4OL0A

Crystal structure of transportin-sr2, a karyopherin involved in human disease, in complex with ran
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
172
structure length
172
Chain Sequence
QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of transportin SR2, a karyopherin involved in human disease, in complex with Ran.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords GTP-binding nuclear protein Ran
total genus 46
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2014-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ol0A00
4PC3A 2GJ9A 2ZJOA 5BN5A 5FH9A 5JS7A 2DFNA 4MRNA 3T5GA 4HLUA 3TQCA 5GVSA 3RRZA 4KXFB 3W9YA 3EG5A 1J2JA 1G16A 4UNRA 2QGZA 2ZRNA 1KI8A 2WWFA 1I2MA 1DG3A 1OPXA 3BXZA 4IVQA 2YWEA 1ESNA 1ZJ6A 1F2TB 3EZ6A 1Z6AA 1JQLB 2PEYA 4BECA 5K8TA 2HLDA 1P2VA 3GLHB 4IDNA 4B2LA 4AYXA 2D3WA 2RKOA 4ZDWA 4EPTA 2X19A 3U3MA 1II8A 1OFUX 2V9PA 1XDBA 4PO9A 1OH7A 2MSEB 4DBLC 4XD7D 5LD2C 3KFXA 1IY1A 1SGWA 3ZGXA 1R10A 1VG0B 3MLEA 3GLGB 3R7WA 3AP1A 4PC2A 1IN8A 2EW1A 2IYXA 1C4OA 3I8SA 4ZDJA 1ONBA 2IS4A 1Z29A 1XJQA 1G8PA 5FUXA 1OH8A 1KGDA 4GL2A 3O47A 3FHTA 1QZXA 2JLQA 1BMFD 4GNKA 1OFHA 1RZ3A 2REBA 1XTQA 2QQ0A 2ZI5A 3L82B 3ZVNA 2RGAA 3LWNA 1L2TA 4B47A 2XOKA 1G20E 3SYKA 1OXUA 1U81A 3WYAA 3KXIA 2AD1A 4QKQA 3D3QA 4OI0A 2B6HA 3H86A 1KI7A 3WNDA 4NYIQ 3OE7A 4QOSA 1HQYE 1W5SA 5KO2A 2XNSA 4H1UA 1UBCA 4I81A 3OEEA 1PJRA 5J5CA 2G3YA 2ZRAA 4PPGA 3KUCA 3MD0A 5JJLA 4D0GA 1O3YA 4B3CA 2RAPA 3WHLA 2ZI9A 3DOEA 1Y63A 5EE5B 4PC1A 4DSNA 2DFLA 3AUXA 3BS4A 1OW3B 1E1QA 3R7WB 1GSIA 3QF4A 4I1OA 4UXIA 4DLSA 4GOKA 2JJ2D 4IEEA 1FW6A 2A2ZA 3QXJA 5HE8A 2IWHA 3ADCA 1XD8A 2ZREA 5FPKA 1O87A 3UATA 1N6PA 5KU1A 1SXJB 1F2UB 1OF1A 2KJQA 3RS0A 821PA 4D26A 1PZNA 2OEPA 1F2UA 4HZIA 4B6EA 4EQ6B 1MO4A 1N2CE 3U4QB 1ZUNB 1DAEA 4MRVA 1Z6YA 4A6XA 4V0OA 1OKKD 2VRWA 3ZD6A 4G1UC 2QPTA 1M2OB 3FFAA 1R0XA 3I72A 4TL7A 3WXMA 2JLVA 1B23P 4YMUA 3AF4A 4LZZA 5TB5A 4TZ6A 1KSJA 3VKGA 3B78A 3FVQA 5F9HA 1Q3HA 2R2AA 3GJ3A 1Z22A 3B1ZA 4V0LA 5FTNA 1G3RA 1J99A 3NXSA 2UZ3A 1HQCA 1G8GA 5GJCA 4GDFA 4FWTA 2VQSA 2C78A 2G6BA 4KO8A 5KNBA 2CXXA 1ZD9A 3ZD7A 3AQ4A 4HATA 1W48A 5J4HA 2BCJQ 1GG2A 2A5JA 3Q72A 4LWZA 4BEBA 1GUAA 1G41A 3SJBA 121PA 5DI3A 1XF9A 5EE9A 1MO5A 2FGKA 4Q48A 4TSFD 3BK7A 3M4YA 4HEJA 4BFVA 4EAQA 1S1CA 1JECA 1EXMA 2GA8A 3EA0A 3PR1A 5EJEA 2HJVA 3CRQA 2VP9A 4IOLA 1FP7A 3KJIA 4HSEA 1QHIA 1ZU5A 3BGWA 2QBYB 1RC8A 1JBKA 2AD5A 2QP9X 4JL6A 3B60A 1PLKA 2XTZA 1ZIPA 1HEIA 4K8OA 5IT5A 2A3RA 2AFHE 4TMZA 4XVRA 5D3MA 4TYNA 1DAGA 5CM8B 5AWFC 3SOPA 3IO5A 4BFXA 4B2IA 2BMEA 2YWHA 1UAAA 5CDFA 2YOFA 4NPHA 3RS4A 3FFBA 1EESA 1CU1A 1XMVA 5EZ5A 4A92A 2AXPA 1LS1A 4XVQA 1XD9A 4Q1AA 1E2PA 2AL7A 1Z0IA 2WOJA 2PX0A 4A2WA 3GJXC 5CM9C 4G5OA 3RHFA 1TQ6A 3OESA 4NCJA 1DE0A 1Z83A 3AV0B 1ZM9A 2QT0A 2BKUA 1M7GA 4HAVA 4B44A 3EASA 3TAHA 3AF2A 4BZXA 2V7QD 2TMKA 2F1HA 4Q9LA 4P4UA 3AF3A 2OXRA 3P4YA 4PZLA 3ZDQA 2PZGA 1E2EA 2FPLA 3K0CA 2UZIR 1AS2A 3DMNA 3DM5A 1J7KA 3EWSA 3RRYA 3I62A 3O8DA 4D81A 4EFNA 1XP8A 3NC0C 4V0ME 5BQ5A 4B2PA 1VG9B 4C30A 2QY9A 1R0WA 3PIRA 3LLUA 5EP3A 1E9RA 2ODWA 3QI2A 1BH2A 2B8WA 2GZHA 3I1FA 3TBKA 2WMNB 1RRCA 4PSKA 3L0SA 2XEXA 1NSTA 4JIMA 3KTAA 4B6FA 1Q20A 4MRSA 5JHHB 2G9NA 1XNJA 3C5CA 3SNHA 2ZI7A 3AP2A 2DWOA 4C0SA 3TUZC 1XMSA 1CJTC 4QGHA 3SZRA 2BHRA 4A1FA 4C0BA 3U3OA 1DTSA 3TLXA 4B32A 2RB4A 4QBFA 5IK2D 4DB2A 5H1YA 4C7OB 4D4JA 3PITA 3OAAA 4D82A 4CRWB 1OHHA 4DC9A 4LBZA 2D7CA 4Q4JA 2IS6A 4QJ3A 3GJ7A 2H1LA 2QP3A 4OHVA 1AQUA 4XSHA 3U44A 1ZC4A 3KQHA 1EFRA 4G5QA 2VP4A 2NOAA 1SVWA 2GBLA 2ONKA 2PMDA 1VYUA 4MGYR 4GOXA 3KKMA 1DAHA 2YWGA 5KSOA 4EDHA 3I5YA 1KO5A 3AH8A 5FPHA 3VU9B 3MAAC 4TYWA 1E94E 5E4FA 2GCNA 4NBSA 1IAQA 4I1VA 5HPYB 1PUIA 2J0VA 3V00A 1JAIA 1MR3F 2JIZD 1HE8B 3EARA 3NEJA 3I5XA 1AGRA 2PBRA 4M1KA 2GKSA 4URZR 2J7PA 1HYQA 1XCGB 2IC5A 3E2IA 1XXHE 1Z08A 2ZS8A 2H18A 3BWDD 4TMWA 2CLSA 3LBHA 1DAKA 2DY1A 4KLNA 3S1AB 1YR9A 2C9YA 3TR5A 2JASA 3RLFA 4B34A 4QC2A 4RD0A 5FI1B 3LXXA 5BYJA 1RW4A 1KJYA 4RVCA 2F9MA 1JXOA 1KDOA 2QRNA 3E5HA 4RZXA 4TMKA 3K0FA 4DLXA 4ZDIA 5KOYA 1AIPA 2XZOA 2CK3D 2H16A 2R62A 3FDIA 2ORIA 2CHQA 3H1TA 2VHQA 3FE2A 2PEZA 2CMKA 3TQFA 2OESA 1F60A 1GNQA 1E4YA 2WSSD 1TPZA 1KHTA 3EC1A 4HLDA 4UXHA 4PZZA 3S1AA 3IBYA 4PC7A 5DI3B 1QHGA 3LDAA 1FP6A 4M1WA 4BFZA 5CJ2A 1XJCA 3BJIC 4AIIA 3TUIC 3CR8A 1QHHB 3RC8A 1F2TA 2BBWA 4NU0A 4PTLA 2FFHA 2P6RA 3U3RA 3B82A 3KB1A 2IHYA 2VA8A 1U9IC 4QBGB 4PHTA 4RD6A 2RGEA 2N46A 2F9LA 1E2IA 5KUTA 3DKVA 4CEIA 4LV5B 1KOFA 2FEMA 2R6FA 5L3VA 4KITB 5JZVA 4KLZA 4QXAA 4LDJA 1IY0A 2Q6TA 2FMXA 4Q4HB 5FTKA 1YZQA 5M04A 3QUSA 2REXB 3BERA 3QOFA 4QJ5A 2O8DB 5FOUA 1VCMA 1DEKA 5FPTA 4FMCF 1BYIA 2JLSA 2ZU0C 1W7AA 1CJKC 2QG6A 2BDTA 2ODBA 3FPAA 3IPXA 4QHSA 1KYIA 1XFAA 2JLUA 3AVUA 1VTKA 2WHXA 3GD7A 4CEJA 1NVVR 2O5VA 4DIEA 2IEZA 2ZRIA 4G5GA 3KZ1E 4D2IA 1LVGA 1OIVA 3FKSA 4N0EA 3QPWA 2FNAA 3KDSE 2QT1A 1JNYA 3SHFA 4B43A 4PPNA 1MT0A 2IS2A 1NLFA 4W7SA 1VHLA 2ZE5A 2ZTSA 5EXPA 3HR7A 4ERNA 6Q21A 3SBDA 5IRCD 1KK1A 2GF0A 5EE0A 4DSUA 2EFDB 2WWGA 2ZJAA 1GNRA 5CK4A 1N5IA 3FYHA 5E3HA 5TVKA 1I4TD 2BWJA 3DPUA 4LYHA 3U3KA 