1XIVA

Plasmodium falciparum lactate dehydrogenase complexed with 2-({4-chloro-[hydroxy(methoxy)methyl]cyclohexyl}amino)ethane-1,1,2-triol
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
318
structure length
307
Chain Sequence
APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALAHAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase
publication title Mapping the binding site for gossypol-like inhibitors of Plasmodium falciparum lactate dehydrogenase
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 114
structure length 307
sequence length 318
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2004-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1xivA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1xivA02
1B8UA 1RM5A 1YDWA 1XU9A 4FFLA 3LSYA 3PFFA 1D7OA 3P19A 4PG6A 2BD0A 1EBFA 4Z3DA 3VZQA 1NTOA 4RPKA 4BNFA 2I6TA 1G1AA 3DZHA 4FBGA 2IYPA 3F3SA 1JU9A 4PVCA 1X0XA 2I9PA 2UUPA 3Q3CA 1U7TA 4RF5A 4CM5A 4RZIA 1ONOA 3DR3A 4PLHA 2PGJA 5COQA 3DOOA 3QVWA 2D3TA 4CMHA 1UP7A 1GYPA 2CMDA 1UZLA 2ZKLA 1LLDA 2C7VA 1H93A 2Y1GA 4PZDA 3PWZA 3AY3A 2GSDA 4INAA 5DOVA 4YJFB 3F4LA 3JQDA 1DLIA 2OO5A 2CDCA 2OP1A 4HFNA 3U4HA 4CLDA 2VWQA 2HO5A 4AJ4A 4Q9NA 3GAZA 3WBBA 4DRYA 4FN4A 1IOLA 2CUKA 2PKQP 4UEJA 3IMFA 5B12A 1OAAA 2IXAA 2WYUA 3L77A 1QMGA 2IZ1A 4DIFA 3JQFC 4YQYA 3LYLA 4Y8VA 4NU5A 1R4MA 5BSEA 3ICCA 4CM6A 1KVTA 3ZN2A 3ZW8A 1V6AA 1MC4A 1QLHA 5I9NA 4GX0A 4CUKA 3WQSB 2TMDA 4I9NA 1P31A 2RIRA 4HNHA 3LT0A 2OL4A 4E3ZA 2YDYA 4D41A 1BMDA 4GWKA 1QKIA 4EJ6A 3ZWPA 4YR9A 1J5PA 1HYEA 1KBZA 2J3JA 4R5HA 4AJNA 5KVCA 3VPFA 2AA3A 1GADO 4ZRNA 4LCJA 4Q3CA 1MB4A 5IDWA 4W7HA 4WCFB 1X13A 2FN7A 4WLVA 1I32A 3SC6A 4L75A 2C2XA 2O7QA 2ZTUA 4QT0A 2Z1MA 2HQ1A 5CP8A 1IPFA 3P7MA 5BSFA 5JW6A 2WEKA 4IDBA 5AOVA 1AXEA 1P3DA 1KY5A 1R16A 4DYVA 1NNUA 5KJ1A 3F47A 1P1JA 4FJ1A 2GGSA 3JD1A 4F45A 5CDUA 4UVGA 2HLPA 4L73A 1VSVA 2C59A 4G2NA 4B8ZA 2RHRA 1J49A 1ZEMA 4PG5A 3ZI0A 1GY8A 2EGGA 1Q0LA 2B5WA 4OO3A 1QYXA 4MVJG 4PG7A 4XQCA 4YT2A 1P1RA 1D3AA 4GSKA 4N54A 4MVJE 4YTEA 2Q2VA 2Q2WA 3W8FA 3U4IA 4FQ8A 1Y6JA 1P74A 3KEQA 3PLNA 3BHMA 1M67A 5FF9A 1BTOA 3L07A 3H8VA 4OXYA 4R1TA 1WPQA 3JQ6A 4A2CA 4CMEA 3PZBA 3E9QA 2AEFA 2X0NA 3L0DA 1Z82A 3GRKA 5EQFA 3O8QB 3GHHA 4IMPA 4RVDA 4TKMA 3WMXA 2EWMA 3CIFA 3EUWA 5HTOA 1O0SA 4ZQGA 3I9JA 1LC0A 3IL2A 3OP4A 1J6UA 1YBAA 5GZ3A 3IP1A 4BO7A 4JN6B 2D0IA 2FRDA 4P8RA 5TNXA 4B4VA 2DUUA 1T26A 3AOEA 2GR9A 2YFQA 1RM0A 5DBIA 3HDQA 4FJ2A 3WNVA 2A4KA 5JC1A 4E30A 1VSUA 3D5QA 5JC8A 3EW7A 2NU6A 2H6EA 4CMCA 1NVMB 2BFOA 3KYDB 4YAKA 2WM3A 4ALKA 4KQXA 1R6DA 2NU7A 4BO5A 3JQ7B 1YGYA 1Z6ZA 4OOEA 1W0CA 4WCFA 3HE3A 4RPJA 2X1HA 5AQ1A 4PZCA 3KSZO 3BXXA 4FS3A 4IGEA 5BNTA 4XYGA 3IJRA 4CR8A 4RPLA 3TQHA 1FF9A 4HP8A 3F5QA 1CQJA 4IZIA 1U28A 3IAHA 1U7HA 8LDHA 1KY4A 3AK4A 3JV7A 4UEKA 1ZK2A 4N7RA 2EG9A 5EINA 3D5TA 3ZWCA 3MOGA 3MTGA 4RGBA 1OC2A 3NYWA 5L7YA 4Z0TA 2ZB4A 3ONEA 2HKIA 1AGNA 5C7OO 5IG2A 1I36A 4J43A 1E3IA 3O26A 3VH4A 2BFAA 4BMSA 4Z9YA 2IEDA 1NQAO 4P38A 3IC5A 1MV8A 1ZK1A 1U8FO 3LC7O 3OETA 3RQSA 1PJQA 2UV8A 1PS8A 3PWSA 5IZCA 3O9ZA 3V1TC 4KQWA 1Z73A 3CSDA 4WKGA 3KETA 4YCAA 1GUYA 3OEYA 4BNHA 1HT0A 1M6HA 4BKPA 3O8QA 4D79A 3UUWA 2PGDA 4Y67A 2NTJA 2C0CA 4B7UA 1L7DA 4EW6A 5I7SA 4CLXA 1E6WA 1ULUA 3CMMA 4G65A 2C07A 5MDHA 1A7AA 1E7RA 3JCZA 4IBOA 1ZMOA 2G0TA 2HRBA 3NGLA 3PYXA 4JK3A 2YV3A 4E32A 5A5EA 3DOJA 3NT5A 5HS6A 4D46A 4DGSA 2YFHA 1B8PA 1E3EA 3KYDA 3DQPA 3LC1O 4QFCA 1I24A 4EEXA 1Y8QB 5KJ6A 2X6TA 3INGA 2EIHA 2HDHA 3SXPA 4AICA 4BGVA 3JQ7A 4ALJA 3WGGA 1I3KA 4YT8A 5C7LO 4YRAA 2P5YA 2OXIA 2EXXA 4NQZA 4F46A 3K2BA 4LN1A 3GZNB 4R3NA 1UJMA 3UVEA 4R9SA 2EKQA 4A03A 2YV1A 1VKOA 4A27A 1DXYA 2JHFA 1N8KA 3ASVA 4O6VA 5TJHA 1V35A 4LRSB 5DT9A 5TT0A 1VJ1A 3V2UA 4ROSA 4JIGA 4BO8A 4Z0HO 5A3JA 4CM3A 1FDWA 1ONPA 2GDZA 3AW9A 1R0SA 4PLTA 3WYCA 3VTFA 1FDSA 3QY9A 2IXBA 3RVDA 3DL2A 4ALLA 5A03A 1JWBB 2RH8A 1A9YA 1VM6A 3HZZA 2DPHA 5LDGA 4M1QA 5EN4A 4AJJA 4QSMA 1U5CA 1NQTA 2Y0EA 1J0XO 2BI7A 3MZ0A 3WBFA 4EJMA 3OM9A 4KUHA 5A05A 3GRPA 3WGTA 5EESA 2WD7B 1T2AA 4MINA 1P0CA 3VH3A 1BVRA 3Q2KA 1Q1NA 1EK6A 4NPCA 1LJ8A 5JDIA 4UVIA 1DHRA 1NASA 4J3FA 4IPTA 4J9VA 4BMNA 1MFPA 4E21A 3PQEA 3GGGA 5JPIA 2B4TO 4DLAA 3QVTA 1GPDG 3ROKA 4BOYA 3IKVA 3MJTA 1LLQA 1AHHA 1ZUD1 4PRKA 1MG0A 2CF6A 4IQGA 5IXYA 1FDUA 3Q6IA 3HWRA 1ISFA 2J5KA 2R00C 1PQUA 4G5HA 3DTYA 3JQ8B 1WMAA 2AE1A 4O63O 3DMYA 3CZRA 4L8VA 1HF3A 3L9XA 2B0JA 5BSHA 3KBOA 3D1LA 1XQ1A 1Y8QA 5K6AA 4NNJA 4RVFA 4TKLA 5L9AA 3DB2A 3ZH2A 4TRJA 1JN0A 1WAMA 1HDYA 3X2EA 4BL5A 4CQMB 1LDNA 4RVHA 4D3SA 3LU1A 2PGLA 3OJ0A 3GZNA 1G0NA 3TJRA 2Q4EA 4E2XA 1EEHA 5JO0A 3WFJA 2B4RO 1DAPA 3M1AA 4QEDA 2QG4A 3SC4A 1Y5MA 4PVDA 5DBGA 4YAGA 3KZVA 2NQTA 2EF1A 1FXSA 1UP6A 5B4UA 2HCTA 2X7HA 1LRJA 4BO1A 2FPPA 4XIJA 4L0QA 4BGIA 3GNQA 4ND4A 1ZBQA 4WASA 1T4BA 4MDHA 1ZH8A 3F6YA 1T4DA 2ZQYA 4U6SA 1MFZA 1OOEA 4FIZA 2J5RA 4BQRA 1FDVA 3OBBA 1DIBA 3NKLA 4CODB 2WD7A 4M54A 5F21A 4A5OA 2JAPA 2X86A 5ITWA 2D4AA 1SAYA 3STHA 3PDJA 2AMFA 3FSRA 5I8ZA 1PR9A 3C7DB 3PYMA 2P9EA 3O03A 4HFMA 2EJWA 1AXGA 1HWYA 2ZB8A 3E48A 4P4LA 3PLRA 4RPGA 1X14A 1T2EA 3GZ4A 