4OL0A

Crystal structure of transportin-sr2, a karyopherin involved in human disease, in complex with ran
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
172
structure length
172
Chain Sequence
QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords GTP-binding nuclear protein Ran
publication title Structure of transportin SR2, a karyopherin involved in human disease, in complex with Ran.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2014-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ol0A00
3CKLA 1NJGA 1T3LA 5IF9A 3KL4A 4HLCA 4ZPXA 4DLTA 1OXTA 3OF5A 3C7KA 1MO5A 4B3GA 2B7BA 1JI0A 5DI3A 3LBIA 2VH5R 4NP6A 1G6OA 1ODFA 2XEXA 4WW0A 3CX8A 2ZTSA 3C41J 5AWFC 1NIJA 4LPKA 2G1JA 2PT7A 4GZMA 4KLZA 5FI1B 3VQTA 1QVRA 2DWPA 3RWMB 1OB2A 2HF9A 1WBDA 3F8TA 4I4LA 5JHHB 1P2SA 3K09C 5E7JA 3T5DA 1DADA 3C5CA 4KITB 4M1WA 5TXGA 3L0PA 2J59A 3M0EA 5CJ2A 5LPNA 5FFMA 4WOPA 1VG8A 3NBZC 2GJ9A 2YWGA 1VHLA 3QXCA 4MUAA 4MITA 1G7SA 1CTQA 1Z22A 1Z0DA 4V02A 1E32A 2WWFA 4D6PA 3EZ9A 2VP6A 4C3ZA 1G20E 2CCGA 2FX3A 2X77A 4IDPA 5TB5A 2IYXA 4CRWB 4M1KA 1TQ6A 4HAVA 4HEJA 2YWFA 2A30A 2XNDD 4Q01A 5KNDA 2RH5A 2F1IA 5EP1A 3K0AA 2CJWA 3R20A 1GNRA 4TWZA 5G3YA 2Q3MA 2WOJA 1QRAA 4R71A 2P6NA 2RGEA 4ZO4A 2CLDX 4MDEA 2ZRFA 4LI0A 2EWWA 5CJPA 3THOA 4AKIA 4CEHB 4B34A 1N5JA 3W6PA 2WSSA 1BO6A 3VR2A 5BWMA 1JQJC 4PSKA 2OFXA 3DO6A 1KAOA 3CRMA 3KKOA 4DB2A 2ZYWX 1KSGA 3Q8XB 1UKVY 3QXJA 5DGXA 3DOFA 2O0KA 3EG5A 4NZYA 1E2PA 2R6CA 1GDDA 5KDDA 2BKEA 1SXJB 2NO9A 2ZAOA 4AG6A 4CEIB 1D2MA 1E2FA 1P60A 3AGQA 5K8LA 5LBIA 5KU1A 1OIVA 2A5JA 4WAUA 2QM7A 1Z83A 4C30A 1ZC3A 3LBNA 3TQFA 1YRBA 3IEUA 3HPRA 4G01B 3TLXA 3GCGA 2WWYA 2FGJA 1XTSA 4Q9LA 4NCKA 1C1YA 1G6HA 3K53A 4Q7KA 5HKKD 1PUIA 3QEJA 4EPTA 3QIAA 4G3XA 2J9RA 3GJXC 4RD1A 2VEDA 5LD2C 3TNFA 4Q47A 4ZIRB 1Q20A 3RYTC 2JLVA 2RGDA 4V0LA 2GF0A 1U8AA 2PZEA 1GL6A 3QKTA 4JSYA 4Q4HB 3TSWA 3L82B 1DARA 1IOZA 4P4SA 4KHZA 4A4DA 1G3UA 5J4HA 2I3BA 3KDSE 4JJKA 3MFYA 1ZCBA 2OO7A 1MR3F 4GL2A 1AZSC 1JALA 1FQKA 1FPMA 4FINA 4OJKA 621PA 1CR2A 3QVUA 4BLTA 1NMXA 2R65A 4PC2A 2O5VA 3O8DA 3SFVA 3IO5A 4Q1CA 5KDLA 3RANA 3QF4B 5K8UA 3I61A 2KSQA 3GLIE 1N25A 4LPSA 2H18A 1E9BA 1YE8A 4DCUA 5J47A 1RYHA 3O8BA 4KBFA 4BZQA 2JJ1A 1KK2A 2C96A 2ZSDA 4YDHB 4U7DA 4KU4A 4M1TA 4C0BA 1OPXA 1PLKA 3BIFA 5ANRB 1JJVA 2ONJA 2QQEA 4DCSA 5JZVA 1WMSA 3GJ6A 1RRCA 4UNSA 2GJSA 3K0FA 5HZKA 2HXYA 1TUEA 4QJ3A 2D4HA 5F98A 2W6IA 1IN6A 2EU8A 3PUWA 1D6JA 1E2DA 4H1UA 2FSHA 2QAGB 4GSYA 4HB4A 4IKEA 1S9HA 2FG5A 4H1VA 5JI2E 1X6VA 2ZI7A 1OIWA 2IT1A 4P4UA 2YKGA 2ORWA 3GLGB 3FB4A 4B6FA 1D2EA 1PLLA 1N5KA 4F7WA 4RSGA 3K09A 5JEDA 1M34E 4JL6A 1IN5A 4ZCLA 3HJNA 2QTVB 2TMKA 3NDBB 4URZR 4LX0A 2ZJ8A 2QROA 3LXXA 1GKUB 2X2FA 4QM6A 1NVWQ 4R9UC 1AA9A 4TYWA 4HAXA 1I4LD 4JYCA 4JLBA 3CO5A 5JMTA 1WRBA 4DB4A 3FGNA 2ZRJA 3T1VA 2BVNA 4HZUB 5EQTA 2FDCA 1DO2A 3CH5A 1W2GA 3RS3A 1NRJB 1R0WA 2HUPA 1JB1A 3V00A 3MWLA 1AN0A 3NH6A 2ZE6A 3QUSA 4LRWA 4BQSA 2D62A 3GLHE 2R2AA 1KKLA 2ZJAA 1C4OA 1J99A 1G9XA 2J0UA 4ARZB 1S0UA 3TR5A 4URWR 4K8OA 3RAPR 2ZRMA 3G5UA 3W34A 4US1R 4A1FA 4YMWA 2J87A 1XBTA 1PZNA 1GL9B 4PR0A 3G0HA 4PHGA 4DRZA 3LAWA 3KKQA 5FOSA 2F55A 3U3JA 5JWHA 1DBSA 3LA6A 3BJIC 3RS5A 1E1QD 2H5EA 2OBLA 3EC1A 2N1BA 4HATA 3TSZA 1XEXA 1MABB 4YXWD 2MSEB 3C5HA 4Z8YA 2ZRNA 5JECA 4G5SA 1XXHA 3AB3A 4DIDA 1W2HA 1KOFA 3OESA 3TSOA 2ANBA 2JLZA 4HAZA 3K1JA 1NMZA 2MSDB 2YHSA 1ESMA 1U0JA 3W9YA 2ZUBA 4F93B 3BFVA 2BCJQ 4X8MA 5K8TA 2QBYA 4A6XA 1Z6TA 4B74A 2ZYTX 4B3FX 1S8FA 3FE2A 4BFZA 3TAUA 2Z43A 3KXLA 3P1JA 1W1WA 3H84A 3A6PC 4BECA 1DAKA 2ZAMA 3DZDA 1X3SA 4A8JC 3BRWD 3LW7A 4LYHA 1FW6A 4P31A 3BS4A 2HDNB 4RD3A 4ZCIA 1IHUA 1ONBA 2ASEA 2OZEA 3EPKA 1KJYA 3QKRB 5JCZA 4C0QC 1HE1C 1CRQA 4QGHA 2ZRLA 1JXMA 2ZIAA 1YKSA 2ZSBA 1G8PA 2QP4A 1YJ5A 3AVPA 4LJAA 1EX6A 4N0EA 2HEIA 2IS2A 4DKXA 2QRNA 3U7GA 1UBFA 5DLQC 1UFQA 3AF4A 3AVWA 3U7EB 1R5OA 3E5HA 4XVRA 1D9XA 3PR1A 2VLIA 1MO4A 3A4LA 2WOOA 4WZAE 3AGPA 3NG1A 4O25A 5CM8B 2CK3A 3K70C 5L3VA 4ACAA 2KI5A 3ZIAD 1E2NA 5FTJA 1EXMA 1XEFA 4JIMA 1Z8FA 5HCNA 4HDOB 2JIZD 4Q1EA 4DC9A 1NN5A 1CRPA 3IIJA 1G4AE 2YOGA 1OYYA 2IXEA 2ZI6A 3MJRA 2JLUA 1ZINA 3U44A 1BMFA 4Q7LA 4Q7JB 2WWXA 2AD5A 1KI2A 1K6MA 1TU4A 1P61B 3LQQA 4L9WA 2FE4A 3ADDA 3R9WA 4M1SA 1E9DA 3CLVA 4B48A 2B21A 1UKEA 1ZNYA 4KODA 1OH8A 5TVKA 2Z83A 3ZVNA 3Q5DA 1PLJA 4DT1B 1GAJA 1DO0A 3K9GA 2FWRA 2IS6A 2G0TA 1YR8A 4PQYA 3PEWA 1XU4A 1CJMA 1M2OB 5FTMA 3CR7A 1ZRHA 2JDIA 2O8BA 2AN9A 5UKDA 1YZGA 3RS0A 3SN6A 4OYHA 3KTAB 2GAAA 4UXHA 3REGA 3OIWA 1IXZA 2A78A 4XTCS 2Q21A 3HU3A 2OSBA 2F7SA 4C0HA 4JL8A 4YMVA 1M7HA 2HXSA 2B7CA 1RRFA 4IXNA 4NCHA 2IBMA 3BOSA 5JI3E 4TYYA 2ZE5A 2VP2A 3B78A 3P4XA 1NBMD 4CT4B 2G6BA 2GCNA 2JCSA 1W36B 2WPDA 1R0XA 1SGWA 2FU5C 4BWYA 2I4IA 2GHIA 2OLJA 2CLCX 1N6HA 1B0UA 1ZW6A 3AKYA 2AXNA 4C9BA 2JLRA 1V5WA 5FUWA 2PBRA 2FN4A 3PUXA 3QNUA 3KFXA 1GTVA 4OHVA 3CNNA 3B1YA 2Q9AA 4EPYA 1AS0A 2FPMA 2ZYUX 1OKKD 5EZ5A 1DTSA 2PJZA 3MGCA 4BFXA 3A37A 2A7QA 4KFRA 1NL3A 4NYJR 4Q00A 3GJ4A 5JSZA 3U4QB 2MSCB 4TZ6A 5L3QB 3WHKA 5KPJA 4KFUA 4IFEA 3VR5A 1KHTA 1GKIA 4I1VA 2QENA 4LHWA 3D8BA 4JLKA 