2OFXA

Crystal structure of the apsk domain of human papss1 in complex with adpmg and paps
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
205
structure length
205
Chain Sequence
b'HMATNVTYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKTTVSMALEEYLVCHGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKLFADAGLVCITSFISPYTQDRNNARQIHEGASLPFFEVFVDAPLHVCEQRDVKGLYKKARAGEIKGFTGIDSEYEKPEAPELVLKTDSCDVNDCVQQVVELLQERDIVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetas
publication title Elucidation of the Active Conformation of the APS-Kinase Domain of Human PAPS Synthetase 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 78
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 2.7.1.25: Adenylyl-sulfate kinase.
pdb deposition date 2007-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01583 APS_kinase Adenylylsulphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ofxA00
1ZU5A 5FOUA 1Z0KA 1AS2A 2YOHA 1II8B 2ZQ5A 2ZUDA 5AK0A 3TAHA 1QF9A 5KDDA 2GETA 4ZDKA 3H86A 4G5GA 2CK3A 5IT5A 4D2IA 2JLZA 4PAQA 1BH2A 3R9IA 2WJVA 2ZVPX 3TBKA 4A9AA 5CIWA 1VCIA 4WOPA 2HV8A 1S9HA 3K70C 3T1QA 3QXSA 3AF3A 4HAXA 4IKEA 3VU9B 1XPUA 1NL3A 3U3RA 2KB0A 1M1YE 3FMOB 4OBEA 5FTLA 4JVMA 4OQLA 1R6BX 1FQKA 1CLUA 4GZLA 4ESVA 3EXAA 3QY0A 4YMTA 3A1UA 4B3XA 2EFEB 2QRZA 1W36C 4XOIA 2ZS8A 2H7VA 2J41A 4A2WA 3F5FA 1RJ9A 3EC2A 3CKLA 1ZD1A 4LK2A 3RS0A 4C4PA 4IW3B 1PZNA 4ASUA 3SBDA 2MSCB 2FZLA 2P5TB 3K0EA 3QPWA 1KIMA 4TL8A 5DI9A 4B2IA 1OYYA 4P31A 4NMMA 4N0DA 3TW4A 3ECCA 3SJCA 2AK3A 4O2LA 3NWJA 3SI7A 2C9CA 2J7KA 4MRVA 2JDIA 5TVKA 4M9QA 3GJXC 1N6RA 3P20A 3RS3A 3WMEA 1E69A 1SZPA 1II8A 2VHUA 4J0QA 4C9BA 4EDHA 1IOZA 2QQ0A 3TAUA 1K5DA 4Q66C 3L0SA 4Q9KA 2JJ1D 2CLDX 3Q7QA 1E1QA 1OHHD 2O0KA 2CHVA 4FMCB 4OI0A 1D8TA 4ZKDA 1G64A 1E9DA 2G0NA 421PA 1C9KA 2D06A 3BS4A 3L82B 1F2TB 2EWWA 2IK8A 2ZS7A 5JWHA 2IUSA 3VR6A 4DLZA 3QEOA 2RB4A 2PLRA 4URZR 1X86B 2PBRA 1H8ED 1KJWA 1SXJD 3ZS9A 3CLVA 2AN9A 1P9RA 2IS2A 1W4AA 2WKRA 1T3SA 2K5UA 2V9PA 5F3WB 1NN1A 4H1UA 3RWMB 4PHGA 2DCUA 4AKEA 2PZFA 4C0BA 2B7CA 4JLOA 2BVNA 2ODBA 3UWOA 1HV8A 4KHZA 2ZIAA 3K9LA 4TT3A 1OB2A 3AVYA 3B13B 1DS6A 1XP8A 5D3MB 1NKSA 2YV5A 4B3CA 2H17A 5BQ5A 3KJEA 3HR7A 1XD9A 5J4HA 5BN5A 1L4UA 1WF3A 2O8EB 2EQBA 2ZITA 3BIFA 5EE3A 2J5XA 3ZVRA 1Z63A 2EYQA 4GZMA 2C98A 4NCHA 3GEEA 1OIVA 4LY6A 1IJEA 1G7CA 1G9XA 5CIQA 2W0MA 2UZIR 3A1TA 3LBNA 2CNWA 2CL7X 3Q7PA 2KBEA 3GJ4A 4ZO4A 3B1YA 3NVAA 1E9FA 4WZBE 2ANCA 5JFGA 1R8QA 3CBQA 4QBGB 3MWLA 1NLZA 5J4LA 1F2TA 3K0AB 3LQRA 2VLIA 2QMEA 3LV8A 4LYAA 2NG1A 1JR3E 4LV6A 1FZQA 2IYXA 4XWAA 1VPLA 2ZYWX 4URXR 3B2EA 1Z6XA 1RKBA 2GXSA 2YWGA 3B82A 2F1IA 3CH5A 3GFPA 4DHEA 3TQCA 3R9XA 1VMAA 2ATXA 2AWOA 3I72A 4IVPA 5J5CA 2V7QD 4F38A 4JJKA 2ZE7A 3N70A 1TF5A 4M8NE 3THYB 1AN0A 1H8HA 3AGQA 3QG1A 3HU2A 2VP5A 1ESNA 4C0JA 4ESHA 2Z0MA 3ZVNA 4OQXA 2VQSA 4U7DA 2QN6A 2VA8A 4OHYA 2FN4A 4L15A 1A1VA 2RMKA 1NMYA 5D3MA 2ZRHA 2ZRCA 4BRWA 4U5XA 4LOAA 3GCGA 3WYFA 2ATVA 2WAYA 3A6PC 2O8EA 4ZDJA 2BCJQ 4Z54A 4TTPA 2GJ8A 3CNLA 3CZPA 1YKSA 4EFLA 4HLUA 4ITRC 4MYHA 2RKOA 2R62A 1Z3IX 2DWQA 1SULA 3CX8A 1AQUA 1J2JA 2NPIA 1GL7A 4NCIA 4R9UC 2FSGA 1E2PA 4YDHB 1IN8A 1XCPA 1P2UA 4Q9HA 4JT4A 2QG6A 3AGPA 1YU9A 4IDNA 3MWKA 4US1R 3K0AA 3K0SA 5HPYB 1W0JA 2V55B 4M1YA 4RKEA 2QP3A 4NU0A 5KTYA 3MSXA 4O3MA 4EPRA 4PPQA 3DL0A 4LJAA 1E2FA 2ZRAA 2BMFA 3FDIA 1N6OA 3VR2A 3IIJA 5F9HA 3AUYA 3BORA 1G7TA 2RHMA 2V8OA 3THYA 1HT1E 2BM1A 1UPTA 3U60B 1VECA 1QVAA 4B35A 4XVUA 5JJIA 3J81k 3VR3A 2GXQA 1R4AA 2IYZA 4JLPA 2ZSBA 2IYVA 4LBZA 1K8RA 4DUGA 3TNFA 4N1AA 3R9WA 1SHKA 4P32A 3BOSA 2D7CA 2ZR7A 3CH4B 5BXQC 5FL7D 2JJ8A 4QKQA 4QG7A 4R2IA 1TU4A 2FZ4A 3MJRA 4R2HA 5CITA 1GM5A 1N6NA 2IYRA 2JLQA 1YQTA 5CK4A 3WHKA 3HYTA 1VCOA 2ONKA 3I1FA 1KSHA 4TMVA 3O8RA 5L3SB 3VR5A 2ZAMA 4PZZA 2PLFA 4QL3A 1FTSA 4QOSA 4TYPA 2QP9X 2ZI7A 1ZUNB 2F9LA 3D6TB 1KZGB 4PZLA 4BEBA 3SC3A 4B6EA 3C8UA 3THOA 5JBQA 3DOEA 2IC5A 2IS1A 3AP1A 3RYTC 621PA 4D26A 2BCGY 5H8WA 4JBYA 4BQSA 4X8OA 2Z5FA 2UVQA 3LX5A 3B7GA 2KBFA 5B57C 2QMUA 4M4SA 5FPKA 4CEJB 3ASYA 1RZ3A 1KI1A 4W5WA 1J8MF 3D3QA 4Z1MD 4Q4JB 2FV8A 2XTMA 821PA 3VHXA 3EARA 3W6NA 5EZ6B 1IBRA 2XNDD 1SVIA 2GWHA 3NHAA 4DBLC 1G18A 1FX0B 1MO5A 4E07A 1RW4A 1TPZA 3V4FA 4XVQA 1E2EA 2C77A 2ZTSA 4BFXA 5IF9A 4XD7D 3SYLA 1OKKD 4RCYA 3UMSA 1HY3A 1W4CA 3ZQJA 2OBLA 1CJVC 1KSJA 5JLJA 4ZIRB 1CR4A 4FMDF 3NG1A 1DO2A 3BD9A 4MRSA 1J99A 1XTRA 2VHTA 2GK7A 4PFSA 1L2TA 2RH5A 5L3SA 3DZDA 2ZE5A 2JEOA 2KE5A 5G41A 4I1VA 5E95A 4PPFA 4M2LA 5LBIA 4B32A 4B73A 5LB4A 1BIFA 3KQLA 3AVPA 1Z6TA 2CK3D 2GJKA 3B1WA 1X8LA 4BLPA 4QC2A 