2NTYC

Rop4-gdp-prone8
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
176
structure length
173
Chain Sequence
SRFIKCVTVGDGAVGKTCMLISYTSNTFPTPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFFIDHPGAVPITTNQGEELKKLIGSPIYIECSSKTQQNVKAVFDAAIKVVLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Emb|CAB41934.1
publication title Structural Evidence for a Common Intermediate in Small G Protein-GEF Reactions
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein
total genus 52
structure length 173
sequence length 176
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ntyC00
3BRWD 3LNCA 2PL3A 1OFIA 3BAFA 3QXHA 2AKAB 2GXQA 4KYUA 1CLUA 3LFUA 2Z4RA 3LW7A 3H4MA 4HZIA 4D2IA 4MGIR 1WP9A 1NLYA 1Q1QA 2O8FA 3BS4A 4JLAA 4RD4A 1Z28A 4RVCA 3PUZA 4PC7A 3RDPA 1CXZA 4D82A 4W5WA 1Z83A 3AVUA 2ZXUA 1DARA 4U02A 2CXXA 4IOMA 4L5BA 2O0JA 3AQ4A 4QGAA 4JKIA 3AVWA 4EPYA 2NO7A 5KYKA 4R71A 2A5DA 4PC6A 1TQDA 4TL9A 4QFMA 2FU5C 4PSAA 1TADA 4CDGA 1SXJE 4RFVA 2J0UA 1G5PA 1XXHA 1JQJC 2FH5B 4AK9A 1NBMD 5AUNB 2RGCA 1TTTA 5DGXA 4NMMA 5KHOC 1W4AA 1DEKA 4KU4A 2IUUA 4DCSA 1A2KC 1HE1C 3C4JA 4FCWA 4I1VA 4Z1MA 1BYIA 3FFAA 1FFHA 4HB4A 1AQYA 2XZPA 2CCKA 5E3HA 1E9BA 1OJLA 3BORA 3LLMA 2GTPA 2GHIA 3TNFA 2YOFA 1KY3A 2P67A 5HZHA 1Z6AA 3VNVA 1XU4A 4FCVA 1E0KA 5IT5A 1F2UB 1ZNXA 2DY1A 4UNSA 1IM2A 1E2PA 1PLLA 3HP1A 3NVAA 3THXB 4BPBA 2JLQA 1SVWA 5H70A 1E2GA 2IF0A 2JIZD 5CM8B 4BLRA 3W6OA 3EPHA 3L8YA 3K09C 3TUJC 3GLFA 4A92A 4M1SA 2WKRA 3N70A 4C0KA 1IBRA 4DSNA 4TQUS 1XEXA 2OCPA 3WMEA 1XDBA 3RNLA 4FMCF 1NP6A 2IYWA 3GLGE 3G82C 5JI2E 5F3WB 3EC1A 4OQFA 4X8HA 1YVDA 3QQ5A 4YXWA 3VU9B 3AKCA 2P2LA 4B6FA 1P2VA 1U8AA 2A78A 3ADDA 2YVUA 2FSIA 3BFKA 5GADl 3MWJA 2JJ1D 4N0EA 1N5LA 4M1MA 2W58A 1U9IA 3B6EA 4URYR 2QQEA 1C4OA 3TW8B 4EPVA 1W48A 4A82A 2B8WA 4PANA 5EXTA 3TE6A 3WNDA 2QN6A 3JVVA 1HV8A 3RWMB 2V54A 1P9WA 3NDBB 3EA0A 1W0KD 3NC1C 2NZ8A 4B3GA 3BB3A 4A2PA 2WWWA 2Z83A 3AM1A 4Z1MD 2DPXA 2AD1A 4R7ZA 4TMKA 2EWWA 1E1RA 1J7KA 2EFGA 2LCFA 2RKOA 2GBLA 4MRPA 4NYIQ 1JI0A 1ZC3A 621PA 3PEWA 3OIWA 5L3QB 3I5XA 5KOYA 2D74A 1U2RA 2BMJA 4F4CA 3GLHB 4Q4JB 3SJAA 5JWRA 3REFA 3EG5A 3LX8A 1OW3B 5FTJA 3W90A 3U60B 2GF0A 2GZDA 3A1UA 3Q5DA 1XCMA 1XJQA 4DEYA 1IOZA 5FOUA 5FL7A 1F2TA 3QF7A 2VL7A 3CF0A 3E70C 3FMFA 4V02A 3VR5A 3DPUA 1MR3F 2AKYA 1ZU4A 2IW3A 2RGXA 3THWB 1GG2A 3CX7A 2O8EB 3K8YA 4EPWA 5F9HA 4YXWD 4DKXA 5FI0B 4EQ6B 2YC4C 3T5GA 4JT2A 4EDHA 5JS7A 3PEUA 3GJ4A 1KDRA 4KYIB 4CIDA 3ZVLA 5H68A 4QBGB 4G5OA 1IXSB 3KQUA 4OJQA 1ZYUA 3QPWA 1S8FA 2HUPA 2IBMA 5DHAA 1KJWA 5B58C 2D2EA 3CF6R 2F43B 4PO1A 4D80A 4N0DA 2QPTA 1JXMA 1R8QA 4PO8A 2BBOA 2IS1A 1E1RD 5AUQA 1GNQA 2NTYC 5DI3A 3ADCA 1G8FA 4PPQA 1G19A 4TTPA 5G3ZA 4HEJA 5JCPA 1KNXA 1XCPA 4AY2A 1NVVR 1IN5A 2CEAA 2V1XA 2YWGA 4BUJA 2WHXA 2ZREA 5J5CA 1ZD8A 4O2RA 4QGFA 2FEMA 4WIAA 4DLZA 5K8UA 1YKSA 3GJ6A 1N6OA 5FL7D 2ZRMA 2ONJA 3H84A 4PC1A 4KFRA 4Z54A 1W5SA 3WYAA 4G5SA 2WPDA 4LBWA 1KO8A 1OXSC 2O8FB 2WOOA 2H8KA 4LHYA 2VBCA 2XTMA 3A1VA 4D6PA 2C8VA 3SR0A 5AJZA 1Z0IA 1Z6GA 2IWHA 4GP6A 3MLEA 4PC2A 2JLSA 4MRSA 1IJFA 4DLYA 4OI0A 3I61A 2D7DA 2F3RA 1NRJB 4XTRA 3TVDA 4Y0VA 2J0UB 1XXHB 5EE0A 1E69A 1F6BA 1II8A 1K5DA 4I1SA 4IFBA 1R10A 5FUVA 4M22A 1KI2A 1U99A 2Y8EA 2WVJA 3S1AA 1YU9A 4LPKA 4Q4HA 3HU1A 1RRGA 1DG1G 4MKIA 5B64A 4LJ8A 3UMFA 3ZIAA 2XXAA 2C96A 5C4GB 2VP0A 2XNDA 2V6JA 2XJ4A 3BBPA 4D26A 5FI1B 3GLFB 3I5YA 1RE0A 3BWDD 2IYTA 1XEXB 2ZS9A 3QKUA 4A6PA 2WPDD 4UJ5A 1U94A 4PSKA 4HLCA 4UKDA 1T5IA 2EFCB 1DADA 2RGAA 1ZAKA 2VHUA 4IOLA 3TQCA 5HKKA 2HJGA 1RJ9B 2YHSA 4ABYA 5LBIA 3VR4A 3VR2A 4DT1A 5TMPA 4BRWA 1FQJA 3LXRA 4QM7A 3C5CA 1U9IC 2FPKA 3SJBA 4D0GA 3W5IA 4RCZA 2BIFA 4EFLA 1ZUNB 3L2OB 2GCPA 2HXYA 2BM0A 2ZI7A 1UM8A 4G5QA 3OE7D 4HAZA 2PJRA 4TT3A 3PIRA 2ZR7A 3EZ2A 1CJKC 3LQRA 5KPJA 3GJ7A 1IY2A 4EIWA 5CDFA 2GBLC 2YNMA 3MD0A 4URUR 4NCNA 4TN1A 5F2EA 2ZR9A 4LOAA 3B78A 3DO6A 5LD2B 5LD2C 3EW9A 5EE1A 2ZU6A 3UK6A 4ZCLA 2J0SA 1SHKA 2WJGA 1I4DD 1GL9B 5FBLB 5KSYA 1LW7A 1VIYA 4TQ9A 1F2TB 4Q9LA 4UJ3A 1C9KA 1RFLA 1MO5A 3ZQJA 3HJNA 1E96A 4WZBE 2R6AA 3MRSA 3F3YA 3EIHA 4Q7MB 4Q1FA 3TR5A 3GLHE 5CK4A 1DBSA 1DTSA 3A8TA 5HKKD 1OHHA 4DCTA 2V4ZA 4BGDA 2WTUA 3U3KA 1ZUIA 2I1QA 1QHGA 4ZDKA 1W4CA 2WM9B 2J7KA 2MSEB 2G77B 3E1SA 4QBHA 4P0TA 4TQAA 2AN9A 4B74A 2W2XA 1P3JA 1IQPA 1V5WA 3PUVA 1D9ZA 3ND8A 4HUQA 5CK5A 4URZR 1SVMA 1LS6A 4C30A 5FBVB 3VFDA 2W2TA 3AVOA 1JQLB 3OEED 3LW8A 4PC3A 5CYOA 4NE2A 4TT3D 1E4VA 1AGPA 1P62B 5DI3B 4RZXA 4B75A 5GJWC 3MWLA 4QRHA 2IHBA 1OB2A 1UBEA 3GMTA 4PAQA 2OAP1 4RD1A 2HYIC 3PEYA 3NWJA 5KDDA 4B2PA 1E79D 3QG5A 2GZHA 3SFVA 3RS5A 3U4QA 2HYDA 2A2ZA 2UZ3A 3IIKA 3QJYA 3VTKA 4NYIR 5J4KA 5EP4A 4B71A 3W9YA 2MMCA 2ERXA 1G8YA 4NONA 2V6IA 3QIAA 5DE3A 4EKDA 3ASZA 5AUOB 1AZSC 4P3YA 2DFTA 2FFAA 1B0UA 2YOGA 1PVOA 2F9MA 4CEIA 1EFTA 3IBGA 1OHHD 2NPIA 4I81A 2ZJ2A 1F60A 3ZZUA 2QQ0A 3IQXA 4LJ9A 1T3SA 3UIEA 3MWYW 2BCGY 1G7CA 2IHYA 4QGGA 4ZIRB 2IS6A 4PR0A 1GRNA 3REGA 4TYQA 1W44A 4OHXA 1KI9A 3EZ7A 1CJVC 4HZUA 2GF9A 4TMXA 1II8B 1EFHA 3BH7A 1NI3A 2QMEA 2G6BA 4Q9HA 4HSEA 2FZLA 2REXB 3BERA 1G3RA 2R62A 3S1AB 1T9HA 4DSOA 2QSYA 5E7IA 4TYNA 