2OFXA

Crystal structure of the apsk domain of human papss1 in complex with adpmg and paps
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
205
structure length
205
Chain Sequence
HMATNVTYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKTTVSMALEEYLVCHGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKLFADAGLVCITSFISPYTQDRNNARQIHEGASLPFFEVFVDAPLHVCEQRDVKGLYKKARAGEIKGFTGIDSEYEKPEAPELVLKTDSCDVNDCVQQVVELLQERDIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elucidation of the Active Conformation of the APS-Kinase Domain of Human PAPS Synthetase 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetas
total genus 78
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 2.7.1.25: Adenylyl-sulfate kinase.
pdb deposition date 2007-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01583 APS_kinase Adenylylsulphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ofxA00
2PZEA 1GIAA 4BZQA 4DLWA 1TADA 2ZE8A 1AZSC 2ZS9A 3G5UA 1U8ZA 1JB1A 2IYZA 3U3MA 4EPWA 3G0HA 5FUYA 1IN7A 3RSOA 3FFAA 4Q9HA 3Q8XB 3JVUA 1R0XA 2ZRAA 4CDGA 4CEJB 5JWRA 3AEZA 5EUQB 2H1LA 3LRPA 2CE2X 5JS7A 3MAAC 2QY9A 2UZ3A 1XMJA 5CDFA 1E2HA 5KHOC 4KLNA 4A9AA 2P67A 1T8UA 1OXSC 3LX5A 5AUNB 1V43A 2FZLA 3BH7A 2BKEA 2JIZD 4DCTA 4I1OA 3FVQA 1WBDA 3SJAA 1KI2A 4UKDA 1G3QA 3KJHA 1YZLA 3A1SA 4TZ0A 5BN4A 4GZLA 2YWHA 1ZMXA 3QPUA 4HYYA 4LJ9A 4MYHA 3RS2A 3UWOA 3I5YA 5SZIA 2C96A 4FCTA 1D5CA 3VR1A 1TPZA 4B43A 2Y8EA 2XITA 1R0ZA 3C4JA 1YE8A 1EX6A 4ACBA 2J7PD 1C1YA 3AF3A 2J9RA 4PPQA 1D2EA 4D26A 4QJ5A 1PLJA 2KJQA 3TW8B 5F2EA 1N0VC 4POAA 1G18A 3KQLA 3HYTA 4XD7A 3WHKA 3BRWD 2V1UA 2PJZA 2V1XA 3PUVA 4EPVA 4URXR 1KSFX 4DSOA 2GXQA 3CRQA 4URWR 1ZVQA 3V00A 2EU8A 4NH0A 3WP1B 4B2LA 1HUQA 2QI9C 2LKCA 1G9XA 1HH4A 4Y0AA 2A78A 4FWIB 2C2HA 3RSLA 1SKYB 4Q1CA 2ASEA 1T5IA 3FMFA 4G5RA 1QDEA 2GZDA 2W0SA 3MG9A 3QENA 1S8FA 4XTCS 1YQTA 1HE8B 2ZE7A 4D6PA 2HYDA 5KPDA 1N0WA 3B82A 1YR7A 3SE0A 4ASUD 3PUXA 4PC1A 2VF7A 1E2MA 4Q47A 4AURA 2IS6A 2QRZA 4O2LA 1QHHB 4WAUA 3ASYA 3EPHA 2CCKA 1YR6A 4EJSB 3VX3A 1JAHA 2AD5A 1W49A 5AWFC 1R10A 1ZAKA 4KI0A 3QXCA 3IQWA 4B3GA 3B1VA 2RAPA 2OCAA 1RPZA 2QP4A 4WXRA 3QXJA 2A5YB 2OLKA 1XD9A 2J5XA 2XJ4A 1G6OA 4BLOA 5LD2B 1TEXA 2OCBA 2B21A 2OCYC 4HZIA 5CK5A 3C14C 1IJFA 5GJCA 4CEIB 1Z06A 2F55A 1N6HA 3HDTA 3NH6A 2F7SA 3ZIAA 5HCIA 2F43A 3D31A 3I8SA 4LPSA 2ONKA 4TT3D 2JIZA 1OKKD 1ZP6A 1RVDA 4NU0A 2NG1A 5D3MB 4TL9A 4NBSA 5EP2A 5FBRB 1IN4A 3T1VA 3I61A 1UKVY 3VHLB 4BASA 5GVSA 3KFVA 4B2IA 3EASA 3IHWA 1Q1QA 1DAMA 4P32A 1D6JA 2ATVA 1OXVA 1I2DA 2ANCA 4P3YA 4JL8A 2CK3D 2WJVA 3QKUA 1M8PA 2KWIA 2XTMA 4Q1BA 5K8TA 2Q9CA 1FUUA 1OYWA 3EC2A 4OYHA 2WPDA 3DZ8A 4HLUA 5EE1A 2BHRA 1IXRC 1RKBA 4D4LA 1SXJE 2EFHB 4BZPA 1R0YA 3T1OA 2RHDA 5AJYA 2C98A 2Q21A 2EFDB 3GPLA 4FWTA 4U5XA 4PAQA 2ZI6A 4E22A 2ECKA 2ZYVX 3FHTA 2P65A 1T3LA 2BBWA 1G6HA 2FDCA 1KAOA 4A0RA 4UNRA 2IX3A 1ZNYA 2AD1A 1WRBA 4DLXA 2GJAA 3KKNA 4KVAA 3SYKA 4O0MA 4RD0A 5EXPA 4EIWA 3WNDA 1XEXA 4W9MC 1NN3A 1RYHA 1AKEA 3NHBA 1P9WA 1RJ9B 2ATXA 4GI7A 4Q7JB 4LJ8A 4OHZA 4ITRC 3WRXC 2OO7A 2PBRA 1P72A 1W2HA 4FN5A 4U00A 5LB2A 5E4FA 4B33A 2MMGA 4TTQA 4A15A 1Z0KA 2VSOA 1RZ3A 2IA5A 4Q4JB 5A0FA 3U3JA 1T5LA 4IXMA 4XVUA 2WSSD 1HYQA 3B9QA 4PQRA 2EQBA 3EPKA 2J3EA 4NYJR 1Q21A 4N3NA 1DTSA 1G3UA 4R9UC 3VR4A 4AIIA 4CEHB 5FBQB 3LW8A 4PSAA 1PZNA 1Z28A 4LBWA 1MRSA 2WBLC 2IWHA 3PIRA 4KCGA 1CJMA 2GNOA 4EUNA 2C9OA 3QJYA 4NL4H 3GLHE 2B8WA 1MOZA 3NVAA 3JZAA 1DAEA 1XBTA 2CJWA 3EG5A 3OZXA 5FBWB 2Q9AA 5KYKA 5F9HA 1GDDA 4LBYA 2QE7D 3LW7A 3VMFA 3GLHB 2IS1A 1ZU5A 1UEIA 3K09A 4IVQA 1XTIA 2QMUA 1WB9A 5HPYB 2HDNB 2ERXA 4HATA 3ICQB 2E1RA 2GXAA 3ZD6A 1IXZA 2DWPA 3E70C 2Q6TA 1W5TA 3SBEA 2VLIA 3FKSA 4GP7A 3U2QA 2PLFA 4ESVA 4HSEA 3CZPA 4LBZA 2QPOA 2YZ2A 3ZYCA 1W36C 2WZQA 4UNSA 2KE5A 2OCPA 2UVQA 5AUQA 1AGPA 5FR1A 5M04A 1Q1ZA 1S9HA 2QT0A 4JJKA 3PFIA 2JJ8A 4FD2A 1WQ1R 1MO6A 4JKIA 2IUUA 5B64A 3R9IA 4IEIA 4C2UA 2IF0A 2AL7A 3LVRE 1KKMA 4OI2A 4PR0A 3B6EA 2WOJA 4E07A 1ZU4A 1U2RA 1JJ7A 1NG9A 2ZREA 4OJQA 2A5FA 1F3OA 1CS4C 2NPFA 4BLQA 2VEDA 1NP6A 5CYOA 4NE2A 3RC3A 5HKKA 3IIMA 2IK8A 2PZFA 3N5CA 4B3BA 3OIUA 3U7HB 3THXB 4MDEA 4KFUA 4Q1FA 2IXFA 1OIXA 4C0BA 1Z29A 2EYQA 3NC1C 1JR3D 221PA 4G5QA 3THOA 2QAGA 3T34A 1WA5A 3G82C 2JLVA 4AYTA 2ZETA 3RHFA 1W48A 1GL6A 4TTPA 2HCJB 4I1UA 4BFVA 1R7RA 4PHTA 1IONA 4TZ6A 4F7WA 3VKGA 2ZR7A 3QBTA 3GLHA 2C77A 5FPTA 3HYRA 2JLSA 4DKXA 1A1VA 4JL5A 3IO3A 3QEOA 4HB2A 3WBKA 4EFNA 421PA 1G3IA 1KK3A 1JEEA 2NOAA 3I1FA 3ETLA 5BYKA 4DLYA 2CL0X 5AJWA 1KO7A 4QBFA 4FMDF 1UBEA 1B23P 3OEHD 3W5JA 2RGNA 3X1DA 1OLOA 3O8BA 1Q1BA 4GDFA 2H57A 4ZV4A 3B13B 4DLRA 4KV9A 1G5TA 2IYVA 2VIIA 3X1YA 4ZKEA 3MRSA 4NYMQ 4Q66C 4QRHA 2WV9A 3C7KA 3AUYA 4OK6A 2VP6A 2CVFA 4OK3A 4NCHA 1NG1A 4D4MA 4A0FA 121PA 1Z0AA 5EXXA 4IDPA 3AVQA 4EFMA 2IT1A 1W2GA 4FW9A 2J41A 5DHAA 3P1JA 4R2IA 4DSUA 1AGRA 2JASA 2YNMA 5A4JA 3ZJYA 1PJRA 1ZC4A 3GQBA 3I72A 1DS6A 2X19A 2QQEA 2ERYA 4V0ME 4BLRA 3I32A 1S1MA 2FEOA 4ZCLA 1OHHA 1P6XA 5FTKA 4KYUA 5P21A 2ZE6A 4M8NE 4WA7A 4O3MA 4GBMA 2GCNA 4JIMA 1OH7A 2CVHA 2ZUDA 1XCPA 4M1YA 3ZZ0A 5DN6A 1QRAA 2YWEA 2FMXA 1LW7A 1BKDR 3KKQA 2OUKA 3KJEA 2WJYA 