4OL0A

Crystal structure of transportin-sr2, a karyopherin involved in human disease, in complex with ran
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
172
structure length
172
Chain Sequence
QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Structure of transportin SR2, a karyopherin involved in human disease, in complex with Ran.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 46
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2014-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ol0A00
5E7IA 3AF3A 3QPVA 5L3QB 1OXTA 5FBVB 2IS2A 2ATVA 5D3MB 3TSOA 4CYMA 2MMCA 3LBHA 2OEPA 3W3AA 1GIAA 1CR0A 2RHDA 1HY3A 1X86B 2ERYA 5FOSA 3E5HA 1DPFA 2ZI4A 3PXGA 1WQ1R 4KVGA 2JJ8A 2ZE6A 1G7SA 4PPQA 1DE0A 2UZ3A 3A4NA 4WZBE 2ANBA 2W6JD 2HT6A 3DHWC 2C5LA 3CPHA 4IOMA 1L4UA 1ZM9A 1HYQA 4MITA 1T9HA 1XJ0A 2ODEA 2ODNA 4PQYA 2VBCA 1DEKA 3U61B 5JI3E 1LFDB 3QF4B 1IXSB 4I1UA 5JS8A 2GK7A 3SR0A 1KIMA 2O8FB 4A15A 2MMGA 4GP7A 1ZNWA 2Q21A 1Q22A 5IHPA 4B35A 1VHLA 2ZAMA 3NH6A 3DOFA 2FX3A 3PUWA 5FUVA 2YKGA 1JR3A 2XSZD 1AGPA 1NL3A 1CULC 2EWWA 3B13B 3KJGA 4DLWA 2JLYA 1Z6AA 4AYTA 5JHHB 2XOKA 2J0SA 1YE8A 1YR7A 2LCFA 4R7ZA 2QTHA 1G3RA 4EFNA 3QUSA 2WOJA 1XNJA 4ZV4A 2CLCX 2Z4RA 2NZ8A 4YLGA 1P61B 1KI6B 4DSOA 4AKHA 1P2UA 5BXQC 3BERA 1R7RA 1V43A 2XZPA 3CIOA 3RS5A 2DPXA 2JJ2A 5DISB 4DLTA 1T5IA 2N1BA 5EUMA 1G5PA 2ZYTX 4TWZA 4OQXA 2IXGA 2F1IA 3KQKA 5D3QA 4AIIA 2EW1A 4L5BA 4WBSA 1RW4A 4YMVA 3UK6A 1U8YA 3TGPA 1E9EA 1X8JA 2RMKA 4QGHA 4JBWA 2ZQ5A 4WXRA 1R5OA 4JL8A 5DLQC 2RKOA 2KB0A 1M8PA 2ZI9A 3CPJB 4TZ6A 4M21A 2ZRKA 1FX0A 3EWSA 5JJKA 2VIIA 1V5WA 1CRPA 3AV0B 2D2EA 4RFSA 4Q1BA 4HUQA 2W00A 3U3MA 3TQCA 1DELA 4LHVA 2R2AA 421PA 2OCBA 1XZQA 4ZDKA 5FR2A 2HEIA 2IYLD 2PT5A 2IYRA 2CL0X 3HU1A 1P9NA 2CJWA 4M9ZA 4JLMA 5EXXA 2J46A 2B7BA 3GLHA 2NIPA 1ZNZA 5FUWA 2ZXUA 5JWOA 1OYWA 4URUR 5JECA 4ZCMA 2ZRGA 5JRZA 4FCWA 4JSYA 4JKYA 4B73A 1H8ED 3T1TA 3KQUA 5B2ZA 4AYXA 1DS6A 2XNDA 1LNZA 3B8HA 4JLPA 3TAHA 1E79D 2JLXA 1ZD9A 4MYCA 221PA 4C7OA 4Q9LA 3KUCA 5A0FA 5LBIA 3L82B 3W8RA 2W6ID 3GLGA 5AWFC 4L16A 1TQDA 1AQYA 1U0LA 3T5DA 4KFUA 3C41J 1GL7A 1YRAA 4KCGA 1P2TA 1NJFA 1QHNA 1XJQA 4KLZA 1DO0A 4P4SA 4JVLA 3OEHA 1IN4A 1NBMA 5KNCA 1E2GA 3K0AA 2HLDA 3PIRA 3R9WA 2QUZA 1KSFX 2P6RA 1E98A 3BXZA 6Q21A 4U7DA 1S1MA 2X1VA 2O52A 1Z2AA 4B48A 3BH6A 3RHFA 5HZHA 1UJ2A 4FINA 2DB3A 3LLMA 4Q66C 2HYDA 3SU8A 4B3GA 5P21A 4Q7KA 1ZNYA 2LWIA 1E2QA 1VYVA 1VMAA 3FMFA 2ZETA 5JCZA 2ZRIA 2PLRA 2QNRA 3DZDA 1KOFA 4Q4AB 1S3SA 2ZYWX 1S9HA 2ZJZA 2KI5A 4W7SA 2ZRJA 1HT2E 1TU3A 4LHWA 4OJKA 1TAGA 1TADA 3ETLA 3I3SR 4LDJA 1I2MA 1M2OB 5DI3B 4D26A 1OPXA 5BYKA 1BKDR 1PLKA 4G5SA 3KJIA 3LWNA 4EPWA 1IN8A 4BRUA 1RRCA 2ZRPA 1D2EA 3QXCA 5FFMA 1E2DA 3CF0A 1YZKA 3BGWA 2VP6A 3K0EA 2DYKA 4NCHA 3O8RA 5C4GB 2V7QA 4DC9A 1CU1A 5GADl 3L0SA 3T12A 2Q9CA 2ZJBA 2J3EA 3K9LA 2GAAA 3L43A 4G5RA 4Q19A 2ONJA 2CVHA 2E87A 2ORWA 3LQRA 3QXJA 1G3QA 5FPKA 1NN0A 4NYMQ 2N46A 3I1FA 4W5WA 2AFIE 3W5JA 3E2IA 2O8BB 3CRRA 4NYJQ 4CEHA 4JLAA 4IFEA 4LHXA 1PJRA 1ZCBA 3QPUA 4QBGB 2XJ4A 5J40A 4ZPXA 1DAFA 2GZDA 1N25A 5FH9A 4B6FA 1NY5A 1T8UA 1AIPA 4GSYA 4HB3A 1GRNA 3PUXA 3ADKA 2IEZA 1Z0JA 1OH6A 5H8WA 3M1IA 4UQOA 2G9NA 121PA 3FKSA 4DUGA 4PQFA 2DFLA 1XMSA 3LA6A 1NG9A 2ZRDA 3BWDD 4NCJA 4CVNA 3U44A 4LJ7A 1UBGA 1NN5A 5AUOB 1KZ7B 4ZI2A 3CX8A 1AQUA 2H8KA 4US1R 2FEOA 1G6OA 1J2JA 2WJIA 1XEXA 1E69A 5EJEA 3A1SA 1R10A 5UKDA 5EE3A 4M8NE 2QI9C 1UEIA 1ZUNB 4URWR 1XTJA 1Z6GA 4GFDA 2HV8A 4EQ6B 4M4SA 3C7KA 4E03A 4QGGA 1N6KA 4C30A 2ZRHA 4PSAA 3C4JA 1NF3A 1W2GA 4I99A 5DSZA 3ZGXA 4QBHA 4RD4A 1KSHA 3T1VA 2NPFA 5TARA 1T4GA 3SYLA 4A0FA 1HQCA 2ORIA 3NG1A 5CM8B 2XB2A 4Q1EA 3F8TA 2AKAB 5CB8A 3MAAC 3IQXA 1N2CE 3IQWA 3DKVA 4IEEA 5CJ2A 4EJSB 1NSFA 1PVOA 1Z6XA 4XSGA 2YWHA 1LW7A 2ORVA 2ZUBA 3SE0A 2V3CC 4ZKDA 2ZIAA 4Q1FA 2GF0A 1QDEA 1WF3A 4WVFA 1W0KD 1WE2A 5JHGB 3LW8A 2VSOA 2YZ2A 1OIWA 4DDWA 2DWPA 2AKYA 3RDPA 2A78A 3FYHA 2ZEJA 3GJ6A 3AVXA 1NVXQ 1A2BA 4Q18A 3GEEA 1KO7A 2HT1A 2I4IA 3PUYA 5JEDA 3A1TA 4QGAA 1P5ZB 1Z28A 5CJPA 1JEEA 2D62A 1K5DA 1ZD8A 2IW3A 1I4LD 3AVUA 4B3FX 1W49A 2VHJA 4Q7LA 2MSEB 3M6AA 4UXHA 2JIZA 1I4DD 1UKYA 1U0JA 2NGRA 4LCBA 4MRPA 4TSFD 1LF0A 2BCJQ 2ZANA 2A2ZA 1AS2A 5CYPA 3ZD6A 1HT1E 3TNFA 1J7KA 1D9ZA 4XTCS 4HAUA 1W44A 2R8RA 3L0PA 4MRSA 3UG6A 4RSGA 1BH2A 2GJ8A 2CK3A 1SVIA 3CWZA 3L0OA 4B44A 2RGXA 4Z54A 1JPNA 3BB4A 4RJLA 2PEZA 4QHTA 1H8HA 1KAGA 1M6NA 1XD2B 1LF5A 2H5EA 2OESA 2OLJA 1HTWA 3CX7A 5J4YA 2VO1A 1SGWA 2VHTA 1XZPA 2X2FA 3I8SA 4LWZA 4D80A 3VKHA 2JLWA 2EWVA 3MWLA 1OJLA 2GBLC 4PSKA 3HP1A 5TXGA 2BMJA 3BS4A 3DEFA 2B7CA 4D4JA 1N6HA 1DARA 2PX0A 4KFTA 2ZSDA 2F9MA 4TN1A 1OXUA 3QVVA 4CEIB 2OAQ1 1W46A 4TQAA 4IVPA 2WMNB 4X8HA 3AVPA 1QHHA 1KO4A 3HJNA 3L8ZA 3GMTA 4P3YA 2ZI6A 1WDTA 4RFVA 1ESMA 2CNWD 4XD7A 5TV2A 1IN5A 3UPUA 1X8LA 3GLIB 3CRW1 4N0DA 4EDHA 4LPKA 3JZMA 1R0YA 3RANA 3RRYA 2FFBA 2C8VA 4D25A 1FQKA 5FL3A 4TYQA 3WMGA 3EZ7A 4F91B 4QXAA 4NYIR 4JLJA 3P27A 4LY6A 4E07A 2BVNA 2GJKA 1ZAKA 2JLSA 4V0LA 4G3XA 1PLJA 8OHMA 3NBYC 2FFQA 1NG1A 4P4UA 2VQSA 3K1JA 3AVTA 1U0HC 4IXMA 3SFZA 4JLBA 2F9LA 4HZUB 1P75A 3AF1A 