1U81A 1NSFA 1UKEA 1CR1A 2GK6A 1XXHE 1U0JA 3OIUA 2VHCA 2XXAB 3CPHA 2QTVB 4PQRA 1QG2A 4YLGA 1J8YF 1L4YA 2QEQA 1PLKA 2MSDB 5LB4A 3U61B 4L9SA 2VYFA 3P20A 2GEDA 2H16A 4PAMA 1IHUA 4YC7A 2CLDX 1OIVA 3KFVA 5P21A 1K8RA 1NN3A 3SFZA 4DJTA 3EX7C 4B2LA 1JAIA 4QL3A 1X1RA 2OZEA 5FFMA 1YHNA 2OCYC 1XMIA 2PBRA 4IDNA 4PPFA 4IW3B 3GLFE 3SHFA 4BFYA 1UDXA 1KSHA 2ZSFA 2QM7A 3VX4A 4ZDJA 1OKKA 4JJKA 4KO8A 1G7RA 3GFOA 4JT4A 3D6TB 3RYTC 5LPNA 4YMTA 2ZI3A 4ZO4A 1KI4A 1G9XA 4DIDA 5JJKA 4M9ZA 4TYPA 2ZETA 2KBEA 3MJHA 3C15C 3BFVA 4AYXA 2WZQA 5JJLA 3AKDA 2O52A 3EIEA 2CE2X 1TUEA 4IDHA 4GZMA 1P2TA 3SC3A 1XEWX 3CBQA 1Q20A 3K0AA 2GAOA 5HPYB 3RS4A 4OK3A 5EE9A 4A9AA 4QGHA 4V0OA 3AUYA 4A0RA 4IRUB 2WJJA 1JNYA 5HR5A 3CLVA 1QBKC 4YDSA 4EFMA 4TMTA 5GJBA 1E9SA 1T3LA 2EYQA 1G7SA 4XJXA 1S0UA 1VCMA 4KODA 4PO9A 5AJYA 4NBSA 1XX6A 4JIMA 3EARA 1J90A 4GZLA 1GSIA 1TF2A 2F1JA 1JJ7A 1S3SA 2ZAMA 2I1VB 2FGKA 3GEIA 3LVQE 2CJWA 2WBLC 2ZE5A 3BE4A 3AVTA 3QXSA 5FTKA 4B3BA 3I62A 3ZS9A 3C16C 4JKYA 3NHBA 2ZVPX 1OKKD 4DHEA 4KITB 1E94E 4JBWA 1VHLA 4WA7A 5JRZA 5B57C 2QZ4A 5D3MA 3A4NA 1ANKA 2PEYA 1CJTC 4C3ZA 4IDOA 2AXNA 3H1TA 4HUQB 4S2EA 1T8UA 4QKQA 1GTVA 4BLPA 2A5YB 2MSCB 4IOKA 1G16A 1MT0A 1HQCA 1TEVA 4MKHA 1W4RA 4XVUA 3AF0A 2GK7A 4TL8A 1K5GA 1ZM7A 2B8TA 4BLOA 1U0LA 2NO0A 1BH2A 3T61A 2VTKA 2IYXA 4O25A 4BZQA 4GL2A 1KI3A 3EXAA 1XNJA 2IYYA 2WMOB 3DDCA 1KGDA 3U4QB 2B92A 3TKLA 4DDUA 3K0SA 3ECCA 4Q7JB 1NG9A 1OV4A 1HUQA 2OFWA 1Z47A 2V7QA 5DSZA 3PV0A 3TIFA 1SVLA 3GFTA 1WMSA 3QSYA 1G8PA 4ILEA 2B6HA 4JLOA 4DWJA 2AL7A 4DLTA 3ZJYA 1X86B 3VMFA 2ANCA 1M34E 1QF9A 4HLUC 1OFTA 2W83A 3L0OA 4CEIB 2ZIAA 2OV2A 5EXPA 1NKTA 1W2GA 1XMJA 5FUYA 5C1BA 1DAHA 1KK1A 1ZIOA 2CK3D 2ZQ5A 1N6HA 5FPYA 1ZCAA 1N2CE 3WP0A 3VKWA 4M1WA 2PJZA 5BW8A 1N6PA 4HZUB 1ODFA 3A37A 4ACBA 1EESA 4XVQA 1SVIA 3KB1A 3JVUA 4MYCA 3THOA 3U6BA 1E2LA 1QG4A 3AP3A 3EA5A 2GKSA 2ZUDA 3K9NA 4Q1AA 5CM9C 4XD7A 1X8JA 4CEHA 1COWA 4RCYA 1UBGA 3KUCA 4R9UC 3CZQA 4D4LA 2ZYVX 2GILA 1N6LA 5JCZA 1YZKA 3AKYA 1P2UA 5BN3A 1Z3IX 2BBSA 4BECA 2JEOA 4AYTA 1P9RA 2GCOA 4TYYA 2ODBA 4YMUA 2R6FA 2V7QD 4A8JA 4C0AC 2OHFA 1NLFA 3CIOA 3D8BA 3UPUA 1KDTA 1S3GA 3ZZ0A 1RC8A 1L4UA 2ZRLA 1YE8A 2AFHE 2GVZC 2A5FA 3AGQA 2VIIA 2ANBA 4TMVA 4HLQB 2P6UA 1G4AE 2R2AA 2VH5R 3RS0A 5C18A 2F6RA 2PMKA 1R5NA 4NCIA 1JR6A 2O0HA 1UFQA 1NNEA 4LBYA 1OXUA 4R98A 2GA8A 4HB3A 1SKYB 2YC2C 3NEYA 3ND9A 4OJKA 1FPMA 2CHGA 2EU8A 4HLDA 3B85A 4XOIA 2P5TB 2JLUA 2ZSDA 2ZI6A 2G83A 2AXPA 5IK2D 2F7SA 2FPLA 2UZIR 2VHTA 4FD2A 4Q47A 3D3QA 1KZGB 2NOAA 4DLSA 2B7CA 4GNKA 3MMPA 1IJEA 1A1VA 1LB1B 1EXMA 1Q0UA 3THYA 4LHXA 5EUMA 4XVRA 1H8EA 4C4PA 1W49A 5C46F 4L8GA 2QPOA 1D6JA 1P4SA 2ZRAA 4OHZA 4BEBA 1Q3TA 2V55B 4XH9B 5A0FA 1GUAA 3LV8A 3KTAB 3MSXA 4NCJA 1H8HA 2QUZA 4NYJQ 5FBRB 3LO5A 4B3FX 4TMZA 5JSZA 3B5JA 5UKDA 3PITA 3SS8A 2C9YA 2ZRHA 2R65A 4LJYA 3CW2A 5CDFE 4QM6A 3AUXA 4MGKR 2CCJA 3HPRA 1DAMA 4LC0A 3SNHA 4B76A 2OFXA 2XB2A 1N0UA 4AYWA 4EFNA 1SVKA 5J4LA 3ZVNA 5BYJA 2JASA 1UEJA 1XWIA 3K53A 2CJWB 2QROA 5JFGA 1AIPA 2ZM5A 2D4HA 4UXJA 4UXHA 5EP2A 3T1OA 3GPLA 1RRFA 1WBDA 2PZEA 4H9GA 1OIXA 2RHMA 2ZRJA 1KZ7B 1P9NA 2BJWA 2NIPA 3P1JA 4IXNA 5BN4A 5D3MB 3KQLA 1WRBA 4Q9IA 4Q01A 1UKZA 3X1ZA 3IEUA 1DAKA 1ZJ6A 4BASA 1L8QA 3G0HA 4HDCA 3QNUA 1Z0DA 3KKNA 3W8NA 4B35A 3V4RA 5IHPA 1MABB 4MYTA 4GMXA 1U90A 4X8LA 4FMDF 4IDQA 4M4SA 1UF9A 1GRRA 4E22A 2DR3A 3IO3A 4GOXA 1MO3A 2ZI4A 3NHAA 1R4AA 1Z2CA 1F48A 2QM8A 4FWIB 2J0QA 5DISB 4KI0A 4OQXA 2FEOA 4KSBA 4FI3C 5IDVA 2XB4A 3JZMA 2EFHB 3PJRA 1Q57A 4P32A 4GPTA 3T1QA 1DAFA 4D0NA 2ZSBA 3WRYC 1HYQA 3QY0A 2ZANA 1NVUQ 1HEIA 4XSHA 1MRSA 1FMLA 2W0SA 3V9PA 1AS0A 1N5KA 4ESVA 4D4JA 1ZRHA 3A4MA 1ONBA 5DYGA 5HE8A 1SKQA 3ICEA 1BKDR 4OKSA 4ZPXA 4U7DA 3TBKA 1KHTA 5KPDA 3VR6A 4TSFA 1G6HA 4WXPA 2DFNA 1QHXA 2Z4SA 4MA4A 4TL6A 1JR3A 4HUTA 2YWEA 4F4IA 1T8TA 2GXSA 4DDWA 1W0JA 4F92B 1YR7A 5DN6A 3WP1B 4BZPA 1N0WA 1VCIA 2CHVA 4Q5IA 4MKGA 2ODEA 2CMKA 2QP4A 4QOSA 3FHOA 5CJPA 2P0EA 1AK2A 2N1BA 1OYYA 2I4IA 1VKJA 4JMPA 1TAGA 2F9LA 3O8RA 3BFXA 4B73A 2IF2A 4RZUA 3OFNA 3KFXA 1RYFA 3B82A 5DI9A 4UNNA 1W7AA 1OLOA 2Z5FA 4CEJA 4URWR 5EUQB 1E2HA 3A1SA 2NG1A 1W4BA 2BEJA 3ZDQA 3NBZC 1HT1E 1ZU5A 3SYLA 5BWMA 2GCOB 4R2IA 4C7OA 3CNNA 1G291 2R6CA 4A8JB 4A8JC 1AKYA 1E2NA 4M1YA 2ZSEA 2Q3HA 3E5HA 1XTIA 4A36A 4I4LA 4ON9A 1XCGB 2R9VA 1R6BX 2FSFA 1Z08A 2CL7X 3C41J 5C2JB 2J0VA 4UNQA 1DPFA 4Q7KA 4HB2A 4EJSA 4TLAA 4PXAA 3U7EB 5E4FA 3U3OA 2A3RA 3NG1A 3AKEA 3U44A 1JR3D 1JXOA 1E2DA 1RKBA 3DL0A 3V00A 1W0JD 5E7MA 3DMDA 5TV2A 1R2QA 3MAAC 5LB2A 3B1YA 5DN6D 4G5GA 2JLVA 1MO4A 3L82B 1IN8A 4M2LA 4F7WA 2GWHA 4TLCA 5KSPA 1KI6A 4DSUA 1AJEA 2WSMA 2REBA 4C0SA 2ZJ5A 1OSNA 2ODWA 1V43A 5EXXA 2QA5A 5AUPB 1SKYE 2W2VA 3THYB 1NIPA 3UXMA 1E9AA 2VP9A 2DFLA 1Q3HA 2ZRGA 3AV0B 3TSZA 4JLNA 3G5UA 4E03A 1U98A 3DZDA 4Q9JA 3SQWA 2PEZA 1M74A 4WZ6A 1XTKA 4WXRA 3ZGXA 1G3UA 2BBTA 1OXVA 1N6RA 1RYHA 1II0A 3KDSE 1ZM3A 3VQTA 4PTLA 2J5XA 3Q85A 5JSZB 2VLIA 2YV5A 3X1YA 2XEXA 2R6DA 4DLRA 4NDZA 1CS4C 1UPTA 2BVNA 3X1WA 3Q5EA 1VYVA 1S9DA 2W0MA 1NKSA 3T34A 2HDNB 1FX0A 3WRXC 1CP2A 2IYQA 2BDTA 4TL7A 1OB5A 1Z0FA 5JWOA 4US2R 2H17A 3QUSA 