1DAOA 3SLGA 5KVVA 2O48X 2YYYA 5G0VA 3FNFA 4B3JA 3OH8A 4NBTA 3FNEA 4CLHA 3FHLA 1CDOA 2NV6A 4AVYA 3K6JA 1E5LA 1I33A 4ZICA 1DC6A 1ID1A 4FDAA 4RO0A 4J16A 3JQ8A 4ND2A 3EVTA 2HMVA 3PJDA 3E8XA 1UXHA 5F1OA 3V1UA 1OC4A 4BB5A 1ZMTA 3OJFA 2GN8A 2XPCA 2BGLA 1BDMA 1BHSA 1N1GA 3ICPA 2RH4A 3ZV3A 2YUTA 3C1OA 2Q1TA 3A1NA 3EZYA 4NFYA 4MP8A 1HDRA 5IFLA 4RDHA 3PYLA 1W8DA 1PL7A 3SLKA 1T2CA 4TVBA 1EBUA 3D4NA 3JQGB 3GVCA 4DMLA 4M55A 4KTTE 4OM8A 2A94A 4DIOA 3KLPX 1GUZA 3F4BA 2VHZA 3W6ZA 1T2DA 2GD1O 4BS9A 1HYGA 3M6IA 3PVZA 1DDOA 3WWZA 1IZ9A 1RM4A 1Y7TA 3LLSA 1TB4A 1JDJA 1YJ8A 4LK3A 1X7HA 3H3JA 5G0UA 3GUYA 1CF2O 2NU8A 4B79A 1LRKA 1LSOA 1GR0A 3E5MA 4J1QA 3V5NA 3QV1A 1TI7A 4CM9D 2NM0A 3RUIA 2E37A 2WJPA 4UEOA 1EQUA 3GHYA 5C3MA 4AJKA 2W90A 4IJWA 2DTEA 4XRRA 2IZ0A 2ZYDA 4RLSA 5KIAA 2IODA 4GL4A 3EC7A 3G17A 1IYZA 3KV3O 4XEHA 1RPNA 2G17A 4KDFA 4G81A 4XGIA 3G49A 3ANNA 4UVDA 3OF2A 4CV0A 9LDBA 5AXCA 3INTA 1CQIA 3ZV4A 1LLCA 1LNQA 3CKYA 2YW9A 3LT1A 4XX0A 2O4UX 2UAGA 4J49A 2HJRA 4O5OA 4ZVVA 5DN9A 4I5FA 5BT9A 5F3RA 1PQPA 1X1EA 2I76A 1YH3A 4LMPA 3OFSA 2X8LA 3JYOA 5ENDA 3WGZA 2O3SA 2E48A 3KSUA 4ZRMA 3UW3A 3PJEA 2VZ8A 1XYGA 3KVOA 1M6WA 2VWGA 3IQDB 4IM7A 4JXKA 4E5NA 3S2EA 3TPCA 1LEHA 4TVOA 3W4KA 1DC4A 1UXGA 4CL8A 1Z7EA 2C29D 1UZNA 1VRWA 4WOJA 4PG8A 5CDTA 5IAAA 1TXGA 3OIFA 2ZIZA 4RF3A 4RQTA 3NT4A 1ZJZA 4LW8A 3ST7A 5KKCA 3I6QA 2OFPA 3JQGA 4YACA 1B3RA 1N92A 1P1FA 2DBVO 4H16A 1GPJA 4H7PA 1K0UA 3NDIA 1DIHA 4UVHA 2Q50A 5JDCA 2YV2A 4EEZA 1DRWA 4UUPA 3ONDA 2EW8A 3JQFA 3HADA 5TT1A 1PTJA 3AUTA 2NLOA 4CMJA 2EEZA 4L4XA 1E3WB 2DBRA 1K6JA 1PJTA 2WWRA 6ADHA 1E1NA 2H1SA 3A06A 1IUKA 2C5EA 1LQUA 5TRTA 3L6OO 3AI1A 4WOKA 4XIYA 4HFJA 1HDXA 3JQBA 1GL3A 3QWAA 4QQRA 4NFHA 3ZWNA 1JW9B 1T1RA 3ZHXA 3JYLA 1E1KA 1NQ5A 5EERA 2B37A 4AJPA 4J0FA 2VTDA 3C7AA 3H9EO 4J2OA 2XAAA 5FI5A 5TC4A 3ULKA 4BIIA 5ILOA 2VHWA 3H7AA 5I7FA 4DWVA 4NG5A 1ISGA 3K5PA 4CMBA 5IZ4A 1VKNA 1X1TA 4R16A 2GO1A 4E2YA 5EL0A 5F1KA 3BHJA 4AL4A 3TWOA 3ETDA 5G2OA 4B4OA 2XOXA 5JMWA 3JQ9C 3M2TA 3S55A 3AU9A 4DREA 2EERA 1ZSNA 3MJSA 4K9DA 2PNFA 2C2YA 3QWIA 4E5MA 4XDZA 1UXKA 3TZHA 1Q7GA 3GVPA 2ZJ0A 4CJXA 4NK5A 2P5UA 2DTXA 2GCGA 3PWKA 4PLPA 4IGFA 4RF4A 1ENOA 2CZCA 4NBRA 1FJHA 3DTTA 3OEWA 3H9GA 1MXFA 3OQ6A 4A10A 3WJAA 5KOIA 1KEUA 2Q2QA 2WSBA 1ZZEA 4R5MA 5G0WA 1YQXA 5TF4A 4JBHA 4U7WA 3NTRA 1BWSA 3BTVA 3ANMA 3KEOA 3HDJA 2D59A 3DONA 2Y67A 1H6DA 5DP2A 1DBVO 2DBQA 1XIVA 4PFJA 4MVJI 4E5PA 3M1LA 1DFGA 2Q1SA 1YB5A 5JCJD 9LDTA 3DZKA 1LBEA 1WNTA 1IB6A 1TT5B 3FR8A 1JLLA 3IOYA 1E3WA 4GLLA 1EVZA 5A9TA 1ADBA 5TJ9A 4AJLA 4F6CA 3N74A 1TLTA 5ENVA 4YPOA 3WQRA 4K28A 3Q9UA 2GLXA 1YBVA 3IUSA 4II3A 4BO4A 1YL7A 3ZGYA 2OBNA 1HEUA 2ILTA 4ND3A 1PZHA 4QFDA 1E6EA 4ZJUA 2ZTMA 2PD3A 1E5QA 3K2EA 1U3TA 4XJSA 1ZIDA 5IDYA 2B36A 4I9UA 2VWPA 3DMTC 3QWFA 4IIUA 4RQUA 5G0SA 5FI3A 3TFQA 3DAFA 3RKRA 2W2KB 1YB1A 1I30A 5G0TA 3IIEA 4R69A 3IUPA 3R6DA 2BH9A 1WMBA 1GU7A 3WSWA 5ILGA 3P2YA 3WFIA 5IDQA 4NMHA 1MGOA 1TT7A 4TMFA 2FHSA 1ISMA 1K3TA 3OA0A 3PEFA 2UVDA 4XGNA 5DZSA 4RLHA 3WDSA 1GFSA 4AJEA 3R1IA 2AQKA 3WICA 5EIOA 4D45A 3RUEA 5HWSA 1YQGA 2B4QA 2DAPA 2EP7A 4URFA 4PRLA 4EZBA 2HU2A 2DT5A 4BNGA 3WB9A 5HM8A 3S2IA 4E0BA 3U4DA 1O5IA 3AOGA 4E5KA 1G0OA 2P9CA 5CEJA 2DFVA 2ZK7A 4R41A 5ER9A 2HAEA 3W4JA 1BXKA 1KS9A 4J9UE 4OSPA 2OZPA 1ENZA 1YWGO 2PFGA 1NP3A 3CMCO 2QW8A 3PJFA 1C0IA 5JCXA 1PJCA 4CLOB 4QXMA 1GQQA 1QP8A 1WDMA 4K6CA 4YAEA 1V3UA 4Q39A 4TZKA 1TT5A 4GGPA 2VYVD 4XYMA 3ZWWA 1BDBA 4BNXA 5JNLA 2IZZA 3FD8A 4NHEA 4KUGA 2NADA 4IDGA 4W6ZA 1HRDA 1SMKA 2AG5A 3H9UA 4JBIA 2VUUA 4Q3EA 4UAGA 3JYNA 2GN4A 1ZJYA 4YEDA 4Q3NA 5CDGA 2Q3EA 3KB6A 2PR2A 4W9NC 5DCUA 3WGIA 4JP3A 2H63A 1GEEA 1IHXA 3D0OA 4CLEA 3W8DA 1T1SA 2YQ5A 1BXZA 3ON5A 3L4BC 5T64A 3WMWA 3B1KA 2IYOA 2W2KA 3RC1A 3B20A 3FNHA 1JKIA 4NJOA 4PG4A 5F5NA 3COSA 1MX3A 2JCXA 3LC2O 1DEHA 3INRA 2JJYA 5KWEA 5I7VA 4ZQBA 4OJNA 3NJ8A 5ITVA 4PLVA 3WOHA 1VL0A 1GZ3A 1EE2A 4YT4A 2Q4BA 3SVTA 1Q0HA 3DDNA 4P4GA 4BNVA 2W8ZA 4CV3A 5CFZA 4FFMA 3OECA 3ROMA 1GAEO 1HSOA 3QJ5A 1KERA 2NACA 1PS9A 4NH4A 2BFMA 1CIVA 4CL3A 4OSOA 1R66A 4DUPA 3BTOA 1U8XX 4OOFA 1W4ZA 3ETGA 1T2FA 2WTBA 4DQVA 5AXBA 4AJHA 2J3IA 4PZEA 4DPLA 3TOXA 4ZN6A 5L7TA 4ND5A 3PHHA 3JTMA 1HE2A 2OP0A 2DKNA 3O4RA 1GDHA 3VZPA 2I65A 3P2OA 2BHLA 4MIEA 2X9GA 4BNYA 4IDCA 1GV1A 1D1TA 3KOUA 3PDUA 4LRTB 1NM5A 4CLOA 4BO6A 3DWFA 4K1LA 5KKAA 2Y1DA 4E13A 4OGWA 1EQ2A 3HG7A 3QA9A 4J7CA 5IJZA 1V3VA 4YDRA 5AVOA 4HKTA 5GY7A 4BV8A 3NGXA 1C3VA 4BKQA 4XR9A 1OBFO 5BNIA 2X58A 1YOVB 3QP9A 2VNAA 3JD2A 5IN4A 3N58A 1NX6A 4UUMA 1K2WA 3D4PA 4O1MA 1U3VA 5C7IO 1GD1O 3ZHYA 5FYDA 1HE5A 1PJSA 3PGXA 3DZBA 4YJGA 3U09A 1SC6A 4GX2A 3T4XA 1Y5RA 5H82A 3RASA 4OL9A 4MOWA 4MKRA 2V6FA 1HXHA 1ZK3A 3AI3A 4MO2A 3BMOA 2C5AA 1K6XA 1P1HA 1GCOA 3RUDA 1TA4A 1PGOA 1VI2A 2ZJ1A 4CMKA 4N5MA 3UICA 4DBVO 4FCCA 5CHEA 4Q3BA 4KMSA 4JGBA 1E0DA 4GMFA 2C20A 3HUDA 1EFKA 1LRLA 1ZW1A 1WW8A 1H9BA 2X5JO 2Q99A 2X0RA 2F00A 1A71A 1CERA 3HB5X 4GKBA 3OICA 4J90A 4WE3A 5CG2A 3UCXA 3ZNNA 4Y98A 1SNYA 4LCEA 1SPXA 1DIRA 1ADGA 3U0BA 4Q3DA 4Z3KA 5TGDA 2JAHA 3RUCA 3H9QA 4MVJF 1B15A 4EYEA 4YWJA 3WIDA 4M49A 3UHAA 2QRKA 4WPGA 