4OL0A

Crystal structure of transportin-sr2, a karyopherin involved in human disease, in complex with ran
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
172
structure length
172
Chain Sequence
b'QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
molecule tags Protein transport
source organism Homo sapiens
publication title Structure of transportin SR2, a karyopherin involved in human disease, in complex with Ran.
pubmed doi rcsb
total genus 46
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2014-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ol0A00
1CLUA 2CNWD 5TARA 1QHHA 5HCIA 5FL7A 3EZ2A 3LXXA 3EA5A 3QE0A 4CGZA 1KO5A 2IEZA 3CKLA 2WMOB 2VTKA 1CBUA 3H86A 4YXWD 3TQCA 5JJIA 4OJQA 1KK2A 3SOPA 2ORVA 1RFLA 5EE5B 3TR0A 4R71A 2ZRCA 2GBLC 2XB4A 3PCRB 2J0QA 3LO5A 4O2LA 4LHYA 2J3EA 2Z4SA 2NG1A 1CJKC 2RKOA 1W7AA 3FMOB 4FMBB 1D9ZA 3BB4A 4TQUS 1DG3A 4A6XA 2GXUA 1XD8A 4RZ2A 5DI3B 3IPYA 3DHWC 3FMPB 4BLTA 5JCPA 2UZIR 1NMZA 1EK0A 2D74A 4L15A 2A7QA 1G3RA 3UXMA 1KMHA 5F9HA 5D3MA 3K09C 3LX8A 3EWAA 4U02A 2P67A 3KUDA 1VG1A 1FQJA 3U7GA 1XJQA 2A5GA 1Z6TA 4KFRA 2FFQA 2FN4A 2ZRGA 3MWYW 4MRVA 4PZYA 1MOZA 2F43B 4MQBA 5DN6A 3VNUA 2V1UA 5AWFC 2FNAA 1Q0UA 5EUMA 1G8GA 4A8JC 5EJEA 4DLTA 2BJVA 3CRVA 4MRSA 3HYTA 4P0TA 4ABYA 2LKCA 4LOAA 1XEXA 4DDWA 4OL0A 1G41A 4EPVA 2BKEA 3AKYA 2R65A 3OEHA 1P2VA 5J4LA 5FTJA 1P9RA 2A30A 1IJFA 3B85A 1GAJA 2FE4A 421PA 1QDEA 1R0WA 1ZNZA 2E87A 4HLUA 4P33A 1Q22A 4Q48A 1OH7A 3JVUA 3F0TA 3R7WA 2NTYC 4PX9A 2VYFA 1EWRA 4DRZA 4F92B 1P7CA 4TMWA 2IUSA 4OQLA 4AURA 5TMPA 1FP7A 2MSEB 5J5CA 1ZD9A 2UVQA 3T34A 2WJIA 5JWOA 1U8YA 2KWIA 2GXQA 3WMFA 1D6JA 4IVRA 1KI7A 2XSZA 1GVNB 1DAHA 5IF9A 1UEJA 2VPPA 1G21E 2GETA 5C1BA 3P4YA 2EQBA 4JBXA 4TN1A 4DLZA 2CE7A 3K9NA 4Q47A 4CIDA 1ZINA 3UG7A 2X8AA 4KV9A 4GSYA 4NTZA 4LHWA 4ZDIA 2OFWA 3SZRA 3U61B 4G5GA 2F3RA 2X1VA 3OFNA 1L7VC 3RLFA 3VX3A 4Q4AB 3U7FB 1G291 3BC1A 4YXWA 4Q02A 1P5ZB 5CK4A 4XWAA 1BMFA 2VHJA 3KFVA 2QORA 1HT2E 4GT1A 1DTSA 4PHFA 5B58C 1E32A 4XWKA 1MO6A 3WP1B 3GJ3A 3CWZA 2DCUA 1U8AA 1KK0A 4JBWA 5JSZA 3SQWA 1GM5A 4AY2A 2IL1A 2GF9A 3GLIE 3CNLA 1H8HA 1W4RA 4HLQB 4ARZB 2XOKD 3CX7A 4EAQA 2V54A 3IGFA 1O3YA 3VR3A 4N1AA 4OQFA 3L8YA 4JLDA 1TPZA 3GFPA 3PQCA 4M22A 3PUYA 1KK1A 1SHKA 1KJWA 2JCSA 2ZSEA 2C2HA 8OHMA 2FGJA 1E4YA 2GXSA 4NCKA 4Q18A 4MYTA 1U0HC 5GVRA 3T06B 1BH2A 3W8NA 1YRAA 2J7PD 3GLHE 1S8FA 1RRGA 2ODBA 4I99A 1XMVA 1ZMXA 5DHFA 5FBRB 5LB2A 1L2TA 5CJPA 4JLNA 3IKJA 5DYGA 4LI0A 3RAPR 3ZVMA 1OIVA 3CB4A 4GZMA 4A2WA 4P31A 4UKDA 4B73A 3TE6A 2PL3A 1KSJA 5FPKA 2XXAB 1ZCBA 2DYKA 4B3DA 4LZZA 3FMFA 1SVOA 3KUCA 4JJZA 4LJ4A 3UWKA 4C7OB 2QPAA 1HV8A 1OFHA 2ZUCA 2SHKA 1XP8A 3BRWD 4W5HA 1EFRD 4XD7D 5EZ6B 1CF4A 2E9SA 4M9XA 2BMFA 1G6OA 2QE7A 1US8A 2WM9B 1S2MA 1XMJA 2GBLA 4PFSA 4BZXA 1BS1A 2GVZC 3T12A 4C2TA 3EIQA 2LWIA 4TLCA 4DVGA 3VR4A 2J46A 2RGCA 4A92A 4DXAA 3OESA 4HI0E 1HE8B 5TB5A 3SEAA 3QF4B 1S3GA 1D2NA 2P5TB 2RAPA 4C0KA 1XJ0A 2Z43A 2JJ2A 1GUAA 4PSAA 2P5SA 2KSQA 4MRNA 4OI2A 1BYIA 2Z83A 1XTIA 3SN6A 4B2PA 2O8CA 2O52A 3VX4A 2ZSAA 2IYYA 2JEOA 4FIDA 4HAWA 1JAHA 2ONJA 4TT3D 1GDDA 3FVQA 5IRCD 4CRWB 2WWWA 121PA 3WNBA 1N5LA 4DKXA 5G53C 1DELA 4TZ6A 2H8KA 3GLFB 1NN1A 1G4UR 1S0UA 3BERA 4ILEA 3X1DA 2JLYA 1Q3TA 1UFQA 5C4MA 2ZM5A 3TMKA 1E2HA 3CF6R 2QI9C 1KO7A 4A15A 2EVWX 3GEEA 1SKYB 1VIYA 5H70A 3TJZA 2IS1A 1BYUA 4HDQB 3FB4A 3H84A 1OYWA 5BWMA 3LFUA 3QVVA 1XX6A 4FMCF 4L4UA 3QXHA 1S9DA 1Z0DA 2QM7A 4GZLA 4RZ3A 1VECA 2XZLA 3I8XA 3O8BA 1YZUA 1I4TD 4ON9A 3U2QA 1ETUA 1N6HA 2GEDA 2D3WA 5LBIA 4GOXA 3RNLA 5J40A 2WOOA 3B6EA 5FPHA 4B44A 2C5LA 2W2XA 5KSZA 3GLIA 3W5JA 3RC8A 2WJYA 2CHGA 2FA9A 4JKIA 3SS8A 4CDGA 5KSYA 3C7KA 4GRAA 4Z8YA 3GLGB 3DPUA 3AV0B 2VQSA 3FPAA 2QZ4A 4Q9HA 3WMGA 2JIZA 3RS5A 4RD0A 1GNPA 2IA5A 4XD7A 1X8JA 2C03A 2I1VB 1RRPA 2FMXA 2JLWA 4RD2A 2OV2A 3LV8A 3TGPA 1JR3D 1NIJA 3B1XA 2ZR7A 4D0GA 1TUEA 4A6PA 1ZM9A 1E96A 1ZRHA 1N6KA 1SZPA 4TL7A 3WHKA 4AIIA 2ZRDA 4NU0A 3QEOA 2X77A 2ORIA 2W83A 1IN7A 5HPYB 5EXXA 3TSWA 4CEIB 3BS4A 2RHMA 4BFUA 1US8B 2NPFA 4BE7B 5KTYA 2AK3A 5LDDC 1BMFD 3X1ZA 3RSLA 4QFMA 4OBEA 1E2FA 4LV5B 2XTZA 5A0FA 3LBHA 5M04A 4NL4H 4ESVA 2ECKA 3B9PA 1KI4A 1A82A 2OFXA 2PLRA 1E2JA 1IY2A 2GA8A 1JNYA 4B33A 3VKHA 2FWRA 2ZROA 4PHTA 3BWDD 4R98A 5FI1B 2BHRA 5B64A 1S3SA 3IQXA 1Q1QA 3UG6A 1Z3IX 2ZRBA 3B78A 4PPFA 4TWZA 4NYIR 2JLSA 3BE4A 3EWSA 3IHWA 2NO6A 3TAUA 2QMHA 3OFND 5B30A 3H1TA 5J4VA 2AFIE 4LYFA 5GVSA 2PX3A 1XMIA 5TDHA 2Q0HA 3Q7PA 1W36C 3B2EA 1L4UA 4DHEA 2QSYA 4GP6A 4URVR 1E9SA 4EJSB 2J7KA 1KY3A 4KVAA 3MRSA 3LBNA 4EUNA 1BIFA 4OJKA 5CLQA 1U99A 1HYQA 2OBLA 3KQNA 2ZSFA 3P32A 3O8CA 3BB3A 1XTKA 2WWGA 2J0UA 1G8YA 2JGNA 3AKEA 3KXIA 5JWRA 4I4LA 2GZDA 3L2OB 3QF7A 3U3MA 1OH6A 2EFCB 4PPNA 5FH9A 4LBZA 3K0FA 3U3RA 2VHQA 1I2DA 3HU1A 4V0ME 2ODEA 1N25A 1E2PA 2P0EA 3WYFA 5JS8A 1G3MA 1CULC 1M74A 3AUYA 3CRQA 4CW7A 4B3XA 1RPZA 2BV3A 4FN5A 3AKCA 3IIJA 1ZVQA 1ANKA 4RCYA 2EYQA 1RW4A 2D06A 1COWD 5K8LA 4E22A 1X1RA 1WBDA 2QROA 5J47A 3U3KA 1II8A 3GD7A 1AK2A 1OIWA 1K5DA 3TUIC 3LVRE 1XCMA 3PENA 5EZ5A 5JEEA 3ZD7A 2V8OA 2VBCA 4P4SA 3VR5A 4IW3B 3UATA 1W48A 