1BIFA 3I73A 3QSYA 2JAQA 4FCTA 2G1JA 5IK2D 3LBNA 1I4TD 3QQ5A 4IDNA 5IDVA 2QP3A 4OJQA 1ZP6A 1ZRHA 2JJ1D 4HDQB 4E22A 3AVQA 1EK0A 1F3OA 3UKDA 2RGAA 4HAZA 4DB2A 1SXJD 4BLPA 4TYYA 2H17A 5AUQA 2PT7A 3SHFA 1Q20A 3TIFA 3UMFA 4W9MC 1A4RA 4JBYA 1DG3A 1W7AA 3KXKA 4G1UC 4L15A 4F4IA 4TYPA 2FMXA 2HUPA 3P32A 1LTQA 2ZRAA 2PZEA 3OIVA 1Q1BA 2OLKA 3I62A 3EW9A 1Z0KA 5FOXA 1FX0B 1XB2A 4YMSA 5K8UA 1JAHA 4KBGA 3ND9A 4BGDA 1N5JA 3GPLA 1SULA 2NOAA 1RYFA 1R0WA 1BS1A 1M7GA 2FFHA 5G41A 3S1AA 1G5TA 3O8DA 2XXAB 4GOXA 1FFHA 1E3MA 1Q44A 4NCNA 2C95A 2DCUA 5EXPA 4DJTA 1DAIA 3GLIE 1ZCAA 5E4FA 4M1YA 3TE6A 4A92A 5CM9C 1XTQA 2VL7A 3CLVA 4TQUS 3GLHB 4RCYA 3W8NA 4NONA 3MCAA 4ESVA 1EFRA 2RGCA 3K9HA 2BBOA 4PC3A 2O8EB 1YR6A 3NEYA 3BH7A 3CRVA 2WWFA 4LBYA 4EPYA 1L4YA 4IEIA 4UXIA 4ESHA 4XWAA 4QFMA 3R7WA 4QJ5A 5KPDA 1K5GA 3LQQA 1E2HA 2VHQA 4C7OB 1F2TA 3DMDA 4TMZA 3DM5A 3QEOA 4GT1A 5C18A 5F98A 1T3LA 1JB1A 5KSZA 4DZZA 3PG5A 1P7CA 3GLGB 1CJVC 1E2IA 2MSCB 3KZ1E 4KFRA 5AUPB 4A8JC 4OI4A 4MKHA 2XTMA 3I5XA 3WRXC 1Z0FA 2F43B 2IXEA 3H1TA 4JVSB 3AP3A 4P4SB 1DAMA 1CF4A 2VP4A 3FHOA 3K0AB 3NDPA 3THWB 4C0HA 5JMTA 1AA9A 3HDTA 1S2MA 2EFDB 3RRMA 2XSZA 5LDDC 4TTRA 1IJFA 4N1AA 3U6KA 5HCNA 4GBMA 4BZQA 4C0KA 4DXAA 5DIFA 3EPHA 4QL3A 4HATA 3K09A 5CDFA 3UANA 4BE7B 5C46F 3W6NA 3AUYA 4AD8A 2HJVA 3V9PA 1GNQA 2WJVA 1FTNA 4WAUA 2I1QA 2IHBA 2H7VA 4JZKA 2GZAA 1AN0A 3B9QA 4OQFA 3H84A 3ZVNA 2OG2A 1IY2A 2QY9A 2Z4SA 3T35A 2P5SA 5LB4A 3QENA 3WNCA 1Z5ZA 3TSWA 4JLKA 2GJSA 4V0MA 3Q8XB 5E3HA 2QM7A 4DKXA 3WXMA 3I32A 2OUKA 1IQPA 4OQLA 4X8OA 1XTKA 3OE7D 4RVCA 1IJEA 1PZNA 1XP8A 3KTAA 3OESA 3FVQA 2XJ9A 3GLHE 3MUFA 3QF7A 5DO9A 2ZJAA 1SXJB 1E99A 3AVOA 4I1OA 4EJSC 1ZMXA 3H2YA 4DDVA 2PJZA 2GAOA 2OBNA 4LJ8A 1II9A 1OKKA 3ZYCA 3PJRA 1R4AA 4KAXA 5JZVA 2FG5A 3GJ7A 4BFZA 1Z06A 4C2TA 4CEHB 2IYWA 4MYHA 3SHWA 3GLGE 1JPJA 2W83A 1KYIA 3C5CA 3BH0A 2P3SA 4HSEA 4FW9A 3VHLB 1EX6A 2YV5A 4B2LA 1JQJC 1P60A 2H57A 3RAPR 2WVJA 4A0HA 3QE0A 1AKYA 2JLRA 2WAYA 4BFXA 3M0EA 4DSNA 4NU0A 2QAGA 2D7DA 4AI6A 3U44B 3Q5EA 3TMKA 1G19A 2XITA 2Q3HA 1IHUA 4ZO4A 5EE1A 1XPRA 1UF9A 4TL6A 4JL5A 4LJ9A 4N3NA 3O47A 4IJMA 2BKUA 4NL4H 1G7TA 1XEXB 1E32A 2QTFA 3GFTA 3LD9A 5EP2A 4YQFA 3B7GA 1E0SA 4MGYR 621PA 1UPTA 2W6IA 1DO2A 2EQBA 3TQFA 3GLFA 2B6HA 5FOWA 4I1VA 4D0NA 3TVDA 1VPLA 2GCOA 4BFSA 1NLFA 1CJKC 4W5JA 2GKSA 2IUUA 1TUIA 3U60B 3CH5A 3LVRE 3U4QA 3PVSA 3BFKA 4JLDA 3GJ8A 3FGNA 1IY0A 2BEJA 3R9IA 2ZJ5A 4C9BA 1CIPA 2GDJA 2J59A 4V0KA 2VP9A 3KJHA 2ZR0A 4Z1MD 2QE7A 4ZCLA 3PENA 1HEIA 5JSZA 1SXJE 3NBXX 5FTLA 3KQNA 4O0MA 3UIEA 1XMJA 2NTYC 1WBDA 5J4HA 4XIGS 4ACBA 3MMPA 5SZKB 3LV8A 1ZJ6A 1YU9A 5H68A 2FSIA 5J47A 2YWEA 1R5BA 3LBIA 2H16A 4LZZA 2GEVA 2QPAA 2ZE8A 4V0NA 2QENA 2KE5A 2VF8A 3A4MA 3PUVA 2NO6A 2V55B 2F1RA 2QQ0A 2C9OA 4IDPA 1NVUQ 4D4LA 3FMIA 2FSGA 3MGCA 4GMXA 1DAHA 1S96A 2J7PD 4HDOB 4POAA 4Q1AA 5FTKA 3ZS9A 4HLCA 3TH5A 3GJXC 1JECA 4DB4A 4HZIA 3GEHA 1IN7A 4RZXA 5FUYA 3SOPA 4B3DA 1P3JA 1W4AA 3TBKA 3M4YA 4XJXA 2EYUA 4D6PA 1C1YA 2ZITA 3F3YA 521PA 5IRCD 4C0AC 5JJLA 5GJCA 2QMUA 4DDTA 4C4PA 3MWYW 2AK3A 4C0QC 1W5SA 2J0UA 2HJGA 1XTRA 2H18A 4BLOA 3SJAA 1HURA 4KJZA 2QN6A 2EFCB 4IDQA 4UNQA 3R20A 4BWYA 1QG4A 3WNDA 3ONWA 3FB4A 1G8HA 4PAQA 3IHWA 4BEBA 2JDIA 3RLFA 3VR2A 2A5FA 2AFHE 4JS0A 4OBEA 2V1XA 3VU9A 4KITB 1Q12A 5CLQA 1YQTA 4Q9IA 5LPNA 4JBXA 3P1JA 3EG5A 2D7CA 5FR1A 4GZMA 2A5GA 4Q00A 3THYA 2WJGA 1XWIA 2QEQA 4BRWA 1VHTA 2IYYA 2FNAA 3RSLA 1XTSA 3B60A 1CRQA 2QAJA 1II8B 2R44A 1W36D 2IC5A 5IT5A 1CBUA 1VG0B 1XTIA 4JL6A 4YC7A 3VHXA 1OXVA 1RPZA 2FDCA 2FSHA 1K8RA 3MWJA 1G7CA 2D3WA 1MOZA 4A0RA 3IHLA 4H1VA 5EUQB 4B33A 2EFHB 1VCMA 4JJZA 4PQRA 1HE8B 1KJYA 1VCIA 2CMKA 3OFNA 3OIYA 4QBIA 4EFLA 1BO6A 3BB1A 4ZDIA 2FE4A 2QA5A 2CCKA 5DHFA 3SJCA 3QKSA 4O25A 3ZVRA 2KBFA 4ZIRB 4ASUD 1MT0A 1US8A 3Q7QA 1E1QA 2AWNA 4MKGA 1UFQA 4YXWD 1N0WA 4M0LA 3MRSA 3TRFA 1U8ZA 3LY5A 1R0ZA 3WYFA 3FHTA 3ZD7A 1MO4A 2Z6VA 1EX7A 1EFHA 1E9AA 2KBEA 1ZVQA 2W2VA 3BFXA 3NEJA 3PEUA 3HWSA 4LHZA 3RYTC 2VHUA 3I5YA 1U94A 4OHWA 3JZAA 4NBSA 2Y8EA 3ASZA 1COWD 3PR1A 1BMFA 4GI7A 4ZCIA 5FTJA 2C78A 4IOJA 2DBYA 4J0QA 1FOEB 1Z08A 4S2EA 3Q3JB 4RD2A 2ZRLA 4ARZB 2V8OA 2ZU6A 1OHHA 1E1RD 3C16C 3CH4B 4U02A 5DH9A 5GJVC 3ZS8A 3GFPA 4QC2A 4ZKEA 2ZRBA 1F2UB 4FN5A 4BASA 3PQCA 3DO6A 4XVQA 4TSFA 2PX3A 3IUYA 4V0OA 2ZS9A 1FNNA 2GZHA 1UAAA 1P4SA 2F1JA 4QNMA 4Q9KA 4IDOA 3ZIAA 3AVVA 1U8AA 3A1UA 3TK1A 1ZD1A 2ZR9A 1XF9A 1Z29A 3ZZ0A 2HCBA 4DIEA 1R2QA 4G5OA 1Q1EA 1SVOA 2IYSA 3BORA 4TL9A 5EXSA 5KTYA 4DEYA 1Q57A 2O8DB 4P31A 1TQ6A 1BOFA 3GFOA 4DDUA 2IS4A 2AXPA 4RD1A 5C2JB 4TTPA 5KHOC 4JYBA 1GL9B 1TNDA 2JLVA 4TT3A 1S0UA 1SXJC 1AZTA 1YRBA 2B8WA 2OFWA 4CEJA 1FZQA 4LPSA 5KOYA 3R7WB 4RKEA 1E0KA 3D8BA 1Q3HA 3R8CA 4B71A 1NVWQ 4PPFA 1G7RA 3T61A 4HB0A 2QSYA 1QHSA 2VSXA 1WCV1 4ACAA 1T0JB 5BYJA 3X1YA 2CVFA 4D81A 4PZLA 2ODWA 4KLNA 1R8QA 4QKQA 2A3RA 2VH5R 1KK2A 4Z8XA 3RWOA 2PZFA 3RRNA 4C2UA 2GETA 1HV8A 4TTQA 3ZH9B 3TUZC 1FPMA 3OEEA 1J8MF 2D4HA 2RGNC 3QXSA 3ZZTA 5L3SB 3GQBA 4O2RA 2XX3A 1W36B 3B85A 1W2HA 3SNHA 4PC6A 4BFTA 2A9KA 1KJZA 3PUZA 1CP2A 1RRPA 1W4BA 1P62B 4Q21A 2IUSA 4G5GA 1YHNA 4BPBA 