4HWKA 4N18A 1I3NA 1IULA 1PGJA 2P4QA 2QYSA 3JD4A 3SJUA 3PQDA 4GWGA 4I5DA 4L76A 3NTOA 2H5LA 3RSHA 4BKOA 5AYVA 5DCYA 3TNLA 1PSDA 4GX1A 3JQAD 1DFHA 3DXFA 4WEOA 3GG9A 5JAZA 3FPCA 4CV2A 3QIVA 2FP4A 5JLAA 4YT5A 5T8KA 5JSFA 3PHJA 4Y6PA 2WDZA 1U9JA 4AFNA 3V8BA 1HZJA 2GRAA 3HDHA 2SCUA 5IDXA 3VC7A 4J1SA 2W4QA 3C1AA 3DFZA 5EPOA 1YOVA 2QYTA 4GMGA 3FWNA 4J7XA 3ANLA 2FR0A 1N9GA 3JQEA 3AM5A 1RWBA 1ZNQO 2GZ3A 1Y9AA 1B2LA 3F5SA 1LDMA 4CM9A 1YL5A 2NSDA 3AY7A 3DAPA 2NUAA 3DZFA 1KIFA 2HJSA 4FSHA 3S2GA 3ZW9A 4OMUA 5CAEA 1Q0QA 4JP2A 3RIHA 3QVXA 4BQPA 1O6ZA 1E1MA 2GASA 3E03A 4BNNA 2BRUA 3BMNB 3HDYA 3RI3A 4ILKA 2GERA 3ZWAA 4LMRA 3K96A 1LDBA 3DEYX 4E31A 3TDKA 5ICMA 4YRBA 3VH1A 1WDLA 1U3UA 3AU8A 1C1DB 1SCUA 3SBOA 2X23A 3W6UA 2VT3A 1NVTA 1OI7A 1F8GA 3AFNA 1ZKMA 4J4BA 4J4HA 1LSUA 2G82A 2ZCVA 3C85A 4DXHA 4E2ZA 1LA2A 3C7CB 4Z0PA 1PL6A 1DC3A 3PHLA 4XCVA 5B37A 1XA0A 3OJLA 4MIYA 1QYCA 1UAYA 3OJOA 4FR5A 4XJTA 3G1UA 2C7GA 5L51A 1HE4A 4DL9A 4IS2A 3GEDA 2JFFA 2PKRA 3DBLB 1LI4A 3AOEC 5A1TA 1PIWA 1YB4A 2O3JA 2O3RA 4GVLA 4D0SA 1YS4A 3GNSA 3AWDA 4DC0A 2XXJA 1BGVA 1QRRA 1FMCA 4GI2A 1PS0A 4D3DA 3H9JA 4FPXA 2B5VA 3KTDA 1XR3A 3TL3A 1XDWA 3AUSA 4WCFC 4LISA 1ZK0A 1XWFA 5TLSA 1C14A 1F17A 1I8TA 1QYDA 4WLUA 5K9ZA 2Q45A 5JFOA 2CVOA 3B6ZA 1NFRA 4JJGA 1DB3A 5GMOA 4FD3A 1F0YA 3P5SA 2AQHA 2PK3A 3ENNA 4PCVA 4E33A 3ZCXA 1E3JA 1E7QA 3C8MA 3RBZA 1BRMA 4MPDA 4NBVA 3EK2A 4IJUA 4IDDA 4I1IA 3TZCA 4MVJH 4F3YA 3I23A 5ICSA 1UDBA 2QHXA 3BMNA 3ENKA 1JVBA 1AE1A 3D64A 4B8WA 4IY1A 3FWZA 1V9LA 2X5KO 2UUOA 4RV9A 2OHXA 1ISJA 1HSZA 1H2BA 3VAZA 1C1DA 3B1JA 4II2A 7ADHA 5IZCC 2TMGA 1H2HA 2BKAA 4D44A 3QRWA 1H0KA 1HE3A 1KEWA 2RBEA 3MWEB 2P91A 4TRRA 3VDQA 2RCYA 2I5PO 4FOSA 2XXBA 3RC7A 4KZPA 4FGSA 2QZZA 1DFIA 3ADPA 3OSUA 5H83A 3PRJA 1ZEJA 3DBLA 4IXTA 4EITA 4QO7A 4XRGA 1KC1A 1ZSYA 4B7XA 3TF5A 2G1UA 4FJ0A 5T57A 1NFQA 1U2GA 3WIEA 2BELA 2UDPA 3ZWVA 1VJ0A 1SBYA 2HRZA 3CPSA 4BNTA 5LC1A 4ZU3A 2JD0A 1LQTA 3LZ6A 1P0FA 2CVQA 2HMUA 2PY6A 3GPDG 1IL0A 4J2HA 1LDEA 3FBGA 3JQ9A 1HL3A 3A14A 4B3IA 3NDRA 3LF1A 2NVBA 1EVIA 3MJ4A 1DPGA 1R37A 1YJQA 3H6KA 2OOSA 5JCJA 3NJ4A 1MXHA 3ZU2A 3ZU3A 1F8FA 4BB6A 4J7UA 4BNUA 5THKA 5DNAA 2NVWA 2X0IA 5DDIP 4NR0A 1E1LA 3LK7A 1PGQA 1PGNA 3ETEA 2DM6A 3FTPA 1KETA 4GVXA 2OUIA 2VTEA 2C82A 5FWNA 1D1SA 1M66A 2O50A 3RBVA 3HN7A 5JY6A 3MJVA 3MOIA 4OXKA 3WQQA 4EGFA 4DQXA 4WNIA 3BZUA 4CV1A 5BSGA 3WTBA 1WZEA 3PTZA 3UAGA 1NAIA 5JDIC 4GH5A 4ALMA 2JFGA 1RYEA 3H5RA 2P4HX 3SX2A 2DFDA 2Y0CA 3H5AA 3C1TA 3HN2A 1LUAA 3AM3A 5G4LA 1NXQA 4RDIA 1R0LA 3LF2A 1VL8A 5A3VA 2Z1NA 1LC3A 1AN9A 4Y6SA 4YB8A 2LDBA 5EMHA 4ZHSA 1V8BA 1I10A 5ER6A 1PWZA 4BNMA 4HFRA 2X22A 2EKPA 2YJZA 2PZMA 3LT2A 4WECA 3DHEA 4FFOA 5T67A 1SEPA 2JHGA 2YDXA 4CM8B 4U8GA 3HNPA 1XG5A 3CE6A 3QVOA 4R1SA 4TZTA 2HMSA 3BHIA 1GYQA 3DMTA 2Z95A 1B0AA 2RAFA 2FSSA 4CM4B 3W1VA 1PGPA 4QTZA 4J1NA 3I6IA 2F1KA 5JE8A 4N5NA 3OQ1A 4TRMA 1ZXBA 4R54A 3E6AA 4WLFA 2VN8A 4E12A 4KWHA 3KXDA 4L4RA 5COAA 2QIOA 3SEFA 1R4NB 5CEEA 1PQWA 5JBIA 2X9VA 1HKUA 3GK3A 2C54A 4MVJP 1Y8RB 2AW5A 4NJMB 1E92A 2VYVA 4CM7A 3Q11A 1HETA 5KVQA 1N1EA 4FGWA 3GOHA 4XGKA 1NR7A 2YY7A 3QWBA 4TRNA 4PGFA 4IQ0A 1O89A 3E18A 1XSEA 1QV7A 1W73A 3MCVA 3GG2A 5KNLA 2V6GA 3ZV6A 3DHNA 4ALNA 5A9SA 3GDOA 5MGBA 1X0VA 1PJLA 1EDZA 1B7GO 4PLYA 3VPSA 4E5YA 3I9KA 1YE3A 4D43A 1LU9A 3K92A 3RROA 1A4IA 1E6UA 5DP1A 3GEMA 4X54A 1K89A 5G4KB 3ZNOA 1YRLA 2VNSA 2NTNA 2WE8A 3WTCA 2Y66A 1JWAB 1N5DA 3I9LA 4DIBA 4BNWA 3VH2A 1B14A 4XZ3A 1UDAA 5K0ZA 2EW2A 2LDXA 4E6PA 3I52A 4CQLA 3V2HA 3D4OA 4BHTA 1WWKA 2Y0DA 3DZJA 2VOEA 5IF3A 4CM8A 3M2PA 4W9NA 3HFGA 1D4FA 2VHVA 2VYND 4YA6A 4ITUA 5COBA 1ZK4A 1RYDA 1VPDA 2DC1A 4WLOA 4D7AA 4GPD1 4A0SA 1PEDA 1M75A 3GPIA 1P1IA 2AQIA 4LVCA 3GVXA 2EGHA 2G5CA 3QW2A 4CM4A 2PV7A 5KTKA 4YYZA 2FOIA 4ZQHA 2E4AA 3VHRA 4N5LA 2O3TA 1H5QA 1B26A 3GGPA 1HZZA 3K9QO 5JY1A 4MVJD 3B70A 4DLLA 1VLLA 1MA0A 2O3UA 1R4NA 2AXQA 2D1YA 2D8AA 4BMVA 5KVSA 3JQAB 3S8MA 1EVJA 1Y8RA 1GEGA 4A7PA 2YQ4A 4NJMA 1L1FA 4DLBA 2YHUA 4ZA2A 4AJ2A 1PJBA 3AM4A 2H9IA 1I2BA 2W98A 3RFVA 4CUJA 1F12A 5FEUA 3ZV5A 3S1LA 1MG5A 3JD3A 3PIDA 3D3WB 3ADOA 3EGOA 4Y6RA 2DU8A 4CPDA 4ZD6A 4H15A 4HBGA 2VT2A 2D5CA 1KVQA 3KHUA 2EJVA 3TSCA 3ZNPA 3JSAA 1ZO8A 1GQ2A 2B35A 4ND1A 3NEPX 4EI2A 5G4KA 4PLGA 1XHLA 1PR3A 3RFTA 3VZRA 1AHIA 4RF2A 1LSSA 2JCVA 3I4CA 3FR7A 4MP3A 5U1PA 4CR6A 4RORA 4QUKA 3V2GA 1I2ZA 2OGUA 3WX0A 2DTDA 3EHEA 4OQZA 1X7DA 3VPHA 3RBXA 2YZ7A 2GYYA 1X15A 1PZFA 5A02A 5CDSA 1QORA 1U4SA 3E9NA 1VE9A 2PZJA 4GAEA 5JAMA 4AJIA 2P68A 3RJ9A 4WEQA 4YAJA 5JYEA 2CSUA 3AUAA 3OQBA 3WWYA 3VDRA 3ZHZA 2DBZA 1N7GA 4D0RA 2I99A 2ZB7A 4BO3A 5BQFA 4CUZA 1XLTA 4IJKA 2Q46A 4JCOA 2HMTA 1Y9EA 2BGKA 2VOJA 1I5RA 2VQ3A 3NAQA 4IIVA 2JCYA 1VL6A 3ITDA 1A5ZA 2O23A 2AHRA 3RU9A 4I5EA 5HRUA 4CMGA 5DCWA 2VZ0A 2BFPA 2VHXA 3GVIA 3JQAA 4HY3A 5JDCC 2V65A 1Z75A 1WP4A 3BA1A 3U62A 3A28A 3ZWBA 1DLJA 2QRLA 2VCYA 2WE7A 4K26A 3TRIA 1UH5A 4L4SA 2Y1FA 1LDYA 4JBGA 2Y93A 2DPGA 2VUTA 3BIOA 4GSLA 1R12A 3D3WA 3L6EA 5HS4A 3JD0A 3OMLA 3PHGA 4QO8A 4Z9XA 3JYPA 4K6FA 2PH5A 1O8CA 1TEHA 3ITKA 3JQBC 2FMUA 5JYDA 2IDZA 2Y68A 1V3TA 3HFSA 1GYRA 4NBWA 2FR8A 3GLQA 2PD6A 