1XIVA

Plasmodium falciparum lactate dehydrogenase complexed with 2-({4-chloro-[hydroxy(methoxy)methyl]cyclohexyl}amino)ethane-1,1,2-triol
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
318
structure length
307
Chain Sequence
APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALAHAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mapping the binding site for gossypol-like inhibitors of Plasmodium falciparum lactate dehydrogenase
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase
total genus 114
structure length 307
sequence length 318
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2004-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1xivA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1xivA02
4XRGA 5LCXA 4YPOA 3E9MA 2VOJA 1BXGA 2OXIA 1ZO8A 2P68A 1ZNQO 3DFUA 1I24A 2HK8A 4J9UE 5C37A 4DPLA 4FGWA 2PZLA 3AUAA 2IXBA 3CIFA 4CMIA 4BS9A 3ZWVA 4DLLA 3PGJA 1ZK3A 2HRZA 3GUCA 2Z95A 2J3HA 3PFWO 2HRBA 4J4TA 2PZMA 3LC7O 1WP4A 1XYGA 2DFVA 3RI3A 5JLAA 2Q3EA 3B1JA 3VZPA 1RYDA 1NAIA 4CM3A 1NASA 4JCOA 1Z73A 2RH8A 4H16A 2ZQYA 2BFPA 4IDEA 3C1OA 5ITVA 4BNUA 3HJAA 5L3ZA 3K92A 1PGOA 2H1SA 2G1UA 4AJNA 1ZSYA 4RO0A 3QJ5A 5G0WA 1FJHA 3NT4A 1GZ6A 2YQ4A 3GVXA 2C82A 3AFMA 1UZNA 1O5IA 4MVJD 4WPGA 2WEKA 1HDCA 4BGUA 4YDRA 4D44A 5L4LA 5DBGA 3H7AA 1YOVB 3OJLA 3OQ6A 4OKNA 1ISHA 4I9HA 2O7QA 4DYDA 4WGGA 1PZHA 2PGLA 1S6YA 3OIFA 5KJCA 3O9ZA 3RFXA 2DUWA 3DZIA 3LQFA 1CEQA 2YW9A 2BLLA 2HK7A 3SLGA 4NBUA 4RPLA 4URFA 2VRBA 3N58A 1ZEMA 4CLRB 3E6AA 1FDTA 3GPDG 3DL2A 3KB6A 2X0IA 2J3JA 3TFOA 3WNVA 1PGPA 3AI2A 3DZBA 3QRWA 5IDWA 3I4CA 3ZWAA 3HN7A 5JAZA 3PLRA 1B8PA 4Z9FA 3L6OO 1NVGA 3SLKA 2IEBA 4HXYA 3WOHA 4LN1A 4PG5A 1YB5A 4BNMA 3FNEA 3DWFA 3VPHA 2OOSA 1K5HA 3MOIA 4XCVA 2DC1A 3AU9A 4O1MA 4FGSA 4XQEA 2NADA 1PQUA 2VUSA 5DDIP 5AXCA 1IL0A 3VDRA 1YL7A 4L9RA 3OP4A 1E3JA 4R9RA 5KKCA 4Z9XA 2HLPA 3ONDA 1P0CA 3BMQA 4MVJP 3PXXA 3V8BA 2DLDA 3I5MA 3ROKA 3UF0A 3D1LA 4O6VA 4QFCA 4TZKA 2Q4BA 3JD1A 1Q1NA 1ZIDA 4ZQGA 4Y98A 4CODB 4D45A 5A5FA 3RD5A 5KTKA 1JDJA 3ZWYA 2VUUA 3HDQA 1M6WA 1VM6A 3FHLA 4FS3A 1ISGA 1XQ1A 2ZB3A 4NK5A 4CL3A 4E2YA 4GKVA 2GSDA 1Q7GA 5A02A 1FMCA 1BG6A 3ADPA 3JQEA 3PGXA 4W99A 4YAGA 2P5YA 5BSGA 4ZA2A 1EE2A 4MVJH 1B7GO 1N5DA 1Y8RA 4XB1A 3UFXA 3NTRA 3GVHA 2EKLA 3LYLA 3PWKA 2BGKA 3WFJA 3FN4A 3DAFA 3LT2A 2P5UA 4F45A 3ICCA 1GQQA 4BO1A 3TOZA 4HP8A 1NVTA 4XYEA 1C14A 4CM6A 5FWNA 4PLGA 4F6CA 1I3LA 3AUSA 3EMKA 3LF2A 1HDRA 3QHAA 2X0JA 3SEFA 3ZNQA 3GH3A 1DFHA 2EKPA 3GRPA 2X4GA 3BHMA 1E3WB 5H82A 2DTDA 3ANLA 4DQUA 4CM4A 2O3JA 3IJRA 1E3EA 2AEFA 1TXGA 3QWHA 2C20A 3KLPX 1HE2A 4GWKA 3F5QA 5G0VA 5TS3A 4QFDA 1QXSA 3DTTA 5TT0A 3H9EO 2DPHA 3S2EA 1AXGA 4HBGA 1CDOA 2JAPA 3VPXA 1Z7EA 3EHEA 1KVTA 1R4NB 2E48A 4MDHA 1ZKMA 2YFHA 1NR1A 4HNGA 4XYLA 1GUZA 3E9QA 3R6DA 1SOVA 3F47A 3JYQA 4IZHA 4PG7A 1SB9A 1W8DA 5BSEA 4G81A 2I5PO 2VYVA 4LCJA 1UXGA 3H3FA 2IE0A 3HFGA 2RAFA 1SMKA 1LLQA 2E37A 1K2WA 1QYDA 4TVOA 4WLVA 4A73A 2D59A 4RDHA 4AJOA 1PS9A 4DPMA 2X1HA 2R00A 4DTIA 1A72A 2B5WA 2HMVA 4E5NA 5EL0A 4AJLA 2BF7A 3EVNA 5A05A 1LU9A 1XG5A 4LK3A 1I2CA 3ONFA 1V6AA 3GT0A 1I2ZA 2OP0A 3LZ6A 3OJFA 1NPTO 5A9TA 1I3NA 1U3WA 3JQCA 5IZCA 1YB1A 2QRKA 3CINA 2C5AA 2DBZA 4U0JA 4OAQA 4D42A 1MXHA 2PGJA 2NVBA 1VPDA 2GN6A 3GHYA 3O38A 1DLIA 3T4XA 2FPGA 3RUDA 5AXAA 3GZ4A 2Q50A 3MJSA 4HFJA 4JJIA 1J6UA 2C59A 4MP6A 4W4TA 4FIZA 3H3JA 2J3KA 2GLXA 3MJEA 4BKUA 3UGKA 1D7OA 3IKVA 1JLLA 3JQBC 4UVGA 2O4CA 3WXBA 1YWGO 3S2FA 3D3WA 2Y0DA 2Y1EA 2O3TA 2QYTA 3RUFA 4QXMA 3INTA 2IXAA 3E18A 3KBOA 2ZB8A 3TRIA 1PQPA 2UUPA 3GVPA 1MGOA 3HHPA 4KWIA 4NFYA 1X13A 3G79A 1ZW1A 1X1EA 4XD2A 2HJSA 2D8AA 2GZ1A 3RJ9A 4CQMA 4QQRA 1O89A 5COBA 3T4EA 3I6QA 1NQAO 3WSVA 1T2AA 1PGQA 3C1TA 1XU7A 3D4PA 1K0UA 1G0OA 2RH4A 4GBJA 1UR5A 4IDGA 4CV0A 2VHWA 3ENKA 1AN9A 4HADA 3GEMA 2QZ9A 1U2GA 4AJHA 1MG5A 2YDXA 1NPDA 3NGXA 2FR1A 1ZK4A 3BXXA 3QV1A 1R0KA 3ZW9A 2XXJA 3ZWCA 2BGLA 1QLHA 1RKXA 2NTVA 3NT5A 2P4QA 5L45A 2LDBA 3JD4A 4KUEA 5THQA 4CR6A 3JQ8B 1P74A 3RUAA 1PJLA 4GLLA 4YAIA 4Z6KA 3EUWA 1HEUA 3KHUA 5DOVA 4R4JA 3RUHA 1YL6A 3R3SA 4II2A 4E31A 1V3TA 3DBRB 3WB9A 1MA0A 3H9JA 1M2WA 1NX6A 1U5CA 4YJDA 4EI2A 1LLDA 2VT3A 2PZKA 3PHHA 1ONPA 3O03A 1KEPA 3WQQA 5B4UA 4Q39A 4TRNA 2QRLA 1BHSA 1L1FA 1DSSG 2PLAA 2AMFA 3GDGA 1UAYA 3V1UA 3PPIA 1CYDA 2B5VA 5TNXA 3FBGA 2CDAA 5GZ3A 1Y6JA 2DQ4A 1V9LA 4CMCA 4NNJA 1GV1A 5C5IA 3OSUA 1KVUA 2Y67A 3QWFA 4JLWA 2UDPA 4GX0A 1OZAA 1YBVA 5A9RA 5IFLA 4K9DA 3WGYA 3BA1A 3AY3A 1G1AA 3I23A 3TDKA 4PGFA 1C3VA 4RF5A 3DBLB 3HNPA 1N92A 3WIDA 1QR6A 4Z3DA 4GWGA 4DVJA 1P31A 1UXIA 4FPXA 5IDYA 5FYDA 4IIVA 4PZCA 2J5RA 3U49A 3GDFA 4NPCA 2VTDA 2IYOA 1MXFA 2I66A 1NFQA 4FDAA 4P4NA 5THKA 4BNLA 4X54A 5TQVA 1CF2O 3D3WB 1DXYA 2GD1O 5JO9A 1PJBA 3A4VA 1T4BA 3ROQA 4E13A 1GCOA 3HDHA 4CLDA 4EITA 3R3JA 4ZU3A 1XGKA 2VZ0A 5A3JA 4TQGA 2FSSA 3HB5X 3VVBA 2O50A 3DXFA 1E7SA 1LDEA 2GN4A 4ROSA 2HJRA 4ZD6A 4I5FA 6LDHA 4HNHA 1HDYA 2EWMA 1RM5A 4INAA 3ZHZA 4DLBA 2DVMA 4JK3A 3ST7A 3BZUA 2GUGA 5JAMA 5MDHA 5TLSA 4RPKA 5G2OA 4U5QA 5JS6A 3LT0A 3BMCB 3FWZA 7MDHA 1KYQA 5CPBA 3H65A 1WWKA 1QRRA 1ZK1A 2OBYA 4R5MA 3VH1A 