1YZTA 4XSGA 2JJ8A 2ZIAA 1COWD 3H84A 1DELA 1J90A 2ONJA 3SFZA 2GXAA 1UEJA 2N1BA 3C5HA 4YMWA 2HDNB 3DOFA 3CPEA 3QF4B 4WA7A 1T3HA 2AKAB 3UG7A 2ZS7A 1YU9A 3GLHE 1BMFA 4URXR 1RRPA 1NLYA 1F5NA 3PFIA 2IT1A 5J4VA 4Q7LA 5L3QB 1G7RA 5EE3A 5AJXA 3OIUA 2HYIC 2X2FA 1Z0FA 4C0QC 4CZ2A 3V9PA 1IJFA 1KSHA 1US8B 3P4XA 1I4LD 4OQNA 2FSIA 2D2EA 2IW3A 2QAJA 3IILA 2ZRLA 1TF2A 3U6BA 3MWJA 2EFGA 2GETA 3K9GA 4DLWA 4D25A 2ATVA 4LJ4A 3THOA 4O25A 1CS4C 3SHWA 4EKDA 4U00A 2BMFA 4ARZA 4M9QA 4B3GA 3SI7A 1HH4A 1YZLA 3WP1B 3SQWA 4LJYA 2OCPA 2A9KA 5DLQC 1MRSA 1CF4A 4EQ6A 1Z0KA 2VO1A 1P7CA 2BKEA 2C9OA 4A4DA 1QHNA 2CVHA 1Z5ZA 1NP6A 4URVR 4CEHB 1KO1A 4MUAA 4IKEA 4RD2A 4QBHA 4TZ0A 2OAQ1 4C0JA 1VMAA 4FI3C 1MO3A 1T9HA 4MITA 3U60B 1TU4A 3SU8A 4QGGA 1NBMA 3CO5A 2IF0A 1S3GA 2YZ2A 3EIHA 4HAYA 4ZDKA 1FNMA 1G3MA 3PEUA 4JT4A 1GWNA 1R0ZA 1E98A 3KTAB 4HI0E 4KI0A 4P3YA 3CR7A 1QG2A 4FXPA 4QM7A 1E0SA 3CX7A 4BWYA 2GJ8A 4L16A 3GMTA 5TDHA 1OXVA 1OIWA 3NG1A 4FMCB 5G40A 3VMFA 1TNDA 1JQJC 2IEYA 1Q44A 4JMPA 3UWKA 2GCPA 1E1RD 1M1YE 3A4MA 1DAFA 3M1IA 4PHFA 2FDCA 3T12A 2WJVA 1KO8A 2WIBA 1MKYA 3Q3JB 3VX4A 5LPNA 1G17A 2H92A 3MMPA 2B8TA 2D62A 1ZW6A 1BYUA 2V8OA 1IN7A 2J0UA 1UKVY 4PZYA 4CYMA 4OQLA 5AUPB 1W36D 1U98A 3AKDA 5A4JA 3U6KA 1AQYA 1FOEB 2VL7A 5JEEA 2WJGA 3P1JA 3NDPA 2JLRA 1J8YF 3MWKA 3NKVA 5EXXA 4KFTA 3VU9A 5J40A 2FSFA 4ZCIA 1JJ7A 3LVQE 1UFQA 4U5XA 4AD8A 1NN5A 2J59A 2D7DA 4RD4A 2P65A 1QHHA 3THYA 1XX6A 2VP2A 1XD2A 4I4LA 4QG7A 4IVPA 1R4AA 3SFVA 5CIQA 4KBGA 1JPNA 2DYKA 2GTPA 2ZRFA 4A8JB 2XB4A 2O8BA 1S9DA 3ZVRA 4XTRA 2WICA 3TE6A 2YV5A 1XEFA 2CNWA 4ZPXA 3O8CA 5D3MB 2ZRBA 1HURA 3GLFB 3CX8A 1I4DD 3TK1A 2GVZC 4IVRA 1AKYA 5JBQA 1E2DA 1HV8A 3BD9A 1Z2CA 2F43B 4IOMA 5H70A 1KJWA 3H4MA 3T06B 4JKYA 2NO7A 4DLYA 5TMPA 3ZYCA 2WJYA 3HYRA 2LWIA 4KYUA 4WZBE 3WNBA 2JLXA 1GDDA 1II8B 2GXSA 3T15A 2J7PD 2WJJA 3CWQA 3CX6A 3P27A 1ANKA 2BBSA 1N6KA 5EP2A 4ZKEA 1SULA 1XXHA 2FOLA 2O0HA 5C18A 3FHOA 3NBFA 5L3RA 4AKIA 4QNMA 2WPDA 4GBMA 3ASYA 3FMPB 2NZ8A 2JDID 4K46A 4AK9A 3LVRE 4HZUA 2GHIA 4XVUA 4GPTA 1KAOA 2J87A 3MWLA 1K5DA 1U90A 1P3JA 2FG5A 2EYQA 1SVOA 2H17A 4P4SB 4KCGA 5JSZB 2Z83A 5EUQB 621PA 1NIPA 5BN4A 4ITRC 3W34A 3LH5A 2IYYA 2IYRA 4XH9B 3UMFA 4BZQA 3A6PC 1XXHB 3OEHA 3QQ5A 5ELXA 5JJIA 1V43A 4W5WA 2QORA 5JCPA 4C2UA 3M0EA 1T5IA 1ZD1A 3VX3A 4LJ7A 4PC6A 4UNPA 2HV8A 3SYNA 1T4GA 4YXWD 3QVVA 2BMJA 3FMOB 1VIYA 1E1QD 2HT6A 3ASZA 3C15C 3AB3A 3T1OA 2JIZA 2WBLC 1RRGA 3VQTA 4GMDA 3FOZA 4OK3A 2FPMA 4LV6A 4BZPA 1TUEA 3BRWD 3B1YA 3TIFA 1XZPA 3QPVA 4FW9A 2FN4A 2B7BA 5HKKA 3IIMA 4AYWA 5DIFA 4IEIA 2OLKA 4IOJA 1Z2AA 1OE0A 1WMSA 1Z47A 5BW8A 3GJ4A 1E0AA 2BM1A 5EUMA 1KDPA 3RSLA 4OKSA 2VH5R 4Q47A 1R2QA 4LRWA 3UXMA 2G77B 3X2SA 1MH1A 1P61B 4LI0A 5KDLA 4V0KA 3KKNA 4BFSA 3KQLA 1UPTA 1K8RA 4Q21A 3VR4A 1GOTA 1E2LA 1OB5A 3VR1A 2QE7A 2ZE7A 4MH0R 2YJTD 4Q1BA 5LB4A 3VKWA 3AVWA 3AP3A 2RGNA 1Q12A 2OAP1 1DAIA 5AJZA 2XX3A 3KFVA 1UADA 3AGQA 3L0OA 2KI5A 4HAUA 3W6NA 1NVUQ 1CP2A 1M8PA 1F48A 1P73A 1TQDA 2R44A 1SKQA 3Q7QA 4FMDB 3I4LA 4M4SA 1OT3A 2O0KA 4AY2A 2V54A 2ZSEA 1ZYUA 4BRUA 4M53A 1W5TA 1CEEA 4ZIRB 1KO7A 1CRQA 5KNCA 1GTVA 2NTYC 1KO4A 1GL6A 1EG7A 3GLHA 5CLLA 3QJYA 5SZIA 2G88A 1NMZA 4HDQB 2FEOA 4Q1EA 2MSDB 3D6TB 1W44A 3DL0A 4PR0A 2G0TA 4WAUA 3PUVA 1U8YA 3K0AA 4H1VA 2E87A 4DLVA 4IFBA 3K0AB 3GPLA 1KK3A 4D6PA 2DPXA 1R0YA 1ZD8A 4QJ4A 2ZYVX 5D3QA 4WZ6A 2FSHA 4HAWA 4X8HA 2GWHA 4JZKA 2J0QA 1N0VC 2AWOA 4DSOA 3CBQA 3OZXA 3AUYA 5DI9A 1XD2B 2FFAA 4OHWA 1SHKA 1D9ZA 1E9SA 1G1MA 1OB2A 1OSNA 4M1SA 1G9XA 4Q19A 4QM6A 3B9QA 3AVYA 2DFTA 4OBEA 4DDTA 5LB2A 4TYYA 1OXSC 4NYJR 2FPKA 1YE8A 3A1UA 3QXHA 1E9EA 1HY3A 3FB4A 4TLBA 5IK2A 3TW8B 3Q8XB 4JVNA 2OG2A 2ZRMA 2W00A 2DB3A 1FX0A 3TRFA 2CBZA 3K1JA 1UM8A 2PT5A 2G0NA 3OF5A 1P4SA 3AF0A 2XXAA 3GLFE 3PUXA 3SJCA 3K0CC 1PLLA 4JJKA 4PAQA 1XEXA 1ETUA 2ATXA 4DEYA 1GKYA 3CNLA 2PT7A 4F4IA 4B74A 4E09A 4NYJQ 1GVNB 2KBFA 2ZSAA 3WBKA 4UJ3A 1G18A 3QBTA 4KFRA 2KE5A 3DKPA 2QMHA 4L8GA 1KI2A 1W49A 2QAGC 4R98A 3MRSA 3PVSA 3UMSA 1EFCA 4C2TA 1IY2A 3GLIE 1E2MA 4HUQB 1NLZA 2R8RA 3WYFA 4R2HA 4OQMA 3KJHA 4B3DA 3U7GA 3IHWA 1SHZA 3UG6A 2RHMA 4R71A 2QAGA 1A2BA 1D2EA 1GRRA 2CCKA 3Q5EA 4JLNA 4JLMA 3PV0A 2CVFA 4TYPA 1Z0AA 4P4SA 3KKQA 1NF3A 3V4FA 1H8EA 2GBLC 5B2ZA 4YQFA 2EWVA 1N5JA 4RCZA 1UKYA 2GJKA 1L7VC 5C2JB 4PPQA 2VF8A 3ADDA 2R65A 3F8TA 1GFIA 3DMDA 8OHMA 2UVQA 3IPYA 3QNUA 4LK2A 2Z0MA 3NVAA 3QKUA 4GSYA 3TNFA 4AWXA 4HLQB 4LHYA 5HZKA 4F38A 1LFDB 1E3MA 2VSXA 3L2OB 1VG8A 4NYMQ 3BB1A 5FTJA 4MGIR 421PA 3WMFA 2R6DA 1NJFA 2GXQA 2WSSA 3NDBB 1P62B 1G4UR 3GFPA 5LBIA 3RS2A 3LFUA 2PLRA 4PSVA 3EW9A 3W3ZB 3I3SR 2ZXUA 1S2MA 4W9MC 5J4YA 3W6OA 1LV7A 3BH7A 2H5EA 3GFOA 2IBMA 1U8AA 4F4CA 2ZS9A 3SJAA 1JR3A 2OV2A 2QROA 1CR2A 3A1SA 4F4JA 2ZJBA 3NBYC 4NDZA 4GFDA 4YDHB 5GADl 5AJYA 1J70A 1ZNZA 3U44B 4TLEA 1W36C 2B21A 1TEVA 2W0SA 2XTMA 3T34A 4DUGD 1J8MF 1IXRC 4IDPA 4NCNA 2P5TB 2X77A 4LOAA 5IHPA 2W2XA 3LD9A 2J7KA 4JVMA 4N0DA 1JI0A 2J5XA 1E9CA 1XTKA 2VHCA 3AVOA 3WRYC 4KSBA 2BEKA 2VSOA 1JR6A 1EWRA 3H0KA 2HXSA 2ZEJA 1Z6XA 1EFHA 4OK6A 1KI4A 1E99A 2OE2A 2NGRA 3HDTA 2KWIA 3EIQA 4EJSC 1E2KA 3UWOA 4DRZA 