3ZYCA 3GLFE 3LBHA 4OI0A 2F3TA 4GP6A 3TUIC 4HSEA 5CB8A 4UJ5A 3LY5A 4Z51A 1VDZA 1HEIA 3HP1A 4PSVA 1NI3A 3CPHA 1QBKC 2WJGA 2VA8A 2A5FA 2OAP1 1OFIA 1P5ZB 2BIFA 3OEEA 4G1UC 2X2EA 2ZETA 3OFND 4MKHA 2RAPA 2XTNA 1NVVR 2PEZA 4DLUA 1ZCAA 4G5QA 2O8CA 3RRYA 1VCOA 4GI7A 1Z6XA 1G8GA 4B3DA 4OJQA 2XOKA 4B33A 5AJZA 4Z1MD 1JNYA 3B2EA 3IQXA 3PUVA 4TLEA 1EFUA 2LKCA 4A8JA 1J7KA 4Q4AB 4IOKA 1OW3B 1RVDA 4C7OA 1LW7A 2JJ2D 1WBBA 2G0NA 1N0VC 3UATA 1I4TD 2ODEA 4ESVA 4TL7A 5C46F 1AS3A 3WRXC 2ORIA 4TT3A 3AH8A 3NC1C 4W7SA 2GDJA 3L2OB 1W4RA 3JVVA 3L43A 1R4AA 1A7JA 2J41A 2VHTA 2IHBA 3AP3A 3EA5A 3GJ0A 2XSZD 3OAAD 4FW9A 1OXUA 4ZDJA 2IUSA 4JLDA 5KDOA 1FMLA 4IOLA 4JVMA 4CYMA 1TU3A 4UNRA 1IJEA 2CLSA 2QPTA 1KIMA 1HTWA 2FEOA 1G41A 2WKPA 3A1WA 4PZLA 5DI3B 1OH7A 4Q4JB 4WZ6A 3PIRA 1ZP6A 3SHWA 3WNCA 2IYUA 2XJ9A 2G83A 4A36A 1G64A 3RC3A 1ZM4A 2P6RA 4KLNA 4LBYA 1A82A 1KAGA 2AD1A 2Q3FA 2QGNA 4PAQA 3IILA 2W83A 4IJMA 5AUPB 3EIQA 1AK2A 1N6RA 4TMWA 5GVSA 4RD6A 4LDJA 4QG7A 2ZI4A 3PEUA 1P9NA 4LY6A 4ASUD 3B1WA 1X1SA 1IJFA 3FPAA 121PA 3CF2A 3BB3A 4IDNA 4XD7A 1US8A 3O8RA 5KO2A 1AGRA 2HCBA 1FMJA 2PLRA 3W90A 2AFIE 3TVTA 1Q3HA 1W0JD 2O0JA 3ADCA 2SHKA 1COWD 2P5TB 2KE5A 4KAXA 3QJYA 3KQHA 4WA7A 2P0EA 3DVLA 1Z0FA 4YMSA 4ON9A 1DG1G 5B2ZA 5FPTA 5JCPA 3K0AB 1Q57A 1VYVA 1WA5A 2CJWB 2MMGA 4OL0A 3AKDA 2ZRPA 3JZMA 4E22A 1LY1A 3I92A 2ZR0A 5AR1A 2AK3A 3MJHA 3TW8B 1NG9A 4GZLA 3T35A 1IN8A 1SVLA 3AV0B 5JS7A 4TMKA 1II8A 1KMHA 3KZ1E 4JMPA 1VCIA 2HLDD 4M1YA 1S1CA 2RKOA 2GBLC 2H8KA 1XEWY 4LZZA 4TN1A 5KSYA 3RRZA 4DZZA 2DY1A 1CF4A 2ZI3A 3PFIA 2XITA 1MOZA 4PQRA 2F9LA 4RZ2A 3SYKA 3EW9A 1P62B 5KPDA 1AKEA 4B32A 1G17A 4URXR 4NMMA 4ILEA 4ZV4A 3IDQA 1AM4D 2XTMA 1KJZA 3O47A 4MQBA 2P65A 4WXRA 4QL3A 4C4PA 4LWZA 3QOFA 1KK3A 3V4FA 5A5GA 3OZXA 3QBVA 1ZM3A 1L2TA 3IBYA 1TEVA 1CEEA 4U00A 4FWTA 5J4KA 1YZTA 1R10A 2BMFA 3WP0A 2VF8A 1R6BX 4XVQA 1ZD1A 4RKFA 4POAA 4MH0R 3X1XA 4B43A 4YMUA 5M04A 2VRWA 2C5LA 1AIPA 3B13B 2O8DA 1FP6A 2AWOA 1OHHD 2FJUA 4TTRA 2QU8A 4BFWA 2J1LA 4CDGA 2QSYA 3E70C 2QMOA 2ZXUA 1BH2A 5EP4A 4RZ3A 1J2JA 4OHZA 4P4SB 2CL7X 4O3MA 3W5JA 2IYSA 4LSGA 3GFPA 4L15A 2N42A 1DS6A 3WHLA 3SQWA 3N5CA 2ZEJA 3RSLA 1WF3A 1CR1A 3P27A 4TQUS 5P21A 3GEEA 3ZJYA 1GILA 4DLXA 2NO1A 2D7CA 1T3SA 3SU8A 4Y0AA 3R7WA 4PO1A 4TLCA 2WV9A 3LV8A 1OLOA 2VP9A 4D4KA 2WWHA 2BJWA 2V7QD 1A1VA 5BN3A 2W6JA 4HLQB 1IAQA 1N5LA 4UJ3A 3TMKA 5F3WB 3UIEA 2IYRA 1X8JA 4AURA 3RWOA 2IYYA 3BK7A 4YQFA 3IPXA 4KFSA 2R6DA 4JLPA 3ZVRA 3U7HB 5JFGA 5J5CA 1KI8A 2CVFA 4FMCF 1XNJA 2W2TA 3NVAA 4RFVA 2L0XA 3O8CA 1W4BA 3CF0A 3X1YA 3UANA 4IOMA 4JLMA 3K0FB 4LC1A 4IEEA 3JVUA 4C0KA 2PH1A 2AK2A 3LWNA 2C03A 1XMJA 3SI7A 1OYWA 2OUKA 3GLIA 2CHQA 4L5BA 1XJ0A 1E9EA 3KB1A 3QKSA 3UPUA 3VAAA 3AVVA 3GJ3A 4IW3B 4M4SA 4QBFA 5C1BA 3HU1A 5FUVA 1G4UR 5CB6A 3K0SA 2JLWA 2GJKA 3ICEA 1RJ9A 3HWSA 4GBMA 1YQTA 2QZ4A 2YINC 2IHYA 1XCGB 4M9QA 3KQNA 4GOJA 521PA 4DLSA 4PHFA 2ZPTX 1F5NA 1N2CE 2DPXA 4LV8B 3VFDA 3VR3A 2EFDB 4Q03A 3BBPA 2ODBA 1KO7A 2OM2A 4DIEA 2GF9A 4EJSC 3WMGA 2EYUA 2G3YA 4DCTA 4JYBA 4LBWA 1LTQA 4B73A 2NGRA 2H16A 4Q19A 3Q7PA 2YV5A 3TK1A 2H17A 2G1KA 3JZAA 5TARA 2FFQA 2DBYA 4Q4JA 1XPRA 2WVJA 3AVUA 1G3IA 1RRPA 2NIPA 1XCMA 2J0UB 2AX4A 2HT1A 4EFNA 4KO8A 2G9NA 2YWHA 5JRZA 5TMPA 4TMVA 3FMFA 2ORVA 3REFA 4D0NA 3CWZA 1ZNXA 1UKYA 1ZU4A 3HR7A 4JT2A 1KO1A 4XVUA 2BM1A 2QL6A 2DCUA 4TQAA 2IYVA 4N3NA 1HE8B 1JPNA 4OQXA 5E95A 5L8VA 1KMQA 3ICQB 3ZZUA 1XEXB 2X19A 3BORA 3BXZA 1G5PA 2JJ8A 1K5DA 1SKYE 3I72A 3RNLA 4AYTA 3EASA 4B3XA 4KI0A 1H8HD 3GLHA 1XXHB 3H1TA 2XZLA 2XZOA 3LFUA 1NKTA 3WBKA 4CZ2A 1G3RA 4TLBA 4XIGS 4Q21A 5JBQA 5B30A 5JLJA 3IIMA 4XOIA 3AVQA 4OI4A 2OCAA 2ZE7A 4OQMA 5DI9A 1XD2A 2GXSA 1Z2CA 4Q1FA 2QBYB 4XH9B 1Y63A 4DLZA 4DUGA 4QHTA 1QHNA 4DLRA 4DJTA 1NLZA 1Z2AA 1FUUA 1E99A 2QPOA 5C2JB 1ZAKA 1GZSA 1E1RA 1N3BA 5DH9A 1E2HA 1MRSA 3J81k 4AKHA 1NLFA 1U0LA 1SHKA 2Z4SA 1EFRA 2KBEA 1OJLA 1EGAA 3AF0A 3NBXX 3TVDA 1OIXA 1KI9A 1YRAA 1WQ1R 5LD2B 2IX3A 1UADA 3ZIAA 2Q0HA 4LBVA 1Z07A 2QA5A 2WMNB 3Q72A 5DISB 1F3OA 3LQRA 2PMKA 2OXRA 2FH5B 3EIHA 4Q1BA 3SNHA 3NWJA 1XF9A 2IYWA 2RGGA 4B44A 2ZRKA 3PEYA 3CF6R 1W4CA 1S3SA 2GCOA 3CR8A 5CIWA 4JBWA 4B47A 1JECA 1E6CA 1G7RA 5G40A 1KO8A 1NF3A 3MLEA 3SHFA 4QNRA 3NTUA 2D3WA 2WKRA 3PQCA 5AJVB 1G18A 1OF1A 3ZZTA 2V1XA 4M2LA 5C4GB 3U44B 1NMYA 2BEKA 2IS1A 2WBLC 2REXB 1Y3AA 1KSFX 3PXGA 1GRRA 1XJQA 2WJYA 4KJZA 3RS4A 1DEKA 3WYGA 2YYZA 1LV7A 4NH0A 1NKSA 4JSTA 4DEYA 3Q9LA 4LHVA 4QGGA 2WICA 5IK2D 3R8CA 2OHFA 4LJ7A 2JLXA 3ETLA 3UMFA 2GEVA 1P9WA 1EK0A 4FCVA 1E9AA 4JLVA 3QENA 4E07A 1HT2E 2QSZA 1TF2A 3KFVA 4R98A 1IBRA 4IVRA 4ZKEA 3GEHA 3S1AA 1JR3D 2EQBA 2ZJOA 3OHMA 2O8BB 1YZLA 2EFCB 3SZRA 4PXAA 3SJAA 1XTKA 2FPKA 1ZVQA 1TQDA 221PA 4V0ME 4EAQA 3IUYA 4TL8A 3EX7C 2UZIR 2GXQA 1CLUA 1YZQA 3SBEA 5F9HA 2O8EA 3B85A 3I73A 4A2PA 3CPEA 1Q22A 4NKRA 5CITA 1U81A 1KI3A 1WB9A 2ERXA 4B2LA 1MO6A 1XMSA 3OEHD 4EJSA 1XWIA 2ANCA 3B1ZA 4FMCB 2FEMA 2CCJA 1ZBDA 4DHEA 2BDTA 4JVLA 1RYFA 3BFKA 3TR0A 3DL0A 4S2EA 3PV0A 1E2JA 4Z8XA 1ZUNB 3R9IA 3K9HA 1R8QA 4O0MA 1DAMA 4HDQB 1GG2A 3AVYA 2OXCA 4OHXA 1TF5A 1NN3A 3QPWA 4Q18A 3GJ8A 1DAGA 4M9XA 