1FP7A 2ZJOA 2CLDX 3VR1A 3H0KA 4DCVA 2VSFA 1B23P 3CRQA 1KK0A 1E9SA 3ZDQA 2P65A 3AH8A 3AF0A 5DGXA 1NMYA 4F93B 1IONA 4HI0E 3VX3A 5JFGA 2QBYA 1KNXA 1G8FA 2JCSA 3O8CA 4Q5IA 2O8CB 1G64A 1UM8A 2PL3A 4RD0A 4DEXA 2ASEA 3VMFA 5JEEA 3DOEA 3RS2A 5FOTA 3AP1A 1ODFA 4KFSA 4Q4HB 3KTAB 1RFLA 2R6FA 2IWHA 2OBMA 3KJEA 1YJ5A 1FUKA 2HDNB 3DM9B 1NKTA 2H92A 4M1KA 4LJAA 4UXJA 1J99A 1X1SA 1E4VA 1D9XA 3DZ8A 4LBWA 3U3OA 4L9WA 2CHVA 4HAYA 2WJJA 2NO0A 2ZS7A 1XXHA 2RAPA 5SZHB 2VLIA 3OHMA 2C04A 2CL7X 3THXB 1E96A 1CJTC 2ZUCA 3CKLA 1VCOA 2CE2X 3N2IA 3K0CC 3QVUA 4JKIA 5FL7A 4RZUA 5EE5B 3W6PA 4IW3B 4NMMA 4QRHA 1RE0A 5K8IA 1JR3D 1NP6A 4O2LA 4YONB 5FUXA 2GILA 3CRMA 4WW0A 2V9PA 3DMNA 2QGNA 4OQNA 1UDXA 4EPRA 4NHOA 4P33A 2ZYUX 4NE2A 1XDBA 3HR8A 4JJKA 4LC0A 1RC8A 2CEAA 2C9YA 4IKEA 1G4UR 1RJ9B 3QOFA 2QAGB 3HYRA 3QY0A 4RY2A 2W2TA 2IF0A 1P9RA 4EIWA 1VIYA 1NN3A 3EZFA 1D6JA 1M7HA 4EFMA 1MO5A 1CS4C 1GUAA 2HF9A 2JJ2D 3LO5A 4IOKA 4GNKA 5JWHA 4A6XA 1NVVR 4LX0A 2AR7A 3FWYA 3LH5A 4RD6A 2G3YA 1U99A 2BC9A 1EG7A 1LS1A 2FU5C 3QKTA 1YZGA 4Q1CA 4B2PA 2RB4A 4KU4A 3REFA 1KO5A 2GXAA 2P2LA 4JSTA 4JVMA 1SVLA 2PBRA 1P73A 1FNMA 3U4QB 2ZRCA 1D2MA 4MA4A 4P4TA 4PR0A 4TMKA 4LYJA 3QG5A 2R9VA 4UKDA 3FPAA 4DLVA 1W5TA 4TMTA 5EE0A 5JSZB 4HAXA 3UWOA 5F9HA 4HAVA 1S9DA 3AM1A 4KODA 2FF7A 3KXLA 1NIJA 4LV8B 3VR5A 1R6BX 1Z47A 3W34A 4HDCA 3CNLA 2DFNA 2PCLA 1OXSC 3PEYA 4OK6A 5B58C 1OFIA 1U9IC 2J45A 1QBKC 1Q3TA 3EC2A 5CLLA 5KDOA 5DN6A 1CEEA 1MABB 4P32A 5D3MA 2FJUA 2WSSD 3WP0A 5CK4A 2ZREA 2OT3B 3BD9A 3H4MA 5HCIA 1IBRA 2OAP1 3OE7A 2XNDD 1YZTA 4Q47A 4PO9A 4MH0R 2N42A 4S35A 4OI1A 1X1RA 4M2LA 1Q1ZA 2C96A 4NCIA 2BKEA 3B1VA 1NI3A 2ZM5A 3WY9A 4FMCB 1U2RA 2FFAA 3D6TB 5B30A 1TEVA 2D06A 2BDTA 4DLYA 1GVNB 4LV5B 2BOVA 3TJZA 3VNVA 2O8FA 1DVRA 3L8YA 5AJWA 2J0UB 3LVQE 5AJZA 4WXPA 3OEHD 3OAAA 3IO3A 3NC1C 1NBMD 4Q02A 3K70D 2HLDD 1CR4A 4DLRA 4LJ6A 1KMHA 2ZRNA 4CGZA 1OF1A 3EXAA 5JLJA 1GITA 4N0EA 1CJUC 4PC2A 1EFUA 2RGDA 1RRGA 3I92A 5DYIA 1Q1QA 1J90A 1CKEA 5K8TA 3U7EB 4LYFA 4XSHA 4DVGA 1UBCA 3B2EA 1JEDA 1R0XA 3CR7A 4B75A 4HLUA 3WHKA 5BN5A 3RWMB 4B74A 1JAIA 3CWQA 2DY1A 3DPUA 4CZ2A 1AGRA 2QG6A 1Q21A 3IPXA 3MSXA 4L9SA 4BQSA 2OCPA 2GHIA 5KDLA 3THYB 3K53A 4H1UA 2IYUA 2WPDA 3GP8A 4M1OA 2RH5A 4FWTA 3DKPA 3U3JA 2YJTD 5FPSA 5F9FA 5LB2A 1DAGA 4I81A 1ZU5A 4GZLA 2G6BA 1TUEA 2F3TA 1Z6TA 4AWXA 3B78A 5HKKA 1KHTA 5JJIA 2GBLA 1RRFA 5TDHA 5KNBA 4MGKR 2J41A 2V7QD 2Z43A 1Z0IA 5KNDA 4A4DA 1EFCA 3P4YA 3EPJA 1G8YA 3WMFA 3QBTA 3UXMA 1G3IA 1R5NA 4M1WA 1IOZA 5EQTA 3TSZA 1TU4A 4D0GA 3GJ4A 4URXR 1KY3A 4IVRA 1JI0A 2LKDA 3OZXA 1YKSA 3WMEA 3A1WA 3EASA 4A2QA 2PEYA 4RFSB 3SYKA 2DHRA 1XX6A 4HUQB 2REOA 4FMCF 4DBLC 2OCAA 1UBEA 5CB6A 4HB2A 5FPHA 5TVKA 3D3QA 3D7MA 2F7SA 3L0IB 2WIAA 4ZDJA 2CJWB 1QHGA 2QROA 3QG1A 4DLZA 3CZQA 3EA0A 3FKSD 2FSFA 4DUGD 3AF2A 4BZXA 1W36C 2GWHA 1HA3A 3L2OB 4AYWA 2WAXA 4BFVA 1ANKA 2DFTA 4LOAA 3CPEA 4OHXA 5BN4A 1KDRA 1AM4D 1XBTA 3Q72A 2RGGA 1JR3E 1XPUA 1XD9A 2YYZA 5G3ZA 1XRJA 3CR8A 3RVBA 4OHYA 3O8BA 2GJAA 3VR4A 4QM7A 3E70C 2R62A 2YWGA 4X8MA 1XD8A 4AC9A 4CF7A 2W6JA 3BAFA 3NTUA 2FEMA 2FZLA 2PZGA 1RVDA 2ZU0C 3SN6A 1GAJA 1K6MA 2C03A 1SKQA 3LX8A 2JEOA 2WWWA 3KFVA 2WICA 3AEZA 2DWOA 4IDHA 4B2IA 4QOSA 1KK1A 4UJ5A 4PSVA 4C0LA 1ZC3A 4MRNA 1CXZA 2UKDA 1A5TA 1TMKA 2QGZA 4QNRA 3V00A 5HPYB 5KSPA 4M22A 1JNYA 4GMDA 5EZ6B 2WWYA 2IYTA 4B6EA 4UNRA 3K70B 3NDBB 4ZDWA 1CTQA 2RCNA 4YMTA 2REXB 2BIFA 2ZSBA 1N6IA 2W0MA 4OK5A 4CEJB 2YOHA 1DADA 3KKQA 5L3RA 3TW8B 1W1WA 1E9BA 2ZTSA 3A1VA 3NXSA 4DSUA 3AKYA 3G0HA 1SVKA 4E09A 1SKYB 1GRRA 3ASYA 1Z07A 4GRAA 4TZ0A 2X8AA 1EGAA 3SJZA 2QPOA 4Q4AA 3KDSE 4LI0A 3N5CA 4F7WA 3TKLA 2OXCA 3ADBA 3TR5A 4WZAE 2K5UA 2YOFA 4KYUA 5DI3A 1KAOA 3EZ6A 1SQ5A 1W48A 1LVGA 2OXRA 1OW3B 2VPPA 1FMLA 1TX4B 4WA7A 2A5YB 1MRSA 5JCPA 4QM6A 3SS8A 1MV5A 3K0FA 1L2TA 1NJGA 3IPYA 1KO8A 2GEUA 2O0KA 3QXXA 4MKIA 1OV4A 3AGPA 3NBFA 1L8QA 4RD3A 1EWQA 5AJYA 1GILA 3KQHA 1NIPA 1KKMA 5LD2B 1KMQA 1G1MA 2IUTA 2CK3D 1M34E 3PCRB 4C0SA 1YZNA 5AK0A 5KSYA 5L3VA 1KZGB 5ANRB 4PC7A 1H8HD 2YINC 5EXTA 1G5RA 2CE7A 4A8JA 2QRNA 1QZXA 1L7VC 2VRWA 4A0GA 2C9CA 3C14C 3A37A 1VDZA 4C0JA 4I4LA 4NZYA 4BECA 3ECCA 4F4JA 2FPLA 2PMDA 1FTSA 2CLSA 4BLTA 2BBWA 5FPTA 3EIHA 2YNMA 4ITRC 2ZI5A 1KI9A 4OKSA 2F3RA 2OBLA 3RABA 3IDQA 1WMSA 4FWIB 2LKCA 1NBME 2WZQA 2FGJA 4RKFA 1UADA 1N6LA 4B3BA 4XD7D 2XZLA 5CK5A 2BCGY 1H8EA 2WKRA 3HPRA 3ADCA 1KTVA 2GXUA 4M1SA 2ATXA 1XXHB 2XEXA 2J87A 3QXHA 1E9FA 1E79A 1QF9A 1NKSA 2A7QA 1BYUA 1MR3F 2D2FA 4Q03A 5J5CA 1SKYE 1XCPA 4MKFA 3TUIC 4D82A 3SFVA 4EPTA 1XMVA 3U7HB 3FMOB 1E9DA 4B32A 3TW4A 1YZQA 3FDIA 4H9GA 2IX3A 4M9XA 1QVAA 4FMBB 3SEAA 3NBZC 1ONBA 4OHVA 3SZRA 4BFUA 2GXQA 3CZPA 5CIQA 2IL1A 2B8TA 3IO5A 4EJSA 3BB3A 2QP4A 1VG1A 4KYIB 4NPHA 1QHIA 5GVRA 1D5CA 3IIKA 4XVRA 1E0AA 5F2EA 1P2VA 4GOJA 2FOLA 5C4MA 2QTVB 1UDWA 5HE8A 2BMDA 4DLXA 1E9RA 3HU3A 3WBJA 1E6CA 1X6VA 3KXIA 1F60A 2ZJYA 4LYAA 2QMOA 4PTLA 4UNNA 3HU2A 4A2WA 4Z51A 4LJ5A 1OH8A 4PZZA 5ELXA 2P0EA 4A82A 4Y0VA 4KHZA 3W9YA 3C15C 5FTNA 2C98A 4IHQA 3OIUA 4LBZA 4V03A 4MDFA 4F38A 2AL7A 3JVUA 3N70A 2VA8A 3MD0A 1S4QA 4MDEA 4UJ3A 1JALA 1JXOA 