4UNPA 3SDZA 5B57C 4N0DA 1Z2CA 1Z63A 3K70B 1XZPA 1CR4A 2ZYWX 1M74A 1OXXK 1BIFA 3RS5A 4F4JA 4C0SA 4RY2A 1OB2A 2DHRA 5BQ5A 2PX0A 2ZRPA 2WJJA 2R6AA 3LFUA 4I4LA 4Q7KA 1XPOA 2R2AA 3U4QA 1UEJA 1XEFA 1ZD9A 1GSIA 3ZQ6A 2A5DA 1CJVC 3L43A 1E1RD 2IYTA 1E9EA 2D62A 2OZEA 1EFUA 1FPMA 3KQUA 3B85A 3IBYA 4E03A 2Q3MA 2JJ2A 3SU8A 2BMFA 4PX9A 5JWHA 1UKYA 1Z6TA 4L9SA 3LLMA 3L82B 1KI6A 1KO4A 2IYSA 2H18A 2N1BA 1CBUA 4GP6A 5SZJA 2WWFA 3A1TA 4I81A 3CWZA 4TMVA 4OI1A 2L0XA 4P31A 5AK0A 4R71A 1L7VC 5J4KA 1ZM2A 5DI3A 4N1AA 2OILA 2A30A 4FCVA 1XF9A 2FZ4A 1E98A 2D06A 2FWRA 4L9WA 4MKFA 1T0JB 4PO1A 4QGHA 1P2SA 1F48A 4D2IA 2QTVB 1ZNWA 3H1TA 3UG7A 3A8TA 1AS3A 3F5FA 1W1WA 1A7JA 1R2QA 1WF3A 3NBZC 4G5OA 5J4LA 5JZVA 4P4SA 4M9SA 4MRVA 1SVOA 1FQJA 5EUMA 5LBIA 4JLOA 1KK1A 2NO7A 1EG7A 3ICEA 3DZDA 4KYIB 4TLAA 2VHTA 5HCNA 3I3SR 1D8TA 1I2MA 1NIPA 2HUPA 4JLJA 1KI8A 1M1YE 4EDHA 4KFSA 1G291 5B2ZA 2VHUA 1G7RA 2I3BA 1XJ0A 4MYUA 4Q9IA 3ADCA 1GFIA 2IW3A 1RFLA 4QJ4A 2ZRCA 2NO1A 3B1WA 4GPTA 5GJWC 2HT1A 2AKYA 2GEVA 3SOPA 3LQQA 1K8RA 2JDID 4K81B 3N2IA 1DAFA 1MO4A 4A8JB 3BFKA 3VHXA 3NEYA 3EARA 1H65A 1P3JA 3LX8A 1XNJA 4JYCA 1NL3A 3VR6A 2FN4A 1GG2A 1EFCA 2DFNA 1OIWA 1J8YF 3HU3A 4B76A 1V5WA 3PV0A 2IF2A 1MH1A 2BCJQ 2NZJA 2RGEA 3CM0A 3CF6R 2VQSA 2ZRJA 1FX0B 1NVUQ 3AVOA 2JLUA 1CKEA 3AB3A 2O8FA 4JLNA 1DARA 1L2TA 3I92A 1GOTA 5KOYA 4IEEA 1W4RA 2YWFA 2I1QA 4TQUS 3VR2A 4HLUC 4F91B 1KDOA 5KSOA 5E7IA 3AVWA 2W0MA 3KKPA 4EQ6A 4HUQA 3ZVNA 2W00A 4F38A 1GITA 1KOFA 2BIFA 4Q03A 4B2PA 1W4AA 4DUGA 2QMEA 1CJTC 2XB4A 3FWYA 3GLIA 2IXEA 3ZZTA 1DOAA 1G3RA 1OB5A 3VKHA 2NMVA 1MV5A 4JJZA 5EXTA 3VU9A 4BPBA 2FX3A 2C78A 2IXGA 2I4IA 1COWA 4WIAA 4DVGA 2AXNA 4B74A 3FE2A 5FTNA 3RNLA 1OXTA 3CX8A 2DPXA 2WIAA 3K1JA 4LYAA 2WWHA 1KY2A 4QNRA 1SKYE 2X77A 1D9XA 3A36A 5FI1B 3W5IA 2J0SA 1OW3B 5JMTA 2G1JA 1E0KA 4RFVA 1Z2AA 4X8LA 1EX7A 2BDTA 1GM5A 4LI0A 1G5RA 2CK3A 1KAGA 5JJLA 1II9A 2X2EA 4HB3A 1XTSA 5JECA 4HZUA 4PSKA 1TUIA 4H1UA 2EYUA 1NBMA 4US0R 2OG2A 5SZHB 4C30A 3U61B 1FTSA 3IILA 2ZYUX 3CRVA 3HR8A 3SQXA 4A2QA 2JCSA 2W83A 4QG7A 2ZRMA 5KDDA 4A1FA 4CT4B 1CEEA 3IEUA 5IT5A 4NDZA 5G53C 4XWOA 1R6BX 2ZRFA 3CX7A 3OE7D 3TRFA 4MUAA 3S1AA 1CR0A 1XZQA 4V0NA 2RMKA 2CXXA 1LS1A 2G0TA 3QXXA 3LQRA 4JVSB 2O8CA 2OBMA 1E32A 1VCIA 3B78A 5FOTA 5FUXA 5G41A 3AF0A 4CW7A 5C4MA 4MGZR 1ZRHA 4G0NA 4NPHA 2IYWA 2WKPA 4TMXA 1IN5A 3GLFB 3TSZA 3PR1A 4LHXA 3VQTA 2VP0A 2DWQA 1Y3AA 2G1KA 2BMDA 2AWOA 1JPJA 4MYTA 3IIJA 1HQCA 2ODNA 1A4RA 3BD9A 4M1SA 2RH5A 2R6DA 5JJIA 1W0JA 1GRNA 3TR0A 4M9XA 1EFHA 1U90A 3RS4A 4M1TA 3REGA 3L0IB 4Q7LA 4UJ5A 5E7JA 4QGFA 3BFXA 4AKHA 1P4SA 1BH2A 2Z83A 4KFRA 4MGYR 3NWJA 1MR3F 3LWNA 4Y0VA 4HAUA 3DMDA 4MRRA 1NBMD 1RRPA 1DELA 4F93B 4OQLA 1AK2A 5L3QB 2JDIA 3ZS9A 3C8UA 4JLDA 4LYFA 4M0LA 2XZLA 2VL7A 4YC7A 4UXJA 3CR7A 1ZD8A 5H68A 4L8GA 3DKPA 5JRJA 1KYIA 2RHMA 4FMDB 4OHWA 3U3OA 3QKRB 4XIGS 4C2TA 2ZRKA 1RYFA 1SULA 4LJ6A 4TMKA 3W3ZB 1AS0A 1E0SA 4IDOA 1SVLA 1YZKA 2J46A 5DSZA 4UXHA 4TLBA 3T61A 3EPLA 2AN9A 3SC3A 2GEDA 1ONBA 4JBYA 2G83A 4HB4A 4LOAA 1KJZA 1FMJA 1A2BA 1OFIA 2WJHA 4L5BA 3LAWA 2XTZA 2ZPTX 3SJBA 2VHCA 3AKDA 5DNYB 5CIQA 1SZPA 4RKFA 2ZR9A 1WMSA 2B92A 2Z0MA 3ASZA 1G41A 4CF7A 5KSZA 4NMMA 4NKRA 4IVPA 1CRQA 3V4FA 3R9WA 1NIJA 1VG8A 1N5JA 2P0EA 1ELOA 3DDCA 2MSDB 3E1SA 2PX3A 3L8YA 4PPGA 1CIPA 2H92A 2VHQA 4ZDWA 3CH4B 3IHLA 4KVGA 5FOUA 1X6VA 3ND9A 3IUYA 1Z8FA 2WIBA 2UKDA 1TL7C 1R8SA 2CLCX 3C41J 2RB4A 1W46A 4JLMA 2JLYA 2WJGA 2IS4A 1SVIA 4QNMA 1EK0A 3O8CA 4BEBA 3KZ1E 1B0UA 3SR0A 3UKDA 4Q4AB 621PA 2O0KA 5JCZA 1CLUA 1SVSA 4B35A 5LD2C 2ZE5A 5JSZA 1GNRA 3K0EA 4EFLA 3EC1A 1M6NA 3VNUA 2GZAA 3JZMA 2QTFA 4QM6A 2V9PA 4HZUB 1E9DA 1E4YA 5B30A 4YMUA 1WP9A 2FSIA 1XEWX 3H86A 4K46A 4Q21A 1KJYA 3WYAA 4CVNA 3T35A 3QOFA 1H8EA 3QF4B 1ZJ6A 4GSYA 1UM8A 4KITB 2F3TA 3AV0B 1AS2A 2JEOA 2Q0HA 4HI0E 3NBFA 3LH5A 2ZI9A 3QBVA 2ZUCA 4PQFA 5KDOA 2EWVA 4Q01A 5KU1A 1DAIA 1HURA 1VTKA 4LHVA 4EKDA 5C18A 3TNFA 3NIBA 4LJ4A 3VNVA 1G8FA 2JJ2D 2QENA 5CB6A 4W5WA 4OI0A 3AVUA 3R8CA 3W9YA 3OESA 5JEDA 5TXGA 3W3AA 5E3HA 1E94E 2IEZA 4QC2A 5BYJA 3I62A 1LV7A 3GLIB 3CBQA 4IDQA 1D9ZA 1KKLA 2NQ2C 1DAHA 1ZIPA 1T91A 4QKQA 1ZYUA 2WWIA 3AKEA 3QSYA 4PC3A 1WBBA 2C5LA 3LD9A 3Q7PA 4Z8XA 2OAQ1 3GD7A 2J7PA 2GZHA 1DE0A 2ZI3A 5BW8A 2KBEA 3BBPA 3Q72A 1YZQA 5CJPA 4D81A 4D82A 1RW4A 2QQ0A 3X1ZA 1E2EA 1KK0A 3DKVA 1CU1A 1G8HA 2RGGA 2CNWD 3BB4A 1DAGA 4HLDA 3D6TB 1YZGA 1AA9A 2QM8A 4TYQA 4B3XA 5CITA 1PVOA 3IO5A 4M22A 2QSZA 2DFLA 2OESA 4PO9A 4QHSA 2WAXA 1YZUA 2YV5A 5EE9A 2P6RA 1X1SA 4ZDJA 1W47A 2JJ1D 3F8TA 1TQ6A 4TMWA 1MABB 4M1KA 4TSFA 1E2KA 3AP3A 4RD4A 2FEMA 2P5TB 1QHGA 4A2PA 3MWJA 1FZQA 3X2SA 1G7TA 3SS8A 4C0JA 4BUJA 1HT1E 4RZXA 1ZIOA 4KO8A 3K0AB 4PZYA 2J0UB 1NLYA 2BC9A 1N5LA 1E2LA 1KO8A 5KO2A 3UATA 4B71A 4YMTA 2VSFA 3FMPB 4NCKA 2QSYA 2RCNA 1ZM7A 4UQOA 4EPXA 2D4HA 1N0UA 1QHIA 4AI6A 2QAGC 3CB4A 1HY3A 1KZGB 1NVWQ 4BFYA 5JI2E 3SYNA 4TYYA 4XD7D 4NYIQ 1YR9A 2O8FB 2IHBA 4YQFA 3B7GA 1FX0A 1ETUA 2CLSA 1U9IC 2YWGA 1EFRD 5JSZB 1J7KA 1N6LA 1ZM4A 2XEXA 1XEWY 4TTRA 1P2TA 4NHOA 4DSNA 2J0QA 3CWQA 5EE5B 1NY6A 1OFUX 1VG1A 1NMXA 2QM7A 2HCBA 1KDTA 5TARA 4G1UC 3P4YA 4IOMA 2NO6A 2PMDA 4TL8A 3K0CC 