4AKGA 1G3IA 3TJZA 1OPXA 2I1QA 2J0UB 4FMBB 2BKUA 4KFUA 4A0RA 1JEDA 2R2AA 1U98A 4M9ZA 4DLTA 3LXRA 2VPPA 1JPNA 4HAZA 4B47A 1CKEA 2QTFA 2WOOA 1XPRA 4CEJA 5TMPA 4IOLA 1RC8A 1A2KC 3AVTA 4CIDA 4DIEA 3VTKA 1G4UR 2YOGA 1KK0A 4Q4JA 4X8MA 5JJLA 4JIMA 1R0XA 1UEJA 2ODEA 4PO9A 2REBA 4Q4AB 4EUNA 5JHHB 2BC9A 3KQKA 1JAIA 3EASA 1FX0A 5AJWA 3IHLA 1XTKA 2EFCB 2HJGA 3T12A 2YJTD 4CEIB 4JLMA 1XWIA 4ZI3A 1R5BA 2AHOA 2GAAA 1CRQA 1MT0A 1TU3A 2RGDA 2ZJOA 3K53A 3PQCA 4ZIRA 4H9GA 1S3SA 3FMPB 1KY2A 3CIOA 4KVGA 1R7RA 1G3RA 3T35A 1SXJB 1HYQA 4IRUB 4AG5A 3EWAA 1SXJE 3CWZA 2W2XA 2OXCA 1F2UB 2JIZD 3WBJA 2H57A 4OKSA 2FE4A 2DPXA 4TSFA 3WHLA 1I4LD 2AR7A 2BMEA 4IDHA 5C1BA 4POAA 1Z0IA 5FTJA 1NMXA 3DZ8A 1ZNWA 3WXMA 1E2IA 2J0UA 3U3JA 2IS6A 1IXRC 2CCJA 1FNMA 3NC1C 1SQ5A 1KI4A 3LBIA 2OV2A 4A2PA 4LV5B 4AC9A 3MG9A 1NVWQ 4M1SA 4F4CA 3DDCA 2F3TA 2REXB 4HSEA 4CGZA 1QHNA 1T5IA 3A1SA 4Q4AA 5GJWC 4LZZA 4EJSC 1BYIA 3ADKA 2DWOA 2I3BA 1UBFA 1DAFA 3WP0A 1CR1A 1KAOA 3KFXA 3GLFB 1QHSA 1SXJC 3ZYCA 1P73A 2JJ1A 4HLDA 3REGA 3GLFE 4CEIA 5ELXA 4KFSA 2B21A 1OHHA 3UK6A 2WM9B 1OH5A 4LHXA 2FSHA 1G17A 2GVZC 5DGXA 1XB2A 1G8YA 2ODWA 3OE7D 3IDQA 1HT2E 4L9SA 3BWDD 2JLWA 1QHHB 3BFXA 2IYUA 1M6NA 3QVVA 4CZ2A 1F2UA 4JKIA 1P2VA 5FOSA 4AK9A 3V9PA 2XOKD 4HLQB 5TY0A 3FOZA 2O8DB 1G291 1UFQA 4URWR 3BGWA 2CE2X 2WJIA 3CZQA 1T9HA 4V02A 2PZEA 2J46A 1AA9A 4WXPA 3L0OA 4JLDA 3RANA 3EW9A 2ERYA 4FMCF 2ZUCA 3B1ZA 5DH9A 3A58B 2WMOB 3HYRA 2ZJ5A 4GMDA 5AJVB 2FMXA 3TK1A 2ZRNA 2MMGA 2ORWA 2Q21A 2ONJA 1G19A 5L8VA 2IYTA 4EKDA 1AGPA 2IEZA 2ZJ2A 5EQTA 1EFTA 1SHZA 2WWWA 2PX0A 4ZPXA 2FPLA 4A15A 4LJ4A 2FPMA 3IIKA 3T1VA 3GLFA 1NY5A 1GIAA 3DKVA 1RRGA 4BPBA 4LJ9A 4QJ3A 3CPEA 1QZXA 2P65A 5K8LA 2I1VB 5CJPA 1VYVA 4QNRA 1NIPA 4MRRA 3VMFA 3PEUA 1ZMXA 1NN3A 4LHVA 1WXQA 1QHHA 2NZ8A 1N6PA 2Q3MA 1TNDA 3BH0A 4QJ5A 4TLBA 2OCAA 1K5GA 2ZS9A 1E4YA 4Q4LA 4M22A 4A1FA 2W2TA 3U5ZB 1JQJC 2O8DA 1ZM9A 3EPLA 4NYMQ 5G3ZA 4B3DA 3QXCA 3CPHA 2A5GA 2ZJYA 3L8ZA 3OAAD 3Q8XB 4CDGA 1PLJA 3LY5A 4JVNA 2QM8A 4EIWA 1CIPA 3PG5A 4FD2A 3KKPA 3IHWA 5EXSA 1KSFX 2OCPA 3NXSA 5ANRB 1ESMA 5B30A 1R5NA 1V43A 4NCKA 3VQTA 2HDNB 5EP3A 4TTQA 3QPUA 1W7AA 3DPUA 5F2EA 2ZI6A 1N25A 4HZIA 5KSYA 4LJ7A 4FWIB 1TQDA 4LYJA 3OHMA 1CS4C 4NPHA 4TQAA 4RD6A 4KYIB 4Q48A 2C95A 1N5IA 5KSZA 3E5HA 3U44B 1P9WA 1ZNXA 4AKHA 4OI1A 2IXFA 1DAIA 2P6NA 4OYHA 3ZZ0A 3KTAB 3KXIA 5FUYA 5B58C 2FPKA 3AVWA 4JLBA 2H1LA 1Q22A 2V1XA 2E87A 3PV0A 3TRFA 3AVUA 1G8PA 2GCNA 1XEFA 4DKXA 1GVNB 4NL4H 3RS4A 2C2HA 4KYUA 3LAWA 1IN6A 4X8HA 2QMOA 4P4SB 2ZJ8A 1RFLA 5GJVC 2RGEA 4D81A 3CRW1 5J4YA 3KFVA 1ZCBA 2X2EA 1G8HA 1GUAA 1ZIOA 2ZYTX 2FG5A 3AVQA 1KTVA 4UKDA 4DSNA 2RGAA 2R6DA 1BO6A 3VKGA 4DLXA 2P0EA 4WIAA 5IDVA 1IXZA 1FNNA 1QHIA 2ANBA 4BFTA 2GBLA 4OQMA 5E7MA 2F3RA 1E9RA 5JSZB 4FMDB 3OFND 4F91B 2FU5C 1TUIA 1YZGA 1DAEA 4MGYR 5EXTA 3WYGA 1VG1A 4B75A 1D2EA 4JYBA 1ZBDA 1M7HA 2A5FA 2WWHA 2YWFA 3CW2A 1ZUHA 2A5JA 4PPGA 4MGKR 1D9ZA 4P33A 5G40A 3WMFA 3U44A 1C4OA 4B71A 1KMQA 3IIMA 4IEEA 3KTAA 1G5TA 4MYUA 1JPJA 3GJ3A 2QY9A 2QL6A 3UWKA 3M4YA 3GJ8A 3IKJA 1CJUC 4JYCA 1NJFA 3W6OA 4TMXA 4P4SA 3SN6A 6Q21A 3LVQE 4D80A 1U99A 2HCBA 3X1DA 4KBFA 4MKHA 3RRNA 3ZVLA 5HKKD 1EX7A 1X6VA 1XBTA 1W5TA 4QRHA 3TSOA 3CUEF 4IHQA 2EWVA 2QT1A 4MYTA 4DJTA 4RSGA 1OFUX 2IHYA 4JLJA 5FUXA 2XNDA 1WBDA 2REOA 4OHWA 3EZ7A 5IK2D 2YNMA 2A5DA 3EZ2A 1G1MA 2PH1A 1P3JA 2VHJA 4BFSA 2Q6TA 3BK7A 4Q9IA 5CM9C 1NLYA 4W7SA 1E6CA 3QBTA 2CHGA 1GITA 1KDTA 1W47A 2QMHA 5JSZA 4A36A 1GAJA 1KK1A 3B1VA 4S35A 3W6PA 1OIXA 1HQYE 4RKFA 3GPLA 5HE8A 1KI3A 2F1JA 3L0IB 5JCPA 3PR1A 1WDTA 1N5LA 1SKYB 3BC1A 2F1RA 1SKYE 1GILA 5H68A 1EG7A 3UG6A 5LD2B 3KZ1E 1VDZA 2QORA 1DAKA 3M6AA 3D31A 1JAHA 1UBEA 1Q0UA 3C4JA 4C0LA 1GKIA 2BEKA 3PUVA 1UDWA 1IHUA 2PMDA 3N5CA 4B48A 2PEYA 1CJTC 1HE1C 4MITA 1HURA 2PZGA 2EFDB 3EIHA 3NEJA 1R8SA 3R8FA 1W2GA 3QJYA 3SJBA 4MDFA 5JJKA 2NO9A 2QGZA 3FB4A 2V1UA 3F3YA 2VSOA 3AKEA 4ILEA 1TL7C 4ZV4A 3AKCA 4TSFD 2ZM5A 1AZSC 1T6NA 1YR9A 3HPRA 4YONB 5KNBA 4OQFA 3SU8A 2O8BB 2AX4A 4C2UA 2C96A 4TYWA 5E7JA 3KKQA 3LDAA 1OV4A 3C41J 3PEWA 1S96A 2JLVA 1ZVQA 3KJGA 4LUCA 4AY2A 1E2MA 4WZ6A 2J59A 4OJQA 1U0HC 1T8UA 4KSCA 4LGMA 4CT4B 2IEYA 3QVUA 2QTVB 4WXRA 2ZI3A 3G82C 3AQ4A 2BDTA 2WKPA 3LW7A 1GRQA 2ZJBA 2D2FA 2JIZA 3CRQA 2RGGA 1D2NA 4A92A 3L0PA 4B76A 1GZSA 4ZDIA 3HJNA 4I1UA 1O87A 2WSMA 3FHOA 5FR2A 4PQYA 2G3YA 2PCLA 1P61B 2FNAA 3CX6A 1EFCA 1HE8B 1NN5A 1OT3A 3IEUA 4U00A 3U6BA 2KSQA 2WIBA 2C5LA 2FSFA 2PT5A 1XDBA 1KK3A 5BYJA 3T5DA 5AUQA 1KDOA 3TLXA 5JWRA 2HCJB 1AS3A 2ZROA 4PSAA 4R71A 2ZRFA 2O8BA 3CNOA 4BASA 4C0KA 4OHXA 2YC2C 3MGCA 1OFTA 1KO7A 3HWSA 4LJYA 