2NTYC

Rop4-gdp-prone8
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
176
structure length
173
Chain Sequence
SRFIKCVTVGDGAVGKTCMLISYTSNTFPTPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFFIDHPGAVPITTNQGEELKKLIGSPIYIECSSKTQQNVKAVFDAAIKVVLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Emb|CAB41934.1
publication title Structural Evidence for a Common Intermediate in Small G Protein-GEF Reactions
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 52
structure length 173
sequence length 176
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ntyC00
3KKNA 4Q01A 3WYFA 2JGNA 3LQQA 5H8WA 1X1RA 1D2NA 3PFIA 1E94E 1G20E 1ZIPA 1W5SA 4C2TA 3RC8A 2VIIA 1VECA 1GKUB 1E9DA 3TE6A 5AUOB 3MWKA 4DDUA 5FOVA 3L0SA 2P5TB 2ZRIA 3Q5EA 3SC3A 3SEAA 3VNVA 1RYFA 3L82B 2KI5A 2ZETA 4FMDB 3VR3A 2VTKA 3WXMA 1FNMA 1U9IA 3KUDA 3QXCA 5FUYA 4EJSB 2W6ID 2D2FA 3OEEA 1JJVA 1VCMA 1P73A 2CCGA 4XD7D 2GWHA 4Q4HB 4U02A 5KPJA 4U7DA 1WRBA 3FKSA 3T1OA 4RD6A 2ZSDA 4KV9A 4OHWA 3NBXX 2K5UA 1B23P 3K53A 4V0KA 4IDPA 2GNOA 3ZJYA 3P4XA 4UKDA 2FPMA 3CONA 1L2TA 2ZI5A 3IUYA 5JZVA 5AUNB 3CBQA 1AS3A 2ZRKA 2O8BB 2CJWB 4D6PA 1P9WA 1SVKA 3C15C 4JLAA 4UXHA 2O8EB 6Q21A 3DOFA 4C0KA 3X1DA 1NJFA 2CVFA 3ZQJA 1OH8A 4TMKA 1Z3IX 4PQRA 2FFAA 2OG2A 3GJ5A 3M4YA 4B2PA 4AG6A 3UPUA 2X77A 4C0HA 1FNNA 1E6CA 5JS7A 2GA8A 5KNBA 3GJXC 4AYTA 4F93B 3IKJA 1IQPA 1Q1EA 1W48A 4I1SA 3SQXA 3ZZ0A 1KK2A 3T34A 4ZCLA 2O8DB 1XMIA 1HQYE 2G0TA 4AURA 5E7IA 1RRGA 4DEXA 2UKDA 3EC1A 3A1UA 3N2EA 5TY0A 2QBYB 1BOFA 1NBME 2BKEA 2KJQA 4DJTA 3X1XA 3R9IA 3A1WA 3UWKA 2AKYA 2LKDA 3KDSE 2XOKA 3GMTA 1BYIA 621PA 2WSSD 2O0JA 3OIYA 5J4KA 1W36B 2YV5A 5FL7A 3GLFB 2N1BA 4OI4A 3TR0A 1FMJA 2OFOA 1DARA 5EP3A 2IYSA 2JDID 1US8A 5IK2A 1KO7A 2WSMA 2EQBA 1KY3A 4UNQA 3K70C 5IRCD 3OEHD 1XP8A 4AG5A 2ZJBA 2GK6A 4NHOA 3WMGA 2YZ2A 1KSGA 2W2XA 5FBQB 2OFWA 2Z4RA 1Z07A 2RGCA 4TZ0A 4KJZA 4ZKDA 3QF4B 4C0QC 5JFGA 3ZH9B 4BLRA 4LJ5A 4ZDKA 2QMOA 1CJVC 4DLWA 5DHFA 1LF5A 3TQCA 3GCGA 2FWRA 3AQ4A 1XFAA 3CRMA 4HB0A 4IVPA 1S96A 2WWXA 3QKRB 4B32A 2ERXA 4Q4AB 1E9BA 1SHKA 3FGNA 3QXXA 3K9GA 3KZ1E 1L8QA 3P32A 2QSZA 1G8FA 1UKEA 1NMYA 1R0XA 3KUCA 5EZ5A 4CRWB 1KDPA 2GXQA 4B3CA 1G1MA 4F91B 1GRQA 2YYZA 3PITA 4D80A 5KDOA 4KODA 2X1VA 4YMSA 4TTPA 1G7TA 4RSGA 4D81A 4FWIB 3C8UA 2IHYA 4TLEA 2CBZA 2NG1A 4YLGA 4EFNA 1KK3A 2WJGA 1T3LA 2AR7A 1CRQA 4NONA 4M2LA 5D3MB 3CLVA 4CEIB 2WOOA 1XXHE 5L8VA 1Z0IA 4LBVA 1HEIA 2QQEA 4C4PA 1N6KA 4XSHA 3V00A 1M74A 1WF3A 2QROA 4MYHA 8OHMA 3QQ5A 2XZOA 4WXRA 2Z4SA 3EIHA 4TYPA 1YHNA 3VX4A 1KY2A 1P2UA 4D25A 1E1QD 3F8TA 1TQDA 3VU9B 4PO9A 4V0LA 4TYYA 1Q3HA 5FOUA 2HCJB 1E9EA 1G18A 4I1VA 3KTAB 3T1TA 1ZUIA 4E03A 1XTQA 1UAAA 4L9WA 3RS7A 3S1AB 3PXGA 2XB2A 1GNRA 2A5FA 2ZVQX 2ZRCA 4DCNA 2V1XA 1LF0A 2FE4A 1OIVA 3GLIA 4DIDA 4GT1A 2RHMA 3REFA 4EPRA 5FOTA 1E2JA 1C1YA 3K9NA 4WXPA 4OHYA 2CCJA 1G17A 3RRMA 4XWAA 4AD8A 1HTWA 5K8TA 1COWA 2WWFA 1OHHD 4RKEA 5LBIA 1XTSA 5F2EA 1TF5A 4NDZA 4G3XA 1KDTA 1KMQA 4IDOA 4A15A 4YMUA 2QAGA 3NBFA 2YNMA 1HT1E 1U9IC 3ZLJA 2RGNA 4FIDA 4M4SA 1A4RA 4M9ZA 4DBLC 3UMFA 4P4SA 3WYAA 1W36D 4LJ4A 2CK3A 3BH7A 2FDCA 3EAQA 3DVLA 2ZIAA 1CJTC 1LY1A 1W0JD 4IOMA 2Z6VA 1Q1ZA 4DCSA 4DSNA 2ODEA 3GEIA 1UM8A 3AKCA 5B30A 1UBCA 4E5UA 4LV8B 1KZ7B 1E96A 1WB9A 4DB4A 2MSDB 3U3MA 4BPBA 4CEHA 4MGKR 2DFLA 1ZM7A 2FPLA 3OIUA 3SN6A 1ZNXA 2GXUA 3KXLA 1KO8A 4NPHA 3K0SA 2BIFA 1OW3B 3FWYA 4LPKA 5DN6D 1JECA 4DEYA 1QVRA 2YINC 2CCKA 3FMOB 3MJRA 1XZQA 3OEHA 2EFDB 3AGPA 2R6AA 4HUTA 1SXJA 3IBYA 4PC3A 4JLJA 2P6RA 1J99A 3Q3JB 1EWQA 4O3MA 5FTNA 4NCKA 1DOAA 3D8BA 4IVQA 1ODFA 2IS2A 2G3YA 2N46A 1RVDA 4X8HA 3PUVA 3RAPR 4Q9IA 2DWPA 4CGZA 2YWEA 1Z6AA 3L0IB 3RNLA 5LB2A 5D3QA 1T91A 4NYJR 1CP2A 1IXSB 2Q0HA 1TQ4A 4IKEA 1T3SA 3PUXA 4WAUA 1RPZA 1QHHB 3K8YA 2ZE7A 1XJ0A 4CT4B 3SBEA 3VMFA 1GRRA 2YC2C 4LZZA 3DKVA 1XF9A 1Z0AA 4AKHA 1WBBA 1G8HA 3LY5A 1SHZA 3DMNA 2JIZA 1TL7C 3OF5A 4TYWA 1L7VC 4Q4HA 4R7ZA 3N70A 5FI0B 2D4HA 1XPUA 5FOXA 3QENA 2OCYC 2UZIR 3JVUA 4MRNA 4BQSA 1VCNA 3AP3A 3QVVA 4A2WA 1HUQA 3OE7A 1YZQA 3X1ZA 2VP2A 4AYXA 4LYFA 1HE1C 4JLBA 1P75A 1NI3A 4P33A 2F1RA 4DLVA 4O25A 2O8BA 1S0UA 2CJWA 4W5WA 1OKKA 1JEDA 5HE9A 3PEUA 2GCPA 1E4YA 2VHUA 1NSTA 3PQCA 1KDRA 4B3GA 1Z6YA 2C9CA 1Y3AA 4Z8XA 1E9CA 2AL7A 3HPRA 4M9QA 1M7BA 4NKRA 4QHSA 3T15A 1H8EA 5HTKA 3E2IA 4X8OA 5FPTA 1GNQA 2EFHB 4JJKA 3R9WA 1F3OA 1LVGA 3HR8A 2HT6A 1Q0UA 5DHAA 5EE5B 5TB5A 3KKOA 1NL3A 1YRBA 1KSFX 2V7QA 4Q00A 3LX8A 2I3BA 4LC1A 4PZYA 1CF4A 2BMFA 2QBYA 5C18A 2ZRBA 3MCAA 2VSOA 2V54A 4OK3A 1P2VA 1VHLA 3VHXA 1AZSC 1N0UA 3BB3A 2WBLC 3BB1A 5K8IA 1OHHA 1XXHB 1U8AA 3NHBA 5H68A 1R8SA 3TSWA 3LBNA 2FV8A 1N6LA 3FTQA 1XD8A 4Q19A 4OL0A 2W00A 4UQOA 4TMVA 4PO8A 3AKDA 5C4MA 1YRAA 3OFND 2YWGA 1F2UB 1W4CA 4Q9JA 3GLFA 2IXGA 2ONKA 1W0JA 3EG5A 4RVCA 1YR8A 2H17A 3TSZA 5JHGB 5KSOA 3CR8A 3C16C 4NYIQ 1YR7A 2JATA 3B9PA 3K0AB 2H7VA 2G1KA 3Q9LA 4JVMA 1YJ5A 2WPDD 3MFYA 3VFDA 1A7JA 1KO1A 4GOJA 5IT5A 1TQ2A 3NIBA 4B2IA 3MD0A 4LYAA 2ZJ2A 4AWXA 1KIMA 1CJUC 1S2MA 2C77A 3WNDA 4A6PA 5P21A 3QF4A 4PTLA 3WHKA 1NN3A 3GPLA 4YONB 1E2QA 2XZLA 5BXQC 1RRCA 4L16A 3I73A 2DFKB 1ZUHA 