2NTYC

Rop4-gdp-prone8
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
176
structure length
173
Chain Sequence
SRFIKCVTVGDGAVGKTCMLISYTSNTFPTPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFFIDHPGAVPITTNQGEELKKLIGSPIYIECSSKTQQNVKAVFDAAIKVVLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Emb|CAB41934.1
publication title Structural Evidence for a Common Intermediate in Small G Protein-GEF Reactions
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein
total genus 52
structure length 173
sequence length 176
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ntyC00
2A9KA 2QPAA 1HV8A 3H84A 4Q21A 2J0VA 2VSXA 1GIAA 1MOZA 2BBTA 4B34A 3EPJA 1FFHA 1TF7A 2FGKA 4Y0AA 5E3HA 1V43A 4CRWB 3KKMA 5KUTA 2REOA 4C2UA 4NYJQ 2RAPA 2ZYWX 1FQJA 4BEBA 1KK0A 2AWOA 3HU3A 2GXAA 2GCOB 3K0FA 4M21A 2JIZA 4PC7A 4DLYA 8OHMA 3QI2A 3CW2A 4EKDA 2BV3A 1XFAA 2BMEA 3CLVA 3NBZC 1Z3IX 3QSYA 4L9WA 2O8CA 1DO0A 4URYR 1AS2A 1NLYA 5JEDA 5JHGB 5FFMA 3LH5A 2CXXA 3HU2A 4ACAA 2I4IA 1QHHA 1Z0AA 2X19A 2BM0A 1E2HA 2GEVA 2IYXA 4TQ9A 2AD5A 2Z43A 4BFYA 3RS2A 4GNKA 4BFTA 5KSPA 4AYWA 2DWPA 4LYAA 3FGNA 2XTMA 2ZYTX 4M1SA 2WZQA 3B82A 3KTAA 5BQ5A 2ATVA 1E9BA 2HCJB 4ZDJA 2QROA 4QNRA 2PJRA 2J0SA 4A1FA 2B8WA 3BORA 4MKFA 2VHCA 4CYMA 5AUOB 5G40A 3KUCA 1K6MA 3MWYW 1TQ6A 5JSZA 2W00A 2CEAA 2JGNA 3P4XA 4DDVA 5M04A 3F8TA 5EE9A 5BN5A 5KU1A 2BOVA 4C2TA 2ZSFA 4IDHA 1Z0FA 1DTSA 4A0FA 1BO6A 1TNDA 4GL2A 2KI5A 1KI4A 5JI2E 2PX0A 1T5IA 3BH0A 4Q1EA 1ZCBA 3BK7A 3FMFA 3ND9A 4A15A 4A2QA 4B35A 1JEEA 2ZRAA 4DUGA 2PEYA 2RGGA 2YV5A 4RCZA 4A8JB 3SR0A 4FWTA 4LHYA 2ZJZA 5AK0A 1HTWA 4NTZA 4R2IA 1NIPA 1G21E 3EWAA 4HDCA 1DS6A 2IHBA 1OKKD 3PUVA 5HZKA 3HWSA 1E0SA 2HT1A 2VF8A 1XWIA 2VHTA 2KJQA 3CB4A 1VCMA 1JR6A 2FSHA 1XMVA 4Z1MD 2FNAA 1L8QA 5IRCD 1P75A 1SKYE 4V0ME 3MFYA 4F7WA 1OXUA 3R8FA 2E1RA 3QF4A 2WSSD 4BASA 4RZUA 4C9BA 4FMCB 4EJSC 1LB1B 3A4MA 4TN1A 1RPZA 1NBME 2FFBA 3BFXA 4QBGB 3U6KA 3NBYC 1GL7A 2J59A 1OH5A 2QAGA 2EFEB 2GILA 1P9RA 1RRGA 4BGDA 5FBWB 3EIEA 4YDHB 1RYFA 2EYQA 4HUQB 2IK8A 4ESHA 4OQFA 1CJTC 3QXCA 4LPSA 4UJ5A 1XJQA 3WYAA 2BKUA 4JYCA 5K8IA 1SGWA 2OM2A 3KKOA 4TT3A 1Z6TA 5KDOA 1AS0A 1AN0A 4I1OA 3ZZUA 1KMHA 5LB4A 2JJ1D 2QU8A 1CR1A 2OILA 1P61B 2XB4A 1WQ1R 1VIAA 3TR0A 5LD2C 3SS8A 2ZUBA 4Q66C 2ZRKA 5CLQA 1IQPA 3AB3A 3BBPA 1FW6A 4KLZA 2OAQ1 4QGFA 1SQ5A 1U9IC 4EQ6B 1EG7A 1Z0JA 3T1OA 4AD8A 1OB2A 5EP4A 3ZVRA 2KBFA 4BECA 4M1TA 2PLRA 3BFVA 3VNVA 3OE7D 4JLNA 2O52A 2ZVPX 3D31A 3L0IB 3PR1A 4M1KA 4WZAE 1RRFA 1IJFA 2B7BA 1FNMA 4IEEA 2CLSA 1JR3D 1TF5A 1XTQA 1R10A 2HYDA 3PUXA 4EAQA 3CZPA 4MRSA 4XVQA 5JBQA 2ZRIA 1NJFA 1E2DA 4MH0R 4IFEA 2NO0A 2OAP1 2Y8EA 3Q3JB 2X1VA 3C41J 4D80A 2E87A 4YMWA 1JPJA 1J8YF 4RD4A 3RANA 1A1VA 5JJLA 3KX2A 3A4LA 1GKYA 2AXNA 3P32A 2A3RA 1KI6B 3SC3A 5FBVB 2FJUA 1WBDA 1ZNZA 1PV4A 3B6EA 1T3LA 4B75A 1QHIA 2F1RA 2OFOA 1SZPA 4EPYA 2KSQA 4GRAA 4BRWA 1ZC4A 1ZUHA 3MJRA 4O0MA 1KOFA 3T35A 1P60A 2D62A 2V55B 2Z5FA 1OV4A 3BOSA 2CCJA 1AK2A 1JNYA 2VSOA 4XWAA 4KJZA 1MO4A 3ADCA 3KXLA 1VPLA 4PC3A 3ZD6A 3FB4A 2R44A 3EWSA 1FMJA 1IN4A 2OO7A 3B2EA 3L0OA 2YC4C 4JSYA 3FPAA 1G3UA 1BYUA 2WJJA 5JHHB 3CRQA 1NN5A 2FA9A 2QAJA 4MRPA 5TARA 1YRAA 2VTKA 1KI1A 2ZXUA 2H1LA 3K0SA 3RHFA 2FPMA 1EFRD 1IOZA 4BFVA 4BLPA 4IOJA 1F5NA 1KSGA 1IBRA 5KYKA 4M1OA 5KO2A 4R98A 2F9LA 2ZE7A 4YC7A 2JLZA 1CP2A 3W5JA 4AC9A 4DJTA 4II7A 1DG3A 4PSVA 1E79D 2NMVA 1E2LA 1E69A 1DAMA 1N6PA 2XNDD 2ZS7A 4B3FX 5FTKA 2ZYVX 4P4TA 2VH5R 2R9VA 2KE5A 1IONA 4G3XA 1I2MA 1G3IA 3U7EB 1CJUC 2V8OA 5EP2A 4HI0E 4DSUA 4CEIA 3RWMB 4JMPA 5FOWA 2XSZD 5FTNA 1UBGA 1F2TA 2O8EA 2W2TA 1A5TA 4PXAA 2WICA 2GVDC 3CIOA 4NONA 4ERNA 3U7HB 2VA8A 1G8YA 1OIWA 3NDBB 4MYUA 2VQSA 5K8TA 3FDIA 4KITB 1N5LA 3MSXA 5CDFA 3GLFA 3JVUA 1T91A 1II8A 2R6FA 5EXTA 3ZJYA 4V0OA 4LSGA 4U5XA 1RFLA 4DIDA 4DLXA 1W0KD 4HZUB 3WRYC 3LXRA 5GJVC 4Q7KA 2AFIE 1ZU5A 2LWIA 1XEXB 4DDWA 3QPWA 1J7KA 4TLCA 1NMXA 5BN4A 3Q9LA 3HYTA 4TMZA 1TQ4A 1XMIA 1OW3B 3FE2A 3F3YA 4GT1A 3W6OA 5DI3B 4JLDA 2XGJA 1J70A 1FX0B 3U4QA 3Q5DA 4JVNA 4D4KA 3K0AA 2NTYC 3TK1A 2YOHA 1LW7A 1DELA 5KSOA 2Z83A 2FFHA 5E95A 3OF5A 4KAXA 1N6KA 4NYIR 2P5TB 3CR7A 1RVDA 2PL3A 1P2VA 2NO7A 4AYXA 3MD0A 2C78A 1U8YA 2EFDB 2NO9A 2SHKA 5G41A 2V6IA 4KBGA 3QEOA 4LJYA 4TL8A 4Q9LA 3MWKA 1KKLA 1UBFA 2NGRA 1COWA 3GMTA 2FMXA 4M1YA 4POAA 4TL7A 4LJ6A 2IYTA 3WNDA 1ZW6A 2XOKD 5IT5A 3EA5A 3VKGA 1GRNA 1HYQA 1P2UA 2D2FA 1AS3A 3W8RA 4Q4AA 1M1YE 5IHPA 2B21A 4PQYA 1KHTA 2QPTA 1G5RA 1CULC 1W36B 1U90A 3GJ8A 4JBWA 3OEHD 1DE0A 4OK6A 3KQKA 1T3HA 5EE1A 4M1WA 1E98A 3GEIA 1G5PA 2B92A 1QHGA 3GJ6A 1OHHD 2ZI5A 1DO2A 3EZ2A 5BW8A 4D81A 4LBZA 3CX8A 2ZJOA 4HAYA 2F6RA 4ARZB 2YOFA 1SULA 2YYZA 3DZ8A 1MKYA 2FZLA 3R20A 2AR7A 3UG6A 2UKDA 2BVNA 2H8KA 2XZPA 4LYFA 2WWXA 4V0LA 2XXAA 4OQNA 1NKTA 2P5SA 1Z29A 2D7DA 1AM4D 5GJBA 2IEZA 5DLQC 2J41A 2J9RA 3BD9A 3OAAA 2GTPA 1QHYA 5EP3A 1LTQA 2Z0MA 3PVSA 3SNHA 4EJSA 4Z54A 1E9RA 3AF2A 3SFZA 5F98A 2WHXA 4PO1A 2Q6TA 3U3RA 1YJ5A 4KVAA 4DIEA 3Q72A 1P2SA 2O8FB 1SHZA 1KYIA 4NHOA 3FTQA 4M1MA 4F4JA 4M9XA 3WBJA 2GAAA 4L15A 3ICQB 1Z47A 4N0DA 2CJWA 3EAQA 4A8JC 1J2JA 2AD1A 1SVMA 2ZI9A 2OFWA 