2UVDA 1DB3A 1YBAA 3E82A 4D0SA 2C54A 4N7RA 1DHTA 3E5MA 5IDQA 4RORA 3S1LA 4OQZA 1PZGA 1YO6A 1MX3A 3M2PA 4CV2A 4YT5A 5KIAA 3D5QA 5JC8A 4GSKA 1NM5A 1M76A 4WEQA 3JQAB 5BT9A 1P33A 2Y0CA 1GYQA 3ANMA 1AGNA 1GYRA 2NUAA 4MKRA 2D5AA 1A9YA 4MINA 4M49A 5TIIA 4XIYA 3ZU5A 5JC1A 3RC9A 3OA2A 1U1IA 5JSFA 1A27A 4KOAA 1Y8QA 1LJ8A 2JFFA 2NVUB 5L51A 4R54A 2YJZA 3TNLA 1DFIA 1PWZA 2J8ZA 2UV8A 3MTGA 4CMEA 2I67A 4IXTA 1ZZEA 3U62A 4IPTA 1UDAA 4DWVA 4PG6A 1PJ4A 1LUAA 1SC6A 3ZHXA 1E5LA 4M54A 4YRAA 1GZ3A 4KQXA 3ZHBA 1HTBA 4GX2A 1UP6A 4BKPA 4PLYA 2O3UA 4IINA 1QORA 2PFGA 1U28A 1RJWA 2G82A 3QQPA 1NR7A 4CQLB 4HV4A 4B3JA 4BO2A 1WDLA 4EEXA 2Y1DA 5CDUA 4G5HA 4IJVA 4YACA 4CMBA 1DAOA 2VHYA 2V6FA 4FFNA 1DO8A 3AY6A 3Q6IA 2HKIA 3S8MA 3VH2A 1TB4A 3QSGA 3G3EA 4IQ8A 4W82A 4CM9A 2HQ1A 2B36A 4MVJG 1T25A 3V2HA 1JTVA 4DQXA 2VUTA 2NWQA 1NP3A 2AE2A 4EJMA 4AJKA 2I9PA 5CFZA 5B1YA 2XOXA 4I08A 3OHSX 5ENDA 4AFNA 5IJZA 1GPJA 3NKLA 5TJ9A 3VH4A 4MVJE 3BTOA 2I3AA 2A94A 4XRRA 2WDZA 3GDOA 2X0NA 3NJ8A 2CUKA 1Y9EA 1VL6A 1EZ4A 3SJUA 8ADHA 3WGIA 4TMFA 3PQEA 1SCUA 3NAQA 4EUHA 4IDBA 2JD2A 5JAIA 3VPFA 4MIYA 1X15A 4MPDA 1T1SA 4F3YA 3IIEA 3GEDA 2BMAA 2I6TA 2YYYA 2R00C 2GR9A 2Z1NA 1GYPA 3IMFA 5C7LO 3D3EA 3DOCA 3WTBA 2VZ8A 3PIIA 4DUPA 1F8FA 1JKJA 1V8BA 5IZCC 5G4LA 1M66A 2NSDA 4UREA 1EDZA 3L9XA 1R6DA 4ZHSA 1YONA 1B8UA 2GF2A 5KKAA 5IG2A 3VKVA 1QP8A 1H6AA 1DEHA 2HO5A 1TVEA 1Q0HA 3H4VA 4FB5A 2BFOA 3OA0A 3OEWA 4C7JA 3HSKA 1JKIA 2O4UX 1LX6A 4NU6A 2ZCUA 5AOVA 4IBOA 4A10A 1ENYA 1Q7CA 5G4KA 1DIRA 3HN2A 3OETA 2Y0EA 3DBHA 5EIOA 1X7GA 2CVOA 1LC0A 3P19A 4E5MA 2PA3A 3OFSA 3D7LA 1A7AA 4IIUA 2GDZA 3RBZA 3OEYA 1EBUA 4II3A 3PYXA 2QW8A 2AEJA 3KEOA 3P2OA 1UP4A 4XQCA 2JD0A 1IOLA 3RU9A 3V2UA 1SEVA 1BVUA 2HDHA 4XQGA 5K6AC 2D3TA 4A0SA 2DFDA 2VRCD 2GCGA 3HDJA 1ZJZA 3I1JA 1K3TA 2DPGA 2BFAA 3Q9UA 5CP8A 4DBZA 1HDOA 2P2SA 3ON5A 5I9LA 3H6KA 1IZ0A 4BKQA 3RQSA 1WW8A 1N2SA 1T2EA 4RPJA 1E77A 3WICA 2PNFA 3L9WA 2CZCA 3TJRA 4YQYA 1ONNA 3DONA 5ADHA 4NJOA 3FNGA 1NQ5A 4CMIB 1JAYA 3GVCA 2ZJ1A 1HSOA 2FOIA 1H5QA 3WGZA 3PJEA 2IODA 4YXFA 2Q1UA 1P77A 4PLPA 3KO8A 1Y9AA 2Y1OA 4Q3BA 5CEJA 2ILTA 4BB5A 4BNWA 4Z0HO 3CMCO 2X23A 5F21A 3DZJA 3BYZA 5U9CA 1P1FA 3CE6A 3L6EA 5K9ZA 3O8QB 3BMOB 2EP7A 3F4LA 4IS2A 4PLVA 5DBFA 3UVEA 3OJEA 3EY4A 4JP2A 4RVSA 3VKUA 3KETA 2ZKLA 2B69A 3ROMA 4RJTA 2FMUA 5LDGA 3LLVA 3M1LA 1HYHA 3S55A 4BO9A 3M6IA 1X0XA 4MKZA 2B4RO 3HWRA 5GY7A 1L7DA 3KYDB 4WCFC 1VKOA 4WLUA 1HF3A 2OL4A 3CXRA 2CF6A 2PD3A 5G0UA 4ND3A 4TRMA 3H9GA 4E5PA 1HYEA 3RKRA 3I9MA 1P3DA 1BDBA 4MJLA 1E3WA 3GZNA 3WGHA 4RF4A 4B8WA 3WGTA 5I7FA 1CRWG 5DP1A 4NJMB 4AL4A 4YYZA 4D3FA 1UXHA 2DBRA 3DBLA 1I33A 4J9VA 1UZMA 4D3SA 3ABIA 4CLEA 1P1KA 3X2FA 2VNAA 3FPLA 5G0SA 4UUMA 1P44A 1JA9A 5DT9A 3CZRA 5C3MA 2YHIB 3B20A 3Q2IA 3NEPX 1DC3A 4GLOA 3JQ6A 1LTHR 4WJZA 1HE4A 3CH6A 3UHAA 4J7CA 4J1SA 1OOEA 3A14A 2NACA 3PRJA 4BO5A 2NQTA 2Y93A 3KSDO 5I8ZA 4XYMA 4LVCA 5GZ1A 4YR9A 2DUUA 1LDGA 3BAZA 3KLMX 4R01A 3ZH2A 4GMFA 2J3IA 3WS7A 1R15A 3RUIA 3WGGA 3KOUA 1J49A 1SBYA 3ZV5A 4XJTA 4OOEA 4B4VA 2AQKA 1R4NA 5T6BA 3UAGA 1GL3A 1ZXBA 4DMLA 3LU1A 4PG4A 5A5EA 2JL1A 4D7AA 2FN7A 1EE9A 2ZQZA 3ZGYA 1S7CA 1NXQA 2YFQA 4H15A 4OH1A 3U5TA 4HKTA 2P9EA 3ASVA 1DLJA 2VOEA 4YBZA 1TT5A 1ENPA 1HLDA 5HM8A 5ICSA 4M86A 4D46A 1GCUA 4NG5A 1E1NA 1RM0A 4CLXA 1K6IA 5TX7A 2VWGA 1DFGA 1XU9A 4OSOA 3WYEA 3ICPA 1DRVA 1ZFNA 1B0AA 2VRCA 3BHJA 3SBOA 1W6UA 4MO2A 4XDYA 2X9NA 4B79A 2EIHA 1LDYA 1R4MA 4J4BA 5CDGA 1VE9A 3LT1A 1EBFA 1MC5A 2GYYA 1I36A 1LSJA 1EFLA 1OAAA 3DMTC 4IDDA 4WOJA 1H9BA 5DULA 3TWOA 4BO0A 9LDTA 5JFOA 1AHIA 1K6XA 3U3XA 4JXKA 3WTCA 3DBRA 4DYVA 4Z3KA 4CLOA 3H9UA 4PLWA 1AE1A 1PGJA 3DOJA 2V6BA 1ISFA 1YH3A 1ZUD1 2Y66A 1W0CA 3T7EA 1Z7BA 3M2TA 2C7GA 2V65A 1GQ2A 1GUYA 1HE3A 1VJ1A 1I3MA 3VOSA 3WSWA 5CDSA 4RGBA 3GMSA 3ZWXA 3WR5A 5JXWA 1EUZA 1XQ6A 1KBZA 4BGIA 4R16A 1KOLA 1NHWA 4D3DA 3KEQA 4ND5A 1LC3A 1O8CA 1ZH8A 2HMSA 3UH1A 3TZ6A 1NQTA 3GRKA 2D0IA 2X58A 4A5OA 3A28A 2YZ7A 4FOSA 5KOIA 3JD0A 4ZQHA 3RCBA 1PWXA 4KTTE 1C1DA 1DRWA 2Y1CA 1ISIA 4YEDA 4BNTA 4RVUA 2NLOA 1Z82A 4N5NA 1EEHA 1T2FA 3UUWA 4CM8A 5F1KA 4BOYA 4GL4A 2R6JA 3PYMA 4B4OA 3NDIA 4WKGA 5A4DA 3HFSA 3GN2A 1F12A 1EMDA 1XHLA 2WMDA 3OECA 3QP9A 4HX5A 4BNXA 3EAGA 4GQAA 2FP4A 1JKFA 3V1YA 2NU7A 4F6LA 3U4IA 4U8GA 1XIVA 1F06A 4W9NC 2AQHA 1DPGA 1W4ZA 3AW9A 1F0YA 4FW8A 4XQ9A 3ZV4A 3MCVA 3DOOA 4CPDA 1DHRA 1NHGA 4J6FA 4NI5A 1YDWA 3TN7A 5A04A 3LDHA 2OO5A 3SX2A 2W98A 3GC6A 4YCAA 4IJKA 5GZ6A 3STHA 3IL2A 2P4HX 1F14A 1WAMA 4M87A 4R1UA 3JQAA 4E21A 1M6HA 5CG1A 3I9KA 3QW2A 5COAA 3NDRA 1YQGA 2O2SA 2VWHA 4MP3A 3FD8A 4B4WA 4B7CA 4BNKA 3RFVA 4O59O 2VT2A 3KYCA 2O3QA 3D4NA 2OZPA 2RHCA 4J0FA 4WNIA 4DIFA 3B1FA 1EUDA 2ZCVA 1LNQA 4EJ0A 3MWDB 3NTOA 4E4YA 4QSMA 2GZ2A 3RVDA 4I9UA 4UUNA 2YV2A 4HFNA 4RVDA 1VL8A 1BXZA 1EK6A 3RBXA 5F3RA 5ICMA 4DA9A 3DBVO 4PLZA 4CL8A 1HETA 5TSDA 1HDGO 1PS8A 4FJ1A 2EW2A 3RIHA 4NJMA 1UJMA 4R9SA 1B3RA 3MWEB 5I8WA 2Q45A 3OQBA 2AHRA 3K8ZA 3FTNA 1EQUA 4J1TA 1VJ0A 4UEJA 1BGVA 2BELA 4KWHA 4Z0TA 1ULUA 4MVJM 4JROA 3WFIA 3ZZNA 3E48A 3JCZA 2POQX 1SO8A 2Y68A 5T8KC 3CSDA 4GAEA 3ZHYA 1KC3A 4WLOA 4PLCA 1I0ZA 3C24A 3JYLA 