 2O3SA 4N7RA 4DTIA 2WYUA 4H15A 2D8AA 4P22A 4BNZA 1QRRA 1IUKA 3PGXA 2WJPA 1YH3A 5COBA 5KKAA 3WQRA 4MIEA 2IXBA 4XEHA 4W6ZA 3ZHZA 3BAZA 1UJMA 1ZMTA 2H6EA 1FK8A 3LT0A 4R16A 3WQSB 3PHGA 1SZJG 4E5YA 5CG2A 3T4XA 4XWYA 4YAJA 4Z6KA 1BVRA 1UXGA 2OFPA 2I76A 3WJAA 2FPIA 4IDBA 1E3IA 5BT9A 1LA2A 4R1SA 2J3HA 3ENNA 1CERA 4M87A 1JKIA 1M6WA 1E1MA 2PZLA 1QV6A 2B5VA 4LGVA 3ZU3A 3BMCB 2PWZA 1KVTA 4R41A 3RKUA 4M8SA 4DMMA 3A9WA 5MDHA 1RM4A 3JQGB 3MJSA 1E5QA 4WK6A 1YO6A 4NJOA 3ST7A 2NU7A 4MKRA 3H9GA 4HX5A 2F00A 3IC5A 1SC6A 4HFMA 3TWOA 4NZ9A 3JD0A 3K8ZA 4B7UA 4E4YA 4LN1A 1PR3A 4U6QA 4ZA2A 4ZRNA 2JCYA 2PA3A 1I10A 4D7AA 2O23A 1GADO 3NV9A 4GPD1 4DLBA 1HWYA 2GD1O 4OHUA 2E4AA 1X1TA 3GAZA 4J3FA 3JCZA 4CLOB 2VHXA 1CETA 3ADPA 4WCFC 5LDGA 2UUOA 4CM3A 3F4LA 2QRKA 3E48A 3ETGA 4XQ9A 4DPMA 4R69A 4RF2A 3NT4A 3U49A 3VVCA 1B15A 4BNLA 3R3SA 1CF2O 5IG2A 1YL7A 1UXKA 4B79A 4MIOA 3W4KA 4J4TA 3NGLA 2DTEA 1JU9A 2XOXA 3NT5A 2VTEA 5L51A 4NHEA 3WFJA 1SEVA 3KOUA 2P5YA 4IIVA 3AUTA 4IDEA 4GI2A 4B7XA 3B6ZA 3PRJA 4YCAA 1F0YA 2CZCA 1WVGA
chains in the Genus database with same CATH superfamily
2Q3HA 1V71A 1QB7A 3SEZA 5LJIA 1ADGA 2ZYHA 5AJWA 3ZY2A 4DLNA 5BQXA 1VCIA 3FCEA 2C5HA 2EF1A 2W22A 3P9ZA 3CTPA 4GWLA 3WFZA 1BHJA 1SXJC 4TS4A 4UUNA 4BKRA 4BVFA 5CUQA 3TLXA 1G3MA 5DTJA 3L4EA 5A0VA 4Q1BA 4ROSA 4KIJA 5I6DA 1NW5A 3OTOB 1GZSA 1PR2A 3C3WA 4PN3A 1U0JA 1T0JB 1WQ3A 4GRDA 4U7PB 5FWAA 1EP3B 4GDFA 2AWNA 5AUPB 4MV9A 3X1WA 1IOVA 4HTFA 1HE4A 1UDWA 2XSZD 1TJNA 4Q66C 2WHEA 2Z3WA 3M1AA 1FJGB 4HEHA 1W8IA 2ZKLA 5KYUA 3KQNA 4CIBA 1JU3A 2G8LA 3CNNA 3PUKA 5C8XA 2HYIC 4EMSA 3KUDA 4PQEA 5J4VA 2AV6A 1ZVMA 3JASA 3SBXA 4CMJA 3ZE6A 4LJ5A 1VHJA 2QNBA 1XCOA 1WS6A 3EIXA 4L27A 4UBLA 5FOWA 2D5AA 4B7CA 2YUIA 5FOXA 3QKUA 5CB4F 6CHYA 1NI4A 2P2DA 5LBUA 2VJPA 4RIFA 5FBHA 4CQMB 4UAVA 1Q6YA 2OM2A 3HKBB 4ER3A 2DLDA 2YWJA 3P0JA 4OP2A 4P84A 2J0EA 3M6XA 3H5IA 3G0DA 3Q85A 3VNBA 3MN1A 1QPGA 3I52A 3JATA 4LKOA 2VQEB 1NLMA 3I3SR 2G8NA 4M88A 1RXVA 3H05A 3TLJA 4MJXA 4OBEA 4ZARA 2ODTX 3D6MA 1HYQA 1K6MA 4WN9A 4JELA 3S2UA 1WUHS 1J21A 3ZIUA 1CJBA 1KOGA 4X94A 3Q7QA 1EVIA 4OQLA 5HCNA 2CXSA 3FVTA 2VYND 4FGWA 4BLPA 5I47A 1YS4A 1KVSA 3HJAA 2GAJA 1XO1A 1V5IA 1A9YA 2G28A 1FDRA 3F5QA 3VOAA 4ZOLA 3IESA 4DXAA 3VTFA 1H2XA 4PC1A 4PZAA 2NO4A 3E22A 4J91A 2ZR0A 4WQMA 1F4LA 5IJWA 2EFGA 1AS0A 3MS2A 1UH5A 2EFDB 4B47A 2I29A 3U4IA 1G5FA 4EY8A 3AM1A 1JHMA 3TIGA 2BFFA 1M0TA 3QELB 5ESXA 1GCUA 5AQEA 1TA0A 1O97C 4KVGA 2Y2UA 1IHXA 3RAPR 4C4OA 2PKCA 1VLQA 1PS8A 3BG5A 3L8FA 1I6LA 1FNBA 3ED5A 4QIHA 4WFQA 