1TNDA 4OQLA 5JSZB 1VMAA 1KI7A 1XX6A 2NG1A 2YC4C 3I8XA 3T15A 2P5SA 4LJ5A 4Q9JA 1KDTA 3MSXA 1KJWA 5G53C 1P9RA 1G8FA 2ZJ2A 3NHBA 1FQJA 2VBCA 1W0KD 1XTJA 4BEBA 5SZKB 4IDHA 5HE8A 4PC1A 4JKIA 3QSYA 3QKUA 2CNWD 5AJXA 4MRVA 5EZ6B 1K8RA 2ZRGA 1GFIA 3PITA 2FFHA 4XSHA 2WIBA 3OE7D 4RKEA 5FI0B 3X1ZA 2OT3B 4CT5A 2QE7D 1E9FA 4MKIA 3R9XA 1E3MA 1Z28A 5BN5A 2IK8A 2V4ZA 1ZUHA 3PENA 3IO3A 2XTZA 3ZD6A 1E79A 3GLFA 2V6JA 2PJRA 5AUOB 2O8CB 3RVBA 2ZQ5A 5KOYA 2D2FA 2Z6VA 4Q48A 1FNMA 4IFBA 1KTVA 1M7GA 4HI0E 2WWGA 4E09A 2ZJYA 3CRW1 3VNVA 4XJXA 4QGFA 4RJLA 4CEJA 4RD0A 3TAHA 3EZ2A 4A8JB 4JVNA 1SHZA 3B5JA 4V0KA 3ZS8A 5CDFE 4Z54A 4C7OB 3G82C 3AP1A 4KV9A 2VO1A 2BJVA 3B9QA 2VL7A 1Z0KA 3NEYA 2CHGA 3W6OA 4A15A 1AJEA 2QPAA 2HT6A 2XB4A 3ZQJA 3KKNA 421PA 1X8LA 1AQUA 3ND8A 3CM0A 1KDOA 1E98A 5FTKA 1UEJA 2J7PD 4I1SA 4W5HA 5G41A 1IXSB 5FL7D 1P2UA 3VR6A 1JR6A 1LFDB 3BAFA 3HDTA 4LYAA 4QJ4A 4RZUA 1OXVA 3U6BA 1G7TA 3LH5A 3PVSA 4Q1AA 3K70B 1U94A 2F6RA 3ECCA 2BM0A 3T61A 4V0OA 4BFTA 4KVAA 3FKSA 5J4YA 4HLUC 2OLKA 4NU0A 4IXMA 2GZHA 1GM5A 1I2DA 4O2RA 5EUMA 1M8PA 2WMOB 4LK2A 1CJUC 2V6IA 1UPTA 1SQ5A 3UWKA 4BZPA 2OFOA 1JAIA 1CULC 1JEDA 3U3RA 2UVQA 3DPUA 1R2QA 1MRNA 2BC9A 5FBVB 5JWOA 1T9HA 3LDAA 2QY9A 3SFZA 5KNCA 3PJRA 1CR4A 1US8B 3MCAA 4G5GA 3UG6A 4E03A 2V1UA 3KB2A 1KDPA 4HYYA 4L9SA 4NDZA 4BASA 4HB0A 3CB4A 1VYTA 1CJVC 2DFLA 1CBUA 3B1XA 3D3QA 3EARA 5LB4A 4C0AC 1KO5A 5DNYB 3AVOA 2ZE8A 2LWIA 3WMFA 2KB0A 4K46A 5IHPA 1P2TA 1Q44A 1NBME 5SZJA 4AKGA 3W3AA 5SZIA 3VNUA 4US2R 1OXXK 1PV4A 4OQNA 2E1RA 2C99A 3CX6A 4FN5A 1II8B 1KMHB 2AKYA 3BGWA 4Y0VA 2KJQA 3CBQA 3SDZA 4CIDA 1E4VA 2PCJA 4RY2A 5FPYA 4PAOA 1ZUIA 3VHLB 2JAQA 2ODWA 3P26A 1A2KC 1G291 3K8YA 1JJ7A 1HY3A 4GOKA 2WSSD 2VQSA 3QXXA 2FPLA 4BPBA 4FWIB 4V03A 1OHHA 4NCJA 4P0TA 3B7GA 1G7CA 1XEWX 2JGNA 1W44A 3CNOA 4XWKA 3AM1A 4LBZA 4TMTA 1Q1QA 4PPFA 1E96A 2CBZA 5L3RA 2NO6A 1YVDA 1NIPA 4TZ0A 2B92A 4YLGA 6Q21A 2IWHA 1BOFA 2ZSAA 3ZD7A 2J5XA 2O52A 3TQCA 1ETUA 4A0GA 3CW2A 4CW7A 1NG1A 2O8DB 1G5TA 2WJJA 2IEYA 4FCWA 3IGFA 3KJHA 4TSFA 1CJTC 2DYKA 3VU9A 1R0ZA 5A0FA 2P2LA 3EZ7A 4F92B 3FVQA 1E2EA 3TRFA 3RHFA 3U3MA 2AHOA 5CK4A 2NTYC 3NBYC 1SVOA 2E9SA 4QM7A 3NKVA 5FPHA 2F43A 2KWIA 1HA3A 2W2VA 1II0A 2ZVQX 4DDWA 5JJIA 4BFYA 1AS2A 3RABA 4ZI3A 4JS0A 1RE0A 4LJ6A 3ZDQA 1VIYA 3R7WB 1GL7A 4TTPA 4X8HA 4F4IA 3I8SA 1E0SA 4U5XA 3X2SA 3WYFA 1VG1A 5JHGB 3HPQA 2XNSA 3ONWA 4QHYA 3AVXA 3EC2A 3AEZA 4TYNA 3MAAC 1N0UA 1QHXA 2ZRCA 2N46A 3IEVA 5FUYA 2XZPA 1Z63A 4UKDA 3X1WA 2QQ0A 3AF1A 4CF7A 2F3RA 2JEOA 2JJ1D 4NTZA 5KTYA 2C9YA 5H1YA 1ZNZA 1S96A 3WBJA 4MGZR 2IEZA 2ZJZA 5DN6A 4BLQA 2B6HA 2JLYA 1H8EA 1HT1E 1YZKA 3MWJA 3GLIB 4BEJA 3ZVMA 3GFOA 2W6ID 3QKSB 1P2VA 2CEAA 1FFHA 2NOAA 3W8RA 1EX7A 1TQ4A 2CDNA 5CM9C 1KSHA 3AF2A 3SYNA 2D74A 4AI6A 2BCGY 3L8YA 4HLUA 2C04A 1DAIA 1RJ9B 3NIBA 1MKYA 4PQFA 5EXSA 3DHWC 4EFLA 1Q1BA 1VPLA 4OHWA 1UAAA 5EXPA 3ASYA 1T8TA 4Q7MB 1NN1A 1E0AA 1ZIPA 3M1IA 1EG7A 3B1VA 3GQBA 1UDWA 1R0YA 4LHYA 1SKQA 1NVXQ 2FZ4A 4B76A 4QGAA 4UXJA 2OCYC 2VP0A 4FMDF 4JBYA 1P4SA 2C2HA 2D2EA 2ERYA 4RVCA 1XB2A 3FMPB 3CRRA 1XTRA 1GSIA 5IRCD 5HZHA 3VTKA 5ELXA 5CIQA 2FSGA 5SZHB 4S35A 1KI6A 3EPLA 1IQPA 2AWNA 1FNNA 2CMKA 3DM9B 4MGIR 4GMXA 1M7BA 1S2MA 2EFEB 4AC9A 2BOVA 1NJFA 2ZUDA 2XNDA 4AG5A 3ZS9A 2BBOA 1X8KA 2WZQA 3A1UA 4PHTA 4MDFA 1E9CA 3H0KA 5HPYB 5K8IA 1B23P 4FI3C 1Z0AA 1VCMA 3BC1A 3GLHB 3QBTA 1ANKA 1EWRA 3KKMA 4IDQA 3WRYC 3LX8A 2ZSEA 4PO8A 2C9OA 3N2EA 2EFGA 3T5GA 1G3MA 1OH6A 5JJKA 1XD9A 1BS1A 2C8VA 5EE9A 1XD2B 1EFTA 4TLAA 1PVOA 1Q21A 1XCPA 4RZXA 1YR7A 2ZJBA 2GJ8A 3RSOA 2HV8A 3GJ7A 2CE2X 4HAUA 4X8LA 2ZREA 4E5UA 2O8FA 2PEYA 2RB4A 3U61B 2BBWA 3Q85A 4FD2A 3SJBA 3VKHA 3IKJA 3SEAA 1TADA 1QVAA 5C4MA 1L4UA 1IN4A 1U99A 2YOFA 2R6GA 1O3YA 1MV5A 1TL7C 2GZDA 4M8NE 3UKDA 4KBGA 3LLUA 3P4YA 4NCNA 4U02A 1CR0A 5EP2A 2VSFA 3LVQE 4PANA 3RS2A 4L8GA 1ELOA 3U7FB 1Z3IX 4AWXA 4JZKA 5HKKA 3GJ5A 2WAYA 3IHWA 3QG5A 1NY6A 2YC2C 1E2MA 3KKPA 4M53A 3FMIA 1W5SA 1QG4A 3PUYA 1U98A 3ZH9B 3BH0A 2GCOB 2P6UA 1SXJD 3GP8A 3L8ZA 2QAJA 3H86A 1DAHA 4KXFB 3IHLA 1E2QA 1UKZA 1H65A 3LLMA 1XZPA 1ZNWA 2WKQA 4JJZA 1G3QA 4LYJA 3LW8A 4BLPA 1QHSA 1DELA 5KHOC 1ESNA 5IT5A 1UEIA 4ITRC 4HDCA 2RGAA 2BWJA 2QG6A 1UDXA 1Q3TA 4ACBA 1X86B 1UBEA 2H92A 3EPJA 1ZMXA 1QHYA 1FL9A 2ZSFA 3AUYA 1BMFD 2ZYVX 2GTPA 2XAUA 3EWAA 5FR1A 3I1FA 1VYUA 4EUNA 2W2XA 3PCRB 3CRVA 2HYIC 4Q1DA 1XMVA 2GEUA 2VPPA 2JA1A 2PLFA 4NYIR 4A9AA 3RDPA 4EPXA 1GIAA 4MUBA 1D5CA 1E2IA 2NZ8A 1RKBA 3QXSA 3THYA 1JQLB 2LKDA 3S1AB 3RLFA 3WY9A 3GLGE 2EWVA 3FHOA 3PUZA 4G0NA 4RCYA 4Q9IA 4QHSA 1XMIA 4UQOA 2JDID 3EIEA 5BQ5A 1XTIA 4PC3A 4NPHA 1GITA 1MH1A 3K0EA 4KYUA 2O8EB 3FFAA 5EJEA 3E1SA 3IIKA 2X1VA 4LHXA 4OK5A 2UKDA 5D3MA 4OBEA 4DSTA 2DWQA 4ABYA 4NHOA 4QRHA 4GT1A 4OK6A 3DKVA 3HR8A 2HYDA 1N6PA 3E2IA 3AUXA 4OI1A 5EP3A 3DDCA 1IONA 1OSNA 2RCNA 3SJCA 3MUFA 2LCFA 3LNCA 3UMSA 4EJSB 2WPDD 3KXIA 3I5YA 4YDSA 2XB2A 3UK6A 4V0MA 1EWQA 2NO0A 2FZLA 2KBFA 4MYTA 3AP2A 3LX5A 4BGDA 4QBIA 3SC3A 5FBQB 3Q7QA 3VX3A 4D80A 2ZUCA 4D82A 3QXHA 5GVRA 1Q1ZA 4JBXA 4LJ8A 1AQYA 3A36A 3CWQA 4FCTA 4D4MA 5FBLB 2JLQA 4A0HA 3TIFA 2WWWA 1EESA 