3NC1C 1YZNA 1YR9A 2BJWA 4XTRA 2V6IA 3QBTA 5L3VA 3H84A 2NOAA 2HF9A 3QKRA 4Q4AA 3HYTA 5AJVB 4PC2A 1EFUA 4C30A 4M1SA 4DUGD 4TL7A 4KI0A 3TKLA 1NSFA 4C3ZA 1G7RA 3KQUA 4BLPA 1P2SA 2ZTSA 5FL3A 2PCLA 2RGNC 2ZS9A 4CDGA 3IHLA 2GCNA 1MT0A 1F2TB 2EYQA 2WKPA 3SNHA 2XSZD 1ZJ6A 2GEDA 4JSTA 3UANA 1R0YA 4DDVA 2ZSAA 4ZIRB 1MR3F 1DE0A 5CJ2A 5DISB 2YOFA 4NCIA 1ELOA 2HJVA 3FHCB 5KPDA 2P6UA 4BZPA 1CXZA 4CEIA 3K70D 1AN0A 1N0WA 4L5BA 5A0FA 4BFUA 2WMOB 4DLTA 2YHSA 4QC2A 1NRJB 421PA 1JALA 1QRAA 2BBOA 1XEWY 2FFHA 3QOFA 1MOZA 4TLCA 1HH4A 1IOZA 1GKYA 1KKMA 2OUKA 3AF2A 4URZR 3VU9A 2PZEA 4QOSA 3TUIC 4DSOA 4B6FA 4OHVA 1BH2A 4RZXA 2DWOA 4PSKA 2MMGA 1M6NA 3KTAA 1UBEA 2J0SA 3W9YA 1Z8FA 2F9MA 2QRZA 3AEZA 4Q66C 4XIGS 3S1AA 4OI0A 1NIJA 4JVSB 3BGWA 1E99A 3MMPA 5EE9A 3THWB 1G3IA 3PUYA 5DE3A 2CDNA 1FOEB 4IXNA 4OHXA 4GZLA 2G0NA 1GAJA 3EWAA 5FPYA 3K9HA 3WP0A 2CLDX 3LX5A 3ZZTA 1GIAA 4B43A 4KLZA 3KKQA 3LBHA 2VLIA 2IYYA 2WV9A 1IN5A 2P2LA 2IYXA 5A5GA 2IYQA 5FFMA 3TR5A 4EJSC 1W0KD 1N6NA 3AVQA 4D26A 4YXWD 3ZZUA 4RD2A 4MQBA 2PH1A 3OAAD 5DLQC 3QNUA 4PAQA 3AVTA 2O0KA 3I3SR 2BKUA 4PAOA 1G8GA 5HZKA 2W6JD 1Z2CA 2NO7A 4AK9A 1JR3D 4W5JA 1PVOA 4QJ5A 4URVR 3SS8A 4MKFA 1RYHA 1VYVA 3C5CA 4OI1A 1X86B 2IUUA 3CRQA 3SBDA 1UKZA 3BS4A 4EPWA 2OCAA 4BLSA 5HPYB 1HQCA 2ZR9A 2D06A 1ONBA 3VHLB 2ZJYA 4W9MC 2OLKA 4TSFD 2CVHA 2ZYWX 4R9UC 1Z22A 2VF7A 2W2VA 2IF0A 1MO3A 1OXVA 4BUJA 4HB2A 2GJ9A 4JYCA 4S35A 4AI6A 4M1MA 2AWOA 4B74A 3PVSA 3CB4A 3BK7A 4L9SA 3AV0B 4DCUA 1AJEA 3QUSA 5H1YA 1NBMA 2QTHA 1XPRA 4YDSA 1HT2E 4MGIR 3MWLA 4ZDIA 5E4FA 1RRFA 3AF3A 1YU9A 4WBSA 1FL9A 1DG3A 3IIJA 1E2IA 3GLGE 3UATA 4EPXA 1R5BA 1D5CA 1U8YA 2YC4C 2QP3A 5GJBA 2W2TA 1CJKC 1XTJA 4Y0AA 5AUPB 3HJNA 3NDBB 4XVQA 2ONJA 4MUAA 1QHHA 2IYUA 4LDJA 4A8JC 3RYTC 3CPHA 2QT0A 3BH0A 5KUTA 4BWYA 5C4GB 5AUQA 3KJGA 2XGJA 4Q18A 4JL8A 3U3RA 2ZYVX 3M6AA 1LNZA 3IIKA 1IY1A 5AJYA 2PEZA 3UIEA 3X1YA 5JJIA 2JLRA 1E2KA 4MDEA 4EAQA 4BEJA 3KJIA 5H70A 2A7QA 1ZM3A 2CL0X 1EFRD 2NMVA 4ZO4A 4C0JA 3TAHA 1JI0A 5JSZB 2P5SA 5BN4A 1AQUA 4JYBA 2AD5A 2FJUA 4A0HA 5KSYA 2CE2X 2IHBA 4UNSA 2DCUA 2F9LA 1E2PA 3L8ZA 1S1MA 2PLRA 1EXMA 2ZRPA 4EQ6B 3AVWA 1EFCA 3X2SA 4B76A 1T0HB 4IHQA 4R98A 2OLJA 3QXJA 3ZIAD 4CT5A 4JBWA 1RE0A 2OXRA 3HU2A 5IHPA 2GXAA 1ZMXA 1T8TA 1D9XA 4KVAA 2ANCA 2QAGB 3O8RA 4RFSB 2B8TA 3RDPA 3I92A 2J7PD 1S9DA 1VCOA 3QIAA 3W3ZB 2ORIA 3U3OA 3K0CC 1FMLA 1ZC3A 2XNDA 1P9RA 1KAGA 2CNWA 3DM5A 3HPQA 4R71A 1CIPA 2EVWX 3RS4A 3BWDD 3AVUA 4TL8A 2QRNA 2ZYTX 1FUUA 2GESA 1OYYA 1EK0A 1YR6A 4KFTA 4Q9KA 2NIPA 1XXHA 2YWHA 3DKPA 3VR1A 1ZRHA 3OESA 2WHXA 4CEJB 4FMCB 4HB4A 3QXHA 2KSQA 1U0LA 2AN9A 2J46A 3A37A 5G3ZA 5SZIA 2OCPA 3QG1A 1F2UA 3EA0A 2H8KA 1GRNA 1KHTA 2XTNA 3O8DA 1QG4A 2OAQ1 2VP5A 1TF2A 2R44A 5G53C 4Q7MB 1UPTA 3K0AA 1WA5A 2EU8A 5CJPA 1XEXB 3C14C 3NWJA 1KO5A 1K8RA 2N42A 5KYKA 4TQ9A 4B3XA 4MRPA 3GLHB 4RD3A 5HKKD 3B13B 3WNBA 4KU4A 2SHKA 1SKYE 4YMVA 3L43A 3IGFA 2FEMA 2ZU0C 2REOA 4DKXA 3SFVA 5FPHA 2D74A 1AS2A 2CHVA 2OM2A 2VYFA 3GFTA 4LHVA 4LJ7A 2CL7X 3CNOA 3RRNA 5DGXA 2NO0A 4JLDA 1GM5A 3P4YA 1GUAA 1OFIA 3EA5A 3B1XA 3LW8A 1UJ2A 2AD1A 3EWSA 2CL6X 1OLOA 3L2OB 3QBVA 3RLFA 4GRAA 4RD4A 5FUWA 2R62A 3A1VA 2YOHA 3HU3A 3QEOA 2F1IA 1JEEA 2W0SA 4HLCA 3UWOA 4BZXA 3SHFA 1F2TA 2OCBA 1P5ZB 5FTJA 2ZAOA 3MSXA 4PPNA 3PJRA 4KVGA 5JS8A 5UKDA 1QDEA 4A2QA 1RIFA 1D2MA 4IJMA 4M0LA 4ZIRA 3BJIC 3W5IA 4ABYA 4TLDA 1KNQA 2QMEA 3A1TA 1T9HA 1ZM4A 1EX6A 4EPTA 4GOXA 1CJMA 2WWYA 1I4LD 3I5YA 1W44A 3NH9A 1OH7A 1DAEA 1W2GA 3MLEA 1S1CA 2WTUA 3I8XA 2CMKA 3SZRA 1XMVA 2GVDC 2RKOA 3EXAA 2CLCX 2OFXA 2OAP1 3LA6A 4HZIA 2IYWA 4OK5A 1Q20A 1SVWA 5BYJA 1Z83A 4DCTA 4NYJQ 3GLGB 2WKQA 3CO5A 2WAXA 3ZS9A 2NO1A 3ADBA 1EFTA 4XVRA 1G3QA 3NH6A 3ZIAA 1NN5A 2IA5A 1R4AA 2VP4A 3AVXA 4EDHA 3RS2A 1M8PA 2JLVA 5C46F 5FTMA 4CVNA 1FQJA 1N6RA 2G88A 3THWA 2IF2A 1XD2B 2HDNB 1WCV1 4BLQA 2VH5R 2QSYA 2O8FB 2J7PA 3GD7A 2PX3A 4DXAA 1OH6A 4KLNA 2QL6A 3KB1A 4IFEA 4P32A 1W47A 3GJ7A 2JA1A 3EPKA 3R7WB 2FN4A 1DAIA 1JJ7A 2R6CA 2AK3A 2A2ZA 2GBLC 2XB4A 5DI3B 1DELA 4PZLA 2HLDD 4OQLA 2RMKA 3TW8B 3SDZA 4KFUA 1QZXA 4DLZA 1P6XA 2ZUBA 4JMPA 3LXRA 2IUTA 4MA4A 1KMHB 3O8CA 1NY6A 2E1RA 1KK1A 1KI1A 3AF1A 2C5LA 1AK2A 2JLQA 3C41J 1NKTA 3ZQ6A 1BO6A 1R2QA 3KL4A 3B5JA 1I2MA 5JRJA 1KI9A 4HAYA 2H57A 3Q5DA 5SZJA 2QPAA 3IO5A 5CK5A 3SYKA 5KNDA 5E7MA 4PC6A 2Q9AA 1VG8A 3MAAC 4L4UA 2JCSA 1S4QA 2FZLA 4IOKA 3LNCA 1DO2A 4RZUA 1SGWA 3TAUA 1XWIA 2QE7D 4AYWA 4OQXA 4HEJA 2PCJA 3CRW1 5HKKA 2NGRA 2ZPTX 3W8RA 3QG5A 1T5IA 3P27A 2J1LA 4B48A 3KXKA 3TJZA 2V55B 3AF0A 4MKIA 1P62B 2VO1A 1UBGA 3MJHA 3WY9A 2REBA 2W6IA 1KJZA 521PA 4AIIA 4DHEA 2RGAA 2G1JA 2ZJAA 5J4VA 2GKSA 2LCFA 4XD7A 2VBCA 2JAQA 3W3AA 4XSGA 3IPYA 1SULA 4PHTA 1E69A 2IYRA 5EE3A 3FVQA 4RD0A 3CX7A 2A3RA 2WJIA 1XJCA 4A82A 2ZRHA 2KBFA 1LS1A 1XNJA 3IHWA 2Q21A 3TQFA 3B8HA 3FOZA 3F0TA 1UEIA 2ZE5A 1MO6A 4KCGA 4HAZA 1NF3A 2FOLA 4NYMR 2XZPA 2JJ2D 1UFQA 1FQKA 1Z06A 3LAWA 5JSZA 1OIXA 2WM9B 5AJWA 2PLFA 1JR3E 2F7SA 3NBYC 2NZ8A 1SKYB 2IWRA 4DLRA 1AA9A 2AHOA 2QM7A 4ARZB 2ZRGA 1E4VA 2IWHA 4DDWA 2QTFA 4JZKA 4LX0A 4EQ6A 3B1ZA 3BB4A 3ZVMA 1P61B 4US2R 1ESMA 5EQTA 5AK0A 4UXIA 