1T5LA 4LYFA 5GJVC 1E2FA 4JVSB 3SOPA 1ZVQA 5CIQA 1KK0A 3UATA 3WBJA 5G40A 2YZ2A 1TQ6A 4EPTA 5KNBA 4IDPA 121PA 2GESA 5KU1A 5HZKA 3GD7A 2FV8A 3M4YA 1MV5A 2GJ9A 3ASYA 4DB2A 3IKJA 1WCV1 4OQNA 1S2MA 3B1WA 3RRYA 1P6XA 1Z6YA 4HATA 4FCTA 3EIQA 3OIVA 3QKSA 2J46A 4YMWA 3RABA 1PUIA 4TTRA 4ERNA 1CRPA 3WY9A 4NP6A 3LBIA 2CVHA 1Z63A 1YR6A 2DCUA 2DFKB 4Q66C 3CRMA 4BLQA 5FOWA 4IKEA 1KTVA 4LPSA 2W6JA 2XITA 4P4SA 4OHWA 4MYHA 1E99A 2FE4A 3EASA 2Q3MA 1CRQA 4B44A 1G17A 1EK0A 4NYJR 4FMDB 4B34A 1U8ZA 2VO1A 3FGNA 1DAIA 4QHTA 5FR1A 4ZI2A 4M21A 5L3VA 1FUUA 1KAOA 1VECA 1RRPA 2QPAA 5SZJA 4KHZA 2DB3A 4V0MA 2RGNA 1VG9B 2ORVA 5E95A 4QJ3A 1ZCBA 3VKHA 2HXSA 1XD2A 2BMDA 3W6NA 3FKSA 1ZNZA 1HY3A 3P27A 4OL0A 4C2UA 3I92A 4G0NA 4C9BA 4RZ3A 1MOZA 1VPLA 3Q7PA 4Z8YA 2JLWA 2IL1A 1X6VA 1OPXA 4FMCB 2DHRA 4BFXA 5J4YA 2PZGA 1KI7A 3IO5A 5JLJA 2C95A 1OF1A 1ZW6A 1WQ1R 5FR2A 2G88A 1UAAA 5TXGA 4CEJB 4FIDA 2IA5A 4M9QA 3O47A 3QPUA 2VF7A 1E0SA 5G53C 1BO6A 3OF5A 2ATVA 3RS3A 4CGZA 2FN4A 1X8LA 1GKYA 3K0FA 2D62A 2GEUA 2W6JD 3Q72A 3SE0A 3BXZA 1MO6A 2EW1A 3ZIAD 2PH1A 4C7OB 4HAYA 2XNDD 4Q4AA 3VHLB 1HQYE 5A4JA 1HA3A 4O3MA 3AP1A 3CNLA 5GJCA 3B9QA 3KUDA 5FTMA 3IPXA 1KSFX 2IUSA 3TQFA 2ZJ8A 1E9RA 2OILA 1ZINA 1RVDA 4EJSC 4EJSB 3BOSA 4LV6A 1II9A 4B48A 1FZQA 4D4MA 3U44B 1NVXQ 3L0SA 5KUTA 3TR0A 4KXFB 4KV9A 4V03A 5KNDA 1P7CA 2XAUA 3PXGA 1NLZA 4D81A 2VQSA 2JATA 3TSOA 1BMFA 2IXGA 1BOFA 3P4YA 1KI6B 4BFSA 4TZ6A 1OE0A 1TX4B 4UNPA 2JDIA 2JLXA 1CJMA 4V0LA 4FW9A 1XTQA 4OI2A 4WOPA 3UWKA 3RSOA 3AF2A 3CB4A 3LVRE 2WWGA 1KIMA 2XNSA 2YKGA 1OYWA 2H1LA 1SULA 721PA 2WAYA 4BFZA 5GVRA 4EPXA 3GJ5A 1Z0JA 5DNYB 1VCNA 1RIFA 2VP2A 1G41A 3QVUA 3W8RA 3H86A 4JBXA 1XRJA 1P72A 5J40A 2PMDA 4EUNA 3IPYA 2YWFA 4XSGA 4BRUA 1FW6A 3TJZA 1S9HA 4P31A 1DO2A 3CPJB 3X1XA 3P32A 1FX0B 3C8UA 1XZQA 1AM4D 4X8OA 1ZC4A 4B2IA 1CBUA 4MDEA 3A4LA 3I1FA 2VPPA 2QRNA 1Y63A 5IF9A 2AWNA 3U7GA 4I99A 4CYMA 2IXFA 1ZMXA 3CRRA 1ELOA 1VG0B 2FF7A 2QU8A 2IS2A 3LBNA 1N6NA 2VSFA 1BMFD 1XMVA 5BYKA 4AKEA 1M7BA 3NC0C 4DC9A 2Z6VA 3T1VA 1ETUA 2BKEA 1GFIA 2JDID 2VHJA 3MG9A 3KKOA 2HEIA 2VF8A 3GEHA 3K1JA 3ONWA 3CRVA 3K70D 2H57A 4OYHA 4YMVA 2C9CA 1DAGA 2ZJBA 1FNNA 4KLZA 2AD5A 3B13B 4I1OA 3Q8XB 3QKSB 5FOTA 2WMNB 2Q9CA 3IDQA 4Q4HB 3SEAA 3HU2A 3BB1A 2VSXA 2EFEB 1KMQA 4B32A 1OFHA 1OXXK 1Q21A 3U3JA 1QHHA 2D06A 2WSSA 2Q6TA 4Q03A 4DDTA 3SDZA 1QHSA 3QKTA 3I73A 3TW4A 2ZE7A 1HTWA 2WJIA 4JJZA 3PENA 2V1UA 2WWIA 3Q9LA 4ARZA 2XSZA 4IHQA 1K6MA 5FOSA 1I2MA 1WF3A 1GILA 3VHXA 1TQ4A 1I4TD 2OUKA 4LHZA 4NH0A 1OH5A 3ICQB 2V3CC 3LA6A 3FOZA 3N5CA 3SHWA 5F98A 1E1QA 2RGNC 4A2QA 1AA9A 3MFYA 2P65A 1XD2B 4AD8A 4DT1B 2J3EA 2GRJA 4JVNA 3O8BA 5TDHA 5L3SA 2HT6A 4KBFA 5KNCA 2RH5A 2WIBA 1E4YA 2R8RA 4Z51A 3CX8A 1KJZA 5FPKA 1N5JA 2N46A 4C0QC 1G18A 1X1SA 1JR3E 3PVSA 2IYZA 1W2HA 2XX3A 4W9MC 1Z07A 3ZVRA 4FMBB 1ESNA 1Z22A 4WW0A 1E2QA 3T35A 3BB4A 2ZE8A 2X2FA 4AWXA 1G8HA 4J0QA 3RAPR 4W5JA 2JLRA 2XTNA 1KJYA 2X8AA 4GP7A 4IVQA 4K8OA 1R0WA 3VKGA 4GBMA 2EWVA 2WSSD 4JZKA 1KNQA 1EFRA 3D31A 3QEJA 4Q4AB 3NDPA 2WAXA 3T5DA 2QMOA 3AF4A 3FE2A 3CONA 1SVOA 3QI2A 2BKUA 3AH8A 3T15A 4CT4B 1R8SA 4GSYA 2J7PA 3ZS8A 1FMJA 3BD9A 4M0LA 5JEEA 3FHCB 3CNOA 3HYTA 3LWNA 3QG1A 2JAQA 2KI5A 1E1QD 2UKDA 3I8XA 5AJVB 1NSTA 4NL4H 4JVMA 4PZLA 4NCKA 3ZLJA 2QMHA 3AGPA 5FH9A 2GVDC 1Q44A 3TGPA 4MKFA 2IYLD 3NXSA 2DYKA 4FINA 1WB9A 4MH0R 4PHFA 1Z8FA 4Y0AA 3KKPA 3K70C 4U00A 3K70B 2PT7A 4LJAA 1OIWA 3UKDA 2FNAA 2RB4A 2A30A 4JL6A 3CM0A 1WDTA 4M1OA 3NBXX 1NF3A 4M1TA 3DHWC 1LNZA 2QAGA 4KFSA 2ZRPA 3GCGA 3NH9A 3IEVA 1KI1A 4POAA 4ZCMA 4IFEA 1JB1A 1LV7A 5AJWA 5JHHB 3C5HA 3HWSA 1FTSA 1GOTA 4LWZA 2I3BA 2XJ9A 2JLYA 2JCSA 3RLFA 2ZI9A 2WJYA 3RC3A 2GNOA 2X77A 2OCBA 1HE8B 1XFAA 3OHMA 4OQMA 3BC1A 2GJ8A 4PQYA 2FZ4A 1XTRA 2D3WA 2O8DA 4PX9A 1VHTA 2LWIA 1AGRA 2OSBA 3ZD7A 4Q48A 1G8GA 3LRPA 2BMFA 2J7PD 1LVGA 4QBIA 3LQQA 2VP5A 2CE7A 4U5XA 3UG6A 5KTYA 2ZROA 4MGZR 2EYUA 3O8DA 1PUJA 1W36D 3W6PA 1W5TA 4D4KA 4DIEA 2H7VA 4YQFA 5JMTA 4LBVA 1VG1A 3TAUA 1O3YA 2G3YA 3P4XA 1NJGA 4DCNA 1A82A 5FPSA 5EXSA 4LV5B 1F2UA 2FWRA 3ZD6A 3SBEA 1Y3AA 2OO7A 3A1TA 3T12A 2ZU0C 2C2HA 3B7GA 2R44A 3T06B 4AI6A 3R20A 4JLBA 4HB0A 5JBQA 4CT5A 1CULC 1QHYA 4LJ5A 4FXPA 2HCBA 3CRW1 1M6NA 1T4GA 4E09A 521PA 3EAQA 3LD9A 3GJ8A 1IXZA 1PJRA 5H1YA 1T3HA 2PT5A 3RS7A 3E2IA 3KJHA 4II7A 4ESHA 2RAPA 5F9FA 3WXMA 5HCIA 2F1IA 2AX4A 2KB0A 3PQCA 4GFDA 2ZS8A 3VNUA 4TYWA 1YZNA 4Q00A 1QHHB 5KDLA 1U8YA 4W5HA 3FB4A 3AVQA 4ACAA 4Q7LA 1KKLA 2CNWA 4ARZB 3QBVA 2QE7A 5JECA 2IT1A 3SZRA 3GLIA 1SQ5A 3AVPA 1E0JA 5SZIA 1DS6A 3V4FA 3CWZA 4DCVA 3IIMA 3WYFA 1MKYA 4LSGA 3CH5A 1VYTA 5E7JA 1CF4A 3AB3A 4KBGA 1ZD9A 1JEDA 5L3QA 5DHFA 5HE9A 1Z0KA 3SYKA 4IJMA 1M8PA 5GVSA 2AK2A 4MDFA 4JLMA 2JGNA 1YZUA 4RSGA 4WZAE 4V0ME 5BXQC 1N0VC 1XZPA 2H92A 5JHGB 1E9EA 2RMKA 2QMUA 4ZDIA 5K8IA 3QOFA 4IOJA 3WMGA 4AKHA 4Q1BA 4XD7D 1N6KA 1BIFA 1COWD 3K0CA 2O8EA 1P73A 3BGWA 1TNDA 2QP3A 1U0HC 2CVFA 3DEFA 4LBZA 4JLJA 2OFOA 1GVNB 5G41A 3K0AB 4NZYA 2RGBA 2DWQA 1XPOA 5C4MA 2IYUA 2XZOA 1R5BA 3IIJA 2BJVA 1QZXA 4PZZA 1NBMA 1P60A 4JSTA 1CTQA 1J99A 2BEKA 1QVAA 2A7QA 2F43A 1J8MF 1A7JA 3IUYA 4YONB 5CLLA 