5EE0A 4DLWA 4LGMA 3QY0A 4GPTA 3SBDA 3MWKA 5A4JA 1AGPA 2IF2A 2IUUA 2FGKA 3MWYW 2RGNC 5GJVC 3C15C 2BMJA 5EXXA 4TMXA 3GD7A 2IUTA 1NSTA 5LB2A 3EAQA 4MKGA 2PCLA 4LHZA 1E1QA 3BB1A 3CZQA 4PFSA 1DG3A 1CP2A 2EW1A 3OEED 4IEIA 3UG7A 3SOPA 4IVPA 4YXWA 3VKWA 3GLFB 2FF7A 1TEXA 1IY0A 3F0TA 3FTQA 4GRAA 3CH4B 1VIAA 1W5TA 5HE9A 1JXOA 1ZD9A 1HH4A 3LXRA 1TQ2A 3TW4A 4CEJB 2A9KA 2ZJ5A 3EZ6A 1DPFA 5FL7A 3HYRA 2ZRDA 1WP9A 3DZ8A 3EPHA 5EE5B 4NYMQ 1N6KA 2QORA 2QN6A 3GPLA 1FX0A 1Z6YA 2VHQA 3FFBA 4A82A 2VHJA 1FP7A 1W4AA 2GBLA 3WNDA 2FOLA 2VIIA 3FWYA 4PPGA 5KSPA 3RC8A 2B8TA 4J0QA 4CGZA 4TT3D 2CXXA 4CVNA 2DWOA 2FNAA 1J8MF 1EFHA 4AYXA 2NO7A 2VSOA 4B2IA 4QFMA 2IA5A 1KDRA 1R7RA 4PC6A 4XTRA 4KSCA 4DSNA 3CNLA 3V9PA 4L16A 5CDFA 821PA 5FPKA 2ZR7A 1G8HA 4AY2A 1JPJA 1KYIA 4TMZA 2FFBA 2OE2A 3QQ5A 4MRSA 5LDDC 3QVVA 3NXSA 2YJTD 3DMNA 3K70D 3F5FA 3SE0A 4LYFA 5HR5A 2MMCA 3LO5A 1X1RA 4YMTA 2J3EA 2WWIA 4DSUA 4F91B 1A5TA 3RRNA 2ZU6A 3FMOB 1OV4A 2W0SA 1I4DD 4IHQA 3QG1A 5JJLA 2JIZA 3N2IA 4MRPA 3MMPA 1JR3E 1XD8A 1RIFA 4XD7D 3VX4A 2DB3A 5DHFA 1XPUA 1CKEA 4UXIA 1KI4A 2P67A 1S9DA 1U90A 2ZI9A 3AF3A 1NLYA 2PL3A 1CIPA 4BZXA 4HUQA 1KY2A 1KSJA 1W47A 1CU1A 4ZDIA 4UNNA 3TUZC 3WNBA 4M1MA 4OK3A 1J8YF 3B8HA 1NY5A 2WIAA 5GJWC 2IF0A 4LC0A 5CK5A 3EWSA 5D3QA 5CYPA 1A4RA 1U0HC 1DE0A 4MYHA 4A0FA 1F2UA 2QNRA 2VYFA 3UXMA 5IDVA 1QHIA 2GESA 5E7IA 3H2YA 4EIWA 4IRUB 4KYIB 4LCBA 4DVGA 2PZFA 4ZCMA 1OFHA 1F2TB 1XZQA 3T06B 3CZPA 1QHHA 3KJIA 2NPFA 1SVMA 5KSZA 3M4YA 3MG9A 4D4LA 1XP8A 2ZROA 1NBMA 2R6AA 4I1OA 1FZQA 3B9PA 3VMFA 1T5LA 2FA9A 1RW4A 3DOEA 1DVRA 5L3SB 3ADKA 3D6TB 1VCNA 2OFWA 3NBFA 4R2HA 2BV3A 4FMBB 4UNPA 2Z4RA 2YNMA 4PZYA 2GETA 4L4UA 4A92A 3K9NA 1E2KA 1QDEA 4PO9A 1ZU5A 5DE3A 5F2EA 2V8OA 5H68A 3T1OA 5EXTA 2REOA 3IPYA 5KYKA 3ZZ0A 1TX4B 1KK0A 4LJ9A 1OKKA 1GKYA 1WE2A 1UJ2A 2QTHA 1HQCA 1UBGA 3C4JA 4C0SA 1SXJC 3QPUA 2G77B 4JLAA 4RFSA 1FOEB 1YU9A 1NNEA 5H8WA 2RGNA 2C77A 2OEPA 4C2UA 4EDHA 2GXAA 2OBNA 4D0GA 3CRQA 1S4QA 2DFKB 2P3SA 3FYHA 4JL5A 1W36D 2FV8A 3U2QA 3VU9B 4D0LB 2F1RA 4EQ6A 5JWRA 1Z06A 2GVDC 2ECKA 2F9MA 1Q12A 3F3YA 5AK0A 4ZDWA 1LS1A 5E7MA 4JVSB 2W00A 2OV2A 4ESHA 1U8YA 3THXA 2F43B 3DEFA 3C16C 2FMXA 2GRJA 3OFNA 5J40A 1M1YE 3BFXA 4WVFA 3THWA 3B6EA 4LJ4A 4TTQA 1VKJA 1JAHA 2JLSA 5JS8A 3P20A 1CXZA 4EFMA 2ZITA 2FFAA 4A2QA 1D9ZA 1KI1A 2ZRIA 3A1TA 5TY0A 3RS7A 1G16A 1VTKA 3CUEF 4O2LA 3TUJC 5BW8A 4M22A 4Z1MA 2OESA 2W6JD 1OB5A 1KZGB 4KSBA 1E0KA 2QMEA 3SYLA 3I4LA 1E4YA 4RD4A 4US0R 3R8FA 4NL4H 4Q9KA 1GRNA 2ZU0C 2JJ2A 1BIFA 4WBSA 721PA 3LVRE 2J0QA 4KVGA 2NMVA 2BMDA 4QKQA 3B82A 2Q6TA 4HUTA 2W58A 1RC8A 1N0WA 3KJEA 3AKEA 1HQYE 1WXQA 2B8WA 3CX7A 2WAXA 2VF7A 4LJYA 2PX3A 4P4TA 2CVHA 4EPVA 4NBSA 2VHUA 1T6NA 3OAAA 2XSZA 1TMKA 3PG5A 3KQUA 4BRUA 2QMUA 1MT0A 1EFCA 4DDTA 2OBMA 2OG2A 4AKEA 5B58C 1IY1A 1L7VC 3BERA 4Q02A 2GVZC 4DCNA 2GA8A 3L0IB 3KQLA 2QM8A 2QAGC 2W0MA 3UMRA 3HYTA 4IVQA 2IXFA 1UBCA 4MGYR 2NQ2C 3KUCA 3FDIA 5FPSA 2Z5FA 2ZM5A 4YC7A 3C14C 4DWJA 5EE1A 1P7CA 4GNKA 4PX9A 2WHXA 1IM2A 4ASUA 1IXRC 1TPZA 1BYUA 2IYQA 4QNMA 3VR4A 3IBGA 3DM5A 4W5WA 5CYOA 4D26A 1U8ZA 3W3ZB 4JLJA 1GVNB 3RRMA 1Z6GA 1V43A 1JBKA 1KI6B 5FTNA 1W0JA 1Z6AA 1F48A 1COWA 5J4VA 1KGDA 3BB4A 1M74A 1YZNA 4PSAA 1SULA 3W6NA 4F4JA 1LNZA 2Q9BA 2XX3A 3K9LA 2OILA 2Q3HA 2HCJB 4DLYA 1KY3A 1SVIA 1I2MA 2CL6X 2PT5A 3X1DA 4BLSA 4D2IA 2DFNA 4Q4LA 2A5YB 3MD0A 2AKAB 4MYUA 4PTLA 3KUDA 5JEEA 4FIDA 4B3CA 5FH9A 4AD8A 3K0CC 2XGJA 4NE2A 3ZVLA 1ZM9A 1OFUX 2HLDA 4MKFA 1WDTA 2GCPA 2ONKA 4B35A 3TH5A 3T34A 4N0DA 1SVWA 2H57A 1E2GA 3A58B 8OHMA 4CEHA 4D4JA 5DHAA 3H4MA 5BXQC 4NONA 3D7MA 5KUTA 2O8FB 3U5ZB 2GNOA 4DUGD 4C0JA 1FUKA 1SKYB 2GJAA 1HUQA 3BE4A 3ND9A 5G3ZA 5DSZA 1R5NA 4URUR 1E1RD 1R5BA 3GMTA 4G5OA 4MRNA 3ZLJA 2EYQA 1SXJA 1RFLA 2NPIA 2ZR9A 3GEIA 3PEVA 3B60A 4CEIA 2HF8A 1LF0A 1EFRD 3SS8A 4BFSA 3T12A 1F2TA 1G19A 2OAQ1 1E9SA 5CLLA 2PZGA 3V4RA 2C98A 3A1VA 1T3HA 1AKYA 2PMDA 3WMEA 1E94E 3I32A 2GXUA 2R44A 4URVR 3FOZA 1XTQA 2QMHA 4ZIRA 1C9KA 1NP6A 3QF7A 2IL1A 4NCIA 1F60A 2BKUA 2V54A 2BEJA 1P75A 3WYAA 4Q4HA 3A4MA 4P33A 4D81A 2IXGA 2V9PA 2X8AA 1N6IA 1OT3A 1HYQA 3FHCB 5FBWB 5AJYA 5KSOA 5FL3A 3D31A 4JKYA 5DYIA 1GNPA 2XXAB 1T0JB 2IC5A 1Z5ZA 4I1UA 2QP3A 1WCV1 1LS6A 5E4FA 1NSFA 2IYZA 4PAMA 2IYTA 1YR9A 1G21E 2V7QA 4M9SA 3I62A 2QP9X 3T1TA 4PHHA 4TQ9A 1BKDR 2DR3A 4DDUA 1N6OA 3QF4A 2AXPA 1W7AA 4Q5IA 3FHTA 4M0LA 4TL9A 3NH9A 2AR7A 1XFAA 2C9CA 2ZRBA 4A0RA 4GOXA 4JT4A 4GP7A 1U2RA 3THYB 1M6NA 4EKDA 4IOJA 4MGKR 2J0SA 3QE0A 1GNQA 3U6KA 4C2TA 1A2BA 2BHRA 2R62A 2J45A 2WJIA 1SVKA 3A1SA 4C0LA 1VG9B 4BLRA 2GZAA 2OCPA 4HAYA 2JASA 1BYIA 2IWRA 1Z08A 4H9GA 2BMEA 2G88A 5D3MB 2QAGA 1OXSC 5GJBA 1G1MA 2ZI5A 5FOXA 3EXAA 3M6AA 2RGBA 3OIYA 4BLOA 2ATVA 2I1QA 2EVWX 2IW3A 1HURA 1KKMA 3NEJA 4PZZA 4UNQA 3GLGA 4B6EA 2VP5A 4PPQA 1YZUA 5KNBA 3U60B 1OFTA 3I3SR 3SR0A 2ZRHA 3W8NA 4BRWA 2VHCA 1HV8A 2ODNA 3CPJB 1KNQA 1GWNA 3VHXA 1TTTA 4W9MC 1T8UA 3CONA 1CJKC 5BYJA 4GDFA 1K5GA 5DYGA 1W36C 4B75A 1ZC4A 4WXPA 2ATXA 4IDOA 4WIAA 3T1QA 4P32A 1GUAA 3IQWA 4HZUA 1J90A 3W5IA 2DFTA 5C18A 3QI2A 4B3BA 5GJCA 2YZ2A 4BUJA 3ADBA 4M21A 5J4LA 1U9IC 2YVUA 