3VAAA 4Q4JA 4QJ4A 1N0WA 1OYYA 1WB9A 4PZZA 1WF3A 3ZQJA 1Z8FA 4E03A 1BMFD 1OSNA 4PPFA 1S0UA 3GJXC 2PEZA 2ZSDA 3KQLA 4A0GA 1U9IA 1Z2CA 2OBLA 2IYVA 1DAIA 3FOZA 3VR3A 4LBYA 4MUBA 2QMUA 1EFCA 2XNSA 3RWOA 1NKSA 2MMCA 4XVRA 3U3JA 3K70B 2AFHE 2CHGA 3E1SA 2BHRA 2GJAA 3CRVA 3UWKA 3TH5A 3HDTA 4KO8A 4IFBA 2WMNB 2AWNA 4MKIA 1CKEA 3P26A 5HR5A 4IW3B 2QMHA 5DH9A 4KFRA 3EW9A 3TR5A 4ZKDA 2Z4SA 2PZEA 1NN1A 2CNWD 2DYKA 2REXB 3L2OB 3VR1A 1NRJB 3ECCA 1EGAA 1X8KA 3ZVNA 2ZYUX 3ZZTA 3H4MA 1W48A 3FHTA 1F6BA 5CDFE 3GLFE 1CRPA 2BDTA 2ZI7A 4WZBE 3VQTA 3GLIA 1YHNA 3LY5A 2W6ID 4ZPXA 3OEED 3TRFA 2AKAB 2HXSA 3GLGA 4OHYA 3QKTA 1X6VA 2QT1A 4U02A 4PAOA 1CXZA 3KJGA 1JQJC 3PCRB 4V03A 5H1YA 3RNLA 2H18A 4XTCS 3CX6A 2BC9A 2ZITA 1HEIA 1E2IA 4GZLA 2A5JA 5FPHA 1F2UB 2GEUA 4JL5A 4PQFA 1M7BA 2ZQ5A 2ZEJA 4ZIRA 4MKHA 3I32A 2CHVA 1S3SA 2GZAA 3KB1A 2QZ4A 5KDLA 2GDJA 2IS2A 4QBHA 5HCNA 5JI3E 4EIWA 4DLTA 4JYBA 1GDDA 3KJHA 2PCLA 4Z51A 3QG5A 1G4UR 1S1MA 4LX0A 1RJ9B 3L0SA 4CVNA 1PLJA 4B6EA 1S9HA 1ETUA 4OI1A 1ZUNB 4KV9A 2CL6X 3R7WB 5UKDA 3CF0A 3B5JA 3NH6A 2J46A 5H70A 4AKHA 2MSEB 2ZIAA 3IHWA 4V0KA 3LVRE 2WWIA 3HR7A 3JZAA 3ZIAD 4F38A 5DYGA 2ZRMA 2WJVA 4MYTA 1G16A 2OCYC 1OXTA 1R8SA 3MWLA 5AUQA 4G5RA 3TKLA 3ZQ6A 4A0HA 3K70D 3GFPA 1BKDR 5TB5A 3FKQA 3KL4A 4ZCIA 1JBKA 4Q00A 3EC2A 1FMLA 4PAQA 4TYPA 3LFUA 3DO6A 3FFBA 3M6AA 5TV2A 5JCPA 5KHOC 3T1TA 3R9IA 1UEJA 4A92A 1SXJB 1AJEA 2ZJAA 1GRQA 3RRMA 4XWKA 5AJYA 3OHMA 5CIWA 5DHFA 1VHLA 2VYFA 1XD2B 2QN6A 1OXSC 3V4RA 4GOKA 2PZFA 4S2EA 2E9SA 1T0HB 2PX3A 4WAUA 3U7FB 3D3QA 4HAVA 1XB2A 4QHTA 2KB0A 5C2JB 2ZU0C 3X1ZA 2VIIA 4W9MC 1IY1A 2R62A 4DCTA 3MMPA 4BZXA 1FZQA 3E2IA 3VR6A 3KXIA 1K5DA 4DB4A 2WOJA 3PITA 5FR2A 4OHZA 2GHIA 3ZDQA 4JBXA 4TMTA 2AN9A 2BJWA 4MYHA 4LPKA 2DB3A 1TMKA 2ZJ2A 4EDHA 3AVYA 3V9PA 3HYRA 3LBHA 4HATA 421PA 4CEHA 2ZE6A 1G41A 3GEEA 3LNCA 4G1UC 1SHKA 2W0MA 3QPVA 1Z6YA 3A58B 3PQCA 1OKKA 3BXZA 1N3BA 1FP6A 1E2PA 3DMDA 4KBFA 2ERYA 1H8ED 3NIBA 2IX3A 3WMGA 1NI3A 5JZVA 2B8TA 3N2IA 4Z1MA 2WPDD 5E4FA 4BFZA 5F3WB 2OBMA 3ZH9B 3BJIC 3K9GA 4DT1B 1PZNA 3ADDA 4NU0A 2OHFA 2WSSA 4P31A 4LWZA 3X2SA 2C77A 4NP6A 5JS8A 4X8MA 1G291 5AJVB 4C7OB 4BE7B 5H68A 1OB5A 3FMOB 3VKWA 1NN3A 1Q12A 3L0PA 2OESA 2OG2A 4JLAA 3DM5A 1ESNA 4LC1A 5IDVA 2GZHA 4TTQA 2JJ1A 2OXRA 1KZ7B 5KPDA 1PVOA 5EZ5A 3AGPA 4NCJA 3CNOA 4H1UA 4P3YA 3CKLA 5B30A 1NSFA 4IDQA 4NYJR 4R9UC 2LKDA 3ADBA 1NMZA 2OE2A 1ZM7A 3BB1A 4F4IA 4P4SB 4JLBA 5JWRA 1YZKA 1F3OA 1VCIA 2IYLD 4GMDA 2C96A 4XWOA 5TXGA 4FMBB 4BZPA 3VX3A 3CX7A 2DFTA 4GOXA 1SXJD 2Q3FA 1EX7A 4AY2A 3TMKA 1I4TD 1ZNWA 2FE4A 1T4GA 1XEWX 5A5GA 1XU4A 2C03A 3I73A 4Q18A 4KYIB 5CITA 3OE7A 1II0A 1E96A 2W6JD 3AKEA 3LBIA 3EA0A 5DN6A 1IY2A 4ZV4A 3GLIE 1NG1A 5AJXA 3LX5A 4HEJA 1QG2A 2BMFA 4YXWD 1JR3A 4F91B 2AKYA 2QENA 3GLGE 1UAAA 2ODBA 5K8LA 4XSGA 2WSMA 4KHZA 3U44A 3G82C 4C0LA 1R5NA 4LV5B 2Q9CA 1NVWQ 4NCIA 1DAGA 2VSFA 2DBYA 4A8JA 2HF9A 1KI9A 2GXQA 3I5YA 3B1XA 1L4YA 1DAFA 1XDBA 3S1AB 2OZEA 1UBCA 2F43A 3QKUA 1SKYB 1LS1A 3SHWA 2VHQA 1ZUIA 2KBEA 2VP5A 3IEUA 4B2IA 3WRXC 2OV2A 2R8RA 1T8UA 3AP3A 3DDCA 4TZ6A 1TU3A 2OLJA 3P20A 2QEQA 3NBXX 4DCNA 4QKQA 1ZINA 3CNLA 1YRBA 2WWFA 4TMXA 1Z22A 2QBYB 2IEYA 5AUNB 5DE3A 1OF1A 2C2HA 2ZI6A 1N5IA 1M74A 2PT7A 5SZKB 3SOPA 5BWMA 1JPNA 2PT5A 4FD2A 3G0HA 1Z2AA 3IGFA 1MRSA 1MO3A 4J0QA 1OIXA 3EIQA 5DHAA 1R6BX 3SJZA 4FWIB 4JLPA 1ANKA 2YC2C 3MAAC 4TMKA 4KU4A 5FOUA 1TX4B 1L7VC 4Q48A 3PUZA 3NKVA 2ZSEA 1EFRA 2G83A 3HU1A 5HE8A 1KAGA 4N3NA 2V4ZA 4WBSA 4JLMA 2OEPA 2W0SA 1A82A 5TY0A 4AWXA 3WYGA 1KZGB 2P0EA 2NPFA 3TJZA 2FFQA 3WHLA 3ONWA 1E79A 1T6NA 4I1SA 4KXFB 2WOOA 1Q1EA 2XNDA 4GOJA 2WIAA 5TMPA 4DDUA 2JASA 4KFSA 2CL7X 4KYUA 1KJZA 2IUTA 1A4RA 2ZRNA 1IAQA 2J0UA 3DZDA 4D25A 5BYJA 3K70C 3LXXA 4B73A 1S2MA 3D7MA 2XSZA 1SVOA 5EUQB 2AX4A 3RC8A 3DVLA 3BS4A 3AV0B 1YR6A 1XNJA 4L9SA 3QXHA 4Q7JB 4RD2A 4Q1AA 3ZGXA 1W47A 2AK2A 4BLOA 1UKYA 4LV8B 3SI7A 4LDJA 2C98A 4IXNA 1KO7A 3LQRA 1GUAA 1X1RA 3TW4A 2ZREA 3FKSD 1OE0A 3UWOA 5A0FA 2VHJA 1KI6A 2CK3D 1PUJA 1W0KA 5J4VA 4I1UA 2EFCB 4PSAA 1G5TA 1WRBA 4AI6A 1F60A 5EE0A 1NBMD 2JLXA 4TMVA 1ZM3A 1P73A 1R0WA 2O8CB 2ZUCA 3C4JA 2WJHA 4LY6A 4MQBA 4TWZA 3UK6A 4JVLA 2FOLA 1TUEA 4LZZA 1BYIA 2ZJBA 2XTZA 1CIPA 2J3EA 5L3QA 5D3MA 1GOTA 3QY0A 4ON9A 2JLUA 4ESVA 4W5JA 3T5GA 4D2IA 2VEDA 4B76A 2AL7A 1K8RA 1GWNA 3K8YA 5ANRB 3RRZA 4C3ZA 1G6HA 3LO5A 2IC5A 1VTKA 3RDPA 4Q5IA 3LAWA 4TYYA 4ZO4A 4OKSA 2A5DA 3KTAB 2XZLA 5CM9C 3ASZA 4XIGS 2IT1A 3ND8A 3WXMA 5FPYA 3H2YA 5KSYA 2X77A 4G5QA 3RS5A 3SBEA 2J7PD 1VYUA 2EYUA 2GETA 4D4MA 2XOKA 3HPQA 1OIVA 2IXGA 2RH5A 4YMUA 3IQWA 1D6JA 3MGCA 4D26A 3B1YA 3C8UA 5EUMA 1Z63A 4TQUS 1JXMA 4L5BA 3TUIC 2NZ8A 3UIEA 1VG8A 2QMEA 2IL1A 2YJTD 1D2MA 3B9PA 3PXGA 5JS7A 2G1KA 3OEHA 1DADA 1TQDA 1G19A 4IJMA 1GP2A 2ZUDA 3QOFA 1UJ2A 3B8HA 3K09C 4GBMA 3IIJA 4DLRA 4UXIA 1MH1A 2RGBA 1NF3A 4TLEA 1OHHA 3CRMA 2GF0A 4PAMA 2BIFA 2WVJA 4DB2A 4JL6A 2P2LA 3A37A 4OHWA 1X86B 4Q01A 1FUUA 1GAJA 3CUEF 1SXJC 4DCVA 2X8AA 2D74A 1CRQA 4QC2A 5FTLA 4U7DA 4YDSA 1UKVY 2WM9B 3GLHA 4HZUA 4IVPA 3W9YA 3IQXA 2V7QD 5C18A 1I2DA 2QY9A 5FI1B 3THWB 2RCNA 1ZM2A 3HPRA 1YKSA 4PSKA 4QFMA 