1E2JA 5HZKA 1NF3A 3FMFA 4TYYA 2IL1A 3LD9A 4FCWA 1P6XA 3OE7A 4AYTA 4DRZA 1YHNA 1ZC4A 3DM9B 2FFHA 4M0LA 4DSTA 2DFKB 2D7DA 4NE2A 1SKQA 4D6PA 4URVR 4CT5A 4PHFA 4RZ2A 1Z47A 4BLQA 2NO6A 3B9PA 4B2PA 3C7KA 1SVSA 3OEED 4WZAE 3NH6A 2IX3A 4PAOA 2XOKA 3WMGA 2GZDA 1OLOA 3G5UA 2FDCA 4DLWA 4JVLA 2IF0A 5J47A 3PCRB 1E79D 3GLHB 1N5KA 5E3HA 1OH6A 1GL9B 3GLHE 5FOWA 3L8YA 2QAGA 4URYR 4KXFB 2ERXA 1YZNA 3C14C 2J9RA 2Z4SA 2ZI5A 3JVUA 4RFVA 3LFUA 3EC1A 1E94E 4RVCA 2ZR0A 3DHWC 1GOTA 1COWD 3I5YA 4MQBA 1T3HA 2WJJA 2A2ZA 5A0FA 4CW7A 3A4LA 4PC3A 1NBMD 1Q1EA 4ACBA 1OIWA 1Q44A 2G0TA 4XTRA 4HLUC 2YZ2A 3MAAC 3IILA 3O8BA 4MYCA 1TQ6A 1DADA 1AS0A 1FUKA 3JZAA 4DLUA 2WJGA 1OFIA 1GKUB 1MRSA 1GG2A 2MSEB 3MRSA 3SNHA 5C46F 1T5LA 5EZ5A 3NDBB 2FH5B 2D74A 4UXJA 4DLRA 5DSZA 2DWPA 3WRYC 3P1JA 3B1XA 4PQRA 4WBSA 4AD8A 5JHGB 2A5YB 3OZXA 1HUQA 4BRUA 1VHTA 1VTKA 4IEIA 3ADCA 1KYIA 5KPJA 1NVVQ 3OF5A 4BE7B 3CF2A 1KY3A 4TZ0A 3HP1A 2JASA 3BB1A 3E1SA 3GLHA 3W3ZB 3OAAA 3NBYC 1ZAKA 2FFAA 4CEHA 5DO9A 2VF7A 1NNEA 3K8YA 3RS2A 4TMKA 1E2HA 2GEVA 2BJWA 4HEJA 3BERA 2Q9AA 1XZQA 4K8OA 1U8ZA 2QPOA 2OCBA 4M9SA 4EFMA 4NBSA 4ERNA 3LLUA 1QHGA 2GF9A 4DEYA 3KQHA 3GJ0A 2J7PD 2LKDA 3NTUA 4D0GA 3RWOA 2OFWA 4PQFA 3SJZA 2ZETA 5JS8A 2BWJA 4Q4HB 3QKRA 2GRJA 3SR0A 3TUIC 4FXPA 3CR7A 2C03A 2CDNA 1XTJA 1KI7A 1QHXA 1W4BA 4BWYA 2ZSDA 3VX4A 1JBKA 3WY9A 5GJCA 5CK5A 4BLSA 4NTZA 4D4LA 3Q85A 3OIUA 4RD1A 1KI8A 5GVRA 4Y0VA 1A5TA 1UAAA 1M8PA 3IEVA 1MKYA 5FTKA 1TEVA 3THXB 3UG7A 3IPYA 2AXPA 2WWYA 4IXNA 4A8JB 2PEZA 5KOYA 4DCVA 3DKPA 1CTQA 4BLTA 2WJHA 5KNDA 4GRAA 5DNYB 2NO7A 2ZRMA 4LJ6A 4S2EA 1DEKA 2CXXA 2IA5A 1U2RA 2OFOA 3ZS8A 3BFKA 1CR0A 1MRNA 2X8AA 1UEIA 3AV0B 1FQJA 4II7A 3RSOA 3FTQA 2XX3A 1AJEA 1YZTA 1RYHA 3QQ5A 1E9EA 5HR5A 1G21E 5KUTA 1ZD9A 4QNMA 2IYSA 4TYNA 3ONWA 1T8TA 4Q5IA 4DLVA 4C30A 3EPJA 1XXHB 2W2VA 4D25A 2QP4A 2R6CA 2UZ3A 1XXHE 2FX3A 5AWFC 5DHFA 2DFLA 2ZRJA 1TEXA 5JWOA 2ZRLA 4BFVA 2VL7A 3OFNA 2LWIA 4Q4HA 3IO3A 2XJ9A 4NYJQ 2ZRPA 4LHWA 3OESA 4QM7A 4RD0A 4HAYA 1BS1A 3ND9A 2O0JA 4HAWA 1VKJA 4TQUS 2WIAA 4LPSA 1KHTA 1XTQA 2VF8A 4YQFA 1N2CE 1U0LA 5KSOA 2ZRIA 5LDDC 1N0WA 2W6IA 1E96A 1XMJA 2WJYA 1W44A 2A9KA 5TARA 3THXA 4KITB 1US8B 4HDCA 2XB4A 4A8JA 1YRBA 5FL3A 3IPXA 3DMDA 3LW8A 5BWMA 4M1KA 1S1CA 4CVNA 4Q1AA 3I3SR 3B9QA 1MR3F 3KUDA 1DPFA 4QJ4A 2OCYC 4FN5A 5HKKA 2LKCA 3TIFA 2Q3HA 1II0A 4BFUA 4LI0A 2KJQA 4NP6A 1XZPA 1ZC3A 1HEIA 1GDDA 4RD2A 3PUWA 4EPTA 5IK2A 1P9NA 1XXHA 2KI5A 1B0UA 1NY6A 1G41A 2XSZD 1UBGA 1T4GA 3SHFA 4Q7KA 4K81B 1TX4B 5HCIA 2A78A 2NPFA 2CJWB 3ZLJA 1ZD8A 1PUJA 4DZZA 3U61B 3W34A 3VR4A 3SBEA 3WNCA 3K0FB 4QGGA 2G77B 2ZRBA 1DBSA 4B44A 3CWQA 2ZAOA 3N2IA 1RVDA 2CLCX 2WWGA 5B2ZA 3X2SA 2OBNA 4Q19A 5DN6A 4FWTA 1T91A 4Q01A 3A8TA 4KLZA 4Q7JB 3UIEA 1X8JA 4ZCMA 5C18A 3CNNA 4B3FX 1YRAA 3TR0A 1US8A 4JVSB 2GXAA 3MFYA 3PITA 4IDQA 2GTPA 3KQNA 5KHOC 1X1SA 3BB3A 4TZ6A 4A2QA 1NG9A 3BB4A 1XNJA 2GJAA 2BMDA 2GKSA 2NQ2C 3AF2A 3EPKA 1LS1A 4PSKA 2RHDA 3CB4A 5TDHA 4AYXA 3SEAA 2FOLA 2R9VA 1M7BA 2JLXA 2J0SA 3CONA 4D0NA 1F6BA 3RAPR 1UBCA 2J45A 4GOXA 4Q9JA 3QKSB 5LPNA 2V3CC 1XJQA 2ZSFA 2XB2A 1WB9A 5GADl 3FGNA 4C0AC 1N0UA 2VRWA 5CLQA 3FHCB 2NIPA 4QBIA 3W8NA 2OSBA 1LF5A 5TV2A 2OEPA 4A4DA 2WWFA 3I61A 4G5RA 5LB2A 4Q1BA 1Z2AA 4D4KA 2ZXUA 2W00A 3QKUA 5KDOA 2CJWA 2H5EA 4US2R 4NCJA 2G88A 2W0SA 3DOFA 3K0FA 2WV9A 5JI2E 2X77A 2LCFA 1SVMA 4PAMA 3A1WA 3PENA 5BN4A 4B33A 4D4MA 4YDSA 3RNLA 1AK2A 3BXZA 2GDJA 1HQCA 2C04A 3U4QB 1VG0B 2AD1A 1KDRA 2F6RA 4E5UA 2I4IA 3T61A 1BMFD 4G5OA 2BKEA 4JKYA 4M1TA 2QTHA 1A4RA 3UATA 5L3QB 1J90A 3NIBA 4P4TA 3FHTA 1NKTA 1U9IC 2OAQ1 1R0WA 2B8WA 4DDTA 4JBWA 1P5ZB 5JZVA 3KJHA 1YZQA 3V4RA 2Z4RA 5AR1A 1LB1B 2JAQA 1E2NA 2ZREA 3QKSA 5G3YA 3VR1A 4B43A 1NBME 5FH9A 3U7GA 2VP0A 2VHQA 4OK5A 3KB2A 2FJUA 1OXXK 4OK3A 1P62B 1U9IA 4HB3A 4TQ9A 2B8TA 4EPWA 1G6OA 1NN0A 4I1SA 4BZQA 1HH4A 3M0EA 4TN1A 1T3LA 2D2EA 4UNQA 5UKDA 4D0LB 2DB3A 4RD3A 221PA 2AFIE 2OG2A 3AKDA 1UKEA 3BAFA 4LC1A 2QT0A 1F60A 1NI3A 2CE7A 2PCJA 3R20A 4KFRA 4LYFA 2IUUA 4DCNA 1N6LA 1NVXQ 2F7SA 3U2QA 3SQXA 2QAJA 3I32A 3MUFA 3H0KA 3OEEA 4K46A 2HF8A 4AWXA 4H1VA 4YXWD 5P21A 5EP1A 1E2LA 5DHAA 3U4QA 1E79A 1QVRA 1WBBA 4NZYA 1KO8A 1Q1QA 2YVUA 4MUBA 4A82A 4BLOA 3T1TA 2CLSA 3C16C 2O8CB 3WNDA 2OESA 2P5SA 5FPYA 4LWZA 1ZJ6A 1GRNA 3ZH9B 4AIIA 4PC7A 5L3QA 1LF0A 2IHBA 4WAUA 4XWKA 1IM2A 2BOVA 2GJ9A 4NDZA 4B34A 4F7WA 4G0NA 4PXAA 1OH7A 1M74A 4DEXA 2PJRA 1COWA 1D9XA 1YR8A 1N6HA 5FBWB 1NBMA 3DMNA 4P3YA 1RPZA 3U7EB 2QU8A 4IDOA 2MSDB 2WHXA 2ORIA 1IY1A 4OHVA 3NDPA 5DE3A 4TLDA 4IXMA 4QGAA 3X1XA 1EESA 4TWZA 1JB1A 1NRJB 1E2QA 2PJZA 4PHHA 4Z51A 3DVLA 