4LJ7A 2CCGA 4BFWA 1W36B 3D7MA 1W36C 1I2DA 1XEWY 1RW4A 3CZPA 1ZIPA 2QY9A 4GRAA 4ZDWA 4TZ0A 3IILA 3WHLA 1AN0A 2ZE6A 1D2MA 2BCJQ 5FPHA 4M1KA 5FOXA 5TB5A 2ZUCA 2ZYUX 3VAAA 4G3XA 2QTFA 5J4VA 2WIAA 1X3SA 2GETA 1L7VC 2JIZA 3AVXA 1OH8A 1GNRA 2C04A 5EZ6B 4M8NE 4GMDA 4NTZA 5A5GA 1NY6A 4UNRA 3RRNA 1Q22A 3KB2A 2HLDA 4BLSA 4DVGA 1H8ED 1YZGA 221PA 5EE5B 5FUWA 1WBBA 4F4JA 1NN0A 2RGDA 2EVWX 2QAGC 2EQBA 2QAGB 1QRAA 2J41A 2NPFA 4AIIA 2ZRCA 3EWAA 1G1MA 1PV4A 1H8HD 2ATXA 2OT3B 4JS0A 2JJ1A 4UQOA 3L43A 1JEEA 1KO5A 5DIFA 2O8DB 1LY1A 4I1UA 4MQBA 2ZSAA 1VG8A 3I72A 4X8MA 2ZITA 5BQ5A 2ZAOA 1P2SA 1W0KA 1EX7A 4PHHA 2G1KA 2ZRIA 4RY2A 3UMRA 5FBQB 1H65A 2BHRA 2OAQ1 1JECA 1AZTA 3RANA 1RRCA 4C2TA 5DLQC 1MH1A 2LKCA 4GI7A 2B7BA 4NKRA 4DSTA 3VX3A 4E07A 3QXJA 2ZUBA 4O2LA 3I32A 4OI4A 1CKEA 1VMAA 1YRBA 1WA5A 5JJIA 2KJQA 2ZJZA 1Z29A 4AC9A 1IY1A 2QGZA 4K46A 3PUYA 4TLDA 2HLDD 1FUKA 4F91B 3KQHA 3R8FA 4IEIA 1DO0A 2PZFA 3N2IA 4CEHB 1JJVA 3KKQA 3SI7A 2W00A 1RJ9A 3KXLA 4NPHA 1T0HB 1G20E 3DZ8A 3UWOA 1KO7A 1E2KA 2TMKA 2VSOA 3KXKA 4A0HA 2YYZA 3W5JA 2BOVA 1KYIA 1E2EA 4MRNA 4DDVA 1AKEA 5K8LA 2GJAA 1XPUA 1LFDB 2KBFA 1YQTA 2E87A 1PZNA 2C77A 5IRCD 3PUWA 4M9SA 5CYPA 4UXIA 5FPTA 3GLIB 3GP8A 1G4UR 3ZQ6A 2WKQA 4Q1CA 1C1YA 1FTNA 1HURA 1Z2AA 3QBTA 3CRQA 3BJIC 1UKYA 4TSFD 1ZP6A 2A9KA 1T6NA 4MRVA 1FOEB 4A0GA 3TAHA 2OLJA 1UBFA 4A4DA 4PPNA 2OG2A 4TMWA 2H5EA 3VR1A 3IHWA 4EPRA 3GFPA 3BK7A 3FMPB 1KO4A 5FOVA 1OH7A 2DWPA 1KSJA 2ZJOA 4ASUA 4US0R 4Q19A 2VEDA 3UANA 2JA1A 4Q02A 3Q3JB 1TF7A 2ORWA 1E9FA 2GEVA 1ZBDA 2D7CA 3TUZC 4BE7B 3CX6A 3OFND 4US1R 3FMIA 3TMKA 3QVVA 1G3QA 3EZFA 3K0CC 2N42A 2BWJA 2X1VA 1GIAA 2IUTA 2NGRA 2QP9X 4MRRA 4GT1A 4D25A 4DZZA 2A5JA 3RWOA 4QNMA 3FTQA 2KSQA 1YZTA 3HPQA 1EFCA 2IC5A 4MUAA 5CLQA 2FFQA 4TLEA 4F93B 3WNBA 2RHDA 3HR7A 2C9OA 1E9CA 4GOJA 3RVBA 4BZXA 3DOEA 2F3TA 2QG6A 2P3SA 3GQBA 2F1RA 1JALA 2FG5A 2Q3FA 2CL0X 3RRZA 3MUFA 4B47A 2W6IA 2OESA 1XTSA 1NVWQ 1BS1A 3IBYA 4F38A 2GXAA 4V0KA 3A36A 3AEZA 4L15A 3PR1A 3CO5A 2J45A 2ZJAA 4LYHA 2J87A 2QSZA 1KSGA 1CEEA 1UBCA 3N2EA 1R7RA 5B30A 3GJ3A 3K9LA 2FDCA 1XBTA 1TEXA 2Q0HA 2F55A 1XPRA 3R9XA 2FSHA 3FDIA 4A15A 2SHKA 4MGYR 2GJKA 4QBFA 2NO6A 3NTUA 4JL5A 2BMEA 1AS2A 3FYHA 4ASUD 4N3NA 2CLCX 5CB8A 5EJEA 4RJLA 1Q1ZA 1VYUA 2O8CA 2ZYTX 2ZYWX 2OM2A 3DOFA 4AKGA 1OXTA 1HH4A 5HCNA 3B8HA 2YJTD 2H18A 3QF4A 3QXCA 4G5RA 4Q18A 2VHQA 3EZ6A 5ANRB 3SU8A 1Z5ZA 5AR1A 4B6EA 1M2OB 2QRZA 4DCUA 2PX3A 2FFBA 2VA8A 1GKIA 2QAJA 4BLTA 4ZIRA 2QORA 4Q1EA 3KXIA 3OESA 5FUXA 4L16A 3R9IA 4AG5A 5EP3A 1A4RA 3U7FB 3CR7A 3F5FA 3QENA 2W6ID 1M7GA 2LKDA 1S4QA 1WXQA 1NJFA 2E1RA 2NZJA 3NH6A 2BV3A 3M6AA 2IS4A 3PUXA 3OE7A 2ZTSA 1G6OA 2AWOA 1DE0A 4P4TA 1KI8A 4RD2A 5EZ5A 1B23P 2QL6A 3LH5A 4BFTA 2G0TA 2FJUA 3SJZA 2CLSA 3WHKA 2JJ8A 2WJHA 4JLPA 3EZ9A 4LHVA 4D0LB 3U5ZB 4QC2A 2KE5A 4QJ4A 1TU4A 4JYCA 1G3MA 1G5RA 1W1WA 2DWOA 2KWIA 5AJXA 3B9PA 3AVYA 1TF5A 1NIJA 3MGCA 5FTNA 2G0NA 1GZSA 4IEEA 3K9HA 4PAOA 4QNRA 3GJ0A 2O8BA 2FFHA 4ZKEA 2RGGA 2OBMA 3JZAA 4RD6A 5LDDC 3CPEA 2GXUA 1GL6A 4DUGA 3TLXA 1N25A 1UDWA 2AR7A 1EG7A 3KX2A 3FWYA 3A58B 1VIAA 1GM5A 1DELA 4RFSA 5L8VA 2Q9BA 4GDFA 5DH9A 1XD8A 4B3XA 1KOFA 5J47A 4LJ6A 1P61B 3ETLA 2HF9A 2E9SA 4C0LA 1DVRA 4BEJA 4URXR 3W3AA 5KSZA 4Q21A 3OEEA 1EGAA 4P33A 3ZYCA 2CBZA 4Q1DA 2OBLA 5SZKB 1IONA 5AWFC 1DG3A 2REOA 5DYIA 2FA9A 4KVAA 4CZ2A 1UKVY 3M1IA 4PSVA 1E79A 4KJZA 4Z8XA 3TH5A 3O8CA 3EPJA 1FQKA 1ZM2A 3FKSD 3GLIE 4H1VA 4LK2A 1TU3A 3R9WA 1EWRA 1TQ2A 3IGFA 1JAHA 4NU0A 4LHWA 5KDOA 4W7SA 1DAEA 2QBYA 3CF2A 1W47A 4LI0A 2P6NA 2ZRKA 3CUEF 3QXXA 3RHFA 3R7WA 5AK0A 1SXJA 3MJRA 1NMZA 4IXMA 4B43A 1CJUC 4WAUA 4QXAA 4M9XA 1ZD1A 3L0IB 1E9DA 2GAAA 4KFUA 2VP4A 4DUGD 1EWQA 3DM9B 4BFVA 2UVQA 1T91A 2WICA 4LDJA 2QGNA 4OHVA 1KK3A 2AFIE 2ZPTX 4HAVA 2PCLA 5TVKA 1G21E 1E32A 3OEHA 5CITA 2IYRA 3KQKA 1US8A 2RGEA 2WOJA 3QE0A 4DLWA 3I3SR 3OAAA 2XOKA 1ZNYA 2FSGA 1RPZA 3B2EA 1X8KA 4KAXA 1TUIA 3ZH9B 4PHTA 4LUCA 4XWAA 5J4HA 4LYAA 5L3RA 2ASEA 2QT0A 2R6GA 1KMHA 1XTJA 4NYMQ 1KAGA 4S35A 1N3BA 3A6PC 1IY0A 1NBME 3GLGA 2FGJA 3QEOA 3CWQA 4A2WA 4DRZA 1XF9A 2C99A 2GCNA 1R5OA 4G1UC 4WBSA 1SHZA 2WWXA 1MRNA 4XWKA 1CU1A 4JSYA 1NN1A 3KJIA 2Z0MA 5ELXA 2NO9A 3B60A 2O8CB 1XP8A 4B33A 2OXRA 1A2BA 2OCAA 4HLUA 3VR3A 4BFUA 1N5IA 1GKUB 1SVSA 3QF4B 1SZPA 4CW7A 2ZRDA 1SXJD 2C03A 5CIWA 2Q9AA 1A5TA 4AG6A 1XEFA 5KSOA 4LJ4A 4TLBA 8OHMA 1AQUA 3I8SA 1XD9A 4LGMA 1E6CA 4A1FA 2X19A 3EWSA 3KKMA 3PFIA 4M53A 1ESMA 4QHSA 3ZZTA 1O87A 2WKPA 3ADKA 4P4SB 1NG1A 3TRFA 4CF7A 1R0ZA 3QPVA 3NIBA 4DBLC 1P75A 4ZV4A 3OEHD 4L4UA 1BYUA 4PQFA 3H0KA 3EPLA 4FWTA 1E2MA 4RD0A 3OAAD 3P26A 2XOKD 4HAWA 3QKRA 2FX3A 4GOKA 2FOLA 3Q7QA 1UJ2A 4HAXA 3HYRA 3SN6A 2BM1A 1QVRA 2J9RA 4QJ5A 2RCNA 1F3OA 1YJ5A 1EX6A 4QG7A 1JPJA 2ERYA 1G3IA 4JYBA 1E3MA 1P5ZB 2V8OA 3OZXA 4PFSA 5B2ZA 1G5TA 1GP2A 1NMYA 2P5SA 4LX0A 2ZEJA 1WE2A 2B21A 2ZRBA 4LV8B 3U3MA 1M1YE 5JWHA 1E0AA 1LTQA 1D5CA 4ZKDA 4C0BA 5M04A 2GDJA 2ECKA 3MWKA 1G64A 1VTKA 3F0TA 3TVTA 3RC8A 1Z6TA 4P4UA 3B1XA 2VP6A 4OBEA 4TTQA 2QI9C 1TL7C 3UG7A 4CVNA 3AVVA 1F5NA 2O8BB 421PA 5JI3E 4DB4A 3A1WA 4N1AA 4XTCS 3DKVA 2ZVQX 1ZM4A 1IN7A 1J2JA 