4CM1A 5J23A 2CDBA 2GN9A 3GDFA 1A9ZA 1WVGA 5F5LA 3TFOA 3L4SO 4YJGB 3ZU4A 4PLFA 1EMDA 1BVUA 1ADCA 3E82A 1KVRA 3ABIA 4YVFA 1EE9A 3CZMA 4TWRA 1U1IA 5L40A 2J3KA 3GFBA 4IDEA 3KLMX 4BO2A 2UYYA 3WSVA 3BMOB 2I3AA 5GZ6A 3VKUA 4A26A 3A4VA 2P9GA 5L4NA 1RJWA 4HX5A 2FWMX 2J8ZA 3GMDA 2A92A 3D7LA 1YXMA 2JKVA 2JFHA 1JAXA 2DVMA 4LSMA 3UOGA 1YQDA 4UREA 5B4VA 2FZEA 1A7KA 1HYHA 2EV9A 3GA0A 1LLUA 4YJFA 3CH6A 4RVSA 3SJ7A 5C5IA 2FPGA 3DBVO 1SEVA 1I01A 3N7UA 2I66A 4L74A 4YQZA 1K5HA 3FTNA 3IKTA 3RC9A 4BNLA 4HXYA 4YRDA 4B4UA 4EDFA 3BTSA 3IS3A 2PZKA 1Q2XA 5I7EA 2VRCD 4CMIB 1MLDA 1ZCJA 1JTVA 3OHSX 3BMQB 4PN3A 4D3FA 1HDCA 1PJ3A 3GDGA 3GF4A 1E7MA 4WNCA 3WGHA 3ZWMA 1LSJA 3T7CA 4DPMA 3W8EA 3C24A 1ISHA 2CF5A 1NVGA 1TVEA 3WG9A 3WNQA 5JMPA 2B83A 2FPIA 5JS6A 2R00A 2W2LD 4M8SA 3LVFO 4KP7A 1U3WA 3IP3A 2EHDA 3VVCA 2ZATA 5EQDA 1E7WA 3EZLA 3U4CA 3UN1A 2GZ2A 4WGGA 1N9GB 1ADFA 1BG6A 1T25A 3RCBA 1I3LA 4XQEA 3TZ6A 1NBOA 1PZEA 4WLEA 2PZLA 2VUSA 1BXGB 3WJ7A 4XR4A 1JKFA 2Q1WA 4AJ1A 4W82A 3QSGA 3MWDB 1M76A 4U0KA 4XDYA 1L7EA 1NWCA 4NI5A 4WUVA 3WGYA 5CPFA 2WYVA 4L9RA 4OYRA 2HSDA 4UVEA 5L45A 3EDMA 3LLVA 3ROQA 3L9WA 2HK7A 3CXRA 1WDKA 2O3QA 3NRCA 3QWHA 4DA9A 1ENYA 1LXCA 2NVUB 2CVZA 4WJZA 4BNJA 4MIOA 3MJCA 4IDAA 1Z45A 3DC2A 1Z7BA 3PZRA 3Q2IA 1UZMA 3F46A 2ZB3A 4OAQA 3QQPA 3DOCA 1JKJA 3K73O 4IINA 5TIIA 4BGUA 4B4WA 5H81A 4DMMA 2YHIB 4BVAA 1HDOA 5JAIA 4JNKA 4UUOA 2BF7A 3D3EA 1U4OA 3VTZA 3UFXA 1SZJG 4WCDA 2DQ4A 3VVBA 2ZTLA 6LDHA 2ZYGA 4D42A 4YBZA 2HK9A 3I9NA 3PQFA 4DC1A 2A9FA 2X5OA 2DUWA 4CMIA 3K8ZA 3O38A 4BO0A 2PKQO 5IXSA 1QYWA 3R3SA 1XQ6A 4NFSA 3TOZA 3BMQA 3HSKA 3KUXA 4FC6A 4ID9A 2JL1A 4XYEA 5L4SA 4FFRA 3CUKA 4TSKA 1U5AA 4HADA 4ONEA 3AFMA 4RZHA 1NPTO 5L95A 1SB9A 5L4LA 5HA5A 2HUNA 3PGJA 3T7EA 4TROA 5DULA 4EUEA 3Q9NA 3RKUA 1Z74A 4NZ9A 2EP5A 4MP6A 2V6MA 1ML3A 3UF0A 2NU9A 1E3SA 8ADHA 3NT2A 3UXYA 4GX5A 3GH3A 3NDJA 1GQYA 1EDOA 1I3MA 1NPDA 4FW8A 4P4NA 1P44A 1PL8A 1BXGA 1IY8A 5A5FA 3PIIA 2IRWA 2O4CA 3U49A 1GZ4A 1P33A 2B69A 2RHCA 2X0JA 1VC2A 3UCFA 3I3OA 3AUUA 5B4TA 4R68A 4PLZA 4R01A 2ZTVA 4IJVA 3BTUA 3H4VA 5JO9A 4R51A 3DHYA 1IHYA 3LQFA 2I67A 2V7PA 4AG3A 2D2IA 3GMSA 3E5RA 2NVUA 4KOAA 3E9MA 1I2CA 3ZWYA 4NBUA 5EJ2A 4C4OA 1HLDA 1Y1PA 2NQ8A 4CMEC 1YL6A 1GZ6A 3WGOA 2VHYA 4XKJA 5CEFA 4IXWA 1IE3A 1H6BA 2YHIA 2XF8A 3DBRB 4RL6A 5LDHA 1JA9A 2QRJA 2QX7A 5I9MA 3KYBA 4KTVE 1GTMA 3GR6A 2BI8A 3NX4A 1T24A 2AEJA 4MJLA 2ZYAA 4I5GA 4YXFA 2I3GA 3BAZA 3K31A 4O59O 1O95A 4YJDA 1Y81A 4IZHA 4FOOA 1YONA 4E2WA 1MC5A 1PJ2A 1C0KA 3R3JA 4C7KA 3GGOA 3RJ5A 3PXXA 1W6UA 3UH1A 1NPYA 2J6IA 2Y1OA 1NYTA 2OBYA 1QV6A 3EY4A 1NHGA 4I9HA 5ES3A 5L53A 2CDAA 3LDHA 1ZFNA 1AUPA 3KYCB 1V0JA 3L6DA 1YKFA 4LVUA 1GUFA 1I0ZA 2ET6A 1O94A 4BKRA 5DBFA 1HDZA 5F1PA 4BNIA 3WS7A 3EVNA 3WYBA 4IDFA 3VKVA 3ZU5A 5A04A 3VPGA 5TQVA 5AXDA 4BUCA 2BMAA 4PIVA 4M86A 1XKQA 3OA2A 1B8VA 3QLJA 1A4UA 1FK8A 1PWXA 4OH1A 2FSVA 4E4YA 1UAGA 4ALIA 3ONFA 2PTGA 2JD1A 4NIMA 4YJHB 3G3EA 1YDEA 3KRTA 2GUGA 3Q1LA 1Q7CA 1DHTA 3H3FA 1SB8A 1WZIA 3WR5A 1DRVA 3AI2A 3LT4A 1EUDA 4XYBA 4P22A 4PLCA 1KEVA 2R2GA 4UUNA 3G79A 4ESOA 3H2ZA 3EMKA 1O9BA 1P45A 2CNBA 1F06A 3QHAA 1NFFA 1KVUA 1NHWA 2IEBA 3FRJA 1UXIA 1QXSA 3JQCA 4W4TA 1NQOA 4JJFA 1UXJA 1N2SA 5CDYA 4O0LA 4RVUA 1JAYA 1GV0A 3I9MA 3ASUA 3G0OA 3RUAA 4Y9DA 1XELA 3DBRA 4FB5A 2WD8A 3GVHA 5TS3A 4ZQEA 5THQA 4XD2A 2Y05A 5JAQA 4XB2A 1KYQA 2QZ9A 5KJFA 2VYNA 2PH3A 4YAIA 4WK6A 1ONNA 3GN2A 2O2YA 1ZVMA 3ZZNA 4OKIA 2GZ1A 2AQ8A 3W4IA 2WYWA 2P2SA 1HLPA 5A9RA 5C37A 1PZGA 1S7CA 3NTQA 4MKZA 3GAFA 4DPKA 4R3WA 1QSGA 3H5NA 1H6AA 1XEAA 3DZGA 4MVJA 4HV4A 1DRUA 1VJTA 2OMEA 3T4EA 1ZSVA 1C0LA 4OKNA 3KYCA 3MEQA 4JQCA 5T8KC 3GEGA 1QYVA 3GQVA 5KJEA 4FFPA 4AJOA 4BV9A 4FFNA 3CEAA 3PJGA 2Q1UA 4UULA 3K30A 5CG1A 4I8XA 1BSVA 1JQBA 1DIGA 5T6BA 3PPIA 1MP0A 4C7JA 2X9NA 3WYEA 1HTBA 5B1YA 3BYZA 1XU7A 3IJPA 4NK4A 3WXBA 3DO5A 2VZ9A 4CMAA 3G1TA 3ROPA 4EBFA 1PU2A 4RVGA 4YJHA 2Q49A 3TL2A 3PP8A 1YO6A 1DOHA 3HQ4O 4CQMA 1A27A 4KDEA 4MKXA 2BLLA 5I9LA 1RM3A 3U9LA 1LX6A 2G76A 5DOZA 4Z9FA 5A9SB 1C1XB 1GCUA 5FFFA 1DJNA 4A73A 4DVJA 1G6KA 1KOLA 2GNAA 2HK8A 3PK0A 3V1YA 4DTIA 2AE2A 4GBJA 5LCXA 2FZWA 4OXNA 4H3VA 2O2SA 4Z6KA 4NDNE 3DBHB 3GUCA 4CR7A 4S3MA 3ORFA 4PLWA 3RAJA 1UUFA 1OFGA 4B3HA 3RUHA 4ZGWA 1H6CA 4XA8A 1PX0A 5AXAA 1EVYA 3RU7A 1R15A 2GF2A 3RWBA 2E6UX 4BNKA 5T5QA 3RD5A 1CYDA 5BNFA 1DIAA 2PD4A 4J91A 1E7YA 1UDCA 4BO9A 1SO8A 2J3HA 1M2WA 1QG6A 3CINA 3WLEA 1HDGO 2V6BA 1JVSA 1IPEA 4W7IA 4BGEA 4CQLB 3F1KA 4XQ9A 3OJEA 2POQX 2FR1A 1NWHA 3UCEA 1A72A 2OORA 2Y99A 2BGMA 2GPTA 4RJTA 3I4FA 4KWIA 2J5QA 3QVSA 3VOSA 5A4DA 4J4TA 3U5TA 3IDSA 5BR7A 1PJ4A 2FY8A 2NWQA 4XYLA 3GNTA 4CLRB 3OIDA 3DFUA 4W99A 4R1NA 4IQ8A 5K6AC 2ZCUA 5A06A 1SOWA 3E1KA 3R0IA 2Z5LA 4I08A 3ZHBA 1B3BA 3H65A 3I1JA 1X7GA 3BMCB 4U0JA 1K6IA 1NR1A 2Y1EA 2HMWA 4QX6A 4GGOA 4EUFA 4OIMA 3S2FA 2CY0A 3KO8A 4BNZA 2WMDA 1KVSA 3NUGA 1YVEI 1DC5A 3GN1A 4GQAA 3HB4X 4EUHA 3KSDO 1H94A 3TN7A 3KM0A 3I9OA 3AJRA 1R0KA 4QECA 1OZAA 1CETA 1XCBA 1WLYA 2AEMA 2O7SA 2D5AA 4M89A 4FC7A 3AY6A 5TX7A 4M87A 1CRWG 5KCZA 1MUUA 3FN4A 4R4JA 4F6LA 5GZ1A 1LTHR 1C1XA 1CEQA 4R9RA 3FF4A 4DBZA 1EK5A 3QE3A 