3AQ4A 4Q9LA 2G77B 1JPNA 3AVVA 5KDDA 4IOJA 5FL7D 1E79D 3W5IA 3W3ZB 3KJHA 1E0AA 4Q4LA 4PO9A 3QQ5A 3ZVNA 3DKPA 1IBRA 3DEFA 3RWMB 2PCJA 3I4LA 1D8TA 4PSKA 4AI6A 3PV0A 2B7BA 1SVLA 3OE7D 2WPDD 4QHTA 4TMTA 3W34A 1G7SA 3SI7A 4ZKEA 3FGNA 4IDHA 1OXTA 1JECA 4HB3A 2O0KA 3NBXX 5FUXA 4C0AC 3U4QA 4B47A 1UF9A 2IUUA 1UDWA 1CJMA 2HJGA 3LAWA 3WRYC 3GJ6A 1DAMA 4G5SA 3L0PA 4PHGA 1P9NA 1KI6A 3L0IB 2C8VA 2QAGA 4LJ9A 2NQ2C 2FSFA 3ADDA 3R8CA 4JLOA 2EFEB 2V7QA 3T61A 3CUEF 3ZDQA 2JASA 3LQRA 3KQKA 1Q12A 3ZZTA 4EPWA 4QGHA 1G18A 1OFUX 4PQFA 1ZIPA 1KNQA 1UADA 1EFUA 4FMDF 3G0HA 2TMKA 4C0LA 2OM2A 2OAP1 4H1UA 2YVUA 3MCAA 1XNJA 4XVRA 1ZP6A 1QHGA 1AS2A 2X2EA 3NG1A 2ZRJA 3DO6A 3P27A 2JLRA 4TTPA 3QSYA 2IYXA 3CPJB 3AF0A 2ANCA 1R10A 1A4RA 3LRPA 5C18A 1N5KA 4QJ3A 3QPUA 1IONA 2WHXA 1K8RA 1GSIA 4DCSA 2ZQ5A 2OO7A 3RS7A 4M1SA 2PJZA 3NDBB 1OYYA 1OLOA 4UJ3A 1VHLA 4M2LA 1XRJA 3B60A 2BBTA 3KKPA 2ZE5A 3OIUA 4EPTA 5IT5A 4JVNA 5KSOA 1U9IC 1S96A 4BLQA 3K53A 1R8SA 4JLPA 2PEZA 1CKEA 1EFCA 1E2LA 2F7SA 2P2LA 1EGAA 1FMLA 3HPRA 4C30A 3IIMA 4G5QA 4I81A 3RANA 2A3RA 4Z51A 2CHQA 2C99A 3B13B 1DARA 2AR7A 4TL6A 4PZZA 2FZLA 4UNNA 1M8PA 4LJYA 1Z2CA 4QBGB 3U3JA 2RGEA 4X8OA 1HA3A 3K9GA 4TYYA 2W6ID 2ZPTX 3QXJA 4NP6A 5AUPB 2YHSA 5DISB 3EX7C 4ITRC 3AH8A 1KI1A 1C1YA 4V0LA 1T9HA 4TYWA 4IVPA 1HY3A 4LBWA 1JAIA 2BMJA 2PLFA 2ZE7A 2ZI4A 5F98A 3REGA 4C4PA 3W8RA 5FTLA 4F4JA 4M1WA 2CJWB 3PUVA 5DN6D 5BN5A 4D26A 4LC0A 4EPYA 2CLCX 3KB1A 2NO1A 1NVXQ 2WKQA 4AC9A 1KIMA 4ERNA 4B3GA 2GZAA 4FWIB 3U4QB 3W90A 2JATA 2VHTA 1NRJB 3GLIB 1P73A 1OW3B 2YJTD 2X2FA 2A2ZA 5C2JB 5JZVA 4UNQA 2VO1A 3VTKA 1IN5A 4BUJA 1G4AE 3RS0A 5JI2E 2IF0A 2WIAA 2IS4A 4RY2A 4RFSB 5C4GB 1OB5A 1OXUA 2CLDX 3SC3A 3W6PA 1GRNA 2WVJA 1YKSA 4LYHA 1E9CA 2PX0A 3OHMA 3MAAC 1N6PA 2ZYUX 1VG0B 3AB3A 4LPSA 4GDFA 1MABB 1XPOA 1KDTA 1JALA 3B82A 3MMPA 3QI2A 4YDHB 1OPXA 2WV9A 4A2PA 1AKYA 1MO3A 2RH5A 5KU1A 1KMQA 2DFTA 1NSFA 3IBYA 5AUOB 4WZBE 1II9A 4YMSA 2O0HA 1T4GA 3ZJYA 3RABA 2A78A 2FFAA 5GJVC 3SU8A 1OKKA 1W2GA 2ZRLA 3GLGA 1L8QA 2WKPA 3NBZC 3MJRA 3AF4A 4MA4A 1WCV1 4KU4A 2XX3A 4ASUD 4PHHA 4KSBA 4A82A 1AS3A 2W0MA 4Q9IA 2O8FA 3UIEA 2JDIA 3WXMA 2DB3A 3QKRB 1RYFA 2GESA 4LRWA 1NJGA 3U44B 3KTAB 1ZAKA 5DI3A 2BIFA 2XTMA 3AVYA 3DZDA 3SJAA 3SJZA 1YZQA 2FEMA 3IIKA 5FUVA 5HZHA 5LD2B 1FX0A 2XITA 3W6OA 2ANBA 4PO8A 4RCZA 1SVKA 1Q20A 4Q1DA 3X2SA 4JL6A 3RRNA 2XEXA 3WRXC 2REOA 2C78A 2JLVA 4Q7JB 2MMCA 1P2TA 5C46F 2P3SA 5AUQA 4WW0A 3I61A 1AN0A 4JVSB 3CH5A 3QXXA 1JR3A 3CNOA 1P2SA 1XXHA 2ODNA 5KO2A 1EFHA 1U2RA 4ZI2A 1WE2A 4XJXA 4B71A 4IXMA 1E9BA 5KNCA 2QMOA 2P6UA 1XTRA 3AP2A 4KODA 4QBFA 1F48A 1OFTA 1ZUHA 1NVUQ 3NXSA 4KCGA 3ZGXA 3WP0A 4ZI3A 2YKGA 2Z6VA 4KBFA 3WNCA 4JL5A 5HTKA 3SDZA 2WWYA 3QVUA 4Q19A 3LLUA 4DT1A 1DG1G 3ETLA 4EJSC 1ESNA 4OQXA 4ASUA 2FFBA 1S1MA 3EIEA 2VP0A 1Z29A 1ZM2A 1VYUA 2ZJ2A 2ZRMA 4JLVA 2IYWA 4US2R 1E2MA 3WNDA 2W2VA 1W4CA 4DEYA 4A2QA 2JA1A 1Q3HA 2ZJ8A 4YONB 2PMKA 2GRJA 2HXYA 3U7EB 2DBYA 4QBHA 4HAZA 1CTQA 1T6NA 1V5WA 2VSFA 3K0AA 3I1FA 3U60B 3IO3A 1CJVC 3AKDA 3MWKA 2OCYC 1S4QA 2WWHA 1KZ7B 2YNMA 2ZJ5A 1LFDB 3MUFA 2DFNA 4D25A 3LY5A 1XXHB 1ZJ6A 4TYNA 1DPFA 5JRZA 1EG7A 1C9KA 2UKDA 5IDVA 1TTTA 2C9CA 3UMSA 4URZR 2W58A 4NBSA 4Q1AA 3B1WA 3B5JA 2O8DB 3PXGA 2ZRHA 2BCGY 1ZM7A 2KI5A 3RRZA 3KJGA 2W0SA 2A9KA 4TMKA 1W49A 1XZQA 3ADBA 3GMTA 4M9ZA 1W5SA 3AGQA 3QPWA 4LJ5A 3KJEA 5UKDA 3HR7A 4IDQA 3IEUA 4I1SA 1K5GA 4TMZA 3QXSA 4JZKA 1E6CA 5CYPA 5FOUA 4Q1EA 1IY0A 1DAEA 2OFOA 3NH9A 4B34A 1R4AA 2HDNB 3TUJC 1NN3A 3FMIA 3PEUA 2QMEA 4Q4HB 4EIWA 1N0VC 2IHBA 2ZUBA 3NIBA 2HV8A 3DKVA 3H0KA 5FTMA 1DEKA 2QENA 4OHXA 1XD2A 2H5EA 4O25A 1ZBDA 3AF2A 2I1QA 4L9SA 4PANA 1IAQA 3S1AA 4C0BA 1R0ZA 1G17A 1UBCA 3BORA 2G0TA 5L3QB 4EFMA 2CCGA 2IYRA 3NC0C 4P3YA 3GQBA 1H8HD 4Q1BA 2KBEA 3Q8XB 3DM5A 3FKSD 3QKUA 4PC6A 1ZC4A 3ZS9A 1PLLA 1Z5ZA 4OQNA 4QHSA 3FHTA 1XTJA 2BMEA 1KJZA 4NONA 1A2BA 4BEBA 4GL2A 2BMDA 3A1TA 2QTVB 2BJWA 3N70A 2QE7D 1ZU4A 1T8TA 2HF8A 4CYMA 2VLIA 4XTRA 2HUPA 2HLDA 2DPXA 2DWOA 1HQCA 4Q1CA 4BFWA 4DB4A 4LPKA 5FUWA 1PZNA 4RD6A 5B2ZA 1GFIA 1XBTA 5KDOA 2AKYA 4B75A 5DHAA 3B1VA 3NVAA 1ZNWA 2WAXA 4B3FX 1E2DA 1GNRA 2BCJQ 2I4IA 2YOGA 4AWXA 3BGWA 4HATA 4HLCA 3AM1A 2RGAA 1TL7C 2BBWA 4Q1FA 2OHFA 4DDTA 3H4MA 1IN6A 3C41J 3QPVA 4BLSA 4R9UC 4C7OA 3CX8A 2ZJOA 1RJ9A 1XTSA 1NNEA 2OLKA 4A0HA 4G3XA 4ZCMA 2QG6A 1JQJC 5TXGA 5GJWC 5KUTA 1AIPA 2YC2C 1IOZA 3SHWA 1CIPA 5CJ2A 1Q44A 2C98A 4XSHA 2ZJBA 1KAGA 2ZRPA 3W3AA 2ZI7A 2X19A 4HAXA 2D62A 4GI7A 1GRRA 5G41A 3CW2A 5ANRB 3M1IA 1OH5A 1OT3A 2QA5A 1FL9A 2FSHA 4I1OA 4P4TA 3TAHA 4PXAA 4YQFA 4KITB 5JHHB 1PUJA 4M9QA 3C5CA 4Q03A 3B9QA 5FPSA 4DSNA 1ZNYA 2QRNA 3GJ0A 4DT1B 5JI3E 2FSGA 1CJTC 4M0LA 1OV4A 4W5WA 3VKGA 4WOPA 3OEHD 4CEIA 5FTKA 1FP6A 5KYKA 2EU8A 4MH0R 2E1RA 2FZ4A 2JJ2D 3B1ZA 1EWQA 1F2UB 4BQSA 4DLRA 1OH8A 3BH0A 3QY0A 1NL3A 3L8ZA 5LD2C 4E5UA 1Z83A 4KYIB 4NYJQ 3FOZA 2AWNA 3SFZA 1XPRA 1W1WA 3RHFA 2VSXA 1A7JA 4QM6A 4RVCA 2V3CC 1M2OB 2FOLA 5G3YA 1S1CA 4CEHA 4UNPA 4ARZA 2A5DA 2B8TA 3MJHA 2R6DA 4LJ8A 2VHUA 4W9MC 3PIRA 1VHTA 1KKLA 1W0KA 4KFUA 2OZEA 1OXXK 1G5RA 2FDCA 3QENA 4K8OA 3KB2A 5EE0A 3VAAA 2GK6A 4YDSA 