2BBOA 3GJ3A 3B60A 3T1VA 4BRUA 3UG7A 4RD1A 3WP0A 2YWGA 4U00A 4A4DA 4M22A 2FX3A 4KFTA 4HB2A 4Q9JA 5LBIA 3AH8A 4Q1CA 4IOMA 5L3SA 2OUKA 5CLLA 5J4HA 4URZR 1TUIA 4PTLA 4QJ3A 1KMHB 3K9LA 3I61A 3KZ1E 1Z28A 2IUSA 2NG1A 1KDOA 4BFXA 4MGIR 1G1MA 2HEIA 2QSZA 3O8RA 2ZETA 2ZU6A 1QDEA 4FINA 1AZTA 1BMFA 1E9FA 4BLQA 3THXB 2IS4A 2ZRDA 3BERA 4ACBA 4JL8A 3K9HA 1BIFA 4QRHA 4F92B 1OFUX 1E2GA 1P5ZB 3CNNA 1WP9A 4LRWA 4HSEA 2RMKA 4F93B 2FWRA 3MG9A 1NP6A 2GRJA 3DKPA 4XD7D 2J1LA 4CEJA 1MR3F 3QJYA 1L2TA 1VG0B 1PUIA 2NIPA 3Q7PA 4QXAA 3UMFA 4D6PA 1XTSA 3THYA 4EPWA 3C16C 1KMQA 3A1UA 4E07A 4CGZA 3M4YA 5JLJA 2GESA 1KJWA 2QTFA 4MKGA 1I4LD 3NH9A 1Q22A 2ZS8A 3FFAA 1AKYA 4XTRA 3CH4B 5DO9A 2BMJA 3GQBA 5JEEA 2CNWA 2F55A 5HTKA 4GZMA 1Z06A 2PH1A 3CWQA 1EXMA 1ZD8A 4OI2A 4BFWA 1NSTA 3GP8A 2YWHA 1Q0UA 2BBSA 4G01B 4ARZA 5JJIA 1N6IA 2REBA 4RFSB 1ZC3A 5EQTA 4C4PA 2O8BA 3BB3A 4GDFA 1IHUA 2BBWA 1KAOA 3IUYA 2W6IA 3OEEA 3AP1A 1DBSA 1UF9A 4B48A 4L16A 1AQYA 5G53C 2F9MA 3LLMA 4QGGA 3EARA 2ZRBA 3REFA 1D8TA 1Q57A 2YOGA 4RY2A 1JAIA 4GI7A 2ORIA 4HLDA 3ICEA 2N46A 1ZAKA 3Q85A 4PANA 2O8FA 3QKSA 3AF4A 5FOSA 2ATXA 3QKRB 1QHSA 2NOAA 2ZROA 4UNSA 3GEHA 3V00A 4Q03A 3LVQE 2N42A 4C30A 2IHYA 2IF0A 5A4JA 2P6UA 4HB3A 3IEVA 1QF9A 3W6NA 3AKCA 2X2EA 4QM6A 3FWYA 2GWHA 3C5HA 1W5TA 2RGXA 1U0JA 3DKVA 1VKJA 4QJ5A 1SVLA 4WW0A 2D06A 2G0TA 2ANBA 3OIVA 1Z5ZA 5G3YA 3TSWA 2P67A 3WMEA 4TYWA 2O8DA 1C4OA 4D82A 1NL3A 4B3BA 2H92A 3ASYA 4PC2A 3O47A 3U2QA 1Y3AA 3UPUA 3ETLA 4YLGA 2G88A 2EWWA 4TSFD 3ZVLA 3ZLJA 3GCGA 5J47A 4Z8XA 3CPEA 1KI8A 2FZ4A 1RW4A 3DHWC 4H9GA 1E94E 5FH9A 5L8VA 1GKIA 3DEFA 4CF7A 3TGPA 2WAYA 1FTSA 4JLJA 1E0JA 3ZIAA 1GTVA 4BLTA 4R71A 3SEAA 2V1UA 1W4RA 2EFGA 1G6OA 5J40A 1CJVC 1GRRA 4NE2A 3ZZ0A 3BB4A 1PLLA 3KKPA 4H1VA 5FL7D 1LF0A 5L3VA 2O8EB 4IEIA 1E1RD 1KI2A 4R7ZA 4JJZA 1W44A 1XBTA 1GVNB 1G8FA 1ONBA 2CVFA 2QQEA 3A1VA 2F1JA 4XOIA 5KDDA 4QM7A 1XZQA 3PUWA 2QE7D 5JCZA 4X8OA 3GLFB 1N6OA 1U0LA 4GFDA 1RKBA 3IKJA 1E1QD 1E9SA 4B47A 3PV0A 4B3GA 1ELOA 2CLCX 5F9HA 2QGZA 4AKIA 1ZD9A 3C15C 2YNMA 2BM1A 1X1SA 4PPGA 3GFTA 4ZDKA 3RSLA 1RC8A 4JBYA 1XPUA 3RS4A 4Q9HA 1HT2E 3B1WA 1YR7A 5C4GB 1U99A 3P4YA 3WNBA 3PG5A 1US8B 4OHVA 2GEDA 3ZVMA 1Q21A 3AM1A 1Z08A 3AVQA 1Q3HA 4K8OA 4RCYA 2EU8A 5JRZA 4LYHA 5GADl 4OHXA 1O87A 2ZRFA 1OXXK 2QUZA 1QBKC 3B1VA 3EZFA 4QHYA 5B2ZA 1OFHA 2DPXA 3K1JA 3W8NA 4V02A 3J81k 2WAXA 2IWRA 3KFXA 1P9NA 1F2UA 2WBLC 2QP9X 3HJNA 4IRUB 1YZUA 3I3SR 3I62A 3ZS9A 3ZYCA 3EZ6A 5BXQC 2I1QA 1N6RA 2FN4A 1H8EA 1KY3A 3QG1A 1MABA 3PEYA 2WPDA 4A0RA 2DFNA 3BH7A 4I81A 2GBLC 2ZPTX 1Z6GA 2IF2A 4RZ3A 4N1AA 2ORVA 3T12A 4LI0A 3I72A 4URWR 2D3WA 3QPUA 1QVRA 2DFLA 2QNRA 1P2TA 3NHBA 4IVQA 2VHUA 3VU9B 2NQ2C 3A6PC 4DRZA 4IHQA 4Q4AB 5E7MA 1E99A 2NZJA 4LJ4A 3R7WA 4LHWA 1W36D 3VKHA 4BLSA 5KOYA 2ZRCA 4QGAA 3TAHA 4Q4HB 4DDTA 1ZYUA 3Q5EA 5EE5B 5CJPA 3KDSE 1IXZA 2ODNA 3VTKA 3SYLA 4QHSA 2GNOA 4IDNA 2QM7A 3U3KA 3EIHA 2V3CC 1E9EA 1HE8B 3FVQA 3CRRA 1ESMA 4RFVA 1R5BA 3K09A 1VHTA 2NO6A 4M2LA 2QP3A 3WYFA 1N25A 1OT3A 3TQFA 4X8LA 4A82A 1XTIA 2FEMA 5CB6A 2CHQA 1XX6A 5FBQB 3AEZA 1CR4A 2HT6A 4IKEA 3IIMA 2FFAA 4TLAA 1UBEA 3VR4A 3PFIA 1E9DA 3LWNA 1SXJA 4AURA 1V5WA 4A36A 3RS0A 3LLUA 3DOEA 1XD2A 3JVVA 2F3RA 4WXPA 4DHEA 2W6JA 1Q20A 1GG2A 4D4JA 3LW7A 2IW3A 1XXHA 3AF0A 5DSZA 2IUUA 3O8CA 1HE1C 1JALA 2LCFA 2VF7A 2DY1A 2VBCA 1HUQA 1VG9B 5CJ2A 4TQAA 1U8AA 2FSGA 1KSJA 4PHGA 2WJGA 4NYMQ 4MGYR 4HAWA 3TVTA 4WZ6A 2BEKA 1RZ3A 1CEEA 2CJWB 4DSNA 1W2GA 2NO1A 1WBBA 4UXHA 4LBWA 3W34A 2WKRA 5DI9A 5FOXA 5FUXA 1EFHA 3PEVA 1U94A 2PCJA 2IWHA 1PLKA 1QHXA 4Q4JB 2H5EA 1KKMA 2OSBA 1U2RA 3U3OA 1XCMA 5CYOA 4YQFA 1G8GA 5LD2B 4KSCA 4ABYA 4Q7LA 4URXR 5CK4A 1M7GA 1DAEA 5AUPB 3R9XA 4US0R 2G9NA 2RGCA 1VYVA 4G5SA 3D8BA 3JZMA 2G3YA 2VP0A 4TTPA 3WY9A 5J4LA 2GJSA 3G5UA 3K9NA 3AVWA 3QXXA 2CDNA 2ODEA 2XJ9A 4AK9A 1KK1A 4ILEA 1NNEA 4V0NA 1ZU4A 2QP4A 5EP1A 4OK3A 1YE8A 4CW7A 4C0JA 3QE0A 1KJYA 1G8HA 5F9FA 1Z0KA 3MUFA 3NC1C 1X3SA 4MGZR 3RABA 1AKEA 2A30A 1IXSB 5GJWC 1Y63A 4US1R 4JT2A 1DVRA 2FSFA 3WNCA 2JJ8A 3EZ9A 2J0QA 1B0UA 4OI0A 4EPXA 3VR2A 1KO1A 4P4SA 4B71A 1KY2A 2J7KA 1SKQA 5IK2D 1G3RA 2WTUA 1ZM9A 1D9ZA 1VMAA 3GLIB 2A5GA 4K46A 5FTJA 1A7JA 1AIPA 721PA 4PHHA 3KQUA 1XEWY 4RSGA 5C1BA 5KNBA 3GLGB 5HZHA 1EWRA 4B43A 2DCUA 5DGXA 1E2EA 3B85A 4O2RA 5HKKD 4OK5A 2C04A 1XMJA 1VYTA 2J45A 4I99A 1E2KA 1TEVA 2RHDA 2QMOA 1MT0A 1R4AA 1Z6XA 1ZP6A 2HXYA 1VECA 3VMFA 3W5IA 2O0KA 3B78A 2P65A 4JLOA 4LJAA 4LYJA 3NDPA 5FUWA 3W90A 1KI3A 4Q1DA 4ZIRB 5EXSA 1D2NA 4FI3C 1J99A 5EJEA 5SZJA 4XVUA 2H16A 4EFNA 1KSHA 3FKSA 3S1AA 3BC1A 4WOPA 2GCOA 1XTJA 3N2EA 2CK3A 4V0MA 4YONB 2OFXA 3KQNA 4OQXA 3CPJB 4IOKA 2RKOA 4DXAA 1NBMA 1B23P 3O8DA 4OQMA 1CJMA 5AR1A 2YVUA 2FF7A 1DEKA 4XJXA 4DWJA 3N70A 2QBYA 2HUPA 1G8PA 2FSIA 5TVKA 4O3MA 2EFHB 1HT1E 4MRNA 2R6AA 1SVSA 5KSZA 4HDOB 4DLZA 2OT3B 1VG1A 1C1YA 2VLIA 2ANCA 4EFLA 2WJYA 1Q3TA 1W4CA 2IYUA 1XRJA 4NCHA 2D4HA 3SDZA 1P62B 1RRCA 3AGQA 4TL9A 1XJCA 4CT4B 1NVVQ 3CR8A 4G5GA 3B13B 4ASUD 4X8HA 5GVRA 1E9AA 2HJVA 2IYZA 2ORWA 5BN3A 4M9QA 1A2BA 3NHAA 3KKQA 2HLDD 2AK3A 3LV8A 2C9CA 4IXMA 1KSFX 1W49A 3SQXA 2J7PA 4CZ2A 3I92A 