1FPMA 2XTZA 1G3UA 4NYIQ 3B6EA 3W9YA 4P0TA 2O52A 2BBWA 2Q0HA 2ZI4A 4MH0R 5DYGA 3T15A 2V4ZA 1SVWA 5EP2A 3F8TA 2G83A 4GMXA 4MRNA 2H18A 5CYPA 2B6HA 1G3QA 3SFVA 3PJRA 3IQXA 1OXSC 4UXHA 2EFGA 1RYFA 1W5SA 3ZIAD 2JGNA 4G5QA 4UNRA 3AVOA 3K09A 3BH6A 4YMSA 5B64A 3L2OB 1M2OB 1AM4D 3IBGA 2QPAA 4LBYA 4XVRA 2WMNB 4XWOA 1S3GA 1FL9A 2O8CA 1MO4A 3C15C 4FCVA 1W4RA 3GJ5A 4HUTA 4JBXA 3RABA 4TL6A 4DT1B 2EW1A 1Z29A 4KAXA 4B74A 1H65A 1E9SA 3A1VA 1ANKA 1MV5A 3WBKA 2J7PA 1Z22A 2X2FA 1TQ2A 1WRBA 2B7BA 3ZZUA 1CU1A 3CF6R 4JS0A 3MCAA 1OH8A 1E0AA 2GBLC 1AZTA 3RRZA 2IW3A 2ZR9A 1GNPA 2QPTA 2F55A 3QXHA 4O2RA 5E7IA 1GNQA 3GMTA 4MGZR 1P60A 2ZYUX 4Q7MB 2WOJA 4V0MA 5AUNB 1Q1BA 2NOAA 2R65A 2V6IA 3GD7A 3KB1A 5L3RA 2OLJA 2ZJAA 1RRPA 4DWJA 3UMRA 4YC7A 2AKAB 1NG1A 1AKEA 3U3MA 1L4YA 3GP8A 2Q9BA 1LS6A 2ASEA 3OIYA 3RRMA 5JCZA 1G4AE 1A2BA 4FCTA 121PA 4GNKA 3QOFA 1Z6AA 5EE0A 4IDPA 1Z07A 5FUWA 2C78A 3ZD7A 4HB0A 5FTNA 1A82A 2XITA 2OXRA 3B60A 1YJ5A 1G16A 4L8GA 2VSFA 1TQ4A 4Q03A 2X19A 3SYNA 1QHYA 1S4QA 2CCGA 2PX3A 4F4JA 3EPHA 4NYMR 5H1YA 3H1TA 2W83A 3ZZTA 2W6ID 3W5JA 1BYUA 1Q3TA 1VG9B 3TVTA 4HYYA 4DT1A 1IONA 1XEXB 3DEFA 4NH0A 5KU1A 1HA3A 2VP9A 1KMHB 2MMCA 1T0JB 2G6BA 1N6IA 3SE0A 3T06B 5JI3E 2YKGA 1JNYA 1YR6A 2OM2A 5EE5B 1VHLA 1TAGA 4GP6A 2WPDA 2IT1A 2VHCA 2GCPA 3WNBA 4IOKA 4BECA 5BW8A 1ZINA 3U6KA 1VCMA 3Q9LA 4V0NA 1UKZA 1KI6B 2KWIA 4MKFA 4EPYA 3KKMA 5SZJA 3FKSD 4DB4A 4LRWA 4ZDWA 1XEWY 2QUZA 3KX2A 4KSBA 4G3XA 3P4XA 4XSGA 4EPVA 1OB5A 3U7HB 4Q18A 3TSWA 3RC3A 2H16A 3LWNA 2YWEA 3RLFA 5JEEA 3TUZC 2FSIA 4PSVA 4L9WA 3EAQA 1FW6A 4UNSA 1II9A 4PO1A 1DARA 1ZCAA 4TL9A 3FFAA 3QBVA 3SS8A 1N5JA 2WAXA 1Y3AA 2P67A 3B85A 3LNCA 1CR2A 4DB2A 1XU4A 3AVVA 2N46A 4KFTA 1VG8A 3ADBA 3K70B 3HR8A 5DN6D 4TLEA 5HTKA 3EZFA 1RIFA 4B3GA 1DTSA 2DR3A 1AIPA 4JLAA 1XEXA 5EE1A 4KJZA 2OE2A 4GDFA 2AWNA 2XSZA 3IGFA 3NKVA 1UDXA 4HLCA 3U3OA 4M1WA 3MJHA 1XTSA 2GNOA 1KMHA 3IQWA 2WTUA 4LV8B 1P75A 4TYQA 2AD5A 1XRJA 2F1HA 4KCGA 1NIJA 2ZVQX 1BOFA 3HU1A 4V03A 4JLKA 4BFYA 3I8SA 3LLMA 3AP3A 4DLSA 2IYYA 4N3NA 1OXVA 1Y63A 2V54A 1E2GA 3NHBA 1E3MA 1DAHA 1KI6A 5EXXA 1XMVA 5H70A 4B3BA 2GVDC 4GI7A 4IJMA 4PHTA 3LA6A 3GLIA 3ETLA 3TE6A 5CB8A 4LHZA 5K8TA 1SGWA 5LD2C 4WA7A 1U81A 5A4JA 2QA5A 3QNUA 2QM7A 1XX6A 1EFRD 3X1YA 4QGFA 2WKQA 4LCBA 3PIRA 1N0VC 3RC8A 4OL0A 4QHYA 1OXUA 2JCSA 4HAUA 5AJYA 1W49A 2C8VA 1NVUQ 2VP4A 3RRYA 4ZI2A 4D4JA 3U7FB 3B8HA 1Z28A 1E1RD 2CCKA 3P27A 3OEHA 3PEVA 2QAGB 3T1OA 3O8CA 2ZJZA 4UQOA 4MDEA 4Q00A 1Z8FA 5EE9A 1MABB 4Z8YA 2RGNC 4Q1EA 3BE4A 3LXXA 2PT7A 4C7OB 1CJMA 3BRWD 4IVRA 2WWXA 2R6FA 5KO2A 1OJLA 4TMTA 1ZM3A 1DELA 2BIFA 4DDWA 3MWJA 3GEIA 3NEYA 3TKLA 3SZRA 1J7KA 1YZUA 4KO8A 1IQPA 2NO1A 1D2MA 3QG5A 2OAP1 2RGNA 1E9AA 2C99A 4JLNA 1J70A 4GSYA 2VIIA 2F43B 3VU9A 3TSZA 1BMFA 1E2KA 3Q5EA 1F5NA 3BH7A 2GESA 4JL8A 4DDUA 3QF7A 1EFUA 1N6KA 1ELOA 3PUYA 4UNNA 2QAGC 1KO4A 3I73A 2XZLA 1E99A 1E9BA 5J40A 1Z2CA 2GHIA 4QFMA 1XFAA 2BBOA 4TLCA 1DG3A 4D82A 5M04A 1OE0A 2HUPA 4G01B 4GOJA 4NONA 3NBZC 1OFHA 2CEAA 4MA4A 1UKYA 3NBFA 1MO6A 3L43A 2JJ2A 3MMPA 1Z0FA 4LHYA 1U8AA 4DC9A 4DCTA 5JRZA 2G1JA 5HE9A 4L5BA 2WSSD 2FWRA 1E4VA 4CEHB 1FP7A 2VBCA 5TB5A 1JALA 1F48A 1MABA 2D4HA 4TL7A 2ODNA 3GFTA 4Q02A 1JJ7A 4L16A 1GFIA 1CULC 4C0QC 2QNRA 4C7OA 2IS4A 3QIAA 1XMIA 1XD2B 1ZNYA 4LX0A 1LV7A 4FINA 4YMWA 4UXIA 4PO8A 3RVBA 4W5JA 1E2DA 3QKRB 4M1MA 2VSXA 2J1LA 1IN4A 4YXWA 1XEWX 2L0XA 2GZHA 4UJ5A 3TQFA 1Z6YA 3M1IA 3KKNA 4ON9A 1FUUA 2F43A 1I2DA 2IWHA 1ZNZA 2JLSA 3CX7A 2IF2A 4LC0A 1LVGA 5DI3B 3PXGA 3P26A 3QPVA 1R0ZA 3H4MA 4AG6A 1RE0A 3EA0A 1T0HB 1E9CA 3SJAA 521PA 1SVKA 1X1RA 2VO1A 1GP2A 3VAAA 2UKDA 5E4FA 3I5XA 4XIGS 2QE7D 1P4SA 4U02A 4CRWB 2ZU6A 1M7GA 3REFA 3GJ7A 1KSGA 4AURA 4OI2A 4BLRA 2RGBA 3LBHA 1OF1A 1NSTA 2IYWA 3Q5DA 4EQ6B 2Q3FA 4MGIR 1KOFA 1FMJA 2CMKA 1WE2A 3T34A 1ZUIA 1ZM4A 1EX6A 4TLAA 1KJYA 1EXMA 3D7MA 3KJIA 4BZPA 4EAQA 2OZEA 2FF7A 4HUQB 1XPOA 5CDFE 1XD2A 4UJ3A 1R10A 2ZPTX 3KXLA 2P3SA 4IFEA 1W0KA 3GJ6A 5DYIA 2EU8A 1DVRA 1Q20A 2BBSA 2ZU0C 1S1MA 4C3ZA 2GAOA 2H8KA 2HLDD 2Z83A 2IXGA 4OI4A 2W6JD 1G3MA 3ZIAA 2GK6A 5FOVA 4Q1DA 1JR3A 3KKOA 3I4LA 4HI0E 4TMZA 4V0LA 5J4KA 1VYTA 4C0HA 5KYKA 3RDPA 2C9OA 3GEHA 4XTCS 2PMKA 3K9GA 4RZUA 1KZ7B 2Q9CA 5DI3A 3I8XA 3T5GA 1DOAA 4BGDA 4MKGA 4RCZA 4DXAA 5CLLA 1ETUA 5EUQB 2W58A 5FBRB 4RZ3A 5CJ2A 3W90A 4IVQA 1K6MA 1KO5A 4LJ8A 4QBHA 1KKLA 3N2EA 1Q3HA 4A0HA 2AXNA 5CM8B 1P7CA 1KO1A 4IFBA 1GTVA 3RHFA 4EQ6A 5AUPB 2QSZA 1P2TA 1WMSA 4UNPA 5FBLB 5AJZA 3W5IA 3A36A 2A30A 4RD4A 1VYUA 2AL7A 5J4VA 3NH9A 2FGKA 3LQQA 5CDFA 1P2SA 4HUQA 2BBTA 3AM1A 4DDVA 1ONBA 1PLKA 3BFVA 1I4DD 2IBMA 4C0SA 3NC0C 