4MKHA 2QM8A 3D6TB 4P3YA 5J40A 3LD9A 3T1QA 2R9VA 3U3JA 3I4LA 3LRPA 5CLQA 3VR4A 4Z54A 2IEYA 2JLWA 2IC5A 2VHCA 5DYIA 4HSEA 4K81B 4RFSA 1IN6A 1IONA 1RKBA 1XU4A 2ASEA 4HDCA 4Q4LA 2ZRNA 3AP2A 2JLUA 1FX0B 4A0GA 1IN8A 1P72A 4URWR 4N3NA 3TIFA 3QKTA 1N5KA 4I1OA 4IVRA 4D0LB 5L3RA 2WSSA 1CBUA 1DADA 3AH8A 1DVRA 1XZPA 2CLSA 4JVLA 1GDDA 2R6DA 1ZYUA 2ZSEA 1DTSA 4PHGA 4XTCS 2BM0A 3TGPA 4KBFA 5LD2B 3FKQA 3R9XA 2F3RA 4XWOA 2Y8EA 4D4JA 4JT4A 2XJ4A 3C5HA 5DI9A 4LK2A 4D0NA 5B64A 1E0AA 1DS6A 2JDIA 4CEJA 2NO9A 3CPJB 5TDHA 5J4LA 4JLPA 5J4HA 4DB2A 2PT7A 4LOAA 5TVKA 1ZD8A 2HLDA 4Q9HA 4TMTA 4JSYA 4UXJA 1SKQA 3CZQA 1HE8B 4Q4JB 1NN0A 5HCIA 4B3BA 4EPVA 3NG1A 2Q3HA 4UJ3A 3V9PA 3CZPA 5AJXA 3CRRA 2OEPA 4JL5A 2BEJA 4PANA 1XEXA 2FSFA 3RS0A 1JBKA 3AUXA 4DDTA 5B57C 5DIFA 1IM2A 2F1JA 2HV8A 3QI2A 4R2HA 3SYNA 2F43B 2PMDA 1G5RA 3DDCA 2ODBA 3GLHA 4FI3C 3IQWA 3QEJA 1W49A 3ASYA 4B33A 4TL6A 4R2IA 1MRSA 3K09A 1FZQA 4ZCIA 3KFVA 1XMJA 1W1WA 4TMWA 2Z5FA 1E9FA 3A4LA 3WRYC 5CDFE 1NMXA 1E2MA 1JXMA 2RB4A 1U0JA 3BOSA 2FEOA 3BERA 1NVVQ 2YVUA 2ZJ8A 1XTRA 1E1RD 4ILEA 1E2EA 3LVQE 3HDTA 4DLXA 2JJ1D 3PR1A 2BDTA 1XDBA 3U5ZB 4PSAA 3GP8A 1E9RA 1G21E 4V0MA 4QBGB 1TU3A 4KHZA 3CX6A 4LV5B 4CW7A 2GZDA 3BIFA 4QBIA 1Y63A 1ZP6A 3NHAA 1OE0A 2B92A 5F3WB 2H18A 2HF8A 3KX2A 4DLYA 3DM9B 4QM6A 2YJTD 3K70B 3TUJC 2J5XA 3U61B 1BKDR 3E1SA 2OBLA 4MYTA 3BFXA 3EW9A 2HYIC 3AB3A 3WP1B 4LJ6A 4OJQA 5JEDA 1NVUQ 4GI7A 5KDDA 1NLYA 1E1QA 3LDAA 1N6PA 3A4NA 1G6OA 3FFBA 4WW0A 3NXSA 3ETLA 1FUKA 2IS1A 1VG9B 4JVNA 2XEXA 5CLLA 2ZI3A 4LBYA 1XJQA 2KE5A 1TQ6A 3UMRA 1M34E 2R2AA 4NCJA 4QL3A 3A58B 5DNYB 1DAKA 1P4SA 1IHUA 1H8HD 5JHHB 1MABB 3C4JA 3RSLA 4HUQA 2OBNA 4RKFA 3UG6A 2FZ4A 1TPZA 3QKUA 5ELXA 2JEOA 4QGGA 3GLGA 2ZS7A 4ZCMA 2B7BA 5EP4A 2DY1A 2ZRAA 3LXXA 5KU1A 3BXZA 3ONWA 1K5DA 1IN7A 1ZW6A 4CYMA 4TTRA 5BYKA 4Q03A 4PC1A 4Z1MD 1NG9A 4Q7KA 1XD2A 2FH5B 4UNRA 2RGBA 1BYUA 2VEDA 1XTKA 1KK0A 4KITB 2O8FA 1FFHA 2DFTA 2AFHE 1V5WA 1GL9B 3T5DA 2ZJZA 4M8NE 3I61A 1W4BA 2DB3A 4QBHA 1KI8A 2XXAB 1Z6XA 3R7WA 2IBMA 2P6NA 1VIAA 1KKLA 1ZU5A 3MUFA 1E3MA 1UKYA 2H5EA 4POAA 4H1UA 2BC9A 4HLUA 4HYYA 5DI3A 5BN3A 5GVRA 4MKGA 4ON9A 3TW4A 4EFLA 3AM1A 4DSUA 3PV0A 3SJCA 5LPNA 4HAWA 4D4KA 1DAGA 1GZSA 4B3DA 3L0OA 1DG1G 2C99A 1KMHA 2D62A 5CIQA 5DN6A 3RHFA 2BBSA 3BH6A 1OFHA 2AX4A 4FCVA 2ZM5A 5JI2E 3Q85A 2GXSA 2PZFA 1CLUA 4HAVA 4O2RA 5JCZA 3U44A 2PEYA 2I1QA 4IOLA 3EC2A 3VKHA 5CB6A 4Q47A 3NEYA 3EZ2A 5L3SB 1Q22A 2BWJA 2FFQA 1QHIA 4LSGA 3SHWA 1EESA 1Z08A 1T6NA 5BN5A 1OXSC 1TAGA 4MYUA 2AWNA 4U5XA 4M9XA 1OT3A 2QAGC 2JJ8A 4LCBA 1N5JA 3TBKA 2ZI6A 3DZ8A 4TLAA 4D82A 4OK6A 3T35A 1IJEA 1BMFD 2ZJOA 3HU1A 4OQMA 5ANRB 4O0MA 1T5LA 2GJSA 1RC8A 1VTKA 1WXQA 2B21A 3EARA 5BQ5A 3W6NA 5EE0A 1G41A 1YKSA 3RABA 3HYRA 2ZR7A 1D2EA 1G4UR 4LUCA 5J4YA 3TUZC 2EFGA 1VYUA 2HCBA 2J59A 3K9LA 3X1WA 5JBQA 2VSXA 1K5GA 2X19A 1NP6A 4RD1A 1LS6A 1G8PA 3DHWC 1H65A 821PA 1TEVA 3P1JA 3CH4B 1VDZA 4F38A 1Q1QA 3VR5A 1SXJC 4MUBA 1ANKA 1NIPA 4B2LA 1XCPA 2WWGA 4IFBA 4KFSA 4IRUB 1Z6TA 4IW3B 4EUNA 3ZS8A 2P65A 1JQJC 3D3QA 2FFBA 2G9NA 1E79D 3LLMA 1E9AA 4ARZA 1W46A 4U00A 4C0LA 1CS4C 3UKDA 3VAAA 2RGDA 1YZKA 1DPFA 1R5NA 3QJYA 4V0OA 4DT1B 2J45A 4YC7A 2GHIA 2BMEA 2Z83A 2F3TA 2OXCA 4KBGA 3K09C 2FF7A 4GFDA 4BFZA 3DPUA 4ASUD 2BM1A 5EXTA 3JZMA 3O8BA 3PEVA 2ZUDA 3QF7A 3RWOA 3EIEA 5KOYA 4MGZR 4A9AA 3SQWA 3ICQB 3EZ9A 1AM4D 4KSBA 1FX0A 2GCOB 1G64A 3FMPB 1C4OA 3MRSA 2OBMA 4ZKEA 4KO8A 1HYQA 3KFXA 4RZ3A 5EXXA 1J7KA 1YVDA 1N3BA 4M9SA 3FE2A 5GJWC 2RGGA 1ZBDA 2DFNA 3Q7PA 2ZXUA 3TLXA 3LLUA 2NO6A 1X1SA 5J5CA 3SJAA 4GNKA 3TK1A 4EFMA 4Z8YA 5KTYA 3OFNA 3O47A 3IBGA 4BFVA 1O3YA 5HCNA 3B82A 2O8CB 4E22A 2QAJA 2CHGA 3LO5A 2VQSA 4F92B 1LFDB 4JL6A 3HR7A 1OFUX 4JKYA 1CEEA 1II8B 2WPDA 4ERNA 4LHZA 1QHNA 3DZDA 3KQLA 1NG1A 1EWRA 2V6JA 3CX8A 2IL1A 4IDHA 4L15A 1G7SA 1U81A 2ZE8A 5BWMA 4Q4JA 2GVZC 3PUZA 1E0JA 1CR1A 1G4AE 1NY5A 4TYQA 1G5TA 1Z63A 3F5FA 2J87A 1M2OB 3ADKA 4PSVA 1C9KA 2F43A 4D4MA 1SZPA 1E0SA 3TRFA 2IYLD 2WWHA 4B71A 2I1VB 2FU5C 3DL0A 3GFPA 3BORA 3OEED 1G9XA 3LH5A 4A4DA 4DUGA 1Z2AA 3VKGA 3SYLA 4HDOB 3A6PC 221PA 4OYHA 1WQ1R 2E9SA 5IF9A 1TMKA 1F5NA 2HXSA 3FKSD 3NVAA 4LYHA 4AC9A 3WYGA 3KXIA 3EPJA 4DRZA 2Q3FA 1M7HA 1JAIA 1L4UA 1QBKC 4WA7A 5EZ6B 4HAXA 1KI4A 3MWJA 3OHMA 3I32A 4HB3A 1W36C 2XSZA 5JWOA 3TSOA 1S8FA 1BMFA 2J3EA 4GP6A 5CYOA 2VP9A 2V9PA 2QY9A 1GITA 1WDTA 4NE2A 1PUIA 4JT2A 3A36A 3R8CA 1U2RA 2G77B 2H1LA 3PUWA 1SVMA 1NNEA 2Q9CA 5CB8A 1Z6GA 4M1TA 1R0ZA 5FPSA 5JJLA 4QHTA 4DZZA 3LW7A 1TADA 2ZU6A 1AGRA 1R10A 4JLOA 4M22A 2IS6A 1R7RA 3EX7C 4BEBA 2PT5A 2ZRFA 3FMIA 3CWZA 4FWTA 2GDJA 4QGFA 2I4IA 4DC9A 3QKSB 5CM9C 4LHXA 5E3HA 4NYIR 4A36A 4LHYA 4BZQA 3D31A 1TEXA 1L4YA 3QPWA 2QT1A 3BAFA 3GEEA 4D0GA 3U4QB 3U7HB 3AVYA 4FCWA 1MABA 1SVLA 1UDXA 1Z0FA 3H4MA 5TXGA 3KQNA 1TF7A 2MMCA 4MYCA 3ICEA 2C9OA 4BFWA 4Q9LA 1JB1A 5CK4A 2XOKD 1X3SA 2TMKA 3AKYA 1CULC 4JLMA 2BHRA 4BASA 4C0BA 5FTKA 3U7EB 1P7CA 3B78A 3CKLA 2GJAA 4QKQA 1G16A 1G3UA 1OIWA 1XD9A 1G8YA 1WBDA 1ZNYA 2QP4A 4IDNA 4ASUA 4MDFA 1Q44A 5FL7D 1GILA 1IAQA 2GJ8A 3WNCA 2ZRDA 4E07A 3B2EA 1G6HA 1W0KA 4NBSA 2XAUA 3T1VA 5IK2D 