5JLJA 1Z8FA 2R6AA 5DSZA 2IYTA 2DY1A 4QGGA 3BD9A 2OESA 5L3SA 1EX6A 1G6HA 1HEIA 1TQ2A 3QKRA 4HB4A 4R2HA 5D3QA 5FOSA 3ADKA 3KZ1E 1DAGA 5FBLB 1JXOA 3Q7QA 3EZ6A 2V6IA 3V4FA 3UKDA 4C2UA 5DI9A 3REFA 5EP2A 2VRWA 2ZR0A 3UANA 1Z6XA 1N0WA 1AGRA 1QRAA 4ZPXA 3I8SA 1ZCAA 3OZXA 4NPHA 2CJWA 2CLSA 2G0NA 5GJCA 3GFTA 3RS2A 4NMMA 1EESA 3PITA 3PUXA 2H92A 1E2NA 2QU8A 1WRBA 5HKKD 1IQPA 2QPTA 3I73A 3RYTC 1KOFA 2KJQA 4V0OA 4B76A 5AJVB 2OSBA 1GP2A 3LD9A 1PLKA 4Z1MD 3X1XA 2CCKA 3BFVA 2VHCA 3Q72A 4MKFA 1F2TA 5HE8A 3FDIA 5K8TA 2IEYA 2J0UB 1R0YA 3LXRA 1IY1A 3I32A 5CDFE 3ZLJA 2FF7A 2RGNC 4BFZA 1YHNA 4ZIRA 2ZE6A 3J81k 2CL6X 3FKQA 3NBFA 4HAUA 4Q66C 5L3RA 2GILA 4WXPA 1TF2A 5L3VA 3VFDA 4FWTA 4PAMA 4E09A 1X8LA 1ZW6A 3P4XA 2WTUA 4QNMA 5FOWA 2G1KA 1SHZA 3NDPA 2AD5A 2EFHB 3EC2A 2QT1A 4A8JB 4P32A 4GP7A 221PA 5FTNA 5SZKB 3I92A 4R2IA 2G6BA 2GF0A 2XJ4A 2D7CA 4NYIQ 1T5LA 2AD1A 4DDUA 3IPXA 4C0JA 1YQTA 2A5YB 2VH5R 4IOMA 5B57C 2ZI3A 3AVQA 1YZLA 2BC9A 2PMDA 3KDSE 3MFYA 4IKEA 2NO7A 4M53A 4DLWA 3QUSA 1ZIOA 1Z6AA 1NSTA 3ZS8A 4CVNA 5DNYB 5AR1A 4IRUB 4Q7LA 4UXHA 4Q7MB 5AJWA 4D6PA 1KHTA 3TVDA 2IYLD 4JVLA 1QHSA 1QZXA 4J0QA 3K0AB 4EFLA 4FCTA 2ZS7A 2CBZA 2B8WA 4B32A 5BXQC 621PA 2MMGA 3FFBA 5JEDA 5FR2A 2ZXUA 1QHXA 1KO8A 3C5HA 3O8DA 3ICQB 1XWIA 2YINC 3QBTA 3SFVA 5JHGB 1BKDR 2QEQA 1LV7A 4TYPA 2OCAA 4A0RA 4DC9A 3NH6A 2IT1A 3ZH9B 5KNBA 4TMXA 5EXSA 3IQWA 1QG2A 4BPBA 1U0LA 4DBLC 3BIFA 3R20A 1R5NA 2KBFA 2J1LA 1W5TA 4HAYA 2GJ9A 3SJCA 4A8JA 4I1VA 1S9HA 3UK6A 1QHHB 3DDCA 2HXSA 1XPUA 4G1UC 4TT3A 4DLVA 1RVDA 3U44A 4IEIA 4B3BA 3THXA 1MH1A 1OXVA 4MYHA 2V6JA 4TLDA 4ZDJA 2VL7A 3KQUA 2WICA 3RWOA 3I3SR 3EZ7A 5FBVB 1AJEA 2G88A 5BYJA 2ZAOA 4TQ9A 3T15A 3D8BA 5E95A 5JSZB 4YC7A 1XD2B 1XF9A 4LHZA 3AUXA 2ZIAA 3SYKA 1NVVR 4B2IA 2IS2A 2JJ1D 4M1KA 4Q4HA 2ZEJA 5F3WB 3X1WA 2IYZA 2YZ2A 2VEDA 4LX0A 2R2AA 2GVDC 4LUCA 3TBKA 1GZSA 2PZFA 4S35A 3A4LA 3KKMA 3OIYA 2DFKB 3AEZA 3A6PC 1PJRA 1YJ5A 4MKHA 4RZXA 5KSPA 2IS6A 6Q21A 1ELOA 1ZD8A 2H1LA 2N1BA 2RGXA 4TL8A 4Q9KA 2QY9A 3JVVA 1EX7A 1G7TA 3KKNA 4Q01A 1J2JA 3EARA 1M7BA 3HP1A 4PPGA 1G3QA 2ZR9A 5JBQA 5HCNA 1D9XA 2ZE8A 1XCPA 1VDZA 1NKSA 4LC1A 2JAQA 3EPLA 4X8MA 1KSFX 3E2IA 1UM8A 2OUKA 1G7CA 2DR3A 2W6JA 3QKSA 4Q9JA 3VMFA 2GAAA 1ZU5A 3FKSA 3TUZC 1WDTA 3TSZA 4KXFB 4TTRA 4D2IA 4KHZA 4D0LB 4IFEA 3EG5A 3L0OA 1B0UA 2C96A 3OEED 4DWJA 4F93B 4LGMA 3LW7A 2GWHA 1VTKA 3CONA 5BW8A 2A5FA 1IXRC 3BAFA 1GTVA 4MUBA 5AJZA 1SKYE 5SZHB 2IC5A 1NBME 2RGGA 1WA5A 4JLBA 4W7SA 2ONKA 1LNZA 1XXHE 3BH7A 1NLFA 4OYHA 4F4CA 3PEWA 3A37A 3CRMA 1Q1ZA 4FINA 1E79A 2YWGA 3QG5A 2AKAB 4YLGA 1E4VA 5E3HA 3F3YA 3ZD6A 4AYXA 2EWWA 3JZAA 1CS4C 4CZ2A 3LVQE 1MRSA 4GPTA 4Y0VA 4A36A 2ZYWX 5E4FA 3ZVLA 3TVTA 3A36A 3CR7A 1KI2A 1X86B 3PEVA 2I3BA 2NPIA 3U7HB 2XB2A 3BK7A 4URYR 3CIOA 5FOTA 2ZRKA 1W0JD 3JZMA 4DIDA 3MWJA 4DLUA 1NVWQ 3L82B 2BM0A 1M34E 1E9AA 2D2FA 2XTNA 3EIHA 3LW8A 1ODFA 1YU9A 1G19A 4M1OA 3DZ8A 4PQYA 4IDOA 3TQFA 2O8BB 1KDRA 1G8HA 2YV5A 3IUYA 721PA 3ICEA 4DB2A 5CIQA 2IHYA 3IEVA 1UAAA 1FZQA 4JLJA 2LKDA 2F1JA 2QT0A 1P62B 4NYJR 2C04A 3A4MA 3KFXA 4QBIA 4JS0A 2FGKA 2J0SA 1G3UA 3EAQA 4E03A 1F6BA 2R6FA 4JYCA 2WWIA 3U3OA 1YZTA 4DZZA 5DLQC 2WWFA 1YVDA 4AG5A 2AL7A 4RD3A 1E1RA 1N6RA 3KTAA 1VG9B 5FL3A 1B23P 2KB0A 2G3YA 2GNOA 2CCJA 5CITA 4GOJA 2PCLA 4IOLA 2R8RA 4ACAA 4RFSA 4WA7A 2N42A 4PC7A 5DH9A 4BRWA 1EFTA 5FOXA 1OF1A 4MDFA 1TADA 4JJKA 2FFHA 4A0GA 1Z06A 1UKVY 4OK6A 4RD4A 4YMUA 3W6NA 3IILA 1SKQA 2BM1A 1NF3A 2YWHA 4KYUA 1OXSC 1Z22A 2WBLC 4M4SA 4WAUA 2JLXA 1AZSC 2REBA 3VR2A 3THYA 2J0VA 2A5JA 3KX2A 4HYYA 2AK2A 4LWZA 3GFOA 4JT4A 2HCJB 4C0SA 2RB4A 1LB1B 4DCVA 4QM7A 2Q9BA 3CZPA 3NTUA 1NP6A 2CK3D 4FCWA 3MWLA 1XJCA 3UPUA 2V4ZA 3LH5A 2ZRNA 1YZNA 2CMKA 1U98A 2VP9A 4K81B 1G16A 3LBIA 1NN0A 1SGWA 3UMFA 1HH4A 5L3QA 4OHYA 4TSFD 3HWSA 3N5CA 2IXFA 1UEIA 4MYCA 2FG5A 3QJYA 1J90A 3NBYC 3M6AA 2Z0MA 4LYAA 5CM8B 1E2KA 1T3SA 1X6VA 1IHUA 3K8YA 3P1JA 4H9GA 3C4JA 4UNSA 1W36B 4QGFA 4AKHA 4V02A 2ZRAA 4DDVA 1KI8A 4RFVA 4BFTA 1P3JA 4GFDA 2OBNA 3K0CC 1YRBA 1YR9A 4US0R 2OT3B 2RGBA 1TX4B 2WOJA 1II8B 2ZITA 1F60A 5BQ5A 2FSIA 3T1OA 1LW7A 5CK5A 1LTQA 1U9IA 3ONWA 3DL0A 1QBKC 1NY5A 1DBSA 4EDHA 1E0SA 4NKRA 1N5JA 2AFHE 2GK7A 3EASA 3K0FB 4IOKA 4RD1A 4NCNA 2GZHA 4D81A 3SYNA 2H17A 5DO9A 1OHHA 2ZJZA 1JXMA 1SQ5A 1NIPA 4XVQA 1O87A 5FPYA 4I1UA 2CK3A 3OIWA 1M6NA 1F3OA 2OXRA 5GJBA 1Y63A 2PT7A 1ZM4A 4BASA 4B6FA 3F8TA 3KQHA 4MYUA 1QF9A 1C4OA 2QPOA 1OJLA 4F4IA 3M0EA 3WHLA 5CYOA 1T0JB 2RGNA 5IK2D 3Q3JB 2MSDB 4A0FA 1DE0A 1FNNA 1FTSA 1RC8A 4HZIA 1SXJB 2OBMA 2GAOA 2ZS8A 4TMVA 4WZ6A 4X8HA 521PA 1XMSA 4EFNA 1GL9B 2R44A 1D2MA 1SXJC 3GEIA 3KJIA 4NDZA 4DIEA 2XNDA 4PR0A 3PUZA 5JECA 2ORWA 1G8FA 1DO2A 3OF5A 1E2EA 1G64A 1Z6GA 4ZKDA 3B8HA 1R6BX 1WMSA 2XSZD 4LY6A 3I62A 4L8GA 3THWB 4XTCS 4QHYA 1MO5A 1Q1EA 4QC2A 4JLMA 1YE8A 2ZTSA 2NZJA 2IBMA 1AQYA 3EPHA 3AF3A 1P2UA 3GLHB 4BGDA 1W47A 1OE0A 1W2HA 4B2LA 2FJUA 3AVPA 3A1VA 2RMKA 1J8MF 1G5TA 2ZVQX 1FUUA 1E1QA 1WP9A 2C9OA 2RCNA 3ZZUA 3VR6A 4AYTA 2XAUA 2G9NA 1UBFA 4D80A 4WXRA 2D7DA 1TQDA 4JMPA 3H2YA 3BBPA 4LV8B 1Z47A 1COWA 3Q9LA 1WB9A 1X1SA 4HB0A 3CWQA 2F6RA 3QKSB 2CNWA 