4M9ZA 1GNQA 2R65A 1OH6A 2ERXA 4JJKA 4A9AA 3MCAA 1MV5A 2CLDX 3IILA 4PC1A 2VP9A 1FP7A 3IIKA 4C0QC 4UNPA 1MO5A 1W36C 4BEJA 1U98A 1E32A 2MSDB 2FPLA 2ECKA 4RKEA 2WIBA 4MYCA 4PO8A 2F1IA 3SBDA 3RS3A 2JEOA 3GFOA 2ZVQX 1IXRC 2Z4RA 3FMIA 2VP4A 5SZHB 4FW9A 3GJ4A 3IDQA 1TAGA 3SZRA 3RVBA 1OFIA 4DSOA 2FH5B 2OCAA 3EPKA 3SFVA 1SVWA 5JRJA 2IXEA 4OL0A 2QSYA 3TLXA 2RGDA 1ZMXA 4RZXA 1W4BA 3B7GA 1CS4C 4RD3A 3QXSA 1ZRHA 1X8LA 3EASA 4NPHA 1G9XA 5EZ6B 2FPKA 4JLKA 4NKRA 2ODWA 4TMWA 1M2OB 2YZ2A 4ZCMA 1S96A 2J87A 3PJRA 2GBLA 2JLVA 2V7QA 4Y0VA 2TMKA 1WA5A 5FOVA 5JWOA 3MWJA 2H17A 2C95A 4RD0A 4C0BA 1E9CA 4TTRA 1YZNA 1CTQA 1G7SA 2JDID 4HZIA 3ZD7A 4HUQA 3SYKA 5CK5A 3L8ZA 1G7RA 1M34E 2Q3MA 4M0LA 4Q1BA 4MITA 5J5CA 3FHOA 2JLYA 1X8JA 4NZYA 3M1IA 2Q9AA 5CIQA 1N6LA 2ZE5A 4GP6A 3KJEA 4HB4A 4A2PA 2UVQA 4E5UA 4LJ9A 1E0KA 1R0XA 3TBKA 2C9YA 3KQHA 1BH2A 2HV8A 3DOFA 4BPBA 1LF5A 3EPHA 1KDTA 1NN0A 1KK3A 4EQ6A 5J4YA 1VDZA 3UATA 3LDAA 1E4YA 3QEJA 3SU8A 4B6FA 2ZSAA 1IN6A 4TZ0A 2QTHA 5LPNA 4C0AC 1D9XA 2IS6A 3KJIA 3WHKA 4XD7A 4O25A 1W0JD 4QBIA 3VX4A 4ZI2A 3TIFA 1Z6AA 2DR3A 2QI9C 4W5HA 2QG6A 4S35A 2VL7A 1Z0DA 1E4VA 3PIRA 3X1WA 3QUSA 3U7GA 2VPPA 2RGAA 1XZPA 3U44B 3QENA 1HA3A 5DYIA 1II9A 3VR5A 2EVWX 4HAZA 1EX6A 3IHLA 3WMFA 1JXOA 3KKNA 4MUAA 1QRAA 2JAQA 4N0EA 4R2HA 1P4SA 2A78A 3FYHA 2XTNA 2MMGA 2C99A 3I4LA 1YZTA 2F43B 3K0FB 4NCNA 4PZYA 1JB1A 1DPFA 4PQRA 4BWYA 4US2R 3BH6A 3T5DA 2ZI3A 4RD6A 4L8GA 3AKYA 2A5YB 1R8QA 4PPNA 4KVGA 2JJ2D 1T9HA 2CVHA 2PLFA 2V9PA 4FCVA 5EXXA 3F5FA 3QBVA 5LB2A 3SJCA 5KTYA 2WV9A 3E70C 5C46F 3TW8B 1QHHB 2F3TA 2GJKA 2UZ3A 3THWA 3R9WA 2QGNA 1GILA 2OXCA 3TUZC 3U3MA 3A1WA 1OH8A 1GITA 2ZJ5A 1J8MF 3NEYA 3REGA 1E6CA 1R7RA 4PFSA 1JI0A 2OBNA 4IVRA 3SQWA 1XD9A 1KK2A 4OJKA 1JJ7A 5JJKA 3K0EA 2WJIA 1UM8A 2GK6A 3NBFA 1YR8A 2C8VA 4BLRA 1BS1A 3CF2A 4DCUA 3W3AA 2DWOA 1M6NA 2GJ9A 2W2XA 1W4AA 4IDPA 5DISB 3SHFA 1OXVA 5JSZB 1FPMA 2HCBA 3OFND 3LW8A 4M4SA 2B6HA 3TVDA 4TLBA 4YMTA 1LVGA 1IY0A 3THXA 4YMVA 1DOAA 4TSFA 4UNQA 1W5SA 3VHLB 4D4LA 1KO8A 5FL3A 5ELXA 2RGNC 4Z8YA 2BCJQ 1AZSC 4AIIA 2KWIA 2GXUA 3QXJA 4LCBA 2UZIR 4FMDF 3IPYA 1JR3E 5FR1A 4GSYA 5DN6D 1N5JA 2J0UB 2YWEA 5KPJA 4FXPA 4HLUC 4CT5A 2C5LA 4KSBA 1QVAA 4Q1FA 1NLZA 1H8HD 5FL7A 3BRWD 1NJGA 2HF8A 1E1RA 4MGKR 3W6PA 3SJBA 2ZTSA 4G5OA 3UMSA 2CCKA 1LS6A 3N5CA 3NEJA 3SN6A 1EWQA 1G18A 2K5UA 4ZCLA 2QE7A 1XEFA 3IO3A 1G7CA 4FN5A 4LHVA 2YKGA 1AGPA 1E1QA 3RAPR 3RC3A 1C9KA 3CH5A 4YMSA 3QF4B 1Z0IA 3OIUA 5CM8B 2CE2X 1NMYA 2FGJA 3CF6R 2JIZD 1XEXA 3U61B 3IBGA 4MRRA 1TF2A 4C0SA 2QAGB 3AF3A 2L0XA 1G17A 4RFSA 1CR2A 3TAUA 4DSTA 3AVUA 5DI3A 5FUYA 3K53A 1FX0A 4EPVA 2WWHA 1AA9A 4UNNA 2GJ8A 4HYYA 3D6TB 2V6JA 4GP7A 5L3QB 5JECA 4UJ3A 5D3MB 3W3ZB 1XCPA 1YVDA 4W5WA 1CU1A 2WKPA 3LBNA 4HAXA 3TSOA 3BIFA 1TL7C 3K0CC 4D0NA 5JMTA 1N0UA 5H8WA 2PBRA 3AVTA 3QKRA 3TNFA 4B2LA 3I5XA 5GJCA 1S4QA 4C0KA 3H86A 1YZLA 1ZVQA 3NTUA 1T5LA 521PA 4CDGA 2HYIC 1PJRA 1R0ZA 1S3GA 2IS1A 5BYKA 4QGHA 2OLKA 1WCV1 4FCWA 3BAFA 4TYQA 3BWDD 1G64A 5KNDA 4GMXA 3UANA 3X1DA 1S1CA 4PC6A 1FUKA 1ZBDA 1LNZA 2A2ZA 4WXRA 121PA 2FG5A 4D0GA 1P6XA 1UKEA 4B2PA 3RRYA 4OI4A 3TSZA 4DEYA 1HY3A 1XJ0A 4DLVA 3VHXA 2ZR7A 4QL3A 3RSOA 1N2CE 4LHXA 2CE7A 4PR0A 1IN8A 4DUGD 4AG6A 1H65A 3DM9B 1TU4A 2GCPA 2QM8A 1IN5A 4NMMA 4C0HA 3NC0C 3CBQA 4DLSA 1VCNA 2YHSA 2ZAMA 4KODA 2ZM5A 2EQBA 2FV8A 2P6NA 4HLCA 5E7JA 1MRNA 2P3SA 1NY6A 3LRPA 5JWHA 5TDHA 3LQQA 1Q44A 4URVR 1HH4A 4JVSB 2OCPA 4L4UA 2GVZC 1G20E 3FMPB 4F4CA 3P27A 3IPXA 1GM5A 4DLWA 4DC9A 1T8TA 2RGEA 4JZKA 1NVXQ 3LD9A 1J90A 3PEWA 2G6BA 3ADKA 2WKQA 3C5CA 3GLHB 4JT4A 3T34A 5FUVA 4LJ7A 1EESA 1US8A 2J5XA 4UXJA 3CZQA 2IA5A 2HDNB 5FPSA 1UKZA 1RE0A 4HB0A 2ZAOA 1P3JA 2BMDA 2GAOA 4LBVA 4A2WA 4MDEA 4TT3D 2D2EA 3GD7A 2IYWA 2ZANA 3CRW1 1XP8A 5L3SB 3UMRA 1UFQA 1AQUA 1KDRA 3X1XA 2ZS9A 4EPTA 2G1JA 4DCSA 2X2FA 4DBLC 4ITRC 3H0KA 3B1ZA 5HE9A 5DNYB 4E22A 1CJKC 3L8YA 4LK2A 2ZSBA 4JKIA 2R6CA 2RHMA 3TQCA 1EFUA 3EPLA 3Q8XB 2R6GA 3VNUA 4KCGA 1YZGA 4B44A 1QZXA 4K81B 3QIAA 4M8NE 1G3MA 5B58C 3CONA 1JECA 3FHCB 1FTNA 3GJ7A 2A7QA 2JLRA 4RVCA 1UDWA 3VU9A 4CEJB 3QVVA 3KB2A 3UXMA 4CEIB 2I1VB 1F2TB 1KI7A 1LFDB 3MJHA 5SZIA 4EPRA 3SYNA 3THYB 4BFSA 4JKYA 4OBEA 4TL6A 1JJVA 2PMDA 4QOSA 3TUJC 5AWFC 4Q4HA 1M8PA 1YR9A 1II8B 2Q9BA 1VIYA 2PZGA 1GNRA 4NYIQ 3ZS8A 4KLNA 1NG9A 2F1HA 2PJZA 1G4AE 2QQ0A 2VO1A 2DFKB 3AKDA 1ZIOA 4D0LB 2V1XA 1FNNA 1ZNYA 2QORA 1R2QA 2GXSA 5CB8A 5IK2A 2AXPA 4RJLA 2GCNA 2ONJA 2O8BB 4LOAA 4WVFA 3RYTC 4PHFA 1XD8A 1VCOA 3GLHE 4Q7MB 2HJGA 3RLFA 2ZJ8A 3OIYA 3H1TA 4NL4H 621PA 3U4QB 1HURA 4AYTA 5D3QA 2CCGA 2BCGY 3K0AB 3Q7QA 3EG5A 3NWJA 1E3MA 5FI0B 5AJWA 2BKEA 2N1BA 5HKKA 1W1WA 2JCSA 2W2VA 3BE4A 1TQ2A 1JAHA 1GNPA 3L82B 5JFGA 3QKSB 1EK0A 3CO5A 2BJVA 2P6RA 2B7CA 2YINC 2XX3A 4B32A 2BWJA 2ONKA 1S9DA 1GSIA 2R2AA 1NVUQ 1UPTA 1KO4A 2QA5A 1XMSA 3BGWA 3T06B 1E0AA 2DHRA 4Q19A 4LV6A 2IYRA 1OJLA 1ZD1A 4MRVA 1WXQA 5KNCA 2ZR0A 2Q3HA 2WWWA 3IO5A 2CMKA 2G0NA 1TADA 4B33A 3AVVA 4KFUA 3F0TA 1Q1QA 1RJ9A 1OH7A 2FEOA 4NCKA 1XPRA 1P7CA 1Z83A 4RZ2A 1UEIA 1CF4A 2Z6VA 2O8DB 5AJZA 4XSHA 2ZRHA 1UDXA 4CIDA 3PENA 5HPYB 2RB4A 1E2QA 1GL6A 3KXKA 