4EPRA 4DBLC 1XDBA 3NHAA 1VECA 5B57C 1XXHE 4M9ZA 3MRSA 1KK1A 1T91A 2RGCA 4ARZA 2A3RA 4A2WA 2A5GA 3KXKA 4DDVA 3K0CA 2H7VA 3ZQ6A 4HB3A 2AFHE 3HU2A 3AVTA 2ZS7A 4MA4A 4LUCA 3OIVA 2YWEA 1P3JA 1H8HA 1MABA 1QZXA 1E79D 1CS4C 1W48A 2IYLD 3TGPA 4NYJQ 1Z0JA 1ZD8A 4XSGA 1E0JA 2QT0A 3DKPA 4BFUA 2A5DA 3QPVA 4XWAA 5BYKA 4P3YA 1FX0B 2D06A 1TUIA 3KJGA 4HB2A 4URYR 4OI2A 1PUJA 2GK7A 1TF7A 2FSIA 4JLNA 1UF9A 3DMDA 1OE0A 1ZIOA 1ZM7A 1SXJE 1RZ3A 4N1AA 4TYQA 4M1OA 4QBHA 5DO9A 4Q66C 4ERNA 1NVVQ 1N5IA 3BWDD 5CLQA 4BE7B 4HLDA 1ZYUA 2XJ4A 2QGZA 4MRRA 4D25A 3QKRA 2K5UA 3FKQA 1E69A 1GRQA 3KX2A 2WM9B 2RHDA 1P73A 4FXPA 4QC2A 4DXAA 2ZRAA 2BBTA 2V55B 5L3SA 1T0HB 4A6PA 4LV6A 3L0SA 4XWOA 2QT1A 3FKSD 2QEQA 1D8TA 1Z29A 3TE6A 4QJ5A 2YOHA 4AIIA 2ZS9A 4I99A 5GADl 2C95A 3U3OA 1N6NA 3GFTA 5HCIA 2WJHA 2RMKA 1KO4A 4DSOA 2EFHB 4GMDA 4R2IA 2WSMA 2V3CC 1UM8A 1N6LA 1FTSA 2ZVPX 1Q1EA 2GWHA 4MYCA 1F6BA 2J7KA 1QF9A 3ASZA 2CHVA 4HUQB 4X8OA 5FR2A 1RPZA 2GEDA 5IK2A 2J46A 4B71A 2E87A 4V0NA 2JATA 1XRJA 4QXAA 2CK3D 2FSFA 4AYWA 3VKGA 2NZJA 4DT1A 4ZKDA 5JRJA 2Z0MA 2GAOA 2XXAA 3AQ4A 1JR3A 4GFDA 1R8SA 1VG0B 2R8RA 4HAWA 2AL7A 5TV2A 3SQXA 1LVGA 1SVSA 4PC7A 1F2UB 1G5RA 1G8YA 3LRPA 5AJWA 2R6FA 3OIUA 4ZI2A 1O87A 4QBGB 4DCVA 3I5XA 2IS4A 1YR6A 2VP4A 5FOUA 1JEEA 3C8UA 1YHNA 4EPWA 1II9A 2F1HA 3KTAA 1LF5A 4II7A 2Q9CA 2RGXA 1L4YA 2DHRA 4OQFA 1QHHB 1MO3A 1L8QA 1P6XA 1FTNA 3NDPA 4HZIA 4KFTA 3TBKA 4RCZA 5E3HA 1NN0A 3N70A 2H1LA 5B64A 2ZS8A 1QHGA 1IN7A 1T4GA 2Y8EA 3NC0C 4OKSA 1W46A 2QRZA 3OEHA 5FUXA 1RRGA 3A8TA 1P72A 3SJZA 4PPNA 3ZGXA 4TYPA 1LB1B 1DOAA 2GK6A 3QEOA 5FOWA 1E9RA 2HJVA 2R9VA 1T5IA 4KCGA 1S3GA 1ZM2A 3LD9A 3L0OA 4DEXA 1D2NA 1U9IA 1ZJ6A 1VHTA 1DAEA 5AUQA 4BFVA 2BBSA 5FTLA 2RHMA 2CE7A 3A4NA 4RFSB 4F4CA 5F9FA 1NVUQ 3U4QA 4LOAA 5L3QA 1Z47A 2HJGA 5H70A 4EQ6B 2O0HA 2GILA 1KNXA 2GKSA 1DAFA 1W0KA 1OH5A 4TSFD 5DIFA 4F38A 4NYMR 2PX0A 3KQKA 2QI9C 1XJCA 1GOTA 1SZPA 2CNWA 3THXB 4R7ZA 4I81A 1W49A 3BD9A 4Q9HA 3Q5EA 4DLVA 1AZTA 2VSXA 3BH7A 1KZ7B 3OE7A 4RD2A 3TKLA 1S1MA 2CCKA 2QE7A 3Q3JB 5HTKA 2WTUA 3THWB 3TJZA 1PJRA 4W5JA 3EA0A 4AK9A 3U3KA 4ZDKA 2OCBA 4TLDA 4K81B 1E2LA 2F1JA 2ZANA 4B2PA 3UWOA 4G5RA 5AUNB 5FOVA 4TL6A 3VR1A 2VTKA 2UZ3A 2WJVA 1Z0IA 4OHYA 1GP2A 4WZBE 2REBA 4FMDB 4Q4AA 1IY2A 2J0VA 5EUQB 4YONB 5EE3A 4LV5B 2QTFA 2CL0X 3AKCA 4NYIQ 3CIOA 5BN4A 5TDHA 1QG2A 1Q0UA 3BH6A 3WP1B 2QUZA 1J70A 5DN6D 4QOSA 3WXMA 1H8ED 3EZFA 2J7PA 4JLOA 5FBRB 1TAGA 2C78A 1XPOA 2XOKD 2D7DA 2I1VB 5FOTA 3P32A 2A2ZA
chains in the Genus database with same CATH superfamily
1G55A 3E6AA 5IF9A 1V9SA 4ER3A 3RC9A 4CUKA 3LIPA 3DW1X 4GDMA 3M1YA 1EJ2A 2Q4EA 3SBXA 4B3GA 4GKKB 4CMEA 1CQIB 2CUTA 5DI3A 3WFIA 3HL4A 2O48X 4IJKA 4M8SA 3INRA 3GZNA 1S7CA 3OQNA 5EEHA 3LUHA 3KKKA 5EJ4A 4AKSA 4RPCA 1DKPA 1U8FO 1P0CA 5JDCA 2Q2OA 3GP5A 2GKOA 3HB9A 2YJGA 3RWMB 2CLMB 2HF9A 3TN7A 1WBDA 4I4LA 1P2SA 5E7JA 1VBKA 2IJGX 3R5FA 1XL1A 3DOJA 2P90A 1PQUA 4EOGA 1TKAA 4WFKA 1L7DA 1LVHA 3H5AA 4R2XA 3LQKA 4LSZA 1GG9A 4GUAA 1H22A 2IIVA 4I5FA 1Z88A 5IPFA 4UUMA 4UOQA 5KS2A 1FY2A 2VUTA 2YWGA 3LCMA 4F12A 1PJ8A 1ZEMA 4DNPA 4MITA 3SEZA 2NXEA 3PD1A 4DDKA 1U2DC 1XQ9A 2JJQA 4V02A 5TLSA 2YL2A 2PKEA 2AOWA 4D98A 2HQOA 3PE3A 1OGIA 2R4UA 3ONNA 3G1WA 5TPZD 4OAOA 4C3ZA 2X3YA 3ZD8A 2QLTA 1G20E 4X5OA 1F9EA 4IDPA 3WFZA 3X1MA 2IYXA 4M1KA 4HRYA 3IRVA 2XAAA 3T41A 1KETA 3M6IA 4HEJA 1W93A 3ER6A 5AVUA 5KNDA 4Z7NB 1ZVVA 3K0AA 1XN1A 2Y1KA 2DF8A 5CEJA 1QP0A 4BV3A 1COZA 5LQAA 4H7EA 2RBEA 5C5DA 3TQOA 2RGEA 5BSWA 3AKZA 3LVFO 1V45E 4CMCA 5AKYA 2QZPA 3KV1A 3V46A 4MDEA 1O9GA 2PO7A 4LI0A 2EWWA 1CIJA 4AKIA 5CFQA 1QFMA 1P1RA 3D0RA 2X8JB 4RIEA 2G1UA 2HJSA 3S2YA 1EYZA 1K2VN 1N5JA 2WIKA 4B34A 4F2HA 1LWOA 4B87A 3CLSD 3GHYA 4PLHA 1R00A 3TOSA 3VOAA 3W8DA 2RH8A 3IXQA 3DO6A 4TV8A 2AZDA 4GQBA 4C20A 3OZCA 4DB2A 1KSGA 4UBNA 4E2YA 1JVBA 2XNJA 1E5DA 3DOFA 2O0KA 4FHDA 5BSTA 2HR1A 2R6CA 2BUBA 1GDDA 2JAUA 2AC7A 3E3LA 3FNFA 1FTYA 1SPBS 3TRDA 2Y0DA 1L5VA 3O82A 1D2MA 4O4HF 1ODTC 3N3BC 5IXJA 2WUGA 3C1UA 4G8CA 5EIAA 6REQA 5KU1A 1W52X 2JANA 5C8DA 5CLFA 3S81A 1V41E 2FWNA 3ICCA 3M4ZA 5K3AA 4FKZA 2VPXA 4Y1GA 4BVJA 3EF1A 4MX8A 2A7XA 2QRLA 1XIVA 3B51X 3ZTYA 4Z7QB 2V5VA 4OM7A 3TLXA 1IH8A 4E33A 2WWYA 1XTSA 1QAOA 1G6HA 1RYMA 1VBMA 3I9MA 3DEZA 4MQ4A 4Q7KA 3PGA1 4YRMA 1PUIA 1UMDB 2PFGA 5HKKD 4XARA 1OLSB 1I7NA 2VWQA 4M0FA 4JROA 5JBNA 2J9RA 4FT4A 3V8RA 3UMYA 4Q47A 2DBRA 1Q20A 3RYTC 5IASA 2JLVA 1O9HA 1A8SA 2AMJA 4ZD6A 5JTTA 3EMKA 4DSZA 1GL6A 4Q4HB 1TC1A 2HU7A 1OX6A 3PYXA 3L82B 3OQOA 1DARA 3OSZA 3GFSA 3PNQA 1EK1A 4AULA 2XUZA 2D54A 3NEAA 1VFNA 3ZCTA 3D6NB 3B3AA 3MFYA 3F6RA 1H2RS 4GXQA 2D1SA 1ZCBA 1STOA 1N77A 3T3GA 1H9CA 3D3KA 1RR6A 1OI7A 4GL2A 1AZSC 2O4UX 4FDUA 5DOVA 2EL9A 1VDMA 2FP4A 1PJBA 4FINA 5EIFA 1U02A 1CR2A 3UM9A 4XFKA 3DL4A 2R65A 3R3UA 4RGBA 4PC2A 2BGLA 2O5VA 4MKRA 3K72B 4B7AA 3GRCA 3IO5A 7REQA 3W7AA 2BE7A 3KHUA 1PKXA 1AUOA 3EVZA 3GBSA 5K8UA 5DBIA 4PEVA 5EZYA 2P2ZA 2KSQA 4HNHA 3WO0A 3SM9A 1EHCA 1QIMA 3IOCA 4XQGA 4HFRA 4LPSA 1SUSA 5AKKA 1Y1LA 1YE8A 3ANNA 4DBVO 5J47A 1R6TA 3Q5GA 2WJ3A 4KBFA 1G2OA 2JJ1A 3ZKAA 1M3SA 2OD9A 3MBKA 2X9VA 2B8NA 