1ONBA 1WCXA 4ZVNA 5CK5A 3T5MA 3VV3A 2CCJA 3W7VA 1ZZEA 2X76A 4PYNA 4TMXA 1D2CA 4J4BA 2NSHA 3EBLA 3Q5GA 2W2MA 4HRXA 3R7FA 1JSXA 4EK9A 4TN5A 5PGMA 3RIGA 2BYTA 8GPBA 4BQSA 5JI2E 1GGFA 3FVWA 4JUDX 2QDXA 1FDVA 2OL4A 1KIAA 5IVPA 2P4QA 4MMXB 4R9VA 5I3CA 2O20A 2WD7A 3EGEA 2PRKA 3I6IA 1NL3A 1AUOA 1F51E 3PJGA 5GV8A 1FTNA 2OQVA 4AMGA 1KQ3A 3TXXA 5KNCD 4M1WA 1CE8B 1SUAA 2AC7A 2BFBA 2VK2A 4WN3A 3ZVKA 3PFNA 1GN8A 1QYRA 1U3GA 1SU4A 1PV4A 1KY4A 3JR7A 1ZWLA 2J5RA 1CZUA 3NBMA 3ZWOA 1NHGA 1UBOS 1A96A 1G8FA 3G9ZA 4NPCA 4C20A 5DM1A 3RABA 1XD2B 2HWKA 4CODB 1K97A 4DBLC 4HTFB 5KZMB 1TVKA 4GL4A 4HH3C 4GVPA 4U3JA 2FW1A 3QF4A 3TJZA 2ADFA 3ADKA 2QVCA 3LHDA 3NETA 4DABA 4ER6A 4C7XA 1CY4A 3BMQA 2O57A 2W6JD 4QATA 1NXTA 1J8YF 1T4CB 3W2GA 1JDNA 3UGQA 4QOSA 3NTUA 4XQ0A 4GQBA 2EG9A 3AUAA 3WKDA 4J0DA 3IV6A 5G40A 1HDCA 1M1YE 4Q4HB 3KSBC 2Z6VA 1JS1X 3V1UA 1K27A 3UXEA 2W2KB 1N2OA 4FHDA 1TM7E 5AJUA 3KUUA 2CB0A 2QJWA 3L0IB 4XYMA 2HMWA 4OQZA 4YH1A 3SMVA 2IEIA 2XTNA 1QTNA 1HLPA 1WHTA 1Y37A 2FCAA 3B3AA 3KEQA 3MCWA 4NVRA 3RU3A 2OC4A 1AM4D 1A9RA 4MQUA 3AI2A 3AFNA 1JB9A 1FX0B 4OB8A 1ZJYA 4LJAA 5LKAA 3DLHA 2AS0A 5KJFA 1RQNA 2HPAA 2Z2KA 2JH8A 5D1HA 2IDJA 2QROA 3IHLA 2VT7A 2WYVA 2OCGA 2X77A 2FPPA 3B6EA 3WNVA 2AF4C 4B71A 4Q9IA 1W96A 3UXMA 2ZW9A 1E32A 2EFYA 3ANXA 4HH1A 2G1UA 5DGDA 1T43A 4N3AA 2ADMA 4G65A 1ZUWA 2AZMA 4DCGA 3LA6A 5IT0A 1KSJA 3FUWA 2QPLA 1W2GA 4RHCA 2O3UA 3C85A 1Y6FA 2COEA 2QV0A 1PRYA 2X9GA 4HNRA 4QUHA 2E5LB 5CDYA 2PJUA 3BGIA 3NIBA 2WUDA 1MFZA 2ACVA 3OPYA 3VI4B 1R0KA 4P5EA 4C7MA 2MYPA 3UOAB 1L7OA 5FO1A 2SNIE 5BPHA 5B7PA 4G8DA 4TOIA 2VHQA 3DOUA 1ZXBA 1A9PA 2O2DA 5F9FA 1I7NA 4JR0A 3WKCA 4HDMA 2J0SA 4IVNA 2C04A 2Q5FA 4Q37A 1KFKB 5AK3A 1G4UR 2LNDA 3VO1A 1QFMA 5COQA 1U8AA 2TYSB 3H84A 2OV8A 2XMSA 1MV5A 4IZHA 1AKVA 4LK2A 4QLAA 4KFUA 4QPZA 4ZQFA 4PNPA 4ZU3A 3ETEA 1KEPA 3HBMA 1NC1A 5DV9A 1ZC4A 3C3BA 3KYDA 4A0QA 4TUYF 1X3SA 4R1NA 4YR7A 2PUFA 2V5AA 5G0UA 3AR7A 5KTKA 4B6EA 3PQEA 3WK8A 3KPWA 4UHFA 4X45A 1J0CA 1O87A 3HEMA 1E20A 3O4RA 4QEDA 4IFTA 4EP1A 2OAGA 2Q41A 2QMYA 3A31A 5KVQA 3D0QA 3IKJA 4AX4A 1VYTA 3J81A 3EISA 4Q4JB 4EB0A 3QHAA 2VYQA 3OZWA 4UOZA 1WPGA 3FGNA 3PPXA 1KO5A 3C7DB 1DAIA 4IWYA 1TU0A 2BSAA 3VR4D 2FU5C 4E5SA 1FLVA 4ZMSA 2DTDA 3B2NA 3M6AA 4IDGA 1HNZB 2ZSDA 5C34B 2BR4A 3CVJA 2J9ZB 1U1GA 5CCDA 4XW2A 2XA1A 1VL2A 3AJRA 1VYUA 2G3YA 3UB3A 1ZQ9A 1ISRA 4Q1VA 3GGDA 4RD4A 5FV4A 3QW4B 2DERA 2MTBA 2IFTA 1OZAA 2Q21A 4LYEA 1ISPA 3IBTA 4JEMA 4TWBA 3FSEA 3BB3A 2B7LA 2AN5A 2ZS9A 2XGMA 1IY0A 4HDCA 3L6BA 1S2DA 1J56A 1RYEA 