1HT1E 2YWFA 3CZQA 1D2EA 1IXSB 1Z63A 1VYTA 2O8FB 3LWNA 2HT1A 1E94E 2QM8A 1NLZA 4DJTA 1KI6B 3D3QA 1E99A 4LSGA 2CXXA 1YR7A 4PO1A 4D82A 1T0HB 4G01B 1I2MA 4F91B 1IN8A 3U5ZB 3VU9B 2ZU0C 3AF1A 1XFAA 4TLAA 4BLRA 4TLEA 1KAOA 2R9VA 5SZJA 3SHFA 1R5OA 2FX3A 5KPDA 2IF2A 4TL9A 4KLNA 1WBBA 1E3MA 4PC3A 4GNKA 4N3NA 1HUQA 1E9RA 1AA9A 1SXJD 4MKIA 5IK2A 3UWOA 3V4RA 4WBSA 2YOHA 4BZPA 1W44A 1LS6A 4AKIA 3K70D 5KNDA 3R9WA 4FD2A 3D31A 1SVSA 2WIBA 2H7VA 3K9HA 3K0CA 2G1JA 3NWJA 1J8YF 2IW3A 2QTHA 5CB6A 4ZDWA 3AVXA 4BWYA 2ATVA 1RIFA 4LJ6A 1X8KA 3ND8A 2EW1A 3LA6A 2ZAMA 3SBEA 5H68A 2BEKA 3BB1A 4MDEA 5FFMA 1N0UA 1ZYUA 2B92A 2ERXA 3MLEA 4E07A 1U81A 3AP1A 2AXNA 3QOFA 3EPKA 2WJVA 1HURA 2FEOA 1UKEA 1CEEA 1CU1A 2F55A 4QL3A 4DUGA 4LV6A 1CRPA 5FPTA 2AXPA 1JEDA 1DAKA 4MRPA 5BN3A 1NMYA 4LYJA 4RSGA 4NYMR 2GDJA 1KKMA 3PUWA 5JJLA 1W46A 2CE2X 1JQLB 4OI4A 1CR4A 3WYAA 1M7HA 3K0SA 4LJ7A 4KBGA 1RRCA 2O8BA 2HJVA 4G5OA 1E9FA 4MUAA 4UQOA 2FH5B 1N6LA 1RJ9B 3P26A 1CR0A 1QG4A 5J4YA 2J59A 3AP3A 1KSHA 2QP3A 4XIGS 1KMHB 1XEFA 4PC1A 2VP5A 2GJSA 1GNQA 1NG1A 2WZQA 1XCGB 3DM9B 1SXJE 1P75A 1YR8A 5GADl 1GOTA 5BYKA 3SNHA 2GJAA 1FW6A 3LX5A 1FNMA 3E70C 3BFXA 2ZANA 1XDBA 2WPDA 5J4HA 5TVKA 2ATXA 2BKUA 1QVRA 1MO4A 4C0HA 2FPLA 4EQ6B 4XWOA 3K70B 4UXIA 3HYRA 2ZREA 5EUQB 3TLXA 2XZOA 3R8FA 2OLJA 3FTQA 3GEHA 3L43A 4FW9A 3W9YA 4B6EA 3HU3A 3LQQA 3QEJA 1DS6A 4Q4JA 1G5PA 2UZ3A 4CT4B 1AKEA 4M1YA 1QHNA 1OSNA 1CRQA 3ZZ0A 4ZIRB 2QBYA 3RS4A 2C77A 4YMWA 1TQ6A 2OCBA 1OFIA 4BFVA 2XNSA 2GCOA 4XH9B 5CLLA 4NCHA 3C14C 4HUTA 4BLOA 2MSCB 4RKFA 1E2IA 3RC3A 4Q4AA 2XXAA 4G0NA 4F7WA 3A58B 4JBYA 4KO8A 2Q3HA 2YWEA 3SR0A 1ONBA 4WVFA 3G82C 5EP1A 4C9BA 5P21A 1P72A 1VCNA 3R9IA 3VQTA 2WJGA 4XSGA 3VU9A 4EPRA 2K5UA 4ESHA 2IUTA 4R7ZA 1Q1BA 2N46A 2OE2A 2QAJA 2F9MA 2CHVA 3PR1A 1DOAA 4AYWA 3T1VA 3HJNA 4IJMA 3WBJA 4NCJA 3FWYA 1XTQA 4US1R 3IDQA 1DADA 4HLDA 1E9DA 4GOKA 4KFTA 4AKGA 1RKBA 3VR1A 1FQKA 4BFSA 3R7WB 2H16A 1TU3A 5KDLA 2HYDA 4KI0A 2VP2A 2XZPA 2QQEA 2BOVA 1VCMA 4PTLA 3THOA 4XOIA 1R5BA 1TF7A 1NMXA 3G5UA 3GJ5A 3X1YA 2CDNA 3DOFA 4M1TA 4U5XA 2CVHA 2NGRA 1KY2A 3K1JA 3HPQA 5JWHA 1NLYA 4GBMA 1G7RA 3EXAA 3RDPA 4IEEA 5DE3A 2VIIA 1Y3AA 5JMTA 3ADCA 1Z0AA 1UKYA 5G3ZA 5DYIA 2PZGA 3GLFA 4LJAA 1N6NA 1CP2A 4HUQB 4M1MA 4H1VA 2PBRA 4DCTA 2JIZD 3Q85A 2VSOA 3EPJA 3E5HA 2YC4C 2Q9AA 4DLSA 5JFGA 2GEVA 5TV2A 1KTVA 1U0JA 4CEHB 4DLYA 1NN5A 4JL8A 2JDID 4L5BA 4QOSA 4FXPA 5FOVA 1W4AA 1P61B 3U6KA 4FMCB 4DSUA 4KJZA 2EWVA 4A1FA 4D4KA 1J7KA 1SXJA 2NOAA 1G3IA 2F1IA 4GMDA 1NJFA 1AM4D 1DO0A 1X3SA 3M4YA 1PLJA 2ZS9A 4Y0AA 3CX6A 4Q21A 5EE3A 5EXPA 4AK9A 4URXR 1P60A 1A1VA 2VP6A 2BBSA 3OE7A 3TRFA 2RGDA 3CF0A 5H1YA 1LS1A 4C0QC 5JJKA 1N2CE 1JEEA 3WMEA 4AKEA 1R7RA 1NKTA 3IO5A 2WSMA 3TK1A 3VNVA 1VG8A 3AVTA 2Q21A 2F43A 3CLVA 2V7QD 1GIAA 3TR5A 3TW8B 3WYGA 4DSTA 5FI0B 2QBYB 1I4LD 5LB4A 5A4JA 4TSFA 4EJSA 3ECCA 1II0A 4Q4JB 2Q6TA 3RSOA 3AGPA 5E7IA 5FUYA 4GMXA 3SE0A 4B3CA 4BFXA 2ZVPX 1P9WA 1J99A 3VHXA 4Z8XA 2H18A 2JJ1A 4PPQA 4QJ4A 2QAGC 1E0JA 1CR1A 1KDPA 3FE2A 2QN6A 4LHVA 4IDNA 4D4MA 4JLKA 4HZUB 5FBWB 3MSXA 2XNDD 1TQ4A 5J4KA 3QNUA 1TEVA 5HZKA 4CT5A 1JJ7A 2QAGB 4TLBA 1VMAA 2R6GA 1WQ1R 1Z6YA 2HT6A 2YYZA 4A4DA 3UMRA 3ZIAD 2OCPA 4FI3C 2GCPA 1IJEA 1MT0A 4QJ5A 3T5DA 2RHDA 3V00A 2F3TA 4L16A 1F2TB 1VYVA 5TY0A 2D2EA 1N5IA 5A5GA 4F38A 2WSSD 4FCVA 4N0DA 2IWHA 1T5IA 2B7CA 4MRRA 1SVWA 1DAFA 2D4HA 2WSSA 1F5NA 4HLUC 1YZGA 4ZO4A 4D4LA 4LHXA 3BOSA 1JBKA 2QSZA 1NI3A 1W4BA 3LNCA 4RZUA 2NO9A 4MGZR 2ZSBA 1P4SA 3ZIAA 2GEUA 1J70A 1UKZA 3MD0A 3GLFE 1XZPA 2Z4RA 4JVMA 3THYB 4OKSA 1MABA 1KI9A 2DWQA 3FYHA 3S1AB 4NHOA 3GJ4A 4QRHA 5EP4A 1OHHD 3GJ7A 1GG2A 4HSEA 2ASEA 4HB2A 4BECA 2W00A 1E98A 2OXCA 4UXJA 5D3MB 5IHPA 5DIFA 3EC1A 3K70C 1KO1A 3EW9A 2VA8A 2ZJAA 2C9YA 4LBVA 1SVMA 4Q00A 3PEYA 5F2EA 5EP3A 1KDOA 3HDTA 3CNNA 1KJYA 3C16C 3N2EA 3OAAA 5L3SB 1PVOA 1A5TA 1HE1C 4ZCLA 1TAGA 4LBYA 4IXNA 1FOEB 2QTFA 2P6RA 1EFRA 3K9LA 4O2RA 3TW4A 5E7JA 1AS0A 4BEJA 1H8ED 2V1XA 1PUIA 2IWRA 5HE9A 4L9WA 5F9FA 2ZYVX 3E1SA 3ZQJA 4QNRA 3GJXC 4MGIR 1H65A 1VCOA 4DSOA 1JR6A 3HR8A 4POAA 2O0JA 5EXTA 3NEJA 1M7GA 3MGCA 1Z0IA 3KXKA 4MKGA 1JB1A 1AQUA 4JSTA 1OIXA 2L0XA 4QKQA 1CR2A 4ZDKA 4YMVA 3BFKA 1JI0A 1Z2AA 4OHVA 2J87A 1ZD1A 1JJVA 3K09A 2GCNA 3T1TA 4CEJA 1VIAA 5HKKA 2CVFA 2W6JD 1LY1A 2QUZA 2Y8EA 1H8EA 2OAQ1 3NKVA 4K46A 2HYIC 1KO4A 3BH6A 2QP4A 2C95A 1U94A 2GTPA 4U7DA 5CB8A 2R62A 3KKOA 1GITA 4JIMA 4D0NA 4B35A 2ZJYA 2B21A 3TIFA 3T35A 5CM9C 4NZYA 3QF4A 1W0KD 3QIAA 4P4UA 1T91A 821PA 5FBQB 1T3LA 3QG1A 3FFAA 5CDFA 4OI1A 2GJKA 3RS3A 5JCZA 4PZLA 1UBEA 4DCNA 2BBOA 2O5VA 2H57A 1AZTA 1NY6A 2BDTA 4MGYR 3FHOA 3VKWA 4M8NE 3TNFA 2GHIA 5SZIA 2ZUDA 5BN4A 2XJ9A 3U6BA 3CF2A 1R0XA 3DVLA 1XEWX 4URWR 3O8RA 1P6XA 3A1UA 3A8TA 3QBVA 4OHZA 2GJ8A 2Q3MA 3I5YA 3I5XA 4LK2A 4HAVA 2ZI9A 1E69A 3WBKA 2AWOA 3NEYA 4QGAA 4KSCA 4CEJB 3IBGA 4JYBA 5AJYA 5G40A 4HDOB 2QGNA 4S2EA 3AVOA 2OEPA 3SJBA 1TMKA 3ZYCA 2HCBA 2PT5A 4DLXA 2NMVA 3CO5A 1R8QA 2J41A 3T5GA 1ZNXA 4RKEA 5K8IA 3KXLA 2JLQA 3I72A 4FMDB 3OIVA 3T1QA 4OQMA 3CRW1 4PAQA 1QVAA 1GKUB 1N3BA 1RRFA 2EFGA 2JLUA 3AVUA 1W0JA 1PV4A 3C8UA 3D7MA 3ASYA 