4BFXA 1E9CA 3Q3JB 1SQ5A 4UNNA 1BMFA 3SQWA 1ZNZA 5EXSA 4DXAA 1OH8A 1VKJA 4URUR 3EA5A 3WMFA 3OF5A 1F5NA 1UKZA 4MKGA 4R2HA 4XVQA 1W36B 5JEEA 4P33A 4JLKA 3UIEA 2QPAA 2ZRHA 4DWJA 2JLZA 1H8ED 5DI3B 2FGKA 4MGIR 2HYIC 1Q12A 2O8BB 2XXAA 1AQYA 2J7KA 1E2NA 1UDWA 3B8HA 1YR8A 3UANA 5FOSA 2ZIAA 1NKTA 1Y63A 3KTAA 3WRYC 3I4LA 5HKKD 3P27A 3WMEA 2OEPA 1NBME 4GZMA 1E9BA 3THYA 1KMQA 3NDPA 3BH0A 4D4JA 2F3RA 4F92B 2FPMA 2PEYA 3EXAA 4DBLC 3AKCA 1WCV1 3HR7A 4QXAA 1Z6AA 4MRPA 1I4TD 1SXJB 5LDDC 4FCWA 1FOEB 4QFMA 1EFTA 3UK6A 5SZKB 4QBGB 1X8JA 3HP1A 1GNPA 2BMJA 1G7SA 4EQ6B 1E4VA 1S9DA 2RGAA 2OLJA 4V03A 4A8JA 4ZPXA 2B6HA 1M2OB 1XJQA 3IPXA 3NKVA 4JMPA 3ZVMA 3GEIA 4Q4HA 2CBZA 3EIEA 1BMFD 3SJZA 1TF7A 5DISB 4DEXA 4LK2A 5EJEA 3RVBA 4MYCA 1KTVA 2W6JA 5JCPA 4HAWA 3R7WB 1AQUA 5G3YA 2IYLD 4LCBA 3SYLA 3BK7A 2A5GA 4IJMA 1XMIA 2H5EA 4I1VA 2R65A 3RLFA 4BLPA 3RRMA 4M1MA 3NDBB 4OHVA 2WWGA 5L3VA 3LXXA 1VCOA 1G17A 2F9LA 1YRAA 2EFEB 4RFSB 3T1QA 5GADl 1SHZA 3BERA 4LUCA 1T6NA 1X8KA 1XCGB 4MRNA 2D7CA 1XRJA 1GRQA 4ZI2A 4X8OA 2EWWA 2XTNA 4IDHA 1SGWA 2PL3A 3WYFA 5C1BA 3P32A 1NN0A 1Q57A 3AF1A 3BS4A 3PUWA 4IOKA 1TF2A 3GMTA 1TTTA 2GJ8A 5F9FA 2BOVA 3LY5A 4NONA 2QG6A 1OE0A 3H0KA 1JQLB 1U94A 5JWOA 4AD8A 3DMNA 1TX4B 2O8CB 1GNQA 1JR6A 5CM8B 1KI3A 4RZUA 1BO6A 3H2YA 1HQYE 1E1RA 3AUXA 1TUEA 2D74A 4OK5A 4JSTA 2O8EA 1Z08A 1F2UA 2Q9BA 4LHWA 2WWXA 4BRUA 1K5GA 5AJZA 5C4GB 4BZXA 4M1WA 1Q0UA 3FHOA 4BWYA 2WWYA 3THXA 3PQCA 4H9GA 2C99A 2FF7A 3OAAD 4LJ7A 3C15C 3CONA 5K8UA 1P73A 3CUEF 2CNWA 2R6CA 1HA3A 4X8HA 4HLCA 821PA 5FOWA 1II8B 1M34E 4JVNA 1FUKA 3K0FB 3SJCA 2A3RA 521PA 5DGXA 3Q5EA 4PQYA 3VKWA 1N6NA 5EP1A 5G3ZA 3KKOA 4MITA 1FW6A 2ZU6A 4C0LA 1A2KC 1LVGA 1XDBA 1DO0A 2ZVPX 2P6UA 4LBVA 4LJYA 3A1WA 5DLQC 3U60B 2IYQA 4PC2A 3DEFA 3EZ6A 4YMSA 3PUZA 3TLXA 1F2UB 4N0EA 4RZ2A 2KB0A 4CEIA 4HAVA 2H7VA 3GJ0A 3O8RA 5C2JB 1NLFA 3QNUA 4DLTA 1GAJA 2HJGA 2GXUA 2BJWA 1BS1A 4J0QA 1OYYA 2C9YA 5J4HA 2QNRA 4B34A 3MWYW 2WTUA 3R7WA 4TMZA 2HT6A 3RRNA 4D0NA 2CHVA 4D4KA 2QBYA 2C9CA 4V0LA 4OHXA 5TMPA 5JHHB 3UG6A 2ZM5A 3UMSA 2XSZD 4D80A 1QHHA 4HUQB 3SEAA 4GRAA 4FI3C 1RRCA 1S3SA 1ESMA 1OFHA 4G3XA 3TW4A 1Z6GA 5CJ2A 4M2LA 4NCNA 5K8IA 2QZ4A 4DB2A 3FDIA 4V0MA 1OXUA 4CRWB 3TIFA 3U7GA 4RD6A 1E69A 1L4UA 5LPNA 2YC2C 2OFWA 2Z4SA 1SVMA 4M21A 1Z0DA 3UWKA 3PJRA 3B1YA 5FH9A 3B1XA 2XZOA 2ZU0C 3DPUA 4KLZA 4R98A 1FFHA 1XD2B 2R6GA 4M1OA 2O8DA 3M6AA 4KODA 2V7QD 4PXAA 5FUVA 4Q19A 5DIFA 1LFDB 2J87A 1KIMA 2OT3B 3ND8A 4P0TA 4XJXA 5B58C 3PEYA 3LA6A 3MCAA 5DO9A 2CJWB 3W8NA 3Q7QA 4JLAA 3PITA 5CM9C 1RJ9A 1P60A 4V02A 2NO9A 3DOFA 1ZD1A 1P62B 2E87A 1P2UA 4TQAA 4DCVA 1ZC3A 5HE9A 3BOSA 4NTZA 3I8XA 4BFWA 5KSYA 4A82A 4GOJA 2Q3FA 2VP4A 2R44A 4S35A 1SXJA 1DPFA 4PC6A 1P7CA 4WZBE 5EZ6B 4DT1B 1IY1A 4FMBB 1ESNA 1O87A 3A1UA 1W4CA 2PH1A 1QHNA 4BQSA 2XGJA 1U8AA 2QN6A 2XOKA 3BWDD 4JT2A 3PVSA 3RS0A 1KJWA 4LJ5A 1Q20A 1KO5A 1ZCAA 2AK2A 3TH5A 3QVUA 1Z47A 2ZI7A 4KXFB 1A82A 3RWOA 2ZANA 4OQXA 3A37A 2GF0A 2V6IA 1NF3A 2BMEA 5UKDA 2WICA 3T15A 2PJRA 2GAOA 4YXWD 721PA 5TV2A 2ZJ2A 1QF9A 4TT3A 2XXAB 4C7OA 4EPTA 2WWWA 2OE2A 5L8VA 1QG2A 3AVTA 2RGBA 1PUJA 2AXPA 2ZTSA 3W90A 3F0TA 2FV8A 2ZSBA 2FOLA 4JBXA 3X1WA 2GK7A 1DG1G 3ZD7A 4IVRA 3ZS8A 2O52A 2GCPA 2V3CC 1G4UR 5JI3E 3A58B 5EQTA 5EP4A 4BLSA 1TEVA 4ARZA 1YZTA 2XNDD 3PXGA 2ZEJA 3IGFA 3T06B 1J8MF 1FTNA 2ZJBA 3AP1A 1XD8A 3MSXA 4PFSA 4LV8B 3P26A 3DVLA 4AKIA 5IF9A 4NYMR 2ODEA 1NJGA 2VSXA 3EZ7A 3REFA 3Q5DA 2HF8A 2ZRIA 1DAKA 1L8QA 1T3HA 2DFTA 3KXKA 1E0AA 1KY3A 1E2DA 1G8PA 5FL7D 5JBQA 3TQFA 2ZROA 3AVYA 4TSFD 4F4IA 3RABA 1MO3A 5JRZA 2CL6X 3K9HA 3LO5A 1W0KA 4IFBA 2D2EA 3BGWA 1JAIA 1EWRA 3CRMA 2B7BA 4M9QA 1HEIA 4TQ9A 4A92A 3TR5A 2CE7A 3HWSA 4D25A 4US1R 5CIWA 5H1YA 3EPJA 3KUCA 4D0GA 2EW1A 4FIDA 4P4TA 3CX6A 4PPNA 1K6MA 2G9NA 4ZI3A 2OFOA 2J0UA 2G0NA 5DI9A 1OT3A 3QG1A 2AX4A 3OIVA 4C0KA 1CULC 2QEQA 3AGPA 5DHFA 5FI0B 4ZKDA 2JJ1A 3GEEA 1F6BA 2FSFA 3CNOA 4O25A 1TMKA 5CDFE 4Z54A 2VA8A 3BFVA 4RCYA 2BWJA 3PEWA 5FPSA 1XMVA 3O47A 2XNDA 2PEZA 4LRWA 2ZI4A 1QZXA 4A6XA 2MMCA 2NIPA 4B75A 4EJSA 3CIOA 4XWKA 2IYUA 3R9XA 2WJIA 5FTLA 2A2ZA 1XTJA 1QG4A 5FUWA 3W34A 3ZIAD 3H84A 1IQPA 4XSHA 2MSEB 2ZUBA 4ZCMA 2OFXA 3CRW1 4LGMA 3LBHA 3SFZA 2JLWA 4CZ2A 3MUFA 3GLFE 1TAGA 1Z3IX 2TMKA 4JKYA 3CR8A 4EPRA 2YOGA 4MQBA 2NZ8A 2GCOB 4DHEA 1UBCA 3RDPA 1IOZA 2EVWX 3UMFA 4WVFA 2JGNA 1CRPA 1HV8A 3O8DA 5D3MA 1Z5ZA 5L3SB 2F9MA 3A4NA 4PPFA 1ZNXA 2IC5A 3GJ8A 4KBGA 1NMYA 3D7MA 2HV8A 3TUJC 4A6PA 3K70C 2CL7X 1G21E 4DSTA 4CEJA 2O8BA 2YOFA 2QE7A 1N6RA 3OIWA 3L0PA 5CLLA 3ECCA 2QTHA 3KQNA 2CEAA 1TF5A 2IYRA 3ZQJA 5J47A 1UDXA 3ZH9B 4AKEA 3WP0A 2ZAOA 2D3WA 1DEKA 4DZZA 4Q9JA 1KI9A 1ZUNB 3SZRA 5E7MA 4A2WA 2WMOB 2P3SA 4E09A 2DB3A 1R5NA 3FB4A 4EJSC 3OEHA 3B9PA 4Q4AA 2DR3A 1E79D 2OSBA 2F43B 2FSGA 4QGGA 2F1JA 4IOJA 2QORA 1KSGA 3ZVLA 2FH5B 2REBA 2ZJ5A 1LB1B 3RYTC 3TSOA 5FTJA 3RC8A 1PUIA 1XXHE 1CP2A 4QM7A 4ZIRB 3QG5A 4BFUA 4CGZA 1U81A 1FNNA 3CZQA 3K9LA 4QOSA 4MKHA 4NCIA 2QGZA 2HLDA 4RKEA 3U7EB 2BJVA 1SKQA 3T1TA 3THWA 1UBFA 4O2RA 3QXSA 4JVLA 1CR2A 4X8MA 1Z22A 2ORWA 1NMZA 1RE0A 1YVDA 1CXZA 2IUSA 4KSCA 4AG6A 1GKUB 1X3SA 4MUBA 2QU8A 1G5PA 4JL6A 1TQ2A 1E2QA 3LBNA 