5C1BA 1KAGA 4A0FA 2HF9A 2A30A 3CB4A 4JL8A 4NTZA 1W1WA 2ZSDA 4XD7A 4L5BA 4JYBA 3UK6A 3ZIAA 1G7SA 2VHUA 5HZHA 3Q7PA 1K5GA 1UJ2A 4A36A 1DS6A 1QF9A 4Z8XA 3U7EB 3GP8A 4DWJA 4HLCA 4EPXA 2KB0A 4ZV4A 2J46A 2QSYA 5CITA 2ZJ8A 1G5RA 2XNDA 2P67A 2DFKB 3JVVA 1DOAA 1QG4A 1U2RA 3I8XA 1VECA 2NPIA 1X8LA 3A8TA 2GCOA 1VCOA 2OO7A 3REGA 3QE0A 4B3FX 1Z06A 5EXSA 2ASEA 2E9SA 4LUCA 4HB2A 1KJZA 4I1SA 4JBXA 4NP6A 1D8TA 1YZGA 4Z54A 1EGAA 1G8FA 4EPVA 3ZZTA 3TMKA 5KYKA 3IIKA 1W2GA 1YHNA 1WE2A 2JA1A 1KSGA 4OK5A 1KI6B 3K0FB 3EZ2A 3BFVA 1KZ7B 3IGFA 1TQ4A 2PX3A 3OEED 4KJZA 2XSZA 4JLVA 5FFMA 1U99A 2DWPA 4DLZA 1WDTA 3U7HB 2AK3A 1XTJA 1IJEA 1CJMA 1SXJA 3L8ZA 4CDGA 4RJLA 2GCOB 4DLUA 4CVNA 1W46A 1ZUHA 2IYWA 1GKUB 2W6ID 2WKRA 3B1VA 4JVSB 1RPZA 1N6IA 3GJ8A 4L9WA 5CB8A 4M22A 4OI2A 5FR1A 2XZLA 2RMKA 2OM2A 1XCMA 3IDQA 5AJVB 4NCKA 4ARZB 3CF2A 4JS0A 1OHHD 4X8MA 3BBPA 4R7ZA 5HE9A 4RZ3A 4JLOA 4AI6A 4OJQA 4ABYA 1Z6TA 1RIFA 2GEVA 3LY5A 4TQAA 1XTIA 4BFUA 4WZAE 3SS8A 2NO0A 4Q4LA 1TADA 2OXCA 2W83A 1GITA 1OKKA 1UDXA 5FL7D 1AKEA 3LXRA 2D06A 4KU4A 1PV4A 3PENA 2VP0A 2YVUA 1NL3A 3A36A 2PJZA 2EVWX 2ZYWX 2P0EA 4Q00A 2FFQA 4UNSA 2QNRA 1DADA 2CE7A 4U7DA 1YR7A 2FE4A 3A1TA 1F3OA 1KNXA 1BS1A 5FBWB 1G8YA 1FUKA 2GZAA 3MWYW 5FI0B 4EFMA 2GF9A 2R6GA 1T0HB 5FUYA 2IXGA 2IUUA 3U3JA 3BAFA 1VYTA 1U8ZA 2CNWD 3KKPA 5FUVA 4Q9JA 3ZQ6A 2JLWA 2REOA 5F2EA 1KY3A 2CJWA 1HTWA 2FU5C 2IUSA 3TSZA 4RFVA 4AC9A 1OXTA 4QGFA 4G3XA 4JT2A 4TTQA 3LV8A 2R6AA 4HAXA 4TSFA 1JPJA 2I1VB 1Q3TA 2EFHB 3CZPA 4Q4JB 4MYCA 4FMDF 2IYZA 4P32A 1XEWY 1P2TA 5CIWA 4BEJA 1GILA 1SVMA 3KL4A 4JKIA 3K70D 2V3CC 2XGJA 2K5UA 3QKRB 3QKSB 3QKRA 1YR8A 4TMVA 4K81B 1ZMXA 3WMEA 4A2QA 4HAZA 3R20A 4DKXA 721PA 2V1XA 3VR6A 2W2VA 1NSFA 4YMSA 5B64A 1S4QA 5A0FA 1HT1E 4JLBA 1UDWA 4A2PA 3GJ6A 2QZ4A 1ZP6A 2QMEA 4BLOA 3KQKA 2QPOA 3DZDA 2D2FA 2DCUA 2GK7A 1TTTA 1IM2A 1RJ9B 4P31A 1NJGA 2OZEA 4RD1A 2IUTA 2EYUA 1UKEA 4EUNA 4YMVA 5K8UA 4W5HA 1N25A 3WNCA 2WJHA 2R9VA 3CH4B 5KDDA 2O8CB 2MMGA 1UBEA 2CL7X 1FQKA 2AHOA 4NCHA 1YVDA 2Q0HA 5FL7A 3LNCA 1XBTA 4KFSA 4Q4AB 1GAJA 4P4TA 4IFEA 5KDOA 2HYDA 4QL3A 2BMDA 2X1VA 4BLSA 1XU4A 1A5TA 5JWOA 4DB4A 1N3BA 3LAWA 4M9XA 3T61A 1E2FA 2H7VA 3PG5A 4HDCA 4DCSA 4TN1A 3EPJA 5C4MA 1YZKA 3I61A 4ILEA 2OCAA 2JJ1D 1H8HA 1P9NA 2GILA 2ZUBA 3MSXA 1N6RA 1TQ2A 3Q85A 4OQFA 1NBME 3QENA 2BBTA 3QF7A 4J0QA 1H8ED 2ZSBA 5F98A 5IDVA 4QGAA 3KX2A 2QE7D 5LDDC 1ESMA 1AZTA 4PO1A 5P21A 2ODEA 3KQUA 3MGCA 1IHUA 1MV5A 4N3NA 1HUQA 1G6HA 2ANBA 2ZE8A 4B48A 1X1RA 2DR3A 3AKCA 4FCTA 1BIFA 4ACBA 4AYTA 1YRAA 1AS3A 3ZS8A 3I32A 4ZI2A 2YOHA 2G1JA 1BOFA 2JCSA 4BLQA 3WYGA 1CBUA 2ZJ2A 4L15A 2WWXA 2D4HA 4Q9KA 1R8QA 3TR0A 2VF7A 2IHBA 1QDEA 2AXNA 3N5CA 3T1TA 4ASUA 2QENA 4KVGA 3X1ZA 2UKDA 2DHRA 2RGCA 1U0LA 4GZLA 4RD3A 2GAOA 4TL6A 4PAMA 2QAGB 3BFKA 2QSZA 3ICEA 4GOJA 1E9FA 4TYQA 2OILA 2IYQA 3HJNA 4JL5A 1WQ1R 2BJVA 4OJKA 3VTKA 1N5LA 3AM1A 3A4NA 3G0HA 3BE4A 4EJSA 4RFSB 2VTKA 2Q9BA 4V0MA 4RFSA 3QKTA 4AKHA 5EQTA 2X2EA 1VCNA 2BC9A 3EA5A 3NBZC 4IOKA 5FOXA 3C4JA 3RRNA 4M0LA 3THYB 4M21A 4F7WA 3VR5A 4IHQA 2V1UA 4A0HA 4DLTA 1E9BA 3MG9A 5DSZA 1YRBA 5B58C 3B7GA 2O52A 1OXXK 1NVXQ 4DIDA 5KTYA 1E2QA 2QI9C 4DCNA 2AR7A 3A1WA 1FTSA 5DH9A 4LBWA 4MKFA 4NL4H 4RKEA 3W6PA 4DCUA 1MABB 1RVDA 2CLDX 5JHGB 5TXGA 2HF8A 3KB2A 1S96A 2F6RA 2WIAA 4NKRA 521PA 3PEWA 5DNYB 1XPOA 4KV9A 2ZANA 3E70C 5AUQA 2ORVA 3CPJB 4MYTA 2Z4RA 1JAHA 1N0WA 1OIXA 2ZRDA 3ECCA 4KYIB 2QTVB 1X86B 221PA 3CH5A 4S35A 4QHYA 1SVLA 4MRRA 4RZUA 4V0NA 2GEUA 2ZU6A 3T35A 4GI7A 4CT4B 4ESVA 2O8EB 3FHCB 5G53C 4D80A 3AEZA 3NH9A 1LS6A 4TQ9A 3RANA 2F55A 2J3EA 2GDJA 4CEIB 3VFDA 2GESA 4TMXA 4II7A 4A0RA 4DUGA 4CT5A 4EPYA 3FMIA 2FX3A 3CF6R 4Q1CA 4TT3D 5HTKA 1GP2A 1E2JA 4MRPA 1G4AE 2FJUA 2QRZA 3EXAA 1A4RA 5DYGA 3ZZUA 3TGPA 3EPLA 2CL0X 3L0IB 3GEIA 4LCBA 4EPWA 4AURA 1YR6A 5TY0A 3LW8A 2A5FA 3QKSA 2GVDC 3CLVA 1XEWX 1E32A 2OCYC 1SXJE 2VIIA 3VHXA 4LHVA 1TL7C 3K09C 1VPLA 4M2LA 2HXYA 3B85A 4TLAA 4YONB 1EFRD 3EAQA 4ON9A 3EZFA 1FL9A 2WJIA 5FBRB 1KZGB 5IF9A 2DWQA 2RGBA 3KJEA 4PPFA 1RYHA 1RYFA 3MCAA 4PX9A 1CJUC 3HPQA 3ONWA 1IN5A 1TX4B 5JI3E 1S9HA 3OIVA 5EP1A 1L4UA 3NHAA 2NIPA 3CNOA 4A0GA 1YKSA 2ZE6A 5FR2A 1RJ9A 2O0JA 2QTHA 1IN4A 1ODFA 1QHXA 4BLPA 4F93B 1P9WA 3FKQA 1Q21A 1S1MA 4GRAA 3L43A 3M6AA 4E5UA 1JR3D 3I73A 3W90A 4O2LA 2N42A 5FOTA 4DHEA 2WKQA 1Z8FA 1OLOA 1VYVA 2QUZA 3EC2A 4IW3B 5AK0A 2OCBA 3IBGA 3VHLB 1SQ5A 1VKJA 3F5FA 3RDPA 2B7CA 1CULC 2IXEA 4YXWA 1NNEA 3H2YA 1EFTA 1ZUIA 1TF5A 3SDZA 3K53A 1T6NA 3B9PA 4LBVA 4JLKA 4M8NE 1X6VA 4IRUB 4OL0A 2J9RA 3IQWA 3CUEF 3QPUA 3DVLA 4LX0A 1G8HA 1WXQA 2MMCA 4X8LA 3HWSA 1ZRHA 2WMOB 2BCGY 1TUIA 3K09A 4OHXA 4B71A 5B30A 5SZJA 2C8VA 1NKTA 4NYIR 4UQOA 3W8NA 4TQUS 3LBNA 4IDHA 1TF7A 3VKHA 1KTVA 2C98A 2Q21A 4A8JA 4EPRA 1G19A 3Q9LA 3AGPA 1ZC3A 2ZROA 2XNDD 2F1RA 5FTMA 2WKPA 5KSYA 3IEUA 4HB4A 2FSGA 2VSFA 2WOOA 3RS7A 3N70A 4NONA 3QXXA 1P2UA 4AKGA 3NEYA 5CB6A 2ODNA 2W2TA 1DARA 5KPJA 2RGXA 4PQYA 5JECA 3QBVA 3NH6A 3W8RA 5FTLA 3R9XA 3GEHA 1UBGA 2QL6A 3X1YA 3IUYA 2Q9CA 4JLDA 4CGZA 5GJVC 4Z8YA 2CE2X 4NE2A 2V6JA 2ZRCA 1Q1QA 4EIWA 4WBSA 2ZJYA 3VNUA 1F6BA 3LW7A 1P72A 4PQRA 