4D0RA 3UCFA 3DHYA 4D41A 4GX1A 3PFFA 4Q3EA 2NNLD 1JN0A 2CNBA 2FR0A 4CMAA 2LDXA 2X22A 4BNIA 4YQZA 3N7UA 3UW3A 1LSSA 1L7EA 4JBGA 3QWIA 4IQ0A 4ZQBA 1Q0QA 4B7XA 4TSKA 5BQFA 4DIOA 3A1NA 1CQIA 3NYWA 4ALKA 3ZI0A 5CAEA 2IYPA 2A92A 2DBQA 5B4TA 1YS4A 4NZ9A 1EVZA 3TQHA 1JVBA 3ONEA 3DFZA 1DIHA 4CUJA 1R66A 1AXEA 4BUCA 2QIOA 1HRDA 2VYVD 4P38A 2Q4EA 4UEOA 1PL6A 1JU9A 4J49A 2IRWA 4NU5A 4M1QA 2AG8A 3DQPA 3RFTA 3AI1A 4E2WA 4BO7A 1H2HA 2UUOA 3G17A 3HB4X 3PHIA 3RBVA 2EJVA 3JQ9A 3PLNA 4GPD1 1P1JA 4L4XA 3KUXA 1P45A 4OMUA 3QLJA 1C1XB 1N1GA 2FZWA 2GGSA 8LDHA 3GN1A 1IUKA 3ROPA 4BO8A 1E6EA 2C7VA 4DGSA 1H6BA 5IXYA 4LMRA 2AEMA 1FDUA 1N9GA 4P4GA 2C2XA 4KDFA 3WYCA 3GR6A 3L6DA 3MOGA 3WG9A 3U09A 3GHHA 3IC5A 5BR7A 1GDHA 5JBIA 1U7HA 4MIEA 4S3MA 5L4NA 3ZU4A 2O3RA 4ID9A 5JW6A 3GVIA 1ML3A 4UVIA 4K6CA 1GY8A 3GA0A 2VHVA 1TA4A 1IYZA 4O0LA 4ZJUA 3MZ0A 4PZEA 1XR3A 3ZDFA 1T2DA 4RQUA 3RC7A 3CPSA 2BD0A 2Q46A 3ZWOA 5L4SA 1UUFA 4HFMA 2CVQA 2PD4A 4E0BA 4LRSB 4WLNA 4YJGB 3SC6A 4S1VA 2G5CA 2R2GA 4AJEA 3NTQA 4H7PA 1ZK2A 2PTGA 3RUCA 1E7MA 1E5QA 1BRMA 3AJRA 1E3SA 3AM5A 2HMTA 4PLFA 3B70A 1P1RA 2D4AA 5F5NA 3ZCXA 4D43A 4Q9NA 1CETA 3GUYA 4YAJA 5JAQA 4IDCA 4PIVA 4CLOB 2SCUA 3JQDA 1HKUA 1D3AA 4BNJA 4XGKA 2YHUA 1ARZA 3GAZA 4J2OA 5EQFA 1QSGA 4TVBA 2C29D 4CM8B 1TEHA 3JV7A 4WE3A 4ZRMA 1HDXA 1TI7A 2RHRA 2YV1A 5U4QA 7ADHA 2E49A 1EK5A 1HZJA 2ZTLA 3ETGA 3RKUA 2EHDA 4AJJA 5DN9A 1QMGA 1WMBA 2VN8A 4YA6A 3IQDB 1V35A 4BMNA 5B4VA 1XLTA 2QX7A 1VC2A 1NWCA 3I83A 2GERA 2YDYA 4ONEA 3W4IA 2BGMA 1I2BA 5BNFA 4CMEC 4HFRA 3JQGA 1ADBA 5K0ZA 4CUZA 1OC4A 3ULKA 4DBVO 4IS3A 5IZ4A 5CPFA 3RWBA 4RDIA 4K26A 1WXDA 3HG7A 2WWRA 4N5MA 3WQRA 3K96A 2V6MA 3E03A 1I3KA 3WNQA 1C1XA 1ENOA 2Y05A 4DL9A 3WDSA 4XYGA 5JDIA 5DCWA 2V6GA 1YJ8A 3HE3A 4JNKA 4JGBA 3N74A 4K28A 4CM1A 4CR7A 5I9MA 1N7HA 5CG2A 4OM8A 1IZ9A 4BNHA 1Y7TA 5TRTA 4FFMA 1DIBA 3GY0A 5BSFA 3ZNPA 2BH9A 2ZTVA 3GNQA 3R0IA 3I52A 5JY6A 1FF9A 4ZQFA 4GKBA 3JQAD 1ZJYA 4LSMA 4IZIA 1LRLA 1Z45A 4BL5A 4A7PA 2Q2WA 1T2CA 4N54A 1LEHA 1U3TA 5L7YA 2C0CA 1KVQA 1NNUA 2AXQA 4C4OA 1BSVA 3X2EA 1U8XX 1WDKA 1ADFA 5EJ2A 4DREA 4TRJA 1OI7A 5I7SA 3AK4A 5A9SA 4FFPA 4XA8A 1IULA 3K30A 3MJCA 3ZU3A 2EW8A 1H9AA 3PHGA 4NBWA 3QVTA 1X7DA 1ZSNA 4YT4A 2G76A 2VQ3A 3PHLA 3L07A 3L4SO 2NU8A 3INRA 3KV3O 3MJTA 4XYBA 4YB8A 3VZQA 1OFGA 3I9OA 4I5DA 4I5EA 4JJFA 3UCXA 4XR9A 1X14A 3W6ZA 5ILOA 2JCXA 2Q1SA 2X6TA 4R51A 3ZWBA 3H8VA 1UZLA 4PCVA 2HCTA 1Q7BA 1UDCA 3GQVA 4G65A 3E1KA 5EMHA 3S2GA 1ZVMA 1SOWA 3KYDA 4RVFA 5A03A 1PJQA 3TFQA 5HWSA 1PJTA 3U4DA 4IXWA 4R1NA 4EGFA 3CTMA 4FQ8A 3WIEA 4KDEA 5FI3A 3C3XA 5C7IO 1RYEA 4O63O 3BTUA 4R5HA 3GLQA 3JTMA 2BI7A 2ZB4A 3EW7A 4Q3CA 1D1TA 1JW9B 2X86A 1VSVA 3VPSA 3KYCB 4IJWA 3Q11A 5CEEA 4WASA 4ESOA 2I99A 1PGNA 1R4MB 5TGDA 1YXMA 3WJAA 3PK0A 1BWSA 4OJNA 1VLLA 1QYWA 3FWNA 4RF3A 2NQ8A 3IJPA 2EV9A 4JP3A 4LISA 3FR7A 5KJEA 2YHIA 3COSA 4NFHA 3OIDA 4P8RA 2FZEA 2X9GA 4OSPA 1ENZA 4OHUA 4XJSA 2O48X 4WLFA 4CV3A 2ZIZA 1TT5B 1NAHA 1T26A 3ORFA 1LDMA 5JCXA 1LRKA 1R0LA 1GUFA 1E7RA 1E1LA 3EZYA 1V0JA 3K5PA 1B8VA 3MJ4A 1MC4A 1NBOA 2B83A 5G0TA 3TZCA 1QKIA 2WM3A 4ZRNA 1Q0LA 3TL3A 1PR3A 1X7HA 4BIIA 1LDNA 3DMYA 5KVSA 4K6FA 4FCCA 4CMJA 5AYVA 3D5TA 3DZFA 1SPXA 1M67A 1NPYA 4LCEA 3C8MA 4FD3A 1UH5A 3DAGA 4PVDA 5A1TA 3I3OA 4HUJA 1U7TA 4Y6PA 5TF4A 4XR4A 3GG2A 3KRTA 2JD1A 4OOFA 3AUTA 3KSZO 2QG4A 4NK4A 4EW6A 1FDSA 3OBBA 1H6CA 1OBFO 1LI4A 4J2HA 4RV9A 1JWAB 1TLTA 3EYWA 2BFMA 1K89A 4MP8A 3OMLA 2P9GA 3FTPA 4WEOA 1D8AA 3CUKA 1EFKA 3LT4A 3AM4A 2DU8A 4NR0A 4PZDA 1LDBA 2F1KA 5BNTA 5JY1A 1FK8A 4D79A 4E5YA 1U3UA 4RZHA 4Z0PA 2ZK7A 3AM3A 3E8XA 3PHJA 4CMGA 4AJ4A 1C0LA 1PEDA 2EP5A 1W73A 4E32A 1ZMTA 2DKNA 1SNYA 5ILGA 3GFGA 2P91A 3L4BA 4WNCA 4QEDA 5KCZA 1I30A 3NGLA 3Q3CA 5KNLA 2V7PA 1KVSA 1ZEJA 4M8SA 3M1AA 4WCFA 1F8GA 2JCVA 2A4KA 4FFOA 1GU7A 2QZZA 1BTOA 1P9LA 1QV6A 3DC2A 2X0RA 3CEAA 3OICA 3PQFA 4KZPA 5HRUA 1XCBA 4L76A 1YQDA 4OGWA 4YJFB 3W1VA 2ZATA 1BMDA 2X5JO 1KC1A 3AOGA 1NTOA 3PIDA 3O26A 1Q2XA 1LLCA 4AJ1A 1E7QA 2VYNA 3U0BA 1IPEA 2DAPA 1E92A 4E5KA 3ZN2A 4TKMA 2QYSA 3F46A 5JCJA 2OHXA 4RLSA 2GN8A 5G4KB 1MUUA 2G17A 1I32A 1ZK0A 1I8TA 1Z74A 2WTBA 2NTJA 1R16A 2HAEA 4GI2A 4ILKA 4K1LA 2PKRA 2FSVA 2GO1A 1YGYA 1GPDG 2WE8A 4L0QA 4B4UA 5ITWA 4BQPA 4XB2A 4OQYA 4Q3DA 5IN5A 3TOXA 1BXKA 1KY4A 3BTSA 3GGOA 4CR8A 1LBEA 4DQVA 1EDOA 1H2BA 4KMSA 4LW8A 4QTZA 3RU7A 4ALIA 3C1AA 4BQRA 4NFSA 4BV9A 3HADA 2EGGA 1TT7A 1U3VA 4ALJA 3I4FA 2X9VA 3WGQA 1V3VA 5B12A 4Q3NA 5JNLA 4BNYA 4GH5A 1E1KA 2JJYA 1P0FA 1PJ2A 2CMDA 3GMDA 4E2ZA 5MGBA 1UXJA 1FDVA 5HA5A 4AJ2A 5ES3A 4QECA 1MB4A 2I65A 3ZWPA 1XEAA 4RF2A 4BGVA 4L75A 3LK7A 1VSUA 2D5CA 5A06A 3ZV3A 2EG9A 4QO8A 1B14A 3GGPA 4GGPA 4EUEA 2J5QA 2EGHA 4BO3A 4LRTB 3JD3A 3ENNA 4BVAA 1A4IA 2C07A 5H83A 1O94A 5IN4A 3RROA 1BVRA 1ZCJA 2YUTA 3MTJA 3VTFA 4BNNA 4Z9YA 1Y8QB 4AJIA 3MJVA 4KUGA 3NUGA 2W4QA 1H6DA 1GV0A 3EDMA 3DZHA 1QG6A 4ZQEA 3RUEA 1XKQA 4YJHA 4B8ZA 3QY9A 4Y6SA 1M75A 3F5SA 3ITKA 2C2YA 4OL9A 3K2BA 2WD7B 4L73A 3HUDA 1DC4A 2W8ZA 2ZYGA 4NIMA 2EEZA 2VWPA 3OJOA 2GNAA 3K9QO 4OIMA 3H5RA 3RAJA 3H2SA 4RQTA 3DDNA 4CUKA 4DC0A 1WZEA 3DO5A 4DXHA 3ZNOA 1RWBA 2JCYA 3CZMA 4FN4A 