4LCBA 4AD8A 1VPLA 2DFLA 4G5RA 2R6CA 3LLMA 1GL7A 5AJXA 1QHIA 2WAYA 3D6TB 5ELXA 4BZQA 1KSGA 4OI0A 1SVIA 4W5JA 1NVVQ 1KNXA 4DCUA 4DUGD 2EYUA 1FTNA 1E1RD 1Z0KA 2O8DA 2W6IA 3IHLA 2ERYA 1KI3A 2XGJA 2CL0X 1D5CA 1KYIA 3CH4B 5DGXA 1DVRA 1XU4A 1EXMA 1Z28A 3PVSA 3BXZA 3C15C 3P20A 4P4SB 1U90A 2NIPA 1IXZA 3DMDA 3GP8A 2GCOB 2GXAA 2V55B 3OEEA 1Z0FA 4NE2A 3EZ9A 4JKYA 2Z5FA 2V9PA 2F1HA 1F2UA 1GILA 1RYHA 1KGDA 3L0SA 4V0NA 3HU2A 2IYVA 3O47A 4IVQA 1GL6A 4Q7KA 2IX3A 2KE5A 1LF0A 3NHAA 1QHYA 1TUIA 1IN4A 1L4YA 3V9PA 1UPTA 4JSYA 1GRQA 1A2KC 3GLHA 2REXB 3K0EA 4Z1MA 3TKLA 1Z08A 4V03A 1NG9A 4BRUA 4XVUA 2P65A 3PG5A 3MG9A 1UJ2A 3A1WA 2J45A 1CXZA 1AGPA 1JPJA 1GWNA 3R9XA 1BO6A 2CEAA 2PEYA 1TU4A 2CL7X 1KK3A 2QP9X 2O8EB 4TTQA 1FMJA 2AX4A 2J7PA 5H8WA 1MRNA 1MV5A 2AHOA 2ZSDA 4OK5A 4EPXA 3THXB 1I4DD 2NZ8A 1T8UA 2LCFA 1TNDA 2ZI5A 4PSVA 5E7MA 4URUR 1M1YE 4ACBA 2ZU6A 2ODWA 2FPMA 2P6NA 3DMNA 1G20E 2IYSA 3GLGE 1VKJA 1E1QD 3BJIC 4EKDA 1OKKD 4ZCIA 2O8CB 4V0KA 1K6MA 2PJRA 1FUKA 4Q5IA 1FPMA 4EQ6A 4HZUA 2IXGA 4JLAA 2HF9A 5K8UA 1XEWY 4MGKR 1ZUIA 1G1MA 3SYLA 2JLZA 3OAAD 2VF8A 4WZAE 1KZGB 2FU5C 5KPJA 4ZV4A 4KAXA 4A9AA 2WKRA 1YZKA 2OG2A 2FPKA 3EZFA 3FHCB 5L8VA 2NO0A 2Q3FA 5JS7A 2AN9A 2GKSA 4PQRA 4QXAA 4KFSA 4X8LA 2QQ0A 4YMTA 5LPNA 3A1SA 2ZRIA 2O8EA 1W36D 1CJUC 4WIAA 3TH5A 1N6OA 2JJ8A 4BFYA 1LVGA 2WWXA 3LDAA 5HR5A 2OILA 3PFIA 4HUQA 4B74A 3CBQA 5EQTA 1E2GA 5KHOC 3VHLB 1TF5A 2QRZA 3CRRA 3ND9A 2QMUA 1HQYE 3Q5DA 4C3ZA 4MITA 1N6IA 1TEXA 4V0MA 1V43A 3Q5EA 2ZETA 3GCGA 1FX0B 1WF3A 3KL4A 5FR1A 1ZC3A 4D4JA 2VF7A 2VP4A 4IFBA 4RJLA 5CIWA 1JR3E 1YR6A 2QGZA 2G83A 3RRMA 2BVNA 2ZI6A 4HEJA 1MKYA 5AUNB 1Z0JA 1U8ZA 4O3MA 1LF5A 2J5XA 3ASZA 1GKYA 1RE0A 4Z54A 2ZYTX 4JT2A 4HDCA 4QG7A 4B43A 4UJ5A 1HTWA 4PC2A 4KLZA 3KQLA 3AVWA 2DWPA 2WJJA 3TSOA 4B48A 3SBDA 2F9LA 4M21A 2BWJA 1WXQA 3GJ8A 1RZ3A 2B6HA 4OK3A 5KOYA 5EE9A 3GPLA 5JRJA 2WMNB 3SQXA 4TQAA 3F5FA 3CR8A 2HEIA 2IXEA 4PAOA 4IHQA 4KVGA 1VCIA 1GKIA 3CM0A 4NH0A 2W2TA 1IM2A 3EA0A 3ZQ6A 1Z07A 1SULA 2IYUA 1E0KA 4AG6A 3THWA 3QKTA 5EE1A 3PJRA 2YOFA 3RRYA 1FFHA 3A4NA 4O0MA 1Q21A 4IDPA 3NHBA 1UBGA 2PH1A 3RVBA 4CF7A 1NBMA 1ESMA 3B7GA 3CPHA 3CPEA 1G8PA 4TYQA 2PZEA 1NBMD 2XOKA 1ZM3A 1BOFA 1G9XA 4U00A 2IYQA 4LDJA 1T3HA 1DAIA 1XB2A 2DHRA 4TZ0A 2J9RA 4DEXA 2Q9CA 2WJHA 1E2QA 3ZVRA 4NYMQ 2FV8A 4UNRA 1OB2A 2BEJA 2QNRA 1Q57A 1R2QA 4M9SA 2HLDD 3NC1C 4BLPA 1MR3F 1ZUNB 1XEXB 3N2IA 2F1RA 3QXCA 2IK8A 1UDXA 4II7A 2QL6A 5AK0A 2ZRFA 2EFDB 3WY9A 3KKQA 4OHWA 1XD9A 3B1YA 4N0EA 3DOEA 1E9EA 4NCIA
chains in the Genus database with same CATH superfamily
1W8IA 4EKNB 1P4HA 3H5OA 3HVRA 3CVXA 1ZH0A 1C2TA 4HDRA 3L4KA 1NQWA 3EA5A 4LN1A 3BD8A 3RH0A 2A5LA 2FFRA 4RPLA 2IEZA 4WHMA 5CT6A 2VC2B 2WMOB 2SKDA 3MJSA 5AKKA 1S7GA 3KVRA 3H86A 4YXWD 1ZK3A 3TQCA 1P17A 3UO8B 4OJQA 5JJIA 4F1WA 1EUZA 2PH3A 3ESDA 3JD2A 1JSRA 4PZPA 3E22B 4MVJA 3HXKA 2P62A 1P5RA 2ZRCA 1UBSB 3KR9A 5B55A 2NSJA 4LOJA 3AUSA 4NBUA 4R1LA 2CSXA 2WZDA 4AFNA 3VHQA 3VNRA 2BMVA 1ND5A 1MQ9A 1U0EA 2NG1A 4GPZA 3VPDA 1W7AA 3C48A 3FMOB 1THGA 4FQ7A 4Y6GB 4RZ2A 5B1EA 5KTKA 3GPBA 1EUDA 3QVOA 4E46A 1SHUX 1NMZA 1BX0A 1ST2A 4UBMA 1EK0A 3DGFC 1E92A 4DJ5X 7GPBA 2A7QA 3UXMA 3P9ZA 1KMHA 3VUFA 2J30A 4WLVA 2HMVA 2H51A 3LX8A 5F9HA 4J6EA 3FJ1A 4CF6A 2PHZA 2BGIA 1FQJA 1BNCA 1CX9B 1D2CA 4NF2A 2R8ZA 4MRVA 2FY8A 3I1YA 3WQRA 2V58A 4MQBA 5DN6A 3ITDA 3WX0A 1JBQA 2AH5A 3IOEA 5KYYB 4IYJA 2K6GA 3OWOA 4DLTA 4MRSA 4P0TA 5CFPA 2FPGA 2I7XA 2LKCA 3OJEA 4OL0A 3VR2D 3E05A 3FCOA 4JP8A 4LDQA 5DXAA 1B2LA 3OWHA 4V2UA 4EG7A 3AKYA 4IFIA 4QTZA 3WNVA 5U4XA 4YCCA 2R65A 2N0SA 4R1NA 4WKOA 3RB8A 3UK7A 5FTJA 5C5DA 3W2EA 3HRIA 2I4MA 1IJFA 2A88A 3B85A 421PA 2PUEA 1NA5A 1ZNZA 2Q5JA 4GMKA 3BICA 3M4NA 2JIPA 2W6QA 3JVUA 4QBKA 2NTYC 2GN4A 4H4EA 4FHCA 4DRZA 5JSUA 4F2DA 4OQLA 4V3BA 4AURA 1HNXB 2A84A 5FB3A 1QJ4A 3QP9A 4KR0A 5J5CA 1U7XA 3D4PA 3SHOA 3CFYA 1J8DA 2UVQA 3ZE0B 2WT4A 3NASA 4BB5A 4NZMA 1MUUA 2KWIA 3L7OA 5BT9A 5JHHB 3WMFA 2OUIA 1D6JA 5HVNA 1KI7A 3GBVA 1GVNB 5ALYA 2VPPA 4S0XA 4Y7DA 1SU6A 4X7PA 1O5OA 3RUEA 3V4LA 4DLZA 3K0BA 3TLBA 4Q47A 1ZKDA 4CIDA 3UG7A 2DUNA 2X8AA 4KV9A 1Y33E 4NTZA 5CAEB 1NW7A 4LHWA 4L1KA 1IZ0A 3SZRA 5MN5A 4YT4A 3U61B 2G71A 2F3RA 4YAUA 2EZ4A 3BAZA 3ZJUA 3PYMA 3TCNA 2Q5EA 4YXWA 3H6KA 4YPOA 4Q02A 5CK4A 3A27A 2JBWA 3SS7X 1BMFA 1RXEA 2I4NA 2QORA 4RIFA 3T5CA 5DM60 1QP4A 1DTSA 3OM0A 4K6CA 3N0VA 1MB4A 1DUSA 1MO6A 3L7DA 4JOQA 4YR9A 3OCJA 4JBWA 4EMTA 1KK0A 4NZOA 4F8EA 1M8GA 5JSZA 3SQWA 1WG8A 1GM5A 4G9EA 1D1PA 5IJ0B 2GD6A 1DFGA 2X6QA 4HLQB 1W4RA 4DNOA 3VDNB 4E13A 3H2JA 1O7JA 3KOYA 1NPTO 1XUOA 1N1GA 4MKXA 2IU0A 4L9AA 3L0CA 1H2BA 3LA8A 5DZSA 5JISA 3TZKA 1KK1A 1QYDA 1SHKA 3ICPA 1GO2A 1KJWA 2IFTA 2JCSA 4M7RA 3RTEA 3V1NA 8OHMA 2GBGA 3S2IA 5A3JA 2RD2A 4NEGA 2B5VA 1XWFA 4HADA 1ODTC 5GVRA 3W8NA 3GLHE 4XWTA 1ZHOA 1V8FA 1RRGA 3DFUA 4I99A 1XMVA 1R1DA 5DHFA 3V32A 1L2TA 4HNSA 3PDWA 4WFIA 5CJPA 4L5IA 5DRYA 4Z0TA 3RAPR 5HZMA 4DR7B 1OIVA 1PFWA 2X1MA 3L8HA 3BWBA 2H1SA 4P31A 3UK2A 1NZDA 4ETMA 5C1OA 3DMFA 4ZYTA 2EDAA 3BXGA 3FGPA 2PSEA 2QX6A 2PL3A 4GVPA 2BF4A 1MB3A 2XD4A 5EYPA 3NS7A 1WMBA 1Z3CA 5JNTA 4DYDA 3JQEA 