2C95A 5KPJA 3K0AA 1OPXA 4GL2A 2ZJYA 3H4MA 4CEHA 3A4LA 3TE6A 2R9VA 2VP2A 3ADDA 2G77B 2VYFA 4Q4JA 2GDJA 4JYBA 2HLDD 2VP5A 1KI4A 2VO1A 2ZVQX 3MD0A 4F4CA 2VBCA 1E9RA 3PCRB 5J40A 2R62A 3QKRA 2G6BA 2BM1A 3WMGA 2ZXUA 1E9FA 1CF4A 1T4GA 5JFGA 3L0SA 2H8KA 3ONWA 1U9IA 3C16C 1Z83A 1AIPA 2VPPA 5FOVA 4URYR 3CNNA 2FFHA 2Z5FA 4XOIA 4LV6A 3T12A 2AK3A 1IAQA 3EZ2A 4RVCA 1IN8A 3OEED 4DLZA 1KNXA 3OFNA 2FGJA 4MRSA 3AVVA 3QKSB 2ZRNA 3KL4A 4G5GA 3OAAA 3PEVA 3K0CA 2PCJA 3HU1A 5CB8A 4II7A 3M4YA 4G01B 1EESA 2W6JD 4RJLA 3FGNA 2IHYA 1F60A 3CF0A 1KSJA 2ZYTX 3CW2A 1M7BA 3B60A 5FBVB 2IL1A 4OJKA 2XSZA 1DG3A 6Q21A 2N42A 3M0EA 4IFEA 1Q22A 1TQDA 3S1AB 5GJVC 3BAFA 1AM4D 1NN5A 1WDTA 1NKSA 1H8HA 3ZLJA 3OEEA 3A4MA 3BC1A 4Q00A 1E9AA 3DHWC 2QUZA 1T9HA 1VIAA 4LPKA 4OL0A 3U7FB 1G64A 2OXCA 1JEDA 1N6OA 3HPRA 5FR2A 4ARZB 5KTYA 1JPNA 1GL7A 4TLDA 3U6BA 4BRWA 1CJKC 2YHSA 3K70D 1P9RA 4QHYA 4ILEA 3EA0A 3GLFA 4US2R 3BIFA 3LBIA 1EWQA 2GJSA 2J1LA 4WXPA 5BWMA 2ZJOA 3LNCA 1YHNA 3BJIC 1UFQA 3UMRA 5ANRB 3VR5A 2BCGY 2ZR0A 4JZKA 3TK1A 3ZDQA 1M7GA 2AFIE 2OV2A 3TMKA 3TAHA 3QE0A 2YJTD 2ZRDA 3QPVA 4TN1A 4PTLA 1G8YA 4ASUA 3QVVA 1JJVA 1KI7A 3I5XA 1Z0FA 4PZLA 2P5SA 3CNLA 2YKGA 4OQMA 2UZIR 2FE4A 4WZ6A 1QHSA 5IHPA 2YINC 3NXSA 3WNCA 3THWB 3K0SA 1YRBA 4MKIA 1SVKA 4PHHA 1PLKA 2XOKD 5DYIA 4MH0R 4LYJA 1ODFA 4V0OA 3EWSA 4Z8YA 1F2TB 2G88A 1BYUA 2FNAA 1VIYA 2C04A 5JLJA 5IDVA 5ELXA 1LF5A 1GP2A 4ZIRA 1S3GA 2W6ID 3K9NA 4Q4LA 2CLDX 3QUSA 4HLQB 3IKJA 3DM5A 4GMXA 2QP9X 2GBLC 4I1SA 3WYGA 2GKSA 2V54A 3HJNA 1U98A 3NG1A 4XTRA 1J99A 4JSYA 4HAYA 2GK6A 3TJZA 2RGDA 3GFTA 1G7CA 4RD2A 1L4YA 1E1QD 1VYUA 2PMKA 3SHWA 2W2VA 1PV4A 2YVUA 4XH9B 5KSPA 4YDHB 3T5DA 2DCUA 3KJIA 1OSNA 4JS0A 2Q3HA 4PAOA 5FPHA 3U44B 4XVRA 5IK2A 5H70A 4Q1AA 3EWAA 2N46A 4S2EA 4LV5B 4L15A 2IUTA 3QQ5A 2EFGA 1II0A 1GKIA 4NP6A 4A4DA 1XPUA 1BYIA 2CHGA 1U99A 3K8YA 4BLTA 4U7DA 1E79A 1SXJC 3U3KA 3IQXA 1JQJC 2QT1A 5F98A 3C5CA 2QMOA 5L3RA 1RIFA 3N70A 1FL9A 1W5SA 3MFYA 3P20A 2BM0A 3V9PA 3GJ3A 2QBYB 1PLLA 4P4UA 1GUAA 3TAUA 5KNCA 2FPKA 1XTQA 2F6RA 1G1MA 1HE1C 4TLEA 2V4ZA 2WOOA 2W2XA 3BXZA 1S96A 4DJTA 1RRGA 2X1VA 4YMWA 1FP7A 1G19A 1T0HB 1X86B 3MJHA 3SI7A 2ZITA 3B5JA 5DN6D 1S0UA 4W5JA 4AYXA 4PAMA 5J4YA 2AHOA 4P4SB 3NH9A 1EFRA 3TQCA 1JBKA 2BBTA 2CCJA 2MSCB 3E5HA 2HJVA 3GP8A 3GJ5A 2WMNB 2KBFA 3B2EA 2WKQA 4B3FX 1MRNA 1XMSA 4KAXA 3QEJA 2XX3A 1VYTA 2GVDC 5BN5A 1LNZA 5HE8A 4MDFA 4NZYA 1NLZA 3LLUA 4GMDA 2XNSA 5AUOB 5FPYA 2REOA 4R7ZA 2GESA 1SXJD 3CKLA 1KZ7B 3K0FA 3RS3A 3J81k 1C9KA 4DCUA 1E2PA 4L4UA 1FP6A 3EZFA 5DYGA 1NNEA 1FQKA 2V7QA 4Q02A 3AGQA 1YZNA 1E2FA 1R8QA 4YLGA 5FBLB 4Q9LA 1UF9A 1ZUHA 2VTKA 1MT0A 1TNDA 1GWNA 1OHHD 3NBYC 3U4QB 2YOHA 1P75A 2FJUA 1P9NA 1IY0A 3DOEA 5AR1A 2XAUA 4A0GA 2ODWA 2ONJA 3ZVRA 4C0HA 1TQ4A 4HAXA 3FKQA 3KKMA 4DLUA 3M1IA 2B8TA 4JLVA 1J90A 2GCOA 3QF7A 3AVXA 1N5KA 3OFND 1VCMA 4Z1MA 4C3ZA 4AWXA 1EXMA 1QVAA 1K5DA 5TDHA 1G20E 1NN1A 1UPTA 2GBLA 4LHYA 4OQFA 4QL3A 3X1XA 2I1VB 1E99A 1Q1EA 2CCGA 2ZS8A 1XP8A 3KJGA 2NPIA 2NTYC 4NCJA 4RCZA 4AG5A 2BV3A 1XPRA 3IPYA 1G8GA 4C7OB 4JBWA 1JNYA 3WBJA 2A5JA 5FPKA 2QROA 3F3YA 4EPYA 2VH5R 1AN0A 2DBYA 2P6NA 2C8VA 4KJZA 3HPQA 2AKAB 5KNDA 3C5HA 3NC0C 4ERNA 2VRWA 3L8ZA 4UXIA 4M53A 3VU9B 3I73A 1MO5A 3A6PC 3AVPA 3TUZC 4A36A 3K53A 3AH8A 1KMHA 4WZAE 4HUTA 1NSFA 2VF8A 1OV4A 2F1HA 2ZRLA 2ZRBA 4BE7B 4UJ3A 1XFAA 5FL7A 1YKSA 2BVNA 1X1RA 4PHFA 4U02A 1OH5A 4DDVA 4TWZA 1Z07A 4Q4HB 5EE3A 3WXMA 5GJBA 2ANBA 2E9SA 2OBNA 3JVVA 5BXQC 1CR1A 3TSWA 4DDUA 2QA5A 1TU4A 1IN6A 4LX0A 1DBSA 4JT4A 5FL3A 4BGDA 3TGPA 1E0JA 5AUPB 1XWIA 2ZSEA 2O0JA 2GXSA 5DH9A 1E2GA 3QI2A 4IRUB 2H16A 1RC8A 1W7AA 3EW9A 1JI0A 3UXMA 3CO5A 1E1QA 1I4DD 1OF1A 2RGCA 4IOLA 2FG5A 2GJ9A 1XD2A 2RGNC 1LF0A 2JLXA 3KUDA 1N25A 2FPLA 2ZSAA 1VHLA 2ZRGA 1LY1A 1ZINA 3OIYA 4WBSA 3LV8A 4CT5A 3NHAA 2GAAA 2ODBA 4DCNA 1S4QA 3WNBA 1XXHB 4PO8A 2QAGB 1XB2A 3TVDA 4DIEA 2ORVA 4EAQA 3FYHA 3GLGB 1VG0B 3IDQA 4ZDKA 3MLEA 1VCNA 4ON9A 2DY1A 4ABYA 4YONB 1P5ZB 4DCSA 3V4RA 1R0WA 1MKYA 4Q7MB 4B3DA 4QBIA 1W44A 4DLVA 5HZKA 2G3YA 1N2CE 2DYKA 2FFBA 1XU4A 4QJ3A 1N6PA 2O8DB 2ZI5A 5K8LA 3U44A 4AK9A 5DE3A 4URVR 1BOFA 2Z4RA 3GFPA 3RANA 3QKTA 3TKLA 1P2VA 1XTKA 1M7HA 4YXWA 1VDZA 2GWHA 1I4LD 5IK2D 1HT2E 4TYPA 3RRZA 4GOXA 2VP9A 3N2EA 2QP3A 2R6FA 1Q44A 1DO2A 4DIDA 5KUTA 1KSHA 2FFQA 3CPHA 2VHJA 4IXNA 1IJEA 5H8WA 1C4OA 3IEVA 3DO6A 3EAQA 1NI3A 2ZJZA 1IM2A 1XTRA 2V6JA 2YYZA 4DT1A 1KDPA 1ZCBA 4BFTA 3P4XA 2J0VA 1KI6B 1VECA 4LJAA 3RWMB 2X8AA 1FNMA 1VPLA 3LVQE 4GOKA 4L16A 2F1RA 5BN3A 3CPJB 4IKEA 1COWD 1D2MA 2QAJA 4Q1DA 5E95A 4RD3A 3FMIA 4HAZA 4HB0A 3K09C 3MGCA 1NVVR 2GA8A 2QMHA 1N6IA 4LSGA 1LS6A 2HXYA 2GTPA 1OKKA 1OJLA 4V0KA 1Z0JA 1QHYA 5TB5A 5J4VA 2PT5A 2XJ9A 3GEHA 3IBGA 1QHXA 3SNHA 2FA9A 1G4AE 1IHUA 4HDOB 3ZZUA 5JS8A 3NBXX 5CLQA 1Q3TA 5D3QA 1TU3A 1CJUC 4XWAA 5HTKA 3KXLA 4C0QC 4C9BA 2P2LA 5G40A 1II8A 3KXIA 1NVVQ 4DC9A 4TMTA 1HTWA 3CLVA 1QVRA 2GHIA 3R20A 1E2JA 4A8JC 1JXOA 4Z51A 5KDLA 8OHMA 2D2FA 4HEJA 4AKGA 3KB2A 4JLPA 1OH6A 1JXMA 4DLSA 1YU9A 2RGXA 3AP2A 3MWLA 4M4SA 1AKYA 1U0HC 4ACAA 4AYWA 2A7QA 1EGAA 1XEXB 2SHKA 4LWZA 3GJ4A 4B6EA 1NRJB 4MGKR 4B6FA 4FXPA 1ANKA 4LY6A 1XXHA 3VTKA 