4NYMQ 1PZNA 5CYPA 4YXWA 3EIQA 1GG2A 3IEUA 3GJ3A 3IQXA 2NPFA 2XXAA 1ZM2A 3GFOA 4J0QA 2ZREA 5FTLA 3OAAA 5F9HA 1KJWA 3AGQA 4KFRA 4HZUB 3THYB 1GP2A 4GDFA 2QA5A 2W6JA 4A0RA 1JR3A 1YZLA 2JLSA 1SVOA 4PFSA 1QVAA 1PJRA 2XJ9A 2BCGY 4A1FA 4BLOA 1SVSA 2AK2A 4JBXA 1G3MA 3AF4A 4GL2A 4S2EA 1FW6A 2A30A 4I4LA 3GJ8A 2GF0A 4GPTA 5KSPA 3G82C 4G5OA 3ZD6A 4TSFA 2HYDA 5M04A 4WVFA 3LFUA 4TWZA 3ADCA 1JQLB 3U2QA 2A5YB 3FYHA 3AVOA 3SJZA 1P60A 4RCZA 1PLJA 1PV4A 3E5HA 2AFIE 2PBRA 5L3SA 4II7A 2LWIA 3KKMA 1HY3A 5LDDC 4B75A 3AKEA 1ZNZA 2X2EA 4LGMA 4KXFB 1KTVA 4PZZA 1J2JA 4UJ5A 4A92A 4DLSA 3VR6A 4F4CA 2ZVPX 2BBTA 4H9GA 1GL7A 5HZHA 4BFXA 4IEIA 4V0NA 1YZGA 1ZNWA 4LJ9A 1JR6A 4HATA 4V03A 1AIPA 1CR0A 4A0FA 2F1HA 1J70A 3SFZA 3N2IA 1GTVA 3CR7A 3NTUA 2G83A 1WMSA 2EYUA 1S9HA 2J0UB 3ECCA 4JBYA 1KDOA 2ZEJA 3KQKA 1KGDA 2QUZA 4ZDJA 5GVSA 4TMZA 5JI3E 5LD2C 1E98A 1EFRA 1XEFA 4GMXA 4B73A 3VQTA 1M7GA 4TTQA 2WJJA 4HUQB 3BRWD 1FP7A 5FR1A 5KSZA 3PIRA 2G6BA 2EWVA 2BCJQ 1W7AA 2IT1A 4N1AA 1T8UA 1V43A 4QRHA 3CWQA 3WMEA 3ZGXA 1J90A 4YMTA 4JLKA 3CNNA 3RRZA 1M1YE 1E2HA 1ESNA 3AVVA 4PQYA 1EG7A 3EZ6A 5FOWA 1RJ9B 1CTQA 2ZUCA 3Q7QA 2F55A 1PLLA 5CDFA 1KI6A 1COWD 4D4LA 3U7FB 4GMDA 4FINA 1OPXA 1ZINA 4JLNA 1CU1A 1P2TA 3TVDA 4DT1A 4QFMA 2AKAB 2IX3A 4NCNA 1IXZA 2CXXA 1GL6A 1DAMA 2VHJA 1MO4A 1XBTA 2CK3D 5BW8A 2GAOA 4A8JB 2XTZA 4EPYA 2GCOA 4QG7A 5AWFC 3NEJA 4PXAA 1XCGB 3JVVA 1DO0A 2DR3A 3A8TA 2A5JA 3DMDA 5GJVC 2A5DA 4MITA 1JAHA 2WIAA 3B60A 1ZIOA 2EW1A 4LC0A 4NU0A 1IY0A 5AJZA 1RRPA 4M1KA 3R20A 1Z28A 4BFSA 2ZR0A 1R8QA 1EX7A 5JRZA 4OI2A 4NCHA 4DCVA 4HLDA 3U44B 1OFTA 3WBKA 2O8CA 1DAHA 1D8TA 2ORVA 3AVPA 1ZD9A 4TLBA 5L3QB 3U60B 1OYWA 1W4AA 5EUQB 4Q1AA 4M53A 4XH9B 5JLJA 4MRSA 1SXJD 3TH5A 1SVIA 5DH9A 4QJ4A 4TT3D 1II8A 1ZVQA 4OQFA 1J8YF 2V1UA 2QMUA 1LW7A 1TU4A 4X8MA 1KOFA 2WAYA 1LB1B 3ND8A 2ZRLA 2XITA 1G3RA 1X8JA 3T5GA 1HURA 4GSYA 1E2GA 4US1R 2IEZA 3BFKA 2IXEA 3IILA 2WMNB 2D7DA 3V4RA 1AQYA 2WJHA 4G5GA 4M1OA 3K0FB 3NC0C 2EWWA 1HV8A 3BE4A 5EP2A 3SR0A 1OJLA 3TNFA 1XCMA 2OILA 2ZSBA 4ZDWA 4M21A 1WE2A 5HE8A 4DIEA 2IYVA 2JIZD 2QENA 3K0EA 3SI7A 5G40A 5JCPA 2C8VA 2BVNA 1U94A 1OB5A 3I62A 1GNPA 4MGYR 4RZ2A 3OE7D 4PHFA 4IOJA 4G5QA 2YOGA 2J41A 2H92A 4KSCA 2J0VA 4Z51A 3IIMA 4B3FX 5J47A 1T3HA 3Q8XB 3KJHA 3LQRA 1OKKD 3BD9A 1OXTA 3G5UA 1LTQA 4FCTA 3ZYCA 4Q1CA 2QPOA 4QGAA 3UG7A 4CZ2A 1DEKA 3QPVA 1Z47A 4XVUA 4QXAA 4A6XA 2ODNA 4FMCF 1H8ED 4E09A 4M1WA 3SOPA 4A2PA 4RY2A 4QM7A 1F60A 2QMHA 2X8AA 3QKSA 3RS5A 1MV5A 2PZGA 4WZAE 4JKIA 3WHLA 4RJLA 3H1TA 3C7KA 4MRVA 4BRWA 2V7QD 2NQ2C 4LV6A 1FTNA 1VG0B 1OV4A 3LV8A 3U4QA 1RZ3A 1Z29A 5CITA 4OQNA 3J81k 3ZVRA 5KNCA 2LKCA 3W6OA 4Q21A 1II0A 4F7WA 3EASA 3M1IA 1ETUA 3ZDQA 3SE0A 721PA 4LJAA 2D2EA 4FW9A 2Q9BA 5IDVA 1U0HC 5FPKA 4P4UA 5JJKA 3VR2A 4HAUA 2FNAA 2ZSFA 2R6GA 4FMDF 3RWMB 2OESA 5HR5A 1ZUNB 3RSOA 5FUXA 1X8KA 3CUEF 3FHTA 1R0WA 2OZEA 2JLXA 1ZCAA 5KO2A 3W90A 3RANA 2C95A 3GJ0A 5DSZA 4I81A 4P31A 2GJKA 4TQAA 2EFEB 2REXB 1CKEA 3I8SA 3N5CA 2ZI9A 4G1UC 2GTPA 2W58A 2BMJA 5EJEA 4LJ8A 3ADDA 1OH5A 3CNLA 1P9NA 1II9A 1ZM9A 3OIWA 1Q3TA 2ZYUX 3QVUA 4HZUA 3THYA 1OXUA 3FMFA 1KI2A 2A9KA 1D9ZA 4YQFA 2RAPA 1KYIA 2WJVA 1QHYA 3PG5A 4YDHB 5SZKB 2RH5A 2DPXA 4TL9A 2WICA 1VKJA 2X2FA 4ITRC 4G01B 3THOA 4PX9A 3U6BA 1ZCBA 4TZ6A 2RCNA 5TMPA 1XX6A 4HDQB 2GEVA 2ZS8A 3M0EA 1QHSA 4TT3A 2B7CA 1YQTA 2QE7A 4ESVA 3EPHA 1IY2A 4DWJA 1QG2A 1A2BA 4LBWA 2A78A 2ERYA 2FSHA 2WWWA 5AR1A 3U3KA 1VYTA 1DAFA 3I1FA 3IO3A 1E2NA 5C1BA 3NBZC 2J9RA 3FHOA 1CRPA 2A5GA 4BFTA 1NKSA 2FMXA 3B1VA 3P20A 2BV3A 2GETA 2ATVA 4C2UA 2ECKA 2PL3A 1NVXQ 2ZROA 2E87A 3CF2A 2GRJA 2ZQ5A 1U99A 1NN1A 4JJZA 3L8YA 4EJSA 5K8UA 2VL7A 3THXB 4AKGA 4QGHA 3CF6R 3I5XA 2O52A 3D7MA 2IYTA 3IPXA 4B34A 2C9YA 3DEFA 4N0DA 4KYIB 4Y0VA 5JECA 4NTZA 1N6IA 5KHOC 4FXPA 2J0UA 3K1JA 1KZGB 1R6BX 4IXMA 1OSNA 1PUJA 4P4TA 1PLKA 2CEAA 4RFVA 4X8LA 2VP6A 3A4MA 4C7OB 2OT3B 2WZQA 1Z5ZA 2JJ2A 1AS0A 3GJ4A 4B35A 1G5PA 1UBFA 3A1SA 1A2KC 1ZD1A 1OF1A 2WVJA 3FFAA 4DLUA 2P0EA 2IUSA 2ZI4A 5A4JA 4Q1FA 1E0KA 4UNPA 2C2HA 2FSIA 4HLQB 4XOIA 2O8EA 3H86A 5FBLB 2F6RA 2JLZA 3T12A 3HP1A 2W0MA 5GJCA 1N25A 4NMMA 2VSFA 1A1VA 1IN4A 2YWFA 3LVRE 1E2DA 3CRVA 4PR0A 1FPMA 4ACAA 3U6KA 4V02A 1Q1BA 4ZPXA 1RJ9A 1YE8A 4BLTA 3W6PA 2OE2A 5JWHA 1MO5A 2O8DA 4FD2A 1Z0KA 4Q1BA 4LI0A 4M1YA 3G0HA 1TX4B 3QE0A 3R8FA 3UXMA 2NPIA 5EE1A 2PJRA 2VF8A 2ANBA 4BFYA 1NLZA 4G5SA 1OXXK 2DHRA 2WKRA 4A8JA 1QHGA 2VRWA 2ZJ5A 2RHDA 1O87A 2NZJA 1NLFA 2BJVA 1MH1A 2WWIA 1MKYA 1KO4A 2EFCB 1LV7A 1E9SA 1IBRA 1GSIA 1N2CE 5B58C 2Q6TA 3DO6A 1HA3A 2JASA 1UDWA 5DO9A 2GAAA 1N5IA 1I4DD 1KAOA 1P3JA 4GBMA 5JEEA 2FX3A 3NDPA 2V8OA 2PMKA 3FPAA 5F98A 1RFLA 2FA9A 1TUEA 5L3QA 2KB0A 2XNSA 2ZRMA 2KBEA 3FB4A 1GOTA 3B1WA 4Q02A 4AY2A 2IS4A 2HUPA 3QY0A 4KYUA 4P0TA 1VG1A 1N0VC 2BMDA 4B44A 3FDIA 2VP0A 2FSGA 2B6HA 4Q7LA 2VPPA 1NBMD 3CM0A 4DSTA 2J0QA 1YZUA 4PC7A 3I72A 1E2LA 1UADA 1YZTA 2CHQA 2P67A 2RGXA 2PX0A 1NJGA 4TMXA 3GLIE 2DWQA 5FH9A 2IW3A 1KI3A 3PEYA 2QTVB 3P26A 4URUR 2V4ZA 5DYGA 2HXYA 1UEJA 3K0CA 5F9FA 3BFVA 3JZAA 3KKPA 4UNNA 5GADl 4Q5IA 1E1RA 1S3GA 5SZHB 1BS1A 3K0FA 2JJ1A 2W83A 2QZ4A 1VHTA 