2XNSA 3CW2A 4B47A 4GDFA 3F5FA 1DTSA 1G291 1ZNXA 3QIAA 4DCNA 3NH9A 3T34A 4QJ3A 2H1LA 2VHCA 2Z0MA 1N6OA 1EESA 2IK8A 1ZW6A 3LNCA 3W90A 3ICEA 3B1XA 4GL2A 3VKGA 1TTTA 5CYOA 3MLEA 1OYYA 1LY1A 3BFVA 2FN4A 5C1BA 1XXHE 3P26A 4DCTA 5HZKA 4MUBA 2YWFA 4LHYA 3FOZA 1XD2A 3C5HA 1VYTA 4FMDB 1N5IA 2BHRA 2V6IA 2RHMA 1EFRD 1KI1A 4IOLA 2OFOA 2C99A 5J4KA 5EZ5A 4OK3A 3CF2A 4A6PA 4OI2A 1W47A 1CR2A 3R9XA 4GPTA 1YZUA 2ZE7A 1NSTA 1KGDA 1RZ3A 3MFYA 4DSTA 1BYIA 4CEIA 4BFWA 1XFAA 5FI1B 3Q85A 3J81k 1VG9B 3SI7A 3IIMA 4Q4JA 5HTKA 3FTQA 1JQLB 2UVQA 4D4KA 4DWJA 4URVR 3T5GA 1JBKA 3X1WA 3GLIA 1QHHB 1G16A 2OV2A 3AQ4A 4PO8A 4HYYA 3QJYA 3CNNA 2EVWX 5FBLB 4DT1A 2J7KA 1PUJA 3BJIC 3DDCA 5FPYA 1Y63A 4M9QA 2P6UA 5A4JA 1E2LA 2NMVA 1KMHB 4ILEA 2GVDC 1G20E 4M1TA 1Z83A 3BE4A 1Z6YA 2R6DA 3PITA 3QEJA 1G9XA 2GRJA 1EXMA 1FUUA 1J70A 4XOIA 1R8SA 5EP1A 1G8PA 4M53A 2Z5FA 4HZUA 4JLNA 4QHYA 2ZI7A 2OZEA 4TMXA 1KI3A 1OFUX 1WXQA 1YR8A 4CW7A 5TY0A 1OFTA 2X2EA 5E7JA 3R8FA 4M9SA 4YDHB 3B1ZA 2RGBA 2W2XA 3B5JA 4PHTA 4CIDA 3HR7A 1OIVA 1TQ4A 2QT1A 2TMKA 1S3GA 3KKOA 4NP6A 4CT4B 2ZSAA 4ZI3A 1MKYA 2G77B 1B0UA 1W0KA 2YHSA 5B57C 1T6NA 5B64A 3AGQA 3BC1A 2BJWA 1GRQA 2QL6A 3A4LA 3AUXA 3NHBA 1FL9A 1U81A 4FMDF 2JLZA 1FP6A 1SVWA 3K70C 5KPJA 2QQEA 4PXAA 4QG7A 3A36A 2QU8A 1NLYA 2WM9B 3GJ5A 4L4UA 2HCJB 4WIAA 3LLUA 1OKKD 1OB5A 2NO9A 2KJQA 4PZYA 2GA8A 1WA5A 3EIQA 1P72A 2XTZA 3U3RA 4FIDA 2Q9AA 2YC4C 2XXAA 1JJ7A 4ON9A 2IS6A 2GVZC 4OL0A 4PC1A 4Q01A 3UATA 4JT2A 4TL7A 4JIMA 4XH9B 3SC3A 4CT5A 2ZSFA 3S1AB 4Q48A 2XZOA 3QNUA 2BJVA 4X8LA 3GJ0A 4K8OA 2XTNA 2IYZA 3GEIA 4AK9A 1M74A 1XMIA 3FFBA 1CLUA 1OLOA 1EWRA 1XEWX 2G0NA 4XWOA 3K9NA 2Q9BA 2ZPTX 1KSGA 5HE9A 4QGFA 1CJMA 5G40A 2JGNA 2WSSA 4RZ3A 2I3BA 3VTKA 3UMSA 1ZINA 3LFUA 2O8EA 5H1YA 2ZVQX 2IWRA 4BEJA 4JYCA 3IEUA 2J0QA 4YMUA 1DG1G 4BFYA 1OFHA 1VECA 2KSQA 3KX2A 1F6BA 1TF7A 4YMWA 1G41A 3CNOA 5LD2C 5CIWA 3KKMA 1IN6A 1OSNA 5E95A 1F2TB 2QMHA 3U7GA 4A9AA 1WP9A 2QP9X 3U7FB 3EC1A 2WSMA 3B6EA 1FW6A 4GOKA 3QBVA 2P67A 2FGKA 2CNWA 2F43A 2BM1A 1KO1A 4PHHA 1OE0A 2O5VA 4MUAA 1ZYUA 3RSOA 1GWNA 1Z0AA 1W0JD 4F92B 2WWHA 1T91A 4LUCA 2Z83A 3D31A 1ESNA 3THWA 3LRPA 2B92A 2QE7D 3UG7A 3X1DA 2BM0A 1ZM7A 4LGMA 2C2HA 1N3BA 3MJRA 3VKWA 1JR6A 1AS0A 1WRBA 4TLAA 721PA 3IGFA 1NMXA 2J5XA 3LX5A 2ZJ8A 3K8YA 4US2R 2P5TB 1UEJA 1E2FA 1M1YE 1NVVQ 2C77A 2OILA 5EP4A 1A7JA 1WBBA 2IHYA 5HR5A 1YVDA 2VF7A 1E94E 3ZZUA 1DAKA 5AUNB 3ADDA 1UKVY 3ZVMA 1GM5A 3BRWD 5IK2A 1KDTA 3WYGA 3TLXA 4JVNA 1HE1C 1RYHA 1HUQA 1TF2A 2WJHA 1GKYA 1VYUA 2JJ1A 2PJRA 3WHLA 2YC2C 5KDDA 1SXJA 1OH7A 1E9CA 4LRWA 2CCGA 2V4ZA 1KY2A 4L8GA 1XEWY 3K0FB 3Q7PA 4I1SA 2I1VB 4HLDA 3IBGA 5DHAA 3NIBA 2ERXA 3B9PA 3ZJYA 2EU8A 1T0HB 5J4LA 4F4CA 2G0TA 2WKQA 2ZSEA 3FE2A 4V02A 2WWGA 2R6GA 4TMWA 2WHXA 2GK6A 1N5LA 2PH1A 3WRYC 1T3SA 4HB4A 1DAEA 3X2SA 1LS6A 3LDAA 3P4XA 4A8JB 4IFBA 3QKRA 1TQ2A 4R2IA 3AP2A 1KI4A 2A30A 2QRZA 4FI3C 4DLUA 5FTMA 2OM2A 2VP2A 1IXZA 2ZRFA 4FD2A 3VQTA 1F5NA 1GG2A 2RGNA 3EPKA 3ICQB 1OH5A 2BBTA 2JDID 4RZ2A 2KWIA 3H86A 3KB1A 4JLVA 2HXYA 5CITA 1G3UA 4JMPA 2XOKD 4URYR 5AJXA 1VIAA 4BLSA 3SJBA 3B82A 4MYUA 4EPVA 5EP3A 1G6HA 3EWAA 2GTPA 2VP5A 3EZ2A 1ZUIA 1ZC4A 2NO1A 2NZJA 2P6NA 1N0VC 1Z8FA 4NH0A 4D4MA 1GSIA 4R9UC 2EYQA 1J8YF 3EZ9A 3OF5A 1KSJA 1Z22A 2JA1A 3VX4A 3PEVA 5CDFE 2REBA 5G53C 4B34A 2OHFA 2ZYVX 4Q1DA 2Q6TA 3CO5A 1GTVA 1G8GA 3T06B 4CRWB 1D2NA 4DCSA 3GLFB 3RRZA 5JS7A 3V4RA 2ECKA 2ZJ2A 4PHFA 2BV3A 4NYIQ 2GCOB 3RC8A 3KL4A 1XJCA 3OFND 1YZLA 2AD1A 4LBVA 3A8TA 3HPQA 4V0ME 2QM8A 5DNYB 4AKEA 4B3CA 1MRNA 4MGZR 4TQ9A 2E9SA 1E1QD 2BWJA 3T1QA 3EPLA 2NG1A 2AN9A 4EUNA 2RGEA 3PV0A 2W58A 3SYNA 1D8TA 4KXFB 1U98A 2CDNA 1VTKA 3MWKA 4G5QA 3BK7A 2AHOA 1G17A 3P20A 1ZM3A 1AK2A 3K0CA 3U3KA 4NYMR 2L0XA 1SVMA 5SZJA 3WYAA 5JBQA 2Q3FA 4XTRA 1BMFD 4UNPA 5J4VA 4NYJR 5L3QA 2AWOA 4AURA 2GXSA 2FV8A 2GEDA 2VP0A 3AVWA 3AKCA 5AR1A 5DE3A 2PLFA 3SBEA 1Z2CA 3OIWA 5G3YA 1OHHD 2FH5B 4PO1A 2QZ4A 3TAUA 4EPXA 5KUTA 4K46A 5FBQB 1T8TA 2E1RA 4W5HA 3T1OA 4XVUA 2EFEB 3RS4A 4HLUC 1ZUHA 3N2EA 3MJHA 1VCNA 2CHGA 3V4FA 2G83A 3ZIAD 3RS7A 1GZSA 3EX7C 5M04A 3VFDA 3FFAA 4WZ6A 3PEWA 1E2NA 4PHGA 3KKPA 2IS1A 3CUEF 5BQ5A 4PFSA 3U2QA 1N6RA 4KI0A 2IYVA 3QF4A 4TYNA 4MRRA 4QBFA 2R65A 1TPZA 3C8UA 4LSGA 4KVAA 4TT3D 4U5XA 1ZIOA 4A1FA 3PFIA 2OE2A 3LXRA 1HQYE 2FWRA 2SHKA 1OXXK 3GLFE 5KSOA 2YOGA 3IKJA 3W5IA 1ZU4A 1VKJA 4Q7MB 4CDGA 5GJWC 3VNUA 4HUTA 2DR3A 3FKQA 3WBKA 1E2MA 1NMZA 2DWQA 3K9GA 4G0NA 2G1KA 3VU9B 4Q4JB 3SQWA 4KSCA 3RS3A 1GNRA 5IF9A 1A2KC 2G88A 1SHZA 4Q4LA 4HAWA 821PA 1KI6A 1SVSA 1FQJA 1S1CA 4DRZA 1ZIPA 2NPIA 1U9IA 2OFXA 1II8A 4TLDA 2X19A 1ZBDA 4DT1B 3BOSA 3QPWA 4D0LB 1PUIA 3OEED 2NO7A 5DI9A 1E2JA 4AG6A 2O0JA 1P9WA 1XPOA 1XU4A 2FA9A 4LV6A 1A82A 3TR0A 3AKEA 2GNOA 2WV9A 5K8LA 1ETUA 1Z63A 2V1UA 1GKIA 3FHCB 1IY1A 3RNLA 5TB5A 3BBPA 4ZIRA 4URZR 2F55A 1SHKA 1KKLA 1Y3AA 3EARA 1ZM4A 4E5UA 3W6OA 4G01B 5KYKA 1E2EA 1KI2A 1NRJB 3QKSB 3G5UA 4Z1MA 1US8B 1OB2A 3ND8A 4KO8A 1ZM2A 5FI0B 3RC3A 4XWKA 2JATA 4IVQA 1AS3A 3DL0A 4M1MA 1II0A 5FOVA 1GOTA 4NKRA 4PX9A 3LW7A 3X1ZA 1GDDA 3SDZA 4TMVA 5GJBA 1XCGB 2W0SA 3TUJC 4ERNA 3AVYA 2V6JA 