4B47A 2GRJA 3FOZA 5J5CA 1FMLA 3KX2A 2GETA 5FFMA 4C4PA 4DB4A 3UPUA 2ZJ8A 4IDNA 4ZO4A 2RKOA 3AF4A 3BE4A 4PHGA 1MABA 3Q85A 3VFDA 1J2JA 2JA1A 4Z1MD 3Q9LA 3TVTA 1E96A 3W6PA 1VMAA 5CK4A 3FFBA 4PC7A 1H8HD 2PZGA 4PZZA 3VR3A 3L0OA 2BEKA 2A9KA 2GJKA 1JR3E 4ZCIA 3LXRA 1IY2A 3FMOB 3NTUA 1UADA 2DWOA 2HEIA 4LDJA 3L2OB 4LC0A 2OAP1 1ZM3A 4H1VA 3VAAA 1E2IA 1YJ5A 4OI4A 5CYPA 3SHFA 1N3BA 5LB4A 3MJRA 5FOXA 1ZW6A 4YMVA 3CH5A 4LYHA 2GEUA 2JLRA 4NYIR 1W36D 4JLBA 4Q1EA 2ZQ5A 3SFVA 3RRYA 2Z6VA 2QPTA 2ZSDA 4RZ3A 3RS7A 4TLCA 5A5GA 4AC9A 5EE0A 4BEJA 5AJVB 3GJ7A 3CPEA 3U5ZB 5TY0A 2IYYA 5EP3A 2R8RA 3T5GA 1GVNB 1NSTA 3W6NA 3IIKA 1Z6YA 1O3YA 3FKSD 1G16A 4TL6A 2CDNA 2FFAA 1ZM9A 1IXSB 4TYNA 3GFOA 2QL6A 2WM9B 2JLQA 3KB1A 1SVWA 1OFTA 4NYJQ 4TL7A 1E3MA 4E5UA 2O8EB 4I99A 4KSBA 5JJKA 1N6KA 2V8OA 2WPDD 1GRRA 2LCFA 3AM1A 3KFXA 3R8FA 3B1ZA 3ZGXA 2PCLA 3ADBA 3DM9B 4JVMA 2BKUA 2Z43A 2QRNA 1Q3HA 2KSQA 2BBSA 4GT1A 3QF4A 3BB1A 1U8YA 1KGDA 2WVJA 2CMKA 1UJ2A 2WHXA 3NEJA 2WSSA 3U3RA 3PENA 4Q48A 3VX4A 5GVRA 4IW3B 3MWKA 1T3SA 2JAQA 2QGNA 4KFTA 4B73A 1SHKA 4CYMA 3EX7C 1JR3A 4FMCF 5AJXA 1R4AA 4RSGA 3GJ6A 4RFSA 3KTAB 2PT7A 4M9ZA 4OKSA 1GKYA 3OE7A 4BFSA 4BFZA 1A5TA 3QXHA 1NJFA 3FHCB 4LC1A 1AZTA 4DDWA 2OHFA 1J70A 1UBGA 1WXQA 2GILA 3GJXC 2FU5C 2J45A 3FTQA 1WE2A 3WY9A 4B44A 1F2TA 1XCMA 2HXSA 2K5UA 5FTMA 4G5SA 4ESHA 1R5BA 1W0KD 1D2NA 2NO0A 3BB3A 2LKDA 3BORA 4FINA 3KQKA 5IRCD 2IEYA 5HZHA 2W58A 2ORIA 4Q18A 1KK2A 3MMPA 1KO1A 3DL0A 4B3CA 4DRZA 5F3WB 1KI1A 4OHYA 4AY2A 1VHTA 5TVKA 4W5HA 4URZR 4B32A 1W0JD 4KU4A 3QPWA 5JHGB 3GLGA 5L3SA 1G3MA 2HF9A 2C03A 1NY5A 2B7CA 2IYXA 4KBFA 1VG9B 4RD1A 1AJEA 3RAPR 4C0AC 3LDAA 4OBEA 4WOPA 4BECA 1E9SA 3THYB 2XB2A 1W4BA 2AFHE 4HDQB 5HR5A 2D7DA 3E2IA 4HDCA 1US8B 1XX6A 2GVZC 2F1IA 1KNQA 2O5VA 2WKRA 4DEYA 3AF2A 3AKYA 1UAAA 2XZPA 4KHZA 3KDSE 5KNBA 4PSVA 4XSGA 3EZ9A 1X8LA 4OQNA 3PEUA 2J59A 4QBHA 3D3QA 1RRFA 2OM2A 2PLRA 4FMCB 1OIVA 3EIQA 2YC4C 1ZUIA 5L3QA 2O0HA 1Z0IA 2ZS7A 1DADA 4LHZA 1CTQA 1GTVA 2ZAMA 1GZSA 1UKEA 1DVRA 3CRRA 2WAYA 4D0LB 1Z6XA 1ZBDA 2DFKB 1QBKC 2W2TA 3PG5A 4ZDIA 2REXB 3A1VA 1KMHB 2LWIA 1P61B 1U0JA 4PANA 3CF2A 1XJCA 4GNKA 3ADKA 3U6KA 2GF9A 4DDTA 2JATA 3QKSA 4QGAA 1R5OA 1LTQA 3FPAA 2W6IA 4YDSA 1T8TA 2CHQA 4GFDA 4UNQA 4WW0A 4K8OA 3EIHA 4TYWA 3BH6A 2IBMA 5C46F 3HU2A 5EZ5A 1GILA 3TUIC 1E6CA 2OXRA 2AR7A 1US8A 1VYVA 2V55B 4W7SA 1N5IA 2ZSFA 2BEJA 3AQ4A 3WHLA 4Q5IA 1S1CA 3TBKA 1S2MA 1NVXQ 3GLGE 1KDRA 1U0LA 1GL9B 2WSMA 4A0HA 1JALA 4QHTA 3W6OA 4B48A 2ZJAA 1IBRA 1KHTA 3K9GA 3PUYA 3QIAA 2AWNA 2KI5A 4LZZA 4MA4A 3SBDA 3QY0A 3OHMA 3SN6A 2IS2A 3D8BA 3W8RA 2BBOA 3GLIE 4CIDA 3GCGA 1JECA 2EFCB 4IHQA 4DUGD 3KQHA 2X2FA 2FSHA 2IWRA 2OBLA 4Q9KA 2NGRA 2H17A
chains in the Genus database with same CATH superfamily
1M0SA 4BZQA 4NICA 2PUVA 1KPGA 3UT5B 3ZV5A 2A9VA 1L8AA 2CV2A 5AESA 3G5UA 4I4IA 2L69A 4FFOA 3TSCA 1Z45A 3KM0A 4BP8A 2MINB 4X85A 3NONA 2IYZA 1ZMTA 1OI2A 5B37A 5FUYA 3SOZA 3KQPA 3FFAA 2DAPA 2Z8ZA 4OH7A 3CEPB 5G1PA 2P9QA 3KL2A 2FP4B 3FLMA 3R24A 4CEJB 5EQFA 3D4LA 3RJ5A 2WSIA 4R3NA 1WIWA 3K0KA 1JHQA 3UQYS 2BFFB 3R23A 3MAAC 3TWOA 2UZ3A 3HKBB 1V8PA 5CDFA 1M33A 5IPFA 4E08A 1DQSA 5CNJA 4KLNA 1E3LA 4F5YA 5AW7A 1T8UA 1OXSC 3KKLA 3LX5A 4EG8A 1V43A 2FZLA 2WZCA 1VE3A 2WQZA 3BH7A 2JEYA 3ZN2A 1HLDA 2JIZD 5J58A 4ZU6X 2N9UA 4ZGWA 4P0PB 1WBDA 4GQIA 1AV6A 3V7YA 4TZ0A 4U3JA 3R7DA 1XE3A 2BZSA 1W6RA 3E03A 3EQ8A 4LJ9A 4W9NA 1TYDE 1J5EB 4HL6A 4RMJA 4D81A 3ND5A 4FCTA 1FPQA 4J91A 4EHAA 5IEJA 1NMEA 5CX1B 4LS3A 3UPTA 3UXHA 2XITA 3EPRA 3C4JA 1F8UA 3OICA 3TMYA 4F3RA 5DASA 5KU7A 3UMCA 1XZCA 3CVYA 2O7NA 5ENVA 2W8ZA 1NWCA 4Y2GA 1F51E 2EG9A 4PSDA 2CUTA 1OR8A 5IH3A 4QJ5A 4LRTB 4MLDA 4D26A 2KJQA 3AW9A 2EJCA 1G18A 5ALUA 1IH8A 4ODIA 2XMBA 4B87A 2FN3A 4XD7A 1RXYA 4TSKA 4W63A 2PJZA 2XIQA 3PUVA 1Z12A 1EZ4A 1YJXA 1CUZA 2GXQA 3ANXA 3F3KA 4URWR 5LA6A 1UZMA 1SD2A 3EODA 1V3VA 4N12A 4B2LA 2QI9C 1R9NA 2P90A 3KUUA 3PQ5A 1G9XA 1HH4A 4PWYA 4Y0AA 3SYMA 4FWIB 2F3SA 2OP0A 4HWTA 1SKYB 5EKDA 4CODB 4NZNA 1T5IA 2FLWA 4AO6A 1ISJA 4CQMA 3I01M 5AKEA 4JJ4A 1W30A 3F1LA 1T6XA 2BGMA 2HIGA 4XTCS 3SVLA 2ACVA 3EXG2 1A9RA 2HYDA 2QN9A 4J1TA 4ZEOA 3DCNA 5K0JA 1SK9A 2X7XA 5KPDA 3PC4A 1WUKS 3EGXB 4KWHA 5KOIA 2GI4A 1GFZA 4O2LA 4WAUA 5NLLA 5IEBA 3SF8A 2C2XA 1NONA 4MSUA 5IAGA 3EPHA 4DIMA 3TTWA 4EJSB 2VR1A 2X76A 3Q0IA 3NHYA 3H75A 3HYSA 1JAHA 2AX3A 4YCSA 4BKPA 1W49A 2D0OB 1R10A 3KZXA 1ZAKA 4J3JA 4PNHA 4M54A 3HDGA 2CFSA 2DBVO 2EZUA 2XGSA 1B8OA 3R6LA 1W1IA 2RAPA 4GBJA 2PKWA 2DX7A 2PKQP 3MMXA 1LDMA 1RWOA 5EJGA 3RFUA 4AIRA 1XD9A 2IH2A 1G6OA 1Q91A 3FROA 3LVBA 4P34A 4WBXC 4BIIA 5LD2B 4HZIA 5CK5A 2OZLB 1CQJB 1IJFA 2CUZA 3KU1A 4F6CA 2Y1CA 3TPZA 3EE6A 1N6HA 4R2LA 1CZUA 1L5VA 2NSJA 5GY7A 3I5MA 3ZIAA 4MQEB 2LGJA 2XTJA 3I8SA 4NAUA 4H7IA 2Z2ZA 4HWRA 3FM9A 5D3MB 1PW7A 3S0JA 1F9EA 1YMUA 1JR4A 4NBSA 2DQYA 3LQYA 4UD2A 1NBEA 1BKSB 2EHDA 3GP3A 3OZIA 3RRXA 3TSYA 3ZK7A 5GVSA 3I61A 4NV1A 1EU1A 1I24A 2W8BB 3HA3A 4B2IA 5LU8A 1Q1QA 3ESQA 5BY2A 3DOUA 3FGPA 1W1UA 4EF5A 3C6MA 4NOLA 1SK8A 3WGQA 2GPWA 4JL8A 4Q3AA 2CK3D 2IJGX 4Q4DA 4IHJA 2KWIA 2HJSA 4Q1BA 4JI3B 3ZJ4A 1FUUA 2E82A 4FR5A 3EC2A 4UPDA 4PEVA 3JW8A 2WPDA 1UH5A 