4LBZA 1Q21A 2UVQA 3WMFA 3B9QA 5CM8B 2P3SA 3QPUA 3U7GA 1E2FA 2QN6A 4G5RA 4URXR 3T06B 4XJXA 4AKIA 4Q1EA 2RGEA 4F4IA 1N5LA 3QSYA 1X6VA 4RCYA 1EFHA 1IJFA 1KNXA 3PENA 1G19A 4OBEA 4CF7A 2JLYA 1AZTA 2ORWA 4C0AC 1F6BA 4FMBB 5D3MA 5JMTA 4IDQA 3B1YA 1FP6A 2QQ0A 121PA 4JLVA 3RS3A 1KI6B 2C03A 3E70C 1JNYA 5EXPA 1DBSA 4EKDA 4QJ3A 3W34A 5C2JB 2J7KA 5EP1A 2HT1A 4US0R 1SXJE 2WIBA 4LWZA 2OSBA 4W5HA 1H8HA 4URYR 3BBPA 2QNRA 4ZV4A 2B8WA 4NH0A 4BECA 4F4JA 3F3YA 3ZVLA 5E95A 2PJZA 1U98A 3B7GA 1KI7A 3PEWA 2XNDD 1KSJA 2ZE6A 4N0EA 2CNWD 4PAMA 1TUIA 5FUVA 2FG5A 2ZRJA 4JS0A 3GLHE 3L0PA 1TTTA 1T0JB 2L0XA 2FGJA 2AXNA 4Z1MA 3TVTA 4I99A 4PHHA 3VX3A 1W2HA 1N6HA 1U90A 3MGCA 4LHWA 5G3YA 5K8LA 2VHTA 3RC3A 1W4RA 1US8B 4L8GA 4Q7JB 2QG6A 4PPGA 1E32A 1NVVR 4LPSA 2BBWA 2D7CA 4QHYA 4GOKA 4V0ME 1R5OA 5G41A 1KSHA 2BOVA 2H16A 1A82A 1AKYA 3IDQA 3LWNA 3UK6A 5B2ZA 5EUMA 1QF9A 3W8NA 5FR2A 4QBFA 5FBVB 2Z0MA 1XTIA 4DVGA 1GKIA 5TV2A 3QXSA 3UMSA 4QNMA 2DBYA 1OB2A 1IXRC 3ND9A 4I1UA 2C96A 2V3CC 3RRYA 2GZHA 4WZ6A 2C98A 3NKVA 2WOJA 3BC1A 1VMAA 4W7SA 1Z0JA 4H1VA 3VTKA 2DYKA 1XEWX 4B6EA 3CPEA 2GK7A 4ACBA 2FPKA 1Q57A 2ZAMA 2KWIA 4MRRA 2IK8A 4LJYA 1WP9A 4GZMA 1RW4A 2Q3MA 4BE7B 4TQUS 1VPLA 2R8RA 2OV2A 5FOSA 4NZYA 4JIMA 3AP1A 4OJKA 1MRNA 1ZAKA 2D3WA 4ESHA 4GP7A 2OHFA 4CIDA 1J8MF 5FBWB 3WRXC 4PPQA 1JPNA 1XMSA 4LRWA 5E7JA 4K8OA 4OKSA 4HLUC 3GJ6A 1KJYA 5FI1B 3ZVNA 1W5TA 1UKVY 2O5VA 3THXA 2HEIA 5LB4A 4YMWA 2GBLA 3KJEA 1AGPA 2VHQA 3AUYA 3TMKA 3GLFE 4D2IA 1XB2A 3B6EA 3KQHA 3ZD7A 4PPFA 2NTYC 4AKEA 4NL4H 4Q1DA 4ZI3A 5KDLA 2C78A 3PCRB 3RVBA 4ZI2A 2OO7A 3CIOA 3H2YA 4BRUA 2Z43A 1XRJA 4C7OA 2QU8A 1FTSA 3H0KA 4PQFA 3VNUA 4O2LA 3KB2A 3CW2A 2R65A 2QI9C 2FGKA 2ZI7A 2QEQA 1ZU4A 3SJBA 4NP6A 1GVNB 2QGNA 2UZ3A 1EGAA 2GZAA 1NVWQ 3GLIB 2CE7A 2YKGA 3GEHA 1G7CA 1K6MA 1E79A 1SQ5A 4OHZA 3GQBA 2C04A 1B0UA 1AKEA 1S3SA 1UF9A 1CR2A 2ATXA 1ZC4A 1I2DA 2ZITA 3MWYW 3VKWA 4WZBE 5EXSA 4B47A 2IXFA 4WOPA 1X8LA 4P4SB 2WJYA 3B85A 3W5JA 3DOEA 1Z0DA 3LBIA 3SU8A 1BIFA 1Q12A 4HI0E 4C9BA 2QPTA 3REGA 4PO1A 4IEEA 2QGZA 1TNDA 3IEVA 4WIAA 4C0SA 4XWKA 1G291 2GF9A 2O0HA 3V4FA 2XTMA 3WBJA 1JXOA 1CR4A 3OIVA 4FN5A 4TN1A 3OZXA 1GWNA 5JWRA 4MH0R 2QORA 1QHXA 4CEHB 2GILA 3CH5A 3HWSA 1F48A 1N6OA 2XX3A 2ZANA 3MG9A 4K46A 1JPJA 4Q48A 4TYNA 3EPLA 3EZ7A 1XPOA 3Q72A 2IYZA 1VIYA 4LYJA 2VA8A 2BEKA 2HJGA 2ODWA 2MSEB 2R6FA 3T61A 1D6JA 2MSCB 4QNRA 1U8ZA 5TARA 3ASZA 4EIWA 3EZFA 1GFIA 1VCIA 4KAXA 1A5TA 3CF0A 5CIWA 1SXJB 4LY6A 1NMZA 2QP9X 5FBRB 4G0NA 4BGDA 1T4GA 2AXPA 1I4TD 2GEUA
chains in the Genus database with same CATH superfamily
2GN4A 4PINA 5HOEA 4RLSA 4KUHA 3WYFA 1L5ZA 4ZVKA 5GM2A 1X1RA 1D2NA 3WDLA 1E94E 4FSXA 1CUYA 3BCSA 4C2TA 3IEPA 1XNGA 1NULA 1VECA 1U7ZA 1GKUB 2B35A 1E9DA 3TE6A 4KSYA 3TJMA 4OOEA 5AUOB 3IP7A 4OKIA 4QQ8A 2JAHA 3Q5EA 5FI3A 2XCIA 4GQIA 3VNVA 4J7CA 1RWWA 3GFSA 4HEA6 3RE1A 4FMDB 1YFKA 3WXMA 1NX6A 3NX4A 1U9IA 3RVLA 1CS0A 3LQKA 1TK9A 4ZGGA 3NP7A 2ACWA 4EJSB 1QORA 1TMYA 1K8QA 4OHPA 4D44A 2O7QA 1RQPA 5GGXA 3LP6A 4RPGA 1CZHA 2QB5A 3H7IA 1VCMA 1P73A 1P3DA 2CCGA 4EH1A 3RIGA 3UB3A 5ALUA 3X1KA 5B6JA 1WHSB 2C57A 2VQEB 3KQWA 2Q28A 4N3CA 3WLQA 3LYUA 3RSFA 1NUQA 1AHNA 2K5UA 2LXNA 4Q3DA 1QE0A 3IKTA 2H2FA 1C0LA 1B23P 3HSSA 4F4HA 3D3KA 3H2GA 4IDPA 4MARA 2JCXA 3ZJYA 4U6NA 1L2TA 4H15A 3IUYA 3W5VA 4CMKA 3S68A 2H2AA 1I4OA 2OV8A 2WE7A 3KVOA 3IR6A 1SNYA 3GJTA 3K8ZA 3FMGA 4FDVA 4IWYA 2PZKA 2W8BB 1XU7A 5GWXA 4HNVA 2ZCUA 5TEVA 2DHDA 1H6CA 3QOYA 1EEHA 4I66A 4C0KA 1P1KA 3PLRA 3Q6MA 4NS1A 2O57A 1VL6A 2YMPA 2FTKE 4LSZA 2YRWA 3BTOA 3IOEA 3KR0A 3X0DA 5JTUA 3BQMB 3GJ5A 1Y1RA 3M4YA 3O93A 2X77A 5KNBA 4R05A 2R7NA 4RDXA 1FFXB 3IKJA 1IQPA 1Q1EA 1QP8A 1RJWA 1JP7A 4KN9S 4YCLA 5AXDA 2QRQA 4D9CA 1WXDA 1NNUA 2Y93A 3AR4A 2IYEA 4IIJF 4LCJA 4MPTA 5B2EA 3S3TA 1HOTA 2FPPB 1QX4A 3LI2A 5B1IA 5E7IA 1RRGA 3C97A 4IIXA 2QRGA 2WD7A 1MENA 3N2EA 4LZJA 5TY0A 3ZIDA 2QQ5A 4YLYA 1NBME 2HGSA 3R5KA 2Z6QA 3MS7A 3W2FA 3L1JA 2AKYA 3HKCA 3UWKA 4BAZA 3FF4A 2XOKA 2F4VB 1BYIA 2GYVA 1J00A 4G81A 4YRFA 4FYYA 4AJJA 2PVCA 1KU0A 1YE3A 3OLWA 3HXMA 4YRTA 3BIXA 5T4HA 3U09A 1X87A 3DFZA 1NV8A 1W36B 3T7KA 4ZVOA 2N1BA 3GLFB 1E3WB 4MR9B 1FNSA 3TR0A 3G88A 2OENG 2OFOA 3BHNA 4R51A 1OWLA 4MI3A 3PC4A 5FNVA 1TVKB 1P9OA 3SK0A 2JDID 3VR5H 3WO1A 5K6AC 4UNQA 2NU9A 3OURA 3Q3VA 1GT91 1CZUA 1QUEA 2YQ4A 5ADWA 1A9SA 1KY4A 1ZBQA 3OEHD 1IPHA 3D7LA 3D4LA 3SLKA 2C42A 2PUDA 1BDBA 2ACEA 4B4OA 1PGNA 3Q2OA 3SICE 3STXA 3PUJA 3DL4A 1Z07A 2EQAA 4ZZ1A 2P9FA 2F67A 2VBFA 3B7WA 1HETA 1FDUA 1J6UA 1UBTS 1U8EA 3BMOA 3D6UA 4RTKA 1QRUA 2OD7A 2ZWAA 1WMBA 4DLWA 5EZSA 1BEUB 3PI7A 1THMA 4YR7A 3OJEA 5FV4A 2Y1WA 3Q7SA 4D02A 1VPWA 1DJMA 4IVPA 2C5AA 4FW8A 2WWXA 3QKRB 3ZU4A 2PPVA 1E9BA 4P93A 3QXXA 3ASVA 1RM5A 2HJSA 3LXUX 2OCGA 1QFSA 3ZGYA 1L8QA 3WAKA 3ZCTA 1G8FA 4I50B 3B9BA 2NZVG 3FTDA 1KJNA 3HZHA 1UDBA 1AO3A 3KUCA 2PA3A 1OVMA 4NICA 4QTTB 1G1MA 3JRXA 1W5AA 4DA6A 2YYZA 5KVSA 4ZQBA 4E5VA 3I01A 3LY9A 4NBWA 3DAGA 4P86A 5JVDB 4BHTA 2COKA 2JB9A 4D81A 4O4LF 3AYZB 2AX3A 1TVMA 4LGYA 4ESOA 2NG1A 5IAEA 3C3AA 4OHUA 3SC4A 1IQ0A 3BFJA 2COEA 1RI4A 4YUWA 2AR7A 4K3VA 5TQ0B 2G1AA 1KH3A 2WC1A 