2VH5R 5DIFA 2QQEA 2Y8EA 3ZGXA 2HEIA 3A4NA 1YZLA 3Q72A 4A8JC 1E32A 2WPDD 3A4MA 3D8BA 5FBQB 3EWSA 3ADDA 2GEUA 2P6UA 4M21A 1XMSA 1XCMA 1NVVR 5K8UA 5C2JB 1O3YA 1VIYA 2OHFA 3WRXC 2NMVA 4HB2A 3KUCA 3X1WA 1GNRA 2IXEA 4KVAA 4EFNA 4BUJA 2J87A 4MUAA 3UANA 1E0JA 4ACAA 1CEEA 2ZEJA 1EFHA 2XNSA 3E2IA 2JATA 3ND8A 3LO5A 4Y0AA 2D3WA 2O8FB 3RS5A 2HXYA 1KKMA 1TF2A 1TUEA 2ZSEA 1U8YA 4CF7A 5GVSA 3AF0A 4ZKEA 1JXOA 1Q1ZA 1X3SA 1C1YA 1R5OA 1UADA 4LPKA 2AKYA 1U0JA 2G9NA 1IXSB 5JMTA 3AB3A 2V6JA 8OHMA 2G1KA 1ZIPA 1GRRA 3TW8B 1KNXA 3FKSA 2BM0A 1Q12A 2FEOA 4L4UA 4QM6A 3QKTA 5FBVB 1Z0AA 3K9HA 2GF0A 2FA9A 3I62A 3O8DA 4GL2A 1UJ2A 3CR8A 5CB6A 2HYDA 3SDZA 3ZVMA 1KAGA 3TVDA 1R0YA 3THWB 2ZANA 1JJVA 1MH1A 2ECKA 5AUOB 3EZ9A 4M53A 1CBUA 5SZHB 2J0QA 1DO0A 1OSNA 2BV3A 2QZ4A 2CL6X 2ZRDA 3TUJC 4GPTA 721PA 2ZSAA 5KPDA 3LRPA 2JLRA 1NP6A 2ORVA 1U94A 3H2YA 5IRCD 5K8IA 1F3OA 4GP7A 3UPUA 1DAGA 2O8FA 1JECA 1YE8A 4CYMA 3C5HA 1Q57A 1JR6A 3CRRA 4Z8XA 2WWIA 4XSHA 4Q21A 2IUTA 1OYWA 5FOXA 1KJZA 3OIWA 1QBKC 1QG2A 2XAUA 4TTRA 1ZM2A 3KL4A 4NYJR 2ZE6A 3QENA 4V0KA 4YMVA 1IY2A 3CRMA 3TGPA 3K70D 2FEMA 1BKDR 4JZKA 4DSUA 1RRFA 3VKHA 1N3BA 4FIDA 5CYOA 1GKYA 1AGRA 1XJCA 4F93B 4W9MC 4ASUD 3HU3A 3ZJYA 3OEHD 1NLFA 1W48A 1CRPA 3C5CA 4KODA 3SOPA 2XXAB 3FE2A 1TADA 2H92A 2NGRA 5FI0B 1WQ1R 2O5VA 5FI1B 1EFRA 2BEJA 1Z0DA 1PUIA 2DFTA 2XJ4A 4HDQB 4EJSB 1W36D 2JDID 1GWNA 1IY0A 3THWA 1FFHA 4ZCLA 4URUR 3I92A 3S1AB 1ZW6A 2R6AA 3UMFA 5F98A 4FI3C 3MWYW 1AKYA 4QXAA 4Q1CA 1DAMA 1E1QD 4X8LA 4GT1A 5BYKA 3F0TA 2DFNA 4PC1A 3KQUA 1PLLA 1TTTA 4N0EA 3EX7C 3PUXA 1E1RA 3ICQB 5FOTA 2GEDA 1EWRA 4BFZA 2J3EA 4FW9A 3R8CA 3HDTA 4XH9B 1PVOA 1GSIA 2OUKA 4IOJA 3WP1B 1KK2A 4B6FA 4GBMA 2QBYB 2FFBA 2YC4C 1Z0JA 4DVGA 1FOEB 3VNVA 2AFHE 1U90A 3B5JA 2PL3A 1IAQA 3RSLA 2R6GA 1G8FA 2VP6A 2JJ2D 3O47A 2RGCA 3EIEA 4HAVA 4JJZA 4PANA 1E98A 4TT3D 1EWQA 3MD0A 3K0CC 4I99A 4I81A 1KI9A 2YHSA 4PC2A 2XXAA 1AQYA 2XTNA 2BHRA 3OIVA 4P4UA 4TMWA 4YLGA 4EJSA 1E0SA 2AK2A 1H8EA 4M9XA 1SXJA 4KV9A 3JZMA 3H84A 3SQWA 3A37A 2HYIC 3S1AA 5D3QA 4MRPA 3K0CA 1XTIA 3JVVA 2CNWD 4PPNA 4A0FA 1ZP6A 4HATA 2N1BA 1EGAA 2A3RA 3LX8A 4RJLA 1W46A 5KDLA 4ZCIA 5JECA 4RZXA 1S0UA 4HZUB 2DYKA 4LDJA 4NCNA 1NSFA 4DCUA 5HZHA 1IN7A 1UF9A 1XD8A 4E09A 2VYFA 3RS7A 3LVRE 1I4TD 2RGXA 5KNCA 2WSSA 3LH5A 2EVWX 1KGDA 4QHSA 3IUYA 2P6RA 4OQNA 2JLUA 1XF9A 4M1OA 2HXSA 2IYLD 2QBYA 1OW3B 1GL6A 2EYUA 2QGNA 3AH8A 3FMIA 4I1OA 4ARZB 2DY1A 3FWYA 2GCOB 4V0OA 2OT3B 1LFDB 1ODFA 1Z08A 1H8HD 2YINC 4US0R 4KBGA 2DBYA 2GJSA 2IYQA 3TR5A 5FPTA 1WA5A 2BJVA 4JLVA 1LTQA 1WP9A 2FFQA 3FPAA 4JSYA 3SFZA 5C4MA 1TMKA 4BFWA 1D5CA 1RRCA 2RCNA 2YYZA 4KI0A 3TMKA 4OHZA 3ZQ6A 1Z06A 1JQLB 3PFIA 4RY2A 4F4IA 1OXTA 1QG4A 3QEJA 1PV4A 5KSPA 2OLKA 1G8GA 3BBPA 4G1UC 4V0ME 5FR1A 1R2QA 1G7SA 2Z6VA 4WVFA 3GLGB 3K09C 3GLGE 2WVJA 1FMLA 3FYHA 1TF7A 4QBFA 2XGJA 1G5RA 2E9SA 3AEZA 2ZRKA 2V7QA 2QROA 2P2LA 1W0KD 2YOFA 5SZKB 3W8RA 1D6JA 1UM8A 1SVOA 3EZ6A 3IO5A 1IN5A 2J0VA 2QE7A 3AF1A 5G53C 1SVLA 4AI6A 2JA1A 3HPQA 2CVHA 1YR7A 1J8YF 5GJBA 4HZUA 2D62A 2ZYVX 4OK6A 1G6HA 2F9MA 4LBVA 3DO6A 4JT2A 1JR3D 3ZDQA 1LW7A 1W0JD 2OO7A 3QE0A 1Z5ZA 1M34E 1FP6A 1ZRHA 3P4YA 3W3AA 4YMUA 4DIDA 3CM0A 5FFMA 2WICA 3VFDA 2QEQA 1ZYUA 1VIAA 2WZQA 4ARZA 4F92B 4OJKA 1V5WA 4HDOB 4Q7LA 2GCOA 1QRAA 3EG5A 3CPJB 4Q1FA 3CRVA 3WYAA 3BJIC 4LBWA 1YZKA 3K1JA 2GXUA 2NZJA 5TXGA 2HLDA 3VKWA 4ABYA 5FPHA 2W6JA 2CVFA 1CP2A 3AF4A 4GOKA 2CL0X 1UKVY 5A5GA 5DISB 3EIQA 4MKIA 4DUGD 1W1WA 5F9FA 1CXZA 1WCV1 2OILA 3GLGA 4JSTA 5SZIA 1HTWA 1JI0A 3VHLB 1MO3A 3GFOA 1DG1G 1JEEA 2YWHA 3ASZA 2GA8A 3AKYA 1NJGA 4JMPA 4XJXA 5FPSA 3QF4B 4LYHA 4O0MA 3AP2A 2EFHB 4B2LA 1LY1A 1KDPA 3AVXA 2R44A 1XCGB 2JLYA 2ZRGA 4AYWA 4E03A 1S9DA 2OFXA 4PR0A 5FUVA 1DE0A 4RFSB 2O0HA 3QXXA 1EK0A 2BMJA 4JL6A 4A0GA 5EXPA 5IHPA 2HF9A 4PC6A 4A6PA 4C2TA 5DLQC 1Q21A 4Q47A 3V00A 3KXKA 2OBMA 3NBXX 2R8RA 2XZPA 1ZU4A 3U3KA 4E22A 4LSGA 4PX9A 5JS7A 2DHRA 2QENA 3SYKA 4JL5A 1Z83A 2Z43A 4LJ5A 5FL7A 5EUMA 1LNZA 2FGJA 5FTMA 1ZM7A 4KU4A 2QI9C 2GZAA 3K9NA 4NYIR 3CO5A 2ZE8A 4W5HA 1A7JA 3R7WB 4DLYA 3FFBA 4DSOA 1P72A 2N42A 4NKRA 2TMKA 2HT1A 4O25A 3DM5A 4I4LA 3PVSA 4HB4A 5AJXA 2QSYA 4R7ZA 4BZXA 1QDEA 3E70C 3UKDA 5BN3A 4G5SA 1G7RA 3TH5A 2X1VA 4QHTA 1W2HA 1PJRA 2IWRA 3B78A 2RAPA 1E0KA 2XEXA 3EA5A 5C4GB 4KLNA 1S8FA 3VNUA 5EJEA 3GLIB 3PUZA 2ZUBA 3GLIE 2C9YA 3Q3JB 2HT6A 2XZOA 1I2MA 4PTLA 3QF4A 4IOMA 3GQBA 2SHKA 3MLEA 3FKQA 3UXMA 3KDSE 5JEDA 1VCNA 5HCNA 2GILA 2VEDA 2VTKA 2QRNA 2ZI9A 2NTYC 3QI2A 1KI2A 1S2MA 4Z1MA 3IBYA 3VX3A 4RFSA 3QUSA 4EPXA 3SHWA 2CBZA 4A6XA 5L3VA 5EP4A 1FTNA 1IJFA 4AKIA 3ICEA 3G0HA 2E1RA 2A7QA 2VP2A 2HJVA 1RJ9B 3AUXA 4WW0A 3PEYA 5JRJA 1MOZA 3CF0A 4XD7A 1OKKA 1G20E 2WBLC 3P32A 4Q9LA 3X1ZA 2B92A 4GFDA 1CF4A 3FVQA 4DCSA 1YVDA 4QGHA 1CJKC 3R7WA 3QSYA 1X8KA 1G5PA 2NO0A 1XJ0A 2CHQA 1L7VC 1Z6GA 3ZD6A 4R98A 4BEJA 1W36B 1JXMA 4NHOA 4PZYA 1B23P 1KNQA 3QXJA 1NMZA 1L8QA