2FF5A 4GGMX 1GU0A 1ZKDA 4I5FA 4MYHA 3DF7A 1SVWA 2OOSA 3BICA 4CI0B 3E9DA 3RRYA 4F1JA 4Y2RA 1E5LA 1E4EB 3N58A 2I62A 1IJBA 1M33A 2FOIA 1RCTE 4HP8A 4L5YA 4JSRA 4RHEA 2QY9A 4ZVRA 5B1SA 3MJCA 5EWMB 5C18A 4KU4A 3KFVA 3M6WA 4B3TB 1E6MA 3CVXA 1N8KA 2PSEA 4M8KA 4Q4AB 1FS4A 1KXJA 2DECA 1EDEA 3DEJA 2AR9A 2JJMA 1M8GA 2PKRA 1N9GB 1TCAA 4H2DA 3LBIA 4LWOA 4RHTA 1XP5A 3QOFA 5C0OE 1G5IA 4DIDA 3GD5A 2F7SA 1RHQA 4QQKA 4EMBA 1UMCA 1LVGA 2CHQA 3E82A 3RSGA 1T2AA 1E2MA 1R8SA 1XTZA 1JG4A 4N65A 1ILWA 5L7TA 2VQDA 3R9KA 4EYSA 4DJ5X 2BSXA 2DWPA 2NPOA 4E7OA 9MHTA 4TRMA 3AGQA 3H4IA 1G5TA 4ZXFA 3A3OA 1NULA 2H16A 3S7TA 4JS0A 1DMSA 4REQB 5JVDF 4DRXA 1E3TA 1V25A 4C2UA 1W1UA 2WFAA 4AP6A 4XIGS 4XJXA 5JCOC 3ZKWB 5EGNA 1I01A 1DC4A 1T3TA 3FW1A 1EK6A 4IEIA 4FR2A 2G72A 1FY2A 1RTKA 3V1NA 4N0QA 1DDGA 1OV6A 2ZYSA 3MPUA 5CNJA 4JZYA 3FCSB 1C1DB 2BPOA 1FZQA 4F0JA 4U9HS 2WYWA 1ZUNA 3UA4A 4TVBA 3FAKA 4HVLA 3IAUA 1FCJA 2OYSA 3ZI7A 5I7OA 2Z6QA 2QG4A 4TROA 1HOTA 4PVDA 4P7JA 2X0EA 5JD6A 1BCRB 1K8RA 3GH1A 3BQMB 3UFXA 4BFUA 2SICE 1YA8A 4NE7A 4Z4QA 4P86A 2RDMA 3PWTA 1REQA 4UQPA 1GLNA 4OLBA 1M75A 2BFEB 2R4TA 1W0KA 3CCBA 2B36A 1STOA 4DN6A 1FDUA 4R0MA 2W48A 3TGPA 3F8WA 2OGUA 5FF9A 3L0OA 3BTUA 1B0AA 1KJ8A 3CX8A 3KVNA 5CDTA 7MDHA 1HNNA 1PFUA 2C2MA 3K7EA 3MWEB 1J99A 4IJMA 5JCJD 4X66B 4M89A 2HPHA 3HYNA 1TD1A 3VU9B 5IJAA 1O94A 4BMZA 4MPRA 2X6TA 5JJKA 3QLTA 4MTLA 4OBXA 3D6TB 1UCFA 1WUIS 4QNNA 3KXPA 2PZMA 3CY6A 3V4SA 2ZITA 1UOEA 5BSTA 3C5EA 3DBVO 3OVMA 4YCBA 4B09A 4BL5A 2H31A 2A88A 4G97A 3OQJA 4O0MA 3RUAA 3TGWA 4RZIA 5CEJA 3UMYA 4FWIB 1FFDA 2R9VA 1B6RA 4GR5A 1V0JA 1L5NA 2GKSA 4EUEA 1A5ZA 4L4RA 3QUSA 4L5JA 4RIHA 5C35A 3S8EA 5ADVA 1X13A 1Q0LA 1U9ZA 3H3XA 3B3FA 2O8EB 2LCQA 3B36A 4C0WA 4CQJA 4PLWA 3IBCA 3KELA 3ZE1B 1LW6E 3CKMA 4P4SB 1ADJA 2A5JA 3HYTA 3P9CA 3I9FA 4GLFA 4GBMA 1Z3IX 1J1ZA 2H92A 1WNFA 3T1HB 2JFNA 1NMEA 3M6FA 4PQYA 4Y0VA 4KFTA 1TAGA 3CUSA 3HRKA 4LTMA 5DH9A 2OECA 1TUGA 3OWXA 4I14A 2PXXA 5A9SA 1LS1A 4C4YA 3HO6A 3CUVA 2WICA 1SJ9A 1GWNA 1GTG1 1YS2X 3AKDA 3KJZA 1P2TA 3TJRA 3AWDA 4UAUA 3VAAA 4MS3A 4CHGA 2AG8A 1U0RA 4IXTA 2PZAA 4FILA 1ZDMA 3F46A 2XDYA 3F0TA 4F1KA 1SZPA 1V3TA 3DD1A 3EGDA 1MTZA 1H2YA 3MT0A 3EPPA 2ONYA 1CEQA 2WRZA 5CEEA 1G41A 1WXIA 3OFJA 3SXJA 2NNWB 2BGNA 4HDMB 1O4WA 4OFWA 2ZT5A 2V45A 3QLEA 4NMMA 5TGTA 3GJTA 2AVDA 1OWLA 3EA5A 1AQLA 1ZS9A 1ONPA 3VH1A 4GVLA 1CZKA 2ID4A 4WXMA 1OXXK 5BXQC 2J3DA 4G26A 4HJXA 4WXPA 1D4OA 3CXRA 1BFDA 2PEZA 3Q7PA 3SIPA 4GZ6A 4MO2A 2YCLA 5CCXA 1Y3HA 1L5ZA 4L4YA 4NG4A 1XD2A 5IKMA 4K28A 1ZM9A 