4BQSA 4HDQB 1NIJA 3QF7A 4DEXA 1IJEA 1M7HA 2VP6A 1BOFA 2WWGA 2RGNA 1XTRA 3OESA 4OJQA 4HLQB 4B3CA 2XB2A 4JLVA 1LY1A 3AUXA 4NYMR 1Z07A 4Q4LA 4UNRA 4URUR 1CR0A 2XITA 3WP1B 1OYWA 4HLUA 3SJAA 4AKEA 3NG1A 5C4MA 1G3QA 1ZCAA 5DIFA 3DMNA 4I4LA 4ZDWA 2QTVB 4DZZA 1HQCA 1DARA 4ASUA 4P0TA 2C9OA 6Q21A 2GA8A 1I4DD 2XXAB 5CYPA 5FPTA 2HLDA 4XH9B 2XJ4A 1E2FA 3OIWA 4BUJA 3U60B 2XZOA 3PEUA 2XEXA 4HAUA 4NH0A 4PPQA 2D7CA 4QBFA 1L4UA 4A6XA 4MA4A 1ZNXA 3MRSA 5L3RA 2G77B 2GZDA 4EJSB 4LJ8A 4FMCF 4YXWA 3A4NA 5G3ZA 2IBMA 3EZ7A 1FL9A 3CPHA 1IM2A 5FBLB 4PO9A 1HQYE 4A6PA 1OLOA 4NDZA 1SVIA 4FMDB 1XPOA 3U6BA 4JVMA 3I8SA 4FCTA 4M9SA 2ZE8A 3GPLA 2O0JA 3DL0A 4DVGA 2ZJYA 3NXSA 2R6DA 4BFUA 2Q21A 2YWFA 5B57C 3M0EA 1MO6A 1GFIA 3TE6A 1TEXA 3K0CA 3LA6A 4QNMA 3U5ZB 1E2MA 3C7KA 1KDPA 4Q9KA 2BEJA 2VRWA 3I8XA 1A2KC 1UADA 3UKDA 1MABB 3AUYA 1D5CA 4DT1A 2OCBA 1COWD 3AQ4A 4AG5A 3A36A 4LHZA 2QRNA 4GPTA 2ZR9A 3HP1A 4C7OA 5FTMA 4M53A 2QAGC 5F2EA 5P21A 1FQKA 5K8UA 2JDIA 3EC1A 4WA7A 1JEDA 4P32A 5EXPA 4WIAA 4EFMA 2GK7A 1E2JA 1GZSA 4LGMA 1KIMA 3T61A 5HCIA 2ZI4A 3E5HA 1R0YA 4JSTA 4BZQA 1U8ZA 3AVXA 1ZIPA 4ZI3A 5FBRB 1W7AA 2JA1A 2I3BA 4P4UA 3A1SA 2QT0A 3B9QA 4Q9IA 3MLEA 4B3DA 1D2EA 3QBTA 4RKFA 4IDOA 2ZRGA 3EXAA 4TLDA 3T1QA 2W58A 1LV7A 1ZM4A 3L43A 3IBYA 3X1YA 1E2NA 4IOLA 1F48A 1TTTA 1OFTA 4TYNA 1XF9A 3A1TA 3I1FA 3OAAD 4P33A 1ZJ6A 3AF1A 1P72A 1W0JA 2IYYA 1O3YA 1G7TA 1YU9A 1XXHB 1WE2A 3SE0A 3BFKA 1YQTA 3AVOA 4JIMA 2EW1A 1NY5A 1RYHA 3THOA 4W7SA 5J4KA 3R8CA 1W46A 2FU5C 1T0JB 1Q1BA 1WMSA 1NVVR 1K5GA 2JLQA 1WDTA 1JQLB 2EWVA 1AGRA 4B74A 2GKSA 2Q0HA 4HUTA 5IF9A 1GL9B 4ZKEA 221PA 2ZRPA 4JS0A 3C14C 2QRZA 3QNUA 3CWZA 3EX7C 2A5FA 5GVSA 1W2HA 1EFTA 2WWYA 4EUNA 4Q47A 4G0NA 2ZRLA 1U81A 2JJ2A 2ZRJA 3KUDA 2FDCA 1CBUA 4PHTA 4QG7A 4UQOA 2V54A 3PUYA 1NLFA 1YZQA 3DPUA 1XCGB 1DG1G 2MSCB 1N6HA 3AVPA 2IXFA 1IN7A 1QG4A 2F7SA 3T15A 5LDDC 1GKUB 1P9WA 3NVAA 4PZLA 4Q02A 5B64A 2LKCA 2O5VA 2QPOA 2H57A 2PMKA 5EE3A 4E09A 3WBKA 5FOTA 2DWQA 3VFDA 4O2LA 2QL6A 1N0VC 2CBZA 1TPZA 2CL0X 4NBSA 4OYHA 3GJ0A 2W83A 4FIDA 2IYSA 1SVKA 3HR8A 1T3SA 4LUCA 3AP2A 2ASEA 4DLUA 3V4FA 1ODFA 4I1VA 4AKGA 1RIFA 1CLUA 2JLWA 2WMOB 4B3XA 4PX9A 1KTVA 5E7IA 821PA 3OFNA 3GJ5A 1KGDA 1XTKA 1S8FA 1SXJE 2JATA 3OZXA 4UKDA 2JLSA 3P1JA 1RRPA 3QVUA 3LX8A 2NPIA 1KNXA 1Q1ZA 1QHNA 3KFVA 3RRNA 1FOEB 2O0HA 1KNQA 4LJ5A 1N5KA 3QQ5A 1XXHE 1DAKA 2XAUA 4LC0A 1R5OA 1N6NA 3A8TA 3CM0A 2IYQA 1DAHA 3RS7A 4OQLA 1KO5A 2GF9A 1OPXA 4KI0A 4ZDIA 5FPKA 1H8HA 2VP2A 3O8BA 1U0HC 4DKXA 4MDFA 4CEHB 2H7VA 2AHOA
chains in the Genus database with same CATH superfamily
2QPAA 3DO8A 4OFXA 1HV8A 2VTBB 2P1RA 1G21B 3IQIX 2BBTA 5DM60 4EJ2A 3AIKA 1EVZA 3HVUA 3EPJA 4Y0AA 5E3HA 3GFSA 1V43A 1IYZA 1Z12A 3H1AA 1W1UA 3UHJA 3ZX5A 4C2UA 4EGCB 4N18A 3MOSA 2GX6A 3ZZMA 2YDXA 5ITZB 5KSWB 3ST7A 3AMVA 4PG6A 1RXYA 5F7ZA 1GU0A 4G81A 3HU3A 3UEOA 1YWGO 2FR0A 5J3JA 4NJMB 4WXYB 5JSQA 1PJBA 1U1EA 2O5RA 2XCLA 3QI2A 3CW2A 1HEYA 4I8XA 4MVJE 3W4JA 5M7EA 2HR1A 1XFAA 2YASA 3CLVA 3PFNA 4CMKA 2HX1A 4GAEA 3QSYA 1NPTO 1FFWA 2H2DA 4KXNA 3ROZA 4WACA 4AULA 4MV7A 3EGCA 4L6AA 5JIBA 3KT3A 3W34A 3X1MA 4E5PA 5FOQA 3BULA 4E1BA 1Z0AA 4R0VA 3A3OA 2BM0A 1H5UA 1TPYA 4CMBA 4WN9B 2IYXA 4TQ9A 4ZARA 5G1NA 4BFYA 3RS2A 4R2XA 4JELA 5F7XA 2P9FA 4M0KA 2ET6A 1B3BA 3OJ0A 2PZMA 3H3FA 3JYNA 1QH1A 2XTMA 1HX7A 2EL7A 1UBLS 2VDMB 2WZQA 3B82A 5IVDA 5BQ5A 2ATVA 2B9EA 3T3IA 1V3QE 5A3VA 3O1IC 4DR5B 1EH5A 4C4YA 4DLAA 3T0FA 1ICIA 1UPBA 4IICA 4B6RA 1U7HA 4TM8A 4S04A 4WADA 4H27A 2A9PA 2ILTA 3PF9A 4HN2A 1SC4A 5G40A 4XKJA 3KUCA 2AZMA 5BSMA 4C14A 1TQ6A 2HSJA 4UQLA 4OGFA 5FWYB 5JSZA 3C3KA 1HZZC 2A9RA 3UW1A 3R75A 5M04A 1DJNA 3F9RA 5F21A 1NDUA 4A6EA 2BOVA 1MP0A 3T41A 3X43A 3DV9A 4C2TA 1VI2A 4A0FA 2YZGA 3AR3A 3UJ7A 4DM7A 1V35A 5LJIA 1T5IA 3BH0A 4PQGA 5BUCA 5I48A 1ZCBA 1A0OA 4A2QA 4P4LA 1KPHA 4XYBA 1ZXLA 2P9CA 3KPWA 4OLHA 3K1TA 1FNDA 4QYWA 3W6ZA 1ODLA 2IH5A 2W71A 4FWTA 1OYOA 4LHYA 1GU1A 4RV4A 3TIGA 1JQ3A 4B3TB 1G21E 2AOTB 3EWAA 1SC6A 1DS6A 4ZVSA 3DV0A 1K63A 3PGXA 3SIWA 2VWGA 2VF8A 1T6XA 4JBIA 1ECPA 2DR2A 4PN7A 2KQUA 4LTNA 5AHOA 5HCIA 2QTGA 2J3DA 3MGGA 4LCJA 2ECPA 4XUCA 4M88A 4PNEA 2OCDA 5BRNA 1P75A 1SKYE 2JGRA 4RXMA 4V0ME 3R8FA 2E1RA 2XUJA 4MVXA 4O8ZA 3UGJA 2WSSD 2WIDA 4EJSC 4TN1A 2JA2A 4K9MA 4CF3A 5K05A 1JKIA 3NWOA 5KTMA 1C29B 3A1FA 1RYYA 4LXTA 2DFDA 4HKTA 4XQEA 4E31A 2L69A 1RRGA 3H9BA 5AI4A 4BO4A 5HP4A 2ISQA 3OU6A 1HL3A 4YPOA 5IJ9B 2F64A 4ESHA 3MW8A 1CJTC 1GY8A 1LU9A 2FMTA 1XJQA 3WYAA 2XXJA 2ZM6B 2BKUA 1SKAA 5I9NA 1Z25A 2OM2A 2BFFA 1RJGA 4I1OA 4RHTA 1JEYA 4ZAXA 2QU8A 5SY9A 3WLMA 3LZ6A 3A6HA 1U2TA 3QFHA 4D3XA 3TR0A 3BK2A 3T7SA 1Z9BA 1W96A 1BKSB 3TW6A 3L3BA 4F1KA 4LDQA 4FQ5A 4QDXA 3BZBA 2ZUBA 3AR9A 1TUBA 4AQDA 1NUSA 1OMOA 5E1DA 3WYNA 2F00A 2B0JA 3OPQA 5ALVA 1KVSA 2OAQ1 4QGFA 2WUWE 1SQ5A 1U9IC 3PKZA 4WLOA 5TS2A 1EG7A 2IGBA 3M6MD 3TMAA 5D5QA 2KBFA 3AY3A 3RARA 4BECA 1CV2A 3G5MA 4BKPA 4CQMD 1KJIA 3MJSA 4GPEA 4JI7B 3T3NA 1XZEA 3L1JA 1KBZA 3JSAA 4QXRA 1XPJA 3ELUA 4R8MA 2UXBB 1YE5A 2B7BA 3AV3A 4QAQA 3OTOB 2W9XA 3AHCA 2XAAA 1DEXA 1SH7A 1MFZA 4LRQA 5CEFA 2XGGA 2HYDA 3CZPA 5H02A 1DRVA 5BWCA 