4LYHA 2YVUA 4TLEA 3Q9LA 3IBYA 3SBDA 4AG5A 3KQLA 3CBQA 1QHXA 2OCYC 2A5DA 3IILA 4OYHA 1PV4A 2ZAOA 1N5KA 2BMFA 3JVVA 3QKUA 4GP6A 4ARZA 1KI8A 2J7PA 3LXXA 4DHEA 2CL6X 1LV7A 3MG9A 2WMOB 1F2UA 1NLZA 5FBWB 2HXSA 1E0JA 3K09C 3NC0C 3T15A 3QI2A 2WTUA 3RS0A 2VEDA 2ZE5A 2PMKA 4EKDA 1AZSC 2EFGA 5FL7D 2IT1A 2JASA 3CONA 5H70A 5JWRA 4A2PA 1AJEA 3FMPB 3REGA 1KNQA 3IEVA 2OSBA 4MGIR 1MO3A 1M7BA 2D74A 2O8DA 4R71A 1N6PA 2IYQA 4BLRA 4HLQB 3UMRA 3VR3A 3HYTA 1NNEA 1CR1A 3I72A 3CF6R 4AY2A 1C4OA 2AXNA 1YR9A 5FOUA 1GL6A 3U6BA 3SQXA 1ELOA 1KJWA 2QMEA 4DIDA 2CCJA 4R98A 4WOPA 3AB3A 5A5GA 3G82C 1W4RA 4TLCA 2QORA 4C0BA 2J1LA 4B43A 4KV9A 3BIFA 2CHQA 3GD7A 1UBFA 2R6CA 4JT4A 2CXXA 4Q9HA 4HEJA 1P6XA 3KFXA 2HF8A 5JRJA 1S8FA 3UWKA 1MO6A 2FPKA 2F6RA 1HH4A 2GF9A 3THOA 3ZVLA 4UNSA 2UZIR 4AKGA 1GFIA 4MQBA 4P0TA 2JLQA 1O3YA 3E1SA 2F1HA 4FCVA 4TL8A 1G18A 1OT3A 3TVTA 5L3SA 3AKDA 1Z3IX 4MRVA 2AX4A 2GCNA 3A58B 2IYXA 3U5ZB 4MYTA 1DOAA 5BN3A 2ZVPX 4YDSA 1TF5A 3NHAA 2JIZD 3A6PC 4US0R 1EFTA 2QAGC 2QT0A 1AKEA 2IEYA 3EA5A 4DLSA 4EAQA 1T5LA 4PPGA 1A1VA 1I2DA 3I61A 2XB4A 3EIEA 3I8XA 1DBSA 3AF4A 4ASUA 4Y0AA 2XAUA 3ZQ6A 1G21E 5DN6D 2BBSA 4Q9JA 2VTKA 3NWJA 4YXWA 4FXPA 2O8CA 2O8BA 2QBYB 4K81B 2IA5A 4II7A 4U00A 1P2SA 4PAOA 4Q4HA 2ZRMA 2GJ9A 2PCJA 1N6NA 4NDZA 1KDPA 4A36A 2HYIC 1N0UA 2ODBA 1QG2A 4LK2A 1G3MA 2ZR7A 1WB9A 4PANA 4D2IA 1E2KA 5SZIA 2ZS8A 2O0HA 1E4YA 1COWA 2V54A 2GESA 3W3ZB 1XCMA 2XGJA 5KU1A 5DYGA 4KSBA 3NVAA 5EE9A 1GP2A 1VG8A 1G4AE 1O87A 1TEXA 1W4CA 3B1WA 4R2HA 1XEFA 2X77A 1IXRC 1U90A 3THXA 1E1RA 2JLUA 3CM0A 2B21A 2ZI3A 4B76A 4RCZA 3IIJA 3OAAD 1GKUB 1C9KA 1NN1A 3CB4A 2FPMA 2FZ4A 2J9RA 3QKRB 1QHYA 3DVLA 4EQ6A 1FMJA 2Q0HA 3X1XA 1IM2A 1E2PA 2WWXA 2IXFA 1RKBA 1X3SA 2WJYA 1X8KA 4QHSA 4LJ4A 2QPTA 3Q5DA 2J0VA 2Q3MA 4Z8YA 5BWMA 2BEKA 5E7MA 2AD5A 2A5JA 1RJ9A 1KI7A 3B1YA 1TL7C 2ZUDA 2CBZA 4Q7JB 1Q0UA 4BLQA 2WPDD 1QRAA 3EAQA 1GNPA 4LJYA 3KUDA 4IRUB 4OQMA 4OI0A 3WP1B 3CX6A 4ABYA 4DCUA 2WKPA 3VAAA 4TYWA 2ANCA 4O3MA 5JI2E 1UKEA 1JXMA 2GCPA 2ONKA 5GVSA 5KO2A 5F3WB 2VYFA 1QVRA 3NKVA 1F48A 4C3ZA 1IAQA 5FBRB 5HKKD 4AKIA 4TLBA 2WOOA 3K0SA 1KDOA 1KK3A 1Z0DA 3GJ3A 3ZLJA 1SZPA 1W0JA 4B3XA 2BMEA 1NY6A 5AJVB 4PAMA 5BW8A 2IBMA 2MSDB 4OHZA 3LAWA 1PLLA 3ZQJA 1T3HA 2WWIA 1JJVA 2WIBA 3WNBA 2DFKB 1UKZA 3KB2A 3VR6A 2ZROA 4BZPA 3KKNA 2QSZA 4LC1A 4QJ4A 4NTZA 2AK2A 1H65A 1LB1B 1MH1A 3I4LA 2IF2A 2R6AA 4JLOA 2OO7A 1RIFA 4KBFA 3GCGA 4IXNA 5TMPA 4BUJA 3F0TA 1OIXA 5L8VA 2WBLC 4NCKA 4PPNA 2NQ2C 1MABA
chains in the Genus database with same CATH superfamily
3OG9A 2BGUA 3BD8A 1TYBE 2X6TA 5FBVB 1OBHA 3NOOA 1HLFA 2ATVA 4YCDA 1DLIA 2MINA 1KAMA 1AXGA 2GHRA 5ALWA 1T0PA 4U7WA 4DLNA 1VHQA 2VNIA 4DBVO 3M6WA 1Q6YA 1IEXA 1QTRA 1MCZA 1WSWA 4IKPA 1JILA 2RHDA 5GY7A 1HY3A 3B1KA 2ERYA 3E5HA 2Q3BA 4EO9A 3DNFA 3PXGA 1WXXA 1R12A 1UJ4A 3VR4D 1G7SA 1OVGA 2UZ3A 1M2NA 3E9MA 3SZ3A 4KSYA 2PWYA 2W6JD 1UPFA 2QZ9A 1C8BA 3DHWC 3PIIA 3I12A 5JH7B 2AOVA 4P98A 1L4UA 1ZM9A 3NATA 3H4IA 2R79A 5IBRA 3ZHQA 4G0WA 1T9HA 2ODEA 4RQUA 4N0PA 1HDRA 5E1BA 4LAFA 4B0OA 1GUBA 2ODNA 3MOSA 3ZIDA 4BZWA 4HNQA 3I9V6 1RCTE 4P82A 1GLNA 4UU7A 4ND8A 4BNMA 5JS8A 3FDFA 2X5XA 2WYWA 1QX4A 2YMQA 3IVGA 4BUCA 4C4XA 2O8FB 3OJEA 4RY0A 3G23A 2HF2A 1Q22A 2HREA 4RS4A 5ILQA 7REQB 4QPNA 4EK9A 2FZGA 2WP0A 4A73A 3GD5A 4YEDA 2YKGA 2HDHA 2ZCVA 1GRVA 1NL3A 1Y89A 3W1EA 4UUOA 1Z6AA 1L5QA 3KJXA 4CKEA 2QRKA 3DMTA 2XOKA 4RGQA 1CUEA 1XKXA 4MW7A 1YR7A 6ADHA 5E38A 1SXGA 2FY8A 1PZFA 3K6JA 4MIOA 5HM6A 3IXLA 4DR7B 4KOEC 1Z7BA 5I9NA 3QE4A 4TWAA 2WOJA 4GWLA 1RS0A 4ISBA 2CLCX 4JI5B 2NZ8A 5D6OA 1VHWA 1P61B 2M1XA 1I2ZA 4GLLA 3IQIX 2BGRA 3OO1A 4L7VA 4RNDB 4KH0A 3H1GA 4HJRA 1JDSA 5REQA 1KZHA 1X9GA 4WKPA 4I3GA 1AC5A 3AZQA 1T5IA 4OIFA 4QREA 3K0KA 3NRCA 1QPZA 5FTWA 1Z9BA 5ERXA 1L3BA 1IDN1 3G8YA 4L07A 1PN3A 3C4QA 3M3PA 2VAWA 4L5BA 5JXGA 2YQ4A 2VAMA 5JO9A 3D8TA 1LI5A 2RMKA 5LYJA 4QGHA 4JBWA 1AU9A 1T4MA 1XAGA 5INTA 2AMLA 1UAYA 3FI9A 3S68A 3VSBA 2KB0A 2ATEA 2B99A 2ZI9A 1PIWA 1V37A 2BEWB 1RMTA 1FX0A 3EHEA 2I4RA 4YECA 3WLJA 4BP8A 4ZHSA 4MVJG 2TMDA 4H77A 3HADA 3AV0B 4R1OA 5H9VA 2HSZA 5JNTA 1CRPA 4RFSA 3M1AA 1UMDB 2EWMA 2W00A 3U3MA 4Y7CA 1DELA 5JH7F 5FNZA 2IP2A 4URFA 1YJ8A 5THKA 1SEPA 1K8ZB 2ERCA 5FR2A 3TBFA 3USES 2MSKA 5KQGA 2CL0X 4HQRA 3TEMA 1E1YA 3HU1A 4WXHA 1S8OA 2POCA 3NJ8A 4IGKA 3K0BA 1ZRSA 5CRIA 2B7BA 3SWWA 2NIPA 4ZAYA 2FETA 2A7XA 4NMXB 4UATA 4E5SA 2LW7A 2ZXUA 5FADA 3U1BA 3P9YA 3SGLA 4RJIA 1OYWA 1OLXB 2ZRGA 4JSYA 1DQPA 4WEOA 2GAIA 4JSRA 3KQUA 1IXKA 1QDUA 5AI6A 4CT0A 2QXUA 4JLPA 4Q4CA 1LBIA 4HH1A 5A4DA 1VE7A 3H4TA 1VZ3A 3E7WA 3L6RA 2QS9A 5E6UB 1JTFA 1CERA 4KQWA 3NHLA 4Q9LA 2OP1A 4O4JA 2YWRA 2VRCA 3S1SA 1NYLA 4LC9A 4RXMA 2WFAA 1ZA2A 4QDKA 5BT9A 4A0SA 4BMCA 1PT8A 4A8HA 4FKMA 4OH7A 1PJLA 2VZ0A 1I3OA 2ZJ4A 1SXHA 1WM1A 3G0BA 4R2MA 5AWFC 1NJSA 3L18A 1ZGCA 3GLGA 2QV0A 2RARA 4KFUA 1LA2A 1KA9H 1NAIA 5BOSB 1V5FA 4IV8A 1XQ9A 3PFHA 3S27A 5F7OA 4YP0A 4QDTA 4IF4A 1NJFA 2VDOB 3QU9A 1RYDA 1SBZA 3LGSA 3UJBA 3U7IA 1CHNA 3R24A 3OPQA 5B4TA 4MQMA 1E58A 4L5JA 5EJFA 1KSFX 2AC7A 3H13A 3BXZA 1A5BB 3DULA 3QX8A 3ESXA 1XI2A 4ZXPA 6Q21A 4U7DA 