1Z62A 1IDN1 3IUEA 4QTUB 4N3NA 2LDBA 3Q3CA 4P32A 1T8PA 1ADYA 2O2JA 1TVEA 1G1MA 2ZSEA 4C6HA 1GO2A 3IEVA 1QO9A 1NM5A 4RKWA 2HJGA 2ZR9A 4O59O 3SJ7A 1WX1A 2VZ8A 3WHPA 4MRPA 4QDOA 2C2BA 4K7JA 3UFXB 3DLAA 1FU8A 5EINA 2X0IA 4WIAA 3S2GA 5IYZB 2D62A 2ANBA 3MJDA 4XUEA 2BFAA 1TAUA 2XQFA 2VEDA 5TQ2B 5IHPA 1R0SA 4J07A 1GZ6A 1K98A 2CUNA 2PXCA 2QVZX 4KVFA 4FE4A 1EVZA 4TTIA 1U5BA 4XGIA 3AK4A 4JJZA 3VR5H 4BX9A 1JAHA 3VZRA 5ISMA 3ZWNA 5KNLA 3HGQA 1C29B 1T36A 3B3QA 1TJ3A 2XBLA 1KRHA 2BFDA 2XPCA 2VHTA 1OX4B 4QVIA 2PGJA 1GAJA 3FETA 3P9SA 4MQEB 1N6LA 4RTJA 3G85A 3NDPA 3AUXA 1QQBA 3SG0A 1ZH0A 1KPHA 2R68A 1XLTC 3EAFA 4KOEC 1IULA 3FRHA 3LPAA 4EZIA 1ACMA 2R8YA 3LTEA 4QM7A 4CXMA 4C3OB 1KOFA 2BR5A 4FFLA 1CY8A 4UCFA 2HU2A 2G0TA 4IWXA 3RUEA 3EPKA 1QAQA 4AJ2A 3B8HA 3H16A 4M0EA 1DQSA 3IR5A 4FQ5A 3QF7A 1ZOOA 5BW5A 1XEAA 3ET4A 4BZZA 3L7YA 4U4AA 1B26A 2ATVA 4IV0A 5K8CA 3TINA 4BX8A 2OGWA 3AR3A 3SYRA 1PJAA 1DI0A 1A9XB 2WSIA 1KYVA 3N6XA 1TK2A 1J9ZA 1N6KA 3L8HA 4P93A 2EZ8A 2YMPA 4NPAA 2V7GA 2ZSFA 1WCWA 1DKOA 1AN0A 1W46A 4G0OA 1KDZA 1P0QA 721PA 3CKKA 5BWCA 5B4VA 4RUKA 2EJCA 1A7UA 2NUTA 4Y8VA 3IUNA 3KSUA 3TR6A 3RUHA 4PZPA 5EE0A 2FA9A 4DF3A 4XE5A 1NFFA 1AA9A 1J1IA 1VPLA 3KQVA 3PHIA 2ZJ1A 4OYRA 1OQAA 3U4DA 1N75A 1T15A 1MO3A 2IY8A 2R00C 4UUMA 5KYGA 1AQJA 3O94A 2VP2A 2AJCA 3DUFA 3PFGA 4JT8A 3AKZA 2VZEA 3DOJA 4AJ4A 1J25A 4IHJA 4MA4A 3N5KA 4NOJA 3ZQ6A 1WXDA 2VBCA 5AT1A 1SD5A 1CQIA 1U0EA 1XPJA 2JL1A 3VVBA 2NU8B 4DV3B 3DLIA 4TQGA 5FBRB 3RCBA 4GFDA 1H4QA 1B8UA 3PGLA 4Q01A 2AFRA 2ZVQX 4A16A 1REQB 2C0CA 2ZSUA 2VRCD 4MRNA 3ZWMA 2YN2A 3C48A 3WMWA 4BJ3A 4BFVA 4HQLA 4IH9A 1YMQA 5DHTA 3FTPA 4O0LA 1NVDA 5FNZA 1LGYA 2IWRA 1UKZA 4YT2A 1ABBA 3KEGA 1E99A 1RI5A 1THTA 4FGKA 4DVJA 3HFSA 1F3LA 4JROA 4KQCA 2JFGA 4KWEA 3VV2A 5KOHA 3JAKB 4Z4GA 5KNBD 1GPWB 2EKDA 2RCNA 2CNLA 3RS5A 2XZDA 2P1DA 3RHZA 4P9NA 3OO0A 1W88A 4A0HA 3SZUA 1U2RA 4HQ0A 2BM1A 1ZN9A 1WDKA 4NZMA 3E27A 2MU1A 1QANA 3ZWXA 4UHDA 4ZJUA 1SCAA 3AINA 3K71B 1RU3A 3KKMA 1UPUA 2BGIA 1E4EA 3G0IA 2I2XB 5EJ6A 4R7TA 4B6OA 3BJZA 2CJXA 5MDHA 2JAWA 2GFQA 3G7SA 3GEMA 3O8QB 3K5IA 4DM3A 4BJ5A 2R5FA 3LQYA 4V0KA 3C8DA 2VNJA 5CU7A 1Z56C 2C2YA 4E70A 2ZRLA 3B7GA 4ZDKA 3FR8A 3LZCA 1OGYA 5JXIA 4GE0A 4PQFA 4LG1A 3IMCA 4MEJA 5CT4A 3IDQA 3WVNA 1V5WA 4YAKA 2RIRA 4Y9DA 1E7RA 3V2UA 3UT5B 2YWXA 2PSDA 5TEVA 2FAXA 1R88A 3QPBA 4KMOA 1OFIA 3WRWA 2V5UA 5KVSA 2DR2A 3NHSA 2YKGA 1LSOA 1FQKA 3ZBQA 2RAFA 3BAFA 1NBMA 3CBQA 2QE7A 1E6CA 1HC7A 3QMMA 4D42A 4D9EA 4CUZA 1T8YA 2EOAA 2Z2ZA 2PBZA 3NKFA 3QWBA 5JTUA 2W9XA 