1FNSA 2ZK7A 1J1IA 3K73O 2WUEA 3GJ6A 1RRCA 2RKWA 4UNSA 4MUJA 4PZDA 3V34A 1NXOA 4RDCA 1ZLXA 3IR6A 4MQ6A 3E9MA 8ADHA 3KU1A 4RSHA 5KTKA 4KNYA 1NKVA 4BXOB 1NW7A 1S9HA 2FG5A 2Y93A 1NF2A 2YYAA 1OIWA 4Q3NA 4B5KA 3CW8X 4XVCA 3F5DA 4EP1A 2G7MC 2CHFA 4FNOA 1VHDA 3I9V6 1ORHA 1JIUA 1CS0B 1Q50A 3GLGB 1P17A 4B6FA 2VNIA 3HB1A 5KVCA 3D43A 4WESB 4FFWA 4F7WA 1VSBA 3OCCA 3RJ9A 5C8VA 1V96A 1M34E 1M6VA 2WF9A 5CXUA 1IN5A 2PX4A 3AR5A 1J23A 1WCXA 2C2GA 3EJ6A 4NV1A 3UN1A 3SNKA 1NFQA 2CFTA 3KT8A 4FCCA 1P3Y1 1YO6A 3LECA 3PDIA 3LXXA 3ROFA 2X2FA 3HKEA 4TTSA 1NE2A 1QGOA 2TMDA 3G6WA 2JCXA 4HAXA 1XDWA 4R3WA 4TYWA 3E1KA 4F2GA 3F9IA 4JLBA 1WCYA 2ONYA 2YHIA 3CO5A 5EIBC 4HG2A 3OZUA 3JQAB 2WW8A 5CD1A 2W2NA 1OVMA 2NT3A 4HZUB 4FFVA 5EQTA 1FSSA 2NUPA 3TTUA 1ZK0A 4NRDA 2FRDC 3LGAA 1NRJB 2BF4A 4W7HA 3R5XA 3V00A 3WL6A 4FEGA 3OQ6A 2DT5A 3NH6A 4J2HA 3KZMA 4ARSA 4BQSA 4I1PA 3ET4A 4DJ5X 2ZJAA 1G9XA 5B1SA 1IG0A 1R6XA 2H1FA 3O2SB 4RK6A 1ZCJA 4URWR 4K8OA 2QMZA 3RAPR 3N07A 2ZUSA 3T3DA 3VPFA 3W34A 1MVLA 3U62A 4N12A 1PZNA 3PLRA 3V1UA 2XWPA 2YJNA 5ALMA 4CI9A 5KYWA 1FBNA 4PHGA 4BQIA 1E0AA 2PKRA 4L0CA 2G72A 4F3KA 4FFNA 3RS5A 5E0OA 3ZBQA 4E0BA 2MJLA 2N1BA 2Y9PB 1YC2A 3V1TC 1CF9A 1MABB 3O4IA 2CBGA 3C5HA 2QLFA 4Z8YA 5ALJA 2ZRNA 2NYVA 3HGMA 4E11A 3EC7A 5K2OA 2MYNA 4EYKA 1P4AA 2PLWA 4DIDA 4LXUA 5BR4A 5BOSB 3HN2A 5JNWA 1KQFA 4HS9A 3RYCA 1PD1A 4BNDA 1SBCA 4HAZA 1NMZA 1A9RA 1CY7A 2AFHA 1GPWB 2ZUBA 3PI7A 5L53A 4C08A 4A6XA 3DC2A 2ZYTX 1S8FA 3LPMA 3PSHA 1I2AA 2COKA 3NBQA 4BFZA 2Z43A 1X38A 3KIPA 2LD4A 2ZAMA 4A8JC 3RUAA 3LW7A 3F78A 2PWPA 1Z26A 2QG9A 1OLXA 4EG8A 2DLCX 1UJNA 2FPIB 4M9UA 4EVRA 1IBKB 4ZICA 4LF5B 1ONBA 4YBZA 1C7FA 1ZN9A 3QVOA 3EQ2A 1JI3A 5JCZA 1CRQA 1TT5A 4QGHA 4QWMA 2ZRLA 3GH3A 5F35A 3JASB 5JAMA 3B3GA 1R6UA 3WV4A 5CAEA 2CFRA 3HNPA 4IHJB 5AVTA 3IXMA 4IGEA 1YKSA 4CM9D 2FLVA 4QVKA 1GUZA 3G0OA 4LJAA 1EX6A 3HWWA 5L3SB 2I76A 1P1JA 2QRNA 4FYVA 1FC0A 4WGGA 4Z9BA 5DLQC 3AVWA 1A1SA 3ABRB 4XVRA 1D9XA 3PR1A 4WL0A 1MO4A 5HHTA 3DJFA 3S1LA 1K86A 4WZAE 4E13A 1V7PC 4Y9SA 1L5GB 3OTQA 2DFVA 2CJXA 4BX0A 1AQNA 5JMOA 3ZIAD 1BXGB 5BT9A 3I2YX 1Z8FA 4C4RA 2XMDA 5JROA 5L4NA 2H1WA 3BGVA 3D4PA 2G1AA 4GKBA 2WZDA 3NWBA 1NN5A 2HADA 1THTA 1OYYA 1K5PA 1NXTA 1E3JA 2A9VA 3GMSA 5IG2A 5J59A 3RVKA 3U81A 3OU6A 2WWXA 3MTDA 1HE4A 3SLRA 5KX5A 2AD5A 2FF5A 3MJVA 3LP8A 2CB0A 2FE4A 1TEHA 5TQVA 4A03A 4DWOA 1G20B 4F3TA 3WLOA 1OI2A 3H5IA 4RADA 1ARZA 3QLUA 2ZVJA 4IXWA 1E7QA 3DNMA 1CUIA 1GAJA 3ILXA 3ZJUA 3M6MD 1KFCB 1GNLA 4P8RA 2VATA 2H7YA 4HDMB 1LLUA 4RHYA 5LA6A 4NZPA 1GAQA 4DV7B 3I04A 3CR7A 5DEIA 4A6DA 3PE6A 3RS8A 3FG9A 1LBIA 3QVJA 5UKDA 1YZGA 3C7CB 3E03A 4TS3A 4UBMA 1UC4B 4P84A 5DBEX 3CZ9A 4EW6A 2CGEA 2IBSA 1MXHA 2QI9F 3NNDA 4C0HA 1CF4A 4YMVA 1M7HA 1L4EA 3DFFA 4NCHA 3EOBI 1C4WA 5DN9A 3W2GA 5G0VA 4JXZA 2OECA 3ETDA 3O0TA 1NBMD 3P4XA 4AWBA 1HOXA 1T2CA 1CG6A 3R6GA 4KEAA 4V3CA 4X1IA 1W36B 1VC2A 1R0XA 1Y7HA 2FU5C 4EEKA 4JJAA 1XAHA 2XNCA 1AOXA 1B0UA 1N6HA 1ZW6A 1UPCA 1JHZA 3HO6A 3GHHA 3T94A 4D9HA 2FN4A 1A8IA 2PFKA 2Z5LA 2G17A 2Z08A 3MTIA 2Q9AA 1RPTA 3O8QA 4EY7A 5JVDF 3ZY4A 1C9DB 1DNPA 3CEPB 5EMJA 2VI5A 4JX8A 3PPWA 4MARA 4PBTA 1IOVA 4BFXA 1LJUA 1QGED 4OBBA 4Y1RB 4Q00A 2VPIA 1GGNA 1N8SA 4NEQA 4AJ4A 4ZQBA 5JSZA 5AW9A 1VCHA 3JAKA 3NOQA 3RFVA 5KJFA 5KPJA 1FSZA 3I9OA 3ZWAA 1GNTA 2P5YA 5HFNA 1ITZA 3D8BA 4JLKA 4OI0A 1IG3A 3LBHA 1KYZA 2F3TA 1KR2A 1EEHA 4GP6A 1J0AA 3QGMA 1ZY2A 3R6LA 3GZTB 4UJ5A 2YWXA 4Z51A 1VDZA 3CTMA 3ED1A 5EWMB 4PSVA 1ZGAA 1M54A 2ZPUA 3CUVA 3CPHA 4ES6A 1QBKC 4F4FA 2VA8A 2UZ4A 3NTOA 1OFIA 4XYBA 1I51A 4IMIB 3K8ZA 2BIFA 1IULA 4G1UC 4ZEXA 4HL6A 1FDSA 3NNSA 1OWPA 3OFND 4AO8A 4EITA 2RAPA 3H5NA 4EG1A 2XTNA 2YXBA 3SZMA 2BGNA 4QPCA 3DEHA 1NVVR 2PEZA 3ICVA 3VSBA 4BRSA 1ILEA 1EIZA 4NNOA 3MQFA 3RRYA 4BLWA 5CG2A 1IUOA 4G89A 4GI7A 4NNPA 1Z6XA 5CHYA 3WWPA 1Y6GA 3UWDA 3OJLA 5AJZA 1EIWA 4IR7A 3IQXA 3GV0A 4GPEA 4OSEA 4NATA 5CM2Z 4Q4AB 1ONPA 4IOKA 1ZD3A 2ENWA 2QB5A 3KXPA 2JJ2D 3HY4A 3QVWA 1N0VC 2PSSA 1A04A 3E7PA 4I66A 4HR7A 4TS1A 5BN4B 5TJ9A 4ESVA 1J22A 4F56A 5T6BA 3TB6A 3NC1C 2CDAA 4Y9RA 4PZCA 5AOVA 5B53A 1JDUA 3E4DA 2QJTA 3JVVA 3L43A 3BK2A 4BJHB 3EA5A 5B2EA 1FJHA 1ZJJA 4FW9A 1QYWA 4JLDA 5KDOA 4GYYA 4GH5A 1T34A 1BWSA 4UNRA 3P96A 4CN8A 2QPTA 1PL0A 3C3JA 1E3SA 5EJ2A 2Z3VA 3O9ZA 3E05A 4YAIA 2WKPA 3PZRA 4A26A 4AJEA 4Q4JB 4YCDA 3CC8A 3JWPA 4WZ6A 4C05A 4RTKA 2MSLA 1GQRA 2IXTA 2IYUA 4OMUA 4KXVA 1SCUB 3RC3A 3QTLA 4JUIA 2ARKA 2GI4A 2FW7A 3IUMA 3F90A 3K32A 4KLNA 5T8KC 4EH1A 2AW5A 5ICSA 4BB6A 1P0MA 4ND1A 3IILA 1OZHA 1RADA 1FLAA 3EIQA 3TCXB 1N6RA 4GLLA 4RD6A 4LDJA 3PEUA 3EH1A 3VR6D 5HBRA 3EDRA 5DM70 1DRKA 1JQBA 3L6RA 3VR4D 4MQLA 4ZP1A 5DWVA 5FQOA 4KO4S 2ENUA 3H0CA 3QUCA 4XD7A 5IC6A 3FCXA 1TZKA 5JLAA 1RYEA 1ZO8A 4GNRA 3BGOS 1Z2PX 4X71A 2AFIE 3GCXA 3TZCA 2PGJA 4QYTA 3M9WA 1W0JD 2O0JA 4DSAA 2SHKA 1COWD 1NP7A 2PRZA 4LY0A 1EM6A 4BFCA 1RZRA 4S24A 3KQHA 1WUYA 1Z0FA 2VPQA 4O4HA 4YMSA 4BB0A 1T1JA 2GHTA 2VQ3A 4DM4A 2Q1XA 4UVGA 3JWEA 4X54A 2ONCA 2BGKA 4OQZA 3C5VA 4GEGA 2IYFA 4QULA 2PYDA 1VYVA 4E5DA 1JIKA 5K05A 2I4RA 1WKCA 3DFKA 1YK0A 4FK8A 1UR5A 4XLZA 4AZ0B 4E22A 4UOZA 