2Z98A 1E7WA 3CUYA 4FJ2A 2F00A 4B48A 1JHUA 3BH6A 5JAOA 3N2KB 5HZHA 2IITA 4EKNB 3Q11A 5CA1F 3C6MA 4ZZ0A 2PRSA 3G5AA 3I3OA 2HYDA 2WK1A 3RYCB 3LX6A 4JB2A 3HDVA 4B82A 2FPIA 1ZNYA 2LWIA 1OT5A 1ZJ5A 1T13A 3R4VA 1VYVA 1JP7A 2AMVA 2ZETA 3FI0A 5HQJA 3CT4A 1TI7A 3S1LA 2VFAA 1FUIA 1CVIA 2PANA 1PHRA 1WTAA 3E61A 3SC2B 2J6IA 3A14A 1J2EA 1PQPA 3BL5A 2BFBA 4ALKA 2ZSHA 2JI8A 2ZRJA 1TU3A 4U3JB 3PCTA 3ETLA 5LIPA 3AZOA 2VEOA 3DKKA 2V03A 5BYKA 3NJ4A 1WNTA 4L6AA 1FFGA 3LWNA 3HY6A 1IN8A 1WMEA 3EUAA 3AUUA 1H69A 5TEVA 1D2EA 1E7QA 1QV6A 1LK7A 1N2CB 3GF4A 1Y9ZA 2ETXA 3HB0A 5LA6A 3RUDA 1TM5E 3DAFA 3RASA 4H2DA 3RBAA 3BGWA 4XA8A 2VP6A 3PX3A 2TRSB 2HBQA 3K73O 3Q6NA 3PPWA 5HP4A 3NIWA 5DU2A 2V7QA 1CU1A 2C5GA 3L0SA 2I7VA 3L43A 3T12A 4QLOA 4KK3A 2ONJA 3UAGA 2E87A 4EBFA 1KFKB 2P6OA 1A5AB 1G3QA 1GR0A 4CTJA 4K5QA 4J75A 1W5FA 2O57A 2NU6B 4W5WA 3VGJA 3MT7A 2OC4A 3IXMA 2NX2A 2OQRA 3E2IA 3QLVC 1JZQA 4K6CA 3W5JA 2ZW9A 2WHRA 2AV6A 2ZRQA 5IP5A 4CEHA 2O8BB 3H9EO 5AVOA 4DYVA 3K7EA 3P9ZA 4S1TA 2CJXA 1N25A 1JDNA 4MWGA 1NY5A 1AIPA 2PUCA 4WWHA 3HRHA 4UFOA 2ZATA 4DPLA 1AGYA 3ADKA 1FNSA 1WUHS 4YQEA 3QMPA 4XUGB 2E89A 4WVLA 3UZUA 3D0KA 3VUEA 4DSAA 1VIDA 1Z0JA 5KKAA 3HZOA 3R3HA 3U09A 4GM0A 3I04A 2Y68A 1NF8A 1QIFA 2KS6A 5IWCA 3HJUA 3RIXA 1BVHA 1DZ3A 1IOWA 2ZBDA 4UHBA 5HIMA 3MT9A 1C8KA 1XDDA 2ZRDA 2X15A 4D3FA 2P2CA 5I4BA 4LJ7A 4RPHA 1UBGA 1NN5A 3AK4A 5AUOB 1YA6A 1WXIA 1AB6A 4ZI2A 5KKCA 4UU0A 5K7SA 4BZZA 5EJ4A 1Q0QA 1ULHA 3CUUA 5I47A 1NR7A 5TNXA 4B1FA 3ZY3A 3HJHA 2WJIA 4IDEA 4UEJA 3W5UA 1XEXA 2FSSA 3WIBA 5CG1A 1T0BA 5EJEA 2XMGA 2X3FA 4X20A 4B6OA 1R10A 1M2EA 4MV1A 2VXOA 5EE3A 2PYIA 3ESZA 3FFTA 3K1ZA 1C3OA 2QI9C 3WV4A 1CJBA 1J06A 2XQKA 3HY3A 3RFVA 4AAYA 4EQ6B 4LZOA 3B3JA 3C7KA 1V11B 3INTA 3IQEA 3DG9A 3T4XA 2Z04A 2JPDA 3T3IA 2ZRHA 1Y6ZA 3IPLA 4PSAA 1KQGA 4BLVA 1VFPA 1NF3A 1WZNA 3L6OO 1U6KA 4AL4A 4RD4A 1CNEA 1KSHA 1NOIA 1Z5OA 2QUKA 1T4GA 2VDQB 3F2IA 3SYLA 5HRUA 5CM8B 1PVVA 3D6FA 3VKUA 5EL0A 3M9LA 2AOTA 1EJ0A 1UJBA 2AKAB 4Q1EA 5KWSA 5ES3A 2M6RA 4GUDA 2LIPA 1N2CE 2PGAA 3ZWYA 4BGEA 5IAAA 2W4IA 3AEKA 4PU0A 4EYQA 1PVOA 2KLHA 3PYXA 1T9ZA 1LW7A 3EOAI 3FYSA 5I7VA 2ZUBA 4LTMA 1N75A 3JYNA 3D4IA 1CUHA 2CGEA 3D3WB 4ZKDA 4URHA 2G1UA 2O9JA 2V6GA 5IH7A 3W5SA 3NIFB 5K51A 2WF7A 3H3JA 1P0IA 1W0KD 3TD9A 2YZ2A 3QU2A 4E51A 2ZUEA 2DWPA 2AKYA 1G20A 4L0MA 3LQ1A 5LQMA 3UHJA 4HTFA 1A88A 1RKQA 2ZYAA 3N6RA 1PJ8A 1VKRA 3PEFA 1A2BA 1GPJA 1HLDA 5G1NA 1KHHA 4XFJA 3GEEA 5TMEA 3O83A 1KO7A 4QYXA 1DAOA 4U7HA 1YFKA 1K9VF 2B4AA 4QGAA 1YS1X 2X23A 4K86A 3U7QB 4EG3A 4J7AA 1K5DA 1ZK0A 1IHDA 5JPIA 2FPUA 4KQXA 4UCFA 1VHDA 2MSEB 3H2HA 2JIZA 1I4DD 4N5MA 4LCBA 1I7NA 1Y6RA 4EG4A 5I6DA 4BLUA 2ZANA 2D3TA 2F8LA 3ZD6A 1HT1E 1SFRA 5A6VA 3G9XA 1W44A 4MRSA 3KBBA 3RIEA 3RT9A 3G2NA 3HJCA 2OV6A 1WXGA 3C5WP 1N7GA 2RGXA 1JPNA 3BB4A 3IT0A 1CCWA 4RJLA 4M60A 1JU4A 1YRYE 2PEZA 4MUGA 1HNZB 3RGWS 1NJ8A 1M6NA 1XD2B 1LF5A 5CFMA 5IDWA 3BM5A 3CX7A 3A6HA 3IDZA 4YROA 2B5VA 1Z5GA 3NTOA 1CUCA 1K6XA 3PWKA 2FLKA 2JD0A 1Q0RA 3I8SA 2EWVA 2TS1A 5L53A 3ISVA 4PSKA 3HP1A 3FG9A 4G84A 3DEFA 2X7XA 4YO8A 1H23A 4NX2A 2E2WA 2BFAA 4CUKA 1WU7A 4KFTA 1SZDA 2F9MA 3GMDA 4CEIB 3U31A 1TW2A 1N8TA 3FTEA 1UXJA 3ENWA 1BW9A 2G04A 3DW1X 3DOJA 3ETJA 4IVPA 3HJNA 1GNVA 1V6CA 3TNLA 3GMTA 4ZV9A 4RQBA 2X5NA 3U13A 3LP5A 4XD7A 5TV2A 1IN5A 1RWXA 2XIQA 3D2CA 3QPAA 3SIXA 1IJKA 2WFLB 5A7HA 3GLIB 3R75A 3QM1A 3PQ5A 1ZQ1A 3N59A 3GEGA 4PTZA 1R0YA 3LP6A 4TUYB 3RANA 3RRYA 2FFBA 1V26A 1TCCA 4TYQA 3WMGA 3FUVA 3B53X 4YRQA 3J80A 3VNBA 4JLJA 1BE1A 4FEAA 4ZAGA 3AUJB 4PQGA 1IHOA 2BVNA 1K06A 3I5AA 1ZAKA 4IXTA 4G3XA 2VWPA 5JSYA 3OC0A 1HDOA 1JQDA 2I2CA 2FFQA 3F3KA 4P4UA 4DNFA 1NATA 4ZREA 1ZK1A 3IB3A 1P6QA 3G8DA 2Z8YA 3IODA 4EP1A 3G0CA 2UU9B 1KQPA 1VL1A 2F9LA 3KAKA 1CRWG 1P75A 5BQ3A 1U0NA 4UEQA 3EOZA 2JFHA 3R3XA 4M7PA 4XQCA 4FGUA 2JAQA 5T41A 1UK7A 4FCTA 4IG4A 1MC1A 4NJMA 1K86A 5BO5A 3VVMA 1U2QA 4E2YA 3Q3EA 1I4TD 1Y0BA 2QD1A 3P2EA 4HRVA 5IDVA 1NXQA 2Z6QA 4NZPA 4XWGA 4QO8A 1NF2A 5L4SA 2X8BA 4CL0A 4R54A 1DO8A 3K15A 4UD2A 1ZRHA 2H4YA 4R68A 4FNMA 4LRYA 1EK0A 1OZGA 3T7DA 4HAZA 2P78A 1NTOA 4D4GA 1SXJD 4R2WA 5E9JA 4BLPA 5AUQA 2XB9A 4G1EB 4RVNA 1Z5UA 3L9WA 2SNIE 5PNTA 3P9PA 1NBHA 4JBYA 3V1YA 4JEUA 1QYCA 4F4IA 4AJHA 2FMXA 2NZXA 3EVZA 2HUPA 2VK2A 5ALQA 2OHJA 2YASA 3H5OA 3I9V1 1L1EA 1M1YA 3EMBA 4R0NA 4L3VA 4JUDX 2CBGA 3EW9A 2HW8A 1YCDA 1XB2A 4YMSA 1JAHA 4MQEB 1H85A 3ND9A 4RACA 2JBWA 1IWOA 1UZUA 5EOVA 5FPPA 4BGDA 1SULA 2NOAA 1RYFA 1R0WA 2FFHA 1B16A 3GH1A 3O8DA 3FXAA 2YDXA 1JLLA 2CXOA 3O8QA 3ZDXB 2X8JB 1YB1A 3CQ9A 1AVTA 1USIA 4PONA 5CG2A 1E6EA 4NCNA 2A84A 3RYFA 1QK3A 3HVRA 3GLIE 3IUPA 5EZYB 4TVOA 5E4FA 4EEZA 4Y67A 4FONA 1LU9A 4W63A 4TQUS 2B83A 4CR8A 3JAKA 2YWJA 4TUYF 3TNDA 4L3OA 4EW1A 2I0FA 2V6MA 4OP2A 4D8TA 1RJWA 4B09A 3RSQA 2O8EB 1XAHA 3NEYA 2BFDB 4L8LA 4LBYA 4LOKA 3SD7A 3GHYA 3PL1A 3ZWQA 2BDUA 5DBIA 3OJOA 2ET6A 4U2GA 4QFMA 3R7WA 3UY4A 5TGZA 5KPDA 4F12A 4F46A 1E2HA 4C7OB 1SUSA 5KJCA 3DMDA 5LZ2A 1S2OA 2CN1A 2VWQA 3DM5A 4TMZA 3EQ6A 4WMLA 4YRRA 3PNMA 4IX9A 3TDKA 3WIVA 5F98A 2I7DA 3ME5A 5GM1A 2RCYA 3W9UA 1P39A 2RH4A 3COZA 4FHFA 2A1IA 