4DNOA 3E53A 3LWDA 1ELOA 2KSQA 3RLIA 2I1QA 4POOA 4LBZA 1PYGA 2EFJA 2WHPA 4IDDA 2H7YA 2QRUA 2VDJA 5CB0A 5FA6A 3O8NA 2XNCA 1BDBA 3FGZA 5EIAA 5BWMA 4Q21A 4J43A 1W19A 2PFSA 5DGCA 3EXG2 1KI3A 3CSUA 4I4IA 1NNUA 3UJ9A 4P38A 3LY9A 1BW9B 1EUDB 1Q6ZA 2P8JA 4KZPA 4N5NA 1SUPA 5TPWB 5JFOA 2H7XA 4FZRA 2B4RO 1D2EA 1CZHA 4HCJA 4S0XA 4A82A 1WD5A 4QYXA 1EX7A 1KOJA 1VHQA 3K31A 5B6PA 5U1PA 5DP2A 2GF2A 3DEZA 4JZKA 1HEYA 3EDCA 2PUJA 1U28A 1AV7A 4OHKA 2BUCA 3O2QB 1QPZA 4B43A 1VG1A 2Z5FA 4TKLA 4DSUA 4DQVA 1PZNA 1J06A 1D5CA 5K8IA 3LXUX 1TFRA 4NOMA 3IALA 3H1PA 2GJ9A 1QM5A 1LV8A 2PT5A 1XJ0A 3IGFA 2RMKA 2MINB 2BGRA 1R10A 1IAQA 1W5FA 2Z8ZA 4WZBA 3SC4A 4V0NA 3AXSA 4K9SA 3OPVA 2VJMB 1L5GB 1J6UA 3NW9A 4KV7A 1NJ5A 1TZKA 1FRNA 1G16A 1OCEA 1L7QA 1P7ZA 3OEEA 4KO1S 4OCZA 3RBZA 3UKOA 1KI1A 1FRVA 5E7JA 1R9JA 3I53A 3BRWA 3G0CA 5KOHB 2OHJA 3ZHSA 1LBSA 5ALZA 1ZW6A 1N2JA 4FC7A 4Z9XA 1DLIA 3DBLB 1JYSA 4CV3A 5KVVA 1QKJA 3KCQA 4GO1A 4IF4A 1Y82A 2D1RA 5KNDD 3EH2A 1WU8A 3ECAA 3A3PA 3ENVA 4X6UA 4UEWA 2QLNA 5E3JA 5EXPA 4CTKA 2I66A 3TUZC 3CNBA 2LCFA 5LWQA 4R40A 4GHWA 2VNHA 3BVPA 1JIJA 4TSFA 4ZQGA 3I09A 4NMLA 2Z6AA 4AS2A 4IS3A 3SX0A 2PM8A 3FY4A 4J1NA 3LHSA 4GR9A 1IN4A 3M6UA 3WYBA 2PWPA 2PGOA 3K1AB 2EIXA 4R0VA 2QTZA 2Y1CA 4ZCLA 1G8KA 1JTVA 4JBLA 2GI4A 3D64A 4W6QA 3URKA 4MUNA 4D9GA 5B1YA 1OU0A 3PDIA 1J07A 4JLVA 4GL2A 4NCKA 3OU7A 1G20E 2W8BA 3HL4A 4XZ3A 1N9ZA 5C5EA 3I4LA 3B1XA 4KFCA 3L9WA 4B87A 4EUFA 2PYZA 3SHFA 2O8CB 1CR1A 4Q18A 4QEZA 4CM5A 6ABPA 5KYXA 1ACJA 3ETDA 1IVYA 2VSOA 1LTKA 4ETMA 1O4VA 3TDMA 4E13A 2GYUA 3A1EA 4XIYA 3WIDA 1J20A 3HMQA 3PQ7A 3DNMA 2C2OA 1DKRA 4ZQEA 4Z9AA 2R6DA 2O2ZA 3GDOA 4EEXA 4GKVA 4ZEOA 4TSKA 3FNGA 3F3SA 3FWNA 3QQ5A 3VX4A 4JLAA 3Q10A 1MRZA 2YFHA 4OXKA 5D87A 1CYDA 5DSTA 2OFWA 3ETJA 3IOEA 2YR0A 3Q8KA 1C3EA 2W58A 3CX4A 3VYRB 3ZDQA 5IT9A 3DUFB 1WW3A 5IJZA 3KRTA 2OWEA 2CBZA 3ODGA 5FNVB 1QXSA 1UANA 4MR9B 3QOWA 1J0EA 3CLRC 4TUYB 2JIBA 4UBJA 2JF0A 1ORVA 1AY0A 3QU4A 1B3BA 5AW6A 3NBQA 5EHGA 3PNMA 5C4IA 2C20A 3M83A 1WA5A 3DKPA 4BMXA 3E1SA 3U56A 1C0LA 1Z4KA 5EJFA 1SEPA 4D8XA 4ESEA 5C37A 3IERA 5HTOA 3FNRA 3V5NA 3T0GA 1Y89A 3PICA 2QT1A 3C1AA 4QO7A 2ZRMA 5KJCA 4EFDA 4EVIA 4X3PA 4RS4A 4TTTS 4YP7A 2DR3A 4JJ6A 1V8ZA 1F0KA 3MK31 4KQGA 4XLTA 2QI9C 5SYAA 3GUYA 3DCYA 4UEOA 4WOKA 3RREA 3RWMB 4I1RA 1AGRA 1RHJA 3DCJA 2A0FA 2WUFA 2QM0A 3GYGA 4MAMA 4O4HB 3S1AB 4AP5A 3WGIA 2BBSA 1L5HB 2IU4A 3PQ6A 4CKCA 2DMRA 1DAEA 1O6ZA 1Q77A 2AA3A 4P5PA 3F8TA 2IF2A 3BE4A 3L84A 3NPMA 4G1CA 4MROA 5HJ7A 5K45A 1Z17A 4MV7A 2O14A 1T2DA 4AJOA 