chains in the Genus database with same CATH superfamily
2HNBA 1BCSB 1EVYA 1P4HA 4RK0A 3C3YA 4CMCA 2ZQ5A 5AK0A 1TAQA 3TAHA 3WOHA 2GETA 3GVIA 4G5GA 1RWQA 5IT5A 1EFPB 2ENUA 4PAQA 1BH2A 4PZUA 5CU7A 3R9IA 3TRIA 1T5OA 2IX9A 2ZVPX 3I6ZA 3WGVA 2YJZA 1JIQA 2CFRA 4WOPA 5JVDF 2A9QA 2C2YA 1RWKA 3C0KA 3KR1A 2XIJA 3I37X 4IKEA 2GBGA 3U3RA 3PC8A 1PR4A 2Q6IA 1SN7A 3JQ8A 4K9MA 1IJBA 4RKQA 3UV3A 4HYEA 4RZIA 4JVMA 2H1WA 1L9XA 1PR3A 3RTCA 1SCIA 1PT5A 1T5BA 3ZDRA 1LI7A 3NGLA 3S7ZA 1JLKA 4B3XA 3FOEC 2EFEB 1GSAA 4H4DA 4RK1A 5EZQA 5ADHA 1TIKA 2NVUA 2E6KA 5AD1A 4XOIA 5CLHA 2ZUTA 1QHEA 2W6ZA 3OBIA 3QJGA 4RU1A 3CKLA 4R69A 4IW3B 3A4TA 4K87A 4ZTUB 2MSCB 5EI5A 3EMKA 5JYDA 3IKTA 3EYAA 3ZHXA 2X5OA 3OD1A 3VH1A 3O1HB 1X7WA 2O3TA 2GN0A 2K7ZA 2EW8A 2JFNA 3EAFA 3JR3A 1SQ0A 1ORDA 4O2LA 3W06A 4ERXA 3CLUC 4DLNA 3NWJA 4QLOA 3ADOA 1NI5A 2C9CA 2J7KA 1FFWA 2GSDA 3OPMA 5JTUA 3B36A 4FFWA 2TMYA 2JDIA 3IEMA 4I46A 3KQMA 2IZZA 3V2HA 2BELA 2V6BA 1QKJA 3AESB 5K2OA 3WNVA 1ODJA 5GINE 3ETGA 1V1MA 4KGXA 4EDHA 2QQ0A 3L0SA 3Q7QA 1DXHA 3X2EA 1NJ8A 2OHIA 4JFAA 1AQLA 2YVAA 4NV1A 2AZ4A 4FMCB 2R6JA 4KVZA 4ZKDA 4DV1B 4O2BB 2G0NA 421PA 4DRYA 4JQSA 3MHTA 1WWKA 3S99A 5KTPA 2D06A 1WDLA 2ECOA 4TTIA 2ZS7A 3M83A 1RTKA 1C1XB 1MPXA 3MXTA 5JWHA 3VR6A 4E33A 4K1XA 1KETA 3D6FA 1Q6YA 2RAFA 3PVZA 2RB4A 4Z9XA 1X86B 1H8ED 1KJWA 1SXJD 2G1AA 1C30B 1WMBA 2RD2A 3WAJA 1JI3A 2WKRA 4XB2A 1T8YA 2B1QA 2QTZA 5F3WB 1NN1A 2OK7A 1GGFA 2DR0A 4AKTA 4AKEA 1QTIA 2YYAA 2DUMA 1PV1A 2NV0A 2RK6A 4P22A 4Y98A 1QLHA 3HVUA 4HGNA 2Y6VA 2EBFX 3SY8A 2ADMA 1DC3A 3K9LA 1YGYA 3FTNA 3KVNA 5BMOA 1DS6A 2NX2A 4LF6B 2PRYA 4B3CA 1T25A 4P3OA 4QPNA 1CUWA 5DIZA 5J4HA 1L4UA 1BXKA 3SSAA 3ZGZA 4DV7B 3IQIX 3IE2A 2PQ2A 5HZGA 3UMVA 1RAEA 4OMDA 2PYDA 4GZMA 4J0CA 4NCHA 2CUZA 3GNSA 5KAPA 3GEEA 2RE8A 1UZMA 3QEKA 5EIHA 2HR1A 5CIQA 3IUQA 3V6MA 3UJ6A 3JQGA 1NONA 4R68A 3EDOA 3LBNA 5JNWA 4DV5B 1M3SA 3E8MA 1S2DA 2B4AA 3WQBA 2CNWA 2VVTA 1CS0B 1Y37A 4HX9A 4C5CA 4CU2A 2OPBA 3DQPA 1MJGA 3NVAA 1Y7TA 5HGXA 1U1GA 1X1DA 4I55A 4BO3A 4WV3A 4DC0A 2ANCA 1TKBA 2V6GA 1MRZA 3CBQA 3HO8A 2J3HA 1XZIA 3L7OA 3MWLA 1F2TA 3T4PA 2Q5HA 4YR7A 4DDHA 1B74A 2VYQA 3LV8A 1NAIA 1ZMOA 4LV6A 5IU6A 2IYXA 3RFXA 5K8VA 3BHNA 1DO8A 4CKBB 1GQYA 1KJQA 3CH5A 4WXHA 1QYWA 3GFPA 4DA0A 5AOVA 4CIWA 3MT7A 5EWLB 2WI8A 3TQCA 3PXDA 3PQ2A 3B38A 3L1UA 2PRZA 3I04M 1VMAA 2ATXA 4IVPA 1JFFB 5DYWA 1FTWA 4F38A 3ESZA 1ODSA 3OO0A 5C9ZA 1GTG1 1YH3A 2F90A 4RMIA 4YQZA 5DM4A 3THYB 5K3EA 1M6EX 3QG1A 3HU2A 3QKIA 3SAJA 4C0JA 3DFZA 4RHXA 2DQZA 5E6SA 3R5FA 5KOJA 5CGZA 4L15A 3U0VA 3M3PA 3UAXA 1YDWA 2CUKA 2RMKA 4M6WA 4EY8A 1URPA 4PVDA 2ZRCA 4D5EA 2G04A 3GCGA 2QX4A 2V98A 2B9VA 4CL0A 4N6GA 4OGFA 4R6XA 4EKIA 1DTEA 1KZYC 1ACLA 2BCJQ 4ZDJA 3ANNA 3CNLA 3U7IA 4J03A 3TGWA 5LM3A 3CU5A 4IIHA 3L8MA 4LMAA 3HXOA 2VS1A 4DPMA 2LTAA 4NCIA 4EB8A 2FSGA 2BT4A 2ODAA 1U2EA 2VK4A 1L7DA 3BSFA 4DMUB 1W96A 3KTDA 1XCPA 1SVUA 3GN1A 4Q9HA 4JT4A 2QG6A 1YU9A 2PYIA 4IDNA 1H2YA 1DDIA 3MWKA 4UMDA 3K0AA 3IOEA 4US1R 3HY4A 1CUYA 5K0CA 2GERA 3IPRA 1W0JA 2V55B 2W43A 3USES 1C9NA 4DW8A 5LP6B 3BT7A 3HFGA 4TXMA 2AOUA 5BUCA 3OCJA 3ZN2A 3W8DA 3IB6A 4GRDA 1XDDA 2VJMB 3FOWA 1TCUA 4EMSA 4FYPA 1RADA 2AR9A 4QPZA 5AW6A 2D7JA 4BBPA 4N5MA 2VHXA 2UVDA 4O63O 1PTKA 1M2HA 2BM1A 1ILEA 4XVUA 1QVAA 2AQIA 2APJA 2QQ5A 1XRLA 4O4IF 5LU8A 1KDYA 2EF0A 3VR3A 2GXQA 4WHMA 2QU7A 2EG9A 3DULA 3PC2A 1H5UA 1LLCA 4LBZA 1K8RA 4R81A 1IXYA 4D98A 3NHMA 2HA5A 5CXUA 3U56A 1HE5A 3BOSA 1FLVA 4L28A 3IFSA 3A2NA 4TWJA 4PU0A 5T4BA 5BXQC 1JHPA 3PKZA 2ILTA 4M0MA 1TU4A 2QIOA 3MJRA 3FZQA 4AJ4A 5CITA 3DEHA 3FI9A 3Q7RA 4GQIA 2I7DA 5KQRA 1K6JA 5GONF 4F3CA 3NRBA 4WXYB 4ZEMA 1NBWB 3AETB 5G0TA 3HJGA 3JWPA 3L4KA 1KSHA 4TMVA 1VBMA 2R5WA 2AJTA 1SBNE 1KTIA 3HMQA 1AHIA 3PRKE 4AT1A 5HEKA 1WXIA 4KWCA 1AO3A 1FTSA 3A3OA 3B9RA 3DFUA 1HDGO 1SR8A 4H60A 5JASA 3AZOA 4AQDA 1A9XA 3ER6A 4WFKA 2RK4A 4RMGA 3C3BA 2CV2A 3S7TA 4MB6A 3TOCA 2HWWA 3O92A 5FO1A 2PQ6A 4EHHA 1L5YA 1ZIYA 2IC5A 2YMLA 3WKBA 1PRYA 1X7XB 2Q2VA 1FFXA 3MA0A 3RYTC 621PA 4D26A 2FWBA 3GW8A 4J3JA 3X43A 5KWVA 2QY6A 2BCGY 4BQSA 3FPHA 1BEUB 1GVHA 2Z5FA 1BROA 3VSCA 4BNMA 2AMFA 4MNTA 2QMUA 4CEJB 1RZ3A 4MI6A 5KCZA 1AKRA 1U2DC 4Z1MD 3UHFA 4WDRA 1N2CB 3EOBI 4Q4JB 1VLZA 4LRSB 4UD2A 5CD9A 4Z5XA 1LV8A 1WCIA 4CKXA 2XNDD 2XUKA 1L5SA 2GWHA 4DBLC 1U2TA 5AI9A 3N8DA 