1HKHA 4ZVRA 4IFIA 4LE2A 4EG7A 1JG2A 3JPYA 1SZDA 1FJ2A 1GPH1 3QEKA 2YASA 4CEIB 3EDRA 1QQBA 4F3TA 5KTKA 1Z0IA 1P6QA 4GI2A 4LBVA 2RD2A 4XSHA 3TI7A 3G85A 4GOND 1WXEA 3QQ5A 2XZOA 1RLUA 1S7CA 4DEVA 3QE9Y 4L51A 4XX0A 3VX4A 3CVVA 4BXOA 1E1QD 3F8TA 1TQDA 3VU9B 1OUMA 1Z15A 3GH3A 4TYYA 3EXG2 5FOUA 4WGGA 3F5SA 4KK3A 1NW4A 1EDBA 2CYAA 3F90A 2KMLA 3CV3A 1CUEA 1V5IA 1XI2A 3PRYA 3IA7A 3KTAB 1C7FA 1UPBA 3GRCA 3T1TA 1ZUIA 3PTAA 4RS3A 4CQLB 2Q4DA 5KYYB 1GNRA 3EDYA 4DREA 2ZRCA 3UZUA 2OORA 1LF0A 2FE4A 3SP1A 2WF8A 4WK4B 5A3QA 1OIVA 5F2KA 3GLIA 4ER5A 1Q11A 2RHMA 3REFA 4KYTA 5FOTA 4Q3CA 4EPRA 4LJSA 4UEOA 4OHYA 3HJCA 1YRWA 3P9PA 4H4EA 1U3FA 4DCPA 5HKBA 3EEYA 4ZO8A 3ZC3A 1COWA 3BF7A 3NYWA 4RKEA 1XTSA 1ECFA 4QGBA 4NDZA 1NOJA 5CFQA 4IDOA 3T7RA 2YNMA 1HT1E 5EKXA 4M9ZA 5NULA 2TSYB 4DBLC 4P4SA 3K6SA 3WYAA 2PDAA 3FROA 4K6FA 2CK3A 2HDWA 1T0BA 1X39A 1DKLA 1KEUA 3PCXA 3DS8A 2W2MA 4I14A 3SG0A 4O2BA 2DUMA 3GEIA 1OVGA 4LOJA 3M7IA 5A06A 2RSLA 1KH2A 1KZ7B 1N9GA 1AOXA 2CB9A 4OXNA 3CNBA 2RBEA 3GUVA 4LI3X 5EJ7A 2R00C 2UUOA 1SBZA 4MGKR 1AGXA 1DQZA 2FPLA 1ZM7A 4BMSA 3OIUA 3SN6A 1X92A 3L1HA 4DDMA 4NPHA 4MJ3A 1ESDA 3QFRA 3NHUA 2C88A 3UGQA 3FWYA 3FG9A 4LPKA 5BR8B 5DX8A 1QVRA 2I3ZA 4GPIB 4B5KA 3B6JA 2BKAA 3FMOB 5HIMA 2B6NA 1AKUA 1XZQA 5EHZA 1RPAA 2VH2A 2EKLA 4ZZ3A 4ZTZB 2R6AA 3CPSA 4S1PA 3O1JC 4JY7A 2QLNA 4FLEA 5FTNA 1EDZA 4GI5A 3P9QA 1KMCA 3HCWA 5K20A 1KFEB 3HEBA 4TLLB 2H4ZA 3G2HA 2FRXA 4ZT2A 1Q5PA 5BQXA 1RVDA 1RBMA 1UQTA 4P54A 4S24A 3IV6A 1NJ5A 3CLTC 3PUVA 4F96A 1B4DA 4OAQA 4RIFA 3RNLA 1MQAA 4LDAA 4H1HA 5EWLA 2IHZA 1EB9A 5LB2A 1DIAA 4AZ3B 2OCXA 1YFLA 2IXTA 1CP2A 1V71A 1BJTA 2Q0HA 3ADOA 3EUFA 3KJXA 4BX8A 5KREA 2ZE7A 3UJ8A 4KWTA 3DEAA 4YI3A 5JYEA 3UA3A 3SBEA 3VMFA 4F12A 2JARA 2OY0A 3W2HA 1MDFA 1F5SA 1L5NA 7GPBA 1DAPA 2B99A 2IZ6A 1ESCA 1SHZA 3LY5A 4AN0A 1TL7C 2PRKA 3NEPX 3N5KA 2EP8A 4R7ZA 5DGCA 1U4OA 1FFSA 2J85A 2YIVX 4GUAA 2D4HA 4OJYA 5FI0B 4H1WA 3WGIA 1XPUA 3JQFC 2UZIR 2BHTA 3L93A 4X71A 1ESEA 2I2DA 5JNUA 5JYCA 4CM6A 4ZV7A 3ZHTA 2VP2A 4F60A 3ZXIA 1C41A 1FXWF 2FR8C 2M1ZA 1QVVA 4NH4A 4R8RA 2AC7A 5C52B 3WB1A 3OQNA 3R7NA 2EKDA 1W6UA 2QG9A 2CJWA 4CE6A 5HZGA 5COBA 4YRGA 1ZOLA 3ERCA 1I2AA 1BS2A 2DY0A 2H1VA 2QVBA 2ZT5A 3PEUA 4LXGA 3ZWYA 4CG3A 2I4LA 1JTVA 5IVDA 2VHUA 3TKAA 1NSTA 1S2OA 3TZBA 3VZRA 2C9CA 3PFNA 1E9CA 3M5PA 1A96A 4M9QA 4PX2A 4XUEA 2OZPA 4Z99A 2LW7A 1NC3A 1ZX1A 2Z04A 4M98A 4MWSA 1YL5A 3E2IA 4EQZA 3TM4A 1GNQA 3H4VA 4LMAA 1XZBA 1KP3A 4O1HA 3NHWA 3ZQUA 3QFCA 1R9MA 1YDHA 3VSCA 3N3AC 3ZW8A 1F3OA 2JBAB 5DHAA 2HT6A 4FGZA 5DNAA 5BV8A 4NJEA 3W2TA 5DNVA 1KP2A 3KKOA 5JAUA 2Q3CA 3AONB 1VSTA 2V7QA 4Q00A 3B3GA 2Z5LA 2IQIA 3D4IA 4IFTA 2C1EA 2NO5A 2PJUA 5TPZD 4PZYA 2WUFA 1LH0A 4IIFA 4MV8A 4ZHQA 2XVYA 1R6UA 1E59A 1VHQA 3COYA 3KM0A 4G8DA 4X7BA 5C18A 5K0GA 2QBYA 2B1JA 1N5DA 3B5IA 5EWMA 3WGVA 1N0UA 5HQ3A 1EGQA 1HWYA 2I7VA 3A0RB 1SCDA 2O1SA 2P6MA 4NDAA 5TS2A 4H1TA 1CEYA 1I6MA 2Q50A 2YJ6A 4X0EA 3HSKA 2FV8A 3LBNA 1BDIA 1A5SB 3UB2A 4D9GA 4QUBA 2H11A 1Q6ZA 3AKDA 3NBAA 1BXGA 4PO8A 5C4MA 5LKRA 4YMGA 5ITVA 5M3BA 4L0QA 4ISBA 2Y68A 1JIKA 3CG4A 3R74A 5ISMA 4Q9JA 5LP6A 2A0YA 4G1EB 3C6XA 1FXUA 3WSWA 2O50A 4C1BA 1RWQA 2PKRA 3I2GA 1N8SA 4UUNA 2IV2X 2L2QA 4ALKA 2NU8A 4NYIQ 2J31A 1YR7A 3QEMB 1CNMA 2WNHA 4WK6A 1DKRA 2H7VA 4WZAB 2ZBGA 4L4YA 2G1KA 3Q9LA 5SV2A 3ZWNA 3OWOA 3BMQA 2GBPA 4ZAGA 3SR3A 1MMFB 4IJKA 3INRA 4NE7A 5JZOA 3MLAA 1J2TA 1GARA 1U7XA 3PPYA 5D85A 4YP7A 5JTTA 1CJUC 2YHBA 1EFDN 4PTLA 3UK7A 2FUKA 2QUHA 2HRCA 4WHMA 4EYOA 2XE6A 3GCZA 1FUEA 4AB1A 1RRCA 2WR8A 3PDJA 4N5MA 1ZUHA 2VNKA 4G0QA 3NC1C 7REQB 1G59A 1C0IA 1O6GA 4Y1RA 2B1GA 1A95A 1UPAA 3QBTA 1CPYA 1BKSB 1RCUA 3H84A 2NOAA 4OD0A 5FPQA 2VJOA 3HYTA 3BEOA 5AJVB 1OT5A 4KJXA 1EFUA 1B0PA 4KNWA 3L4EA 4PC2A 2WRZA 5T67A 3RGGA 2FRDA 1JA1A 4H17A 2ACKA 4N9WA 5TGDA 3GDGA 4RHEA 2FN7A 3FB1A 5DOZA 2ZDQA 3MMXA 2OZLA 4D0SA 3FFTA 4KQWA 4N7BA 5DWDA 4J3FA 1BGVA 1XDDA 2RGNC 3OHSX 3IHLA 1J0XO 3OIDA 4PFJA 3THSA 1GNLA 2XSZD 2R25B 4L4SA 1ZJ6A 2WP8J 4CCSA 4KQ6A 2I7TA 4LFBB 4C7MA 3UWPA 4G0YA 3UANA 5CT9A 4DDVA 4Z4HA 4JBLA 2ZSAA 1DZIA 1PK7A 2QW0X 2Y1DA 1HYBA 3LP8A 3WKEA 3ZTWA 4JENA 1VP9A 4D97A 5CJ2A 3UAGA 2O2XA 2BGGA 2YZ7A 4BZPA 4YCCA 1WXXA 3OCXA 1O03A 1CXZA 2JANA 3KLBA 4RQTA 4CM7A 3D8UA 3K6KA 1GU0A 4M87A 5ERXA 2R1TA 3HRIA 2ATIA 2Z08A 3GH1A 4PSDA 1GGMA 3K5HA 5HIJA 4DLTA 1BDHA 4KGXA 1NRJB 4CMAA 3PQ7A 3HJHA 3DNMA 2OYSA 4YJ2F 1GPJA 4OHKA 3GJYA 4KR6A 1T8WA 4URZR 2PZEA 3TUIC 2GZ2A 3B52X 4DSOA 2ECFA 3H2BA 1BH2A 2WD7B 3O95A 3ESAA 3QTLA 4FPXA 5MN6A 4RZXA 1H6BA 4ZEXA 3QLJA 5A4IS 2J0SA 3T3HA 1V3UA 3EGDA 4OMUA 3ESBA 4S3MA 4E2WA 4XIGS 2XUJA 5JNVA 1WZCA 4MW2A 4JCOA 1K92A 5EE9A 1G3IA 2QTBA 2XYVA 3MD9A 2CDNA 1N5MA 1G6Q1 1I80A 1M2EA 3A1FA 5EIAA 4OP1A 3RJ5A 1GA6A 2G0NA 2PMBA 1QP4A 2HWYA 3EWAA 3PC3A 4MUKA 5EZQA 5FPYA 3BZUA 3WK4A 3WP0A 1PR5A 1T5SA 3LX5A 4HGOA 4PFQA 4PZ0A 1GIAA 5GGYA 2VLIA 3EAGA 3MWDB 3KJNA 4RHCA 3QOXA 2WIKA 2IYQA 3GU3A 3VJRA 5JZMA 1TUGA 1UFKA 1G38A 4KIJA 4PF1A 3AVQA 3C8DA 1WHTB 1CUVA 2GM3A 3KKLA 4MW5A 4YXWD 2PN1A 1DJLA 1KAQA 1RHKA 1VSQA 2Z30A 3MTBA 3OZEA 4NBNA 5U1PA 4ZVUA 5KJ6A 2WW8A 