2M6RA 3M2PA 4F06A 4X62B 1KQPA 3BMOB 2PX6A 1QQ7A 4URHA 2AB0A 1JVBA 4IRMA 1PK8A 4E31A 4ENUA 3D0RA 2YJ4A 1WTCA 2DLNA 2QT0A 3HBJA 521PA 3M2TA 4TS3A 3D3WB 2Q3FA 5IWAB 2IZ6A 2WTXA 2ZR7A 1GDTA 1DSSG 4QC2A 2PVCA 2OO5C 2HK8A 3F4BA 4KN5A 1HFKA 4Q7LA 3FG9A 3ORFA 5T3UA 3WIBA 1D0IA 4US1R 3DMTA 2P41A 4ZAFA 2C4HA 2ZIAA 4JP1A 4OH7A 2NVUB 2D2XA 1NMZA 3AU9A 3RUPA 5AKKA 1MDBA 3E4DA 3ESRA 5CW1A 5CPBA 2FWAA 1SZDA 4O33A 1GP2A 4TLBA 2FFQA 3ENKA 4JYAB 1CUGA 2GNPA 2GF0A 2O48X 3L7JA 4FUQA 1UMDA 1PZXA 4LYHA 1H1DA 4KBFA 1NF3A 4W82A 2YY5A 4WLVA 4NEQA 1C3LA 4WBNB 2VXOA 1WUKS 2N46A 1U65A 4MVWA 4OHVA 4Q02A 5DYNA 5AR1A 3W8RA 3U7HB 4WEQA 4XEUA 5C81A 1MPTA 2DEUA 3O8OA 3R0IA 1Y3FE 3Q3VA 5KO2A 1ZK1A 1YU9A 3MEQA 1JIVA 4OBBA 3UV7A 2G5GX 4W4TA 5JALA 1LLQA 2C9MA 2IITA 5T4BA 3ER6A 3VHQA 4GP6A 4HSGA 4H9GA 1PSDA 3ND6A 4F8YA 4P83A 5K7SA 3SYMA 2VUIB 3Q7SA 1GG5A 2JB9A 2YV3A 4QELA 3BJMA 3A1DA 3T9EA 3ZK7A 3CE6A 1X77A 1E9VA 3REGA 4GGPA 1RZRA 1ULUA 2C9ZA 3VC7A 3UJNA 2GS9A 4E09A 4F3TA 1FNMA 2WDZA 2AN3A 1QE3A 4FX2A 5J2UA 3UTCA 5I5GA 1WSBA 1SCKA 2AOUB 2R65A 4H0NA 1Y6GA 4OQDA 4ME6A 1F7UA 4GKJB 1V37A 2NLOA 1RJFA 2JRCA 2KPOA 2P3SA 3DDCA 4PX9A 3RYFB 5IJ0B 5KX5B 1RMTA 4L7QA 2FQYA 1Z5NA 1T4GA 4GDMA 2YW2A 5HZGA 3SJZA 1SQ0A 2MSWA 3Q41A 1ZM3A 4G9GA 1U2TA 5BSEA 1U7OA 5IRCD 1EIZA 2BEUA 2OFFA 3VX3A 3VPHA 3LVRE 2FEOA 2ODPA 4QTZA 3SAJA 3WLEA 5C5CA 3ZEIA 2R6GA 4HVCA 5A02A 5CVEA 2ZYIA 3K8YA 2NMVA 1CDEA 3GJSA 4G24A 5EJIA 1QH9A 4KR9A 4G9BA 4NMWA 3J7TA 1P0IA 2UZ0A 4E03A 1DKPA 2RFLA 2YTZA 4RX1A 2ZUTA 2XUQA 3MWJA 4RPJA 2E4ZA 1RD4A 3M9LA 1IEVA 3ZV7A 1BS9A 3AO0B 4RL4A 1KI6B 2HWWA 5E1DA 5B1IA 1NDQA 3OFVA 3M4ZA 3ZYCA 4YV7A 5A4DA 1N7GA 3PDIB 4MW7A 1L7VC 2ZRJA 3GD7A 5D3MB 3CWQA 5FDFA 3U5TA 5BN4B 4OXRA 5CVVA 1X1QA 4IY1A 1S8AA 4N18A 3S2ZA 1RAEA 1IXKA 3N87A 4HDKA 4TYPA 5A4KA 4IO1A 2WFMA 3WR5A 2V7XA 1G0OA 3PLNA 4OX9Y 4TXHA 4P3XA 5CLJA 4ZVSA 2G0NA 3JWJA 1FQJA 2H4FA 2ECOA 1PG5A 1OFUA 3IVRA 3MAAC 4XAQA 4BJ1A 8ADHA 4ZIRA 3AY6A 4UTNA 3ZD7A 1A27A 1NXXA 1EMDA 3T35A 1II8A 1PQUA 4CKEA 2I4IA 1EWRA 1TD9A 4LI3X 3Q2IA 4CYMA 1VIMA 2AW5A 1O54A 3CONA 5CXXA 3D8RA 2VDPB 3ROKA 1LNQA 1M2NA 2JANA 1AE1A 2B2NA 3HJHA 1QHYA 1Z5PA 1KI2A 3PXCX 1EVYA 1RLUA 1UMKA 5JBQA 1V3VA 3CJTA 3NV7A 2FR0A 2CK3A 4MR9A 2FXIA 3BRSA 4TZ0A 1DO2A 2QMEA 1SB8A 1DZIA 5T4EA 4UHJA 4AG5A 1FP1D 2CL0X 3KEFA 4DEXA 3EPHA 3QKWA 3UCXA 3BIXA 4MR8A 1ULSA 3A9VA 5CYFA 3WWPA 3L3BA 4B84A 2GMWA 3I83A 2W2LD 1RCUA 2A5LA 2Z0MA 5K0TA 1ZVKA 4UHEA 2H08A 4LOKA 4ZI7A 1QGED 4IJVA 4LOJA 1FLAA 1JEQB 5D85A 2HLDA 4Z7QB 3T9DA 