1NP7A 5TQ2B 1O96A 4HDAA 3KUCA 4C05A 4R2WA 3EXHA 4GR9A 3PX3A 5F7XA 4XD7D 3BRWD 4W5HA 3G2IA 1CF4A 2H1IA 4FE7A 1IFXA 4QPZA 3N75A 1G6OA 2DKOA 1LLFA 1US8A 2WM9B 1S2MA 4BJ5A 3O38A 1TA4A 5PGMA 4EGQA 1C3VA 3IQEA 2GVZC 4FFVA 4YT5A 2JHCA 4ITUA 4F2HA 3OQ1A 4O6VA 1HDZA 3R5JA 4N41A 3SPXA 2J46A 3WO0A 2BEUB 4A92A 1HE8B 5LYYA 2JHPA 3H18A 4I8DA 5MN4A 3WRXA 3G7NA 1Y8AA 2YFYA 2ZYAA 4LWQA 4D4GA 1XJ0A 2B3DA 1YL5A 2V4MA 5I9SA 4F3RA 1GUAA 3PFKA 4TVOA 3RPEA 2JGFA 2P5SA 4X97A 1ZX1A 2BW0A 2F00A 5IM5A 2FI1A 2Z83A 1GZ3A 1CPYA 1L3BA 3IUJA 3ZWNA 2O52A 4YO7A 4DPLA 2IOFA 1FFXA 5HKLA 4H18A 4TT3D 2Q5LA 3SDBA 4ALKA 3A6HA 3OY2A 2K2WA 4NJEA 2XGSA 2WWWA 5IDYA 2XT9A 3A9WA 3UKOA 4I9UA 121PA 4BO9A 3WNBA 1N5LA 1UOOA 4X9XA 1KC3A 4MV9A 3VZDA 4DKXA 2B5OA 4OB6A 3ODGA 3KPWA 2H8KA 2BH2A 1S0UA 4ILEA 1PDVA 4BBJA 1Q3TA 1UFQA 3JQPA 3IP3A 4R0NA 4RPIA 3Q9SA 3CF6R 3RUDA 4KO1S 1KO7A 2C54A 2EVWX 1L3CA 1GHTA 2GZRA 3AHEA 3ANMA 2DGDA 2NXCA 2PX6A 3TJZA 4CF5A 4GYWA 3S99A 1OYWA 1JRLA 3QVVA 5EWJB 4F6CA 5HRCA 1ZMBA 4GPEA 4BU1A 3WGMA 4H1WA 5JDCA 1L9KA 2JFWA 3KLNA 1FXWF 2QM7A 3I1JA 4RZ3A 4UU7A 2L2QA 1ULSA 3O8BA 1QE0A 4BJ6A 1UMCB 4JUIA 4MO9A 4N82A 3L1HA 1BQ4A 2D3WA 2HQSA 2XVZA 2GPWA 2JI8A 4J1NA 3TL3A 5BW4A 4ZU1X 2WJAA 3CVOA 5I7FA 3C3YA 3VR6H 1X7HA 2J5BA 3B6EA 2C92A 5FPHA 4J2TA 3OSZA 1AKVA 3RC8A 5LMZA 2FA9A 2IHKA 4IIJA 4CDGA 4UVHA 4AZ0A 2H07A 2GYVA 3C7KA 4Z8YA 4EGFA 1HYBA 1NVAA 2W71A 4LI3X 2BFFA 1EINA 3AV0B 3D54D 4Q9HA 1FFDA 3FNBA 3U9TA 2JD0A 3ER6A 1UWCA 2CXQA 2X5XA 4EATA 3EMDA 4RD0A 1PNTA 4O59O 4XD7A 5JAOA 2E1PA 2A9PA 3EGIA 2FWJA 3G2KA 3TPCA 1EVEA 3CY6A 2CMGA 1WZ2A 2OV2A 3PKJA 4YGXB 1S2DA 1JR3D 3PC2A 1TAHA 4A3SA 4D98A 2YZGA 1DLIA 3E58A 4YV1A 4BKUA 1JEYB 4P53A 3RASA 2CBXA 2OD9A 2FN9A 1ADYA 3MB8A 4MUHA 2YJ4A 4FZJA 4LVOA 3N6VA 3JTEA 3LOUA 3COSA 3N6RA 4K1XA 4KXQA 1HNWB 5KC8A 2A6PA 4PSUA 1J06A 3BTUA 3VZSA 1GPUA 3GFQA 1SBIA 2X77A 1RLIA 1ZIYA 3AM5A 3LWBA 1K88A 5AMXA 3ZHOA 5C9ZA 4CEIB 3FUTA 4BFUA 1DBQA 4ZZIA 2OXFA 3PNPA 3ZCXA 1A97A 1KH3A 2AK3A 5LDDC 1Z0SA 3X1ZA 1I36A 4CU5A 1YMQA 4U7GA 3UPDA 3HCCA 2CF6A 4FGLA 4KQXA 1DKLA 1PQUA 1ADGA 1W76A 4QFMA 5HK9A 4DIKA 5HS4A 3RIGA 3AR2A 4CR7A 2EXXA 3PZBA 4GECA 4LNHA 1ORIA 3LBHA 3HM9A 3KLBA 3LCRA 4NL4H 2YBEA 2Z2YA 4UTZA 3B9PA 1ZUD1 4WN3A 4IUDS 5U4QA 4LRXA 3RCBA 3B2QA 2ODTX 4CF3A 1E2JA 2PLRA 5IPFA 1IY2A 2X0FA 2PTHA 3WYNA 5ESRA 2XYHA 3K31A 3O2NA 1EUCA 1ICIA 2HFKA 2XH8A 2G8NA 2FRVA 2WJWA 5AKEA 5B64A 5LN1A 1S3SA 2VXYA 3FW1A 2XE4A 3IQXA 3JQBC 4QTTB 3UMYA 4JJGA 2YDXA 4RHTA 1IQUA 1XMPA 2NTVA 2A58A 2VPYA 1EDBA 3D7NA 3IHWA 3Q10A 5B30A 3OX4A 4LYFA 1FJ2A 5GVSA 4RPGA 2XDYA 4ENTA 2Z5VA 1U3FA 1VRWA 4GMHA 2IZ0A 4QOJA 3S2FA 1W36C 3EG9B 2IUYA 5EMKA 2HWXA 1PS0A 1L4UA 1W87A 2QSYA 4G24A 4MUXA 2OXTA 4DHEA 4URVR 1V11B 1YFZA 4HMPA 1GQYA 4J91A 2Q62A 4KVAA 3I04M 4RF5A 3LBNA 4BX2A 1RPTA 2O7SA 3KTDA 3VZPA 2WMDA 4ZVKA 1N8TA 1Z4MA 1SO8A 2X0NA 3BB3A 1XTKA 1EDDA 1E3SA 2WWGA 3P32A 2R6JA 3KXIA 3AKEA 3N39C 4HNGA 3FY4A 4CM4A 2J9YB 5D2CA 5JWRA 2PXHA 4PPNA 4ZFNA 3L4SO 1ZI8A 2VHQA 3HJAA 3HU1A 4M0UA 4V0ME 5AOVA 1E2PA 3K9CA 2JLBA 2P2NA 2XV1A 1Y3HA 3I37X 4ZT3A 5C81A 4U9UA 4YMIA 2Q7OE 1UANA 4HEA1 3IIJA 2JG3A 2D06A 4YUAA 3MLBA 2NYRA 3DLIA 5K8LA 1W34A 1Y3BE 2ZUFA 1OTHA 1U8XX 4EB8A 3JALB 3Q0IA 4OIMA 3SIRA 2QROA 3VPFA 5J47A 1OU0A 3UEOA 1I0IA 1II8A 2E5LB 3ZD8A 1EU1A 3EVNA 3JQAD 1RQGA 1DINA 3NM5A 2FXIA 3PENA 4EL0A 2V8OA 2VBCA 2QTLA 3AOGA 4RDXA 5ETJA 2DETA 4Q9LA 4FFDA 5H02A 4YJ2B 1UOQA 1OWLA 4UDNA 3MWEB 3UA3A 5C1PA 3WICA 4MVJD 1E79D 3DL7A 2QHXA 3W3ZB 5GTDA 3O21A 1ZGGA 4GEKA 4J4BA 4R6XA 1XRQA 2C3YA 2FCRA 3AHDA 2BEWA 4XYMA 3RM3A 1RBZA 4JYPA 5L9AA 1DP4A 4BQPA 3JD4A 2BI7A 3O6VA 3SLRA 2AMLA 2FPOA 4QD3A 4OMCA 2Q50A 2ZYIA 3PV0A 1SVLA 1BWQA 1ZN9A 4KQ6A 5KOHB 3V8BA 1X14A 3ED1A 3LECA 4PRLA 4TMTA 5LZ7A 4N6NA 4F46A 2A3NA 4MV1A 4HB3A 5M29A 2QRVB 4R8KA 4C0AC 4X60A 5DULA 1GTJ1 2PYZA 2B2NA 1Z37A 1YZYA 3CN9A 4ZZ2A 3HXOA 3L0PA 4NQZA 2IEGA 4CG3A 4HRXA 1ZL2A 2WLSA 3H5NA 1WXXA 1NUHA 1JSCA 3AHGA 3HU5A 3JQGB 1LDEA 1GPH1 1OU4A 2W6NA 3BCUA 3WISA 3FSRA 1NHWA 4X1YB 4Y2VA 1WB4A 5BV7A 1T9ZA 1PI3A 2EFEB 5IN5A 1VZ2A 4FOTA 2A9VA 1E63A 2JASA 1H93A 4N8SA 1FVHA 3DS8A 3HUUA 4EPWA 3WTBA 3R7DA 4NOMA 1KOLA 1UADA 4H3KB 4IF6A 4W1QA 1MT3A 2JC3A 3TXAA 4ISCA 3G0HA 4D9KA 4OLBA 1HDXA 2OAP1 2WD9A 3HV2A 1C0EA 4RWZA 3Q7RA 1JQEA 4OJMX 4XVRA 4C21A 1ZP6A 1Q15A 2EX0A 2WUFA 2ZJFA 1HRKA 4BNNA 4DMCA 2H31A 2EBWA 2ZRJA 5BNFA 1W1IA 5AESA 1Z39A 4B3HA 4WUTA 2ANCA 4YROA 4A5SA 1R10A 1YK0A 3M9LA 3O1JC 4AJEA 5IC4A 4PNPA 2ZSJA 4IS2A 3WIOA 1P5HA 4CE6A 2ZKIA 4P82A 4RK7A 1MFZA 1ZIDA 1OLOA 2ADFA 3PQ7A 1XRJA 2BBTA 3AOEC 4R9SA 4YAJA 3BL8A 4AO6A 4H3SA 3FNFA 1JUDA 2BZGA 4MCJA 3UF0A 3VMMA 4EUKA 1I14A 3I9KA 2PK3A 4JIGA 2ZATA 4OGKA 3JAMA 3PRYA 2WSLA 1N2XA 1I10A 1OFVA 3DDZX 1UT6A 4NNPA 3NM6B 1YL6A 1Y7LA 1QP7A 2NO5A 1ZN2A 3LX6A 3TZCA 5BNIA 2A3RA 4KHPB 3JQQA 1H4VB 2C99A 2UVPB 1SBYA 1QGED 5AI4A 1AT1A 4TL6A 4S3MA 3OFJA 3WZLA 4BX3A 2Q7DA 4PZZA 1IWPB 5EMJA 2VS1A 1M8PA 3U3JA 3KL2A 3KR1A 2RGEA 2H4WA 3KWLA 4GGOA 3HJCA 2W6ID 3VU8A 4I4TF 2I91A 3EX7C 2YHSA 4OMFG 1WETA 1E6KA 1ISRA 3PRKE 2JFOA 4TTSA 1GCIA 4U6SA 