2CKDA 4HLUA 5LA6F 3N05A 4IRXA 2HIAA 4U2BA 5IT0A 4D4LA 3KTFA 1B7GO 1N2IA 2ID4A 1L5GB 1TM2A 5BSVA 3PRKE 4BZPA 1A8PA 1R0YA 3T1OA 1SC9A 2Q29A 3HCAA 2Y93A 4QYMA 2JIRA 1RPAA 3QXGA 3ZWKA 4XVCA 3PGJA 5G0WA 3ZDXB 4F9GA 4RTKA 4LCJA 3U0VA 3KE8A 3OOWA 4TV9F 2P65A 1KH3A 4UM8B 5HBGA 3P9YA 3PUJA 1AT1A 1M1NB 2YV1A 2R7KA 3M6UA 5KC9A 1G6HA 2H2FA 5KTPA 1ND5A 3I0MA 4UNRA 4V0SA 3EOAI 4IG4A 4M98A 1QH0A 5IXSA 3TRHA 3I1YA 2HIMA 3P2KA 4P81A 4COKA 7ABPA 1NQTA 1P8JA 5CXUA 3MTIA 4JDPA 4CMJA 2PUBA 5HF8A 4J29A 1XEXA 5K2OA 3R0VA 5IC6A 1RYHA 4BGEA 1AKEA 1RJ9B 3KLMX 4Q7JB 1FC0A 2QRLA 2VDUE 2E5WA 4LJ8A 4BNMA 3CINA 1WF6A 2RBKA 3JWEA 4HQNA 1E4EB 4RVSA 3WRXC 3BYZA 4YJ3F 2PBRA 1P72A 4NWIA 1P0MA 5EEHA 2MR5A 3FA2A 4R8LA 4B33A 1C3LA 4BO4A 3MOSA 4DIKA 4DV6B 3NLLA 2GT1A 5KS2A 4WOKA 5FBKA 4IIXA 4OKIA 1CUDA 1OUMA 3TL2A 4Q4JB 1VLZA 3R5XA 2WSSD 1PGQA 1I7LA 1Q21A 1DTSA 1G3UA 1O1YA 4N3NA 2H2WA 2PV0A 3KIPA 2VDRB 1Q2UA 2BHTA 4PSAA 1C9DB 5IC4A 3BG5A 4LSMA 5BPHA 3C4VA 1X1TA 2IWHA 1PK9A 1PTJC 1ZS9A 2E4VA 4DPMA 9ATCA 2C2YA 1MTZA 3EGCA 3L6RA 2C9OA 4HGRA 3ILXA 3MEQA 4WACA 1I10A 2B8WA 2HHCA 5ESRA 3NVAA 4IYRA 3U7JA 4DG9A 3TTVA 5FBWB 3KOOA 5AVWA 4LBYA 2C4NA 3VC1A 5H7XA 1S2IA 3WLEA 1G2IA 3PR2B 3LW7A 4M9CA 5GGXA 3CUSA 3HGMA 3V6MA 3FJOA 3B89A 2P9CA 5GOTA 4HFJA 4I4TB 3DTVA 3PDCA 2CV1A 3ICQB 1BC5A 4ND6A 1T9KA 4DR6B 3F6YA 4GSKA 5DYTA 1ZH6A 1PUXA 1TKAA 1JFFB 4RJIA 3SBEA 3QVWA 2H9AA 4RE5A 4Y9UA 4EB6A 3ZJVA 2DC1A 4IHKA 2XZDA 1DUSA 2NTNA 3BWYA 3WSWA 2E4ZA 1C4WA 1EP2B 3CFYA 4HQ6A 1E6UA 3LOQA 1VIMA 1B1CA 3SHOA 4N9QA 1R50A 2YZ2A 1W34A 3ZYCA 3COYA 5IAKA 2WZQA 1H5NA 3HKEB 4QICA 5CB4B 1IRXA 1VMDA 2UVQA 5EC8A 2DM6A 5AUQA 4E1BA 1AGPA 2X8JB 1H0RA 1Q1ZA 3Q10A 4JJKA 4MI1A 1PL6A 2JJ8A 4FD2A 5DI3B 1MO6A 3GLVA 1KERA 3MMZA 4IEIA 1Y4DE 3VGJA 4UAJA 4WKCA 5FWNA 1CVRA 1MAAA 3O3CA 1U2RA 2UUOA 1NBOA 1J2RA 2ODQA 1NG9A 4K6CA 1I4WA 2A5FA 4UC0A 1R1DA 4YJDA 4DUPA 1GZ5A 3LC7O 3E27A 2I7VA 4N8DA 1VQ1A 1AGYA 4BNXA 1LXCA 1M1ZA 1R0BA 1Y42X 3IIMA 5EQDA 4B3BA 3OIUA 3THXB 3OX3A 2ISQA 4LFCB 3PNQA 4GXRA 1OIXA 3JTMA 1Z29A 3CSUA 4OQYA 3TL3A 5L40A 2GBFA 3CO0S 4JP1A 1AN9A 2I1WA 3ETJA 4F45A 3H7IA 4ZI5A 3EQZA 3ZV4A 1XSEA 4XJSA 1WA5A 4AYTA 4Z3DA 1L4MA 3RHFA 4TTPA 3PDJA 3QE4A 1WV0A 4J43A 4RKQA 4HDKB 5BV2P 5KYXB 3UWDA 4MQUA 1UBTS 2GOYA 3QSGA 3ZQ4A 2H4XA 4TZ6A 4F7WA 4G97A 2ZR7A 4F04A 3ZDBA 1GJRA 1GQYA 3GLHA 3DFMA 4EQZA 1RJEA 4HXYA 4D57A 2IKQA 3L3BA 2OP1A 4MR9B 4YB8A 1Y6RA 3IO3A 5LXTF 1KXJA 4G5XA 1U28C 4DXHA 2QRHA 5TE9A 1R6XA 5HUJA 1QIDA 1XA4A 1QS0B 2X58A 2V96A 3VNQA 3SWWA 1U2EA 3ETLA 2OCKA 3K1YA 5AI4A 4RLQA 5AJWA 1U2TA 2TS1A 3NBAA 5AW0A 3NUZA 1B6TA 3SICE 3JWHA 3SZGA 3A9CA 3X1DA 3DDNA 3FR7A 1Q1BA 3HE3A 5TSDA 4DLRA 3PDIB 2PPLA 2CXNA 1DXHA 2IYVA 3I6YA 3ISTA 1DIAA 2FK8A 4NYMQ 2VJNA 5ALQA 4QRHA 2WV9A 5KSWB 1JQDA 4BO2A 3PHHA 2VP6A 1YRQA 1K89A 2IZ7A 3EAFA 2BGIA 4H3VA 2VFAA 1A9TA 121PA 2XHZA 1Z0AA 2J48A 3NOVA 1J9GA 3A6EA 4WH0A 5EXXA 3ZLVA 4IDPA 5M29A 3HBLA 1O96A 1WXFA 4AL4A 3FIJA 2E85A 1W2GA 1SUWA 3O26A 2XCUA 4FW9A 1AOXA 3EGWA 2J41A 3UUEA 4DSUA 3FTFA 3HV2A 3I6ZA 3ZJYA 1FUEA 1Y9ZA 3OPYI 2CN1A 4ZZ2A 1RYNA 1D8AA 5JANA 2QQEA 3CN9A 4BLRA 4N0QA 1C7QA 1NQ5A 3DR3A 4ZCLA 4NFLA 5P21A 1DKNA 4M8NE 2FRDA 1EG2A 4BXOA 3EBOA 3TRIA 5T4EA 2J30A 4XPIB 4KQWA 1YUNA 1PR9A 5AI0A 3FPEA 2ZUWA 1NQXA 2GCNA 3UAWA 3W2FA 1WKBA 2IHJA 4FS8A 1KP3A 1U9JA 2DPMA 5DN6A 1P0FA 3F3MA 3KKQA 3GEPA 4NATA 2OUKA 2RHOA 3KJEA 4WQMA 1AKVA 1XAHA 4AWAA 2I2BA 2RHGB 1SKBA 3K70B 4QBTA 1CR4A 3Q7TA 1WXEA 5CU7A 3DLAA 3HXOA 2JGDA 3IOCA 1DZ3A 2KQUA 4V3BA 4RY2A 3DE7X 4TTIA 4FE3A 4UATA 1NTRA 1V1RB 2DHRA 5BQ5A 2B35A 2ZRPA 1OB2A 3B8EA 1FEZA 3LFUA 2PWYA 4I5FA 4IJVA 2R2AA 4PG7A 4V1CI 1URPA 1CEXA 1XPOA 2J8ZA 1XEFA 1HOTA 1SUEA 3ZQ6A 5AW6A 1ID8A 1NVKA 1XRPA 2HSJA 4LZOA 4LV6A 1NW4A 1RWWA 4FK8A 1V95A 1E9EA 2IYTA 1L7RA 2QRUA 3R76A 3F7NA 3ZC3A 4J4BA 5ILQA 1FRQA 4IUDS 3IPAA 4UAGA 1IWOA 3IERA 3PXAA 2ZSJA 4YMIA 4GNRA 1KBOA 5A2QA 4ABTA 3ASUA 1RXWA 4L9SA 1E8DA 3LLMA 1V0JA 2IYSA 1RPTA 3DZHA 3FPBA 3DT9A 1CBUA 3PL1A 3C7CB 1PJ4A 2WWFA 3A1TA 3VSBA 3CWZA 4ALIA 4B40A 5AVVA 3S6JA 4L74A 4GX2A 3CCFA 2L0XA 1P44A 4O8CA 3A6JA 2OILA 4NQZA 2A30A 4FCVA 5LZ8A 3GZ4A 2Q4TA 1GGFA 4L9WA 2YWJA 4D2IA 3IIIA 1Z5UA 1L7AA 3HEMA 4RV4A 2AE2A 2BZ0A 2Y66A 4JQYA 3T4PA 4ALJA 2QD1A 5FNVA 2DLCX 1YB7A 2Y71A 1WF3A 5MFPA 2BI4A 5J4LA 3N58A 4FSDA 1Z6PA 1RT9A 1NZDA 1L3CA 2QTTA 3IJPA 1C3EA 1EG7A 4X90A 3N0RA 3ICEA 6ADHA 2DT8A 2UVDA 2VHTA 5A7GA 1C5KA 4ZEMA 1FYDA 1I2MA 4RANA 2IS2A 1M1YE 5JY6A 1O6CA 3EUAA 2VHUA 4YAEA 2OV1A 5I7OA 4Y2SA 3T3MB 2X0RA 1G7RA 3C5VA 4MO2A 4Z9YA 3M5DA 3GNQA 5LKRA 2IW3A 5EJ8A 2ZRCA 1HO3A 5G0SA 5E1BA 1TT7A 3B1WA 1LLFA 4MQLA 2HT1A 4RUKA 3IMKA 4K81B 1UBOS 4FYYA 3VHXA 3EARA 3CRZA 5K3FA 1QYIA 3SLKA 4X6XA 5FWXB 4CQJA 1PNRA 4L5CA 3G5TA 5F64A 4INJA 2X22A 4L8YA 2AT1A 3RTDA 1IYZA 1QH8B 1OIWA 2DFNA 3YASA 3I52A 4L9AA 4MR9A 5LP6A 2DG2A 4YAIA 4HY3A 1MENA 3PV0A 2IF2A 4R0NA 1VE7A 4ER5A 3MAJA 2BCJQ 1QV7A 1WPGA 2NZJA 3JTEA 3R5HA 3ECAA 3D7RA 5KX5B 3CM0A 3R5JA 3FVTA 4P1ZA 1KRXA 1NVUQ 3IUBA 8ABPA 4E21A 1CKEA 2VYND 4XR9A 1FP4A 1CUBA 1YFZA 4WD3A 5E4YA 1WHSB 2O8FA 3QELA 1VL1A 3ICPA 1R0KA 1GOTA 5KOYA 3RCBA 1W4RA 