4GLOA 1U2DA 3NV9A 1P1KA 1S6YA 2X4GA 1P9LA 4XWYA 1BW9B 4LGVA 3VZSA 5ADHA 4J6FA 4Q3AA 4IMRA 3WLFA 7MDHA 1E7SA 3FCOA 3PI7A 3DBHA 4HUJA 4U6QA 1ARZA 3MJEA 4OQYA 4S1VA 1XGKA 3HHPA 2Y1CA 4U5QA 2NNLD 3DZIA 3F1LA 2GN6A 4HNGA 3GY0A 3ZDFA 3FPLA 4BKUA 1CJCA 1QLJA 1YBMA 2VWHA 5U9CA 3C3XA 4OHUA 5L3ZA 3VPXA 1EUZA 1F14A 3FBTA 3U3XA 3EYWA 2PLAA 1ENPA 4GKVA 4R1UA 1RKXA 1P77A 4LSWA 3MTJA 3RUFA 5I8WA 3RC2A 4J1TA 3OIGA 5HBRA 1EUCA 3FI9A 4JLWA 1QR6A 3X2FA 4KUEA 4WLNA 3WGQA 1D8AA 5CPBA 1DJQA 3HJAA 4RCVA 2ZQZA 3TZKA 4IUYA 2AG8A 4NU6A 1OMOA 4CLRA 3ZWXA 5JXWA 2E49A 1FDTA 3UGKA 1UR5A 1KC3A 1N7HA 3L4BA 3Q0EA 1DSSG 4EJ0A 4B7CA 1E77A 2VRCA 4RPHA 3H2SA 3UKOA 4DYDA 2IE0A 3BMCA 1NAHA 1ORRA 3PFWO 5TSDA 3PHIA 1ULSA 3A9WA 3TZQA 1EZ4A 1H9AA 2R6JA 1SOVA 1ZXLA 1IZ0A 2E82A 3GFGA 3JYQA 3FNGA 2W2LA 1J4AA 1Q7BA 3GT0A 3ZWOA 4DQUA 3F9IA 3CTMA 2DLDA 2A35A 4TQGA 1CWUA 3GC6A 1R4MB 4MVJM 1KEPA 3RFXA 2PWZA 2QQ5A 4JJIA 4JROA 4JX8A 5U4QA 3B1FA 1ISIA 3I5MA 1LDGA 3I83A 1B16A 5DF1A 2PA3A 4CQMD 1E3LA 1BW9A 1C0PA 5L7WA 5KJCA 2EKLA 2JD2A 4XQGA 2CD9A 1DO8A 1WXDA 2VRBA 2CFCA 3DAGA 3EAGA 4ZQFA 1UP4A 5IN5A 2NTVA 3ZNQA 4J0EA 4XB1A 1EFLA 4IS3A
chains in the Genus database with same CATH superfamily
2GARA 4BV2A 1IN7A 2W6NA 1R4AA 2HYDA 3M6WA 2JGJA 4FFLA 3L7YA 3S99A 4WD3A 4AF6A 4GOOD 1D7OA 3NP7A 3P19A 2XVAA 2YY6A 4YLGA 4BMPB 5IK2D 4L0CA 4F56A 5BV7A 2OEPA 5ALSA 2WHQA 3K0SA 1WRBA 4RPKA 4HN9A 2R5WA 1ULZA 4BNFA 3R3YA 3DZHA 4R40A 2OPHA 3S5UA 3ZCRA 4KRFA 1KORA 4M0FA 3Q3CA 2MOKA 5JI2E 3B2NA 1W9HA 2JHAA 1YVDA 3L0SA 2GTIA 1U7OA 3DLIA 3EGIA 4DAOA 2JIZA 4K9MA 3DR3A 5B58C 5JSYA 1EE1A 3FDXA 4MGEA 5DHTA 1VMIA 4YMSA 2XSZD 2D3TA 5TPZD 2CMDA 3GFQA 4JVOA 2C7VA 4WERA 3VU9A 5CA1F 5CNMA 2P6UA 3S27A 2WF6A 3ESAA 3TSOA 1OV6A 4INAA 1MJGM 3GLGB 3Q4GA 3FCYA 1CS0B 1Z4PX 4YJFB 3O3CA 1UQTA 3UHPA 3JQDA 2PYDA 4O4LF 2OO5A 3I1FA 2CDCA 1CIJA 1M2JA 4HFNA 4FK8A 4CLDA 5JNVA 1TMKA 3SI7A 2HO5A 2IC5A 4AJ4A 1R1DA 3I4LA 3QXXA 3IDAA 3UHOA 3RW9A 4C7OB 1OLSA 4L5IA 4NCIA 4DR2B 2O8EB 3I61A 2CLMB 1KZ1A 4TTQA 2MYPA 3HRKA 4R1MA 1KJWA 1PYGA 2JH9A 4JA0A 2XTZA 5EUBA 4WJKB 4QDUA 1M1YA 5B12A 2IXAA 1IN8A 2JLWA 1PLKA 2P79A 1CY8A 2AFHA 4XIFA 3IE1A 3O95A 2P27A 1R10A 4YQYA 3LYLA 4UHFA 5E9QA 3DFKA 3W9YA 2PNJA 1R4MA 1MD9A 3NEAA 5CLFA 2A5GA 3T1HB 1T8SA 1TK3A 4TLMB 4AN4A 3ZN2A 1ITZA 4GPAA 4Z4CA 1XZMA 1PDOA 4GX0A 3GWGA 2E4ZA 3SSNA 4X66B 1UBFA 4RFSB 4C21A 2O05A 3IYLW 2TMDA 5JIBA 5JD5A 1X1BA 2SKEA 3LI2A 1VL1A 4UZSA 5H59A 5IYZF 3G7NA 3TEFA 4F84A 2C8JA 3ZDRA 5ELXA 1KMHA 1FP6A 1P31A 4QPCA 2XYGA 2VNKA 2OL4A 2YDYA 4S0ZA 5E4FA 4D41A 4GWKA 4DLYA 1Y3DE 1VZ3A 3AETA 2I4TA 4L0MA 5CB8A 2J3JA 1LTKA 2NU7B 2PPVA 2ZEJA 5CB4A 4CEHA 2IHJA 2AA3A 1QIMA 2CXXA 2NIPA 2CJYA 2Q3FA 2X1VA 2IV2X 2BUBA 3UJBA 4Z3OA 4AMGA 2D1RA 3F7MA 4I99A 4D5EA 1EFPB 1G8SA 2JJMA 2JCSA 4HDSA 3DHWC 2O9JA 3ED1A 1X1SA 4FYVA 2ISQA 4ND8B 4YP6A 1TA9A 3E22B 5CP8A 1CQJB 3WGKA 1TPZA 3ZWKA 3P7MA 1Z33A 2DEUA 2JFXA 3PUZA 2WEKA 5JW6A 2LPMA 2TYSB 3V42A 1A97A 1AXEA 3VR4D 4RTPA 5GTDA 4I1PA 1R16A 4NLLA 3AESB 1O9GA 4H08A 3TSWA 1Y3HA 1RDFA 5KQSA 5JYBA 3ZDDA 1XP5A 1QS0B 4Y2YA 4QYWA 1GKLA 2R84A 3CUUA 4MWTA 3DMGA 1VSVA 4H1TA 3ZZ0A 2GD2A 4N7MA 5BYAA 1AV6A 2B5WA 4Z5XA 1SURA 3H2JA 2XKKA 1P1RA 5BMVB 3HO8A 4GSKA 4N54A 4MVJE 4QJ5A 4Z54A 2I1QA 4YTEA 4ATNA 1Z15A 3JWPA 5HBGA 2VBIA 2RG1A 2H48A 1E1QA 2IVFA 3PLNA 1M67A 4Y30A 1QVRA 3L07A 3H8VA 3OWXA 4MV5A 1XHEA 1FZTA 1XRRA 2BH2A 4AC9A 4FFDA 4FGKA 4N3CA 1KR5A 4OXYA 5EKXA 3RLIA 4A2CA 3WGVA 4BP9A 2XMPA 3CRMA 3E9QA 2X0NA 4D9EA 3DLBA 3EIHA 1QDEA 5J2TB 1R6TA 3GRKA 1NUAA 1NNLA 4XX1A 2EFEB 1WDTA 1HNNA 1U6JA 1DX6A 2DE0X 4MRMB 4RVDA 1TM1E 1WKBA 3Q5DA 1NJSA 4TV9F 5M2QA 4ZQGA 2BZGA 3U1VA 5BWCA 3BN3A 3OP4A 4S04A 2BGIA 3HLYA 1J6UA 1BZYA 4IFBA 4PC3A 3VPAA 1MB2A 4RZ3A 3PFKA 3IP1A 1MQ9A 2NUTB 4QWWA 4XVRA 1E4EA 4PXSA 3TB4A 4BO7A 5KO2A 2H4JA 4YONB 1T26A 1YZUA 5AHXA 3OLWA 3GLRA 4PXYA 3IAUA 3L1HA 4P82A 2YINC 2C9BA 1U2PA 3PNVA 4QDZA 2OCIA 3R8FA 3X1MA 4JKOA 3ZJYA 4CMCA 3LK6A 2BFOA 1WABA 5JCZA 5JNSA 2D3WA 4L6AA 3VR2A 3P2MA 2AJLI 4KPUB 1M73E 3C5VA 4BO5A 4OOEA 1W0CA 4WCFA 5C46F 1MX1A 2JG3A 2X1HA 3P5BA 1CFZA 4LOIA 5ALUA 1XJQA 3GLKA 3Q6NA 1G8KA 5EVCA 1C7QA 2QBYA 4DCSA 2J3EA 2HF2A 3HKDA 1LBQA 3Q12A 4OX9Y 3F5QA 4IZIA 1U28A 2TECE 1XNRB 1J9ZA 4Y9RA 1YR9A 4MLDA 3AK4A 2WV9A 4L4ZA 4X44A 3JV7A 2YVAA 1ZK2A 1S2LA 1T8UA 2OQIA 5EINA 3D5TA 3FFAA 4CQJA 2BV3A 4RGBA 4RFVA 2FWAA 4HEA6 4V0LA 2WT8A 1OC2A 1U0NA 5JEEA 5K6TA 3CW8X 2QD4A 5L7YA 1X77A 2P4EA 2B1RA 4A4DA 3N2YA 3ONEA 1UCFA 4IZ6A 2HKIA 4U2CA 1BFKA 3EG5A 5EP3A 3C5HA 1JECA 3Q8XB 1WOMA 1FA9A 2V8OA 3MSCA 3RS5A 2Q3LA 5C7OO 3LXXA 4AG6A 3G2HA 4J43A 4GGMX 4HNQA 1AUOA 2LRHA 4YMWA 1EQAA 1PKXA 2BFAA 2HQBA 2VEDA 3DF7A 4OHWA 4P38A 4ZAWA 3KKQA 1KP3A 2C94A 4BUJA 1S5PA 2ZPTX 2XBMA 5SV2A 1U8FO 1FFAA 2ZIEA 1SWWA 3OETA 3PQ6A 1P5FA 2G28A 2I4IA 1NW9B 3OPYA 2W70A 4RZSA 4KQWA 3DDZX 3CSDA 2QL6A 4YN3A 3KDAA 4X85A 4JB2A 4KJZA 4O4LA 1KJ8A 3IAAA 1SUIA 4BNHA 5LP6F 2C31A 1X1AA 1IRIA 2EJTA 1NULA 4HMOA 4LMAA 2OSBA 4QYTA 4B7ZA 3S68A 4D79A 3UUWA 3R3XA 2PGDA 3UMVA 3C8UA 2ZREA 4G67A 1RQ7A 2B99A 2PRYA 2NTJA 4QHSA 4YCDA 4CLXA 2XCLA 1ULUA 