3A11A 1NRWA 3AFGA 4YJ3A 1VHWA 5K51A 2FMHA 2WDPA 5DLQC 5F78A 8ATCA 5KCZA 4X45A 3RU3A 1G8GA 5HZKA 1D6SA 5KQRA 1PJBA 1JR3D 3HDJA 4XIYA 3STYA 3VKUA 3I9V6 2AGVA 3SXPA 4URVR 2WWRA 1MPXA 1RYHA 1FFCA 3C5CA 3HA5A 3SS8A 2FVYA 3G1WA 3PNYA 1UKZA 3BS4A 5DGIA 3N7UA 1GDHA 1RXSA 1RAEA 3VR6H 3JD2A 3ZGVA 2WHYA 3P0RA 4MW4A 3VHLB 2ZJYA 4YP5A 4BP8A 4W9MC 3FVWA 1RTTA 3ZJTA 2FJPA 5IN5A 3DSRA 1KVQA 2RAVA 2IF0A 3P2EA 4OQEA 3QV1A 2GJ9A 1P29A 2DUJA 4ZOLF 5EJ6A 3CB4A 1W5EA 3OCZA 3VKFA 1EUCA 3BK7A 3QW2A 4WKPA 4UCFA 1AJEA 3U3ZA 4IJQA 5H1YA 2VNIA 2IHKA 2IFTA 4MGIR 3AFIA 5E4FA 3R75A 2DQYA 1RRFA 3N7TA 4QXQA 3L5KA 3WO0A 1QFZA 3NONA 1BQ4A 2EJWA 2V7UA 3F7OA 2JFGA 3W2IA 4D4HA 5LNK1 3TXAA 3UATA 2QVCA 3FOCA 2YC4C 5C5DA 1MOQA 4FK8A 5U4QA 7AT1A 4Y0AA 3C7TA 2OGTA 2GARA 1GADO 1P1HA 3DWGA 3GLVA 3LY7A 4HN9A 2JZOA 2IYUA 2ONJA 4EG3A 2NADA 1CUUA 4IHJF 2QT0A 3PQ8A 3BH0A 4BWYA 3KJGA 5JC1A 1XEAA 4JL8A 3ZWWA 3RYHA 2XGJA 2ZYVX 3M6AA 4KAAA 4NMHA 4X24A 1IY1A 5AJYA 1IZ0A 2P3QA 3HMQA 1U1EA 1X13A 2ZBVA 4CM9D 4MDEA 1UDCA 1KAEA 2K4MA 3FVVA 1NPDA 1UP6A 3FR7A 3JYQA 4K1LA 1ENOA 4P7BA 5SY4A 1FFDA 2M6LA 2A7QA 2CL0X 2FW1A 2GO1A 3OOSA 4FYMA 1Q95A 3WJ2A 2C3OA 2R7MA 5LYJA 1TJ4A 5JSZB 4W63A 5JD3A 4JYBA 1MW8X 5AW3A 5KSYA 4AECA 2Q6KA 3H1AA 2G5TA 2DCUA 3M89A 5E1MA 5IUNC 4F86A 3L8ZA 1S1MA 5IAGA 4EQ6B 4F5DA 4O4IA 4B76A 4QTXA 3AUKA 3OT1A 3D6JA 1GSAA 1ZHFA 3QXJA 4R98A 3ZX4A 3HJFA 4CT5A 1CDEA 2OXFA 1J5EB 1RE0A 3BFPA 2OMEA 1SCUB 1T8TA 3DBRA 3G5LA 4WX2B 5KBYA 4XVCA 3TD9A 2J7PD 1CJCA 3GP5A 1YQ9A 2VJYA 2X6TA 2X1HA 2B0CA 4MPJA 3C1TA 5AKXA 3U3OA 3DO8A 1T24A 3AY7A 2Y77A 1CUCA 3DLAA 4B7UA 4GC5A 1PG0A 2IKQA 4J4BA 4RZIA 4CUZA 1QRDA 4WXYB 4E94A 4Q93A 2CD9A 4AQYB 1JXAA 3R5JA 1N8NA 3GBSA 5G4KA 3ZOZA 2CNWA 3PUIA 3FSGD 4R71A 3RS4A 2EVWX 4M37A 1O8CA 1GLNA 2B61A 3DXYA 1VIVA 2B8JA 2OR3A 2HAEA 3DAFA 3WLPA 4H31A 4KXQA 5A2GA 1FUUA 3B12A 4FLFA 2VJCA 2TRSB 2BFNA 1YR6A 3C7AA 4KFTA 1RVV1 2MTBA 1QLWA 4C5AA 4ND8B 8MHTA 3VVMA 1IB0A 1WKBA 2ZXEA 2FMTA 3EEQA 2J3MA 2KSQA 2YS7A 2J46A 4HDKA 5G3ZA 5SZIA 1F2UA 3KR9A 3PXDA 4LHSA 1PR0A 4LXTA 4CTKA 1Z2OX 5G02A 3GROA 1T1SA 1U0SY 5JDIC 4IQFA 3PHJA 4WXEA 4HRXA 2OAQ1 1TF2A 1S7GA 5C8YA 1KDZA 1WA5A 1XEXB 3N2KA 1S8OA 3C14C 3ZU6A 1NW3A 3VZCA 4OSPA 3VHRA 2N42A 4LY9A 4MI9A 5BV2P 3DZFA 5KYKA 2LBPA 3IVCA 5F21A 2WFAA 2GTIA 3NVKI 4RVNA 3B13B 3OX1A 3MTQA 2DFDA 1CZKA 3QPAA 5EHQA 3L43A 4CKEB 1DXQA 2B4TO 3BMNB 4EUEA 2CVPA 2Q1UA 3HP7A 3HXQA 5JRDS 3GFTA 2ZIXB 2CL7X 4UDXX 2VDQB 1JYEA 2O3UA 5B37A 2WF6A 1QRTA 1OFIA 3L1UA 1ZH4A 3JSXA 2R97A 3LW8A 2LTAA 1SUEA 2VAVA 1V1MA 5JJBA 2CL6X 3IAHA 2HSGA 4FDLA 3VR0A 1Z37A 1SXQA 3TQHA 3WQHA 3MJ4A 2E6UX 2R62A 1GQRA 4K86A 4UCXA 4BZXA 4Y2TA 2XYQA 1F2TA 4I9HA 4WNAA 2JIRA 1P5ZB 5JPDA 3Q10A 2O59A 1DWUA 4UNIA 5JDCC 3FNGA 1T0IA 1TAQA 1G5IA 1YXMA 4G0PA 3RRJA 4H6VA 3MAGA 5K0CA 1NOKA 1PZHA 1TZ2A 2REQA 4YRKA 4B5LA 3W5IA 2JI8A 1GQOA 1F51E 3JD3A 2ZSHA 4KQMA 4DV3B 3WGJA 2PS3A 3ROQA 3RVSA 1XV5A 4Q39A 3A1TA 3MT7A 5KNCH 3NTRA 3Q8WA 4Z4GA 2V45A 2LP4Y 1E60A 2G76A 2WWYA 1PZGA 3CX4A 4JX9A 1ZD5A 1W44A 5FULA 1DAEA 1DUSA 1S1CA 3K5IA 4BQOA 3ZE6A 3OM9A 2CMKA 2ZBQA 3R3JA 3SZRA 4RJ2A 1ZHOA 2GVDC 3EXAA 3LA6A 3TNJA 5DTIA 1B41A 3RV3A 1SVWA 5BYJA 4WKCA 2UUCB 3ONEA 3OCJA 5DLDA 3ZG6A 1R5JA 2NO1A 3FCOA 3MMSA 3ZS9A 5HQ3B 2PSSA 1G3QA 3NH6A 4QECA 4W1QA 1VL2A 3RHSA 3TLGB 2IA5A 2QJFA 2VP4A 3AVXA 1TYZA 5I5GA 3GUCA 5SYNA 3RS2A 3CGGA 3WL4A 4DTIA 5LBTA 4DILA 2WT4A 3E9CA 1XQXA 2HDNB 3UUFA 2NAFA 4DSZA 1UMBB 2VH5R 2QSYA 4WUVA 3IKVA 4GAEA 1TK2A 3NO4A 3HVHA 3FCEA 2RONA 1YL7A 1ZOOA 1Q1NA 2O6LA 3GMIA 1JFFA 3HLKA 4FJ0A 2PZAA 4KLNA 1LI4A 2C20A 4II3A 3KB1A 4IFEA 3FDXA 1H2WA 2C5EA 1PTJC 4MVJM 2NTJA 3JD0A 2RAFA 4K2AA 1VJDA 2FN4A 2Q9UA 1ZW1A 5DLPA 3A6KA 4G85A 5DTEA 4EO4A 2R6CA 2A2ZA 3TTYA 1Y7IA 1LBIA 1V5FA 2XB4A 1DELA 4PN7A 5AVYA 4P2GA 2CDBA 5IXSA 4HGNA 5CA1A 4AW9A 3TW8B 5E6SB 1Y81A 1W0CA 4WN9A 3TX6A 1XQWA 5ADVA 3QVKA 1WM1A 5J63A 3ZY3A 4BQPA 4FXOA 1PL0A 1JHZA 4UHDA 3MGAA 4ZVTA 4XYMA 1AK2A 3KL4A 1VSVA 1Y6RA 1R3UA 4Y1RB 5MF6A 1X94A 3Q5DA 1K68A 2QPAA 1TXGA 3KOOA 4ZAXA 4I5IA 5IJ0A 4EHJA 5HJ2A 1M5UA 3PSAA 2PM8A 3Q7IA 4I1IA 1CY0A 1NV9A 5B2FA 1JHYA 3U48A 2J32A 2JCSA 4L4UA 1VHDA 4IOKA 3T9CA 2DERA 4CIWA 2RH8A 2ZVDA 1XWIA 5B55A 3VYSB 1GTRA 4AYWA 4MHTA 3THRA 3AW9A 4EHNA 3FRHA 2P9CA 4J4HA 1TT5A 2ARKA 2BGJA 3RARA 1KYTA 3PNVA 2O8VA 3DF9A 6YASA 2C2WA 3D3WA 1OAOA 3QG5A 1P4JA 1RJGA 5EJMA 2BTQB 1A97A 4G1FA 2DFVA 4KPUA 3T38A 4XGQA 4PCLA 3TJZA 2V55B 4B48A 4YYZA 1TYEB 4MKIA 2I4NA 1C4XA 2VO1A 1UBGA 1NVKA 4ZT6A 2REBA 3CLUD 4DCMA 4DBVO 2HEGA 4XM2A 4IYJA 1D2CA 2YHUA 3G9XA 1JZSA 1ZJZA 2X4IA 2GKSA 2M6KA 4MPDA 3SNKA 5IXJA 3W3AA 3IPLA 1QFJA 3LKZA 2E5FA 1E69A 2J4DA 1RHJA 2F62A 3UO8B 1RDFA 1E5VA 1PI3A 3BTSA 3H9BA 4GXQA 5B4UA 1I7QB 2VTBA 4KFCA 2F48A 1W94A 1DKMA 1YBVA 4Y7CA 2KBFA 4B7ZA 1SUSA 1JJAA 4V0SA 3TB6A 3TQFA 4C4TA 1ESZA 4WKBA 4YRBA 4MV5A 4RHFA 3V2UA 3HRKA 2N9UA 4F0JA 4X00A 5D86A 3E9DA 2JJ2D 2DP4E 2FR1A 1KC3A 4P4GA 1DC5A 1OIXA 5AJWA 1O95C 2QN8A 3OD1A 1EINA 5AJHA 5T8KA 4CKWA 2F7SA 1ZAYA 3JQ8A 4FKZA 2EW2A 3EY4A 2QM7A 1BRTA 2VATA 3Q1LA 4X20A 2IWHA 5EXDA 4C3UA 3P0FA 4JZKA 