4JLVA 4LY6A 4RD3A 4TWZA 5TY0A 4H1UA 4EAQA 1YRAA 2NQ2C 1QHNA 3K0FB 5HTKA 3FKQA 3NEJA 3U2QA 2HJVA 2HCJB 1XMSA 1OFUX 4RFSB 4MUBA 2IK8A 3L8ZA 5D3QA 3LX5A 3NBFA 1I4LD 2OBNA 2XSZD 1NN5A 4PHGA 1KO1A 3HR8A 4JVLA 3TSWA 2OE2A 2XGJA 4G01B 1YR9A 1CR2A 2PX0A 2XZLA 1FNMA 3WBKA 2WJVA 4NHOA 4HI0E 4DLXA 2ORIA 4HDQB 1VDZA 3X2SA 4Q9KA 3TUIC 1GDDA 4XWOA 2QENA 2ZJYA 3KTAA 1FL9A 4Q4LA 2J59A 2O0KA 3GEEA 3WMFA 2PLFA 5JEDA 5EP1A 1FP6A 3W3ZB 5JRJA 2WWYA 1Z6XA 3KJEA 2YINC 3CH4B 3DVLA 3FMOB 2X2EA 2C78A 3KL4A 2ODNA 3WNCA 1D8TA 2C98A 4IVRA 2QBYB 4A6XA 4ZCIA 3CR8A 1E2IA 4FN5A 1CR4A 4LZZA 1D2NA 1YZQA 2OXCA 4O0MA 1GITA 2YWHA 4HAUA 1DOAA 2QNRA 3R7WB 1KKMA 1SXJC 1SXJB 2HV8A 3IQWA 5EE3A 2BC9A 3LY5A 3LDAA 4C0HA 1YZLA 2ONKA 1T0JB 4DLUA 1E98A 2XTZA 1R0XA 2G9NA 1TMKA 1YR8A 5CB6A 2CK3A 5SZHB 4QHYA 1J70A 1N6IA 4JLKA 4K81B 1D9XA 4RKEA 1EFRD 1HT2E 1ZNWA 1RZ3A 1NY5A 4B3DA 2OEPA 4URVR 1US8B 1FP7A 4E5UA 4BQSA 4AKIA 2Z43A 3AF3A 1CR0A 1MABA 2G1JA 1QDEA 4OQLA 4BWYA 1IXRC 1R0YA 4PZYA 4RKFA 3SYNA 1OT3A 4A0FA 2D2FA 4OK6A 1XJCA 3R8CA 2CDNA 3B1ZA 2NO1A 1KMHB 1W46A 1KK2A 2K5UA 3RS2A 2ZI5A 1S1MA 3GLGB 2F1HA 2DBYA 5K8TA 2GJSA 2BBWA 4IVPA 5EQTA 3THXA 4OK5A 5H8WA 3KZ1E 4ITRC 821PA 4HYYA 1LS1A 2P6RA 3LXXA 3MCAA 5KO2A 3K09A 3SBDA 1JPNA 3K0EA 4LYJA 5JZVA 4OHYA 1IAQA 4OI1A 2J1LA 2YOHA 1E2JA 4HDOB 3IHLA 4L9WA 3X1DA 1SGWA 3B1VA 1XJ0A 2HF8A 3VU9A 4WVFA 2JLZA 2JJ2A 2OLKA 3NBYC 5FL3A 3TK1A 3KQNA 1GNPA 1Z06A 4V0NA 5IK2A 1XB2A 4JL8A 4XIGS 1IN6A 4YMSA 2IWRA 1ZM9A 3W34A 3U7HB 4KLNA 3AP2A 3HDTA 3I4LA 4JBYA 2EFDB 2IX3A 2ZRNA 3M0EA 5FBWB 3K9GA 2HT1A 2AK3A 4JLDA 1AS3A 4MITA 3QKRB 2WWFA 2O5VA 1ZUHA 4RZ2A 4CRWB 3DM5A 4DEXA 1LF0A 1NVVQ 3OIYA 3U6KA 1PLJA 1S1CA 2FPMA 1NL3A 4ZI3A 1IN4A 1D2EA 1G7TA 3PG5A 1VCOA 2Q21A 2WWHA 3CKLA 3T1TA 1Q1BA 1KDOA 3L0PA 3LBHA 1CIPA 1Q1EA 3KJGA 2IYVA 4PPGA 3GLHA 4Q4JA 2PCJA 4B3CA 4NYMR 3FFBA 5L3SB 1NMXA 3J81k 3GJXC 1TPZA 3AF1A 2CHQA 3BH6A 2FMXA 3LAWA 2QTHA 4AURA 3ADBA 3SQXA 2ZS7A 2QT1A 2VRWA 2ZRFA 2A5GA 2IXEA 5BN5A 3THWA 2IEYA 4LCBA 3F8TA 4YDHB 4EQ6A 1S96A 3DMNA 1UADA 4KCGA 3EPKA 2AHOA 1M7HA 2JJ2D 4LRWA 1EFUA 2IEZA 3BH0A 3PEVA 3RSLA 3UMSA 1L2TA 2ZR0A 4DLVA 4KFTA 3C7KA 5CJ2A 1GRQA 3LLUA 1GL7A 1GAJA 5DO9A 2IYSA 2NMVA 2CNWD 1KY2A 2L0XA 1UEIA 2QE7D 4KVGA 2PLRA 3EC2A 1Z0AA 5FTLA 3SJCA 3RRMA 3BIFA 1Q12A 4KSCA 3C14C 4DXAA 1LF5A 3HU3A 1KDPA 4R2HA 1JBKA 2V9PA 4C0JA 3PCRB 2C5LA 2MMGA 3FVQA 3U3RA 3ZVMA 3DKPA 3FHTA 3NKVA 4LC1A 4MYUA 5TARA 3H2YA 2GZAA 2WV9A 6Q21A 1OH6A 5G3YA 3FPAA 1QHIA 5JS8A 4NCHA 1GWNA 2CL6X 3WYGA
chains in the Genus database with same CATH superfamily
1QH8A 1XMPA 1SIWA 3LNCA 1DDGA 2WAAA 4H2DA 4MIEA 3BAFA 3B1JA 2Z09A 3R5FA 1YB5A 4YRKA 3LW7A 3H4MA 3PVCA 4HZIA 4D2IA 4HNTA 3E9ZA 3U9TA 2GERA 1AX9A 1CETA 2P75A 4IXTA 1CQXA 3H1GA 4RVCA 3RDPA 4W5WA 4GPBA 1Z83A 3CV3A 2WD8A 4FXOA 2ZXUA 4HQRA 4MJXA 4N49A 2XGMA 3BQNB 1CHNA 1EHIA 5CLJA 4JX9A 4IOMA 4LYEA 5CH3A 4QPCA 1Z8DA 2OGSA 2W71A 3O9ZA 3LPCA 3QPDA 4ZMRA 5CEFA 1XALA 2BZGA 1MX3A 3H8WA 5EIBD 2QLNA 4D92A 4YX9A 4P84A 1TADA 5AVJA 3VHQA 3J80A 1QP8A 2O59A 1G5PA 1T29A 1XXHA 1NBMD 3V3TA 2RGCA 4LJKA 4LTDA 1TTTA 5DGXA 1E6WA 3LT2A 1BKYA 3WYNA 3E22A 3I6QA 2QUAA 3NFRA 1G55A 4RVUA 1W1UA 4CUKA 1P1BA 5JASA 4KR7A 4FQ8A 4I1VA 4Y2XA 4Z1MA 1BYIA 4HB4A 1FFHA 2X5KO 4REQA 5A5VA 4PLWA 2XZPA 2CCKA 5IKXA 1OBVA 2E89A 3EXIB 3BORA 4M36A 2GHIA 2QRVA 2YOFA 4O4JB 1EP1B 1Z6AA 3H1PA 4MWSA 4NCXA 2EFYA 3DC2A 1QIDA 5IT5A 4XDGA 2Y77A 1R6UA 1PLLA 1W85A 4BPBA 1NT4A 2G07A 2OUIA 4F9FA 2JLQA 1L6IA 3H4IA 2IF0A 1FLAA 1E6MA 1OGJA 4Y9DA 5CM8B 3VGPA 3EPHA 4HNQA 3L8YA 2QLLA 3GLFA 4ADSG 5AVXA 1E60A 3N70A 1IBRA 2FQ1A 1XEXA 2OCPA 3WMEA 5BUZA 3KWJA 2XOEA 3OLQA 3LKDA 3RNLA 1EM6A 4C4XA 4TKZA 4YCCA 3NR2A 2I80A 4CEIA 1H4TA 1UQUA 3T9AA 2R48A 1YVDA 1VLZA 4RHYA 2RGWA 4X8HA 4NK4A 4C5AA 3GRUA 1GEGA 3NDIA 3MWEA 4OGWA 2J6CA 3S27A 2IHJA 4F6CA 5T4HA 3SICE 2O6LA 5L45A 5LMZA 1U8AA 2HO4A 5IWAB 3ADDA 2IGBA 1CUWA 1Z25A 4XCVA 5E6SA 2ZYHA 4MK4A 5IJ9A 1LI5A 1LQ2A 3AHFA 3O73A 4R83A 3B6EA 3DEHA 1GZUA 1C4OA 1LBTA 3FIUA 2PGXA 4XGRA 2C3YA 4K0RA 2PT6A 4PANA 2WD7B 3NGXA 1ZUNA 3WNDA 2AS0A 1LX7A 2QN6A 3JD4A 4Z2AA 3PDUA 4FR0A 3UV7A 1P9WA 3L79A 4UBKA 3FOBA 3NDBB 3EAFA 2NZ8A 2AC2A 3RO7A 5D51S 2IHVA 4HDKA 2XAAA 4I14A 4UD6A 2GNAA 5FWYA 4TV8B 2VG8A 2OBFA 1EVQA 3E3MA 1NRIA 1VGRA 1Y9ZA 1HDXA 2XYVA 3T7TA 1ZC3A 1I0ZA 3OIWA 4WZBB 5DYWA 3U7RA 3DPIA 4I4TA 1F2VA 1N5DA 1YIAA 3TIGA 5KOYA 1XWFA 4GXQA 3I5XA 3ED5A 5JZVA 2IYOA 3GLHB 4DPKA 2R751 5CEJA 3AWIA 3ENQA 3LX8A 3R0JA 4M86A 1MX9A 3W90A 1DIGA 3FPHA 3W1WA 2J4DA 4QWWA 2FFRA 3ZZ1A 2HWKA 1IOZA 3IMGA 4U63A 4YRGA 5EJ7A 3IP7A 1USUA 2VL7A 4KQXA 3FMFA 3TLEA 3O7WA 2Y0EA 5CTAA 3PHJA 2AXEA 1IL0A 5DOZA 3R7LA 5CCBA 4F2GA 5J2UB 1U4SA 1ZU4A 1N2IA 1SN7A 2I54A 3THWB 3JVIA 1DRUA 1Z18A 3K8YA 1AXEA 2VRCD 4YXWD 1M1UA 3KUKA 4DKXA 2YC4C 5D01A 4JT2A 1XVAA 3FSRA 3M4ZA 4EVSA 2DAPA 4JVOA 2GTHA 5AKZA 1KDRA 4S24A 3FHLA 1NW4A 4FFWA 5H68A 2QTRA 1NF9A 2BGJA 4G5OA 5EIBC 3S7ZA 2XCTB 3KQUA 1X1BA 4MYDA 1JAZA 1ZYUA 1Z2PX 1I30A 1NOIA 1UK8A 3DCYA 4S1PA 4WOKA 1UKBA 5DHAA 3P7MA 4CQMB 4D80A 2FPGA 2JA2A 3OSUA 4HRAA 2BHSA 1E1RD 1TO2E 