2IEDA 4E33A 3ZNNA 1NWHA 4NBTA 3IP1A 5AXBA 3IAHA 4GVLA 4L4SA 3FSRA 5IXSA 1DC6A 1HWYA 1Y1PA 5JDCC 3VH3A 3TF5A 1ADGA 3TPCA 4AVYA 1U4OA 2Q2QA 2H6EA 5I9NA 4OXKA 3G1TA 5JDIC 3EZLA 2HU2A 2Q1TA 3C7CB 3UCEA 3D4OA 3O8QA 4RZIA 5KVQA 5T8KA 4R3NA 3W8FA 4R69A 3I9JA 1B16A 4W7IA 5FF9A 1PIWA 3VPGA 1R0SA 1WZIA 2CSUA 2PV7A 3KSUA 3WQSB 4ZN6A 4XKJA 5BNIA 3VZRA 2YQ5A 3ZW8A 1U2DA 2PY6A 1E1MA 4XIJA 2WJPA 3DEYX 4BKRA 2F00A 5IF3A 3CKYA 3GFBA 3F1KA 4WUVA 5T64A 2TMDA 1UXKA 5FFFA 4XWYA 3ITDA 4Y67A 4J7XA 1F17A 2BRUA 4P22A 4NBVA 3UN1A 2AW5A 4AG3A 4JN6B 3BMCA 3K31A 4PRLA 4YWJA 2D2IA 4AICA 3K73O 4IUYA 4ZVVA 1NFRA 2X5KO 4YTEA 5L7TA 5CEFA 2VNSA 1PTJA 3SVTA 2WYUA 4LGVA 1WDMA 1PZFA 1DBVO 5KVVA 2Q49A 3JQFA 3BTVA 4TROA 5ER6A 4N5LA 3WWYA 1HL3A 2NTNA 3NJ4A 3ANNA 4YAEA 4IMPA 3ADOA 4WLEA 2XF8A 1XELA 3EGOA 1J4AA 2FY8A 2CY0A 5JPIA 4C7KA 3KVOA 4XGNA 2AG5A 3I9LA 3QA9A 2OGUA 2E6UX 4JIGA 3G0OA 3TZHA 1FXSA 2EERA 3UICA 3ASUA 4ND2A 3U4CA 2PWZA 1ZMOA 2OMEA 3F6YA 2WYWA 3PI7A 4HWKA 4MOWA 4IQGA 3TZQA 1B3BA 2H63A 4PLTA 3PZRA 3AWDA 3H5AA 3GK3A 4CQMB 2A9FA 4U6QA 3W4JA 4JQCA 2PH3A 5IDXA 2Y1GA 3DZKA 1WPQA 1SZJG 1D1SA 1J5PA 3GZNB 4KQWA 4RVGA 4A27A 4UUOA 4E6PA 5DF1A 2JAHA 1A5ZA 1H94A 3QVWA 5L40A 1GAEO 4J16A 2B37A 3HDYA 1LRJA 5KWEA 4IM7A 2ZJ0A 3JQFC 1IY8A 3PWZA 4KUHA 4OXYA 4Y6RA 3U9LA 4EEZA 3F4BA 5U1PA 3AFNA 2B0JA 3JYNA 4OKIA 1XDWA 5EESA 3D64A 3P5SA 2FRDA 4YT2A 4R1TA 3GNSA 4TKLA 3GF4A 3ETDA 1SB8A 3G1UA 4WCDA 3GEGA 1IHYA 3WYBA 3GOHA 1MFZA 1A4UA 5KVCA 4CMHA 4J7UA 1PJCA 2W2KB 3JQ7A 4CM7A 3TSCA 3IOYA 3VHRA 3ZV6A 4J90A 4PVCA 5AVOA 5JMPA 5JO0A 2RIRA 2TMGA 1WLYA 2VHXA 1LXCA 4J91A 1QYVA 2HSDA 2CFCA 3INGA 3IS3A 4YRBA 4FC6A 4DPKA 1E0DA 3D0OA 5IAAA 1NYTA 5AXDA 2ZYAA 5GMOA 1PQWA 3WLEA 5F5LA 2IDZA 1KVRA 2DM6A 1EVJA 5T67A 3ZWWA 3OM9A 4LSWA 5JCJD 2NU9A 2Q1WA 3SJ7A 1ADCA 1C0KA 3W8EA 1Y5MA 4B3HA 2PD6A 4A26A 4O5OA 4ZGWA 4IGFA 3C7DB 3Q9NA 3WX0A 1WNTA 3I9NA 1LQTA 2IZ0A 1MFPA 1AHHA 4LMPA 2NV6A 2CVZA 4E3ZA 3Q2KA 4Q3AA 3LLSA 4NH4A 2O3SA 1YOVA 4KTVE 1GFSA 2OBNA 4FFRA 4QUKA 2X7HA 3ETEA 2P9CA 3GAFA 3DHNA 1DJNA 1YJQA 4A2CA 1LSOA 2CDCA 2JHGA 4G2NA 1E7WA 2BI8A 3SXPA 4E2XA 3NDJA 3UKOA 5EN4A 2X5OA 1QYCA 2WE7A 1U5AA 5T5QA 3RSHA 5CDYA 3IUSA 4CM9D 3FF4A 1G6KA 3LSYA 1I5RA 1N7GA 3DBHB 3A06A 2UYYA 4UEKA 2XPCA 2VWQA 4CM5A 2PZJA 4BKOA 3RJ5A 2AE1A 3ZWNA 4J4HA 3WLFA 2A35A 1EVIA 4XZ3A 3QVSA 3JQGB 2GZ3A 3PYLA 4UUPA 2OORA 4J43A 4Y8VA 1RPNA 4J0EA 1IHXA 4BMVA 1C0IA 4IY1A 2VCYA 1YB4A 1GD1O 3RC2A 3DAPA 4GVXA 2FPIA 2C5EA 4DRYA 1ORRA 1Y5RA 2BHLA 2VZ9A 4FJ0A 3V2GA 4CQLA 2VHZA 3F3SA 1DJQA 4IGEA 3FNHA 3E9NA 2EJWA 1Y8RB 4A03A 5LC1A 3DTYA 1HSZA 4W9NA 4L74A 2B4TO 5AQ1A 3P2YA 2XXBA 2O23A 1H0KA 3KXDA 2JKVA 4QO7A 3OH8A 4OXNA 4IDFA 3V1TC 4MIOA 2G0TA 2HMUA 3EC7A 4GX5A 5EINA 1LLUA 1A7KA 2RCYA 1I01A 2CD9A 2Y1FA 3FRJA 3TL2A 4I5GA 4B3IA 3ZU2A 4JX8A 1ISMA 3FR8A 4WOKA 2VTEA 2YV3A 2OFPA 5JE8A 3MEQA 1V3UA 4IJUA 5TT1A 3JYOA 2W2LD 3RC1A 1PJSA 3GG9A 4YAKA 3KTDA 3LC2O 5L53A 4J3FA 1MG0A 4NQZA 1NQOA 3PDUA 4ALLA 2HMWA 2BKAA 4XGIA 5EERA 4CV1A 1WMAA 4GSLA 4EZBA 2QHXA 2AA3A 4E12A 1IE3A 2JFGA 4EDFA 5J23A 3KZVA 5H81A 3DZGA 5KJFA 5JMWA 2B4QA 5DOZA 2DBVO 4UULA 4QT0A 3O4RA 4TRRA 4B7UA 2ZTUA 4FR5A 1CQJA 2XAAA 3BHIA 1E3IA 3B1KA 4RVHA 1I10A 2HK9A 3WBFA 2FWMX 1KY5A 1XSEA 2EXXA 2ZTMA 3HZZA 3WBBA 4XEHA 2WD8A 4R1SA 3IUPA 3JYPA 5CHEA 1XWFA 1IPFA 3PQDA 1O9BA 2GN9A 3K2EA 5F1OA 1P1HA 4UVEA 4BMSA 5DNAA 3JSAA 1MLDA 1ONOA 1ZXLA 5F1PA 1A9ZA 3C7AA 1N8KA 4TWRA 4GGOA 4BNGA 4RCVA 4BNVA 1GQYA 5ENVA 1ISJA 1CJCA 4ALMA 5DCUA 4U6SA 1EVYA 4H3VA 4CM4B 5JDCA 1YBMA 3H9QA 3DB2A 1PS0A 2ET6A 4RLHA 3OJ0A 4N18A 2PKQP 1CWUA 4IMRA 2Z1MA 1YL5A 3Q1LA 5A9SB 3G49A 1RM4A 2D1YA 2PR2A 4YVFA 2AQIA 3QIVA 3IKTA 3FCOA 3NX4A 4CQMD 2J5KA 3OQ1A 3BMOA 1KEWA 2JHFA 1CERA 2I76A 1PSDA 4PLHA 4WK6A 2DT5A 4CLHA 2GPTA 2JFHA 4CLRA 3JD2A 1ZBQA 4BV8A 1IB6A 4ND1A 2PGDA 3AY7A 2NVWA 2AQ8A 4UAGA 1T1RA 4FSHA 2NM0A 1NFFA 1JVSA 3FNFA 2E4AA 4BNZA 3U4HA 2O2YA 3AOEC 1SEPA 4OYRA 3VC7A 4NMHA 4L4RA 2VYND 1Y81A 2Q2VA 1T4DA 1N9GB 1DC5A 3JQ9C 1SAYA 3LC1O 4IDAA 5CDTA 1B26A 3UXYA 1KS9A 1QLJA 3F9IA 2RBEA 2ZYDA 3QE3A 4R3WA 1O0SA 1LQUA 4R41A 1DRUA 3FI9A 3L77A 2OUIA 5JYDA 4Y9DA 4UVHA 2GASA 1DDOA 4XDZA 4JJGA 5TC4A 4F46A 4LVUA 1YKFA 2PK3A 2QQ5A 3F1LA 3LVFO 5ER9A 4YJGA 2CF5A 4YJHB 4FJ2A 1LSUA 1GZ4A 3FPCA 4TZTA 2WSBA 3E5RA 4U7WA 1PR9A 4FFLA 4WECA 1MP0A 4JBHA 2O7SA 4J1QA 3RASA 1H93A 1YDEA 3NRCA 1VKNA 3H2ZA 3EVTA 4NDNE 3WJ7A 1BXGB 1R37A 4FBGA 1BW9B 2NU6A 3QVXA 5L7WA 4MVJI 3VAZA 2YY7A 4QX6A 5FI5A 5KJ1A 2X8LA 1PX0A 4XX0A 4BHTA 2HUNA 1KEVA 3S2IA 1PU2A 2WYVA 1VJTA 1KEUA 2W90A 3DMTA 1J0XO 3LF1A 1GADO 5HBRA 1QV7A 3QWAA 4P4LA 4CMKA 1K6JA 4J1NA 3WMXA 1O6ZA 4KP7A 4FOOA 2E82A 1E3LA 2W2LA 3KYBA 4RPGA 4JBIA 3W4KA 5DZSA 1RM3A 3JQ8A 6ADHA 1Z6ZA 3OF2A 4M55A 1GEGA 1PJ3A 1OC2A 2WD7A 3AI3A 1O95A 3NT2A 4EUFA 1BDMA 1FDWA 1PZEA 3TZKA 4BB6A 1JAXA 1R12A 3B6ZA 3R1IA 5LDHA 3IDSA 3PTZA 3AOEA 4DIBA 1EUCA 1CIVA 1JWBB 3QVOA 4E30A 5HS4A 5I7VA 1GTMA 4PN3A 2DTXA 1HDZA 5A3VA 3VTZA 2H9IA 1A71A 1MV8A 3QWBA 1X1TA 4ALNA 2PH5A 4YRDA 1DOHA 1KERA 3K6JA 5DCYA 1B2LA 3PWSA 1C1DB 1PL7A 5DP2A 2CDBA 1DIAA 1UAGA 4YJFA 2J6IA 