3GRZA 2AXNA 2C07A 4HS9A 3TPZA 3X1WA 1P9OA 4UBKA 2JLQA 3OMXA 1WCXA 2GZAA 2WFZA 3LY5A 5KDDA 5A4KA 1M6YA 3TLGA 5CB0A 3GP5A 3AKEA 3HJTA 2HIAA 4IW3B 1SIBE 3MLAA 5BN4A 1T1GA 2YV3A 3NT5A 3D0RA 4DCGA 4YK7A 4DGSA 1XVTA 3TTUA 2P0EA 2VJKA 3GH1A 3C6MA 3O4GA 1MC1A 3U81A 4QFCA 9LDTA 3NANA 1KYXA 5AI0A 2MYNA 1R0ZA 2R7NA 4M0UA 4BWVA 1DDIA 4EGQA 4CKWA 3IBSA 1UPTA 1I3KA 2AK3A 1KIAA 4LGMA 4MRPA 4HYQA 4YRAA 4YT8A 2OXIA 4IG9A 4N7BA 3EFEA 3BK1A 2WLSA 1IVSA 3FKSD 4P7GA 3AEQA 3ECCA 1ZUNB 5EJMA 5A4IS 5LNK6 2PRSA 3NFYA 4G24A 4MV1A 1P0IA 1FNMA 4IRXA 4A03A 2YV1A 3NFRA 5TJHA 3ZD7A 1V35A 3V2UA 1VJ1A 1YUNA 4ARZB 1TIKA 1IHPA 2WWXA 3B9BA 3AJAA 3MCAA 3QPUA 4Z0HO 4D9NA 4PLTA 1R0SA 1X87A 3WYCA 2LR0A 4MEAA 3RG2A 1KJ9A 2IXBA 3O83A 1MO2A 4I1UA 5DIZA 3R7FA 2R48A 1PV1A 1BEZA 1EK2A 4ENQA 2AJDA 2DPHA 1G1MA 4QC2A 4P7JA 5FDFA 2LCIA 4O4HB 3GFVA 1RWKA 1YCGA 1T5IA 3G0IA 4Q7LA 4AJJA 1G9XA 1CE8B 3E9EA 4M0EA 1FRFS 3I6MA 1T1JA 2VJLA 5A05A 2A59A 3KPVA 4YY3B 1E9RA 1NYLA 1T2AA 2CC2A 4IUCS 4Z86A 5HIAA 1P0CA 3WK8A 2PUCA 1T9ZA 4KQIA 4M6WB 3BORA 3ZBQA 1MAAA 1NASA 3ZDZB 4J9VA 1ZIXA 1XX6A 4Q1FA 1MFPA 1X86B 2Q2OA 2R7KA 4E21A 5K8JB 3PQEA 3EDCA 4HVAA 2L42A 4K40A 1IWBB 2OAEA 3HB0A 2XUKA 1ESMA 5JPIA 3K9FC 3CZPA 5JU6A 4FEGA 3QVTA 1DAEA 3KKZA 3IKVA 3FPEA 4KXVA 3AP1A 221PA 3MJTA 3T0FA 1KI2A 4LJ6A 4LAFA 4YLYA 3B9QA 5IVDA 1YK1A 4QVIA 1QIJA 3HGQA 2ZRBA 1IDOA 1WMAA 3IJ5A 5BP7A 5FHQA 1H2FA 5CA0F 4N8EA 5LLTA 3S6JA 4DQDA 1FSFA 3EAFA 1N32B 4DG5A 3F5FA 4QNRA 1EESA 3LPNA 1M2OA 1ILEA 3EGEA 2JLCA 4Z8XA 1Y8QA 3A1VA 1QVVA 5K6AA 2P6NA 2YHAA 3DB2A 4XVQA 1KSFX 1R3DA 4DM7A 1JN0A 5HYVA 1N4DA 2H2DA 3FYCA 4CQMB 3K7EA 5CDHA 1LDNA 1Z0SA 3LU1A 4GZMA 1XE3A 2DYKA 3F98A 5E0OA 4NATA 1O0CA 2K6GA 2QXTA 5CYPA 4UJ3A 1LFDB 1EEHA 2YYSA 3CZCA 2QTZA 2B4RO 4MH0R 4TUYB 3M1AA 1MVLA 2ATXA 2YXEA 1OX6A 3SC2A 3UT5B 5B1HA 3DOIA 2UZ1A 1U6KA 3R5JA 1YRBA 3D54D 4ZOLF 4O4JF 2M1XA 3R7DA 1I2MA 4DIMA 4LSGA 2NQTA 1HH4A 2NZUG 4UEWA 4GM1A 3SJCA 2WVGA 1A69A 4XIJA 1EA7A 3TJMA 2CBGA 2FDXA 4UPEA 1Z0FA 2PA0A 3WGUA 3BG5A 1KJJA 1US8B 1O7JA 2XHZA 5EA2A 3DHVA 4MDHA 4WOBA 3F6YA 3JAWA 4HRYA 2ZQYA 1AK2A 2PLWA 3LD9A 1Q95A 4U6SA 5LU8A 3H11A 1V5GA 1OOEA 1CFJA 1FDVA 3OBBA 2ETVA 4NU8X 3HJBA 3KDPA 2I2FA 3W7BA 4M54A 1N2GA 2JIPA 1LTQA 3VYUB 3OEED 2P5SA 1FY2A 1SAYA 2CHVA 3KU1A 2CHGA 4L8WB 3STHA 3ISJA 5J4KA 1JHOA 1RABA 3PDJA 1OA0A 1IXZA 1JIXA 3C7DB 1N6LA 5JFTA 1ZMBA 4N48A 4FMCB 4U7JA 4NF2A 2P3OA 4Q05A 1T2EA 3UC9A 4DLZA 3L02A 3KZNA 3G0HA 2O48X 2Q27A 2X1MA 4EYSA 3DV2A 4QICA 1DKUA 4NZYA 4B3JA 4RKFA 5LBUA 4GXQA 3WGJA 4B17A 1YQUA 4CLHA 1WXFA 4BWGA 4F1JA 4XX0B 1CDOA 2QY6A 4DSOA 1UKVY 1DC6A 2NOAA 4JLMA 1CR0A 2VTVA 1LF5A 4HUQA 3PJDA 2J0VA 3E8XA 5CCEA 1UXHA 2KB0A 1KFCB 2LBPA 3AKCA 3L04A 5F1OA 3IAS1 4LZLA 3W2GA 1VLMA 1ZMTA 3OJFA 4IFEA 3Q40A 2XPCA 3R2JA 2BGLA 1BHSA 2G1JA 4QU0A 2RH4A 4LOKA 3LLUA 2FK8A 3ZV3A 2V58A 3IELA 1Z0AA 5IBPA 2F3UA 2UVPB 3BF8A 3L7CA 2WINI 3H5WA 2PGXA 3OWOA 1NVWQ 2V96A 5IFLA 1WHTA 4RDHA 4DLPA 1IM5A 5G1PA 2CHQA 4KNYA 4TYMA 5DB4A 4Z4GA 2FHPA 2ZJZA 1GZHB 3TRHA 4XAQA 3AR3A 2ZDQA 1L4BA 1A77A 1EM6A 1EU1A 3LXUX 4P7KA 5E95A 3V2IA 4UDNA 1TEVA 1YR3A 3J7AC 2XYRA 3Q9SA 3ZK8A 3K53A 4WN9A 1RMTA 4JLNA 1IMOA 1GUZA 3K0HA 2VRWA 2WJJA 5FOSA 3FOZA 2BMEA 1Y3BE 1NQXA 2GD1O 4QAQA 1CZRA 3KOYA 3JRXA 3EOBI 1DG9A 1OH5A 4GIBA 2ZIVB 3PGLA 1DDOA 1MHTA 4C29A 1Y7TA 1I1OA 4FSDA 5C1OA 2R8XA 1YJ8A 4ZXFA 5KSPA 2PBLA 4EJSC 2AT1A 2GVNA 3UW1A 2NU8A 2PYIA 1HFEL 3HJNA 3L6BA 1JHPA 4JQSA 4JU9A 2OGTA 2X7XA 3R3ZA 3MINB 1G6HA 3LP8A 3V6LA 2XMSA 4MHSA 3PGMA 5D7NA 4KRYA 3RUIA 3YASA 2WJPA 5KREA 3V48A 1L8LA 4P36A 5C3MA 4KSBA 2WD9A 3RS2A 5A0FA 3BD6A 3UT0A 4CKEA 2DTEA 6GPBA 2ZYDA 2VJMB 3U7IA 5JNWA 2GAFA 1OWLA 2YZMA 1NXTA 3PRYA 1JQJC 2P4UA 2X41A 2QW1A 4TKUB 4ZAZA 1RPNA 5LBTA 4JYZA 1E58A 3K8OE 5MFZA 3QOYA 5HOEA 1ZUWA 4IDHA 4B3RB 1PTKA 2JGRA 3L92A 4MQUA 4YJ3A 5ERGB 4YS6A 1D9ZA 3O8NA 1WSAA 1C81A 3INTA 5AXCA 2VKQA 3ZDYB 1CQIA 5LQCA 4JGIA 4MDFA 4HYEA 3QIAA 2O4UX 4J49A 3CRZA 4JQYA 5IC5A 3RS8A 2JLUA 4O5OA 2C7QA 2JBAB 4QUAA 3TG8A 4HLCA 1PHRA 4A82A 3A2KA 4Y1RB 4CU2A 2CW5A 4Q7EA 3Q7TA 2Y6VA 4TTAA 5HRCA 3LRTA 5E1MA 1RRVA 2OBFA 2W6JA 5ENDA 2O3SA 2OZLA 5DO9A 5PGMA 1Y6FA 1YT5A 3VR4H 2V7EA 2OV3A 3GUZA 4RCZA 3IQDB 2VWGA 4IM7A 5AWFC 5F23A 5BOSB 1HQCA 3WV4A 1U31A 1LEHA 4LJ9A 3HO6A 1J2RA 2Q5LA 4RULA 1XT6A 2IHVA 4K5QA 3PNPA 3UYLA 2ORVA 3VSCA 1C80A 4WDRA 3B7PA 1YMQA 4RK0A 4ZOAA 2HSGA 3K70C 2PQ0A 1JWLA 5IAAA 1TXGA 1ZC3A 2R1TB 4TQAA 1YKSA 2XQJA 3RTEA 3THSA 2VQFB 2ZIZA 1XNQB 4RF3A 4TX1A 5E2BA 3ZBPA 2M6RA 4FKBA 3SVZA 5KKCA 3TXAA 3I6QA 2VXCA 4Q3KA 4YI3A 1B3RA 1P1FA 1UMDA 2DBVO 1TQ8A 2XE8A 4H16A 2GA9A 3IESA 3MMNA 1FNBA 2X0EA 1E2UA 3RVOA 3W9BA 4MV9A 3SU8A 1YZFA 2JJ8A 3BWYA 4PIMA 5JDCA 2CJXA 1F2UA 4ITRC 2NAPA 3D2BA 1DRWA 3V8QA 2QQFA 4JSRA 2VYFA 1A9OA 1YDGA 1CQXA 1VA4A 2LGJA 1FQWA 1JEQB 2J59A 3F6RA 4RW0A 3RPEA 3HADA 4NULA 4NJEA 3RH0A 1SBNE 3JZDA 1PTJA 3AUTA 4B5LA 2B34A 1NF2A 3OO0A 3VGJA 4RKQA 2I3DA 1XZAA 3ZY3A 1SC3A 1JLLB 2QSUA 1E3WB 3AH8A 3GLFB 3AR6A 1RPTA 4KXYA 5CM9C 3ZVLA 4GBMA 4QELA 1E1NA 4IAOA 1L5KA 3KDSE 1KIMA 1KDTA 3A06A 3NU1A 4MS4A 4DAEA 3PFNA 3K70D 4AYTA 