3TAUA 2BVNA 2IYSA 3T1QA 2VHJA 2W6JD 4D4LA 2IYUA 4LYJA 2BEJA 2OBMA 5SZKB 5GJBA 4TMTA 3QSYA 2FH5B 1R5BA 1W0KD 4CIDA 2GZDA 5HKKD 4OHZA 2PLFA 1A82A 1Z0JA 1N6NA 3QXSA 2FFBA 2WWWA 1XCPA 4C7OA 4H9GA 1R7RA 4NYMR 3AVVA 3GLFA 1U0HC 1W4BA 2ZUDA 3ZH9B 4ZCMA 5H8WA 4TLCA 2RGDA 4PXAA 2XXAB 1KDTA 1IQPA 2YINC 3HP1A 5JLJA 5EXTA 3GLGA 4DXAA 4B33A 2NQ2C 2XAUA 5HR5A 1QVRA 1CR0A 1KMHA 2OFOA 1IBRA 3OFND 3RSOA 3GEEA 1WRBA 1EX7A 3CIOA 3CRMA 2O8EA 2NZJA 4DJTA 1KY2A 1M6NA 3BB3A 4OQXA 4LYFA 5UKDA 1EK0A 1JJVA 3VAAA 1SKYE 3NHBA 4LC1A 3DEFA 3P20A 4R9UC 1G64A 3CRW1 1AN0A 4LPSA 1SVKA 2AN9A 4MGKR 1GL9B 2IS1A 4Q9HA 2GRJA 1II9A 5DHFA 3GQBA 1UKZA 3U7FB 4TTPA 4F92B 4CW7A 2F1JA 5L3QA 3JVUA 4LJ5A 5TARA 4C0HA 4XOIA 3KKOA 2H57A 1DBSA 1DO2A 1ZVQA 1NG1A 2F3RA 2XJ4A 3B1XA 4M1OA 4Q7JB 4PSAA 2ZJZA 1KNQA 1TU3A 3K0EA 2R6CA 5K8IA 2V6IA 4LJAA 3BOSA 2PCJA 1DG1G 5AR1A 5AUNB 1KK2A 1KI1A 3QEJA 2VP6A 3D7MA 1H65A 1XMJA 4PFSA 4XWAA 3VR3A 4E07A 2XSZD 2F3TA 3L0PA 5FBVB 1CXZA 1V5WA 2JAQA 2HCBA 4WW0A 5SZHB 4DT1A 3ZQJA 4G01B 2ZI3A 1ZBDA 4Y0VA 2J0SA 2XJ9A 2AK2A 3CONA 3T1VA 5BXQC 4DSTA 1Z6GA 1AM4D 1IXZA 4BFTA 2C96A 4YMTA 2FZLA 1CKEA 1W0JA 5E95A 4IJMA 1S8FA 2FWRA 1FX0B 1Q1ZA 2IL1A 1IN6A 1QHSA 3THWB 1NVVQ 3JZAA 4MGZR 4JYCA 5TV2A 2ZAOA 1DO0A 3PXGA 3WP0A 5G41A 3TJZA 4GZMA 1GNPA 1XWIA 2L0XA 3AF1A 3TKLA 2QN6A 2PH1A 2ERXA 3B2EA 1E2NA 4QHTA 3E1SA 5CJPA 4NH0A 1FZQA 4ESHA 3EZ9A 1GIAA 2A7QA 1YZNA 1C1YA 1VIAA 5BYKA 3IIJA 4MKGA 2GXUA 3GJ5A 1XPUA 2A5DA 5JRJA 1Q1EA 1UBFA 2V55B 4JSTA 2OFXA 4C3ZA 1E0KA 4B35A 3AVXA 2OHFA 1OYYA 4HZUB 3SN6A 4GMXA 4DDUA 4PANA 1FNNA 4ACAA 2YC4C 2ZYTX 3J81k 1NY6A 3T5DA 2P6NA 1UEIA 1KK0A 4CEJB 4B75A 3I92A 2IX3A 1VG1A 4Z1MA 1D6JA 1OV4A 2HLDD 1NY5A 2BIFA 2IK8A 1RRFA 2H8KA 1E69A 3V4RA 4BFYA 4D0LB 2A5YB 2OBNA 1AK2A 2VLIA 4Q18A 5GJWC 1T91A 1N0UA 3THWA 3TVDA 2DBYA 1I2DA 1G3UA 3ND8A 3PUZA 2F43A 3CWZA 4DCTA 4Q1DA 3NTUA 1FMJA 1TEXA 1CJVC 2SHKA 2WSMA 4TL8A 3RWOA 2QQEA 4PAOA 1NMYA 2J41A 1FUUA 4MDEA 2CLCX 2X8AA 4O3MA 3AKYA 1A2KC 3SE0A 3EIEA 2FA9A 1ZNYA 2C95A 2XB2A 4LPKA 1W0JD 1NI3A 3KUDA 1W0KA 1P75A 1E2HA 4B3XA 4DDWA 1ELOA 2QPAA 4B3BA 4JSYA 1HE1C 4WIAA 2JGNA 4NHOA 3MJRA 3EZ7A 3DHWC 4DZZA 2IYLD 2ANCA 1KMHB 2FZ4A 3AVPA 3ADKA 5JEDA 4LHXA 2WPDD 4URUR 3PUWA 4C9BA 4C0AC 4TT3A 2XTNA 3SYLA 5A5GA 3HU3A 2WZQA 4Q5IA 4HUTA 2C2HA 1L4YA 2VBCA 2P6UA 1G7TA 3K0SA 1PUJA 1OYWA 1G3QA 4QRHA 2WVJA 4URWR 4AG6A 2WWYA 4XJXA 4Q7KA 1II0A 2Z6VA 4UKDA 2Y8EA 4B76A 3C8UA 1S0UA 4E22A 1D5CA 1UF9A 1S3SA 1T0JB 5JCZA 2JEOA 4KBFA 4KHZA 4RZ2A 5CYPA 2OSBA 3SC3A 3SQXA 1AGPA 3CM0A 5F3WB 4BPBA 2I4IA 4IDQA 2JLZA 1NVWQ 3OHMA 2GK6A 1IONA 1G291 3W3AA 4S2EA 2PJRA 3LO5A 3TSOA 1AA9A 4NZYA 1W2HA 4D4KA 3ICQB 4X8OA 5JWHA 3CPHA 1EX6A 2IA5A 2ORWA 2C9CA 2I1QA 1WA5A 4TTRA 4P33A 5J4KA 2O8FB 2BJWA 3B13B 4FD2A 1R5OA 4G5RA 1N5KA 5J47A 1LB1B 5GVRA 1MRNA 1XEXB 2ZETA 2A78A 1Z63A 4LHWA 4V02A 1OH6A 3N2IA 3O8RA 1FTNA 3A1VA 1ZCAA 4QBIA 1OFIA 4LBYA 2BBOA 3TH5A 3AVTA 4M1YA 3GLIB 1FPMA 3R8CA 3U5ZB 2P3SA 1D9XA 4UNNA 3SBEA 1U9IA 4Q4AA 4RY2A 2ZJ5A 3JZMA 4FCWA 1JALA 5AUOB 1YZUA 4OHYA 4HUQA 2IF2A 4JLPA 2F1IA 3HPRA 4BLRA 1SVIA 2EFCB 4HB3A 2GEDA 3RNLA 1P60A 4WXPA 1LW7A 4LJ6A 4ZCLA 1WF3A 1QVAA 2ZRHA 4C4PA 4CF7A 2I3BA 4WXRA 3UKDA 3OIWA 5G3ZA 5KHOC 5DYIA 5J4LA 3OIYA 2Z5FA 4I99A 4MDFA 1TAGA 4PHGA 2PMKA 1W36B 4L4UA 5F9FA 4ZI3A 1XPRA 3LLMA 1WB9A 2ZI6A 2GJAA 5DO9A 3RS3A 1FQJA 1T5LA 4LC0A 2O8FA 2JLYA 2LKCA 4LYAA 2YOGA 3B6EA 4Q1FA 3CZQA 2O8BB 3K70B 4D4MA 5CDFE 4ZO4A 3C41J 1MO6A 1N6OA 2HCJB 2ZR0A 4URYR 2EQBA 3C14C 2WAYA 2Q3HA 2EFEB 3ND9A 1KI6A 1OJLA 1JEDA 1HT2E 2JJ1A 5CLQA 2CCGA 5H68A 3WHKA 3IKJA 4US2R 1NN3A 5DHAA 1YQTA 5JRZA 2C99A 3QG5A 4M9ZA 3PJRA 3MFYA 3UIEA 4YDSA 4DT1B 1JEEA 5L8VA 1XJ0A 1US8A 2V7QA 4MKIA 2AWNA 5HCNA 3F3YA 1M7BA 2RGGA 3U4QA 2YKGA 2NG1A 1R5NA 3KXLA 2ZRGA 2RHDA 4EJSB 4FIDA 1KMQA 1SXJD 1JXMA 2VPPA 1D2MA 3BFXA 1YJ5A 3D8BA 2ZM5A 4R2IA 2W6IA 1G3IA 4A82A 3RAPR 1E79D 1CR1A 1Q1BA 2AKYA 2O8DA 2HEIA 4NMMA 1SVSA 5E7MA 4Q03A 3PEVA 3QVUA 2C04A 1KKLA 5DGXA 1GRNA 1WCV1 2HUPA 4TWZA 5KSZA 1B0UA 3X1XA 4M9SA 2WAXA 1LF5A 3BC1A 3RRMA 3ZS9A 1W4RA 4XWOA 3B8HA 2W58A 4JBWA 1EFUA 1PVOA 5ANRB 5DN6D 4DEXA 5FPSA 3EPHA 3IEVA 2XOKD 4RCYA 1G5PA 2ZUCA 1LNZA 3PCRB 3R8FA 3R9IA 1TMKA 5EE1A 4DCVA 3OE7D 4Q01A 3ZIAD 1LY1A 2FV8A 3K9NA 3X1DA 1U0JA 2QTFA 1M34E 1E0JA 1IOZA 1G7CA 2ZRPA 4FN5A 1SXJC 4HLUC 4Q7MB 3K9HA 3Q5DA 1ZINA 4ASUD 4FCVA 5CK5A 4Q02A 3RABA 4KFUA 1BO6A 5LD2B 3TW4A 2OFWA 3ZLJA 2F7SA 1Z3IX 1JR3E 4LHZA 1WBDA 3EX7C 2OT3B 3K9LA 2Q3MA 3HU2A 1R8SA 2XZPA 3VNVA 3RYTC 4BLTA 4LJ9A 3TVTA 2J1LA 1G6OA 3ZVLA 1XB2A 2OUKA 2W0MA 2GJSA 1DPFA 3LQQA 2G1KA 3U2QA 1ZNXA 3HYTA 2W6JA 2QP4A 4KVAA 4GP7A 2QEQA 3CF0A 5C46F 2QM7A 2ZRKA 4BASA 4IXMA 1RE0A 1ZNWA 2BM0A 4MUBA 3DDCA 3DM9B 3RVBA 4MQBA 4O0MA 4UXJA 1QRAA 4FWIB 5EZ6B 3WRXC 1D2NA 4ZKDA 1VHTA 2JJ2A 4LV8B 2PZEA 1T3LA 1NBMD 5C4GB 1MABA 2ZI4A 4OYHA 1CLUA 1X8JA 3QEOA 1ZM4A 3BORA 4LSGA 4U02A 1E2GA 2GAAA 5KPDA 3FKSD 4IDOA 3W5IA 2NO1A 4ZIRA 2E1RA 2PZFA 2JDIA 1Z0DA 3DO6A 3ETLA 1BKDR 2QMOA 1WP9A 2WM9B 1JB1A 2RCNA 3BH6A 3EWAA 5DN6A 1E9DA 1NKSA 4BGDA 3BB4A 3LX5A 1OH5A 5JFGA 1A1VA 