4LQDA 1TECE 3OPXA 3VO8A 3N2ZB 4S12A 1DUIA 3B1ZA 3DVSX 1I7LA 2V98A 3OY7A 4MS1B 4R4JA 1P61B 1RYBA 3HB7A 4QATA 2WYOA 3FNBA 1TO1E 3ABQB 5AK0A 3HG7A 1KRHA 3T1QA 3ZBPA 1CIVA 2X8JA 3EFOB 3JY6A 3LD9A 4L74A 2R7AA 1B8NA 5I7SA 5LSAA 4N7JA 3EULA 2OQIA 2C7GA 1XE3A 3I4LA 2IEYA 1O77A 1WP4A 5CLQA 5AKIA 2E5WA 2JAUA 2Q4TA 1T0UA 4K81B 4PYKA 2HC9A 4RFSA 5DYIA 1RKBA 5JATA 5H80A 1XU4A 3KUKA 3WLEA 1IMJA 2ZRNA 3D2BA 4RQAA 3VOTA 4A0GA 4JB2A 5SY9A 3H0EA 1P8JA 3M5CA 1IN8A 4URWR 1MCZA 3F67A 3P9CA 3IOCA 1XCJA 2XRYA 3PDIB 4FNOA 4H6WA 4D96A 1E1DA 4YJ3B 1TZKA 4P81A 3HKBA 4BE9A 3G49A 1J0CA 1CBUA 3IP9A 1O57A 1XZPA 2CLSA 2BR3A 4V2IA 4BWVA 1L8AA 1EVJA 2R6DA 2ZSEA 4OA5A 3MGGA 4PHGA 5FV7A 4EJ0A 3TGPA 1GJRA 4PS1A 4DBLE 2F59A 3U37A 2Q5FA 2PIDA 4M6WB 1NLUA 4JT4A 3C5HA 5DI9A 1H2HA 4D0NA 2Y0CA 1I9CA 1P1BA 2VT7A 1TGYA 1U28C 3TZ6A 4FFDA 3PBKA 2ZVJA 3D0OA 2AQ8A 2JLCA 1IIRA 1QXSA 2GZSA 4M7OA 4ESEA 4F8YA 5J4LA 4FDUA 3OQPA 4MMZB 1XRQA 2BZ0A 3B8EA 1ZWKA 5ELMA 5LQDA 2VXBA 2XF8A 1PR1A 3R3ZA 1JG4A 4Q9HA 4J0CA 2R68A 5ER9A 2Z09A 2GX6A 3LTNC 1SWWA 3NJRA 2XF2A 3I6QA 1K7YA 3CXRA 2Q3HA 3F71A 3NG1A 4WD3A 5JG7A 3KOUA 3CRRA 2A59A 4B6SA 4WY8A 5KKNB 2OEPA 3BK1A 2BEJA 3HGMA 4JL5A 5ALPA 1V1JA 3AHHA 3QLUC 5B57C 3C4QA 1C8LA 4X6XA 1F12A 3DQZA 1GZUA 1NYQA 2A9RA 3C5VA 1Q3KA 3AR6A 2V9CA 3HP4A 3HXPA 3GT3A 3Q40A 3GLHA 4AQ7A 1QGUA 3DWIA 1C1HA 5CDHA 1X7WB 4DS3A 4QPNA 3M6VA 4MAFA 4WKOA 3ZR4B 3ZY2A 3J80A 1T9CA 2FPIB 3PUKA 4K87A 4TMWA 1YVPA 1MP0A 1NWCA 1XR3A 4MX8A 1VOTA 2DXIA 5CDFE 2CXNA 2FY8A 4AL4A 4I8XA 1JXMA 3G7NA 4B6QA 2FEOA 1NVVQ 3OWHA 3W4JA 1LVUA 1XTRA 1VFNA 2P4QA 3L40A 1QTNA 4W9RA 4WGFA 3VPGA 4DLXA 1X2EA 1G8MA 2WF9A 3PR1A 2BDTA 2XMZA 1JQKA 1U65A 4CR8A 3TS1A 4LKRA 4OO3A 1RAGA 1OFUA 2AZXA 2CLHB 3H1GA 3O5AA 3WJ1A 4C88A 2RJNA 5BR1A 3C3YA 1PR9A 2GCIA 3NWBA 3L1IA 3BIFA 1NBEA 1Y63A 3GFFA 1UIRA 3ZU3A 1FDRA 1OILA 1ZP6A 3IQHX 1EG2A 3AUJB 2B92A 4Y3UA 1YDFA 2H18A 2QJOA 3KX2A 1DJOA 3DM9B 4F2GA 4MWZA 3W5CA 3BDAA 2YJTD 4O4IB 3KHSA 3PDUA 4J2TA 1HEUA 2GCEA 3H2IA 2P9JA 1H4SA 2YHIB 3RUHA 1PT5A 2CXRA 1C3XA 3E0XA 4J0DA 4ANFA 2PR2A 3V3KA 2HIHA 5JEDA 2W42A 3HDGA 3MW8A 5D1HA 3NW9A 3KZOA 3ZXYA 1NLYA 3IBTA 1N6PA 1L4BA 2IS1A 3P0JA 1VG9B 2VR1A 2QSUA 7ADHA 1VE3A 1OD6A 2XEXA 3P9XA 5I7EA 4OHRA 4RTJA 1OREA 1XJQA 4XEUA 1E2UA 2DTDA 5EJ8A 1FU8A 1M34E 3O74A 4PNPA 5DNYB 2FK7A 3A58B 1ZL2A 2HQBA 4C07A 1GFWA 1MABB 3C6BA 2ZUEA 2OBNA 3KQTA 4OXIA 3UG6A 4DARA 1BCSB 4GMGA 3M8KA 3SX2A 1TPZA 3QKUA 5D8DA 3L7NA 2IYFA 2CY0A 3VAYA 2ZS7A 3QBEA 4NE9A 1YFJA 1ZEJA 1V25A 5D3KA 5BW4A 3TDKA 3P0IA 1SU6A 2ZRAA 1BAPA 3BXZA 3NV7A 1IN7A 1BKYA 1ZW6A 3DHEA 2PUGA 3AESA 1G8KA 3F1LA 2ENUA 5I9NA 3U7QA 2EX0A 3FCXA 4Q7KA 4UNRA 2CBGA 1RQGA 3OETA 1LNQA 2XWBF 3QE2A 2E1PA 4KDFA 3ACCA 3ZTTA 2OSVA 4JJGA 1VC2A 1VRWA 1ZD4A 4N8DA 1V5WA 2PA0A 2O4UX 2EFYA 2VNJA 2ZJZA 4ID3A 4TTVA 3RGWS 1VSUA 3IQFA 4JFRA 1CF4A 1IAVA 3DQPA 3X44A 1M33A 2YXDA 3RQSA 2DB3A 2W4QA 1GPDG 2BGWA 1KI8A 2XXAB 2M6RA 4H60A 1SK9A 3LKDA 3R7WA 3QVTA 2IBMA 1VIAA 3WRXA 1ZU5A 4RENA 4G2NA 4DIBA 4EUHA 1NW5A 3GOQA 1YA6A 4HQLA 1E3MA 4POAA 1SB9A 4HADA 3AWIA 2GPSA 3CF4A 3TW4A 5F23A 3CUWA 1XGKA 3PNMA 4DSUA 1ND5A 4RWZA 5EKSA 1DAGA 2MYPA 4BQIA 2JGFA 5AM5A 2XBUA 4NZPA 2R4TA 4BQRA 4ZALA 3ZXXA 4BDSA 3S8MA 2D62A 5LZ7A 3RHFA 10MHA 1F0KA 1Z7EA 3BH6A 2J6HA 3A2MA 2R79A 1C9MA 4BN0A 1QV9A 1ISRA 1T2UA 2HA5A 3Q85A 4J1TA 4HAVA 2BGTA 4HN4B 1CYEA 4CLOA 5JCZA 5C3MA 2PEYA 1P2GA 2PKWA 4IOLA 3W6ZA 4ENVA 4HNUA 2DULA 4HNTA 1WETA 3VKHA 1A50B 1LC3A 1UBUS 3NVMB 1MC4A 3ANSA 1ZQ1A 3VGJA 3EZ2A 5CA0F 1B6SA 1BU8A 2POQX 3EXHC 4G86A 4LSGA 4B40A 5LN1A 2IOQA 1X0VA 2IEDA 4O8ZA 2AWNA 3TMYA 2GNPA 1O94D 2QAGC 4P36A 3VA7A 3IR5A 4IZ6A 4LCBA 1GRCA 1N5JA 3TBKA 3G68A 4II2A 1BU5A 4DA4A 1OX6A 3O8QB 1EK2A 3E7FA 3UNXA 5I5EA 4YJFA 1ZLXA 1IJEA 1U3WA 3GVHA 4A91A 1PEKE 3ANNA 2ZJOA 1CETA 5IFKA 3GNQA 4TKUA 3EVZA 3UHOA 4OQMA 2JAWA 1RMTA 4L0MA 4XCVA 3ZCVA 4BWGA 3BICA 1T5LA 4MLPA 4O0MA 3OOJA 1UBJS 2QRVA 2B21A 1WXQA 3EARA 3VC3A 3I64A 4N76A 1W35A 3GZNA 4K7JA 5D3ZA 1YKSA 1PJ4A 2VDPB 3HYRA 2R3SA 3KPYA 1G4UR 3TUZC 3PNKA 1XC7A 2EFGA 2CZGA 2HCBA 3HJTA 3K31A 3N6RA 4PEVA 5D87A 3JQAD 4BZWA 4DG9A 2F2TA 2GPYA 3R5XA 3WB9A 1RBZA 2X19A 4E5PA 4FDAA 4GZ5A 4XSVA 3EISA 4RD1A 1G8PA 3DHWC 1H65A 1TMOA 4ZT7A 2O2CA 5DBOA 1G0NA 1XROA 4NFHA 1TEVA 4YPFA 3VDRA 5I7WA 1FLAA 1VDZA 1KVSA 4F38A 1IBLB 3BULA 3F4BA 1NIPA 5KI6A 4B2LA 3ZY5A 2D3TA 4YO7A 4KC0A 3VO1A 1HFEL 1FSPA 2XPCA 1JMYA 4A8TA 1KF0A 2CFIA 1LEHA 1GPBA 1E79D 3FPCA 4RACA 2PAAA 3LLMA 1CDZA 2AV6A 3E58A 4NAUA 2LIVA 4R2KA 4ARZA 1CS4C 1MEEA 3WNQA 2X9NA 3KEGA 3RKUA 3WTCA 3CG0A 4HVTA 4YC7A 2AZMA 3LMKA 1ZI9A 2HPVA 1C4KA 4IDDA 1U0NA 2BMEA 4HMOA 1UBNA 3RH0A 4KBGA 2CWWA 2HWKA 4XM0A 1E7RA 3DPUA 3LU1A 4ASUD 4BFZA 2BM1A 4FT4A 4B31A 3BCUA 1Y3IA 1EVQA 1PYOA 2B2CA 1JBQA 3CEMA 2R4UA 5IAAA 4MGZR 2Z2YA 1RZVA 1SQFA 1FX0A 1H1LA 4HX5A 1G64A 1R3DA 3L0DA 3FMPB 3KYIB 5CPFA 5FJIA 4LWPA 3TLYA 4J29A 3GZTB 5KJFA 1Z6PA 1XVLA 1JWAB 5BVHB 4M9SA 3FLAA 2RGGA 2P79A 4BVLA 1RXIA 1U4SA 3Q7PA 3VPAA 3PRJA 3TLXA 4DV4B 2H4XA 1JWBB 2R60A 5D7BA 1EVLA 3STVA 5J5CA 3SJAA 3WWOA 1G8AA 4DR4B 3OFNA 2QYTA 5AXBA