5E0KB 3N7AA 5HBRA 3QMPA 4G6ZA 5IEBA 1LI7A 2VNSA 2PLFA 4L5AA 1OWOA 4J8PA 4YFVA 5FXMA 3QIVA 1K4MA 4NLLA 3Q4GA 4NAHA 5FULA 3WL7A 2G4VA 1GCGA 3HY6A 4I50F 4K6HA 1K5PA 5B6IA 1PNRA 1ZAYA 1ODIA 3NAQA 5FTLA 3CS3A 2CJWB 3PUVA 1NQOA 1FTGA 3EIFA 4KQ2A 3E7PA 3V4PB 3TM5A 1DIOB 3K6SB 4B3GA 4GMFA 1WKCA 3DLBA 1GN8A 3U4QB 1RAAA 1QV7A 4C7VA 3A9RA 1Z2NX 2X0KA 2ZTHA 1P73A 3H11A 1OW3B 3COJA 4PBRA 3PJFA 5C1DA 5JO0A 5K20A 3AJRA 4UNQA 3VTKA 4LJRA 3WL5A 4BUJA 1WXIA 1RMTA 1FUEA 1K0UA 2PGNA 5AK5A 3K8QA 3T7KA 4UHBA 4A8PA 2CVZA 2AQIA 3ZWDA 4EHDA 5JI2E 2IF0A 4IJQA 4DTCA 2ALJA 4L50A 3T7TA 2I7VA 3NOOA 2CJXA 4ISBA 1HDEA 2FW1A 2WHRA 4J0JA 3VBEA 3I2IA 3KQPA 3OEWA 3W6PA 4E51A 4FONA 4KR3A 5EN4A 1GQ2A 2UYQA 5E0OA 3NYQA 4RTRA 2IHJA 2PX0A 3MAAC 2YS6A 1JAXA 3OJOA 4M0CA 1MABB 5HF8A 2XYGA 1R4MA 1JALA 5K5EA 2FCAA 8GPBA 2WV9A 1MMFB 3GUUA 1MO3A 1NSYA 5I7WA 3DC7A 3IBYA 1HE2A 1FRQA 1OZ0A 2EX4A 4E15A 3TINA 1IHDA 2B25A 3ZDEA 4QREA 1DT3A 3GLGA 2FJ0A 4R2MA 2WKPA 2NSDA 3CEAA 3MJRA 1NW6A 3MINA 1WCV1 3R23A 2PD4A 3G0IA 2B1GA 2AEFA 4FN4A 4KU4A 1TOAA 4R68A 4ASUD 4D74A 3MOGA 2H63A 2V9CA 3O26A 4PONA 4A82A 1H9AA 4Z0PA 3UIEA 1YUBA 2XLBA 3EDRA 1O6GA 3QKRB 4RA6B 4UD6A 4MI3A 2B8EA 1NJGA 4LRWA 1HF3A 1QKKA 2OCLA 4NC9A 5DI3A 9ABPA 1FJGB 1AF7A 2XTMA 3ON5A 3AVYA 3OECA 5BNWA 3IR6A 3DZDA 4DSZA 4G0MA 3OEYA 1W94A 3OQBA 4MWGA 2E4YA 5JSFA 1B0AA 5FUVA 5HZHA 3L02A 4HQRA 3AUFA 3RYHA 1V8BA 3W5DA 2OGWA 4CFYA 1FX0A 1YC5A 3I3OA 3W6OA 4PO8A 3NHWA 1P0MA 3UK0A 4JQZA 3FNIA 3ZWWA 4F2PA 1H2EA 3FPSA 1GU1A 4JL6A 3TX6A 1J20A 1GXSA 2REOA 3QKWA 3WRXC 4E5PA 4ER5A 2JLVA 1OR8A 3PIDA 2H5IA 3ROKA 5C46F 3L5OA 4O1MA 3NHLA 3S2EA 1ECFA 4HUJA 3QVLA 4WW0A 4JVSB 1WPQA 4NY1A 1GZ7A 3H9BA 1YJAA 3T5AA 1KZ1A 1P2SA 3CNOA 3KOUA 1XXHA 2ODNA 3DBLB 5KO2A 1EFHA 2KM1A 4ZI2A 2E4WA 3EVTA 2DTEA 1X7YB 3OX3A 5GM1A 1G8MA 4IXMA 3S29A 3N87A 4B71A 3E7WA 1MIOB 3NORA 2QMOA 4MQEB 1XTRA 3ZTWA 3OMWA 1WOMA 4QBFA 5LLDA 1Z45A 4OAOA 1F48A 1OFTA 2FLKA 3NXSA 4KCGA 2BTQB 4RVSA 3RU7A 2YKGA 3ANNA 1RKUA 3WNCA 4JL5A 3SDZA 2F59A 1X39A 3HVHA 3P9PA 1PZMA 3QM1A 1CUWA 4OUDB 1NMEA 4XJVA 4NATA 4OQXA 1LV8A 4B7ZA 5TS3A 1R6AA 2VP0A 3PHGA 1TAUA 3D8RA 4F85A 1Z29A 1R0SA 2RC6A 5J2TB 1XGKA 4C4SA 2W90A 2W2OA 5EZYA 1VA4A 5KYVA 5I7RA 3WNDA 2O1SA 2W2VA 4BP3A 2BLNA 5BUQA 2C2WA 2Q1SA 5GGXA 4KWTA 4AN0A 3AEKA 4FJ2A 3PWKA 1U9JA 1T6NA 1V5WA 2VSFA 3A4VA 4HAZA 5FDFA 2ES4A 3U60B 3IO3A 1TCAA 3AKDA 3G2MA 4CMGA 4OHCA 4IQ4A 3BE6A 2IDJA 2Y4OA 2BUBA 1IWBB 1S4QA 4WY8A 1FSZA 3E0QA 4AF8A 4RTJA 4PAGA 3RVQA 4CLDA 2ECFA 1LFDB 3W06A 4D25A 1AGXA 2OC9A 5AK4A 1JW9B 2XRFA 2WAMA 1AK1A 3MRVA 3BZUA 4RYLA 1C9KA 1AXGA 5CXQA 2JVJA 3LHSA 1AKWA 4OB8A 1ADCA 4C2BA 5IDVA 1TTTA 2I66A 3UMSA 5BRNA 3NZEA 2AN1A 1VL1A 4O8CA 1D6SA 2ZRHA 2BCGY 1JQDA 1ZM7A 2OO5A 5EAIA 1J6UA 1QYXA 1WD7A 1ZCZA 2KI5A 1UP4A 1C3XA 3RRZA 3DUFA 3KJGA 2W0SA 2A9KA 3E35A 3G2OA 2FZ5A 3GMTA 3Q7EA 1CQPA 3D8NA 2QDKA 3KYDA 4M9ZA 4LJ5A 4PG4A 4C76A 2AUMA 5UKDA 4E33A 1UMBB 5CD1A 4I6GA 2P4EA 1K5GA 4B48A 2HADA 2DTDA 4JZKA 4MS3B 1E6CA 3WWPA 3FDJA 3NUQA 4J3NA 5A4IS 2C0QA 1E7SA 2FKAA 2OFOA 2R86A 3NH9A 1FU4A 3TUJC 2HDNB 4F12A 2ZFUA 4LTDA 1MDBA 3B48A 4M8LA 3QHPA 1N0VC 3ZQKA 5HM6A 3T7JA 4ZEVA 3NIBA 5A5DA 2BHNA 2G25A 2VHEA 2XB2A 4YBRA 5FTMA 4KIJA 4ZJYA 4TS4A 5IBCA 4OHXA 1XD2A 2H5EA 4O25A 3L8CA 4G0XA 4CM8A 3S1AA 4C0BA 1R0ZA 1U2QA 2G0TA 3BORA 2IYRA 3NC0C 3L6BA 2QJWA 2MSWA 4P3YA 2UYYA 4MVJE 3U37A 4Y9DA 3W1VA 1ISIA 1GGVA 4K26A 5DCYA 2WYOA 3FKSD 4YAIA 5ALWA 3WV4A 1PLLA 3CUSA 4PYJA 4MZDA 3FHTA 3HBLA 1WMDA 1NW5A 3ZHBA 2BMEA 2Z1MA 4QOGA 1A2BA 2OZKA 1IZ7A 4L73A 4GL2A 3H42B 2ZBVA 4X1OA 5DN9A 1UMKA 3VGJA 4BX8A 1G6KA 1YA8A 1MJHA 2NAFA 3WSTA 1MORA 1RLTA 4KZPA 2VLIA 2PUDA 2B99A 2MHCA 3R3YA 4TOIA 2DPXA 2JCVA 3FPCA 3GRZA 4ZOAA 5EIFA 5LWHA 2JZCA 1BFUA 4LPKA 1PFGA 2RG1A 5JAMA 4UBLA 5KDOA 1MGPA 2AYXA 1N77A 3KSZO 4MMXB 3N07A 4HWRA 2FPXA 1ZJZA 1W88B 4Y8VA 3EAFA 1DI0A 1KYZA 1C3EA 4NXMB 1E2DA 5DNVA 1A9PA 4AWXA 2AOWA 2C4WA 3A11A 4CCSA 1QH9A 2V7XA 5CVTA 4OLHA 4P36A 2W11A 3F67A 1DT5A 3OM8A 4FGJA 2P9CA 1G5IA 3JWGA 4I55A 1VJ1A 4LXUA 2OHFA 1B0PA 2BFDB 4FDAA 4F9EA 3G8AA 2DX7A 1IN6A 3C41J 2XADA 4MPDA 2HA7A 4U1RA 5HIMA 4BLSA 2P41A 2FX2A 4GLBA 4ZVLA 1K75A 2ISCA 1RWBA 5IKXA 1CZLA 3QI7A 2QG6A 4G3XA 4Y1GA 1NNEA 1MPTA 1YT5A 4A8HA 5DNWA 5ADUS 4W5OA 5DYYA 1AIPA 4ZVRA 2YC2C 3H9QA 4U2CA 5CJ2A 5THQA 3KP1A 3SHWA 4CMJA 1LJUA 4IQ0A 3THRA 1JQBA 3IAFA 1GQFA 5E4YA 3WHPA 5DX1A 2Z9BA 2G08A 2ZI7A 3QE3A 4HAXA 2D62A 3ANTA 1GRRA 1W88A 4HNAA 4DNXA 4EDHA 1I7SB 1ZOPA 2NUAA 1FU7A 3EFHA 3A25A 3NTXA 1M2VA 4TT8A 5LJIA 3ROEA 1ZGCA 1QQAA 3NHZA 4YQFA 2A9OA 3C5CA 1QZZA 3ZY3A 5FWYB 3I01A 4OG2A 3QV1A 2WKSA 5EVCA 4M0LA 1V4BA 4W5WA 1KJ8A 3HCOA 5I4KA 2ID4A 1D04A 3IT3A 3NETA 1V3TA 5IDWA 1ZK1A 1HM5A 5FTKA 1RFGE 2Q07A 3T9BA 2XRYA 1YQDA 2E1RA 1YQQA 3DH0A 3EEYA 3B1ZA 4UD2A 3O9MA 3HB9A 3AFHA 5FUBA 1P0CA 3AL0C 2MYPA 1EWQA 3FYDA 1F2UB 4QOFA 1MJNA 3RC7A 3SC2B 4LF5B 1UFVA 1XLWA 3F6PA 1NQ5A 1PFUA 1U65A 2ONYA 3HKDB 1ZOIA 4OLAA 2AWNA 1DKMA 3RHFA 2QXTA 2VSXA 1A7JA 2OO5C 3KB8A 4UW9A 5K51A 5IT4A 1NOKA 1TMOA 2Y4NA 1IQ0A 3DR3A 2POQX 5G3YA 5C7OO 4ARZA 3KS9A 3MJHA 3DKKA 