4DMMA 4I9NA 4EBFA 3PJGA 1DIGA 1HXHA 1C0PA 1UDBA 2EKQA 3EK2A 1JQBA 2UAGA 3SC4A 3PVZA 1U9JA 1T24A 3WMWA 1E7YA 2B35A 1VRWA 2FPPA 1XA0A 1YVEI 1GR0A 4GMGA 1WVGA 2I3GA 4WCFB 2FHSA 5L95A 2OP1A 1PL8A 3VVCA 2EF1A 2H5LA 3H5NA 4EJ6A 2NVUA 2Z5LA 3VZSA 1N1EA 1VL0A 3NV9A 3GPIA 4AJPA 3BMQB 1HYGA 1VI2A 4MVJA 4ITUA 1HE5A 2Q99A 2GRAA 1YE3A 4DLAA 4EYEA 4W7HA 5EQDA 5B37A 5L9AA 1X0VA 5EPOA 3V5NA 5HTOA 4BO4A 1ID1A 4I8XA 2IZZA 5JYEA 3C85A 4BO6A 4RL6A 1HZZA 3PZBA 1U8FO 4ZICA 2ZB7A 3IP3A 4PG8A 5FEUA 1EQ2A 1NVMB 3Q0EA 3PEFA 5TJHA 3BMNA 1OMOA 2DTEA 3HQ4O 1E6UA 4R68A 1KIFA 4MVJF 4U0KA 4DC1A 1GEEA 5BSHA 2Y99A 1BW9A 3PDJA 1D4FA 2FR8A 4RPHA 4HY3A 4MKXA 3JQBA 3L0DA 5I7EA 3CMMA 5HS6A 5K6AA 3WWZA 4M89A 5COQA 1KETA 3FBTA 3ZWMA 3AU8A 4L8VA 5T57A 1AUPA 3I6IA 3L4BC 1UP7A 4OO3A 4UVDA 4BNFA 3PJDA 2PKQO 3AUUA 1LA2A 3PJFA 4NHEA 4YT8A 1QYXA 4W6ZA 3T7CA 2W2KA 1DAPA 1YRLA 3JQ7B 4PFJA 3VDQA 2QRJA 1ZSVA 4FC7A 3OIGA 3PP8A 1U4SA 1Z75A 1HT0A 9LDBA 1P1IA 4I1IA 3DR3A 3WGOA 4NBRA 3A9WA 1YQXA 1ULSA 5DBIA 5KJ6A 1B15A 1G0NA 2IZ1A 3GGGA 4PRKA 1HLPA 1E6WA 3P7MA 3BIOA 3DHEA 4ND4A 5C7OO 4BGEA 3W8DA 3GNTA 3W6UA 3UOGA 4CJXA 3BMNB 3KM0A
chains in the Genus database with same CATH superfamily
4YPOA 2VOJA 3DVSX 3KQHA 1OBCA 1XXHE 2TMYA 1UQUA 3FSGD 1XL1A 3DFUA 4AKSA 1CZRA 4FCWA 4ZREA 2OPHA 1I24A 1R8QA 3BJRA 1HLGA 1VCHA 3CWCA 3C6YA 3O91A 3IHWA 4OPMA 2GQ0A 3LV8A 1Y4DE 3OTQA 4J03A 2PZLA 2XOKD 4DPLA 4M0KA 1R5BA 5HF5A 2YZKA 4LXYA 4PS0A 5K5EA 1T10A 2G0AA 2N75A 5DE3A 4BS9A 2EBFX 1JG7A 2HRZA 2R6ZA 4E1BA 3K1TA 3NWEA 3ICVA 3OCUA 1N5MA 4GPZA 2ECFA 2ZYVX 1PWHA 2HRBA 3E9EA 3NR2A 4J4TA 3WRYC 4B1FA 2JS7A 4Q48A 4HSEA 1ZCBA 2DFVA 4AUNA 3GLFE 4FI3F 2A0YA 4HAYA 1E4OA 1UBEA 1T5SA 3B1JA 4J0DA 4AURA 2D7CA 2NSYA 3FCCA 4DZTA 3LOQA 4E09A 2R8ZA 4BMYA 1CHDA 3GBVA 5NLLA 1L5KA 3OKCA 4PX2A 4RIEA 2F3RA 1DP4A 1A76A 4CYMA 4B80A 1PGOA 2OHIA 5C51B 1RQNA 3NS7A 2NYAA 4AJNA 1Z6TA 4JA2A 4S05A 3EGCA 5CT6A 1GZ6A 2FPUA 4AULA 5CB6A 1AGXA 2FEWB 2J9RA 1TYEB 3ROZA 1O5IA 4MHOA 2J0SA 3DE2X 2WEKA 3CR7A 5L4LA 4W5WA 5DBGA 4F96A 3OJLA 2BEWB 3QOXA 4Y2XA 5H3HA 3U3JA 1RWKA 3C3DA 1PZHA 3KJEA 4FHGA 4Y1FA 3QUQA 4YI5A 3RFXA 2DUWA 1JDVA 3REQB 3LQFA 3P9QA 4GZMA 1CEQA 2C2MA 2ZRAA 2BLLA 1BMQA 1P6UA 2HK7A 3SLGA 2IZ5A 4MI1A 3CPHA 1VP3A 1MRNA 3BKWA 4Q16A 4CKYA 2ZSHA 2XNKA 2JEZA 2B92A 1NXVA 4N8EA 1XRRA 3LT5A 1L0BA 3WMGA 3ZWAA 5JAZA 3PLRA 4A9AA 2Y92A 3RUPA 1NVGA 3SLKA 3UJDA 3MM4A 3SR3A 3WRVA 4PG5A 4BNMA 3K6RA 3DF9A 3DWFA 4JLUA 3VPHA 1GFZA 1K5HA 4XCVA 2Z5GA 2DC1A 2QG9A 4FGSA 3HJHA 2NADA 1OSNA 1CY7A 1J2JA 1NW4A 3IPAA 1NBMA 1ZD1A 3BWCA 5AXCA 2YJ6A 4EO7A 1E18A 2KE5A 3MBKA 3K1ZA 4HH3C 4NBKA 3TLGB 3OP4A 1HZZC 2QRUA 4LOLA 3F9CA 2Q4OA 1FNNA 2FXIA 4MVJP 1W25A 3PXXA 3T95A 2LR0A 2DLDA 3TI9A 4XPZA 5CFMA 2SBTA 2W2QA 4YHBA 3MD9A 5TY0A 3ROXA 3TW0A 4QFCA 5C1DA 3T3NA 4TZKA 3USCS 1RZVA 4JHXA 4ZO6A 1Q1NA 1ZIDA 2C4VA 4HLCA 4TQAA 1BHO1 5KYWB 5A5FA 3CX7A 1C4KA 3VNQA 1NYQA 3ZWYA 1M6WA 1O97D 3N53A 4LTDA 4G1CA 4NK5A 3BE4A 4UXIA 4GKVA 3EXEB 2GSDA 1VE3A 1UOQA 2QI9F 3DCIA 3L7DA 5A02A 1AO0A 2OTCA 5AFSA 1XYVA 3JQEA 4W99A 4K0KB 2P5YA 1EE2A 1TZ2A 4BVGA 1IVYA 4XB1A 1W36B 1EVEA 1EWQA 3MBIA 1ABEA 2R86A 3GVHA 3NTRA 5HE9A 2FPMA 1KP9A 2R8RA 3F5MA 3MIIA 5HS4A 1BQEA 2GTHA 4PGMA 4MYSA 3FTEA 5EIFA 4Q15A 3UUGA 3KBBA 1KMMA 1G7SA 1E98A 3FN4A 3DAFA 2P5UA 3RVBA 1ISPA 4GPIB 4S1OA 1YQUA 3V7YA 1L7QA 1WUHS 4PY2A 4XEUA 5BXQC 4N3GA 2B7CA 5BVHA 2OV1A 3TOZA 3A1EA 1NVTA 4TKZA 1CUXA 1SCDA 1VHDA 2Q5JA 3VR1A 4F6CA 4LHWA 2D2XA 1PHRA 4FZRA 4B46A 5KTNA 1JPJA 2EKPA 3DCJA 2BZ0A 1MQ8B 2X4GA 3D1VA 4FDLA 5B1DA 2GZHA 1SA0A 2Q29A 3P9NA 8OHMA 1S0UA 2VH1A 2O3JA 4BB9A 3QWHA 4GWKA 4ZMSA 3KLPX 1EG7A 1HE2A 1IUNA 1UKAA 2FEKA 4JJAA 2H5JA 1D6NA 3DTTA 4KRYA 4ZVKA 5G0VA 1YDMA 1ZVKA 2DPHA 4IHJB 4IVNA 2KX7A 1AXGA 1JG4A 1KDZA 1GPWB 4U2CA 2ZDHA 4HBGA 5IEJA 3VO1A 1H2XA 3KX2A 4E6EA 5IPFA 2PCLA 1S89A 3SY8A 5JZ9A 4G36A 2P3SA 1LPPA 2XA1A 4QHSA 3I42A 2ZS8A 4H7DA 2YFHA 4MDHA 5CAEB 5EJ4A 1W7AA 1NR1A 4HNGA 1GUZA 5BSEA 2J9FB 2VAPA 1I4LD 2WU4A 2AS0A 2CL5A 3QFHA 3JYQA 4AJOA 3HCNA 2FKNA 3IR7A 2KPOA 2FF5A 1J2TA 4G81A 4KVFA 3NTVA 4RELA 2ZJBA 3WQHA 4A8JC 4BVBA 3H3FA 1KRWA 2ZYIA 1U0RA 3PC2A 4AZ3A 2QU7A 4WY5A 2B7LA 3SF8A 1SPBS 4TVOA 2AJ8A 3ZGLA 3P4YA 2W6MA 2HCJB 4HGPA 2ZAOA 4QPNA 4RDHA 3X1XA 1RC8A 4JSTA 2ZE6A 4A5SA 4JJ4A 1P6XA 1A72A 2B5WA 2ODEA 1SVMA 4E5NA 5EL0A 3RABA 2PUFA 2FYTA 2PL9A 3G2NA 1DTWA 2QR3A 1Q74A 5A05A 1LU9A 3VZCA 2DWQA 4LK3A 5A4JA 4ZYWA 1V6AA 2FW7A 3GT0A 2OP0A 1NPTO 5A9TA 1NNI1 2JAUA 1UEJA 3JQCA 1G3MA 1YB1A 1O87A 1CUBA 1P8AA 1WF6A 3RTEA 4KIUA 3UXEA 1OW3B 4WESB 2PFSA 4D42A 1GNVA 1MXHA 1CY6A 2E55A 2OO5C 3M6VA 1FNCA 3STWA 4IDPA 2VXBA 4OQXA 3MW8A 3GARA 3O38A 5F64A 2GPJA 3T4XA 4BECA 1WKVA 3IESA 1Q7TA 3KJNA 3RQIA 3EXFB 1MOPA 3FWHA 2Q50A 3KOWA 1XMIA 4HTFB 1YS2X 3MJSA 2NU7B 2R65A 4DWOA 3TFWA 3SXJA 3MJEA 1SUFA 4BTVA 2BOVA 4N8DA 1LFAA 3KJXA 3FGOA 1M5TA 4X85A 2I3DA 1D7OA 3P5BA 3JQBC 1P81A 3SEZA 3H13A 4B3FX 3D3WA 5CJPA 4EMUA 4MJXA 2CB9A 1JALA 3QVLA 2O3TA 3GCWA 1QAOA 5IP5A 4FE3A 1W19A 2Z2XA 3KBOA 1JEYA 4FCVA 4IJMA 2UUPA 3IILA 3HHPA 4DBLE 1N0HA 3M5PA 2GZ1A 2DULA 4XE5A 4KBYA 5GONA 