2ILTA 2WBLC 1R6DA 3D7RA 3GMIA 1TYBE 2HSEA 2VJMA 1SUFA 2D0DA 2PKYX 1EUYA 5JHGB 3JV7A 3SZRA 1KZGB 5E1MA 4YQEA 1WXXA 2CYBA 2ZIXA 4L02A 2QGFA 2XYHA 1XXLA 3LF1A 3QVLA 1EAYA 4GP7A 2BM0A 4JLOA 4MRRA 5K6AC 1RC8A 1L9XA 3HA2A 4UCXA 3SDBA 4JI0B 4RTOA 3RF6A 2B1IA 1E7QA 3FVVA 4H77A 1TIBA 2LWIA 2PNFA 3TLAA 1RWKA 4Q9DA 5DX8A 4OFBA 1KE1A 2WTBA 3JD4A 3UK0A 4B6FA 3H5NA 3GPIA 4HYQA 5CBPB 2CXUA 2NPIA 1VGVA 4TXLA 1SCUB 1W36C 1S2GA 1P33A 2WJWA 4J49A 5AVJA 4AW9A 1LNZA 1XTKA 4RD6A 4BO3A 4Z5XA 2GAOA 1E3EA 1NOKA 2M98A 4B0OA 1ZYUA 2ZPUA 4EHAA 4ECAA 1A9TA 4JB3A 2O8DB 3C45A 3Q0TA 3WXBA 2YWRA 5AP9A 3IEXA 4JGBA 3CNLA 4KGZA 4OBWA 5JJ5A 3KZ1E 3KSAC 3D2BA 3BPSA 4IF6A 1MENA 3JQ8A 4V1CI 3D3WA 2QN6A 3O95A 4DLLA 2JK0A 4I55B 3G2QA 1ZUD1 3GL9A 1JR2A 2XXAB 5H1YA 3DW1X 5FFNA 3NIDB 3HHPA 2D2IA 3ISTA 3V34A 5JYCA 1P4SA 1BG6A 3M9WA 4N3CA 4CCYB 4QJ3A 1SVOA 2FMUA 2G80A 3RAEC 2EJWA 3T52A 3CZ4A 3DLCA 3CYFA 4QXOA 1MVNA 4NS1A 5EWJB 4AT1A 5CB8A 4R0NA 3OUZA 4EELA 2HSGA 2OILA 4KO8A 3M8KA 3TQTA 5A4FS 4LXYA 5B53A 2BMVA 3W9BA 4DCCA 3K2IA 3MMZA 3H9CA 3EZGA 1IEWA 4CJXA 4UD2A 3SQNA 4Z4FA 3EULA 3AF3A 2C9DA 2Z04A 1VE6A 3NU1A 5LBTA 3O8OB 2QXUA 2ZAYA 3ZIAA 2EBHX 2IBMA 3FDIA 3HE3A 3ME5A 2C61A 4RVDA 4C6TA 3C7AA 4N8SA 1SBTA 4RAOA 3KXLA 3HN6A 1FYDA 4BNHA 1Z8DA 5IC6A 5L4LA 1IQRA 2CL6X 2R8BA 2E2WA 5DP1A 4KQIA 2I7VA 1A5AB 2F3SA 3C41J 1C7FA 4Q4LA 4RIIA 1MKYA 2FEWB 2UZ1A 4YCNA 2P75A 1LJLA 2CYAA 4NYIR 2QGNA 1R6XA 2FOLA 3FPHA 3K8QA 3X2FA 3W2TA 3ZE7A 4ZGGA 5LZ5A 4CI9A 5M3BA 4TSRA 4D5GA 4PLFA 2BHLA 4GC5A 5FYDA 4B32A 4EHHA 2BBTA 3GJRA 4EPXA 5FPPA 4ZREA 3ZD9A 1C2TA 5IMBA 3VH4A 1E64A 4FYKA 1TO2E 3QBJA 1G0NA 1G8PA 4TGLA 4OK3A 5FYQA 2WF8A 1QH8B 1GUYA 2AMYA 2E1RA 3DA8A 3N53A 4B4DA 4E30A 3TL6A 1YZLA 2QM7A 2ON6A 3G7UA 5A5FA 2G82A 4YFVA 2UAGA 2W4QA 2ZVPX 4M60A 3T3IA 3U3KA 4JBHA 4YBZA 3AP3A 3H2SA 3HDGA 1DC5A 3LCVB 4HYEA 4BFTA 5IU6A 3R0JA 3C15C 2IODA 2P2CA 1BWQA 4LXXA 4ZAWA 2PT6A 4G9EA 4HUQB 3PNOA 2XXBA 4OPMA 1O97D 1NUQA 1Z8HA 3QMWA 1ZK3A 4MUKA 1WDWB 2G9RA 3ND8A 1U8YA 3T3HA 2YMLA 3X1YA 3W8FA 2P6MA 5DM0A 3A4MA 2P91A 1N2SA 3DJFA 3K0CA 4I08A 4HN4B 4YDHB 3RDPA 2A3NA 3QU2A 3B20A 1BS2A 3SICE 2P77A 3KAQA 3AFOA 3QVSA 3IKMB 1NFRA 4IYRA 4LHWA 2JLAA 4M9CA 2FFRA 4OQMA 2VCYA 2DQKA 4PXSA 1T0BA 3R5SA 1SOWA 1XX6A 3RS4A 1G21E 3D5EA 2DPXA 4WCVA 4CUKA 4XARA 3NYIA 4R3UC 4HXEB 1ZIOA 1YONA 4WJKB 1ODCA 3EEIA 2IK8A 3OE5A 3RKRA 5JJLA 1EFKA 1HH4A 2ZJOA 3AQ4A 1L5YA 4BGVA 5HUJA 1JECA 2Q1TA 2Q3JA 4GLLA 3VJKA 4K40A 1V8BA 1RADA 1JQKA 2A94A 1M9NA 2A14A 1T4DA 5B3KA 1WIWA 5IDVA 3L92A 