5DCYA 1NG9A 3VNSA 2AV6A 1F4LA 4JJEA 3DE7X 3TDNA 4B6QA 1F7UA 1GSAA 2E4UA 1II8A 1DC6A 4LKRA 4UAJA 2ZUWA 4MR9A 4CTOA 2VOEA 1OZ0A 2WU1A 3PU6A 1OXMA 1S1CA 2J3LA 1C9EA 2XYQA 4ZO9A 4M46A 2GBLC 3FMGA 2H8KA 4MW6A 4B79A 4TN1A 1ISIA 3ZE7A 2QE6A 2DY1A 4YCBA 2FZCA 5T67A 3LZCA 4C03A 1SXHA 4NJOA 5JD5A 1BVHA 2XITA 1K8ZB 2PIAA 1XDGA 2HTEA 4PQRA 1HT3A 3KJFA 4RZ2A 3SHVA 1L4GA 1MTOA 5C0OE 4RJ2A 5FI5A 1WWKA 2VJDA 4C06A 1FB5A 4ZOEA 3U4DA 4EKYA 3AIMA 1E6UA 3E5NA 5LUAA 5TT1A 3IDQA 2DBZA 2XTMA 3GDGA 1KJZA 4WDRA 3ZCSA 2P65A 4TWAA 3SR4A 4AVYA 3ZW7A 4C4PA 1GPUA 3LYUA 5A5GA 3M9XA 3PPIA 1BVUA 3EIOA 1D04A 2JH8A 1U3GA 5KYUA 5I3ZA 1XZKA 1RPNA 5BYBA 1KRHA 2FUKA 3WP0A 1JFFB 3PHCA 4B3JA 5ILOA 5M04A 4B43A 5JNVA 2CEKA 2P27A 1QP8A 2Z9DA 4JB0A 5EWLB 4DGSA 2O8DA 4IQGA 1Z74A 4DYHA 2AWOA 4QUHA 3U1VA 1KZ9A 1PDVA 1H6CA 3JSAA 3LQ4A 3E70C 2WTBA 4RYDA 5DYYA 2QMOA 1Q77A 2IYOA 3COPA 4DLNA 1VKHA 2ZXUA 4WD3A 4EX6A 1LLQA 3NWEA 4P4SB 4YR9A 2VNAA 3F6CA 1YBVA 3R0XA 4A10A 1B00A 4LSGA 3FYTA 3P9ZA 3W5JA 1Q91A 3LP5A 2CJYA 4Y6OA 5DNAA 5LZ4A 2GS9A 5IAEA 4TZTA 1YUBA 3OC6A 4MTLA 1NTRA 5KYTA 1RXWA 2WFLB 1L4NA 1X7YA 5J2TF 3DWGA 1Y8QB 3P27A 3H42B 2O20A 4JJ4A 4Z0NA 1GILA 2OYSA 1AV7A 1NJ6A 2D7CA 2NO1A 2ZBFA 4XLTA 3IUJA 4BX2A 2OLEA 2R1TA 2OZLA 1RACA 3IURA 1SQGA 1SWVA 3H4TA 2B1JA 1ZHFA 2L82A 4IM7A 1GTRA 4D57A 1E4OA 1Z5PA 3HR4A 4PLTA 1YHYA 4GPZA 4IQ8A 4EI2A 4F11A 3H8VA 5AMXA 2Y1OA 5G1PA 3D8RA 4MIEA 4G9EA 5F3WB 1CNMA 4G8DA 4PYQA 5JYBA 2DT8A 5DTIA 3BK7A 1JBQA 1M2HA 1JQEA 5KJ1A 2JEYA 5LFAA 1F0NA 3KSBC 3U7HB 1IHXA 2HLHA 5JFGA 2PD4A 1FVOA 3WJAA 1UK9A 3UJAA 1BQEA 3O2QB 3RLIA 4GX1A 4PONA 2AR9A 3COJA 3X1YA 4KR2A 2IDMA 3WV5A 1J9GA 5DNVA 2PKCA 4JI1B 3G0IA 4CPDA 3K0FB 1J2YA 4G1CA 1Z4OA 3LWNA 2AK2A 3HK2A 3GP3A 3H1PA 5CYFA 3SI7A 1OYWA 3A32A 1LRKA 1GXSB 4CHTA 1G6KA 1E9EA 2H1IA 2M98A 1LU9A 1PWHA 4RH0A 2B5VA 3V1MA 1KS9A 1HDGO 2BSXA 5ALFA 2HQBA 5C1BA 1BVRA 1J1ZA 5FUVA 1JR2A 4ERXA 3SZ3A 1KPGA 3FPSA 2JLWA 2QXUA 2H4ZA 1XGKA 2CVOA 3P9PA 5FB3A 1JIJA 2Q50A 5JY6A 4G41A 4NMWA 2IHYA 2FYTA 1CUVA 1XCGB 3MGKA 4HGZA 3EUEA 4GOJA 4KXNA 3WSVA 5KNBD 1D5WA 3BXFA 2IXBA 2JIBA 2ZPTX 4PSCA 4BQRA 7ABPA 2DPXA 3M5PA 2QV0A 3FH0A 4LV8B 4RKYA 4COOA 2C9ZA 4JMLA 3SS9X 1RTKA 1VLMA 2K4MA 2X86A 4Q03A 4DIEA 5BV8A 2EYUA 1V16A 1Z68A 3L8MA 4YRTA 4R1SA 4I2NA 4JYBA 4YACA 4DCTA 5KC9A 3JQAD 1SIUA 2FPOA 4KSYA 4B73A 3ZJVA 2W98A 1NAHA 3A04A 4Q19A 4D9GA 3BCSA 1C1DB 2YV5A 1RKQA 1UBUS 3C1AA 5TARA 5CLJA 4UHCA 4JYPA 1L4BA 5HJEA 5JXJA 3MW8A 3AVUA 2EZUA 5IEBA 1PVOA 4QRIA 4CU5A 1UOOA 1Y4AE 3GBPA 3N8DA 2NIPA 4OM8A 2J0UB 4YREA 5HRAA 2PUAA 2N47A 3HJCA 1X9HA 2AX4A 4BZZA 2HT1A 3KUXA 1IZ7A 2R1UA 5KTMA 1HE5A 3ZDDA 2YVAA 4IQ4A 3A6LA 2ORVA 3REFA 5C80A 2OKGA 3I6MA 4IQFA 3KSMA 3SZOA 2QL6A 1YBMA 4TQAA 4WACA 3PEFA 3QMWA 1JPNA 1KMMA 1XTVA 1XL0A 1KMQA 3ZZUA 4BNNA 3BORA 4XYEA 4BP8A 4CMIA 1G5PA 3QFFA 4YX9A 2AG1A 3LUBA 3FYSA 5BSEA 3TFQA 1QOQB 3C8ZA 3JATA 1D2CA 2POQX 3PBKA 5ALLA 3AIIA 4XQ9A 1NKTA 1ZR2A 3WBKA 3RSZA 3WKCA 4MR8B 1G3RA 2CNKA 1ZK4A 1O4WA 1T9CA 2AE1A 3A26A 3CMCO 3GEPA 4MHOA 4HNAB 4XIGS 5FA8A 5JBQA 2DUUA 4BO9A 4KQHA 4CFSA 1O95D 4OQMA 4L07A 1XD2A 4Q1FA 1Z2CA 3WKAA 3DLHA 5C8XA 2B5WA 2QBYB 4FSDA 2F00A 3KE8A 4YP7A 4DUGA 3DMHA 5ICCA 3AHGA 1Z2AA 2NU7A 1R3DA 3EQ7A 1RYYA 2V65A 1K89A 5CR9A 4Q24A 3GU3A 5DH9A 1K63A 1E2HA 2HL6A 3I6YA 1R0CA 1NLFA 1XV5A 3FJOA 3KZVA 5SV2A 4UARA 4D9NA 4L5CA 1Z2EA 1EFRA 2QG4A 4Z4FA 2KBEA 4BL5A 1A2OA 3ROTA 2AEEA 3V7WA 1WQ1R 4X00A 4B4DA 5AP9A 2E4WA 5EHNA 1OAOA 2I71A 5JNTA 4H6VA 4JUCA 3ZIAA 4LBVA 1Z07A 4Z7OB 5BNWA 1QX3A 1ULTA 2WMNB 1F51E 2QRGA 3IMKA 3Q72A 2O7RA 4OXNA 1KL7A 4PCAA 3LM8A 4PICA 3GK3A 3G0BA 2W37A 3EIHA 4LF9B 4HOYA 3ML1A 1B76A 4YTEA 4NJEB 3HXQA 1I3KA 2JW5A 1XF9A 2PX2A 4GLOA 4R6WA 1MB0A 2RGGA 3ZI0A 3MJEA 4KACA 4GPBA 3AV3A 4QXQA 2ZRKA 4YUWA 1BQ4A 1A50B 2Z57A 1NOJA 4I4CA 1W4CA 2ZT8A 2OOSA 2J9XB 2FSPA 3KDAA 4MW5A 4KO3S 1EZ4A 1ZCFA 4D8UA 3EGXA 3GG9A 4QNRA 3SHFA 2QTZA 4EEZA 4R41A 2WKRA 3PQCA 4K1LA 5AJVB 1YBFA 3EEQA 1OF1A 4ER6A 1S2NA 3ZZTA 2TMGA 1YQDA 3L1KA 5TGDA 2H59A 5AW5A 2X1HA 1C3JA 2CN1A 1GGFA 1U4NA 4J0HA 2ZFUA 4BY9E 3UAOA 3A2LA 5F5NA 2ZUUA 4FD3A 4YT8A 1CR6A 3D02A 4UU1A 1KEVA 5LZ9A 3DZCA 3WK8A 4WV3A 2YYZA 2HAEA 1CUCA 3AFIA 1LV7A 4RVDA 4JSTA 3C6QA 1DTWB 4MI6A 2XLBA 3R8CA 3EVDA 4J0JA 1CB0A 4OREX 1P0QA 5IX8A 2WIFA 3UMFA 5GZ6A 4FDTA 4AZTA 1E9AA 3JQFA 4E07A 1HT2E 2QSZA 3V1YA 1X2BA 4IVRA 2FPWA 3GEHA 4J0EA 4C1NA 3W9UA 3DUFB 4XJTA 1HO3A 2ZJOA 3DD1A 3T5PA 4J7CA 4L5YA 2O8BB 1PW5A 1JLHA 4L0QA 1JMVA 5COAA 4Z6KA 3PVCA 1IEVA 1YTLA 2FPKA 3OLXA 2D8MA 4DYVA 4IVNA 1C9YA 4H77A 4EAQA 2YS7A 2C82A 1OBCA 2GXQA 1C4KA 1YZQA 4IJVA 4O6VA 2G6TA 3I73A 1R3UA 1V9CA 1OROA 3EZLA 4DCMA 3G1TA 4WUVA 3KPVA 2O19A 5JU6A 4MW1A 4R2JA 4ZALA 1KI3A 4C14A 3ORRA 1W29A 3TGWA 4E5KA 1YB1A 3K05A 4JI5B 1XMSA 5KAPA 4BVGA 1XWIA 1QQBA 1W94A 3B1ZA 1OC4A 3DSRA 1LDMA 5B3KA 4KXUA 3PD0A 4WNIA 3OSUA 3PA6A 1D4FA 2D2XA 3OVMA 1TW3A 3BFKA 2Z09A 5CPFA 1ZUNB 3V2GA 2C3UA 3K9HA 2H4WA 4ZCSA 1RJWA 2ZIXA 4OH1A 3LX6A 1M73E 4YCCA 4MP6A 1DXHA 3AVYA 4KN6A 1TF5A 2QL9A 4Z2YA 1XNRB 3B6KA 3W4IA 1HKHA 1XCLA 3GJ8A 5L6LB 3R4VA 3RAGA 