1O89A 3D2CA 3ZUGA 1T0UA 1MAHA 2OYRA 2FFRA 2ID7A 1PGQA 2O8CB 4IEFB 1K0UA 3ETJA 4GBJA 3PQ7A 4IDGA 1AIPA 2B20A 3UWOA 1I5EA 1H3EA 3DCYA 4CE6A 1U2GA 2CYBA 4AJHA 1AMNA 2R47A 3NGXA 1IAQA 2E89A 4ZI7B 1R0KA 3ZW9A 2EWVA 3KDPA 4IZOA 3D6MA 4YY3B 4K46A 4D3XA 3OTOB 5C7YA 2Z3WA 3GI1A 1YZYA 2LDBA 5THQA 2BT4A 2ZRQA 3CLVA 3JQ8B 3RUAA 1PJLA 4NG4A 3TEJA 4CR6A 4DSNA 3NIWA 2EARA 2VXYA 3KHUA 5A2GA 4R4JA 2RBGA 3RUHA 1OYWA 1Z4NA 3R3SA 3LUDA 3DBRB 1MA0A 3H9JA 1M2WA 1NX6A 1RJ9A 3N6XA 2XUIA 3UYKA 4Q9IA 2Z3VA 1N0UA 1LLDA 1NL3A 3CEHA 3PUJA 1ONPA 2ZI9A 2ZUVA 1KF0A 1ZA2A 2QRLA 2B82A 2F7SA 2LIPA 1Q57A 1BHSA 3FJOA 2YOGA 2PLAA 4NCIA 5CXXA 3LHFA 3NIDB 2X6QA 1UAYA 3P4UA 2WM8A 4BX3A 3PPIA 2B5VA 4UZSA 2K7FA 2C4WA 2E85A 2DQ4A 3I8OA 1TYCA 3LY8A 3WKBA 2XUFA 4CMCA 2RKBA 3EW9A 3Q7SA 4NNJA 5SY9A 4BZPA 4ENSA 4DSAA 5JTUA 2EW1A 2X13A 1KVUA 4C0BA 1WCIA 1E2NA 5HW0A 2AC4A 1BKYA 3HACA 4OF4A 3DDCA 5EUCA 3ZY2A 4E1VA 4PEVA 3V80A 3AHHA 1MIOA 1OTHA 2VXCA 3DZDA 4PX3A 5K8JB 5I5EA 3TDKA 4ZIRA 4BJ3A 2G9VA 4ETMA 1XNJA 4FHEA 2ORIA 2WZQA 1HQYE 1MW9X 1QZUA 2C2OA 1P31A 2GPYA 4GWGA 4WSOA 1HRKA 3PGMA 2D5BA 4TVKA 5FYDA 5IKEA 4IIVA 2Y1KA 5AKYA 1MO5A 3IXMA 2UVQA 3PEWA 1XRLA 1MXFA 3ESRA 4X20A 1NFQA 1KP2A 4PPFA 2A2ZA 4BNLA 4X54A 4Z7NB 4W5TA 1CF2O 2K2WA 3D3WB 3MQ2A 2VHUA 4TN1A 5JO9A 4LJ7A 1G5TA 3A4VA 3OUTA 1IZ8A 5DNCA 4DSTA 1GCOA 3FCEA 3W04A 1P2BA 2IU3A 1YHYA 5CBPA 1D2EA 1S2MA 1TPZA 4ZI2A 1BU8A 4OHFA 4TQGA 3HB5X 1RAAA 1SULA 2NPFA 2DR0A 2AFRA 4Q1DA 1CUWA 2GN4A 4HWGA 3UPDA 2GWRA 4ZD6A 3VKFA 3LPCA 1RM5A 5CURA 5HR5A 3ISJA 1QDLB 4JK3A 5ECDA 5JAMA 5TLSA 1LNSA 1XVTA 2F62A 2W43A 1VI5A 2JFUA 4C5AA 1EX9A 5G2OA 4C4XA 3U2QA 4MVCA 4M9XA 2VZEA 4U5QA 2AT1A 4IQ4A 4OATA 4YAFA 4ZC1A 2PUCA 1FRFS 1Y1LA 4EB0A 1JF8A 2QAGA 3QXHA 3KVNA 2HNBA 4RIHA 5CPBA 6REQB 5JATA 5HTKA 1QRRA 2ZJ7A 3AUFA 3TTWA 1JI0A 5KNBA 1GTRA 2BFEA 4KVZA 1L5RA 2FB9A 2I6UA 5FV7A 1L5SA 1NMYA 1Z0IA 3K7EA 4I5IA 4MQLA 2VFAA 1KI6B 1M2GA 1N5JA 3ZOZA 3E82A 3UK2A 4E5SA 1OXXK 1VHTA 1T3LA 1DHTA 3U40A 5IDQA 2G8NA 1DTWB 4OQZA 4R0VA 5HUHA 4F91B 4CV2A 3AVWA 4NH0A 2QIPA 4V0KA 3WGJA 5JC8A 3E7FA 2PWYA 1Y6RA 4RIIA 1RCTE 4BRWA 5BT9A 4DRZA 4DDVA 4UUBA 2VJOA 1ETHA 1P33A 2VF8A 1JSCA 2H59A 4RHTA 1SUBA 1K92A 3L93A 2R4UA 3R5FA 1I3CA 3PFGA 4LRUA 4MKRA 5C0OE 3ICWA 4GOXA 4RNCA 2WJ4A 4V3CA 3NNDA 3LVRE 3VNAA 4XIYA 1M10A 2BDTA 3LCRA 3OA2A 3Q3IA 4ZCTA 4GR4A 5GONB 2FWRA 1AGPA 3QIAA 4D9NA 2GXSA 3IEVA 3TX6A 1Q1AA 2JAWA 3RKSA 4ZT5A 1BD3A 1WUYA 3KG2A 4KN8A 3RJTA 3EVGA 3WK9A 4B8YA 4B3RB 3GD7A 1E1RA 4N49A 2YJZA 3TNLA 1QVRA 2UZ3A 2HWUA 3CG4A 2UV8A 3MTGA 4BMDA 1X8KA 2ZIUB 2I67A 4IXTA 3C87A 1L4GA 1UDAA 3L8FA 1IDN1 2IYFA 4G3XA 1UBRS 3FI0A 3CVJA 4ZMBA 2XE7A 1LUAA 5KYNA 3E3OA 3ZHXA 3WL7A 4M54A 3PUHA 4L1KA 4RCYA 1P3JA 3C16C 4HB0A 3A6ZA 1RMQA 1UP6A 7GPBA 3MCZA 3B13B 2IYWA 2IV7A 3D0KA 2FDXA 2O3UA 1X1DA 1LS6A 4FVTA 5LQSA 4OHRA 1U28A 4BVJA 3ZLJA 3CU5A 3QQPA 1NG9A 1X1CA 2G5GX 2AZMA 1U5BB 3DAOA 2C8JA 3WLTA 1GN9A 1D9ZA 3ID6C 5CDUA 4G5HA 1E9SA 3EDCA 4Q4LA 2V6FA 2EGUA 2OBMA 3ZJTA 5M5BA 3U1BA 1T9GR 1Y1RA 2Z1DA 1W88B 3LP8A 4PSKA 4BWYA 1SXGA 2PVPA 4PFSA 1FX0A 1TM3E 4DNOA 1DVRA 4Q47A 4L8WB 4PAQA 3ZK8A 1E8DA 3HCFA 3M6AA 1G19A 4PZ9A 1S2LA 4EJMA 5CLJA 4HDRB 5B1YA 2XOXA 5ENDA 4HR7A 2GBPA 4HNVA 1ODFA 1OWOA 3BGVA 1I4WA 1J70A 1A8PA 1VQ1A 3HJBA 4G26A 1FFWA 4JP1A 4MVJE 4YI3A 2I3AA 1XZNA 3R41A 3L18A 4XRRA 2WDZA 2YMPA 3GDOA 1WB4A 2QAGC 1CDZA 3BJMA 3RSGA 3SJUA 3KNZA 4LZWA 2F67A 4TMFA 3WGIA 2OQ2A 4JUAA 5E3JA 3VHXA 1SCUA 1I4DD 1NNSA 3AF3A 2QTAA 3CNBA 2FSFA 3O8OB 4QASA 1Z18A 4IDBA 1P19A 3WV4A 1T8PA 1JH9A 3ZDCA 5KTYA 1R9NA 1XMQB 3BRSA 1AMOA 2QROA 4G63A 1UC9A 4G0MA 2XCUA 3DT8A 3GX1A 4MPDA 1HNXB 1T1SA 2N47A 2QQGA 5F76A 3H9BA 2C8KA 3TLEA 1Q2UA 2GR9A 4UCXA 4KO2S 4RH3A 1MO3A 3HCAA 5C7LO 5A3QA 3CPEA 4PSDA 3HS3A 1FRQA 1WXIA 2FMTA 5DHFA 1SBIA 2MJLA 1B43A 3PIIA 4HJXA 4QOEA 5MHTA 4G0UA 1B23P 2NGRA 2M6KA 4NYMQ 3WL4A 1V8BA 2ZW9A 1N6NA 4GDFA 1K88A 5G4LA 4UREA 1XQVA 1EG2A 3L9XA 2XW6A 4JYAB 4MUKA 4ZHSA 1YONA 1B8UA 4DCVA 3EX7C 1DBRA 4Y2QA 1MJNA 1DEHA 4RSMA 2HO5A 3KZMA 3NOOA 2NUAB 3RS8A 1ULAA 2B9EA 3H4VA 1JHMA 3FSGA 1RP7A 2OFXA 2QLNA 3AR2A 3LJKA 3N2GA 4OQNA 1YRYE 4UCWA 1JKIA 4P2BA 2Q8NA 1YQEA 4CEHB 4WN9A 1PFVA 3P0EA 4H7KA 1Q7CA 3U80A 5BWLA 2UU9B 1DIRA 1YJ5A 3QYPA 3NKFA 2VF4X 5JNWA 3D6UA 3REGA 3GELA 3T3DA 5JPCA 2JEYA 2W93A 3CQ9A 2YFKA 3GEPA 4NESA 1CEXA 3OFSA 1P2DA 3PCXA 4L3VA 2H06A 3D1JA 4BB0A 3GEBA 1QANA 5E4TA 4EECA 1G38A 1QH8B 4M1SA 5F51A 3PYXA 3TGLA 4ZK6A 4YCLA 3P2OA 3U4QA 2FJPA 2APJA 3SIPA 1SEVA 3N28A 4TL6A 4WZAE 5K6AC 1NJSA 2R3SA 1N4DA 1WEHA 1R0CA 2VRCD 1USKA 1UJBA 4FKMA 1N2OA 4OQLA 4ZI7F 1C3XA 2I7XA 1QRTA 1K3TA 3BXEA 2G9NA 2DPGA 3CNHA 3IQEA 4HRXA 4MUXA 3Q9UA 5CP8A 5LP1A 1HA3A 1I2AA 3TNDA 3UHPA 3ON5A 1G2PA 1KKLA 3T9EA 3MTIA 4LJYA 1ORTA 1O3YA 1OX4B 1YR6A 3IIJA 3NBUA 1CJUC 3TJMA 1II0A 4RYLA 1ILEA 1Z63A 4LY6A 4L27A 1E77A 2P41A 4RHCA 5MN6A 4LI3X 2F8TA 4NZYA 3DLBA 2CZCA 4MWGA 5B2EA 2PSDA 4B40A 4CEIA 3TJRA 5JJCA 1U90A 2PS3A 3MS2A 5AKHA 2R0QC 2F64A 2ZQ5A 3EOBI 1YZLA 2E4WA 1RXEA 3BIFA 4Y0NA 3HHEA 4BLWA 2G1KA 3F98A 1G17A 4EQ6A 1XEXB 2VCEA 4HS4A 2IXFA 1CULC 2V4MA 4G0ZA 