1RW4A 1TPZA 4K2HA 3GUHA 4XVQA 1E2EA 1WDWB 2C77A 4IKOA 4MA5A 4BFXA 4RCYA 3A9RA 4RNDB 4O5AA 4TX1A 4NQZA 1HYHA 1Z88A 3DL4A 4Q3DA 1OYOA 2NXEA 3RM3A 1U2DA 3LJKA 1OI4A 1M67A 4RELA 3NKFA 3W5SA 1GFZA 2YHAA 4ZIRB 3EUFA 1QE3A 3RB8A 3I5MA 3NG1A 3WK6A 1GJRA 1QKKA 2HA3A 2JH9A 5LQUA 1L2TA 1Y6RA 2PWAA 1LVUA 1ETHA 1Q14A 2DUNA 4I5EA 2XCLA 4I1VA 3W9UA 5JXWA 4P4LA 1ULUA 3P9RA 4PPFA 4TZTA 4B73A 2X4GA 3TBFA 3FXAA 2GJKA 5T7BA 2QPLA 2YZKA 4BLPA 2EX1A 2IUFA 1FDWA 1W8IA 1X94A 5T4FA 1N3IA 1P4RA 2G67A 4HH1A 1UBKS 2BKUA 4FMBB 3V9AA 4LHSA 2Q3CA 2ZQZA 3QY9A 1A9YA 1T0BA 3ORQA 4CMKA 2WU3A 1BTOA 1CKEA 2I67A 2QTFA 4EJFA 3PDJA 4DV2B 2OHJA 3J7TA 4TV8B 4NBNA 4XD2A 5AESA 3AVTA 2VNHA 1UXIA 3KM0A 4KPGA 3T1YB 1MAVA 2IOFK 2NN3C 4HFRA 4JELA 1YFZA 1XTPA 4JIMA 4L72A 1TVKB 4MV6A 3ZJ4A 4EUNA 3JWIA 1WJGA 4Q4AB 1QK3A 1TM3E 2Q3DA 2IKQA 4NX2A 3JQBC 3EASA 4PWZA 1RM3A 2EFCB 2HJGA 4TWBA 4CM9D 1T6XA 2RG1A 3WS7A 5TT1A 2LBPA 3GZTB 1H94A 2Y0EA 3KVYA 4MS1B 1D0IA 1FLAA 4OHKA 3RBAA 4DIKA 3QU2A 4Y67A 3GEDA 3A7EA 2BP7B 1NJ1A 2AVNA 2ZJOA 1PFUA 2F3QA 4G63A 3FMPB 4Z4CA 2PKRA 1T2AA 4KVGA 1ZL2A 2P1RA 3TIVA 3STTA 4ENRA 2H0QA 1HYQA 2AG6A 4H0NA 4IRUB 1IM5A 4E14A 3JQPA 3O7MA 5CVCA 2FE4A 1NM5C 1SWVA 3IAHA 5KB3A 3HCFA 5CNIA 2I2AA 2XUOA 5IZ4A 2P9YA 5CB4A 4M9CA 1Z5GA 1Z0IA 4POAA 5FNVA 3B7PA 3KQYA 4WCVA 5FTJA 1ZNWA 3WKAA 1M2GA 5IG2A 2J0UA 4EFKA 3A1CA 3U3JA 1JIXA 5JZMA 4BN4A 4QJIA 1IXRC 1T2UA 4P7GA 3VR6D 1FNMA 3NC1C 3NWPA 1QUEA 4R8SA 4Z9BA 2BGLA 3SYRA 5M29A 1AMOA 1JR4A 4F6LA 3MCTA 4KQ1A 2FEWB 4A2PA 4LV5B 4MDYA 3TGLA 4XPZA 1MFPA 3MG9A 4Z1OA 3L49A 4C0XA 1IHXA 5ARCA 2F3TA 5LNK6 4HSEA 5CVUA 2JNWA 2OZVA 2XNJA 1ZESA 5GJWC 4EJSC 3NU1A 3AUTA 2FK8A 1UBFA 2WDPA 2HFJA 3L06A 3T9EA 5ADVA 3HBMA 3FUVA 4CEIA 3DW1X 3VZRA 1OA1A 1OHHA 2QVYX 3UK6A 3QU9A 3IDFA 1V8DA 3VPXA 4GVLA 2O07A 4B87A 4YRLA 1O7JA 1H3FA 2VJOA 2P1DA 2C0QA 1W5AA 1XB2A 4DF3A 3OE7D 5K5EA 3HXMA 1UMBB 1LSOA 3H2ZA 3IDQA 4G0MA 5G4KB 3ZKAA 3BWDD 4ZVQA 2JLWA 1QHHB 1WLSA 2G0AA 3PF9A 4DE5A 2DCMA 2IYUA 4H6XA 1IJKA 1M6NA 5EIFA 4CM8B 1F2UA 1RHRA 1J07A 2XYRA 4JKIA 3TLBA 1W5FA 1DC7A 4W7HA 4HLQB 4AK9A 1P9OA 2O8DB 1BA3A 3F78A 1R74A 4U2FA 1PSDA 2WJIA 4H7KA 2FSSA 4V02A 1CD5A 4WXPA 3QFRA 4JLDA 4EYSA 1AU9A 2ERYA 3HXKA 4FMCF 4YWHA 2ZUCA 2HA4A 1QYRA 1K6EA 2WMOB 1MHTA 2PWYA 4RACA 4GMDA 3DONA 5AJVB 1L4HA 3DE6X 2HWXA 2MMGA 4L6CA 3E9EA 2AW5A 3AEKB 2IYTA 4MMXB 2C9MA 2W2NA 4ND5A 3HWX1 3CHYA 2ZJ2A 5EQTA 1SHZA 2H1HA 1CSEE 2XQKA 3ENVA 3C3EA 5IM5A 2H63A 1M1UA 4FGZA 5EWMB 3T1VA 1MU0A 2X23A 1JTFA 3DKVA 1H5QA 1X19A 1I1OA 2WJAA 4P81A 3CLSC 3HEBA 4QJ3A 1HFJA 4XGRA 3RVLA 3EN0A 1P2BA 3O84A 5HG0A 2OZPA 4GM0A 3KYDA 4Z86A 1EI9A 1NIPA 1AUOA 4X1IB 4DLPA 1ZMXA 2YJ3A 4KK4A 4UCQA 1RRMA 2NZ8A 1TNDA 3FPSA 1ZK4A 3D5QA 1KORA 2OCAA 3V1NA 3CY6A 5G0SA 3H1GA 4M1QA 5GGXA 3T3HA 3ZX4A 4AJ9A 3GRYA 4BKPA 3SQNA 2E48A 4L3WA 3MINA 2AZTA 1Y89A 3LUJA 3TXAA 5H3LA 3DJFA 1UPXA 2FUEA 1JIVA 2HU7A 5G3ZA 5E6UA 4AZTA 5LZ7A 4B3DA 3EPLA 2XKJE 2IODA 4AW9A 3QUAA 1NXXA 2AQKA 1Y7PA 4RTNA 4AS1A 1FJ2A 4CDGA 4YRZA 4Z4EA 5JANA 3HCBA 4IDAA 1LZLA 1CIPA 2FWAA 2K6GA 4YIKA 4ARAA 4EIWA 1I8TA 4OB7A 2AFIA 3IHWA 4GVXA 3M6MD 5EXSA 1KSFX 2OQVA 3M6UA 3AR7A 2Y4OA 4KPFC 4BNUA 1XDUA 3FJYA 1V3VA 2C9BA 4NCKA 5MF6A 4GZ6A 3R75A 3V97A 4PG6A 3WLJA 4B09A 1ZW1A 1HWYA 1NT2A 3V7YA 1QC5B 2X9LA 4NBRA 1RPAA 5CA1F 1IBLB 1N25A 5EVCA 1U8EA 5KSYA 1BGVA 1PZEA 1TQDA 2Q6VA 3GD5A 3TB6A 5IJWA 3BWMA 4ID3A 1CW2B 1W52X 1CS4C 5JQGF 3FOFC 1OBHA 3D2CA 2VBGA 1BCRA 4H7FA 2ZBFA 3R09A 3P97A 4BVLA 3VR5H 1E92A 4JU8A 3VR3D 1OAKA 1U04A 4Q48A 3WQRA 1N5IA 2Z3ZA 3KEFA 1RVV1 3B5IA 1ZNXA 3F98A 5KVAA 3U44B 4JI8B 2UVPB 2LV8A 2K4MA 2P6NA 2PUWA 1ESZA 2EKPA 2V0CA 3IVCA 4MDHA 3FDJA 3VI4B 1FW8A 1VLLA 1XEFA 4QDOA 5IVHA 4XLTA 2HHCA 2Y3IA 5ICMA 4ALKA 2UZ1B 4YJ3B 2QMOA 1PP4A 4URHA 2WK1A 3JRWA 1ZVJA 2ZJ8A 3OP4A 1NZJA 4P4SB 3TEFA 4C76A 4OJMX 2RGEA 3CRW1 4GX5A 5ALXA 1CY7A 2NAPA 5IT9A 4AS2A 3KPUA 1L4BA 4QO8A 1OFUA 1G8HA 2AFRA 4X1IA 2FG5A 3B3QA 4EO7A 2FZKA 2G70A 2VOEA 3G13A 3OWHA 3OA0A 5CBPA 1DJLA 3Q2OA 2YJNA 1BO6A 4ZOBA 1DLJA 3TQQA 1E89A 2FRDC 3WB2A 5BXYA 1N2EA 2ANBA 4PSCA 3TR6A 3VDRA 1C8KA 3O3NB 1QB7A 3I28A 5HJEA 2B8JA 1YGPA 4AF6A 4CNBA 3P5SA 5EEHA 1VPDA 2MJLA 1V37A 2ZTLA 4XAQA 4J0IA 4YJFA 4FR2A 4F91B 4JP5A 1WDKA 5EXTA 4MGYR 2G28A 2QRQA 5BVHA 5BQ3A 1K7CA 2VK2A 2YWCA 1JDTA 4ZQIA 2A5FA 2FRDA 1ORHA 1ZUHA 3H87A 4TWIA 1KFJB 4K9KA 4GLLA 1NDQA 1D9ZA 3O2QB 4D6YA 2EC5A 1C4OA 3EUWA 3K4QA 5DX1A 4M0EA 5G4LA 1ORWA 3IIMA 4GE3A 4B71A 4IEEA 3KTAA 4YCAA 2B98A 3WLLA 2OWEA 3GJ3A 3SKYA 2R79A 5BUQA 1GU7A 1RBQA 1VC2A 4IDGA 4EHAA 2BGGA 2KLBA 3M4YA 4ZXFA 4YT4A 3E7DA 1JLHA 