2YWFA 4PXYA 5DEOA 5LLSA 3VR2A 4YRPA 2HSDA 3MXTA 3UV6A 1E61A 4F91B 1QQ6A 2CEKA 2AZ4A 3L7LA 3BMXA 3P9PA 5TJHA 5E7IA 4GEKA 2XGOA 4R2XA 4D98A 1O6GA 2W0MA 3KKPA 5T6BA 1Y37A 2HGSA 3A28A 5BW6B 1T0BA 5BNFA 3ZVNA 4X6UA 1IHDA 2H4WA 3KHUA 4W7HA 5J63A 3RIGA 3WWDA 3ZHRA 4RC9A 2WTMA 3IEIA 3A11A 4HGPA 4IDGA 4QU0A 4B2PA 2Z6AA 1W4AA 3DT8A 1QWSA 1Z82A 5D85A 3P9QA 4DMFA 1UBMS 1JFLA 4W9MC 1M1YA 1BRTA 1TTQB 3DMGA 3GFFA 3GEGA 5BV0A 4KRFA 1TM7E 2NT3A 2B34A 3GIWA 3WISA 1Q3KA 5DSXA 3T5BA 5BUCA 1MV5A 2NMVA 2MOKA 3U3ZA 2ZATA 3L8GA 5JS2A 4BPBA 4Y2VA 3L40A 5CB4F 2TSYB 4XM0A 3P5SA 1P81A 1B8UA 4IMIB 5AT1A 1COWA 1GO2A 4QOHA 5CBPA 3UWMA 3F73A 3FZQA 3KOXA 5L6MB 1M76A 1PAUA 4L27A 1YL5A 4L95C 4IUYA 4IMJB 3W5UA 4Y6GB 2XADA 5BQFA 2NN3C 4LYAA 1KY2A 1LUAA 1D9XA 3ZGVA 2GLUA 5JAPA 3C6BA 3L4BC 2NM0A 4DRXB 2BR4A 2FEWB 3C74A 1JKFA 1QTIA 5CG1A 2QK4A 2AMJA 4KE9A 1JDVA 3OPXA 3QOWA 3ULKA 4MZXA 1EEXB 3DTTA 4OV6B 5JJLA 2OOSA 2WP8J 3ZXIA 4EI9A 1FZTA 3DJFA 3GT4A 4HZUA 2A1TS 4OAQA 1TUIA 5HQJA 4ZTZB 1NBMA 4Q3CA 4ZMBA 4XB6B 5SZHB 1ODKA 3OPYB 4C30A 4LTNA 1NFFA 3X1KA 2ZYUX 2PS9A 3TW6A 4MUEA 1DQZA 4QDZA 3R5FA 3H2JA 3FTDA 1FRNA 1Z39A 2WINI 1UPXA 3WK4A 3ZJUA 3QPDA 2W11A 3OF2A 1IU9A 2MHCA 4GYWA 3VV2A 3OE7D 2D5AA 3TRFA 1EJBA 1NVGA 1ZWKA 3T3EA 2QD4A 1SURA 4V0NA 3ZTTA 1MC1A 2WT4A 5FNVF 1UQTA 1I6WA 4PLFA 1LS1A 5IYZF 4RKWA 3S4YA 2VHVA 2VJMB 1XA3A 3KAJA 3LQRA 5CFQA 5IZCA 5KTSA 2O8CA 3B78A 4NZOA 3AF0A 4XR4A 3HQ4O 1Y5RA 2Q3LA 5EMMA 5SY6A 3UJAA 4CKYA 4RDCA 3TFWA 3GLSA 1PDWA 2GYWA 1E4EA 1NVBA 1XXLA 1T36A 4EUEA 3WGVA 1F20A 4BNKA 1JPJA 1DBVO 3KQMA 4YAJA 1JLLB 3NEAA 3IUMA 4M1SA 3UCXA 3QUCA 2WY2D 4X62B 1Y3IA 1A95A 1GRNA 4J49A 3TR0A 4M9XA 3GH3A 4ZYXA 1J25A 1EFHA 3M6MD 5CIYA 1U90A 2BONA 3G2IA 3W9BA 2JVJA 4R1NA 4CIWA 4DV7B 5DYNA 2WUDA 3PLAE 1JA9A 2YX1A 3PYLA 3FN4A 4AKHA 1YAJA 1BH2A 4BNVA 2JL1A 3CWCA 4FS3A 3NWJA 3RO7A 1U9ZA 4S1TA 3DDSA 3SK0A 1MR3F 4IPTA 3HTXA 4Y0VA 5I3CA 5ESWA 4MV5A 1THTA 1DQNA 1JVSA 3VDMA 3DMDA 3SX2A 4H7KA 1MGPA 3DO8A 2DUJA 2P0AA 3ZUPA 2RI6A 1RQRA 4OQLA 3CKYA 1NATA 2JFUA 2FZKA 2JDIA 2XWJI 3QOYA 2AG0A 4IWXA 4JLDA 5G0UA 3QVMA 3G0GA 5B4VA 2ZJFA 3N6RA 4EKNB 5JASA 3AOEA 4YRSA 2VL7A 3IH5A 4JGGA 1B74A 3Q9NA 1GQRA 1ECJA 4KYVA 5COQA 4Z86A 4FLFA 3W5CA 4UMVA 3PT5A 3O4JA 5JRJA 2RHMA 2P2SA 2GWRA 2C2WA 3KSRA 3U3OA 3EFOB 4N5MA 3ZBQA 2HA0A 4WV3A 5A4AA 3ZWVA 1JHOA 2YHUA 3G68A 1IZ7A 2EGUA 4FGKA 4WK2B 3RV4A 1PL8A 4MROA 2I91A 1W8DA 3GVCA 4B46A 5DSZA 2DERA 1TJPB 4TV8A 2PG3A 4QO8A 2Z3ZA 2H1OA 1ONBA 5J2TF 2FR8C 4HB4A 4FYJA 4D4HA 1KJZA 5E9QA 1A2BA 2WJHA 1D07A 3R3HA 4L5BA 1UFRA 1XU7A 2XTZA 4MQEA 1A76A 3PVZA 4YQZA 1J1IA 4KG7A 5DNYB 4CTNA 1BD3A 4RKFA 1V45E 3EVCA 1H2EA 4MS4A 3O4HA 1GPAA 3B9RA 3PF9A 1CQIA 2Z1DA 2ZYDA 4I8DA 4KDRA 4TV9B 3R7NA 1M2GA 1AKUA 1UMCB 2DJIA 1MEEA 3ZI7A 4YR9A 3O2QB 4KQ2A 4DAOA 1ELOA 1Q74A 2OLEA 5DLEA 5DNEA 4MS3B 4ZVKA 1E3EA 4N39A 2IY8A 4HP8A 1GV0A 4NCXA 2Q1WA 1ZCFA 4G84A 2NZUG 4W5QA 2VHQA 2R6HA 7MHTA 3AJ9A 4BNHA 2PYZA 4CLRB 1U8CB 2WIBA 3BSFA 4G4SO 2CLCX 5EG5A 2RB4A 3JAKB 5HG0A 3AHEA 4BNDB 5AH0A 4F85A 3B5EA 3EXIB 4DXDA 2WDPA 3O8CA 2XWPA 2GX6A 3PJGA 1B0UA 1JN0A 3QVXA 5HF5A 3VU3A 3UA4A 3UKDA 4AAYA 2GFQA 5JD6A 5K6TA 1EUDA 5JCZA 4L4XA 4LF9B 2YWXA 1QYXA 2IUEA 3RU3A 1NFQA 1X7GA 1LI4A 2BPOA 3EC1A 5A3SA 1M6NA 5EHZA 2R6ZA 2QTFA 5JZ9A 4AUKA 2V9PA 1YKFA 5JYDA 1E9DA 5DXAA 4LDPA 4JOBA 4MULA 5ERGB 5B30A 5BNIA 1XGKA 3QV2A 1XEWX 2W2PA 3H86A 4K46A 4Q21A 2WHQA 4ER0A 4CVNA 1IJKA 4RSHA 2NNLD 2Q6VA 5CCDA 5DNVA 4K28A 4HI0E 3RUFA 3L77A 3C2QA 3LH5A 1T2NA 2IRWA 3H04A 3NU1A 3QBVA 4I50F 4RPHA 4IV8A 2EWVA 1GPDG 2Z04A 3L7NA 4FOSA 4Q01A 1ACJA 1VB5A 4EKDA 5C18A 3MFQA 3NIBA 4C6RA 1FFWA 4ZO9A 1TZ2A 2H5JA 4IH1A 4JMLA 3RREA 2JJ2D 4EA7A 4AZ3B 4W5WA 5JJBA 4OI0A 3W9YA 5KX5F 2WTNA 5T57A 1DJLA 2O7QA 5E3HA 5I7RA 3G1WA 2H5LA 1QK5A 2NZ2A 1GAEO 2Q5OA 2VDQB 1KYQA 3GLIB 4K9OA 4MHSA 1KKLA 4JI0B 4Z99A 4DWWA 4OSEA 3BJZA 1X0VA 2WWIA 3AKEA 5BR1A 3T7RA 5KWVA 2C5LA 1M2WA 2CBGA 3LD9A 3O4FA 3ZXSA 3ZHTA 3I9OA 2I78A 1LWNA 3L4EA 4AZ0A 1D1PA 2I87A 2B2NA 2KBEA 1YZQA 2Q46A 1S02A 3AX6A 3QVGA 3SXPA 2W93A 2ZZMA 3X1ZA 1E2EA 3DAOA 1CU1A 1F2VA 2BZGA 2CNWD 4J0FA 3BUSA 1FNCA 4GXNA 4JGBA 2Y0PA 1YZGA 2QM8A 1K68A 3D6HA 3BL5A 4JNCA 3K0BA 3ELDA 1I5EA 3E58A 2OESA 2YASA 4QHSA 4AN1A 3G8DA 4N3BA 1EMDA 4NU5A 3FUCA 2P6RA 2JJ1D 3F8TA 1JKMA 1NRWA 4TWBA 1MABB 4M1KA 2QQFA 1ACMA 3ZEAA 4FZRA 4RD4A 5AXBA 1N3YA 4A2PA 3LPLA 4DOMA 5JAUA 1HNXB 4RY8A 4C0JA 1RHQA 7MDHA 5ESXA 1VCHA 1T5SA 1IY9A 2CXUA 3HFJA 1Z4KA 1KU6A 4MR7B 2OY0A 5CHEA 4H0FA 4PZYA 3ZWAA 3QYPA 3TNLA 4RETA 1T6ZA 2HK7A 4QJBA 1KO8A 1WDWB 3TFOA 3GRPA 3T1HB 5ES3A 1MOSA 5IW8A 4YMTA 1WBJB 2VSFA 3OCYA 1OX4A 3R6DA 4UHKA 4XCXA 2TMGA 5JOQA 4EHHA 1G8JA 3U56A 4HADA 4D8YA 1X42A 4YLEA 1N0UA 4F84A 3KCNA 4AI6A 2Q4OA 3PK0A 1WD7A 2LTAA 3ZW8A 4BQOA 1KZGB 4K05A 1NVWQ 2JD0A 4MV7A 3BAZA 3M81A 1SB8A 2RARA 4OJTA 4NYIQ 3SYNA 4E88A 1DMSA 1X15A 2IXAA 3FYUC 4NESA 3IE2A 2GPAA 3DNMA 3LXMA 4S3MA 1V6AA 1CZOA 2O2SA 1SQSA 4HWGA 4RMIA 1JW9B 3PS9A 3R09A 1C30A 1NNLA 3K92A 3NFRA 4RYLA 5I4KA 1EFRD 4ZXFA 3WKDA 1OREA 3PQ3A 1N6LA 5AK4A 3AHHA 4TTRA 1XEWY 3S7ZA 4E1VA 2F59A 4KQXA 1ISRA 1J23A 1A8UA 2I3GA 2JFWA 