3LLCA 1ATZA 4JL8A 3VO9A 4URWR 2ZJ1A 3PF9A 5FR1A 1KJ9A 1C9MA 5JMTA 3I92A 3UM9A 3VX3A 2IODA 4C2AA 4ENUA 2QE7A 5K3AA 2X0FA 5JD5A 2W2MA 3DNMA 3MWDA 2FFBA 2EKDA 4PLPA 4FYPA 1F2UA 2WY2D 3I2YX 5CEJA 2ILTA 3Q7IA 5BNWA 2NO0A 3HXPA 1SUAA 3FOZA 4NL4H 2A57A 2H4JA 4H77A 2QXUA 5F21A 3DZJA 3BYZA 5LQNA 2OCDA 1IB0A 3L6EA 2RK6A 3O8QB 5DBFA 1L1QA 4PLVA 4TTRA 3V8PA 2BEUA 5BPHA 3WWPA 3EY4A 3P9RA 4E3WA 1GGFA 4F9TA 2ZKLA 2JGDB 2B69A 1PSWA 1XZQA 2FMUA 2QSUA 5AK4A 1E8NA 1NRWA 3LLVA 2WG0A 1PG5A 3A9SA 5BWCA 4EKYA 4UQPA 5E1MA 3M1LA 2DLCX 3NDBB 3D8SA 5K4GA 1Y8ZA 2C1XA 1QKJA 3VNSA 5C81A 2HJHA 1DL5A 1YRQA 1ID8A 2OL4A 2MSNA 1AOXA 2OOKA 2CF6A 3EGXA 4Q1VA 2R1VB 4PYLA 4KQ2A 3EXHC 3DLHA 1CY2A 1QK5A 3H9GA 4E5PA 3MK31 2RG1A 1CRQA 1XRMA 4V0NA 1E3WA 4B8WA 3FSJX 4YQFA 2A5FA 3FYCA 3DTVA 4W1QA 5I7FA 5BYJA 1FX0B 1U3FA 1SQ6A 2GVZC 4L4YA 4BQSA 1M6YA 3CJRA 3F7MA 2DBRA 3DBLA 4RK4A 1CP3A 3VSCA 3VSAA 1TUIA 3ABIA 1H5UA 1RP1A 3HLYA 2YS7A 1P1KA 3DE6X 3X2FA 2HQOA 4YMGA 1QP4A 1ICIA 3OZAA 1P44A 4YP0A 4U1RA 4PYMA 4JKIA 1KNQA 1CUUA 3SICE 4WXEA 1AK9A 3B20A 3K9FC 3RSFA 1Q20A 1AKNA 3P9ZA 3Q2IA 4YAUA 2XB6A 3ICEA 3P9CA 2TSYB 3JQ6A 4WJZA 2PZAA 4AT1A 3HA5A 2ZWAA 2O2ZA 5HZMA 2XOEA 5CU7A 2W9XA 4ZDIA 1NJ2A 3LGSA 3F73A 1U2ZA 5FRDA 3AV0B 4WV3A 2RCNA 4W8GA 4JB3A 3PRJA 4DV4B 1BROA 1AKMA 4QNMA 2NT4A 3KSDO 4TQ9A 2AL7A 2OO3A 3H1BA 4MPRA 3O84A 4M1TA 4UHEA 1RLOA 2P69A 2WILA 2VJBA 3KLMX 1K4MA 2C97A 3FNQA 4I1UA 2CLIB 5EJ5A 3U7QA 1O96B 3EISA 1IEWA 1NXWA 4NOLA 1KMCA 3RUIA 3WGGA 4BFVA 1N5OX 1FE8A 2AMYA 2XADA 1NKSA 3COPA 1N2BA 3N0WA 4HRVA 1ZXBA 4QIHA 4DMLA 3OLYA 4PG4A 4A2WA 4C08A 4D7AA 2Z4TA 2O06A 2FN7A 4AP9A 5C8DA 3VO8A 1C41A 2DHCA 5JU6A 5KNDA 2ECKA 1NXQA 2PMEA 3GJQA 4OH1A 4Y2YA 4BN5A 4DZRA 1U1GA 5CTAA 2IQIA 2C5FA 4FGJA 1DLJA 4UC0A 2KHZA 4B48A 3DLTA 3M1YA 4QLAA 3ORQA 2YWGA 4G5GA 4MSUA 5FHQA 3SKVA 5A4MS 5HM8A 4WZZA 2EDCA 5C1IA 4KKXB 3OZSA 4R83A 4V0OA 4WXHA 2FW1A 4KH0A 2XYPA 4KSYA 4B4KA 5FNVB 5BV0A 3DULA 1E1NA 4OI2A 3ROGA 4XX0B 3E9CA 2QI9C 3JR3A 1QFSA 3UB4A 3WYEA 3ICPA 3ROEA 1ODJA 2Y1LA 4CTMA 1ZFNA 4BDTA 2C0PA 2IXGA 3P2MA 3J7AC 3SBOA 1B73A 1W6UA 1DQSA 2PWBA 2X9NA 4B79A 4M9RA 4EEKA 1N3LA 2EIHA 1USUA 4B44A 1QFJA 2BE7A 5LZ5A 2ICAA 5CVTA 3FNIA 5BYKA 1XJ5A 2EKBA 1Q0RA 4IDDA 4FT4A 1EFLA 1OAAA 4FSHA 2IFTA 4B6QA 1H9BA 2I2WA 3EZ9A 1QVAA 3ND8A 4FLMA 5JFOA 1OPRA 3OOEA 1N2CE 4QDTA 1KFKB 1P7YA 2VZLA 4FWTA 3DBRA 3EH2A 3PFCA 1CU1A 3ASZA 1VBKA 2LGJA 2XB2A 4D74A 4PNPA 3BH7A 1JFFA 1PGJA 2FEPA 3FYUA 3TG8A 1ISFA 1E9EA 1V16B 1YH3A 2VHQA 3CBQA 3K6KA 3OCXA 1QNLA 1I2MA 1V48A 1Z13A 4KHZA 4MRPA 1W0CA 4ZCQA 1VLMA 3NANA 1Z4LA 2IGBA 2V65A 3T9DA 3ZDEA 1G66A 2PT7A 2C92A 1I3MA 3VC3A 2YRXA 3KEMA 2GA8A 1ZUNB 2XQGA 1L7VC 3DD1A 4EX7A 4AQ7A 1WMDA 3LH5A 1DRJA 1XQ6A 4BGIA 2JFYA 2NPIA 4R16A 2AN4A 1NHWA 4EFLA 3LDAA 3JZMA 4M1WA 1WXFA 3W5AA 1O8CA 3VISA 4JOQA 2HMSA 5IAEA 3UH1A 4CF6A 3N75A 3TZ6A 5K6TA 4W5QA 1NQTA 2ZVDA 4MYRA 1SBQA 2QP3A 2XAUA 4ZAVA 4A5OA 1UM8A 1ODSA 2YZ7A 2EAUA 3WB0A 4G5FA 3DE5X 3UFXB 4KTTE 2HF9A 3WVNA 1C1DA 2JIMA 3UO8B 2Y1CA 3TGPA 3HC7A 1UBNA 2QM0A 4YEDA 4JUFA 4BNTA 2DFKB 1NVVQ 2LCFA 4K9RA 4V0SA 4JC0A 3VO2A 4IXMA 3Q3EA 2AX4A 4M53A 2XNDA 2IGTA 2B30A 3VU3A 2R6JA 4WJKB 3OM8A 4EG0A 4DUGA 1J56A 1MO4A 3O74A 3FCAA 4L8YA 5CHYA 5BR4A 1N32B 1EMDA 1QG2A 4BVHA 1RE0A 4Q24A 2HL6A 5FQNA 3CBGA 3EAGA 4KQ6A 5ALQA 3WWOA 4TWJA 2LKDA 4YN3A 2XRFA 5LZ2A 2JA2A 2D5IA 2NU7A 2JFVA 1AK1A 1LZLA 2MSEB 4OJQA 1XIVA 3H97A 3IP8A 3TS1A 1GQOA 3IVRA 3OCVA 1GXSA 2I87A 1R3DA 1S7GA 3M9LA 4MB2A 3HKDB 5KB3A 3QXJA 4KO3S 2FOLA 1QIJA 2G77B 2YNMC 3JTEA 5DRTA 1IUOA 2VSNA 2WMNB 2WZBA 1TD1A 1NHGA 1Y4AE 4J6FA 4IEIA 4I1OA 4NI5A 2RAUA 3TN7A 3LDHA 5AM2A 4IOLA 3W5BA 3ICQB 1BJTA 1QE5A 4BQOA 3STHA 2BTQA 3DLPX 4JYPA 4Q6WA 4ECEA 4OU4A 3IL2A 4MV9A 4GXNA 3T7AA 4F4DA 1Y3IA 2BHNA 2C4NA 4RHYA 3HGTA 1T8TA 1M6HA 4LDQA 5DXJA 4EI9A 1UINA 5CG1A 1TQ6A 1CLEA 1MO2A 2QTVA 4NZNA 4QXQA 3QA3E 1OA1A 3WK4A 1DG9A 4ZKEA 4M0EA 2HIGA 1D0VA 2GX6A 3QX7A 3W8NA 1WCIB 2V7QD 1R6UA 2VT2A 2FUNB 4IIJF 1YQQA 1KO7A 4G1EB 4YDSA 1G5QA 2OZPA 4UBOA 3CNQS 4ZO7A 4DIFA 3QG1A 4G2TA 4EJ0A 4L08A 1OGIA 5E1DA 5EUMA 4AWBA 3QF4A 5E38A 5BUZA 2GZ2A 1XDBA 2QYHA 3I2JA 2ZIAA 2C9BA 4I9UA 5DIFA 3WIVA 1AU9A 1VL8A 1RI3A 3OCYA 2P9ZA 3RBXA 1G98A 2VJLA 1GT6A 2V9ZA 3T35A 1NW9B 2FTKE 4W9MC 2ZT7A 2JH8A 1OU0A 3NBYC 1B3RA 4R9SA 4UMDA 3GUHA 1EXMA 3K8ZA 3FTNA 2BM8A 1EQUA 1WRBA 5DTRA 4E4RA 3DVLA 2BELA 4O4IF 1FNDA 2JIDA 4ARIA 5EJ7A 3I9FA 4MVJM 1RYFA 1NONA 3ZZNA 2UXCB 3BDIA 4E5DA 1SO8A 2X5XA 2R68A 5CYPA 4EZEA 4U7DA 4ZYUA 1KK2A 4NX2A 3I2IA 1KC3A 1WZCA 2XGOA 4MW5A 2MWMA 4PBSA 2D7DA 1DBPA 3C24A 3O3MB 5EXEA 3LQ2A 4JWKA 4F56A 3UCFA 1UL1X 4MYHA 3DHYA 1M2HA 4B34A 5KMGB 4PZUA 1KMHB 2QW1A 3CY6A 4Q3EA 5FO1A 4D41A 5C8YB 3AI7A 2YZMA 2LDXA 2X22A 4EDHA 4YQZA 3VPAA 2JLZA 4B3TB 2CHUA 3N7UA 4UD6A 3UW3A 1J0EA 3OQMA 3A6JA 5GV8A 2ZG6A 1HUQA 3Q7QA 4P08A 1YS1X 1UMBA 5YASA 3WIOA 1SVLA 4HAXA 1CUEA 1K08A 1RW4A 2H17A 2VNHA 4TSKA 3JU3A 3A1NA 4DIOA 1KTIA 1QS0A 1CQIA 2Z58A 3FFWA 3SFZA 4ES6A 3ZI0A 4D9EA 5CAEA 2IYPA 3V7UA 3HUTA 4C88A 1YD7A 3P9XA 4W5RA 1YZVA 4B0PA 2X1LA 1BGXT 1Z2NX 3OZTA 4PGGA 3U1TA 3ZXIA 2PGNA 