1ISFA 4ER5A 4CKBA 2XDQB 5CTAA 2XCIA 1JKMA 2YJZA 4G81A 3L7LA 4W5JA 1Q0SA 2OHIA 2XITA 1US8B 3ZU4A 1OW3B 3CH6A 1R1DA 1N5RA 4UTVA 3C8UA 1HSOA 4K05A 1QGOA 4RLQA 4UASA 4MZXA 1SELA 2FXVA 3KWMA 2HJHA 4MDYA 5JCJA 5JPIA 4KGVA 4TZTA 4RHUA 5E6SB 4HAUA 4L4UA 2PGAA 4ZPJA 4EPTA 5LMNB 3G9XA 3RVRA 3MD9A 1LBEA 3OLVA 4TKMA 3I73A 1XKTA 1CZOA 2W6OA 2R48A 4IX9A 2ZI6A 3SR3A 3OZDA 1CUEA 1SA0A 3U17A 3FUTA 1E0AA 4AYXA 1M0SA 1PBNA 1F4VA 2HQOA 2J9GA 2FWNA 4NYJQ 1M3SA 3FMVA 4KHZA 1OZ0A 2YN0A 3F98A 4LIPD 1ATIA 1U3CA 4Z7JA 5FAXA 3KQLA 2FFBA 1BJKA 1QU3A 2DBQA 4O4LA 3MWDA 3EA0A 3GLFE 1OJ7A 1OA1A 1PU2A 4M7PA 5J9FA 4A9AA 3MTBA 3UUWA 4FEGA 3R0XA 2E55A 3P0HA 4J7CA 2XUOA 4KN8A 4NBTA 1VIYA 3MWLA 2CNOA 4MW9A 3PNLA 3ROZA 2CHVA 3GUVA 3MQ2A 3HR7A 5BYKA 4D3ZA 1ZN8A 3OF5A 2ZWVA 3VGJA 1A2KC 3MTAA 2IHJA 3EVCA 4KK3A 3LBFA 1IG3A 3LLSA 3GFQA 3MXTA 2ODNA 3WRXA 2HU5A 1Z0ZA 5JHHB 1ZM7A 2JATA 1KZ1A 3D8SA 2QIOA 3A9CA 3NDRA 4B4KA 3IJEB 1KFCB 1T1EA 4OEHA 3GEPA 4ZYYA 1KC3A 2FUNB 4OK5A 4M9ZA 1ZX1A 3PQFA 3EZLA 1A88A 3ZDEA 4JI2B 1KY5A 4BNDB 1X2BA 4IINA 2LW7A 4RL6A 1IWPB 1BFUA 4LZPA 1RWOA 1E3QA 1MA0A 3L8EA 3URMA 3U44A 2Y9PB 2QTVA 4RACA 1QIHA 4WFJA 2MT9A 3Q9UA 4JDPA 1XA4A 4KIUA 4MR7A 1UAYA 3AJEA 1YSCA 4QDJA 3CVWA 2GBFA 3FOBA 1VMAA 4W9NC 1S01A 3H5AA 5LD2B 2WD8A 5HZKA 4V0ME 4TSFD 3IDOA 2B8JA 1MX1A 2BRUA 4TZ6A 1UBNA 3LYHA 4W5QA 3ELUA 3R3HA 5I8PA 3NQ41 4H17A 4WX2B 3ENZA 2EF0A 2VCHA 4ENQA 4E5DA 4MWOA 4A92A 4TYMA 4YECA 1PIWA 3C0KA 4Z9BA 3RTCA 1Y4UA 3PRKE 3EY9A 3TQOA 4OGFA 2G7MC 2B69A 2BI8A 2EBWA 4QULA 2CNKA 4IOLA 4NQZA 3L41A 2FPIB 4R81A 4QUJA 3RU9A 4XWGA 1UBMS 3F78A 3WYAA 3ZHOA 3BYZA 3EVGA 1WXGA 3FYCA 3KAKA 3WLOA 4DLUA 1JHYA 1JQ3A 2HAEA 4UBNA 1BDHA 3PF8A 4GSYA 4L9SA 4HLCA 2GK6A 1EP1B 1PE0A 3GGSA 1XEXA 1M1NB 3P2IA 4EY7A 5IVDA 1A95A 1T8WA 1WCIB 3U2QA 1BE1A 4MQFA 3DV2A 4WKPA 5TMBA 4E21A 4DR7B 1TOAA 4A6DA 4YJFA 1CQPA 3X44A 4L51A 5AJVB 1MEJA 1ZOLA 5CM9C 1RVV1 3W05A 4B34A 1SA0B 3H2KA 5K4GA 4KO2S 5CH8A 2FMTA 3VHXB 4PM4A 2X8BA 3CW2A 1Z2EA 3AVQA 1QYVA 1FZTA 3NBFA 3SY8A 1V5EA 4BOYA 4NFYA 1R6BX 4ALKA 4FBGA 5BUZA 1BE6A 2W6ID 3DVSX 4GRAA 4ZD6A 3O8CA 2X4IA 1FU4A 4CFSA 1SQFA 2VDWA 1AF4A 4YO7A 1VSQA 1XDDA 4IDFA 5L95A 2J31A 4YUZA 4R2WA 4PX3A 3B9QA 2AQ8A 5JD4A 4DMCA 3FPLA 3GNQA 1EYZA 1TC2A 4X61A 4ZJZA 2DM6A 4EDFA 5LLTA 2H4HA 4WZBE 2NYRA 3LFHA 1X38A 1W4CA 4G8JA 1A8SA 5EMJA 5AM3A 1VL6A 1NW9B 4G5SA 5F7ZA 3FRIA 5EQDA 5A3RA 1R4NB 3AIIA 1FYVA 1RM3A 3OHMA 3H7IA 3N3BC 4FNOA 5EUBA 5EXDA 4DCNA 5AM2A 2BF7A 3ONFA 4D8UA 4S1VA 1RYDA 1TZMA 1Y8CA 3C8HA 3CGGA 3FYUA