5EE5B 1QG6A 4LNHA 4KO3S 1H4SA 3ON5A 2X3FA 2Q4RA 2A92A 1TRKA 3P4YA 1TKCA 2NO6A 3PWZA 4G1UC 4IOMA 5FCDA 4TL8A 3TZQA 4KUHA 1Z56C 4G6ZA 2JAHA 1RR6A 2DF8A 2SKDA 1WMBA 5M2QA 5C1OA 2V3VA 1BDBA 2VJYA 1RXCA 2PMCA 3EOZA 4LW8A 4XGQA 1Z2PX 3OF5A 4DJEC 3EEFA 1F5NA 1Q7CA 3KT3A 4R2HA 4PZCA 5BO5A 1W36B 5ECDA 1PJSA 3CG4A 1J06A 2ESRA 1TC2A 2FEAA 3QRWA 5K0ZA 2ZRHA 3CA8A 2D2VA 4BCCA 2FLKA 4MGIR 5A6VA 4B6PA 5DVZA 4Z9BA 2Y0DA 2G40A 1QNLA 1C9NA 1EDEA 2HWUA 3B8HA 1E1MA 1DTWB 3GUHA 1YR8A 2HU2A 2X9VA 2GH1A 2HBZA 3KAQA 3VR6D 9LDTA 1NKTA 5COAA 3UCFA 3DLCA 3D2CA 4BZZA 2O1EA 2J3KA 4PV7A 3H1GA 3LUBA 3I4LA 1PI3A 1T5BA 4Q7QA 1MFPA 1NVMB 3ZX5A 3H5RA 1FDOA 1FP4B 4ND2A 5DW3A 1HGXA 4YUWA 5BNWA 4N5LA 4PG6A 3THYA 3HFRA 4D4JA 3GLRA 3H3XA 3BMNA 3GC6A 1RC0A 4F92B 4DR1B 4ARIA 1B00A 1H42A 1SCNE 4DILA 5EMJA 3BD6A 3T5AA 2V8BA 3NBQA 4QXAA 4BHTA 1L7PA 3MJSA 1SZJG 1SXJB 2TMYA 3LBAA 2OQ2A 5LDDC 3T7JA 4RDHA 2GN6A 1FLNA 1PE0A 4EZBA 4MP3A 1IUNA 2C84A 2IYFA 3PU6A 1E4VA 1ZOSA 1R5JA 2PTGA 1YUMA 3A6LA 3WAGA 2X9NA 3MCZA 1F8XA 4ICIA 4V03A 4A8JA 1Y33E 2NO4A 2FFRA 2FMHA 3BILA 1M1XB 2B6HA 1M2OB 1XJQA 2OMKA 3B51X 1ZHOA 4UQLA 1VI6A 1JHUA 4DJ5X 3VPGA 2CBZA 2X6TA 1BMFD 2ZB4A 1TF7A 3G23A 5FOQA 3ZGNA 1ABEA 4RWZA 3UK2A 1BU5A 2X0EA 4BMXA 3PFBA 4AX4A 2NTJA 2XUOA 3SYLA 1TYBE 4JXXA 4YJ2A 1DKOA 2A5GA 2IIQA 3E3NA 1ZIDA 4GWLA 3ZHVA 1XMIA 3JQAB 1U8XX 4NBWA 4FHEA 5K1ZA 1REQB 5EWLB 1WZ2A 3HNRA 2XB6A 4IGAA 1CNFA 1L7QA 4RFSB 1W9HA 4RMGA 1DJMA 1MX9A 1O4VA 2HNBA 1EYZA 2D7CA 2H54A 2PSHA 2UZ1A 4V38A 2EWWA 2XTNA 4BNGA 4QLBA 2PL3A 2VUSA 2XUFA 4UOEA 1Q57A 4RJKA 5EPUA 2CFTA 2NAPA 1P2GA 1XF1A 1ZN7A 3PQ4A 4W9RA 2XE6A 4C5AA 1TF2A 1TTTA 2GJ8A 1LH0A 3B70A 4JUAA 1ISHA 1H0KA 3CN7A 3Q2KA 4NONA 4Q9DA 4D97A 4J94A 2XUIA 3H0KA 1OXKB 1JQLB 4M0PA 1RMQA 5JWOA 3OQMA 5CUQA 5KHAA 3DMNA 4BNNA 4CKCA 4F11A 5HZMA 5J2UA 4ZVNA 1GNQA 1CNEA 4IQ4A 1JR6A 5D3KA 3GUUA 2PZJA 5BR8B 1TUEA 4UE3S 2IW1A 2JA2A 4JSTA 1BMTA 4OK5A 1Z08A 2O8EA 3EBPA 5ALGA 4R5MA 4W1RA 3W4JA 4LHWA 2DSNA 1K5GA 3BPSA 1DIBA 5AJZA 1Q0UA 5F9MA 5TEVA 3THXA 4ZOEA 3PQCA 4RIEA 4EATA 3FZEA 2FF7A 1TCUA 4EI7A 5K8UA 2O2JA 2ZIXB 5GAJA 4CMBA 1LLUA 2PRJA 4X8HA 5D51S 5K4HA 2P11A 2HDOA 4KXNA 2Q5CA 2YVLA 2L42A 1M8FA 4JVNA 1FUKA 1D0SA 1B76A 3K0FB 3M2TA 4PBTA 5CEFA 1EBBA 8GPBA 1S2LA 1VL6A 1VL2A 1WD5A 3A2NA 3EMKA 4LRYA 5EP1A 1FW6A 1A2KC 2P1ZA 1NU8A 4M38A 2G5TA 1STOA 1WHTB 4HNRA 5GZ3A 3A1WA 3I9MA 5A0TA 2HA3A 3KOWA 2C4WA 2BFEA 2IYQA 4PC2A 1S8NA 1OI7A 1R3UA 2JI7A 2KM1A 1XTTA 1K7CA 4YMSA 5ENDA 3S2ZA 1F2UB 1XLVA 1U1FA 1KS9A 2WK1A 3LDHA 5DX0A 3S55A 5K0EA 1FX1A 3RUEA 2K7ZA 4CEIA 1U6KA 2H7VA 4TS1A 1Y6JA 1FNSA 1XROA 3QNUA 4L4RA 1EK1A 1XFDA 4DLTA 4F56A 5C1DA 4CKZA 1Y8ZA 4GE0A 2BJWA 1MBZA 3EOBI 3HXLA 4J0QA 1UC8A 1UXIA 1EQUA 4CKCB 5CPBA 3IA2A 3W5AA 2BGKA 5DHPA 3KHTA 1CZHA 1JAZA 2O2ZA 3IXMA 1AKMA 1CB0A 3M6FA 2QBYA 2YQ4A 1CQPA 5TMPA 1IG0A 1ENPA 2ZM5A 1PP4A 3JVEA 4D80A 1MHTA 2QJTA 2VC2B 4W1PA 4GRAA 3SEAA 1Y7TA 4AZVA 4B4DA 3NHZA 3GYBA 3TW4A 1Z6GA 2ZJ6A 4NCNA 3DAPA 3FDIA 1Q6YA 3TXXA 5I8PA 5B7QA 2PUEA 1L4UA 3GOHA 3VNAA 2YC2C 3UYLA 5LPNA 3Q2IA 2UYGA 1SVMA 1FP2A 4JUIA 4EB6B 2M6RA 4KIWA 3FG9A 2VJBA 2I3ZA 5SY4A 4UU8A 3DO5A 1T4BA 3B1YA 3L6UA 4BMYA 4LJKA 4E2FA 3AFHA 1BE8A 5FH9A 3U7GA 3PT9A 3DAYA 3TDNA 2ZU0C 4BGUA 4C01A 1U3WA 3QJGA 1JSCA 3PD1A 4RTJA 1TQHA 2V7QD 3I2GA 4JXZA 2G9UA 1U1IA 5CJJA 2XMCA 4L51A 4P0TA 4XJXA 3ZQKA 3WK5A 3LA6A 4CR8A 7REQB 3UHAA 3ER6A 3V4LA 5IJ9A 2CJWB 2YCLA 4BMPB 3Q7QA 3L9XA 1K98A 1UBRS 3F97A 3R3YA 4R9SA 4OP2A 5CM9C 2PUAA 4V02A 5SICE 3DOFA 2H0RA 2FWNA 1KFCB 2IP2A 3IC5A 3LK7A 1MMFB 4R8VA 2E87A 1P2UA 1YCDA 2W7TA 4TQAA 1W4ZA 1ZC3A 3BOSA 4NTZA 4RQBA 4BFWA 2PD4A 4A82A 1UOPA 2Q3FA 1IZYA 1XI2A 3GN2A 4S35A 1DPFA 1P7CA 4XASA 2BP7B 3W7AA 4FGSA 4H6WA 5EI5A 5IYZA 1IY1A 3P9XA 1PD0A 4P2BA 1JFTA 1EX1A 1M72A 1QHNA 1W4CA 4M7WA 4BQSA 2VT2A 4NRDA 3HYCA 3NHSA 1EJ2A 3BXFA 3GMDA 1BDJA 4JYPA 3WKCA 1YT5A 2B36A 1PV2A 1WEKA 4W7IA 3QVUA 2ZI7A 3ZHOA 5B7NA 3UJPA 5E8RA 1TYAE 1X74A 3A37A 3HJHA 3L0YA 2O5RA 3AHDA 3P0RA 4DS3A 2B99A 3LY8A 3DZKA 2RHCA 3FUTA 1NF3A 2HU7A 3MTDA 5KNDD 2GAOA 1EWKA 3MRXA 3ZE6A 3OOJA 2ZJ2A 1QF9A 5CLIA 4OATA 4C7OA 3JYNA 3O6VA 4WCDA 1NQUA 4FDLA 4IZHA 5C3MA 3WNVA 4BC1A 1Y81A 4LZPA 2IXBA 4DTCA 4BU1A 1ECBA 1FTWA 1HMYA 4XRRA 2GM9A 4GZ6A 2FOLA 4JBXA 3ANSA 3R2JA 1KDZA 1CJCA 3X1WA 4AJ4A 4UBJA 3A6HA 4GI2A 4IVRA 3U3DA 4IM7A 2J0EA 3A58B 1VSUA 3JARB 4U0JA 5EQTA 3TTYA 4KGVA 3BJMA 1UFOA 3MTQA 3QEKA 2PSFA 1XALA 1TEVA 3QM1A 2R4UA 1L4GA 1YZTA 2ZP1A 4NECA 1KE1A 4KGXA 5JZOA 1BS9A 3VR3D 3IGFA 5AHRA 1FXSA 1KEPA 2V9ZA 1J8MF 3MSXA 5KOHB 3RBVA 4CCWA 4R2WA 2PAAA 3P45A 4I14A 4NU6A 4PFSA 3HGQA 4LV8B 5M7EA 3P26A 1DC6A 4NYMR 2VSXA 3LT1A 3UOGA 2NSLA 1RZUA 2WTBA 1C1XA 1K9SA 1NXTA 1S7GA 3Q5DA 1G9TA 3IP1A 3PHLA 2J6CA 2R6R1 2R8ZA 3EQ6A 3CIFA 3EVZA 4L02A 5H81A 2M98A 1QUFA 1QJ4A 1T3HA 2GNPA 4E7OA 3HDVA 2ZOSA 3GDGA 1ND6A 5IM4F 3TQFA 4YGYA 4JH0A 2GD2A 4J7CA 4Y1GA 4YV2A 2BGJA 2YN4A 3RABA 5J2TB 3LUPA 1LKZA 2GYYA 4YAGA 1QGOA 3AJ8A 2D2EA 1PR1A 3BGWA 1F14A 2PS0A 3JSXA 1P18A 4U1RA 3I9LA 1IUOA 1FS6A 1RQ2A 1ZI6A 2FPIB 3RFCA 3THSA 1NR5A 1Y8RB 3SF8B 1EVKA 1G55A 3RSHA 1K8XB 2N1MA 2F48A 3T3PB 3UAGA