5CVUA 1RKVA 1DAGA 3QFSA 4OQLA 2B8EA 3I52A 2P9EA 4NFLA 1KI7A 1XX6A 3PT5A 3K2BA 3T15A 4Z4GA 5INTA 5KHLB 2UZ1A 2EC5A 3MXOA 1VSUA 4LJ5A 4M0DA 2O1WA 1JWAB 3EXEB 1DG9A 3WTBA 1MJNA 3R5HA 1XTJA 4EF4A 1U9ZA 3TSAA 5HE8A 7YASA 5JUWA 4HXFB 4GX5A 1MW9X 2LTAA 4DM3A 2BHNA 3MMSA 4OYRA 2HO5A 4MRVA 3REQB 1L1FA 1I94B 2C57A 3B6JA 2JFNA 2AF3C 3CHYA 4RKWA 3OY2A 2WIBA 4G36A 2FX5A 1YI8A 4EUSA 1EINA 2Y92A 3O4HA 3IMFA 4M88A 4RA6B 2B6NA 5LNK6 1IZ0A 4FS8A 3BTUA 1Z2NX 1NT4A 1Z28A 5GPBA 3GI1A 4DQUA 4PX5A 1ZUHA 2ECOA 2PK3A 3IO3A 1PFUA 2XTZA 1GJRA 3DBRB 3ENNA 3PENA 4BQPA 3ZD6A 5FHRA 4WGFA 3CVOA 5AUOB 2O8CB 3RVBA 2ZQ5A 2LE0A 4F2WA 1ZBQA 2Z6VA 1FNMA 2EF0A 1WY5A 3LQFA 1T1GA 1WB5A 1LFAA 3IP8A 4HI0E 1X1TA 1PJCA 4NBUA 1MJHA 3C8DA 4PQEA 4DA7A 4XJXA 5EMKA 1R37A 1NV8A 1PS0A 4RJLA 4CEJA 3SQOA 4A8JB 4LS3A 6AT1A 5KYYB 1I33A 4WKGA 3LA8A 4JVNA 3VU8A 5DWQA 3NHMA 5ED0A 4I3FA 2O7QA 3WDKA 5FA5A 3G82C 3H9JA 1PJ4A 1QVWA 3FPJA 3Q12A 4CLRA 3IP9A 2EJCA 4D8XA 3BQMB 3Q88A 3HKDA 3H9QA 3R3YA 9LDTA 4OATA 4A15A 3AW8A 1AJEA 2YHAA 1Y42X 2XB4A 3LKVA 3WHIA 4S2UA 5BUQA 3M9LA 1HQKA 1FDIA 1X7XA 1JYEA 1DJLA 1TK2A 4MP3A 4P4NA 4F5DA 3KLNA 5CVDA 4YI3A 3TTSA 4P7BA 4TKUA 4LY9A 1H2BA 1HF3A 1KZ4A 2HMSA 3AFMA 4U8HA 1IXSB 2CLFB 3F2IA 3KQTA 3VR6A 4LE0A 1GZHB 3KZKA 3LBAA 3DE5X 3LFTA 3NHYA 4Y1EA 1NXXA 4OLJA 1CUJA 4B8WA 4OA8A 3U6BA 4OD0A 4NZMA 1YCGA 1EMDA 1L5OA 1U94A 3BZWA 3DMFA 1MN6A 3VHRA 1NUUA 3HUTA 5THQA 3T61A 4YMLA 1S01A 3P2YA 1UOPA 3LKZA 1N9KA 4KVAA 3FKSA 2J4CA 2ZATA 3RB8A 4NU0A 4K6FA 1MJ5A 5AESA 1GM5A 4GI1A 4GXRA 1QTQA 1BD3A 3HE3A 5EUMA 4LK2A 2JBHA 2HU8A 3M81A 1JEDA 4IGKA 3WJ2A 5M29A 4DY6A 1CVRA 1E1CA 2C4TA 2O3QA 3DPUA 5FBVB 1MRNA 2BC9A 4AN0A 4W99A 4AZ3B 2XECA 2Z9BA 3MUOA 4E5SA 4FHZA 1T9HA 4MW2A 2QY9A 1AD2A 5CVJA 1SCQA 3OZEA 2AMYA 4RPJA 2NU9A 4BVFA 4D3YA 4G5GA 3K4HA 1OZFA 4P82A 4I8IA 3UG6A 5CNKA 2IOFA 4NDAA 1JLSA 1DIRA 3SLGA 1OD6A 3Q3VA 3CB4A 1VYTA 2ZQZA 4ZRDA 3D1VA 5CXSA 3B1XA 3AR4A 3AJRA 3FTFA 1VJGA 2ZBRA 3O3CA 1KO5A 3NBKA 1SUFA 2FZGA 1D03A 3OOHA 5FULA 2ZE8A 4OXQA 3RVSA 1P2TA 2PAAA 4AKGA 2O2HA 3NEPX 3CSSA 1XKTA 1GNSA 1TYEB 4HDRA 3JRNA 5FT9A 1D6SA 5GM2A 4M9CA 5IWCA 2E1RA 2C99A 1P7YA 4PGAA 1WXDA 3UOAB 3L6OO 1KMHB 1DKQA 2VKTA 4XGRA 1V8OA 4AMZA 4KPUB 4CIDA 2PCJA 4ZV7A 2C4HA 2VFAA 3FYCA 3ANSA 3AZPA 4UHJA 1ZUIA 2G07A 4U9HS 4FFBA 1JFVA 3I01M 2ODWA 4ZOLB 4DCJA 4YGYA 1G291 1IE3A 1IC6A 1CUWA 2GM4A 4MHTA 5IF3A 1HY3A 4GOKA 4TKVB 1HYEA 1R1DA 4BPBA 4FWIB 5F7XA 2P69A 2GPWA 2PMWB 4QBTA 3H2GA 3K31A 3P9CA 4HYTA 4W8OA 4L6IA 4FE7A 1XEWX 5HBGA 2Q6IA 4MVJF 4NZZA 4NCXA 3VDQA 5J2TA 3AM1A 4MULA 3BDVA 5C4IA 4TMTA 4B31A 3AR3A 4PPFA 3EF0A 1E96A 2CBZA 3WX0A 4WOBA 3CUUA 1S5PA 4OKNA 5J5AA 4KWHA 1NIPA 3A6EA 2B92A 1XZJA 2YZ7A 16PKA 1W5AA 3CZMA 4J1TC 1E18A 5GOTA 3QV1A 5E1MA 2J5XA 2UYYA 1IAVA 4GGMX 4Q3KA 2KMLA 1ETUA 2VYVA 3GJSA 4CW7A 4F2PA 2VNSA 3OT5A 4HBZA 1Y34E 4YDQA 4J9UE 4MVJG 4F8YA 1BW9A 3WNVA 4TXMA 1XMPA 2IEYA 5D3ZA 2FK8A 3ROZA 1D2AA 3OG9A 4YV2A 4JFAA 2BH2A 4FBGA 1CRZA 4D5GA 5B7QA 2DETA 4AUNA 1YZ3A 3BMCA 3EZ7A 5CU7A 5EXEA 1NQTA 2VXYA 3AQIA 3HKCB 3U3MA 2AHOA 2H4HA 3VSAA 1GV1A 1BDMA 2NTYC 2WJWA 2BI4A 1G9SA 3NBYC 2E9SA 4MV5A 4MW9A 3U9SA 5IT0A 1D2HA 2WE7A 1P19A 4EZEA 4YJFA 2KWIA 1HA3A 2WSLA 2ZVQX 3MWFA 2BCEA 3ORFA 4IJUA 3DL7A 3P9QA 1ZNQO 1F0YA 4JS0A 1RE0A 4LJ6A 3ZDQA 4E2WA 1JEQB 4C4XA 3EDCA 3R7WB 1GL7A 1EM8A 2HA4A 4TTPA 5JE8A 2LXNA 1Z4KA 3B2NA 1C9MA 1PFQA 2GN4A 3H9GA 2K6GA 4U5XA 4Q0MA 3VMMA 5BN3B 4YUZA 2QZJA 1VG1A 4RLQA 3HPQA 3KWLA 4MS4B 3TQHA 3PPVA 3IH5A 2J48A 2HCTA 2ZRCA 2N46A 3HJRA 4N76A 3LUGA 2KYRA 1SG0A 3PWZA 5FUYA 5BVGA 3WZMA 3AEUA 1YRYE 5IM4F 4TXJA 4D9IA 2WKWA 1Z63A 2DUWA 4WLEA 3ZU5A 4CR8A 3AF1A 4ZC8A 1YV9A 5C3MA 4ND5A 1U7UA 4PZEA 4TTVA 3H11A 5H1YA 1U6IA 1ZNZA 3S2IA 2PR2A 1OBOA 1EP9A 5GWXA 1K8XB 1Z73A 1FJGB 3TJMA 3AW9A 5DN6A 1MDFA 2Y1EA 1YZKA 2R1ZA 3MWJA 2I80A 2WI8A 3ERCA 2FX2A 4WKOA 1TOAA 2EP7A 2B30A 2NOAA 1J06A 4O2AB 2F4NA 1CZRA 2ZB8A 1KSHA 2HXGA 4IFTA 4AI6A 3UT5B 3HHEA 2BCGY 2NUAB 4H27A 4BNXA 4UEQA 3LE8A 4BOYA 1FMCA 3ZBUA 4EFLA 3V1LA 4W1QA 3UWSA 1T2NA 1EP1B 1G0NA 5LVAA 2GFIA 5A3QA 2C2OA 2X42A 2MR5A 1DJOA 1EG7A 4RDIA 4DMRA 3GQBA 3KEQA 2H1SA 3K5WA 2ZJFA 2GLTA 1A9XB 1NUSA 2BTQB 2CZGA 4FR2A 3GEDA 4FQ5A 3V32A 2JHFA 2OCYC 2VP0A 2XMQA 3OY7A 4JBYA 1GA1A 1VE5A 3K0HA 4DIFA 3FMPB 1HETA 2NXNA 3HACA 4EJFA 4YRAA 8ATCA 3C7AA 1GSIA 1NRWA 2VDOB 3HXKA 5FOQA 2EATA 4NLLA 5HZHA 3AJEA 1N36B 4F0JA 2HMVA 2SBTA 3VTKA 2H31A 1Y5LA 5ELXA 3IEXA 3WKDA 1G5QA 5IBQA 2OPHA 1T4CB 5SZHB 1PN3A 3U0VA 1IQPA 1PP4A 3BMOA 2I3ZA 1YA4A 2H29A 5IUNC 5C7OO 2AJTA 1FNNA 4J0IA 4KO2S 4LMRA 2O07A 5HJ7A 5H02A 4ETNA 1YNSA 3WYDA 2PSEA 3CQ9A 3DZIA 4GM4A 4OJMX 3ZGLA 5IDXA 1NJFA 2BGUA 2XNDA 1T5HX 5DM2A 2XGMA 4JWKA 3DG9A 1XVVA 2BBOA 1RWOA 4XUCA 2RH9B 1E9CA 1PDOA 3Q7SA 3QU2A 3FOEC 5ED4A 3GAAA 1C0IA 4UOEA 3GGSA 3H6HA 1GUBA 3GLHB 5EINA 2FZVA 1ZVJA 2OHGA 1Q0ZA 3T7IA 3LX8A 3UYLA 4BV2A 3I6IA 4PO8A 3T5GA 2VJCA 4NJMB 3L18A 3VU1A 3AUSA 4LN1A 4P81A 5GGYA 2C8VA 3QKWA 4X97A 1NC1A 3RYHB 2X0NA 2IU0A 4QATA 1MA0A 2ZJBA 4RZXA 4C5CA 2FMUA 1YMQA 1XRRA 3GJ7A 2A0XA 3UAWA 5MFZA 3GEBA 3RQSA 3NM6B 2Z8YM