1CJVC 4KQ9A 3WIDA 1GGNA 3UJDA 1YFJA 1XA3A 1R8JA 2CF6A 5JBNA 2ZB8A 2NV0A 3HGTA 1X1DA 1X7YB 3I5XA 3WRXC 2F43B 4WE3A 1ZMBA 1YBHA 1DAMA 4P4SB 5COQA 2HIAA 4EO7A 1EGHA 2CD7A 5CVUA 3FHOA 1Z6QA 4ZALA 3NDPA 4GMHA 1AA9A 1SEVA 4E6EA 1LX6A 3ZI7A 1JFSA 3SSNA 3FYUB 1C4WA 1ENOA 3GRKA 1VE3A 4TT8A 5LDDC 2P68A 2FKNA 4N1AA 2P5YA 5HCNA 1V41E 1I1OA 4GBMA 4DXAA 4HATA 1KMIY 2PIAA 4I8IA 1IPHA 1QONA 1IFXA 4BE7B 1SOAA 3IAXA 2JFPA 3ONDA 2HJVA 3W6NA 1OGJA 3IAM6 5TGDA 4AD8A 3AY0A 3MBOA 5EMKA 4ALNA 4WFIA 4LZWA 5C7OO 2H7VA 2QRUA 4JZKA 4F9FA 2GZAA 2H07A 1D3AA 2CZQA 2HO4A 3EYWA 3G2QA 4OQFA 4ZQGA 3LCJA 4KP7A 3UPTA 2QY9A 2Z4SA 4BVJA 5CLIA 2P5SA 3WNCA 3JSXA 2FPSA 3TSWA 2C5FA 4NCBA 4NATA 3Q8XB 1ISGA 5BR8B 1CRLA 1FFBA 1NUQA 1X1QA 1CNMA 2QL9A 3E22B 3H2BA 5JVDB 4DKXA 4OQLA 2YHIB 2XUIA 4X8OA 1EHYA 4F6RB 3OE7D 4RVCA 2DHCA 5DCWA 1ZGGA 4AKSA 4IDCA 3OESA 5EZYF 1QKJA 5A0VA 5ESWA 1O94C 3SZGA 1BE8A 3WOVA 3QZUA 1JFLA 2FEXA 1WSAA 5DO9A 2A9PA 4GPZA 1SXJB 2JGJA 5DHTA 4KHPB 2MOKA 4I1OA 4ZEOA 4Z49A 2CSXA 2VLBA 2ZUVA 2PVSA 3H2YA 4R8SA 2I8AA 3UJ3X 2PJZA 3WMRA 1QIGA 4YRKA 1II9A 1I7LA 5E6SB 1MDBA 1Z73A 2QRVA 3TJMA 4EABA 2ZDQA 2VJYA 3AIOA 4HDNB 5GMOA 3RUHA 5DW3A 4ZT4A 5F51A 4P7GA 2XLBA 3I39X 4FUQA 3ZV7A 5LLSA 2ZUSA 4CM4A 2GAJA 4AJJA 3A2KA 1KYIA 3LLVA 3C5CA 2PUFA 4BB6A 4HSEA 1PNOA 2P3SA 1RZUA 1V6SA 1RQ7A 4JBGA 1EB8A 1EX6A 1SB9A 2YV5A 5ECWA 4AG3A 4B2LA 2WYVA 3KV1A 5IAGA 1P60A 4YRCA 1AHNA 1SUCA 5A9SB 1UWLA 1KRHA 1ZGZA 3FVVA 4OG2A 1JHVA 1BWQA 1RXSA 2EEPA 3R23A 4OOEA 3QA9A 3D0QA 1CVLA 4R2KA 4RSRA 2JLRA 1I0IA 2HNBA 1JYEA 1XVVA 3C43A 3EDRA 2P79A 1P2BA 3E9DA 3M0EA 4KQEA 4ARIA 3I6MA 2RAVA 5LPNA 3KYJB 1L9KA 3IUMA 4PFJA 3ABZA 1ADGA 1IHUA 1ULAA 1Y7LA 2C8LA 1UF9A 1Y8RB 2FFRA 2Q3HA 2BZ0A 3CEHA 1XPRA 3SQLA 1HR0B 1Z2EA 1U2PA 4QQKA 2HM7A 3TQHA 2XBMA 1RRKA 4YH1A 2GPYA 3PQDA 2IS6A 4HQFA 2QTFA 1EGMB 1RYNA 5ABPA 1ECCA 1E0SA 3D6UA 4X90A 2ZCUA 2EQBA 4JC4A 4ZANA 3IYLW 5HGJA 2B6HA 1VPLA 3WKCA 1CJKC 4W5JA 3REQA 1AXRA 1E8MA 5YASA 2BCEA 2IP4A 2XGOA 5A4MS 1TUIA 4C22A 4YIKA 3BFKA 4EHIA 3HSSA 2QLJA 4INJA 5JVDF 1Z4QA 1IY0A 2Z2JA 1JQBA 2XCSB 2LCQA 2CFCA 5I7OA 2OO3A 3K6SA 2GDJA 2ID7A 3HRKA 3V1MA 1QGED 1ABFA 2VP9A 2AUNA 3RCBA 1GEGA 4PZUA 5EN4A 5C8YB 5HXAA 2F3QA 3G88A 1DQRA 1FRVA 1SXJE 3KQNA 3WJAA 4AN1A 1CX9B 2HA5A 1RXIA 5F3RA 1D8AA 1I6LA 4Z9YA 3G2PA 1NGSA 1VRVA 3C7TA 5JZ9A 3QV1A 4HFNA 3ZV4A 5H68A 1GRCA 5HFAA 4RNCA 5J47A 3T5MA 2YWEA 3TM4A 4ID9A 4LQCA 1C1HA 4AMVA 3X1KA 2QPAA 1EEHA 2J8ZA 2R86A 3FNEA 5EZSA 1U0RA 5T8KC 1F3LA 3H65A 4FHGA 2NO6A 4OJYA 4ZA2A 1NE2A 2R8PA 4RIIA 4S1WA 5ALOA 2B3TA 3FMIA 1XMOB 3DMFA 2WAOA 4GMXA 4P86A 3KVNA 1K7EB 5FTKA 4X3PA 3IKTA 1PTJC 5HTOA 4HKTA 3V2HA 5C7IO 2PS9A 3AX6A 3DT6A 1WQ4A 3B36A 3GJXC 4N0MA 4ZT3A 4DKJA 4L85A 1GXSA 3OFVA 4DB4A 1WJGA 1T8YA 3QWFA 4JNKA 1KVUA 4MO9A 4HZIA 4YFYA 3KPUA 3UMYA 3L4EA 5FFNA 4FLMA 2ZIFA 2GF2A 3TBKA 4KV7A 4MYRA 2X40A 4FYHA 1C50A 5K4HA 4LZNA 5F73A 4F4HA 5GJCA 3TKAA 5HFJA 1NFFA 4F3TA 3H5LA 3LBYA 3AR8A 4YJGA 1YQWA 4QUIA 4YCBA 2PYDA 4RA9A 3UJHA 1RKUA 2H18A 2D5IA 4D1YA 3SJAA 4KR3A 3FLAA 5FQOA 1T8RA 2YMLA 4RWEA 2QN6A 2EFCB 4IDQA 3RU2A 3LS2A 2BN4A 3AW9A 4H3KB 2JJYA 1L7AA 3EFOA 5A62A 1F06A 1CSEE 3R20A 1QG4A 3ONWA 5IDXA 3M5WA 4JXJA 2QOEA 4EHNA 1EE2A 3FB4A 4Z3KA 4M86A 4PAQA 2CNNA 3IHWA 4UE2A 1Y3IA 4J3FA 2WM3A 4WEQA 1OTYA 3N7AA 3CSUA 3QLTA 5CLQA 3S40A 5KEIA 5KS2A 4A6EA 2HKIA 3OLVA 1ADCA 3P1JA 5C8YF 2L17A 5EGSA 3OOSA 1W59A 4UD6A 4MHOA 5CR9A 4BN0A 5I4CA 2A5GA 4GNRA 3TOVA 3IE2A 3H7AA 4Q00A 5J63A 5KJ6A 3OURA 4MR8B 3THYA 2IHNA 1LPBB 2C54A 1A9OA 3UMMA 2FR8C 2X3YA 2FNAA 2J5RA 3RSLA 1BU5A 1MAWA 1NVAA 3B60A 1GNSA 2PZJA 1CRQA 4MA5A 1II8B 4Q9AA 4EWLA 2JFZA 2OVFA 3A3KA 2Q7XA 3UUEA 1FS4A 1J0XO 1QH0A 1VG0B 1YZVA 2RBGA 4JL6A 1PG0A 1QO7A 2HRQA 2Q45A 4YC7A 5DFAA 3S44A 2GYVA 1Z4OA 3HCEA 1VJDA 1YQXA 3MWJA 4KUEA 3VTFA 2FDCA 3STVA 2OORA 3IHLA 4H1VA 1MF7A 4OU5A 1VCMA 2FB9A 4KPUA 4A8PA 2V97A 2EP7A 4Z0HO 2VC2B 3FDZB 3QI7A 5HK9A 1U31A 3IRUA 2Y0DA 2FAXA 3AR4A 2FCAA 3ROEA 2FE4A 2N0SA 3UNXA 3WJ1A 2QRLA 3DOCA 4MP6A 4AY6A 4TKLA 3QOWA 4ZIRB 4AN0A 4BP9A 4UTNA 3MERA 4MPTA 4MINA 3ACBA 1Z8DA 3GPIA 4Y2UA 2UZ4A 3DP7A 3IURA 4EUKA 2AI2A 4MKGA 1G8SA 1WHTB 5AVYA 3VISA 5AXAA 4M0LA 5CPFA 1QRRA 1W85B 2CLEB 3MRSA 3TB4A 1X2EA 3WYFA 4C08A 5KYVA 4XX1A 5HZGA 3NTVA 5TMDA 4G0YA 3W8FA 4KI7A 5H3CA 1Z12A 3PLAE 3NEJA 3N05A 4LHZA 3BFXA 3TW0A 1Y48E 3I5YA 1C1DB 1DEHA 4ALMA 1SC3A 4UUMA 1ZJYA 3ASZA 3DD5A 2Z2IA 3ETHA 3LVBA 2VCYA 3IR5A 1BMFA 4GI7A 3KELA 2AA3A 1V7CA 3NV9A 4ZCIA 4ZMSA 4LF5B 3FPJA 4IOJA 4BKPA 3ISTA 3EVDA 1UANA 3TZ6A 4CNBA 1G8KA 2DBYA 4H18A 1PV2A 2O2CA 4DYDA 1IOVA 1TRKA 4MZDA 1I51A 2ATIA 2NZ2A 3AOGA 1NRWA 3N8KA 4RPLA 4S2EA 4RD2A 3WLMA 4ARZB 3CH4B 3C16C 3JYQA 1E1RD 3ZLBA 3ZS8A 3IVCA 2Z6AA 4GLBA 3FFWA 4QC2A 5IWAB 4MV7A 1EJBA 4RH0A 4FN5A 1FU8A 3C8ZA 3A6EA 3OU7A 1NHGA 3DO6A 1B2LA 3OHPA 3QXGA 4G65A 3N07A 3TPCA 4E15A 1UAAA 1P4SA 3F4LA 4QNMA 4G0PA 4AWBA 4MUYA 4IDOA 4UOZA 1M1ZA 1PE0A 1U8AA 4Y6SA 1Z35A 4NZNA 1G5QA 2ZR9A 3GNTA 1XF9A 1BD4A 1UXOA 2RGWA 4OJTA 3MZ0A 4QFBA 1R2QA 3KKKA 4LHSA 3U3DA 1Q1EA 4TV9B 1V47A 5EXSA 5KNBH 3I9OA 4QWWA 4LXIA 