3AI1A 4WOKA 1NTRA 4IVPA 5KNCD 3FHTA 1IEWA 2Q6TA 3HR7A 1T1RA 1HI9A 2F6RA 4H4EA 1E1KA 1QM5A 2CLSA 2X7JA 3AIKA 3DZDA 3PVCA 4XFDA 2FFQA 4EG8A 5EHZA 3HPRA 4AJPA 2N9UA 1W4LA 3VC2A 1U7PA 3WDMA 5K4GA 3FCCA 4J2OA 4EUSA 1SHJA 4BIIA 2ON6A 2VHWA 1H8HA 1N6KA 1XKTA 3V1NA 1BJKA 1SHUX 5AUPB 4DWVA 1E98A 5HQTA 7YASA 2OC4A 4Q1EA 1ISGA 1E59A 5FHRA 4A15A 2V0CA 2GBGA 4ZT2A 2RC5A 5JMTA 4UHCA 5JSUA 2GO1A 4IFIA 3MYRA 3EZXA 5EL0A 3W5DA 1IRXA 2J6HA 5HVNA 4MUNA 3D31A 3OLQA 5G2OA 1C7RA 4MS3B 2IPNA 4EPXA 2BGTA 3M2TA 4Q93A 5C1BA 1YI0A 5LLSA 1RLTA 3IX7A 4K8OA 2PNFA 4KAXA 5FUMA 1OF1A 2I1WA 1NVVR 3IRUA 4GECA 1KFKB 1Z25A 2ZJ0A 2PRZA 1YMVA 3PQ2A 3GXBA 4XXHA 3L8CA 4CJXA 3U1BA 2DTXA 1SBIA 4J0HA 1XZPA 3G2JA 1DUVG 2ZI7A 4ENRA 4ZYUA 1KQPA 3NDPA 5HFAA 2JNWA 1EM8A 1FJHA 3OEWA 3QMMA 1JDZA 4IYRA 5EPEA 1WPGA 2R85A 1GU0A 2YNMA 4IOJA 5LUAA 2P30A 1KEUA 1OFHA 4Q47A 4RESA 3AHDA 1NATA 2WT4A 4DCPA 4BFSA 4ESVA 4OAOA 1XCGB 3VX3A 3H16A 3IP9A 4FMBB 1WUTA 4IIGA 4RFLA 5E2AA 5HZMA 3SZGA 1FYWA 1KBQA 4A6EA 2C7OA 4IEIA 2OAGA 3PDIB 3COJA 1FVOA 3HTXA 1C8VB 1ZESA 2C5BA 1I3CA 1FTGA 2BFBB 4X8MA 1S9DA 1ZIOA 3N9IA 4M0KA 2AL7A 5JAPA 1E8NA 3BE4A 4DMRA 4OGFA 2MSKA 2VSNA 1JHXA 2OM6A 1K75A 4MVJI 3C3PA 3M1LA 2YJGA 3EE6A 2QVBA 1EGQA 4CT5A 5B1DA 3O1IC 1LBEA 3E27A 3FR8A 1U8EA 4KYIB 3QYJA 2CLFB 2DOKA 1TW2A 2WSMA 5A9TA 1E1RA 5TJ9A 2XNKA 3QU9A 4S2EA 3U3MA 5IKOA 5I4IA 3DNMA 3N0VA 3OEHA 4YPOA 2JARA 3WQRA 1AHPA 1WXQA 1Y6ZA 1RWPA 1JSZA 1XF1A 2I7VA 4Y1EA 4BO4A 4J3NA 1ZHFA 3LQRA 3ZGYA 1HEUA 2LV8A 2IYUA 1PZHA 4MCJA 4ND3A 4AY6A 4UFOA 5ALEA 5FTMA 1MTZA 2FEMA 5K2MA 2WIKA 5DGIA 3KKEA 2PD3A 5K8CA 1ESCA 2Y71A 5LYJB 1AMOA 3B52X 3ZD9A 4XJSA 4I9UA 4MUGA 5KHAA 2P6MA 2BIFA 3QWFA 3WLAA 1V7QA 2ZZKA 1B23P 3C8HA 3GCGA 4XGRA 2BZ0A 4K9QA 5GJVC 1F8UA 5ELLA 3IODA 1YB1A 5J47A 3HJFA 4IUDS 3D7SA 1UANA 3STVA 3X1DA 2MYUA 2CYCA 4QUJA 4EVSA 1MNAA 3A9CA 3IUPA 2BH9A 2JLSA 2ZRGA 4TT3A 3LTNC 4YROA 4C4XA 2OENG 3W5VA 1EVLA 3N6VA 2NYVA 1EIWA 2VSYA 4V39A 4FOLA 4ETIA 4V0ME 3C3CA 1JEJA 2PIAA 5ALIA 3WWOA 3ZI7A 1K3TA 3PEFA 3GFTA 2ZJ8A 1I2DA 1GFSA 3QUCA 4I4TB 1W5TA 2O5RA 1FLDA 1B6RA 1N5OX 5AI4A 3DC7A 4BAGA 3AIMA 5SY9A 3ADBA 1YAJA 3DD1A 4GT1A 1RJDA 4TSRA 3TBHA 1ZU4A 3NIBA 4URFA 1UPCA 4QBKA 2IS6A 2DT5A 2C3OA 2DHDA 3HYSA 4TWBA 2JAWA 2WIJA 5F73A 5KQMA 3MB5A 4G5XA 2W48A 3MTDA 1N6OA 1O96B 2R1ZA 2H3EA 1BRTA 3AOGA 3EISA 1JXAA 1FFXA 2YY5A 3KZCA 1JMKC 3ICOA 2HAEA 1QUEA 2YH2A 1IOVA 1BXKA 4J9UE 4HQ6A 4H7JA 1T35A 4RDXA 2OHFA 1NL3A 3CMCO 1KOFA 5AOBA 2RAPA 2GETA 2JFBA 2O2CA 3DPIA 4LZWA 2NU6B 1OY1A 5BWLA 1N2ZA 3EXIB 2V54A 2FW8A 3M5WA 3TW4A 3P9ZA 3ZGZA 1QP8A 1G98A 4YAEA 2WTAA 1V3UA 1VYUA 1TT5A 3PNMA 1EYZA 4O2BF 4KQCA 1DJOA 2NADA 4KUGA 5IUNC 1NSTA 1P2TA 3J7TA 2WKQA 3PNLA 4NV0A 3NTLA 5FNVF 2R65A 4B2PA 5AVRA 1QRUA 4X1OA 3NALA 2AG5A 3VNQA 1N5IA 2VUUA 4YMHA 1PFYA 1ZJYA 4ICIA 1GCGA 3LVRE 2ZAMA 3AC0A 1JSLA 3C4QA 3FOCA 1XBTA 2PR2A 3MRTA 1X7XB 4MB2A 4BZPA 4QD3A 3WGIA 2J9ZB 1LI5A 2NO9A 4RH0A 4YPVA 1GEEA 1IHXA 2C8LA 1J09A 3HI6A 4ZMRA 3D8RA 3D0OA 2R1UA 4HR7A 4Z4QA 1E6MA 1XWIA 3TQTA 1RACA 2X9QA 1BXZA 2GJAA 3P0HA 1SOAA 1UK8A 5HRAA 2QL5A 2IYOA 3B1KA 1II8A 5MN5A 1SULA 4OQEA 1JKIA 3OE7A 2HMYB 3A6LA 3JAKB 1G6Q1 3KLBA 5F5NA 5K3AA 3TZLA 4C03A 5A1JA 3U61B 2PMFA 3THOA 2UXCB 2E4YA 3LC2O 2GPJA 1NA5A 1QGZA 3N59A 2HHCA 1TU0A 4OJNA 5H1YA 1ODTC 3AUXA 2DR3A 5E1DA 4D9KA 4PLVA 3DE7X 3WOHA 4WBXC 1TZJA 1EE2A 2VPIA 4O3FA 1KSJA 2QGFA 3I76A 3DDNA 3LQKA 1JR3E 4CV3A 2IGBA 3I9V6 3U6BA 3OPVA 3D1JA 1UOOA 4CF3A 2XCSB 3IP6A 1M5TA 1KYZA 1A8QA 2XEXA 2NACA 1BS1A 1NBME 5J5AA 2BFMA 2HU8A 1C2TA 1E62A 5FTNA 1CIVA 2YN4A 3RVJA 3GEPA 5KNDH 5KYWA 4OSOA 1DOAA 1T36B 1U8XX 2PTHA 3ETGA 1T2FA 2ZITA 2IDMA 4G56A 4F0JA 4NPAA 2FF5A 5AXBA 4AJHA 3NAMA 4KO2S 4KQKA 4DPLA 2H5JA 1IVNA 3PHHA 1HE2A 1NXWA 5CITA 6REQA 4X65B 2DKNA 1P39A 4PRYA 2Z6VA 1GDHA 3B2EA 4G97A 2Q0SA 3QFRA 3VZPA 4MIEA 1TJ4A 1DP4A 3O5AA 5E7IA 4BNYA 3ELUA 4ZEMA 4F8EA 2V55B 1D1TA 3DVLA 1ZGZA 4MQ5A 3GJSA 1GKIA 3VI4B 2WG0A 1Z6AA 2HNKA 4RH3A 4OGWA 1EQ2A 3TW6A 2IPLA 2M9MA 1V3VA 5DXJA 3T3NA 4NX2A 2JEZA 4KI7A 2FZ4A 5KC8A 2H2WA 4XR9A 2IH4A 2V98A 5BNIA 1NMYA 2X58A 4K05A 2AKEA 5IN4A 2JFQA 3KPYA 5JS2A 1K2WA 4O1MA 1JHDA 1U3VA 3E3OA 1U0JA 3QG5A 3T1TA 6Q21A 1PJSA 1N5JA 4QU8A 4LV6A 4A91A 1XMQB 3DFMA 3E84A 1JI3A 2QTTA 4G25A 1KP2A 3ETCA 4QXQA 3OLZA 5H82A 3QQ5A 4MOWA 2V6FA 5CAEB 1ZK3A 1C30B 3AI3A 1IQPA 3T5TA 1CJTC 1K6XA 1AUXA 2D13A 2C3MA 3D9QX 4FZJA 4LIPD 4ON9A 1PGOA 2DKOA 3GFOA 1SVLA 3L8DA 4MS1B 4PO9A 4CMKA 1JBEA 3UICA 4E03A 5SY6A 4FCCA 2I6QA 4QGHA 4Q3BA 1BS9A 5BWMA 2XVMA 4Q34A 5HUQA 1RQXA 4LPKA 5KHOC 1E0DA 3BOSA 5KAMA 5TQ2B 3HUDA 1A50B 1LRLA 4BATA 1YSCA 5CTJA 4G8CA 4MWBA 1SFRA 1F6WA 3HB5X 4WE3A 4J90A 2CT8A 5ERYA 3GJ7A 4Z7QB 1D4ZA 5K05A 1N9ZA 3LVQE 5AOAA 1BO6A 4LXGA 4ZJPA 3CLVA 1N5RA 4IUBS 2CLEB 4BZZA 5E9AA 1HORA 1NNSA 4N6GA 4ZIRB 3K72B 3FVQA 1K08A 3L1VA 1E4YA 2BJWA 1RTKA 3KNZA 3RUCA 2EQBA 4B87A 1RU3A 3H9QA 4MVJF 3LQQA 1L5HA 2AEEA 3CBGA 3TZEA 5FPTA 5IMBA 1WV1A 4NHOA 4Q4HA 4YWJA 3GLIE 1R6XA 4M49A 4ZU6X 4RKEA 1I3NA 2VSQA 3LE8A 4KWEA 2Z56A 2ODNA 2YJNA 1KYVA 2FWJA 3FNRA 3JWJA 3LBHA 3PQDA 3TIXB 2ZRCA 3RSHA 5AYVA 5DCYA 