5IX8A 4W9MC 3PIRA 4YACA 1KPIA 1IOWA 5LP6C 1W0KA 2I6QA 4LIPD 5C7IO 3L0DA 1Y8QA 2CY0A 2XAAA 3HWWA 4D8VA 3L84A 2O3UA 4O08A 1LPAB 3W79A 3VAAA 1B3BA 1QCDA 1T9GS 1DWUA 1Z8FA 2R6AA 4IPTA 4JP2A 4IJKA 5DSZA 1Q0LA 1RQXA 3UQZA 3KR2A 3KT0A 1E1CA 2DY1A 3AHHA 3F8WA 1C7JA 1JDSA 4KN5A 4M38A 3ZCPA 4PVDA 5CFZA 1M1ZA 4HB4A 5KNLA 4JQSA 4R2HA 2OFFA 1GR0A 5FBLB 2O2GA 5LXTF 2G04A 4PWYA 3MJEA 2NO4A 3MINB 4K9RA 4NE7A 3KETA 1UJMA 3CJRA 3PVCA 4H15A 4Y6PA 2ZR0A 3ROMA 3ZV3A 1ULBA 2VSYA 3PQ8A 2EKDA 2QRVA 1Z2EA 3E8SA 3I45A 2IPOA 3FZYA 4NPHA 1JU4A 2CLSA 2G0NA 2PRIA 5C8VA 1H9CA 3WYCA 2CFRA 3RYCA 4ZT7A 2QU8A 5CB4B 1LZLA 1IQPA 2FP4A 2A57A 4Y2GA 5TJHA 3LT4A 5HKKD 1KOFA 3IAUA 4V0OA 2P2DA 3IA2A 3W4JA 1RYEA 4KWCA 1P3Y1 3BFVA 1K0FA 2VHCA 5K8TA 2BEWB 1UBMS 1R0YA 1QQTA 3HC7A 1FVOA 2ZWIA 5CDFE 1P0FA 4MW9A 1ECLA 2A4MA 3FXAA 4L5YA 3ZIDA 2MIIA 2ADMA 2PE5A 4BTVA 3N6XA 2CL6X 5H16A 1LPBB 5B3LA 3EFBA 4Q66C 1R0KA 1U1FA 4J16A 5L3RA 4NBRA 3LCJA 3U4CA 1P1CA 4GX1A 1DQRA 4AN4A 3HJRA 4XYGA 3PK0A 4OMUA 1UDCA 4R8VA 5L3VA 1S6YA 4E09A 3WTCA 1X8LA 2WTUA 2H4FA 6PFKA 4E21A 2G1KA 2YQ4A 4YR7A 3CINA 3T7IA 4EY3A 5DBFA 2ZWMA 1HT0A 3QYPA 2ZYHA 5F12A 1KYTA 2PMWB 4GP7A 2GRUA 2ZB8A 221PA 1N57A 5FTNA 3O4RA 4RUKA 2I3DA 3RYIA 2GF0A 3TEMA 3SZUA 3UICA 2C7OA 4NBWA 3O8OB 3MB5A 3IPXA 5J2UA 3FH0A 2AHRA 2AFIB 4ONEA 3VYSB 4C0JA 5C7YA 4UUOA 1JDBC 2ETXA 3FWHA 3IAM6 5DFAA 2I6TA 4P7BA 3CHYA 3ORYA 2I29A 4YPVA 5B57C 2ZI3A 3S8YA 1TYBE 2PRSA 4M53A 4A7PA 3MFYA 4LX8A 2AJLI 2CT8A 2AFVA 3M4XA 3UCFA 3CE6A 3C98A 1ZLYA 4MDYA 4EKIA 4CVNA 2WUVA 4WNAA 1ZH8A 4ER3A 1YRHA 2BL4A 3B5EA 1MB2A 4JVLA 3HB0A 4C5CA 1KP9A 3BTVA 4I55B 5H3HA 1QRRA 2Q49A 3K0AB 5ALKA 4EFLA 1DRVA 2QKYA 4RTNA 1JMVA 2XYQA 1EJ6A 4RX1A 4X93A 4JB2A 2Z9DA 3I2KA 2D1QA 1GG5A 1E1DA 3CH7A 3FFBA 3OLYA 2ZXUA 1QHXA 1KO8A 1L7NA 4G8BA 4ZYLA 1Y8RB 1XAHA 1XWIA 2LUOA 4FGZA 2HMAA 4PNHA 1QO0D 1H6AA 1DCTA 1ESDA 1LPPA 2X4DA 2XCIA 5KYUA 2G7ZA 2JK1A 2J33A 4A0RA 1K4YA 4Z0NA 1FDRA 2IT1A 4F56A 1OFGA 2OZVA 2CNKA 1NMQA 5EXSA 4U7FA 1IPHA 3V8MA 2YW9A 4IM7A 4BPBA 4HY3A 1A7UA 1U0LA 2PUWA 2I62A 1KH1A 5CEEA 1LD3A 2G4CA 4PYLA 1CQXA 3GP5A 5HQ3A 2J3IA 2C2OA 4L7VA 3WWEA 1E1YA 2R60A 5IMBA 3S81A 2P2GA 1ACJA 3LP6A 4RVOA 3VR5H 2G72A 3G88A 4U2BA 3DJYA 3NKFA 4HAYA 4JR0A 1OWNA 4I1VA 4QSMA 5LP1A 4DTIA 3DDCA 2QTGA 4FEEA 2B1RA 2XWPA 4CT0A 4YIHA 1SCKA 4G1UC 3UMVA 2IIBA 1KVRA 4IZHA 3UTCA 4DKJA 4D3YA 1MH1A 1OXVA 2OO3A 5F33A 5IW8A 2V6JA 2W2QA 4TLDA 4ZDJA 3KQUA 3NNDA 3P9XA 1SIWA 3RWOA 2GFQA 3I3SR 4MI1A 1SM4A 3BXOA 3VDXA 2G88A 4L08A 3ONVA 3D8BA 2ZIZA 1YDHA 1XD2B 3R8XA 4LHZA 3TOZA 4GX0A 1P0QA 4GX2A 1FMFA 3TXXA 3L04A 3IP9A 2AUNA 3A26A 4LS3A 2HAEA 3U1TA 4Q4HA 2QJRA 2YZ2A 4LX0A 3AV3A 4LUCA 2XKJE 5CX1A 1BMQA 1Z5PA 1GZSA 2WF5A 2I54A 4FGWA 3KKMA 5GM2A 5J5VA 3AEZA 2FWPA 1PJRA 3AUKA 3WVNA 4RZXA 4H4DA 1NPYA 2WZCA 5A03A 2OB1A 2H1LA 2N1BA 1HEYA 1K9SA 5DTQA 1YQUA 4Q9KA 4W5RA 5KVVA 1IM5A 3JVVA 1I2CA 2I9KA 3KKNA 3DBIA 1J2JA 1UWLA 1M7BA 1Z5VA 3A4IA 1G3QA 4Q01A 4N76A 5HCNA 1KFEB 1EK5A 4W6ZA 5A71A 3DV9A 3JYHA 4JOCA 5D7NA 1NKSA 1U1DA 2JAQA 4O4HA 4DR6B 1Y8CA 1RIIA 2ICAA 2W6JA 3DKIA 2DR3A 4OXKA 3DXFA 4FE3A 3TUZC 2HA4A 3MWFA 5ELMA 3N0WA 3N7UA 2HSEA 5K09A 4D0LB 3KIPA 4IFEA 4B7CA 2X9NA 3EG5A 1B0UA 2C96A 4OXXA 1BWSA 1XKQA 1EM8B 3F6CA 3OEED 5DLYA 4EZIA 2C0CA 1E5LA 4LGMA 2GWHA 4X91A 2EDCA 2NTJA 5DTEA 3QWBA 5K3EA 4G0OA 5E7QA 4E88A 4CM9D 1C4KA 1I2BA 1R0CA 1V5GA 2ODPA 1SKYE 5F1OA 3PX7A 3DEHA 3FCUB 4YAOA 5E3JA 1HO3A 1U2DA 3NP7A 4JLBA 1HE5A 2AOXA 4R05A 3A37A 3CRMA 1Q1ZA 4FINA 5EXEA 5AVKA 4J9VA 1M2KA 3C1UA 4PYQA 4AKTA 4E32A 3USES 4YLGA 1JWAB 3BYZA 3P9SA 3X2FA 4J07A 5HEKA 1SUIA 1ZH4A 3LVQE 4BXOB 5C34B 3WBBA 3E53A 4Y0VA 4TTAA 4A36A 1YCGA 2JFHA 3RVDA 3M6FA 3WL6A 5HM8A 1XL1A 2WHQA 2WD7B 2WIDA 4OKIA 1TM2A 1KI2A 2H1FA 3PEVA 2C2KA 4IO0A 4AMVA 5A4MS 4IG4A 3BK7A 4UOEA 3CIOA 1LDGA 2CNDA 1XHFA 1R9JA 3MIIA 1W0JD 4KPGA 4QYWA 5FOTA 3MWJA 4DLUA 3WDKA 5CXXA 5LZ4A 3MK31 5A4FS 1ZL0A 1M34E 2DHQA 1C7ZA 3L92A 5FPPA 2B83A 3W5CA 2O5RA 1PV1A 2XTNA 4GXTA 1HX7A 3FBTA 2H4XA 2O2EA 3S5JA 3BX1A 3FTDA 3TQFA 4B2YA 4DA6A 1QIMA 1Z5OA 3H16A 3OT5A 2FWNA 3ABQB 4IXDA 2IHYA 2H2DA 3LXMA 5A5FA 1FZQA 4OCZA 3WI7A 3A32A 3I2JA 1E3WA 2F1JA 1VPVA 1GGMA 1NVMB 1DCFA 1L8OA 2YZMA 1TRKA 3HFRA 4NU5A 4U3JB 5I9NA 2FGKA 4MQEA 2UU9B 2EJVA 3IELA 1F6BA 2P2CA 2QD5A 4AP6A 4KLRA 2ENUA 2HQBA 4XVHA 4DR3B 1XXLA 2C9ZA 2X9VA 3MAGA 3ACCA 1LBIA 4P35A 4TXNA 1DCMA 4V0RA 5IKEA 2WWFA 4AG5A 2ZPAA 3IAM1 2WFLB 1IBLB 4GQAA 1C50A 2AL7A 2GN1A 2PR2A 5IJZA 4YX9A 4H7PA 1W1UA 1E1RA 5AVWA 3U09A 1L7DA 2HO5A 3FTNA 1GUYA 5AJHA 5DK6A 4CIYA 5K3AA 4BMZA 3BJRA 3WO1A 1ORTA 1FYDA 2FPUA 1OB5A 2PYIA 2QN9A 3P2JA 5I8WA 2R8RA 5IFKA 1R3UA 4RFSA 3NI2A 4WA7A 1Q14A 3DE5X 1NUQA 5K6AA 4BRWA 1EFTA 5FOXA 1CUJA 2P30A 4X24A 4JJKA 3FOAA 5BSEA 5J3JA 1Q5PA 2XRMA 4MQ4A 2J31A 4PU0A 1XZMA 3LXUX 3IODA 2I1LA 4RD4A 4X95A 3TXYA 3IILA 1VKNA 2Q5QA 1SKQA 1YRYE 4QUIA 1V8DA 1QCZA 1Z22A 2ZUSA 4MS3A 3HLYA 4RMHA 4PSCA 2A5JA 3KX2A 2Y1WA 1D7AA 2Q4EA 4HYYA 5BSHA 3GFOA 4JT4A 1B0ZA 4MJ3A 5E9AA 2RB4A 4LWPA 3VO2A 2JGDA 1PSZA 3ASVA 4CM6A 3NTUA 1WMFA 5DOVA 4EEXA 5JZSA 2B6NA 3FWKA 4RS3A