4BE7B 1ZM2A 4FMBB 2P5SA 3X1WA 2CDNA 2QU8A 1L8QA 3BIFA 4V03A 2O8CA 3P32A 5K8LA 3NBXX 4JLAA 1H8HD 5JJKA 1C9KA 4Q4HA 1Q57A 5JI2E 1GKIA 4P0TA 4MYUA 3LRPA 3LQRA 1P5ZB 4RSGA 1K6MA 3A4LA 4YLGA 3ZVMA 1GL7A 2ZPTX 1NN1A 3ZJYA 2J0UB 3G5UA 1KSFX 3WBJA 3SR0A 3LA6A 2YHSA 2PCLA 3G82C 3KQNA 2NMVA 3C16C 1KI9A 2FGJA 4G0NA 1Z07A 4MA4A 4DVGA 1VCIA 5L3SA 4LJ8A 4A8JC 1KI3A 1R6BX 5HCIA 4OI1A 1COWA 1AJEA 2OLJA 1E6CA 3SJZA 5BN3A 1M7HA 4HDOB 4F91B 1E4VA 3UANA 2C77A 2YYZA 4PQFA 1XZQA 1PLJA 4KSCA 2ZQ5A 4KAXA 4TL9A 3FTQA 1X8KA 3FGNA 1CTQA 4XIGS 4Z1MD 3WMGA 1AS0A 3ADBA 2Z4SA 3OFNA 2IWRA 4W5JA 2QGNA 4BFWA 4KODA 1NMXA 1T8UA 4WVFA 1OFTA 3GCGA 2YC2C 1ZCBA 3U61B 1M74A 1CR4A 1E1RA 2Z43A 2BV3A 3PQCA 1Z28A 3B1WA 2MSCB 1Q22A 3HU1A 5BWMA 1ZU4A 5FOSA 3REFA 5FPYA 4MYHA 4C0KA 1VDZA 2KSQA 1NN0A 1N6HA 4BUJA 2CCJA 5KSPA 3D31A 3ZZ0A 4PO8A 5G3YA 1DVRA 3UMRA 3A58B 4AKEA 2NO6A 1NRJB 4M1TA 3TSWA 1SZPA 3PUYA 5L3SB 3CW2A 2LCFA 5FBQB 3PEYA 1WBBA 2CJWB 2J45A 2ZVQX 3L8YA 4JVLA 1ZAKA 4M1MA 1N6LA 5CYOA 1LTQA 2AX4A 2BOVA 2WWHA 2IXFA 2YNMA 3IQXA 1FMLA 2G83A 2P2LA 1RKBA 3MJHA 3QY0A 2JATA 3N2EA 1Y3AA 3B5JA 3RC3A 1E9AA 4US1R 4DLRA 3R9WA 1DAMA 2ZR7A 2Q9AA 2VEDA 5AJWA 1KDRA 4L9SA 3AVQA 4NCIA 1U94A 2V4ZA 2QA5A 3GJ0A 1QBKC 4POAA 3RWMB 1KIMA 2XITA 2ZRJA 1W4AA 1NIJA 1XTRA 1XRJA 2CHVA 2ZITA 4HB0A 4LGMA 3GLIA 3BH0A 2WTUA 4A6PA 4BQSA 1GZSA 3RS5A 2AFIE 3QG1A 2CEAA 3CNNA 2IYVA 4US0R 5KNDA 1QHYA 4JLJA 4QFMA 3THXA 2LKDA 1E96A 3LBIA 4Z51A 3KXKA 4GT1A 4YC7A 3THXB 3FWYA 4E03A 2ERYA 1KKMA 2QMUA 5FL3A 1X3SA 5E7JA 4CEHA 3GLGE 2CHGA 2EWWA 3IHLA 4Y0AA 1CIPA 2WV9A 2ZYUX 4GP6A 3SEAA 4PHHA 3WY9A 1Q0UA 4JBYA 3MUFA 1GRQA 3NIBA 3P26A 2B92A 3F0TA 4QNRA 1E79A 4HYYA 5DISB 5B57C 1FFHA 2GNOA 1ZIOA 1ZM3A 4D0NA 3OAAD 4FINA 1CRPA 1XTSA 4IXNA 5JSZA 4LY6A 2ZAMA 2QM8A 4AG5A 1NG9A 2QBYA 2Q3FA 4C0LA 3FMFA 5FUWA 5DE3A 2C03A 2YWFA 1HA3A 2CK3A 3VR2A 3NWJA 2WWIA 2CL6X 4O2RA 2RGNC 3NC1C 4EFLA 5JWRA 3HR8A 3O8BA 1T3SA 3LX8A 3K8YA 1IXSB 3DZ8A 1P9RA 4WOPA 4XWKA 1RFLA 1A7JA 1MOZA 2C5LA 5FOVA 1LF0A 2NPFA 1G5TA 5JMTA 4B73A 3AKEA 2HT1A 5FBLB 5FOWA 4I1UA 1P2SA 3CRRA 1P6XA 1ZM7A 4MKHA 4Q66C 4N1AA 2EU8A 2ZVPX 4Q9IA 2D74A 3C7KA 2HJGA 2A5GA 1AZSC 5EP4A 1T8TA 3QIAA 3TUJC 4A9AA 3KJGA 3EPKA 3W5JA 5JS8A 2VHTA 1GM5A 4UJ5A 1W4CA 5E7IA 1X1SA 1G21E 2KBEA 4G5SA 3K70C 4DDVA 2NO9A 2ZSFA 1XMIA 4BRWA 2IYTA 3A37A 3QXCA 4A15A 2FF7A 2VYFA 3CRVA 4UNQA 2OBLA 3UPUA 1W47A 3GFTA 2VP5A 4JJZA 3IO3A 4XTCS 2ECKA 2RH5A 3OEHD 1SKYB 3CKLA 4TLDA 4OI4A 4RKFA 2ZR9A 1EWQA 2PL3A
chains in the Genus database with same CATH superfamily
2A57A 1DFIA 1ZGHA 5EJFA 3DOIA 2G0AA 5FH9A 5JNLA 5JS7A 3K6SA 1Y3CE 4MV3A 3QVWA 1TD1A 4KXFB 5TMEA 1EP3B 1T9GS 4O1HA 3FYTA 4QUEA 4W82A 3Q3VA 3RQSA 2PKXA 3GW8A 4MWOA 4ZMSA 1J2JA 1LD3A 2MINB 3S40A 3OBIA 3OOEA 3NFYA 3WBFA 1QIGA 2EJTA 3ZOZA 1DG3A 3E7XA 3HRIA 3NGLA 4J7UA 2YWEA 4QNNA 4UBKA 1JI3A 1GPAA 5KNCD 1Z6AA 1ENPA 1NC1A 3S5UA 3A3KA 2PEYA 1ACMA 5TC4A 4BECA 4C3VA 3MPUA 5K8TA 1DKUA 1P2VA 2XZTA 3H5LA 5C8YA 4B2LA 2RKOA 1I7NA 3P45A 4QTUB 3JARB 1II8A 4MKXA 4PLFA 2CUZA 2XUGA 1WCXA 4FYWA 4DW8A 4MUMA 1U2EA 3IA7A 4R8LA 1XAGA 3ZHOA 2WYHA 5LD2C 2RHHA 4YYEA 3VSBA 4O4HB 5KYGA 5DFAA 1UC4B 2G36A 3DB1A 3E6AA 3TS1A 3MLEA 1L5YA 4QX6A 2H1HA 4PC2A 4I9HA 4JCOA 1U2PA 1K3UB 2IYXA 5HKBA 3SZOA 2IS4A 3FNQA 3SDBA 1XJQA 4G25A 4H7DA 3M4XA 1I30A 5FUXA 1N3IA 4CIXA 2ZQYA 1KGDA 4JELA 3D6FA 3GVHA 3C5WP 3NHMA 5T6BA 5BNZA 3E9EA 2BP7A 1FSZA 1KOGA 3E61A 1OFHA 4ZHSA 3CUUA 4ATNA 2REBA 4JBIA 3O92A 3ZVNA 4E31A 2AXEA 5FXMA 1OVGA 1HMYA 3IC5A 2IU3A 2X4GA 3LC7O 2E5WA 2HEGA 2QRQA 4IRXA 3Q7SA 4IIXA 4B47A 1UODA 1C80A 2AD1A 3FPSA 3KXIA 4GI1A 4WJKB 3H86A 1NONA 1KI7A 3WNDA 4NYIQ 2FWMX 1OTHA 1W5SA 3K0HA 3OLYA 1DAPA 2CJFA 1SCDA 4R2WA 1O2DA 2PA0A 1JHDA 1NR7A 4HWRA 4I81A 5K3SA 1CIVA 5BSMA 5LYJB 3A2LA 3D2BA 2VAVA 1UANA 3FIUA 1IEWA 2C7VA 4XDGA 5JJLA 4PPGA 4BQNA 4ZJYA 3AL2A 5H3HA 1OZHA 1AUOA 2XYQA 2HHCA 1YZYA 3B1FA 1ORTA 2O57A 2QLLA 1FSGA 2R87A 2ZIFA 4OAQA 3QE9Y 1A95A 1ULUA 3HC7A 2FUG6 3RSQA 1E92A 4BMYA 1DBPA 5KU7A 2GTIA 1OW3B 1YI1A 1U1CA 3HL0A 3R7WB 1T0IA 1GSIA 5K4GA 1H6CA 3Q6MA 4QIHA 1RLTA 4UXIA 4XD2A 3TR6A 3VZSA 1HT0A 2H2FA 4IEEA 5JCOC 3FIJA 1FTYA 4P83A 5HE8A 1XQ1A 2YQZA 2YVKA 2ZREA 2IWHA 3ADCA 5BQOA 3W3AD 1XKXA 4HVCA 2PANA 1N6PA 3SQOA 2KJQA 3WLHA 5BQ3A 2OEPA 2E85A 4HZIA 5HNKA 1WVGA 2I33A 4GH5A 1FFBA 3CRNA 1ZUNB 4A6EA 3W5AA 3T9DA 2D8MA 1VC2A 3LWBA 4OEHA 3F6YA 4V0OA 1CQZA 3MINB 2JGMA 4JB8A 3QYFA 1M2FA 1AE1A 3AF4A 3M83A 4LZZA 4MQ4A 3WLRA 3A6HA 5BVGA 1KSJA 4B6SA 5BWCA 5F9HA 4M0DA 4TZ6A 1EVKA 3RUDA 2R2AA 4A26A 4BMCA 3CEJA 1LQ2A 2AZTA 3T5PA 1TVKA 4HNSA 1XVAA 5FTNA 1A7KA 2GQ0A 1DUSA 2JIMA 3D4OA 3R7LA 5GJCA 1VM6A 4RGYA 1ENOA 3GDWA 4H7JA 2VQSA 3GRZA 2C78A 5EFZA 1ZHHA 5GTDA 2CXXA 5HUJA 3WADA 4CM5A 2VJCA 1JDBC 1I9CA 4PZUA 2XLBA 3Q4GA 4R8MA 1N1DA 4AZ0B 1EGMB 3ELBA 4B5LA 3A1CA 3ZY4A 1I3NA 3R6TA 3TZQA 1GG2A 3Q72A 4IX9A 1V16B 2W90A 3VGPA 3JQ6A 3GV0A 4XOUA 2ALJA 5EE9A 4U6QA 1MO5A 4G4SP 1DIRA 2FGKA 5JD3A 3CCFA 2IZ6A 5JAMA 1I94B 5AJUA 1M0TA 4HEJA 2RHCA 4BFVA 1RQNA 3TN7A 4CLHA 1S1CA 2JL1A 3EZXA 1JECA 2L82A 3PKJA 5TPWB 1X7ZB 1QZ3A 