5F1OA 1PE0A 3RSSA 2BF4A 3M6WA 1X38A 3FAKA 2NO0A 3FI0A 4ZU1X 2X1VA 1JHAA 4HRXA 2CVOA 5KNBA 1JPJA 5DRTA 2H4JA 3O8QB 1QBGA 2O2JA 3A4LA 1FBTA 4Z3DA 2CYCA 1Q11A 3LKBA 2O7RA 3N0TA 1G20B 3EIUA 4YDQA 2W6CX 1MEEA 1FNBA 5CA0F 4EAAA 2XBLA 1RCTE 3FOBA 1WBDA 4CNBA 1YDEA 2EQ5A 3S2UA 5AM5A 2JIQA 3E03A 5BSKA 4KPGA 4ZMRA 4IFTA 3HDJA 4RW0A 4GRAA 2P3QA 1QQ5A 1ZUHA 1GPBA 1PQ4A 3UUGA 1AOXA 1LI5A 1KFCB 1KOFA 4M7PA 1JYEA 4FJ2A 3ZDEA 1P60A 2Z5FA 3RYIB 1QCZA 1AK2A 3O8LA 2C61A 1YS6A 4MSUA 3JARA 3GXOA 3ZD6A 3HUEA 1BCSB 3HRIA 1WW8A 3ZDFA 4F6LA 2WB2A 4PY2A 3B2EA 3PWKA 1MG0A 1G55A 3ZXYA 3LP6A 1THZA 1VMEA 1Y9ZA 4JEHA 1BYUA 2O2XA 5JHHB 4B45A 2A0WA 2QAJA 4P5DA 1DWQA 4MRPA 4D92A 4R81A 5IT9A 1YRAA 2PBFA 2BRUA 1A9XB 2VTKA 2XQJA 3ZU4A 1VBFA 1QPGA 2H1LA 1IUKA 2Y71A 3FLEA 4CUJA 3SXPA 1CZHA 1EFRD 1ZJYA 2BFEA 5I5GA 3GLKA 4NSNA 4EW1A 4JUDX 3PCXA 1F5NA 2FMHA 3I1YA 1IBRA 1X7GA 2WK1A 3OC0A 4M1OA 4R98A 1KSGA 5KYKA 2F9LA 2P75A 4YC7A 2Z8XA 2ES4A 5JZOA 1Q1GA 4AC9A 3UJAA 1V8BA 1AT1A 1DG3A 4PSVA 5AQEA 3TDKA 1KU0A 3I42A 3DXXA 4O3FA 3U9SA 4G89A 5I7FA 1E2LA 3KV3O 4O4JF 1N6PA 2W4MA 1VZ3A 5HK8A 2NZ2A 3OZUA 4I4TA 2ECQA 4WOCA 2HUNA 5FTKA 2ZYVX 2QXUA 4G0OA 1AURA 4AMBA 2VH5R 1M6VB 2R9VA 2KE5A 4G3XA 3TFQA 2CLKB 1SBTA 3VU0A 3U7EB 5EP2A 1ADGA 3EGVA 4E13A 3DA8A 2EP8A 5FTNA 1UBGA 4HDNA 3ESXA 1A8HA 1VHJA 3OLXA 2WICA 3QVMA 1T5SA 3CIOA 1ZLYA 4NONA 3P2MA 4PLHA 4BMVA 4C7VA 4ERNA 4QOEA 1L5QA 2VHZA 2VQSA 4XR4A 4KITB 4HO1X 3GDOA 1E59A 1TI7A 4XWWA 4ZHQB 3GLFA 5ENVA 5BW6B 4IYRA 4YCLA 2R6FA 3A6LA 1T24A 5EXTA 4WZBA 3ZY3A 3ZXSA 7MDHA 5EJ9A 1I8TA 2XBUA 2GM9A 1GZHB 4QAJA 1ZK3A 4J8PA 4U5XA 4AN0A 4TZKA 1RFLA 2WIFA 4DLXA 5FV4A 3BCRA 4EYOA 1E92A 4FDAA 1SMKA 1GN8A 3TZCA 2GCIA 3AM4A 3LKDA 3MQ2A 1TJPB 1E89A 1U9YA 3ELDA 3WGLA 5KWIA 5BN4A 2HH9A 3Q9LA 3HYTA 1J2RA 4JGIA 4TMZA 4E5YA 2HTEA 4KWIA 5ED4A 3W6OA 3ANNA 4GM1A 3A6ZA 2X9LA 3L18A 1ISSA 3AG6A 1FX0B 3CVOA 3QQPA 5LJLA 4JVNA 5CGQB 4D4KA 5JARA 1ZVJA 3ZLBA 5KVQA 3HCRA 4Q24A 3UMGA 3IJRA 2XIJA 3PFCA 1ZIDA 1X19A 1PTKA 3OF5A 4RKRA 2GPYA 1SQ6A 4KAXA 1VXOA 3NIDB 4TMFA 4FKMA 1VJRA 1N5OX 2JGIA 1FIUA 2AOUB 3EODA 1T3ZA 2VTDA 2ZYSA 3DW3X 5G0TA 4BWVA 5KKCA 4HC4A 5SV2A 5B55A 1P2VA 4DA0A 1T15A 2XH8A 1SQSA 1RC0A 2EFDB 3EMKA 1K08A 1A8QA 4HBGA 2J3LA 4DPKA 1JP7A 2NO9A 1HSZA 1SUAA 2SHKA 4MJ3A 3MHTA 5C1PA 1ECBA 2XGMA 4KBGA 3QEOA 4P6VF 1L7AA 1NRWA 5FWYA 3SLKA 1S4MA 5KEIA 3GRVA 1UBFA 4HJXA 4N0PA 1JAYA 2REQA 3GMTA 1RXVA 4IDBA 5IW8A 1G2PA 4M1YA 4TL7A 2CMGA 5GPBA 2AJTA 3VKGA 3EQ2A 1GRNA 1SUBA 2MWMA 2ZDHA 3H9JA 1C7IA 2QTMA 4HGOA 3G23A 4BNYA 1U8EA 2VXYA 3W8RA 2UVPA 4TKUA 5ADVA 1M1YE 3EHEA 3E9NA 3D8NA 5DZSA 4QDKA 4RIFA 4IZIA 3GLRA 4FWBA 4IWXA 1KHTA 1Q0LA 4PQYA 3JU3A 1W36B 5ITVA 2Q0QA 3GJ8A 4JBWA 1SBQA 1JILA 1DE0A 2AG0A 5DLDA 5LYJB 1NHGA 2BEUB 1FRFS 2OCKA 3HKDB 3AEUB 1FZTA 1G5PA 4OMDA 5H4GA 1J07A 1QHGA 2FQQA 2FK8A 3PNKA 5EJ8A 2EX0A 1DO2A 3T8YA 4CR7A 1E1YA 1LJLA 4WOJA 3CX8A 4HAYA 4IG9A 2NU9B 4P38A 2F6RA 1LRLA 3QVJA 1SHJA 4ZTUB 3MRXA 4Y9RA 1QO7A 3VV3A 4RV9A 2PE5A 3R20A 4I7EA 3TO5A 4DYDA 4OM7A 3JV7A 2XZPA 4LYFA 2WWXA 3M9XA 3M9WA 4EG6A 2XXAA 3HM9A 2D7DA 2HKIA 5EYPB 5T5QA 4N8EA 4XWYA 1UFOA 4A23A 4GOOD 4DA4A 1GNTA 3RNOA 2GLTA 1GPMA 3OAAA 1QHYA 1JX6A 1RAGA 3IFSA 4J0KA 5DNWA 4Z54A 5F98A 1EG2A 3E58A 2WHXA 2Q6TA 2XGOA 1YJ5A 1GZVA 2ZOSA 3AHGA 3EPPA 3G88A 4YROA 5FWXB 4KRFA 2HA6A 1C1XA 1NOIA 1SZJG 4BQQA 4L8VA 1SHZA 1EXVA 2XB6A 1SIBE 1M5RA 2C5AA 1TTHA 2V7TA 3JQEA 3PB3A 2GAAA 4RZIA 1V8PA 2DMRA 4UMFA 2PNFA 1HDOA 4N0QA 3BT7A 1LVUA 2GZSA 1ODJA 1AQLA 5HF5A 3FH0A 3DOHA 4KE8A 4FR2A 3IR6A 4EB3A 1SVMA 4F45A 4WESA 2OGWA 5JH7B 4F2DA 3B8EA 2X5KO 5FRDA 4NOKA 4NVRA 4QJ4A 3G8BA 1CDZA 2VP3A 2OORC 2YJ4A 4ZAZA 1KYTA 1WF3A 2Z04A 4Q1VA 2QJWA 4TKZA 1OSNA 3ESZA 2VFAA 3LE8A 4GR4A 3EVAA 1ZG3A 2PUWA 3FLBA 3HXTA 1KRXA 3NTXA 5BOSA 3SVTA 1W0CA 3QFRA 4BAUA 1WZUA 2HLHA 3GGSA 3FDXA 5AVJA 2C84A 3VR3A 4D5EA 4LBYA 4MUBA 1USIA 1YQDA 2QTCA 3CJQA 5E9AA 2A14A 1DT3A 2XNSA 3C2QA 4I66A 1FDUA 1NKSA 1XK6A 2MMCA 4QDOA 4XVRA 5G02A 5WRFA 2SBTA 3U3JA 1UINA 3LLSA 3E1SA 1XRRA 3A2MA 2GJAA 3OOHA 3Q3GE 4WCFB 1NF2A 4MMXB 1FDWA 2I4TA 4NV3A 1SJ9A 4PXYA 4DNFA 3L8HA 1C30A 4KO8A 3Q88A 5T7BA 3UAOA 3UJHA 1CKEA 2OD9A 1Z2PX 3ONEA 3P26A 4EVRA 1LPPA 2BGJA 3O4HA 3N2LA 1RYDA 1QFYA 3P4UA 4KFRA 1GCGA 2WFLB 3EW9A 2Z4SA 3TR5A 5D6OA 3WLQA 5A3RA 2CNWD 3L2OB 3L8GA 1KAEA 3VR1A 4CT0A 3CCBA 6CHYA 1YFLA 1HT0A 5HXAA 1NRJB 3ECCA 4ZVMA 1EGAA 3FSJX 2WA1A 1Z5WA 4LGVA 5T8KA 1XVTA 4CLOB 2OGZA 1W48A 1CRPA 2BDTA 4RZHA 3GH3A 1UH5A 1HOTA 2I78A 2WF5A 2ZI7A 1L7NA 3FDZB 3OX4A 4BNJA 4M0FA 4A5SA 1YHNA 3GLIA 4A1OA 2FDXA 3OT1A 1CUYA 2UZ0A 3OEED 3TRFA 3FF4A 2ZXEA 1GG8A 5HRCA 3VKUA 2OLEA 2FWBA 3GLGA 4OHYA 2FP3A 1SD5A 4HDSA 1UFKA 4PAOA 3I2GA 4H7PA 1NXQA 1Y1TA 3ZNQA 1PBTA 2PD6A 3PCRB 4DY4A 1CQXA 1V25A 2QN9A 2BC9A 3ZE6A 3BKXA 2ZITA 1DZIA 1E2IA 1VCHA 1ZSYA 2A5JA 1Z4NA 3DV2A 4HFMA 1XDWA 1OBVA 5JVDB 2R1VB 3K5WA 4RSRA 2XMRA 4YCDA 4PQFA 1B4DA 3B3JA 2PT6A 3U4CA 2YCLA 1VB5A 4B8ZA 2GZAA 4B2YA 2QZ4A 3H1GA 5HF9A 2RD2A 4QBHA 3QFSA 1DU4A 2QQGA 3BMQB 5KVVA 3KLNA 4D9GA 2VDWB 3L4BA 4IPTA 1GDDA 4YFVA 1T6ZA 2CVPA 1H9CA 4Z51A 1DKUA 