2QR2A 5F76A 1ZCZA 1PSDA 3KUUA 4QE3A 4GX1A 4AT1A 3DXFA 1L7QA 1RI2A 3FPCA 2B8EA 3QIVA 5JLAA 4JU8A 4YT5A 4RMJA 2XB4A 3FMVA 4HDRB 3L6RA 4G85A 1U9JA 3V8BA 5FA8A 3TECE 5AK6A 2J46A 2GRAA 1DAIA 1H2WA 3HDHA 5FL3A 4NYMQ 3KPJA 3W6PA 3A1UA 4PAWA 4I3HA 1M34A 5IJ9B 5J43A 4KXQA 4V1CB 1DKLA 2QYTA 2AN9A 4J7XA 4DQLA 3PXUA 5HGXA 2FR0A 2C78A 3JQEA 4YJ2A 1GZUA 1MO3A 3AM5A 3BERA 1A96A 3MNFA 3PR1A 3O8OB 4JVNA 2Q5CA 3WVNA 4RUKA 5JAUA 1RC8A 2PUGA 1O9HA 2GZ3A 3CCFA 1ZUHA 1SBQA 2D5IA 3EDOA 1KGSA 3F5SA 2EFJA 3QKRB 4FFWA 3K70B 1YL5A 1WEKA 1ZU5A 3DZFA 1ZC4A 4QVKA 4FSHA 3NBXX 3D0QA 4X84A 3LKDA 3ZHCA 3EAQA 5TVKA 2O5VA 5IM5A 1J33A 5B36A 1L7RA 1E6KA 1O6ZA 5AK3A 1DTSA 4U7FA 1QH9A 3I3SR 4U4AA 2RHWA 2J4FA 3TUJC 4YUVA 4KITB 2HV8A 1XCOA 2CB0A 2GBFA 3FHJA 2E1PA 4PTLA 3K96A 1LDBA 1YHNA 2I7TA 2P9ZA 3DEYX 3JWGA 4NL4H 3GQBA 4F06A 4YRBA 5ICMA 4LA4A 1WDLA 3AU8A 4OLFA 1XRSB 3SBOA 4KXXA 3N76A 8GPBA 4CKBA 4JASB 4QU5A 2YJ6A 3DDHA 4L5AA 1E1CA 1P7VA 1ZKMA 1XQYA 4J4BA 1DKMA 4AXXA 1E9AA 4RV4A 2Q6LA 2DKFA 5IC4A 4E2ZA 4KQ1A 1LA2A 4UZEA 2ADOA 2I80A 1VMKA 3L1IA 5J1SB 1THTA 1RE0A 2OV6A 3C3JA 3EIXA 3FCUB 1DC3A 4XCVA 2VDWB 5CXXA 4M1KA 4C22A 1XA0A 5KNCH 3OJOA 2VLBA 2WVJA 1QX3A 4TSFA 4ZT3A 1HE4A 1R0CA 4D6YA 4DL9A 4GICA 3LCRA 3DBLB 5FLYA 5A1TA 1FJ2A 1PIWA 4GVLA 1FMJA 2C5FA 5HR5A 5E6RA 4QPPA 1YZKA 3AWDA 1Q7EA 4W9MC 1D04A 3OUTA 4Y2UA 4W8OA 5AW7A 1VB5A 1M1NB 3R3HA 2AOTB 4J6EA 1B42A 3H9JA 3S5JA 1NMZA 1ELOA 2C4MA 4V0RA 3TL3A 4ERXA 1CR1A 4M2LA 4YGYA 1XDWA 2CYBA 1KNXA 2QJWA 4HWPA 4WCFC 3ZE1B 1AU9A 4MDYA 4HSEA 4LISA 4BLRA 4DDWA 3HP4A 5AVTA 2DCUA 3BK7A 2HEGA 4X7BA 3JASB 4CHTA 4CEIA 3PQCA 1F17A 1L4LA 1E64A 1UK6A 4DN6A 2HRQA 3BD8A 2GMWA 2Q45A 3EZGA 3Q8MA 2CVOA 2IP2A 2Y4NA 3QLEA 2FZLA 3WRYC 3NPMA 4E11A 4YXWD 4KU4A 5ITZA 1U2SA 4A0GA 3P5SA 4PCVA 3NATA 5IM4F 2EG5A 2O8BB 4LF7B 4JYCA 2QSYA 3RF7A 4BECA 1WMDA 1UMBA 1E7QA 5IC6A 4OXIA 1K7CA 3C8MA 1IZZA 2VFAA 2ZYSA 1X7YB 2OLKA 3DOEA 5JARA 3BXHA 4PV7A 2Q9UA 4ENPA 3KK0A 2HF7A 2ZJ3A 3ONVA 1BRMA 3AUJB 4MPDA 1H0RA 3VJKA 2IS4A 4NBVA 4I55F 1K9SA 5G40A 4X92A 1QTRA 2GB4A 2ZWAA 3DW3X 4HDNA 4I1IA 1MDBA 5DSZA 3MCUA 3H2BA 3BMNA 3FMFA 3ZE7A 4HPXB 4TTSA 4ZHQF 3Q7EA 3MT8A 4B8WA 4IY1A 1F8YA 4UTPA 1WTCA 2X5KO 1FLNA 2UUOA 3OOYA 1Y7PA 1CYEA 4IDOA 3QXCA 4JYMA 2GM5A 3O4FA 3ESDA 4TQ9A 1KI3A 1FX0B 2HNBA 4RTOA 2TMGA 4QLOA 4XOIA 4WZZA 2BR3A 4B3DA 2BKAA 2DSNA 5AKJA 4Y0AA 3ZXUB 5HKLA 1KR2A 2XBUA 3GGSA 3QRWA 4BQNA 1HE3A 1TKBA 5L6LB 5D00A 1P8JA 1FNDA 4CG2A 4C07A 2RBEA 4TRRA 4YRGA 2PSDA 4O02B 5IJWA 4J0GA 4O33A 4PHGA 3RC7A 4KZPA 2B98A 4DR4B 5F2OA 4CN9A 3NOXA 3EXG1 4L4YA 4UM8B 3SNHA 4XRGA 2RG7A 1ZA2A 2D0OB 4B7XA 4KPFC 3TF5A 3VU3A 3GEBA 4JENA 4WKCA 1NFQA 1U2GA 1VTKA 4V3BA 3WIEA 4YC7A 2UDPA 5F35A 1L5GB 1SBYA 1YCDA 4ZK6A 3H99A 4Y2RA 3BT7A 4ZU3A 4ZPXA 3QKSB 3KB2A 3W77A 2DUMA 2QTLA 1LQTA 3BGWA 3LZ6A 1P0FA 2CVQA 5CNKA 5G1OA 3UJAA 3HU2A 3GPDG 2BPOA 4ZOQI 4LBVA 4J2HA 4KL8S 1LDEA 2OXFA 4C87A 2PJZA 3PS9A 4G1BA 4B3IA 3USCS 1XDBA 3OTGA 1T34A 2IXDA 5GGXA 3A0UA 3K9GA 4UMFA 1F3OA 3EA4A 3HGTA 1SQSA 2OOSA 2IW3A 3H6KA 4F60A 3T7SA 3NJ4A 3BDIA 2H5IA 2P9BA 4JOBA 3THWB 1F8FA 4J7UA 4BNUA 4ZI3A 2PXCA 3UG7A 2X0IA 4L9WA 3P9SA 4EI7A 1E1LA 1PJZA 3TLCA 1QFSA 5LZ9A 3Q5GA 4JOSA 1PGNA 4A23A 3FTPA 1RJGA 1ODSA 1ULBA 4IRMA 1R8SA 1FYVA 4FQ7A 1WCWA 4CTNA 1Q1QA 4AKEA 5FWNA 1T43A 3UBMA 1SD1A 5KYYB 4QBGB 3U7QA 1M66A 3RIXA 2GA8A 2YXNA 4FD2A 4P2GA 3DQQA 1YNOA 3BULA 4MR8A 4DUGD 3ZQUA 3MJVA 3N5CA 5FV7A 2DHEA 4EGFA 1H66A 4LYDA 4IH4A 3ERCA 2RHBA 5BSGA 3RTBA 4H7DA 4EKGA 1NVBA 4GH5A 1YIOA 1H69A 2BEJA 2CXNA 3O47A 1RYEA 4XSGA 5IVIA 2XQIA 3TINA 2W2MA 2AMJA 3EF1A 3SX2A 3WKDA 4UQLA 4LJSA 1NBAA 2ZJOA 1E5DA 1THZA 1H2AS 2HSEA 1KXJA 1KXZA 5JCOA 3T1YB 4LEIA 4OQMA 3GAMA 4RA6A 4HQNA 5SZKB 1NXQA 1MN6A 4Y6LA 3T5AA 3LF2A 3ZWDA 2ZQ5A 5A3VA 4QASA 4YB8A 1ABEA 3QBDA 4KXNA 1V8BA 2QZ4A 4IIEA 1DKOA 1AKVA 4KODA 2PX5A 3BKXA 2R62A 2IK8A 2YJZA 3C3EA 3NLLA 4PS0A 2BWJA 4NV1A 3LPMA 4FFOA 1SEPA 2YDXA 4NDZA 4L4UA 4DCMA 4DDTA 1SG0A 4U8GA 3HNPA 5DASA 5TE9A 1PR1A 2HMSA 1XRPA 4EYQA 3KS9A 2NO1A 4BQEA 3CGWA 2AX3A 3I1YA 3FYSA 5LZ8A 5E4YA 4DSNA 1Y8ZA 2QM8A 4H6PA 2OYRA 1L4GA 3QNUA 4X93A 1L4UA 2OECA 5JE8A 1XZGA 2JATA 1XDGA 1MRSA 2F8LA 4TRMA 5HF6A 2WJIA 1E8DA 1PBNA 4WAUA 3E6AA 1KZGB 3PFBA 3RC8A 1JIQA 2JKYA 3AVYA 4KWHA 3D6HA 5DNWA 4RHUA 5AI8A 1Z4OA 4XPZA 1JDTA 1WPXA 3HEMA 4L4RA 3VO8A 5CEEA 4O4IA 2VNHA 4FYJA 2EOAA 4OEHA 1VP3A 1A9SA 3A4NA 4H7IA 1NDUA 3OFND 1YMUA 4FZVA 3S70A 1EAYA 4EUNA 1FSPA 1Y8RB 3GELA 4QGFA 2AW5A 4G6ZA 4NJMB 2VYVA 2VSXA 4DV4B 1YA6A 5GJWC 5KVQA 1G55A 1ZD2P 4KXMA 3LSTA 3QE9Y 1AKRA 2PUVA 3E18A 1QV7A 3I6BA 4YUXA 2I2CA 1SQFA 2V6GA 1OXXK 1DIOB 4N0PA 1CY6A 3EZ9A 1CULC 5F4ZA 2GEFA 5IM4A 3FTDA 3F73A 2EDAA 3QEMA 5K3FB 4EB6B 3MD0A 1GZSA 6YASA 3GAAA 1OTXA 1V95A 3SBEA 2FN8A 4E5YA 1LS1A 4MIKA 1LU9A 4FDVA 5JQGF 4LF5B 2QSZA 2ZWMA 4ZV4A 1A4IA 3NC1C 5M5BA 5IKXA 5G3ZA 5EQTA 3ZNOA 2P69A 2QP3A 5FRDA 2VNSA 3HCEA 1IBRA 2ZSAA 3JYHA 3E81A 4TMWA 2VCEA 4JIMA 3NORA 2Y66A 3I9LA 1N5DA 3KZMA 5DM2A 4BNDA 4PC6A 1T3GA 1SU7A 1B14A 2ENWA 3FMOB 3O8RA 5A0VA 2H1WA 3DOUA 3HBLA 4K9PA 1R18A 3KR0A 2H2GA 1WL8A 5K3BA 2CVPA 5DWDA