4B6SA 1R66A 1AXEA 2BTQB 5FH9A 3HUUA 2QIOA 4KREA 3CM0A 3HWWA 4P38A 4UFPA 4UEOA 3ZHQA 3RLIA 1E1RD 4K6MA 1EFRD 1L4LA 2DR3A 4B7ZA 1XZCA 2D06A 3AI1A 4TTJA 1GNRA 1H2HA 3ZY6A 4BO7A 4NFLA 5E0KB 3G17A 3PHIA 4INOA 4OM7A 2XSZA 5HE8A 3R74A 3PLNA 1P1JA 3KEGA 2HGSA 2HTEA 1V5FA 2QENA 4LDPA 4F4JA 4Q9HA 5LYYA 3X1KA 2OCAA 2FZWA 4D5EA 3LRPA 1M1YE 1IUKA 1F5SA 1T2NA 1TYDE 3HO6A 4QU9A 4BO8A 4Z5XA 4FM9A 1KYWA 1H6BA 4LMRA 1GZVA 3MF4A 4KGZA 4DIKA 1YQWA 4KDFA 5FWDA 3IUBA 3GR6A 1XP5A 3B9BA 4BAGA 2A3RA 1P2SA 1HFEL 3GHHA 3IC5A 5BR7A 2VYCA 4S3MA 5L4NA 3ZU4A 2HSEA 2GFIA 3P0FA 4ID9A 3GVIA 1DI0A 1GUBA 1ORIA 3O82A 4K6CA 3MPOA 3K1JA 5KSOA 4KB5A 1GL9B 3TLXA 2JLAA 2Z8XA 4S24A 2C9OA 1TJNA 1GOTA 3MZ0A 3PITA 4PZEA 1U7OA 3UJNA 3ZDFA 4RQUA 3RC7A 3LO5A 1FTGA 1A69A 2IXEA 2O0LA 2BD0A 2Q46A 2R25B 3GWZA 4CIXA 1T5DX 3B2EA 3QW4B 5L4SA 4IL5A 3U17A 1JAHA 4K86A 1M8KA 4HFMA 5ESXA 5AVWA 1IEXA 2CVQA 2PD4A 4E0BA 4RULA 2C9DA 4LV6A 3KHTA 2EJTA 2GCOB 4QEKA 2DHDA 4FIDA 4S1VA 3E3NA 4FHDA 2JW5A 3K2QA 1Z88A 4M0MA 4TMKA 3DPSA 5BN4A 4O4LA 1DKUA 1OF1A 4BWVA 1ZK2A 1WXGA 3MMZA 4WY2A 3LG2A 4BMZA 1F3OA 3BXGA 2C9MA 3G6KA 4QNRA 2FWAA 1RKUA 3ZKWA 5HYVA 5JROA 2E3JA 1P1RA 2D4AA 2HJVA 3ZCXA 4D43A 4R1MA 1CETA 4PPYA 4EB6A 2H1VA 4AZTA 3W5UA 4N4AA 5AJXA 4F60A 1KAQA 2R4QA 3N8HA 2SCUA 1OFHA 1HKUA 2G70A 4GI7A 2O5CA 1GCGA 4BNJA 3D7RA 2GK3A 3E7XA 4DNQA 4MQMA 2YHUA 4Q1FA 4L85A 4YALA 1ZHHA 4R2KA 1W5FA 5E7QA 5EQFA 4YMLA 5LJLA 1IXSB 1JBEA 3EIWA 5FWAA 1W30A 2NXEA 4MB6A 3KYJB 1Q17A 1W94A 4CM8B 2DJ5A 2ZBRA 5K8CA 1VDMA 4TT3A 1ZGZA 2ZRKA 4WX2B 3AHGA 3N59A 1ZONA 1NBEA 1FSFA 4JVOA 1PAUA 3HI6A 3COVA 2YV1A 5AHXA 2A9RA 1VXRA 2E49A 1G20A 4O3FA 3ZOKA 5EJ6A 4M2LA 4KBFA 3RKUA 4ZOEA 2QTNA 1ZICA 5JAHA 5DN9A 2SICE 3PHBE 1G7CA 1V35A 1N9KA 2CFRA 3LQ4A 1PT5A 2BV3A 1NWCA 4L6CA 3II6X 4OY3A 2YDYA 3L7JA 4QRHA 5E1BA 2XRYA 5JSUA 1ZL2A 2VDWB 3TKLA 2XDYA 4JENA 2Q3FA 3RYFA 4CQNA 4OHYA 1QRDA 4YJ3A 1HG1A 4HFRA 4CMEC 1ADBA 3LE8A 4JI2B 2B94A 4FYHA 4ZAZA 4CUZA 4IS3A 1M8JA 5CPFA 3WMEA 3H0KA 4AYWA 3RFUA 3JAMA 1WXDA 2J32A 3HG7A 4B6PA 4CHGA 5FV4A 2YWJA 1RZ3A 3Q3HA 2X42A 3AONB 3E03A 4CIVA 1I3KA 1GNQA 5TS3A 1VXOA 1ENOA 3RJZA 1L6RA 3V7FA 1MC8A 1SKBA 2V6GA 1RYMA 2IA5A 2CDNA 2OK7A 4JSYA 2V7VA 1H9CA 2HWWA 5ERGB 5I9MA 5DN6D 1MA3A 3KPYA 3DYVA 2HRCA 3V9AA 1IZ9A 2I7TA 4BNHA 2KYRA 1Y7TA 1EZ1A 3M33A 3PKJA 2XX3A 1NT4A 1BX1A 2WJWA 3SQDA 1PFYA 2BH9A 3GNQA 5CD1A 3I52A 3HNOA 2QEQA 4FQ5A 2B4YA 3PTAA 1XD2B 1I7NA 3JQAD 4KZKA 5DEIA 1OI2A 4GNKA 2A5LA 4IZIA 1JHPA 1A3CA 4AM8A 3FPEA 1IJFA 3ACDA 1A9RA 3GD5A 1FBTA 3OZRA 1TTTA 1UK7A 3U9SA 3Q85A 3ZGOA 1E63A 1NNUA 1BHQ1 4DCCA 1DTSA 4RLFA 2WVAA 3X2EA 1U8XX 1VA5A 4Z4CA 3HEAA 3E3MA 2CLCX 4JC8A 4DREA 5J4LA 4MJ3A 5A4FS 3WWCA 2LE0A 3OPNA 3LYHA 3LOPA 3N2KA 4H6PA 4J0HA 4NSNA 5G3YA 4JMPA 1D0IA 5KSPA 3F5FA 4GZ5A 4HQKA 5EMNA 2EW8A 3PHGA 3P2IA 4NOMA 4O4JF 4QULA 4DE5A 3QVTA 1G1MA 1KOFA 1XCJA 2AF4C 1PJRA 1QX4A 3DZCA 4K6GA 3IIMA 1SURA 3GJSA 3L07A 3KV3O 5E6RA 1YULA 1L2TA 1OFGA 1SBNE 2QS9A 3HVRA 3EWIA 521PA 4XR9A 5ILOA 1L4BA 2B8NA 2W83A 4R51A 3ZWBA 4PONA 3FOAA 1O94C 3H8VA 2HHAA 2YIVX 2P7IA 1Q7BA 1UDCA 4C4AA 1WVIA 1YCHA 1QGAA 1ZVMA 2C4TA 1TU3A 3OPYB 4RVFA 2CMKA 3CRNA 1V8OA 3Q6MA 3S27A 1PJQA 5JXGA 4B0OA 2BZSA 3UTDA 5CB4A 1AO3A 1YZFA 1XCOA 2IZ6A 1RBQA 1T9GS 3DM9B 1E20A 3NYRA 4EGFA 5AVXA 4FQ8A 1YMUA 2ETXA 3GT7A 4D4KA 2GXUA 3C3XA 5FI3A 2Q1YA 3DBOB 3VV2A 5C7IO 1QU3A 4M38A 1XWIA 3BTUA 1G18A 3AERA 4OB7A 4QXRA 2WUWE 4QTUB 1T6YA 1Z8DA 3VU1A 4OEHA 2VP0A 3WYDA 4CCWA 4Q3CA 1D1TA 2X86A 2JH9A 2IP1A 3EVEA 3PXDA 1YJCA 2O14A 4L2IA 4BLPA 5BV7A 5EMKA 2AOTA 4Z7JA 2VAMA 3PI6A 3V3KA 3EEBA 2ZROA 2CVPA 3VC2A 3BWMA 3WJAA 2AFIB 3EEFA 3R0XA 5CW1A 1ZDMA 3T5AA 1QYWA 4PE5B 2CB0A 3N8NA 3GFPA 4RF3A 3EE6A 5KYVA 4BVFA 2BMFA 1C1HA 5DLPA 3L3BA 4JP3A 3IP5A 5SZHB 1L8OA 1M2KA 1EXNA 2G3YA 1ONBA 3K8OE 3OO1A 1LZKA 1QGOA 3A1CA 3OIDA 4TKUB 3OZEA 4CEIB 2H65A 3BXHA 3RYHB 3O5AA 4D0NA 4XJSA 4KW7A 2CHVA 3AEUA 3ORFA 1YS6A 1Q3HA 1R6TA 5HUQA 5JCXA 2HPVA 3Q4GA 2QZSA 1GUFA 2OT3B 1IJBA 1E1LA 4QWWA 1HC7A 3ETCA 3I6MA 5CT5A 1Q83A 1LK7A 3DTVB 3T9CA 2WSMA 1MC4A 3MMNA 4DN6A 1ZJ5A 2AC7A 2R62A 1UF9A 2XLBA 1QKIA 1CY8A 4N0EA 3I04M 1SU8A 3MCUA 3MLAA 4DABA 1FEZA 3FPHA 4TL8A 2XTNA 1PR3A 3L8YA 4K9KA 3TL3A 4NJEB 2RHMA 4RPCA 5EKTA 4FCCA 2WVHA 3UA4A 4CI9A 3MFYA 3EEIA 3PU6A 1DCFA 3DZFA 3V4OA 2ZWPA 2XVZA 2YJNA 2IPNA 1KWKA 4MMXB 1CF9A 2M6SA 3HJNA 1UH5A 3CO0S 1U11A 4WZBA 2QDXA 5LP6C 3B51X 3GG2A 1JG3A 4HGNA 4TTQA 1GPMA 1O95D 3ZCVA 3W5HA 4ZTZB 4EO4A 5ICGA 2PN1A 1JWAB 1TLTA 3VI3B 3AL0C 2WFAA 1JFRA 4JT2A 5EWLA 3R3XA 4OXXA 1OIWA 4P31A 3FTPA 3K8QA 2B5OA 3CXUA 1D8AA 1EFKA 2BCEA 3SVLA 4IQFA 2W2TA 3EMVA 2WC1A 1QLWA 2EZTA 3IULA 2Z08A 3OBIA 1IZZA 5AVZA 5JWOA 4NR0A 4PZDA 3R9IA 2WWYA 1BS9A 4IO1A 2PKCA 1FK8A 1YE5A 1VP9A 3C15C 1U3UA 4RYDA 4WKBA 5EPUA 4E5YA 4DSZA 3AR6A 1FMTA 1ZGHA 4OA8A 4D8TA 4Z8XA 2GJSA 2BGWA 2GXQA 3HB7A 3LZCA 4AJ4A 4BASA 2OV4A 4KQHA 4E32A 1QRUA 2DKNA 4KN9S 3FMIA 1KAGA 1SNYA 2AG0A 2BONA 1IK6A 1BWQA 3FA2A 9MHTA 4GYKA 3GFGA 3BL8A 4MUEA 4D9CA 5KYXA 3G89A 2ZPAA 4JQSA 4ZC8A 4NP6A 2N1BA 4NPAA 1Z38A 5A5GA 3GJ3A 1I30A 3KKMA 4UBJA 1U0HC 4DCTA 4LJKA 3FVT