3SC6A 3ELYA 3HABA 3WSWA 2RHBA 1WMEA 4PPQA 4TTPA 1YRLA 2W98A 4ZHQF 3KTOA 2ALJA 1KNXA 1XCPA 4AY2A 1NVVR 2V1XA 1ECLA 2YWGA 5LQSA 4AMGA 3VSDA 1F06A 1ICIA 4Q3CA 4YV1A 4OB8A 1OZHA 3H2JA 3I09A 4KMMA 3UW1A 2BCEA 1Z12A 2I62A 1GZ6A 2A67A 2WHXA 2OP0A 2W37A 3ZGLA 3DWGA 4YT2A 5K8UA 3BF7A 1JAXA 1QH8B 3GJ6A 5FL7D 2ZRMA 2VJMA 4NJOA 2ONJA 4DLAA 4RZQA 1GD1O 3VR5D 1O6GA 4PC1A 3O4IA 4KFRA 2IQ5A 4ME6A 4Z54A 3WYAA 2F9FA 2VAXA 3VRHA 3GNSA 1VMKA 1VLVA 5ITSA 1OXSC 5KWVA 2O8FB 1CG6A 1RTKA 4H7PA 3VDRA 2H8KA 2JIPA 1EFAA 1E58A 4RH0A 3ZE8A 1AURA 2WP8J 3QBDA 2BGTA 2HM7A 4K86A 3E84A 3WLNA 1L5MA 1E92A 4PGMA 4OFXA 5AVSA 1GV0A 5FADA 4GP6A 2YN2A 3F71A 2PAAA 1V41E 3OPNA 1O94A 3BSWA 1BFDA 1P7WA 4OI0A 3I61A 1UKCA 1BEEA 2NX2A 3OCYA 2J3MA 3B2NA 4KQHA 2VQ3A 3RV4A 4KKVA 2GKGA 1KYZA 2HZ7A 1XXHB 3M5CA 3NGLA 2PAFA 5EE0A 3L01A 1KJ9A 1F6BA 3WJ2A 2FWIA 5K0FA 4XLLA 5C7LO 4I1SA 3HJGA 1NRWA 3E22B 4KNWA 2Q6VA 1KI2A 1CUVA 2P6OA 3UFXA 3MINB 4REQB 2BKXA 3SF8B 1YU9A 4Q4HA 1PWEA 2OK7A 5A3JA 2QRVB 3HCDA 2Y1OA 2E3JA 3HU1A 3LRXA 4L6AA 5GV7A 6REQA 4HS9A 4FHZA 4TM7A 3QEAZ 8ADHA 3HYCA 5DX0A 1NE7A 3FLAA 1W85B 5C4GB 4NV0A 3D5QA 2DQYA 1G8JA 2V6JA 3IVGA 3LY7A 4GQBA 4KR9A 1B1AA 4PSDA 4GWLA 1E7SA 3C3AA 5IKOA 3GLFB 4DCGA 3I5YA 3A2KA 4B7UA 2P11A 1XEXB 2WWRA 2X0NA 3MNFA 3WBBA 3F8WA 2WPDD 4JJ7A 4HLCA 4OHFA 5IVPA 1G2QA 2QOEA 3PDHA 4WBNF 4IOLA 5HKKA 3L7NA 1IMJA 5KQMA 5CDHA 4ABYA 2DXIA 5TT1A 1W96A 2QD3A 4MLDA 5E6SB 1MA0A 4PXYA 1TZ2A 4XX1A 1Z13A 4BB5A 4F3YA 7ABPA 2IV3A 4QM7A 3JR3A 1BVRA 1U9IC 2W6QA 3AB8A 4D0GA 2AQKA 1V11A 2NXJA 2FR1A 3PDJA 3LT4A 3PFKA 2L42A 1JG6A 4M46A 4OF4A 4PYOA 3VYVA 4EFLA 4ILKA 1Y4AE 1ZUNB 4L4SA 1KP2A 1KBQA 2IU4A 1Z6QA 4K03A 4WCFA 5LQNA 4NXMB 5K3EA 1U9ZA 4DMHA 2JKYA 2BM0A 2HJSA 3V1LA 2IPNA 3N7AA 1PT8A 1SVNA 5FLXA 4HAZA 1O0CA 4WK0B 2CZQA 2E4WA 2ZR7A 2VXYA 3PXEA 5FWYB 3HWX1 3IUJA 1VBNA 4YASA 4EIWA 4J0HA 1XU9A 2GBLC 2XEDA 3AIMA 3BJZA 3E9NA 3N07A 4DAEA 8LDHA 4NCNA 4GR5A 2ZR9A 3LOQA 3B78A 4I4TB 4LOAA 2YUIA 1INLA 4EGSA 5G1NA 3ANXA 4OFWA 1H85A 5F1OA 3TG8A 5LD2C 1ZI9A 1X74A 5EE1A 2PKEA 5I7SA 1J06A 2ZU6A 4B81A 1BG6A 3D3JA 2WJGA 1GL9B 3ROMA 1LW7A 3UAYA 2ZJ1A 5KSYA 5LWQA 4P7GA 4WI1A 4UJ3A 4F12A 1C9KA 4NF2A 3LLCA 1NUHA 5ICSA 3HA3A 4WZBE 1XOIA 2CB9A 3FZEA 3MRSA 1D3AA 4CKWA 1XLVA 3FD8A 4YCAA 2XDYA 5E1DA 3GLHE 3ZWVA 3M4XA 1T26A 1MPTA 2CLFB 2FJ0A 3BHNA 3NI2A 2CF5A 3IERA 4BGDA 2VNKA 2IU3A 3ZKWA 1C7QA 5CB0A 7REQB 1K6XA 1QHGA 4ZDKA 1NW3A 2WM9B 3UK0A 3SIXA 2O1XA 1EWVA 2MSEB 4AO6A 3VJRA 4P0TA 3G2OA 2GN2A 4AJOA 4YCDA 2VYVD 3ANMA 3KB8A 2IDZA 2LBPA 3P8ZA 4CM5A 4V3BA 5K5EA 3K1ZA 2I4MA 4I1PA 3BMOA 1V5WA 2R8YA 1IYZA 2XUOA 3OKCA 3WI7A 1HFWA 1SVMA 5ALIA 1VKZA 2FPGB 2VJDA 3DLBA 2UDPA 3LW8A 2BFFA 3MQFA 5CYOA 4OP3A 5HMMA 3KOYA 3ZHYA 2HW8A 1V9CA 2HJWA 1Z33A 2E0IA 3A9RA 3QVTA 4RZXA 5DTQA 4B75A 4D9HA 3VOTA 4QRHA 1OB2A 4OYLA 1VE3A 1UBEA 2ESRA 2OAP1 4PAQA 3TQIA 3GLSA 3P9QA 5A06A 1UOQA 2G0AA 4UBMA 3GJRA 4ZVKA 2GZHA 1NX6A 2VHZA 5JAPA 2HYDA 4KXMA 1YL7A 2FG6C 3R3HA 4GSKA 3ZY4A 4B31A 3WLOA 3IIKA 3QJYA 5AHXA 4G24A 2GWRA 3LTNC 1PZMA 2B7LA 2EX1A 4DZTA 4EUSA 2OCDA 1Y3IA 1KVQA 3VO1A 2JKVA 1H6DA 3N0VA 2VJMB 1I51A 1ADYA 3QWIA 1G8YA 2NZUG 2XMRA 3GH1A 4NONA 1KYYA 4EKDA 1QRUA 3IIEA 1AZSC 4RJKA 2DFTA 1B0UA 2F9MA 1WSWA 2VPXA 3HUFA 4I6EA 4FU0A 1RZVA 1XYGA 2CUTA 3HA7A 1MB4A 3IBGA 1LSJA 4RH1A 1N5OX 1VZ3A 1XNQB 2V7XA 1F9AA 2XCUA 2EG5A 3ZZUA 2AV6A 5HIIA 1NXOA 1E1DA 1NLUA 3MWYW 3SMQA 2BCGY 4ZIRB 4Q3EA 3WGLA 1E3LA 1D2AA 2RK3A 4MV4A 4PR0A 6CHYA 3REGA 1OXMA 1KMNA 1QZ3A 3E0XA 2AI1A 4OHXA 1Z45A 5HKOA 3WGQA 4V2UA 4PG7A 1JQ3A 2GF9A 3T9FA 3DULA 4P35A 1EFHA 1S2GA 3DB2A 1WWKA 5C5CA 1NI3A 3KKKA 1YOVB 2PKQP 4ML3A 3ILSA 3DLIA 2J3LA 3GRRA 3RIYA 3AHEA 2REXB 3I1JA 3UFXB 3R3XA 1G3RA 3TCKA 5JADA 3D0QA 1YZYA 2D4AA 1UFKA 4X5OA 2VT2A 1C4KA 2UV8A 4OQDA 4UREA 1EUCA 5BSEA 6REQB 1UKEA 1Y9AA 5HTOA 1QP0A 1XXHE 1ZHHA 1XQ9A 2WY2D 5IM4A 4W1RA 2AUTA 1EP9A 2QTVB 2VDKB 4EYSA 2FYTA 3GRFA 3OQMA 1GR1A 2NYRA 3U61B 4X20A 4HXFB 3R4VA 3UJAA 1OAKA 3BA6A 4R6WA 1U3UA 1J56A 1R3UA 4NNPA 1IHUA 2VNIA 1OIVA 3KFVA 1K8RA 3BHIA 5EIFA 1SCAA 2YV2A 4U2DA 1X1RA 2IFTA 3FOCA 1YHNA 2A1IA 2NTEA 2PBRA 3Q6IA 2C5HA 4JUAA 4B3IA 4DG9A 1T5DX 4D9GA 4LRUA 1T0BA 4LFAB 3QVKA 3KT0A 3ELWA 5D86A 1VXRA 2WUFA 3GLFE 1E89A 3EMBA 3WGKA 1HBJA 1K27A 2GPJA 5K0EA 2CV1A 3BE5A 3EVEA 2DX7A 3A9CA 4KO8A 2UYOA 3GFOA 3UC9A 4BU0A 3HWRA 1V11B 2YQ4A 1O95A 1FBNA 4FGZA 4C21A 4F96A 1QMGA 4DIDA 5JJKA 4WCFB 1IM5A 3JR7A 3UWPA 1L4LA 2KBEA 1OAOC 2JLBA 4NWIA 5CX1A 3LFTA 4UUMA 3HJFA 1OGYA 2PYDA 3AKDA 2QSUA 2IUYA 3GUCA 2PVCA 3DMHA 4IDHA 4L95C 2A9OA 1P2TA 2DPLA 1M2VA 5AHOA 3SC3A 3CBQA 2GYYA 1Q20A 3M3HA 3D7SA 4RL4A 2Z1DA 5JT1A 3RS4A 2B0JA 1XDWA 2AHRA 2WR8A 1Q0ZA 4A9AA 4PYNA 2OXIA 3UYLA 1I2CA 3F96A 2XCOA 5KREA 1CYDA 4LISA 1HEUA 2C8JA 2FSVA 5IW8A 2BT4A 1JNYA 2WJJA 2ZT6A 5HR5A 3P52A 1JHYA 5IKPA 1FUEA 2AG8A 5IVKA 5I9TA 3MWDA 2Z30A 1B42A 3GMIA 1WB4A 3F9RA 4W8GA 4KOEC 2Z57A 4BO1A 1X39A 2HIAA 1G7SA 4UVDA 4KODA 4BKUA 3TEFA 2E4UA 2NLOA 5E6UA 1ISJA 1PNTA 2VDOB 4WACA 5CM2Z 4CKWB 4DMFA 4XWWA 3FTEA 1RKUA 1NDHA 1NHWA 2I8LA 2VK2A 3EARA 2NZYA 4ARVA 1JJ7A 3GEIA 2FGKA 