1AY0A 3V7UA 4JI0B 1G2IA 1G4UR 1T6YA 3QG5A 4RH0A 4UTZA 5DK4A 5K01A 1TYDE 5JS1A 1QCDA 1S3IA 1QTIA 1ULUA 4CVNA 4HWOA 1BVYF 1ACLA 1ZCJA 2EATA 1S9HA 2G36A 1KVTA 3JD0A 5EHGA 3SC6A 4QJBA 4B6JA 5JROA 5AIBA 2LBPA 4KV9A 4FFDA 2DU8A 4X6YA 2CL6X 2C7OA 5UKDA 3CF0A 3B5JA 3NH6A 2C9MA 3I5MA 3ELYA 4MR9B 3ZIAD 4F38A 1B0PA 2CFIA 1J2UA 1UKCA 4N3AA 1Y1QA 3BTOA 2WJVA 2JBHA 2YHIB 2JCVA 4U2DA 5TX7A 1R8SA 3MWLA 5AUQA 3GL9A 3K70D 3ZQ6A 1NC3A 2FSUA 1IIBA 3PDIA 3GFPA 1CY7A 3HB7A 4AY5A 2DBQA 3IDFA 2IXAA 3PFHA 3SD7A 1A97A 3HZOA 3VYVA 3EC2A 5BVHB 3V7YA 4A03A 4W8HA 1EVYA 3DO6A 3LFUA 5EY5B 5JCPA 1MTOA 2O3JA 3OWOA 4ZT2A 3R9IA 3ID6C 2W2OA 4WLNA 2D2VA 4IG4A 2AW5A 3ENQA 4A92A 1IQ0A 3A1DA 1WMBA 1GRQA 2ZJAA 4IGEA 4D9MA 1AJEA 1UWLA 3OKCA 3DLIA 2NVBA 2QY6A 3OHMA 4OSEA 5DHFA 3W5SA 1XD2B 4EW3A 1EM8A 1E66A 2QN6A 3ZGYA 5AW0A 3V4RA 1D04A 2PZFA 2QD1A 4LMBA 4PLCA 5K0CA 4G85A 4F04A 1I1NA 4KKVA 4K1XA 4TYMA 3UK1A 1E6UA 1E4OA 5KKNB 1FJGB 2KB0A 3FCCA 4WQMA 5FI5A 4XYGA 3W5VA 5IMSA 2VIIA 4CQJA 1IY1A 2P5UA 4CCYA 4DCTA 1KZ4A 4L4YA 3NDRA 4GLLA 2BEVA 4BZXA 3E2IA 4RU1A 3VR6A 3KXIA 2WOJA 4OHZA 3P0IA 3K2IA 3AHHA 3OPYA 2AJDA 4TMTA 3RU2A 4RTQA 1D1QA 4LPKA 4LCEA 2ZJ2A 1R0SA 3AR4A 3OSZA 3Q2IA 4XWTA 5FFFA 4DCPA 1K89A 1BZYA 3EXEB 4BNLA 4EDHA 3HN2A 3HYRA 3LBHA 1KAMA 4R9NA 3AX6A 1G41A 4EVQA 1RT9A 1SHKA 2VPXA 4E2WA 3QX7A 4C1NA 3E7FA 1OKKA 4JODA 3ZY6A 1P80A 2IUYA 2PVPA 1KAQA 2XKJE 3CY6A 3MTEA 4K86A 4HQOA 1U0BB 2OR3A 1O89A 4F9EA 2Q3LA 3Q3VA 1NI3A 5F3WB 4NIMA 5E4FA 1K88A 2EBUA 3IR7A 3B89A 1DX9A 1E3JA 1M0SA 5ETJA 3ZH9B 4NPAA 5K1ZA 1CEXA 1WY5A 1SURA 1QMGA 2CNNA 1BWRA 2IEBA 3O3MB 4LWZA 4OHRA 4CKZA 2C77A 1GCUA 3DGFC 4X8MA 1G291 1YQQA 4BE7B 1J0XO 3ACCA 4LHSA 3E15A 1M6HA 3RTCA 4OHKA 1OB5A 5F9MA 3FMOB 3L04A 4EYKA 3G7NA 2ID8A 3DTVD 1QZTA 3OCXA 2IV7A 5B4TA 1VSUA 5BYBA 2H3HA 3O2JA 4JLAA 2P1ZA 3GDWA 4LC1A 5DOVA 2C7QA 5IFLA 1ADJA 1JHOA 1HTTA 1KZ7B 5E4TA 4RNDB 3WI7A 1LDEA 1KF0A 4P3YA 3O1HB 1WLYA 4IDQA 1UAYA 3ADBA 4PLPA 5IP5A 2YWBA 3KLPX 5BNIA 1YZKA 1YACA 3QFTA 4J0IA 1DKQA 2VT7A 2I3GA 2XE4A 5DBGA 3EVEA 4FMBB 4RPCA 3RT9A 3CX7A 3ZUPA 2WI8A 3ORRA 1SXJD 5EKXA 1EX7A 1FC0A 3OMWA 4C2BA 3JPYA 4TVSA 4P3KA 1JA0A 3DAPA 5DGHA 1NZJA 1E96A 3EA0A 1ZN9A 1IY2A 4TV8B 5IMBA 2FOIA 1QONA 4EARA 4HEJA 1HXHA 4QDTA 1X77A 1QG2A 2J3KA 1H1LA 2RBKA 3DDSA 2AKYA 4MKXA 5LOVA 2ODBA 2HLNA 3PGJA 4XSGA 3C7DB 3OF3A 5TQVA 1EX1A 4GHWA 3VHQA 4YH1A 4KHZA 3DT6A 2RJ3A 2FF5A 4C0LA 4HWTA 4LV5B 2JFVA 2Q9CA 4HGYA 2ZPUA 1DAGA 4GXTA 4TWBA 3ZVKA 1JU4A 1QAOA 1WSDA 2E0IA 2AG1A 2XYRA 1KI9A 3FYUC 3SDSA 1RC8A 1K7XB 1L4KA 1USWA 3C3AA 4ZYZA 2OZEA 1UBCA 3A6EA 2A1TS 4ZT4A 1NBAA 2WU3A 5AM3A 1NULA 3HO1A 2VHQA 1ZUIA 3VPXA 3IEUA 1R3DA 2OV2A 3AERA 2C5GA 5BSGA 4TM7A 5K45A 4XJSA 2PRSA 1QDUA 2FVXA 1KKUA 1H94A 1ZIXA 4R2LA 3LPDA 2QM3A 3NBXX 1F1JA 1SCNE 1TT5B 1YRBA 2DWCA 1Z22A 4TMXA 4WY2A 1CUUA 2DZDA 4ZXFA 1LDBA 2QBYB 3WWCA 4ZVNA 4EHKA 5IZ4A 2WD8A 1BEZA 1OF1A 5EZQA 2PK3A 3R24A 3U4HA 5I4IA 5CCDA 3IAS1 1E3WB 1N5IA 1F7VA 1M74A 5CA1B 2PT7A 1W2WB 3RUIA 1DQNA 1JPNA 2BFDB 1GNSA 3ORYA 4U2KA 1DP4A 5B1IA 4FQ8A 2Y67A 4Z4HA 1DI0A 2QLMA 1OIXA 1TA0A 3A7DA 5JAZA 1CDOA 3G89A 1PKEA 4QOGA 4YECA 4Z9BA 4FWIB 1UMBA 4JLPA 3NJ4A 3A3PA 3GN2A 3TAXA 4DNOA 2G04A 3OZAA 1MB3A 4KU4A 3Q8KA 1XN1A 2FRXA 3AIIA 5FOUA 3R4CA 1WZ2A 4E5DA 1R74A 5CW2A 4PGGA 4EHLA 2ZSEA 4GMGA 1GA1A 1XLVA 1IRIA 3HU1A 4BWGA 3MB8A 3FR7A 4LQDA 2ZZKA 4PO3X 5IWCA 4JLMA 2OEPA 2FMIA 2W0SA 4PINA 1D4AA 2NQTA 3DE1X 4HBZA 1OU0A 4DG9A 3CZAA 4P5PA 2A3NA 3FCYA 1TW3A 2RIPA 4X1YB 4CR8A 3CUYA 2P0EA 3MINB 1SWWA 2VDPB 2FFQA 3QEMB 2NPFA 3VTFA 3HN7A 4KXFB 5EIFA 1UT6A 4HL6A 5L6LB 1DOZA 2WIAA 2HDWA 2JASA 3I34X 3QMWA 4KFSA 5FEMA 3R5JA 1C3VA 3TCKA 5BVGA 5LUAA 1A4RA 1ZL2A 3FSGD 1IAQA 3BJEA 1FFBA 1HDZA 4D25A 3K70C 4RAOA 5IYZA 1BJTA 1ORWA 4Q6WA 1S2MA 1N2CA 3QVGA 2P8JA 2AX4A 2JRCA 2R7LA 2ZIVB 3DVLA 4HAIA 4ZCQA 3AV0B 2Z9BA 4EX7A 2V8BA 1T3TA 5ALOA 3HDGA 3LUAA 4HJRA 3ETCA 3D0RA 1KZ6A 3BHIA 3QXHA 2J3MA 3VC2A 5EJ7A 3UJCA 2AK2A 3E22A 4Y2SA 3LSTA 3NOQA 1JFLA 4LV8B 4N7RA 3PJGA 3PKIA 1E64A 3HC7A 2IYPA 3IAEA 4IXNA 1CZRA 3SXUA 1J8FA 5H81A 1RAAA 2D2XA 3LNTA 5COBA 2OWDA 1OE0A 1U0OC 2PS9A 1O94D 3N2KA 1U7OA 3NHUA 1KI6A 4QG3A 4IAOA 2QNBA 1RABA 4ZYYA 4Y2QA 1G5TA 3EULA 1OA1A 4D3YA 3KD3A 1HMYA 3F96A 2HNAA 5CX4A 1P1RA 5ICGA 1R0WA 5IH3A 4B4VA 2ZUCA 3ETNA 3C4JA 3MB5A 2ZJ6A 4LY6A 4X1KA 3UK6A 3I6MA 3V2UA 4P98A 1TUEA 1MDBA 1LWNA 1TEHA 2QJFA 4LZZA 1KP2A 1T9CA 5EIWA 3ZWKA 5L3ZA 1GOTA 1QXSA 4ON9A 4ZFNA 3T5GA 1XA0A 4D2IA 2VEDA 4CMIB 2AL7A 4YRNA 3GGOA 3E5NA 4E7PA 3RRZA 2E49A 1G6HA 3UH1A 1A7KA 4ZYUA 2X13A 3RDPA 1YZVA 3TKYA 1H2XA 2JBAB 2PZKA 3V42A 5DASA 4OKSA 3HCWA 5JXHA 1Z8DA 2XZLA 2NSJA 3QLVC 3GNSA 5JPDA 2AI2A 4YCAA 3VNAA 1AUOA 4KQ1A 2PYZA 3TJRA 1RPAA 3WGZA 3IYLW 1ISGA 3SBEA 4V24A 1GUYA 2XECA 3B6KA 4I5DA 5E6UA 5D3ZA 1JBQA 1JIUA 5K6AA 4F06A 9MHTA 4EB0A 2O5EA 1DFGA 2O59A 5LQDA 2D1YA 1ACMA 3L6EA 2RH5A 3CCCA 2J9ZB 3C3JA 3OVMA 3MGCA 3OSUA 5JYDA 2FSSA 3A4TA 5EUMA 4NC9A 5HRUA 2HO4A 1RXSA 1N3YA 2V96A 3BREA 3EQ7A 4IO1A 2Q4TA 4TQUS 4CKEB 2NZ8A 1W5FA 5C34B 1VG8A 4MVJM 4A10A 4HNTA 3NI2A 2FZEA 3ZHSA 3B9PA 2E3JA 3IQZA 