2FJPA 4J3JA 2IQIA 4YQEA 3X3HA 4AMGA 3D8NA 5F23A 1ZU5A 3BGWA 1IEVA 1Y98A 4TWAA 2QBYB 2QP9X 3NR2A 3QFTA 4R16A 3B60A 2WM3A 4YI5A 1C8BA 2XVMA 1ZIPA 1O6FA 1HEIA 3CW8X 5D3MA 4G41A 4TYNA 1FLNA 1DAGA 5CYGA 5CM8B 2A1UA 3SC2B 2H2IA 2VNSA 2CV1A 5ALRA 4KO3S 1J1ZA 3G88A 3VDMA 1PJ8A 1ZX1A 2FMUA 3BDVA 4B2IA 5A2GA 4U63A 3IRUA 2YWHA 2EJUA 4MS4B 1PR0A 1FP4A 3O4VA 1J5EB 4NPHA 2DQSA 1DKQA 1SPXA 3RS4A 1EUDB 3WISA 4EG0A 5EZ5A 1XMVA 4JJGA 4RPCA 5ICEA 5TS2A 3C3WA 3JARA 2O6LA 3D4IA 4Q1AA 1M66A 1E2PA 2DG2A 2AL7A 2DH6A 2G9QA 2C2WA 2Y05A 1C9NA 1IIBA 3AIIA 4AS3A 3IEMA 2XF2A 4BMNA 3H87A 5ADVA 2IPLA 2VBGA 1DE0A 5THKA 1M5UA 1QRDA 3K9WA 2R8YA 4WLNA 4U5QA 2YZKA 3GT0A 4HAVA 3EASA 4EL5A 3E3LA 1UMCB 4ITVA 3VOAA 4EY7A 4P4UA 4TRMA 2OXRA 1LI7A 3CXUA 3D6AA 2CZQA 2PZGA 5JV5A 2HRQA 1ICEA 1RR6A 3K0CA 1U0TA 3DMNA 4P34A 1T8SA 3INYA 3HR4A 3RRYA 3ZDAA 4OB6A 1FDOA 4LW8A 3CUKA 3NC0C 2FVXA 4UEKA 1YD7A 2IHJA 2FR1A 2YXEA 5JALA 2W6OA 1QZUA 5K0LA 1EDOA 1TJ3A 5AXAA 1R18A 2PUFA 3LLUA 1XROA 4UREA 1XNRB 3QI2A 1DT3A 4JAVC 1BH2A 1U4NA 3I1FA 1P0QA 3RVLA 1C8LA 1RPNA 1TVKB 3HHPA 4GU5A 4H35A 1EQAA 1AXGA 2QW8A 2QUBA 2Z2XA 3I5UA 3L0SA 4PSKA 4R6XA 3WYNA 5HIKA 1ZL2A 3GEGA 4G4IA 2GAJA 1A50B 3OURA 4MRSA 4B6FA 1XNJA 3C5CA 4IV0A 4JP8A 2OR3A 3SNHA 3LX4A 2PZMA 5E3IA 1QOPB 2Q3DA 4LYGA 5FQNA 4QGHA 3VDNB 1CUSA 4DTCA 4MK4A 1MV8A 5B37A 4C0BA 1DTSA 1DCFA 3ZE9A 3L8HA 1T0PA 2I4TA 4B32A 3EGDA 3G5AA 4C7OB 2H0RA 1L1RA 3P2IA 3QVJA 4D4JA 2J4CA 2X14A 2UYYA 2IDMA 2CSUA 5AKEA 3OAAA 1A7UA 2P7IA 2NVUB 3FNEA 1SBIA 2OXTA 4EELA 3EF1A 4J0HA 2DMRA 4DC9A 3NM5A 2HI0A 3OCXA 2FFRA 2B4AA 2Y1WA 4FGLA 4XR9A 5CR9A 4ZEVA 2JFPA 1V1MA 3O8QA 4Z9XA 3TEJA 2I3AA 3AXTA 4YRAA 5B1SA 4P08A 2W43A 2DH5A 4XSHA 3V7UA 5BUCA 3T5AA 1PEKE 4JKOA 4PONA 3KQHA 1ZXXA 2FY8A 2VP4A 1VSTA 2NOAA 1SVWA 1U0NA 1I3KA 1E77A 2GBLA 2ONKA 5JQGB 4MGYR 3VR4D 4X1YA 3ADOA 3MJEA 3G1TA 3KKMA 3I5YA 3Q6NA 5J5VA 2DY0A 3LA8A 4CQLA 2FKNA 4TYWA 1JLLB 2B9VA 2HO5A 5JSFA 1Q91A 1LDYA 3G6WA 3E9ZA 2NT3A 3AM5A 1BD4A 2Y66A 4GYWA 4TUYF 5CPFA 5CW2A 3V00A 5HPYB 1FIUA 1HE8B 3EARA 4KRGA 3UMYA 1JDTA 3L0DA 2PBRA 3KT3A 3O84A 3RRXA 2GKSA 2WK1A 4KIJA 3R7DA 3VDRA 4DNFA 4YBZA 3DAHA 1P77A 4EAAA 3S28A 5I9NA 3U5TA 1HNWB 2QM3A 2RI6A 2IC5A 2XE6A 1YJXA 4JQYA 5FLYA 2D4AA 4OHCA 5MN5A 4HBGA 1QIJA 4AP5A 3VDXA 1AF7A 5AKYA 4F3KA 1TIPA 3PXXA 1Q0SA 4KLNA 3S1AB 4K0RA 3GBVA 1YR9A 2C9YA 1UJNA 4FFSA 2NUPA 4LZNA 4QC2A 5BYJA 2P6MA 2Q3JA 1P18A 2EFYA 1KJYA 5T8KA 1HDCA 3RHZA 3DBOB 1ZRSA 1JXOA 3FZGA 3HGMA 5EINA 1QHEA 2BM9A 2QG9A 2VYND 1WBJB 3C8DA 4UBIA 5TT1A 2A9PA 2IQ5A 2CK3D 2HWKA 2EHDA 2I4MA 2FZVA 2OBBA 4G36A 4RHTA 4WNCA 3T7JA 1E7SA 1H1DA 5ERXA 1N2SA 2PEZA 3P2YA 4BJ5A 5C8DA 2OESA 3BCHA 3T3DA 1C7ZA 4Y98A 3M8KA 1E4YA 1U3UA 3F73A 4IMPA 2NLOA 1TI7A 1KHTA 1RHUA 3LDGA 3I1YA 3CNBA 2GM9A 4CLOA 1FSFA 3WLIA 3OCWA 1UH5A 5LNK6 1VCHA 4U8HA 4ZQGA 4CI0B 3QLEA 3MT0A 1Q0ZA 4NCBA 3AJDA 3ESDA 1C5KA 4X92A 2EBWA 2ZDQA 3OQMA 4GIBA 4NU0A 1D7AA 2P6RA 5GZ6A 3I58A 4ALJA 2IHYA 1U9IC 1EJ2A 4QBGB 4PCUA 4RD6A 2XUDA 3SEFA 1K7YA 4OQPA 4QPDA 2MIIA 2IYNA 5KBYA 1RXVA 4G8BA 1XZEA 4F71A 3UFXA 2GCGA 5DNDA 3V2HA 4N65A 4MW6A 1KOFA 2R6FA 4LV6A 3ROMA 1L3BA 3HWX1 1T1GA 4LDJA 2Q6TA 1D7OA 4D6YA 1NAHA 3K31A 3ZX5A 4A10A 2DBVO 2NZXA 4TLMB 3JSAA 4TYMA 2FMFA 1BYIA 2ZU0C 5C51B 1RVV1 4BV9A 1W7AA 1LBSA 2ODBA 1FDSA 2Y76A 1Z4KA 2WU1A 1KYIA 2WP0A 1XFAA 2POQX 1D6SA 1D2HA 2N0SA 3GD7A 1MQ9A 1B93A 2FQQA 2RH9B 4IHAA 4DIEA 5CA1B 1PKXA 2ZRIA 3KZ1E 2O2XA 1M33A 1LVGA 4TWJA 2Q29A 3TRJA 5BVHA 2PRSA 3FKSA 1PE0A 4ZCRA 2Y0CA 1HZZC 4BDSA 2QRLA 1VE3A 2H06A 2K6GA 1ZS9A 4C43A 4QODA 3E9NA 3CEPB 2ZTSA 2W71A 4H3HB 4YJ3F 4EG4A 3MLBA 1PDOA 1QS0A 6Q21A 1RZVA 3F8WA 1KE2A 3M1YA 2WWGA 2ZJAA 1AXRA 4B6RA 5L45A 3MWEB 3BE8A 1QK4A 5KAPA 1I4TD 3U3KA 3CZ4A 3FPEA 4XSGA 3NIDB 1DLJA 2PFSA 1F1BA 4I66A 1UEJA 2JFWA 4P81A 3V80A 1PS9A 4EFMA 4BBZA 2HDNB 1TLFA 1OGIA 2CFOA 3CPEA 2AKAB 2AI3A 3DSRA 2ZS7A 3B70A 3R3YA 4K26A 1USGA 3ESZA 2I4LA 4C7BA 5F78A 1T9BA 2HRRA 4K5QA 3NNNA 1GV0A 1WABA 4MIOA 3VNRA 2B2NA 3OX2A 1JG6A 3VPBA 4MS3B 2QW1A 2XMGA 2HYIC 3AG6A 4KMMA 2QL5A 3UCEA 3VTZA 4O2AF 3VISA 2J3MA 5LNK1 2FSIA 2D2EA 4YRSA 3F71A 4KR9A 5I9LA 3IV9A 4ZVVA 3U6BA 3DMFA 5IC5A 3WWCA 4AWAA 3CLSC 2JFUA 2EFGA 4DLWA 3C3BA 2E3JA 1C7RA 3FFWA 4WFJA 4EZEA 1FQOA 4YWHA 5LZ4A 4O25A 4PZ0A 3LBYA 4U00A 5KX5B 5M5BA 1K9VF 2PUAA 4KLRA 2JIBA 1PJLA 4HS9A 4KO2S 1YZLA 2AN5A 2EQAA 3D4BA 3WP1B 4ZEMA 1Y6GA 3KVVA 2C29D 2QQFA 2QLNA 4OP3A 5DLQC 4P0PB 2Q50A 4LGCA 5DULA 4EQ6A 5CXUA 2VO1A 2WTNA 3DEIA 4FKZA 1JHMA 2I76A 3MD9A 3E03A 4B46A 1A88A 2F48A 2CVHA 4F72A 5LQJA 1WLSA 2EAUA 4CEHB 2OHVA 4UM7A 4URVR 3EAFA 4YRNA 1XLVA 1Z37A 2OAQ1 4YUXA 2PL5A 1VKHA 4ZAYA 4C0JA 3V1NA 1HFWA 3IT0A 4CGYA 1VRCA 3QEAZ 2BSAA 2I8AA 3NM6B 4QGGA 1NBMA 3SU8A 5G2OA 5K0BA 1B8PA 2IF0A 1S3GA 1Y6FA 1Z5WA 4YALA 5JMWA 1L4GA 1NQAO 2BKLA 1FNMA 4JT4A 4G84A 4QATA 4ZYWA 1E98A 2RFLA 2F8MA 4N41A 2Q27A 3Q6IA 1QG2A 4FXPA 4UMDA 3IB6A 4KQ1A 4BWYA 2UXCB 1GGNA 1Q1NA 4L16A 5E9AA 4WUVA 1MTOA 4LMPA 4DG9A 1NULA 5K0NA 1CEQA 3EIFA 2GLTA 1TFUA 3FDXA 3H5NA 3QKWA 4QUJA 2R00A 2W8ZA 3FCEA 1Y89A 1JQJC 4JBHA 3OH8A 1LWNA 4JMPA 3EOZA 