2ZE5A 3ZBQA 1P5FA 3BE4A 3ZKWB 2R4UA 1GZ5A 2HA3A 2OGWA 5FTKA 2IEBA 3GFQA 4JKYA 4ZVLA 4ENPA 1OKKD 3F2VA 3RVPA 3SGLA 5IZ4A 1LJLA 4FI3F 4WA7A 3TTUA 2MSLA 3H5OA 1T8SA 5KYXA 1ANKA 4XDYA 1QLHA 4HNHA 4KQWA 5IDYA 3GRVA 4MNTA 4XB2A 2NUTB 3BMOB 1CFZA 1IUKA 3IODA 4IDOA 1BA3A 3H1TA 1OLUA 3GZ4A 1LTHR 3R6WA 2AJCA 2M2IA 2Q3EA 4OQZA 2A5YB 1LLQA 4BLPA 3G9XA 1G16A 5TX7A 2VK8A 3RM3A 1HQCA 2J3DA 3HL4A 4TL8A 3RR2A 1K5GA 4XWTA 4MS4A 2PSJA 3ICOA 3K5PA 1U0LA 1YZ3A 1BH2A 2NO0A 4BZQA 2Q9UA 4GL2A 3FRJA 2MYUA 4RHCA 2B69A 1J21A 4C6RA 4CR7A 4CV1A 2B4TO 2YZGA 5KWJA 1GAQA 2JBHA 3I04M 5MN4A 3LQFA 4Q7JB 3R3WA 3LQ4A 1D4OA 2OFWA 2AZXA 1UDRA 1Z47A 3R5TA 3HKDA 3DTNA 5DSZA 3ID6C 5JIBA 3ROGA 3GFTA 4I6JA 5JPDA 2VT3A 4OQQA 1G8PA 1I7QB 4ILEA 3L1KA 2DERA 4FYMA 4DGSA 1DIHA 1UBJS 1X86B 2ISQA 4UW9A 5HM8A 3PTAA 3DFZA 1OFTA 1S2LA 4RPIA 3L0OA 4EJ6A 3RYFA 4CEIB 2Y92A 5DTRA 4YAIA 1BE1A 4NSNA 5GOTA 3K35A 3MAJA 4L7QA 3ROZA 4YP1A 2WUVA 5CDUA 1ZIOA 1KK1A 2J9XB 3QVOA 3SP1A 3M2PA 2NZVG 1N6HA 1LXCA 1UJMA 2OKGA 4ZQGA 5FPYA 5BURA 1ZD2P 2JIBA 1EK1A 2QS9A 5ITWA 3E2PA 4UAVA 3R0ZA 4XW2A 1YL6A 4K5QA 1J49A 4HJXA 1GPKA 3PA8A 1EESA 3L49A 1EUDA 1SVIA 5K0SA 1OTYA 2ZDGA 3EPJA 1E2LA 5BR1A 5BSGA 2CY0A 3KQOA 2AG1A 2TMDA 4C4OA 1DV2A 4CM1A 5C8YA 3E9EA 1UBGA 4GZ3A 3KUCA 2VQDA 5GY7A 4R9UC 5FA6A 4EG0A 3N8GA 4D4LA 1N6LA 1U3GA 2OYCA 4ARBA 1EUCB 3UWDA 4D9CA 3H0CA 4P4NA 1NXTA 1P2UA 3VKUA 4F71A 3R6DA 5I48A 1RQLA 1Z3IX 3BAZA 4TM8A 5LBUA 4Q12A 4AYTA 1P9RA 4YJHA 4C2AA 4TYYA 2Q7DA 2P9QA 3QHPA 3DE6X 4S2UA 3VDXA 4A8JA 1I94B 1N2EA 3IP8A 3RS8A 2OHFA 5KTKA 1BXZA 4UEWA 5F7ZA 4BCCA 4CUJA 1CVIA 5KX5A 1N32B 1KDTA 3CU5A 3G8YA 3ZZ0A 3CLUD 3P96A 4YRZA 5IUJC 1UXJA 2C2OA 1G4HA 2FAXA 4X71A 3BHMA 2ANBA 1U0GA 1VPDA 5FX2A 2AE1A 1M2JA 5TQ0A 2R2AA 4JBHA 3WQRA 4I50F 4KGXA 1WB6A 1JR6A 4NBTA 3DEJA 2O0HA 3C43A 2CLLB 4MWCA 4NC9A 4YWHA 1SKYB 4O4IF 1FPMA 2CHGA 5KWIA 5E2BA 5BSUA 4IH1A 1D1PA 1UDAA 4FB4A 2C7VA 4QOFA 3J7TA 5KOHA 2TMGA 5KYGA 1KQ3A 2UZIR 4F4DA 4DR1B 4MR8B 2EJVA 4X54A 1BSVA 1YA6A 1KZGB 4DLBA 3G5TA 3LUAA 3MMPA 3COPA 1EXMA 1Q0UA 2Q1YA 4RWZA 1SPBS 3IB3A 4MUYA 1R9JA 4XVRA 1H8EA 3AINA 3TEJA 1WD7A 4IHAA 4BMVA 5AESA 1G21A 4G5FA 4L4YA 2CMDA 4TN5A 3WNVA 4I3GA 4GC5A 4N3AA 1G42A 1NXPA 3HGTA 4YIKA 1YKFA 5SY6A 2RGRA 5M7EA 2VDUE 2V55B 1RXUA 3GA5A 4ICIA 3VVMA 3KTAB 2HZBA 3NBQA 3VPFA 4B3FX 4DANA 2J5QA 1V4BA 5LLDA 3MWDB 2E5LB 4P80A 2C9YA 2ZRHA 1U7XA 1ZLXA 2R7NA 1NC1A 2XUJA 4B4UA 1DXYA 3A7DA 4MGKR 4QM6A 4K9KA 3HPRA 3HO8A 2R1VB 1DAMA 2Y0BA 1CDZA 1G5FA 5JE8A 3WRXA 3OJ0A 3ORRA 2BFCA 5E6UB 3ZXYA 5K4HA 2UU9B 1SVKA 1W2WB 1XGKA 2WM8A 3GMDA 3ICWA 4G1FA 3KBOA 1FJ2A 4QUAA 4RVNA 2EF0A 2ZM5A 3OKAA 2V6FA 4H31A 1AIPA 2VKTA 4RVFA 1LA2A 3GRZA 5DYTA 4ZT6A 2O1WA 3HVIA 5EG5A 5DX8A 2P0AA 1OD6A 5F9MA 1XSEA 3OO0A 1XZLA 2QLFA 2JZCA 2BJWA 2LRHA 1AXRA 1M1NA 1NXWA 1XLTA 2P9EA 4R1SA 4Q9IA 2O19A 3TOVA 4REMA 3H2HA 1UKZA 2VTDA 3CMCO 3EY4A 2QN3A 2EWMA 1OLUB 3KKNA 3C6XA 4B35A 3HFGA 4QTXA 2F59A 4CQMD 3PIDA 1IVSA 3NJ8A 4R81A 3A28A 4EA9A 2NT3A 1XI2A 4MS4B 3DHVA 2ZI4A 2JVKA 1DX4A 1R4AA 3K92A 4XGQA 3ABRB 3HYLA 2CKMA 2QM8A 4FWIB 1QAOA 4XPIA 4PM4A 5DISB 1X2BA 4RETA 3DR3A 1LK0A 3GN1A 1RBZA 4FI3C 5D3KA 3C3WA 3WYDA 4DQ0A 3FAKA 4XIYA 2I6TA 5EJ8A 5KCZA 2QN9A 3N75A 4MQUA 3QA9A 1T36A 4HS4A 4D0NA 3FJ1A 2ZSBA 1KZHA 3AHJA 3QTLA 2BHLA 4WNCA 2I4LA 1WO8A 1HEIA 1Y42X 3W5BA 1LLFA 2DBZA 2W0SA 3CLUC 2VTEA 3JTMA 3V9PA 3WB0A 4EGQA 2CHEA 5AP9A 4D4JA 4IINA 3Q7EA 2YYSA 2YHAA 3KBBA 3PD1A 3CKKA 1BKDR 3R0QA 1ORRA 3AEUA 4OKSA 4U7DA 4RJIA 1XG5A 2FPSA 4LWOA 4TSFA 4CQLB 3OE5A 1DC5A 5BOVA 1JHMA 3A3OA 4FMPA 5E9JA 5T6MA 4WDQA 3AEXA 3NM6B 4F4IA 1T8TA 4URHA 4HUTA 5H5JA 5C7OO 4FFOA 5EN4A 3SIRA 4X62B 4FJ0A 1ZXXA 2IE8A 3G2QA 5DN6A 4QGSA 1T4CA 2NAPA 2QP4A 5JCOC 3LL4A 2X7XA 4Q82A 3FHOA 2H85A 2YQZA 3AERA 4BX8A 5LN1A 1KPGA 7YASA 4JMPA 2H4YA 1EUDB 3T3PB 1SEPA 3I4FA 3K72B 2G40A 3TX2A 2I2FA 4POOA 5JQWA 1QTRA 1VRVA 2QYTA 3GFGA 3KFXA 1RYFA 4FFPA 4IVNA 2H2GA 2Q50A 2HQRA 5DM0A 3JYPA 5C8YB 3MB5A 5IFLA 1OLOA 3CNHA 4URWR 4PGGA 5EUQB 4F9TA 3T7RA 2B35A 5FAKA 3A1SA 1B74A 4NDAA 2LW7A 1UFOA 1L5NA 3RFCA 2XLCA 4YJHB 3G9ZA 4BMPB 4C7OA 1FTYA 3N3AC 5JY1A 3HZZA 1MGOA 3IEKA 4JKOA 4A8JB 4IQFA 2YV3A 1ECFA 5H82A 1NC3A 2W90A 5L4LA 1NTRA 2JFHA 2JFYA 1K3TA 3HY6A 4N47A 5CFRA 2AOVA 4JR0A 1IBCA 3WDKA 4IS3A 4I4LA 3HP7A 4YTEA 1U1DA 3RFFA 2PUBA 1SBNE 3PC6A 4I19A 1TT5B 1R6BX 2FSFA 1Z08A 2CL7X 3PGKA 5BT9A 5TQ0B 3LKBA 3IEPA 4UNQA 2VUIB 2C7BA 3AJ9A 3W9SA 4AXXA 3T9DA 4IQ4A 5BN5B 1I6MA 3KU4A 5E4FA 5EMJA 3U7EB 3FDXA 3NG1A 2RHOA 5IFKA 4BXOB 1NW8A 2ZSUA 1JXOA 3V4VB 3RVQA 3V00A 3WFIA 1FEZA 3OTOB 5BN4A 4OXNA 5LB2A 3B1YA 3GUYA 5EJ2A 1U3DA 2GEBA 5KOHB 4Q7EA 2VUTA 4JWKA 4DY4A 4EJFA 4CTOA 1BJKA 2PRJA 5ALZA 1CZHA 3OZWA 4RAOA 4F7WA 2VDJA 1ODSA 4GQAA 3QWBA 2WSMA 2REBA 3OF2A 1F12A 4UUOA 5F23A 1Z7EA 1SKYE 3LBYA 4KQ9A 1NIPA 4CKEA 3NKLA 1Q3HA 3AV0B 3H04A 2HK7A 4Y1RA 3TSZA 2IUEA 4EOGA 1F8GA 5HW0A 1J24A 1U63A 4Q9JA 4NMXB 3PNKA 4EMSA 1JEQA 2Q6IA 3O0TA 5AM4A 3AYZB 2EAUA 2FPRA 4WZ6A 2B0CA 1XTKA 3RC9A 3WKCA 3MGAA 3TTXA 3FBGA 1D4ZA 3VQTA 2L69A 3TXYA 2O4UX 5I7WA 3Q85A 2VLIA 2BH9A 3DKKA 3KRTA 4NDZA 