4NHEA 2BFFB 1O94D 5JNUA 1X9IA 2VJPA 4EL5A 5IVKA 1BOFA 1PWEA 5CB0A 1ISIA 4RD1A 3KOOA 3OH8A 4FKBA 3FGPA 1TNDA 4JYBA 4N4AA 4TT3A 1KEUA 4CM8B 3RRBA 4N5LA 5I4IA 1AZTA 1CD5A 3RSCA 4KN6A 1HOXA 1OZAA 1T3GA 3QP9A 2Q5IA 1D03A 1F38A 2P40A 3TW8A 4D79A 4CFYA 4EG6A 2HTEA 3QOXA 2JD2A 2GBGA 3G2HA 4XRGA 4RK7A 1MTZA 1IY9A 3D8BA 3RHTA 1LLQA 3NM6B 1XDUA 1JDPA 3UXYA 3HDQA 1RQGA 5FO0A 3RF7A 4EMTA 1OVMA 5IYZB 1L1RA 2XVMA 1NQAO 4G0ZA 2ZBRA 3T61A 1BRTA 3J7TA 4HB0A 1ZR4A 2XOXA 2VSXA 2X4DA 3PLNA 5A1TA 4ACAA 4OBXA 2JRLA 1DP4A 4OH1A 5G4LA 3HGMA 2CVFA 4D81A 4R51A 4RVHA 4BB9A 3AM3A 4KLNA 4PCUA 1R8QA 4RLFA 2HC9A 4WUVA 1KK2A 2GBPA 4QE3A 4KR9A 4TTQA 1BDHA 4EUHA 5C53B 1NPYA 1SOWA 4O2RA 3E9QA 1DOHA 2XX3A 3M6IA 2QIPA 4MW0A 3SR3A 3LC0A 4PC6A 4BFTA 2EF0A 2UYHA 1CP2A 4X3CA 1W4BA 4NFYA 1Z2OX 3I2IA 1KP2A 1UEXC 4FFNA 1GCUA 2LXNA 4LXUA 4NAVA 1V7PC 3IRVA 4OBWA 4DCVA 3IKMB 3T3NA 3Q98A 2ZAIA 4K26A 3CRQA 1KK0A 3KL2A 3ZWCA 1E9SA 1LLDA 1GFWA 1VJ0A 3CLUC 4ARVA 3F1KA 3KPWA 3O5AA 2P65A 1KQNA 3K8OE 3PICA 2GM4A 2WIJA 5DGXA 4PN3A 4PLZA 1L8XA 3FPFA 5I3ZA 4JU9A 1KNXA 1TZMA 2HH9A 4J2HA 3FIUA 1AQNA 1G8FA 2GYYA 3O8CA 4OFZA 4OXQA 1PDVA 1N4AA 1G64A 1MIHA 3RB8A 1NASA 4DEXA 2A58A 4S1OA 2DSTA 3EUEA 3ZPXA 1ZW1A 2H6EA 7MHTA 2GPTA 4FGKA 4M9RA 3DM9B 2HDNB 2IYFA 1NKTA 3LCVB 4IH4A 4NG4A 4P53A 3V4RA 1J99A 1GPH1 2GN9A 2R751 1D9XA 4LBWA 4MX8A 3U3OA 3ZCXA 3HL4A 2I54A 5CNJA 4MRAA 5K05A 2RIPA 1EAYA 2VJKA 1B8UA 3DLIA 3DO5A 4ER0A 3BT7A 2ZR8A 1PJAA 1AK9A 5CP8A 4LNUA 1TEHA 1BOOA 2HN9A 2ZS7A 3HJRA 1GLVA 4MAAA 1BN6A 3JVEA 4FFLA 4W82A 3AOEA 2ZULA 1CZUA 1CJTC 1GZ6A 3NT2A 5HNKA 1VCOA 2CE2X 5IYZF 5K8CA 3KTFA 2COUA 1RPTA 1DBPA 3DC7A 3KEFA 3TRJA 5K8IA 4DMKA 3H7IA 4O2LA 3WO0A 3ZCQA 1ZJZA 2Q5JA 4GUAA 2X41A 4HNRA 4WW0A 1O97C 2BH9A 2ZIXB 3DMNA 4RZIA 4DR1B 2D4AA 4OQNA 3QFSA 1QE5A 4WZBA 1CETA 5CCEA 3ZCPA 1B15A 3W6UA 2ZYUX 3E9ZA 4EMBA 1W96A 4JJKA 1D1SA 1EM6A 2CEAA 1XZGA 3D7SA 1RJ9B 1K97A 3HYRA 1GPLA 4OTZA 4AS1A 4DANA 1MAAA 2CDRA 3V8PA 4JUFA 4WNIA 4BP1A 1D6JA 4QYIB 1FNBA 3KZKA 4FGJA 3TNJA 3L1HA 4BQPA 5JLJA 4S12A 2VVTA 3RVRA 4LX0A 1FDOA 1P1BA 3IVRA 4W1QA 1EUQA 3ZYZA 3FWYA 4EARA 1U7OA 4G2TA 2FU5C 3IEKA 1YZGA 3QKTA 4B2PA 1QH1A 4WFQA 3REFA 2VNAA 2NYAA 1VBFA 4J16C 3RIGA 4BP3A 5CB4A 4TKMA 2C1ZA 4GICA 1TMGE 4UUPA 3K4HA 1UR5A 2Q5HA 1D2MA 2ZRCA 3PBKA 1W52X 5BOSA 4HX5A 4TMKA 3L1KA 1QXSA 2R9VA 1XV5A 4LXYA 4LSWA 4AS2A 1NOJA 1RXWA 3GRPA 1U9ZA 3DKRA 4UKDA 4YRMA 5JSZB 1EM8A 2GDZA 1BWPA 2HY7A 2QQFA 3AM1A 3Q8LA 5EKDA 4KODA 1JVSA 1HQDA 3TLAA 4OY3A 3HYCA 4MPRA 4RY9A 1DIGA 1ZISA 4DF3A 3HKBB 1ZH6A 3N8NA 3VR5A 3OJWA 1Z47A 2Q3CA 3W34A 4EQZA 5GINE 2Z2XA 3CNLA 3UH0A 3STYA 1CFZA 1JB9A 4ILKA 3JD3A 1Y1QA 1OFIA 3BMNB 3EN0A 2J45A 3HSYA 1QBKC 4LJLA 2WD7A 2ECQA 5IJ9A 2FMUA 2OECA 1AOXA 2BSAA 5CLLA 1PJZA 1B6SA 4E30A 4BEVA 1XU9A 4U9HS 5IBPA 4NSNA 1B6RA 2I8LA 4U6SA 4RUKA 4XYGA 3WP0A 4N76A 1C2YA 2XCUA 3LWDA 3BD9A 4MW5A 2MINB 2CWWA 5A06A 2O14A 4PO9A 2Q4BA 1PJ4A 3G2LA 4FFBB 5JE8A 2A94A 2Y66A 1W4ZA 1Q1ZA 3DEIA 1REQA 4R31A 2EERA 4FZVA 1OBOA 4RM2A 4ZYTA 4EHDA 5D86A 4WCFC 1MORA 3LUDA 1O9BA 5LQDA 1XJ5A 5LZ5A 4UE3S 1ZJJA 3IERA 5B30A 1NUAA 4NWIA 1XZCA 4DUYB 4BX2A 1DZIA 2GZSA 1SUPA 3MW8A 4DLYA 4CV0A 4Z4CA 2BOVA 2B2NA 5GV7A 4B3SB 3WL4A 3LVQE 4ND8B 3CVOA 5LDGA 4D3XA 4C5CA 2I9PA 3V6LA 1Z45A 4Q02A 2EIXA 2J5KA 5BNZA 1CR4A 3AR9A 1BCRA 4CM7A 2P41A 3QLJA 1KMHA 2R60A 2ZRNA 5EIOA 4DLRA 2XUOA 1G2OA 4GKAA 4CGZA 1DC6A 1ZMTA 3DLPX 3KYDA 3A27A 1R6XA 3HXKA 4N0EA 4Y2YA 4YMIA 2XRZA 4PC2A 2CDAA 2K7ZA 4PIMA 1Q1QA 1NTRA 1J90A 1BVUA 1CKEA 3KVYA 5DBHX 1PD1A 2XWQA 3OZFA 4XSHA 5JQGF 4UM8B 4TVBA 1JEDA 4GMGA 5BW5A 1UWVA 4K7JA 4NQZA 3WHKA 3RWMB 4B74A 3C0KA 1JAIA 1WW2A 1EDOA 1FSZA 1Z5WA 3DPUA 1AGRA 3N0VA 4P4NA 3WGMA 2RGUA 4YUAA 2GHIA 5EKSA 3MMNA 4E88A 2QVCA 2RSLA 2H5LA 2OCGA 3LMKA 4DM3A 1B4DA 3KHUA 3WK8A 5K45A 1U1DA 2YJTD 2ZZNA 1KYWA 3SQNA 5LB2A 2ID9A 3QTLA 2FI1A 1POXA 5LXTA 1KIFA 5A4IS 1WIWA 4GZLA 1P7PA 1M6EX 4PTYA 3DDSA 1JIJA 3QMWA 5CLFA 1KFBB 1VBKA 5BRAA 2Y0CA 3B78A 4ZYUA 4TLMB 5K3OA 1RRFA 4Y7DA 1V4BA 5EPOA 5C1PA 5L9AA 5B2EA 2V7QD 3PRKE 1Z0IA 2C8JA 3ORQA 3P4YA 1G8YA 4CCWA 5LYJB 3DAOA 3DDNA 1W88A 4YAIA 3OWOA 1I24A 3U4CA 4H4DA 4M1WA 2D2VA 1Y8QA 1A9XA 1IOZA 4YR7A 4J0HA 4MV4A 7AT1A 3BL8A 3I45A 4QRIA 9MHTA 1ZQ9A 2JFOA 2PWAA 4IVRA 2LKDA 2YTZA 5AVSA 4KE7A 1LD3A 3BF7A 3HUDA 1L5KA 4RFSB 3EVEA 3SYKA 2DHRA 2BMWA 2IYAA 2RHRA 3R3VA 2REOA 3O6VA 1FNCA 1UBEA 1XGKA 2GOYA 3OKCA 1ZONA 4YWJA 1S2LA 2FUEA 2H2GA 1IUNA 5TVKA 1ISJA 3GA0A 4PNEA 3KQWA 1CLEA 4DRYA 4CKCA 3QG1A 5HOQA 1L6IA 3CZQA 3UKJA 4DLZA 2FSFA 3WLRA 1W36C 2GPBA 2G1PA 2GWHA 3PEYA 1P81A 4ZPJA 4AYWA 4BFVA 3SS9X 1M0WA 3EXHB 1J5XA 1H05A 5BN4A 1P0QA 4QUBA 2LD4A 4WKGA 3TN7A 1IU9A 3HVKA 1BXRA 3NRJA 1EXWA 3NASA 2MU1A 1PX0A 2F1KA 2YYZA 4MPJA 2AFIA 1XRJA 4D0SA 1ISRA 2QRMA 4QM7A 2O3SA 1K08A 3E70C 3ENVA 1TTHA 4X8MA 4CF7A 1SXQA 1U7WA 2QTZA 2FEMA 3B89A 3BAFA 4O4JB 3SKYA 3QVWA 3RBVA 1GAJA 1K6MA 5EIEA 1SKQA 1WZCA 2JEOA 4ZU1X 5C52B 3ROTA 3ZBQA 2DPMA 2OENG 4IDHA 4B83A 3KAJA 2PGDA 4O3MA 4NV0A 1T8SA 2HBYA 3AL2A 4R0MA 1KH3A 3PA6A 5FOQA 5G0WA 3WL6A 1ZC3A 5MN4A 1N34B 1X1AA 1A5TA