5CVTA 1E1RD 1UBUS 1YR2A 1C7IA 2OO3A 2NVWA 1DAFA 3AJAA 3M1IA 4IH9A 4MVXA 4PHFA 2FDCA 4HDSA 3T12A 4C6HA 2RONA 3AK4A 3OQ1A 3QLUC 4RDIA 3KG2A 4MQFA 5E2AA 2ZYIA 3RPEA 1GAWA 3MMPA 2GN6A 1ZW6A 1OX4B 2C84A 1UKVY 2X23A 1VPTA 3IUPA 4PZYA 1U6JA 3EF3A 4R51A 4DLBA 4L08A 3AKDA 5A4JA 4Q37A 4MI3A 2WYVA 3UQZA 1QHFA 1VSUA 1E3TA 2WJGA 1MGOA 3IIIA 1J8YF 1RXUA 1U04A 2BGLA 1D04A 2B1IA 3MWKA 3NKVA 3OQBA 4H7KA 5FLKA 3VPFA 1XDUA 2QPLA 2XYVA 4CCWA 4ZCIA 2M6LA 1UFQA 1OROA 4Z4QA 5FKJA 4AD8A 2LIPA 2CJXA 2D7DA 1JG2A 1QFJA 2EARA 2JGKA 2P65A 4MB2A 4QXRA 4JJEA 4B3MB 1VMDA 1QHHA 3ZNQA 4QU0A 4C88A 3THYA 2VP2A 3MQ4A 4MV8A 5IXJA 1R4AA 1SUBA 1YVUA 3OQIA 5CIQA 1YCDA 4Q6BA 3M3HA 1BDBA 2C9ZA 2GTPA 5AK3A 4XARA 1DKMA 2XB4A 1FFEA 1J4AA 4YK7A 4Z9FA 2O8BA 3BFPA 3ZVRA 1N3YA 4XTRA 3U4MA 1VJDA 4G8DA 3IKMB 1DBRA 4BMOB 5JPCA 4W7IA 3QVGB 2NW6A 4RULA 1HURA 3DT6A 3GLFB 1A9YA 3G9XA 1M0SA 5TEVA 2L69A 4GQIA 5JBQA 2EEZA 3BD9A 1QYCA 4K9LA 13PKA 1FXWF 1QVZA 2QN7A 4IOMA 5EN4A 1LPMA 4DCJA 1MW8X 3H4MA 2BEVA 4JJ4A 1PJ4A 4DLYA 2AMFA 1L6RA 3ZYCA 4PZDA 3HYRA 4I8XA 2VHXA 1MMFB 5E0OA 3T15A 3BIJA 2E5FA 3OUZA 4QEZA 4RQBA 3ZGOA 4BNNA 1ANKA 5EP2A 4ZKEA 4F06A 5KKNB 1LLUA 2WA2A 7MHTA 1RHJA 1GAEO 5ALHA 3BFJA 5BSHA 3B53X 4JI6B 3NBFA 4AKIA 2XUPA 1M8JA 3HXOA 2NYAA 3O91A 3JALA 4GW3A 2AUMA 1GTSA 3ASYA 2ECQA 1JJBA 2NZ8A 1E20A 3U56A 2JDID 1GPKA 4FYIA 4F4UA 3VO2A 1GHTA 2C5FA 3LVRE 5H3LA 4JWKA 1F8UA 5TF4A 3WGJA 1NBOA 3PT5A 4RC9A 2PMCA 1SBHA 1NW9B 1U90A 1Z8DA 2FG5A 2HSEA 3S1LA 1HDIA 621PA 2G8LA 2AFVA 4NS1A 2X8LA 3FCUB 4BZQA 3QQ5A 5EEGA 2GI4A 1O95C 2Z56A 4Y9DA 3ZNNA 3N8GA 4M55A 5HQJA 4W5WA 4BNKA 5LLTA 1NZDA 4C2UA 3E7WA 1ZQ9A 3VX3A 4PC6A 3T7CA 4KW7A 3TO5A 2FPSA 3VVCA 1T4GA 3MFQA 4ZVTA 2BMJA 1O6GA 3DA8A 1K7FB 2FYTA 1UWKA 4YRZA 5B55A 1B8OA 3C15C 3ZNPA 4LMBA 3PF9A 3D6JA 3T1OA 4JI0B 1AO3A 1GZ4A 5JSKA 3PPWA 3DZJA 3ETCA 3I5AA 3RU9A 4FCCA 4FFLA 1NUTA 3OIGA 3OZGA 3EAGA 5B6PA 3ZWOA 5ALOA 3P0IA 4EB6B 4UHDA 1RTKA 4BZPA 1QU3A 3ZCQA 1UPXA 2H5JA 1VZ3A 4Q3LA 1IVNA 1EFDN 2FDRA 3TIFA 1XZPA 5FEUA 4OLFA 4FW9A 1GYPA 3M81A 5A5EA 2FN4A 3D8SA 2XA2A 1X0XA 2EWMA 4KPUB 5IZCC 4FZJA 5AOCA 5LDGA 4L0QA 1K6XA 1OE0A 2EP7A 1QYRA 4N8DA 1NNLA 1WMSA 4K6GA 2OFPA 3IMKA 4WKOA 5BW8A 1PD0A 3I9FA 3HJUA 4UHCA 1G9TA 2KX7A 1KDPA 4DQVA 2UDPA 1KEZA 4LRWA 4C3OB 3IQEA 4X1IA 4K6OA 3A1FA 2G09A 3DQZA 4LI0A 1MHTA 3FWPA 3KPWA 1SWWA 4V0KA 3ZU5A 3E2MA 2WZDA 3BZWA 4HDRB 1OYOA 3RODA 3VR4A 1U9JA 3CCCA 4UFOA 4MVJA 1NWHA 4DZTA 4KDEA 1E1CA 1F9AA 2JGDB 3EODA 2PO5A 4Q1BA 1NR1A 4YJGA 1OB5A 3A9UA 3ASVA 3N76A 3GAAA 3AP3A 1FXWA 1FDWA 2RGNA 4D42A 2FP4B 1Q12A 1Z73A 2FN3A 2XX3A 3KFVA 1UADA 1Z4PX 4MEJA 1JHPA 1S6YA 4EW6A 4O2BA 2CYBA 3Q7QA 4M4SA 9ABPA 4AY2A 1B1CA 4NOMA 1ZYUA 3ZEIA 4M53A 5SICE 2VPWA 3PHGA 3DMTC 3LXMA 4X45A 4J4HA 4ZIRB 5H80A 2RHTA 2BTOA 1CRQA 3R40A 2XUAA 1GTVA 5KQMA 2HRDA 1JUDA 1KVRA 2G88A 3JD2A 2R4UA 4OXXA 4UOZA 2IH4A 1P2DA 1C0LA 3GLSA 2VK2A 3SY8A 1JPVA 2WJAA 1JQ5A 4RWZA 4KNYA 3D7SA 1W44A 2PUTA 4KQJA 3CGWA 4WAUA 3ZD8A 3EFOB 2ZIVB 3N2GB 2Q6VA 4AQYB 4RPLA 4ZGGA 3IT3A 3QHAA 4H1VA 1QR6A 4DLVA 3EUEA 1KK3A 5EJGA 4CQLB 5ALEA 4QJ4A 2P8JA 2AOXA 2GWHA 2Y0DA 3K6KA 5KCZA 3QTLA 1SEVA 1R0SA 2AWOA 1FJGB 3D4LA 4FYKA 3R7FA 3BKXA 5LM3A 4GE3A 2JGRA 1SHKA 1OSNA 4ND8B 1EPUA 3IQDB 1Y1TA 4Q19A 5F73A 3URKA 4DA6A 4BEWA 3W7VA 3G0GA 3RVMA 4A0QA 4DDTA 4TYYA 1OXSC 5EUBA 4X64B 2FPKA 3A1UA 4TZ0A 3ETJA 1DC5A 3I53A 3KQQA 4JMLA 5ER9A 3QXHA 1Z6ZA 3C8ZA 1E9EA 1HY3A 3FB4A 4M1EA 5IK2A 3TW8B 2R6R1 4AF7A 4JVNA 3DDWA 3O6VA 3DO5A 3PZBA 1XNQB 3PXUA 4GKBA 3RT7A 2LP4Y 4HNQA 2HLHA 4HQ6A 4S1OA 4ZP1A 5B1DA 2Z95A 3HLYA 2E4WA 3TRFA 3M9LA 3MUEA 1P4SA 3OF5A 1WOYA 5C5DA 3DBHB 2VDOB 3D3JA 1PLLA 4GGMX 1YVEI 1KWKA 2ATXA 1M2WA 2CLMB 5IKMA 2PRJA 4J0FA 3F7NA 3IOCA 4FDMA 3PTLA 4E09A 2Q5QA 4J29A 4MS1B 4NYJQ 1PNTA 4ISCA 4QUGA 2ZSAA 5EIOA 3EIXA 2I3ZA 5F77A 1WMEA 3QBTA 5BVHB 1E59A 2QMHA 1A8SA 1P81A 1XYVA 3BGSA 1W49A 2QAGC 3WGHA 4C2TA 2R1VB 1EFCA 1IY2A 1WV0A 3AJEA 1E2MA 3SIXA 3E9CA 4ZOLA 2R8RA 3WYFA 2IZ0A 1C3LA 2O06A 3KP1A 2DQZA 4UM9D 3ZN2A 2G08A 1IG3A 4YRRA 1MPXA 3IHWA 5HHTA 1FFYA 2QAGA 3QIVA 1YUNA 1ZGZA 4LSWA 1CF2O 5THXA 2CCKA 1NHGA 3Q5EA 4K6HA 1O5OA 4DMFA 1OBHA 3KKQA 4MV0A 4P84A 1P7YA 3PX2A 2Y77A 4AN1A 3AYZB 4E3ZA 1GPJA 1NJ8A 1H2AS 2WQZA 5AQ1A 2IYAA 5AXCA 1L7VC 1CQIA 4PPQA 2H2DA 2NZUG 1QUEA 3KEMA 4X5OA 5BVGB 2PA3A 1I1NA 4PG4A 1WPRA 3F8TA 4KIGA 1SHLA 4C4ZA 4LK2A 4MCHA 8OHMA 4IIGA 2Z0MA 2Z08A 3CT6A 4Q82A 4AWXA 4CM9A 3SX4A 3ZGYA 4LHYA 2CLKB 1Y5IA 2V59A 2WDPA 1LFDB 7ADHA 3RYFB 1Z4IA 2QZZA 1HGXA 1T29A 1SCUB 1CEXA 2OHXA 2JW5A 3EIUA 4ZAFA 5JO9A 1FDUA 3IHTA 2BPOA 5D3KA 1S2IA 3NDRA 5FTJA 4B7UA 2V5UA 3I39X 3DBLB 2YJ4A 1NJFA 2WSSA 3BGOS 2F3UA 4IDDA 2P6OA 4KO4S 2O14A 2PLRA 2QUAA 3ZEAA 2NUBA 4WMLA 1R8YA 2W9XA 2RSLA 4XJSA 5A06A 2ZT6A 3DEZA 3HDYA 1ST3A 5D85A 4NZOA 1LV7A 1L7QA 1Q17A 1VPEA 3QBJA 4XWTA 2HJHA 1UM9A 1YJAA 1U8AA 3CX4A 2FOXA 3KJXA 3OOYA 1J09A 4PLPA 1JR3A 3SJAA 1QIMA 5I4KA 2OCLA 4GFDA 3ODPA 4UZSA 5I5GA 3GC6A 3I4FA 1NQOA 3ZWAA 4KG7A 4Z4GA 1J1IA 1W36C 3ZBUA 2OZPA 3HDHA 1MIHA 1NU6A 5EMMA 4C78A 3M89A 4CKBA 1Z5NA 2P5TB 2W2XA 4EYKA 2J5XA 3IBSA 