1CS4C 2GLTA 4P3KA 1EK5A 3PPWA 4N3CA 4F4UA 5JPIA 4PICA 4GLLA 3MW8A 2JD2A 1U0RA 3IV9A 3QW2A 2HHAA 2BFCB 5AM5A 2D5BA 2YFHA 3KJXA 4L6IA 1OB5A 3H6KA 1XZJA 3BSSA 1TECE 2GCIA 4UATA 4IZ6A 3ACDA 2PSDA 4TTSA 5GV8A 9ABPA 1E2FA 4LTMA 4P92A 3WLJA 1JIIA 1XZBA 5IDWA 3DONA 4ID3A 3R3JA 1M1NB 1O03A 5CVTA 1TQ6A 3SK0A 1DJPA 4DREA 3FF1A 2GESA 1K4YA 3HLYA 2HLHA 1ADJA 3G1TA 3W78A 4GLFA 3WX0A 1GO2A 1MH9A 4BN0A 1KVUA 3I4CA 1S2MA 2PWBA 2ATIA 1P6XA 4FCTA 1BX0A 4Z4GA 2G06A 3QKSA 5ICMA 1N1MA 3A26A 4NZMA 1QH0A 1RQNA 4Z49A 3LQKA 4XPIB 4DMRA 3K4HA 1NV9A 3KG2A 3PEFA 5FRDA 5DPMA 2VZ8A 1YCHA 3PE6A 4IKEA 4IO0A 3U9SA 2NU7A 4P4SA 1EUQA 1NVAA 3MMSA 3PQ6A 4OHWA 2AJ8A 2Q2NA 4I8XA 1JZSA 3SVZA 3JASA 4NYJR 1EZ4A 2PXHA 3F98A 4ER7A 4DKJA 4TUYF 1BFKA 2HNAA 2VO1A 2CDRA 1UZNA 3BWEA 3FGNA 3FTDA 3GJYA 3M89A 4GE3A 1ZQ1A 5DW3A 4M21A 4XYLA 4WJKB 1CQPA 1WOYA 4WK2B 1PT5A 5L3VA 3AEUB 5A05A 2PD6A 1VECA 3B3QA 4S05A 3AUAA 3AOEC 2PUAA 5FCDA 1SFRA 2WAMA 2JGDA 2O1EA 2XLBA 5E95A 3QWAA 5B4UA 1J8DA 2XUIA 3VKHA 2AVNA 2BGLA 3OT4A 1O94D 2Z5GA 5HGXA 1HY3A 3P27A 2PY6A 1E3QA 3DZGA 4OL0A 1T4CB 3D1JA 4M98A 1CX9B 3KR9A 5LMCA 3I92A 1W5FA 3F6BX 4C9BA 3DWFA 3AERB 2P0YA 5DZSA 3VSBA 5C32A 4E4TA 3OPVA 3CZMA 1K86A 3F3MA 3NJ4A 4YS6A 1OPXA 3HC7A 3L0ZA 4AM8A 2ZAYA 3GL9A 4BFXA 4R1UA 1I3OA 5C4IA 3HG7A 5FR2A 5KYUA 2G88A 3NW9A 4AU1A 4NZOA 3WWDA 2POQX 5BQXA 4KQJA 1M0SA 1B73A 2CZGA 3PJEA 4R1PA 2TECE 2XQKA 1UAAA 2IA5A 5C8ZA 1E0SA 1IHDA 1BO6A 4TROA 2ATVA 1CQJA 2A59A 3HEMA 4P58A 4CGZA 2R7LA 3HM2A 3MOGA 5AVVA 4ZQHA 2JCYA 2D62A 4C7OB 2JGEA 3VHLB 3ME5A 1ZRSA 1WXIA 4I8DA 1JBEA 1HQYE 4NEHB 4UHFA 4CM4A 1NZJA 4D99A 3ZDYB 4M7PA 3EQZA 1JWBB 3RSGA 2YN0A 2NN3C 1RMQA 3B9QA 4R40A 4R84A 1QFMA 2IUSA 2BKAA 4CWAA 1JTVA 3TSAA 3IVCA 4EJSC 3ORYA 5FLYA 1TZJA 4FZ5A 2R84A 2AT1A 4BNWA 2SECE 2Y4OA 4RUKA 4YUYA 4QG3A 1SKBA 2VK1A 4FGLA 2ADMA 3L7KA 3PTZA 4RMHA 1QO0A 1DQNA 4Q3OA 2ZB8A 4AZVA 3L6OO 1AKRA 3Q3GE 1L5LA 1CEYA 4LY9A 3GG9A 4BVFA 1B8PA 3PXGA 1NLZA 1P33A 3QWHA 3PYLA 4J1TC 3TSOA 1BMFA 4IO1A 1A95A 5KIAA 4TZ6A 3GNLA 2H2HA 3KSZO 4UNPA 3V8BA 3FMVA 4BV9A 1CUAA 2A5LA 3VC3A 2JLXA 1IB0A 1E7MA 4IRMA 1ZMTA 3B1FA 3E3NA 3EBOA 4XLZA 3CB4A 4CKEB 3AXSA 3ZPXA 4Y1RB 4CLXA 1U8CB 4E5SA 5LZ8A 1LPNA 3HNOA 3O4RA 3OH8A 4HDRA 2CYBA 4BNTA 4WKCA 1JMKC 3D6UA 2WAYA 2Y66A 3ZCTA 1JEQB 3NOOA 1XHFA 1ZR2A 3PUIA 3IEIA 4NOLA 3F4LA 4Q3NA 1KQPA 1Q6ZA 2FSPA 4C29A 5DNYB 4FM9A 1JG4A 3LC1O 1RIFA 2C1ZA 2VP2A 3M6WA 1U7TA 1XRJA 2Y1CA 3DAGA 4G0ZA 1P72A 1Q74A 5J40A 5ITVA 3IPYA 2OMKA 4WGGA 4C4SA 4NFLA 2P4QA 4RE5A 4OOEA 3QOXA 4QSHA 5DBOA 5G4KA 2ZYSA 4P31A 1DO2A 3CPJB 5JISA 1PT7A 3G2PA 4K6FA 3A3NA 4EZEA 1DIRA 1AM4D 3CSUA 4Y18A 1CP3A 5HG0A 3GDOA 3F9CA 4DM3A 4BIMA 1QR2A 3A9WA 5IF9A 5CYFA 3GUZA 2AFVA 4KQEA 4ZHQB 3WK7A 4JT9A 3IUQA 4N18A 1AZWA 1ZMXA 5TPZD 3HY4A 5LM3A 3LC2O 4UCQA 2FF7A 2QU8A 1YAJA 1D0SA 4YGXB 2XMSA 5F5LA 1O94C 4J7UA 4BATA 5FNZA 4NV1A 2OC9A 2ZLBA 1XMVA 5KKAA 3RABA 4CHTA 1J5PA 1FDUA 4DC9A 1ETUA 1GFIA 5K8VA 3FDZA 3HJTA 3KKOA 3OZDA 5IG2A 3GEHA 3OJOA 1ZMRA 1A8QA 3EXG2 3CRVA 3KSRA 1MVLA 3KVVA 3ONWA 2WPNA 3LZ6A 4IDDA 1XJ5A 2ZJBA 1FNNA 4WNAA 2AD5A 5DFAA 1FYXA 2PXXA 3ZV5A 1N1EA 4FW8A 3ACCA 3QKSB 2WMNB 1KPIA 4HK4A 4PPYA 1WZUA 4BO8A 3WSTA 3N0RA 4YT4A 1OI2A 1L1RA 4CMBA 1GGHA 1KMQA 1QE5A 2V8BA 3VMMA 3B2QA 3W8EA 4B32A 1WXWA 4PYKA 2NU7B 4I9NA 3U3JA 4B4KA 2H3HA 1BHSA 3JWJA 4HDAA 5DHSA 5D84A 2OXTA 1FUYB 4DWVA 2RIRA 5K2OA 3FUTA 5KKNB 4GECA 2OOKA 1QHSA 2K7ZA 3T3HA 3QKTA 3I73A 1LDBA 1NTOA 2HLPA 2PR7A 2MR6A 1MVNA 4OUDA 1FC0A 2NTNA 2CMFA 1YHYA 4K9LA 1UPFA 4IHQA 4NIMA 1K6MA 4D9JA 5KQLA 3HN7A 4YJKA 3VNSA 1TRHA 1VRCA 1W8IA 3T4XA 1C3LA 4IJ6A 1TXGA 1SC6A 1WXFA 2VPZA 3LA6A 1NYLA 5AI8A 3VOBA 3WB2A 3ZHOA 4WA8A 5CHYA 5F98A 2QTAA 4ZVMA 2HU7A 5G0SA 3Q3CA 2JGDB 3U48A 1DLIA 1XCLA 1D1QA 4IIYA 1AKUA 3GIDA 3I9MA 5F2KA 3TNDA 1C1XA 4AIRA 1G9SA 2FPUA 3D43A 1FS5A 2XGGA 5TDHA 3FN4A 2QNIA 4KBFA 4RK0A 2WIBA 1TYEB 4MHTA 1MNAA 1BDMA 2R8RA 4O2BF 2Q6OA 5FPKA 1VPTA 1QFZA 1N5JA 2N46A 3KQTA 3R4CA 4LVOA 4Q16A 3GDHA 3ESXA 3BWVA 4YJDA 1IUOA 1KHHA 5KYUB 2AI2A 1Z62A 2FZGA 5K0CA 1NAHA 3N8IA 1ESNA 3N58A 2VPIA 1HNZB 1NQ5A 1Y37A 2P9TA 1E1MA 1YH3A 3AEYA 3ECAA 3MQ4A 1U2DA 3I2HA 4LXIA 5EHQA 4W5JA 4IVQA 2BFBB 4GP7A 3VKGA 3EISA 1SAYA 4GBMA 4XM0A 4BEWA 5KSWB 2JH3A 4ARUA 1KNQA 4E6EA 1OUMA 1POWA 5THQA 4CM4B 5H59A 2QYSA 3FG9A 4IP0A 4B6QA 5H80A 3IX7A 2PD3A 4LF9B 5T3UA 3CYFA 5E7QA 3QI2A 1TEZA 5K0LA 3F7OA 3E9QA 2Q7XA 4IIDA 3T15A 5B6IA 2BONA 1Q14A 3JATA 1SB9A 4M0LA 4XRRA 4BS9A 4D3SA 3FHCB 4PO3X 3QG1A 2OO5A 2QM0A 3BTVA 2HSZA 3IESA 2AGVA 4J16A 2VPYA 2FKAA 4D79A 3H9QA 2J9GA 4J0JA 4DYVA 3C3EA 5HJ7A 4RTLA 4CMCA 4FHCA 1YBVA 2XRFA 4KE9A 1QB7A 1RXYA 1X15A 2QMHA 3AGPA 2WTMA 1ZJYA 3DBVO 1MF7A 3AM3A 1E1KA 2GVDC 1Q44A 1O95D 5KQGA 3NXSA 4FINA 1PS9A 4AZ0A 1GARA 1FNBA 4KGVA 1Z8FA 4DJDC 1F8UA 1XZHA 1WZNA 2WNHA 1FIUA 4YAWA 4U00A 3VTFA 4DA7A 4YA6A 2COUA 4ENQA 5FUQA 1P0MA 5KTPA 1N2ZA 5HQTA 3CM0A 3Q9NA 4HDRB 1RFGE 3NNDA 4M1OA 1HFKA 4L07A 3KSDO 4M1TA 5AHWA 3WICA 4ZEMA 2J3KA 4KFSA 3KHSA 3IEVA 3NH9A 1NT2A 3MWFA 4IFEA 1JB1A 5JHHB 1JFLA 4TQGA 1FTSA 3FM9A 4LWZA 2GTIA 2FI1A 4O4LF 1WJGA