4MP8A 2G1KA 1PFVA 2RHRA 3CXUA 1DADA 4GX2A 4EKEA 4Q9DA 3B8HA 4GBMA 4FLMA 1T4BA 2RGBA 1NF3A 1ZGBA 1BHO1 2OMEA 4Y67A 1CX9B 2GF0A 1L5HA 2WVJA 3NDJA 5E4JA 2P2LA 3DV0B 3A37A 2EIXA 4MTLA 4Y7DA 1X86B 3N6VA 4U7GA 4U7JA 1FUUA 2G5TA 3RVKA 1SXJC 4FDMA 4IXTA 4MI3A 4ALKA 1RM0A 2PTGA 1DSSG 3OT5A 3VJRA 1MT3A 3DMTA 4KP7A 3W2GA 1Z16A 5FTLA 4W5RA 2OP1A 1YA4A 5A71A 2IYEA 4YDSA 4ZRDA 4F2GA 3SYMA 2SICE 4IVPA 1GKKA 1I2DA 2QY9A 3FUWA 3TDNA 3THWB 1QCYA 1ZM2A 2UUCB 2B37A 2B2CA 3C97A 3FPHA 2X3YA 3UG7A 4ERXA 3PHCA 4RD1A 3WP0A 4AJEA 2WPNA 3HVHA 3PLAE 5CVEA 5DP1A 4BQFA 3NANA 2WHQA 3M5DA 4HB2A 4KFTA 3V3TA 1OX4B 2Q4BA 4LXQA 1N2BA 3DKKA 3P9PA 3AH8A 4BB9A 3UNXA 2BFFB 4URZR 3NVMB 4UE3S 3PPXA 3WYCA 5CDGA 4NU8X 3I61A 3PD0A 4B7CA 1TIBA 2O1XA 1PW5A 3RROA 2GFQA 1C81A 3DXYA 5EIHA 4C4ZA 3K73O 2QN8A 2I1WA 2RH4A 4WLUA 2FUCA 2FZWA 2I5PO 1TUBB 1QV6A 2WLTA 3ACDA 2XOXA 4UAVA 4ABTA 1BMFA 1JG3A 1E9FA 5TQJA 1C8VB 1XCOA 2ZRDA 1AXGA 1OLUA 4JL8A 1T0IA 3WLJA 1PL6A 1BIFA 3IXLA 4XVHA 3NYRA 4LRWA 1Q3KA 3M2TA 3MJEA 4LFBB 5EMJA 2WYHA 3E5RA 3MG9A 2PGOA 1XAJA 1UJMA 3W1VA 4FBMA 3EGOA 1L3CA 4DDMA 5TRTA 2ZYHA 3AM5A 3TX6A 4D6PA 1GPWB 5B3KA 4TRMA 1PL8A 3A1UA 4H1WA 4CGZA 5DXJA 3I0MA 2DULA 4G5YA 1PTJC 3UOWA 1KOGA 1QGZA 2FN7A 1JG1A 1K7SN 2PDAA 4WOKA 3Q10A 1I4LD 3AESA 5LLSA 1Q92A 4XTRA 4HNAB 2CFTA 5FNVF 5DO9A 1UBMS 2F55A 3S44A 5LXTA 2MINB 2B94A 5JBIA 1F4PA 2ONCA 3H1BA 3R7SA 1VLJA 1R6TA 1X7DA 2BONA 5EZYF 1SB8A 2YWHA 4MCHA 2BBSA 2XDYA 2WJZB 3VDXA 2PKWA 2QGFA 1LRJA 3ANYB 1B8OA 1N6IA 5KYGA 1AMOA 3WIEA 4IIXA 5JJIA 5FA5A 1YUBA 2IDJA 2O8BA 4GDFA 1KEEB 1VLVA 2BBWA 4QUJA 2CHEA 1D6NA 2JFNA 1O57A 4IGAA 4N5DA 3AP1A 2NZUG 3PC2A 4ZQFA 2EKBA 1SXHA 2A0XA 1EB8A 1AQYA 4JHXA 3LLMA 2VHYA 1RWKA 4UPVA 2Z5LA 3DEYX 1RZRD 4JI2B 4GI7A 3JARB 4ZVUA 1ZA1A 2ORIA 4HLDA 3ICEA 1DRWA 2N46A 1ZAKA 4CL0A 4FS3A 1X0VA 2COKA 1RNLA 5I51A 1DX6A 5CCEA 4Q03A 4BRZA 4ME6A 5DNUA 4CWAA 2IHYA 2IF0A 4XCQA 4KGXA 4HB3A 4UAGA 5A4JA 7REQA 2F3PA 5H59A 5I4KA 5JXGA 5JU6A 1EP3B 2GKOA 3D6MA 4HXFB 3HJHA 3T7EA 3FWYA 3LT1A 2Z9DA 3AJ8A 4PLFA 1O94C 2BFEB 2HPZA 2QD3A 3JQGA 3VR5H 3X1JA 2C7VA 4QDUA 4EB6A 1P5RA 4DV4B 1J06A 2ANBA 5DB4A 3TSWA 3O7MA 3AJEA 1NL3A 1B6RA 3KKEA 2ADMA 2YN0A 1XMOB 2HHAA 4Y6LA 4YLGA 4DCMA 3ZLJA 4DVJA 4ZI5A 2AA3A 3GCGA 3AR5A 4R31A 3CPEA 3ET4A 4RETA 3RAGA 4RIEA 4J2OA 3UBTA 3DHWC 3PL1A 1WMFA 5CFNA 4CF7A 3TGPA 4I4TB 1FTSA 5HGXA 1BSVA 2DT5A 2EFGA 2PRIA 4MLZA 4NS4A 3HJGA 3JAMA 2EJCA 1CJVC 1GRRA 3ZZ0A 4J2HA 4GXQA 1PLLA 1ZLXA 1JQEA 3KLOA 3LBFA 5F35A 2VJCA 4LXXA 4HDNB 4IEIA 4RIHA 2IHZA 2VZ8A 4JJZA 1W44A 1W73A 2H54A 4INPA 4F86A 1D1PA 2VDJA 3A1VA 4XOIA 3LT5A 2AI3A 2VF2A 2ZJ3A 3EOAI 3PUWA 4PCVA 5AIAA 1Z5UA 2C2WA 2IODA 4KH0A 4KSYA 2OYRA 3SHOA 3GLFB 1QIGA 1E62A 1U0LA 2BN4A 3K6RA 3IKJA 3N8GA 4WZBB 4B47A 5L53A 2EBFX 5D1HA 4FLEA 1ISPA 2VJLA 5AVZA 4AKIA 2YNMA 2OL4A 1FS4A 1YVRA 2AG8A 1H22A 4OKIA 2X4GA 3DP9A 4Q9HA 1GGVA 5FPPA 3RS4A 5INTA 4RC9A 1YR7A 3L1HA 1YT5A 3S5UA 1TLLA 4YJ3A 2XEDA 3PG5A 1C9EA 3MCVA 1WEKA 4UUMA 5ALLA 1Q21A 3MT0A 5BN4B 4CLXA 3AM1A 1Q3HA 5KOHA 1FFXB 3UCEA 5K0GA 3ROPA 5JRZA 3PRYA 4XJTA 4B8YA 3UOGA 3RVQA 4MINA 4J03A 5GADl 3PU6A 4OHXA 1H23A 1T1SA 1M0WA 1MX3A 1Y0BA 3KOXA 1K2VN 3OJWA 5ERYA 2V6MA 1ZOOA 3OQHA 5B2ZA 5BSVA 3W8NA 4CIYA 3J81k 3NR2A 2WAXA 2X9QA 2IWRA 3WADA 1P9NA 1MEJA 4DMLA 2FLWA 13PKA 2QP9X 2QTBA 2XGSA 4CBVA 4RUKA 4CLHA 1J20A 4BKQA 1L3IA 2FN4A 4ROTA 1H8EA 3ORQA 3SMQA 4NXMB 3JR7A 2R84A 1GCAA 4ZVKA 1VZ2A 5A4FS 1SELA 3H5TA 2B8EA 5THKA 1LBTA 5GTDA 2ESRA 4M7WA 2REQB 4BN4A 2FX2A 4UEKA 3STHA 4N1AA 5KNDD 2ORVA 1GPH1 5F5XA 4ARIA 2EWMA 1FLDA 2B20A 4IVQA 2QNRA 1AZLA 4JY7A 1GQOA 4ZANA 3K35A 3A6PC 4DRZA 4IHQA 3DQZA 2H2HA 4O1MA 4TKUB 5E7MA 1W36D 1NW6A 2FPOA 4EMBA 3UC5A 4BLSA 1U4SA 4R2MA 4AT1A 2ZRCA 4HX9A 1H3FA 1I13A 4FXOA 4IIBA 2AYXA 2DWUA 4KWEA 3S55A 1ZH8A 1UPXA 4XB6B 5FLEX 1DXYA 2R8EA 1U1IA 2BF7A 1Y5NA 2DF8A 2IZ5A 4IDNA 3AYXB 2QM7A 4QHSA 3EIHA 1RAHA 4JEIA 3CZ9A 1AA6A 2E55A 2P79A 5BQOA 3HE3A 4M2LA 4LRXA 3TPCA 4H6VA 3OTQA 2WSBA 4I0WB 4X8LA 1K3FA 1P3Y1 1XTIA 3BIXA 3BQ9A 4UBIA 4AZ3A 4DPLA 2HDHA 4RXTA 5I7AA 1CR4A 3C3YA 4R3WA 1XZ8A 2FPXA 2FFAA 4TLAA 1UBEA 2N3ZA 3VR4A 3C1TA 1QO0A 1HYBA 3LRTA 1I7NA 1KMIY 2P9YA 1JEOA 4A36A 2VJMA 5KCMA 2QX9A 3RS0A 1YS9A 3DOEA 3JVVA 4QWWA 4WXPA 4EM6A 2VWHA 7GPBA 5EJ5A 5KTKA 1FFSA 2GAFA 2W6JA 1QWSA 4FONA 4TZTA 1Q20A 2QTTA 2PA0A 7MHTA 1GG2A 1LTKA 1XXHA 2ZWVA 1JZQA 3PFGA 1OZGA 2HRRA 1CQPA 4KQXA 4YQYA 4EY8A 3PHIA 2VBCA 1HUQA 1XFDA 4Y1EA 4D56A 1XZAA 2NU7A 1VSTA 4C08A 1XMXA 1KSJA 2AMLA 3WV5A 4ARSA 2CZGA 2BLNA 4HAWA 4MGYR 3TVTA 3DBVO 1NAHA 1U8XX 3D3EA 3L7JA 3Q7IA 4WZ6A 2XUDA 3QV1A 5F5NA 5HEKA 5CFZA 1CEEA 1CY6A 3Q9UA 3ML1A 1V1RB 4MA5A 4QPNA 5EWJA 4S0XA 5FIUA 4ZHSA 4B0OA 1RXEA 4UXHA 3GRUA 4WESB 3EW7A 1NQTA 4XFDA 5DI9A 3C5EA 3PEVA 5FUXA 1U94A 3IAHA 3HG7A 4S1OA 1FFAA 2WTXA 4R83A 4F12A 2R00A 1IHPA 1V5EA 1XCMA 3RT7A 3KZXA 5CLIA 4Q7LA 5CK4A 5AMXA 1I2CA 1NE2A 3R9XA 2IKSA 1GFWA 4MUKA 3OIDA 5IFKA 2O3RA 3N2ZB 4DDHA 1RQPA 2LDBA 3SC4A 4JB2A 4P80A 3UCFA 1T9AA 4JJIA 1L8OA 3IDAA 4REMA 3HBFA 1JMKC 2DX7A 2ID4A 1O6BA 3QXXA 1ECJA 4U7TB 2P11A 5FA6A 3WIDA 1O95D