3KSZO 3M5DA 4MQLA 4HS4A 1XTKA 2Q2QA 1IOLA 3Q7IA 4JENA 5JVDF 2BEKA 4XEHA 2VSOA 1AQLA 1JVSA 1EXDA 4G4JA 3AHIA 3FDJA 3SX0A 1QJCA 2FPGA 1STOA 3IP3A 1ZK4A 2AB0A 2ZEJA 4KQIA 1Z6XA 1EFHA 1P6QA 1UM9B 1KI4A 3L6OO 3PHJA 3OU2A 4IDFA 4PR3A 1ZIXA 2A33A 3EIQA 4YS6A 3K2EA 3RFVA 5F52A 1JWLA 4CM6A 4F85A 1AHIA 1KERA 1JHUA 1ZGJA 5MGBA 4EI8A 1NFRA 1KAGA 3F46A 3COSA 1NVDA 2C9BA 2P27A 3CB4A 3LY9A 2YIVX 3NNSA 1NQWA 4NTZA 5CVVA 2FFJA 4M8KA 4BO3A 1I0IA 2XRZA 4JYBA 5E4TA 5LQSA 3UK6A 1T6ZA 3ZIAA 2H8GA 1KKUA 3A0RB 3Q7PA 1K5GA 2P68A 2KS6A 2ZTHA 3MJVA 1ZSYA 4DDMA 4B0OA 3SQLA 1KJNA 3LHIA 4HLCA 4GX2A 4II2A 2QSYA 3EDRA 5I48A 5LXTA 2ZJ8A 2XNDA 1BVRA 1N2OA 5C7YA 3QMWA 1ZA1A 4BU0A 1DOAA 2PIDA 3SNKA 4R2LA 4C2AA 1VECA 4MQ6A 1RAFA 3GJRA 1VCOA 3REGA 1UBRS 3AM4A 1YJ8A 2IKQA 4RVOA 3TOVA 2FUCA 4I1SA 1L5HB 1NW3A 1U02A 2ADMA 1H4TA 1WPQA 3ZU6A 2CXOA 5G0UA 3AINA 3T5CA 1MTZA 2WHPB 3AZQA 3OQJA 4RJTA 1TQ8A 4ND5A 3EIWA 3MGKA 4K9RA 1YHNA 5HEKA 3ZV6A 2MHCA 4HK4A 1LK5A 4BY9E 1KI6B 3CUSA 4N0MA 3ZQ4A 4JITA 3OEED 3ICEA 1ESEA 4KGXA 1L1FA 2RHOA 5KYXA 1SQFA 2QN1A 3JYHA 4JLVA 1GFZA 3N53A 1A72A 4DLZA 1WDTA 4DSZA 2DUUA 3L7IA 1ZOPA 3PKIA 4RJLA 1ECCA 4IIVA 4MWDA 1W46A 1ZUHA 3BQNB 4ZYXA 5ILQA 1LBTA 2R5FA 3BCRA 4GKJB 1VPDA 1SQ0A 1LBHA 3T99A 2DFPA 1IHDA 4GI5A 4KXNA 4E5PA 2XZLA 5MF6A 1J9ZA 2SKCA 2XOEA 5AJVB 3W8FA 4NCKA 2O2GA 4YRKA 4ARZB 1WXEA 1TKAA 3AY3A 5K6AC 4WNAA 1S2GA 4X8MA 2BEUB 1JX6A 4RZ3A 4B5KA 3G5LA 3GQBB 2AOWA 3K0KA 3IOEA 2Z6QA 3LY5A 3EZLA 3ZUPA 4BFUA 2ZGVA 1DT5A 4FR0A 4MLCA 2M6SA 4MW7A 4AZWA 2C54A 2FUNB 3VR5H 2AC7A 3EMDA 1ZH0A 2YX1A 3ZK7A 4EHLA 4OXYA 5JNSA 2W83A 4B6GA 3LXUX 3GT3A 4U2GA 3AERB 4HN2A 4LWPA 1VBNA 5IVPA 3WKEA 2W4QA 4I2NA 1E3IA 1P4RA 2JBAA 3GFFA 3O38A 4KU4A 4Y9TA 3VH4A 3HXQA 2YVUA 4DRXA 4J1QA 4UU8A 1ZAYA 2PZBA 1K63A 1USIA 4J9VA 3ABQB 2WUEA 3CZRA 4UNSA 4MLDA 2DR0A 1RXCA 1YR7A 4L3VA 1F3OA 2LRHA 2QNBA 2TRSB 2UVDA 1BS1A 4KN8A 5ITWA 2CLHB 2ETVA 1ZISA 5CB4A 2JH8A 4NH4A 3ETDA 2ZJ3A 4K03A 3RIYA 1HLDA 2IXGA 2JAXA 3L07A 4XGKA 3ZWDA 5KYNA 1NXPA 1U8ZA 2VT2A 3KKPA 1HQDA 4LJKA 3TLGA 5CDYA 4Q9JA 1YL5A 4RF2A 5AKLA 1FMCA 3RYIB 3VTAA 5JISA 2JLWA 4F5YA 2REOA 5F2EA 1J6UA 2CJWA 3ZLVA 5TLSA 1HTWA 1Z8HA 5KIAA 1IHYA 3PWTA 5FV7A 3TSZA 3H2GA 4RFVA 1XVTA 5KOJB 2RDMA 5I9BA 4TTQA 5TGZA 3KR2A 2R6AA 3FWNA 4HAXA 1JPJA 3FW1A 4PYOA 4FDAA 2B2XA 4TSFA 1C3OB 1Y8ZA 3HKCB 5HQ3B 5IVKA 1N5OX 1QH9A 4MYCA 2IYZA 1XEWY 3EGXA 5AESA 3QITA 3ILHA 4BEJA 3PQ2A 5LQAA 2ZZKA 2XGJA 2V3CC 4B79A 2IXBA 2VPIA 1H2XA 3F2VA 3MYRA 3TD2A 1MVNA 4IZHA 4TMVA 5CNIA 4K81B 1ZMXA 1BU5A 2ACEA 2HWXA 4FDTA 4A2QA 3IE0A 4ENPA 4KAJA 2V1XA 2HIGA 4AJ9A 5EHIA 1L7MA 5ERYA 3JQAD 3UAVA 1XMXA 1YZFA 5MFPA 1S4QA 3LUAA 2BFEB 2QMEA 3SICE 2VZ8A 4D8UA 1PT6A 3DZDA 3KHKA 2C97A 3A9VA 1YZVA 2AZ4A 1WZEA 2V9CA 2YV2A 3AR6A 3H9BA 3NATA 3U1TA 3VC7A 3QKIA 4BGUA 4M9UA 5K4HA 4CF3A 3ENNA 1H5QA 2PQMA 1MQSA 1YHZA 3PFFA 1JYFA 2Q41A 3WDMA 4HN9A 4XKJA 1SD5A 2FZ5A 2L17A 2AHOA 2SKEA 3NYQA 2ILVA 4LQLA 4POOA 4GQBA 1SIUA 3CZ9A 4G2TA 4G0VA 4IFEA 4M6WB 1FUYB 2BMDA 4D02A 3DMGA 3LDHA 3AEYA 1XU4A 2C4VA 2YCLA 1A5TA 3PZRA 2ZYHA 4H18A 4M98A 3TOCA 2VNHA 4DB4A 1NVKA 4D9HA 5ESXA 1IRIA 4TN1A 4EARA 1G42A 4YUWA 3L04A 3ROFA 4WBNF 5HF9A 2FP4A 2ZUBA 3F6PA 3SMQA 3C3KA 3IUMA 3Q85A 4RSRA 3H13A 3QF7A 2ATCA 1EEXB 2R60A 2YYYA 5F98A 2P69A 5ILOA 5G4KB 3E2PA 3OX1A 1YUBA 4Y2UA 3H16A 1ESMA 1I2BA 2A9JA 2Q4DA 3VI3B 1D5WA 4JC5A 1DOHA 2ATIA 3G0IA 4X1KA 1IHUA 3G2KA 4HNAA 5FD8A 3ZLTA 1HUQA 1LLCA 2ZB7A 1PWHA 4PGGA 3AHFA 4CFYA 5FIUA 5A9SA 5E9JA 3N86A 3Q0EA 3ZI7A 2GH1A 3T1YB 3TRHA 1NASA 1KQPA 2OVFA 4FCTA 1B15A 1Q74A 3VZCA 5TEWA 3ZWYA 1AS3A 1ECPA 4IY1A 2YOHA 2G1JA 4EDFA 4F2DA 1NBIA 4YJ2F 1SUFA 2ZBDA 1ZUWA 1T0BA 4EG7A 3U4AA 1OUMA 5HR5A 3TR0A 3OM9A 1X1QA 4C0XA 4RAQA 1G66A 1A9SA 1BHJA 3JQAA 4BQQA 4Z3KA 1ZSNA 3VVMA 4DY6A 1D4ZA 2QENA 3X1ZA 3BWMA 5CU7A 5EWMA 2DHRA 2XNJA 2JVJA 1U0LA 5JJ5A 1NVMB 4QE3A 5AXDA 4Q9DA 1MAUA 2JBWA 1RYYA 3E9QA 3KV1A 2ZUEA 2QSZA 1RHQA 1M5TA 4GOJA 3ZWQA 4JL5A 3M2PA 2ORYA 4IIYA 1U7XA 5HQTA 2PWZA 1ZH4A 2BJVA 4LMRA 1WXIA 3NHYA 5DT2A 5BQPA 4LXXA 5IUNC 2CXRA 4UCFA 2V45A 1ARZA 2HWWA 3GDHA 4PVDA 1TTQB 2VTKA 4RFSA 1DIGA 4OATA 4AKHA 1RPAA 5FPQA 3UWSA 1BNCA 3NBZC 1L7XA 4IOKA 1YXMA 1E4OA 1MG0A 2PZJA 2VJNA 3PD0A 4M21A 3RTEA 1NVFA 2V1UA 4I9NA 5JH7F 5KMGA 1E9BA 5TPZA 1J9EA 2WU0A 4I5FA 1XU7A 1N0IA 1P1HA 4RGVA 3RTAA 2QI9C 2QSUA 3A1WA 3FGZA 5DH9A 3HN7A 4LBWA 4MKFA 1TM7E 4Z9BA 1RVDA 2CLDX 3BJEA 3U09A 1THMA 4NKRA 1NQUA 1PX2A 3PEWA 2CF5A 1XPOA 3ORHA 3E70C 3GGCA 4ISBA 3ZR4B 2C59A 4MVWA 1BW9B 1U1EA 1EGHA 1B0AA 3A05A 4BATA 5HA5A 4D99A 4URHA 3ECCA 2VRCA 5E6SA 5T67A 3WKAA 3WLPA 2RK3A 4LAFA 1P4GA 1SVLA 1O94D 2VP3A 3H2SA 4MRRA 4NULA 4RPHA 1ZN9A 2ZU6A 3U3ZA 1N2HA 3AEQA 3CVUA 4GBED 4KX5A 1RYEA 4CT4B 1USKA 4K1LA 4CKEB 3B3FA 1G2OA 5D87A 2E4UA 4BYMA 2MSWA 4D80A 3AEZA 1LS6A 5TNXA 2C4WA 1MJNA 3FXAA 2NU7B 2F55A 3ORRA 4XQCA 2GDJA 4CEIB 5K3OA 1WXXA 3B3JA 1P1KA 2FSPA 1G1AA 2GN2A 3JQ7A 4TMXA 1E89A 1A2QA 2HTFA 4DUGA 2QTMA 4CMJA 4YUZA 5H9WA 2O2SA 3DEHA 4B6PA 1FEZA 4EZBA 4R2MA 1KWGA 1EVJA 1MVLA 3DBVO 1T1SA 1P33A 3D7NA 2IZ7A 1A4RA 3EXAA 3ZZUA 3TGPA 3K1TA