3IKJA 3NIWA 2YNMC 2BFFB 4JJ8A 3BTVA 2O3RA 5EIXA 6Q21A 4Q3CA 4R54A 1VKZA 2FY8A 4Z0TA 4Z0HO 4U9HS 4KBFA 3SHOA 4DCGA 4F72A 1S4MA 1X6VA 4HNSA 3GRVA 2PE5A 1JQ3A 3OX1A 2BW0A 2V8BA 2XMPA 5ENDA 1KBQA 2EWVA 1BWQA 1Q91A 3I53A 4JLJA 4AJLA 2REOA 3RC1A 1VB5A 2DTEA 2HI0A 4YPOA 2YNMA 4C1BA 5IK2D 1CE8A 1G1MA 1NYRA 4YAJA 4UMFA 5T8KA 4BFSA 1G9SA 2CHEA 3BK7A 3OLQA 4PIMA 3TZBA 3V1YA 1NLYA 4W7SA 4BB0A 3EIFA 1KDTA 2GD2A 5DNWA 4A36A 3W6PA 1IIRA 1CLEA 1M1ZA 2IZ1A 3A6DA 3B1VA 3FTCA 3LDHA 3MGGA 4M76B 2VPZA 4P84A 4WXEA 1AQJA 4H7PA 4MJ3A 2EZ4A 1UANA 1RWPA 2F1JA 4DYVA 1M5RA 2XCSB 4HNHA 2A0WA 4OTZA 2FPSA 2HH9A 2HPVA 3PNKA 5JCPA 3M8KA 3UWSA 1DEOA 2Z4TA 3PR1A 4F5WA 1Z15A 1CZNA 1SKYB 3MJVA 1N5OX 3C8DA 2W22A 4I1YA 3S55A 1VPWA 4M83A 3P5BA 4V1CB 1EG7A 3EBLA 3KZ1E 1VDZA 1CVIA 2J9FB 2PANA 1Q0UA 3A14A 4C0LA 4UZFA 2NT3A 1AQNA 4G37A 2BEKA 2HBZA 3PUVA 1IHUA 3LPCA 3N5CA 4XM1A 2EZ8A 2PEYA 3JPYA 3SG0A 3OMLA 1NZFA 2B36A 3RVRA 3VO9A 1HURA 3NCTA 2GNAA 4ZJPA 3WK8A 2EFDB 1A50B 3EIHA 4OV6B 4HPXB 3V8VA 4TWRA 1W2GA 3QJYA 3WDMA 1DWOA 4RPGA 1B0ZA 3SJBA 2QGZA 3ZUGA 4L22A 1GN9A 1E3QA 4GZ5A 4BXOB 4PZDA 1TL7C 1HPLA 4RVHA 3RGWS 3BZWA 4ZV4A 1RQXA 4MQ6A 2KYRA 5BUZA 1T6NA 4YJ2F 3FLBA 1B3RA 1GPBA 1NQUA 2MYNA 3RTGA 2O8BB 2HWUA 5E7JA 3LDAA 1OV4A 1FK8A 1N1DA 3KJGA 3B7WA 2C1ZA 2O0LA 1BGWA 3AIMA 3DKIA 3R1IA 3STXA 3HN2A 4QDKA 4OJQA 2NV2B 3OWOA 2SKDA 4U2KA 2IIPA 2FEPA 2O3SA 3ZE7A 5LXTA 1NC1A 2C4KA 2HPAA 2AE2A 1R0BA 2O4UX 1N2GA 2NVWA 3EVTA 3GUZA 3OZVA 4RFLA 3PQ7A 1V3UA 5M34A 1T36A 1ND6A 3OLYA 1GRQA 1A27A 3KVRA 2D2FA 1BE8A 5BWNA 4KI7A 4TKZA 1OASA 4OH1A 3DV0A 3ISVA 1UC8A 5TEWA 1RWVA 3L0PA 4QU9A 1FYEA 4YRKA 4I1UA 5CT5A 3R7AA 2I6FA 5FR2A 4MV4A 3HBLA 1F17A 3JQQA 2O1SA 4ECEA 4ZMSA 1JU4A 5KC9A 5H4GA 1W0CA 2XHEA 5IAOA 1XFDA 3I34X 5JYEA 3AL2A 4YHBA 3IEUA 4IDFA 4EA8A 3CVUA 2AJDA 1JZQA 1ISGA 4ER0A 2JD2A 2WIBA 4TVSA 1XIVA 2PZ8A 4ZA2A 4AZ3B 4PIVA 4MVJD 3N2GA 4XUGB 1QFSA 1RZRD 3OUUA 4BAUA 3PR3A 5BSUA 4ZK6A 3LY8A 4HWGA 3V7FA 2JJYA 3N0RA 2WF9A 4YX9A 1WUJS 3SYTA 5J2UB 4UUMA 4IGAA 3ILHA 1BVRA 2ZBDA 3K7EA 3WHIA 1EE1A 1I7QB 4MI1A 1OFTA 1F14A 1KO7A 2ZUSA 3JS5A 3H11A 4G5FA 1UM9A 4LJYA 4LF4B 3A06A 1XZCA 3CEMA 3ZGLA 1KAHA 1CUZA 2PZKA 5DXJA 4OYLA 2VYNA 4FS8A 4WBNB 2OYCA 1BDMA 2V74B 3ME5A 3VO8A 4P1ZA 3X1MA 4LX8A 3DM9B 1PEDA 2VDQB 3LOQA 4F12A 5DLPA 1L1FA 2XT9A 1Z4MA 2RHCA 3D8RA 2HIAA 2ST1A 4YA6A 2MT9A 3BCSA 4HQOA 4D6PA 1AUQA 4RZ2A 3GDWA 3NUQA 4WZAB 2QM0A 3C7KA 1X2EA 5C8YF 1E7WA 1KEZA 3NH6A 3CBGA 3F49S 5TQJA 2IX3A 4ZVNA 3B3AA 4IWNA 3WMGA 2UUCB 1OLOA 1L6RA 3OZBA 3HRKA 1DFIA 1SOVA 2JEYA 3H16A 5C8VA 3N07A 4JLUA 4XM2A 3TL6A 2D1SA 5K0FA 3V6LA 2QAGA 4JA2A 3OUZA 2ZW9A 4UM5A 4NNJA 1AN9A 1QGZA 4KXFB 2ERXA 1S7CA 1D1QA 3IKMB 1T29A 4MVCA 4Q3BA 2W37A 4YUZA 2LP4Y 3GRKA 2GK3A 2IEGA 4PRYA 4B0OA 4G81A 1YS6A 1DKPA 1I0ZA 1YWGO 4HH0A 4GXRA 3EUAA 2ZDQA 2ZR0A 1VJRA 3INTA 5KOIA 3ZDYB 4F96A 4DSAA 1V11A 2WJJA 2A2ZA 3B5EA 4Y1FA 3A4LA 4XFKA 4OHBA 2H5IA 2DU8A 1IHYA 2YZGA 3WISA 4ACBA 3EZLA 4EOGA 2G0TA 4CG2A 4HLUC 2YZ2A 2ACWA 5KHLB 5FLKA 1ZCZA 3JARA 4CQMA 4KO3S 4U63A 2PX6A 3GAFA 3JZAA 5LLSA 5C46F 2FW6A 1GG2A 2IYOA 1E1MA 2MSEB 1G9TA 4FZRA 2M6RA 1T5LA 4PPYA 1DB3A 2OGUA 5LBTA 2DOKA 2WHRA 4UXJA 1C0LA 5A9TA 1AK9A 4FBLA 3IRUA 1ZSVA 1D2HA 3P9XA 1RYZA 3FYDA 4HKTA 4PQRA 3U37A 4DQUA 3H5IA 3VGJA 2A5YB 2RK3A 3SLKA 5A4MS 4PFKA 3PE3A 5LYJB 2BMWA 3FNHA 1VHTA 2ECPA 1HI9A 2NZWA 5ED0A 1J24A 1KYIA 4C3OB 3KE9A 1RRVA 1ADYA 3MWEA 2IY8A 1EYZA 1NXSA 2EBWA 2ECQA 2P75A 1E77A 1SBTA 2JASA 3CF2A 1P5HA 3FVRA 1PD0A 2E5WA 4NSNA 3NBYC 4OQZA 4I0WB 5BP7A 2BUAA 3MB8A 3ONDA 1TK2A 2C7RA 4HN2A 3AM4A 5COAA 5EN4A 2I5PO 3G8YA 3RS2A 1E2HA 2GEVA 2V9ZA 3TWOA 3TI7A 3EVDA 2AFVA 1L7QA 2JIMA 2R85A 2Q9AA 2Q0QA 1XZQA 3EXG2 1GSOA 2QPOA 3HJBA 3LCRA 5FF9A 5ICFA 4PICA 5L6MB 2OCBA 4EFMA 3JAWB 4KOAA 4DM7A 4OFBA 4OHOA 1NXOA 3NTUA 1S89A 3GEMA 4D0GA 3RWOA 3TRHA 2ZETA 2BWJA 1UODA 5B12A 4XB1A 2OM6A 2GRJA 1J0CA 1Y9JA 3VDQA 4FXPA 4TXLA 2C03A 4DNFA 2FPOA 3D3WA 1W4BA 2GCEA 4BWYA 2X4LA 3PQ8A 2VKTA 3EBPA 2ZSDA 3VX4A 1JVBA 1JKFA 4IPTA 2QTLA 3WY9A 4BLSA 3UK2A 4B79A 3W2FA 3OIUA 4P82A 4J76A 3PGJA 2G5CA 5EFOA 4Y0VA 1UAGA 3H1AA 3KYIB 1J6UA 3ZV5A 4MVWA 4BV3A 1D4OA 1RLIA 3LT4A 2CLLB 1P81A 3UG7A 2AXPA 5CT6A 3A04A 3V3TA 1EA7A 4FDTA 2NSLA 4Y1GA 2D0DA 3I09A 5KNDA 3RS9A 3TFWA 4TS1A 2PH7A 2ZRMA 3PCXA 4YBRA 3T7DA 4ZI7B 2Z2ZA 2B1RA 3ET5A 2JK0A 2C31A 4JKOA 2OFOA 2YWXA 5K03A 1QIJA 5E8RA 3BFKA 2HA2A 2QVBA 1R6XA 2FSPA 3WDSA 2X8AA 1DU4A 3AV0B 4K8RB 3OJWA 3T3EA 4II7A 2D5IA 2W2MA 2Q1XA 3BL6A 1LJLA 1SC3A 5C7LO 1E9EA 1M2WA 1G21E 2FEAA 3BXXA 2MU1A 4ROSA 1ZD9A 1C0KA 2GAJA 3BHJA 1BMQA 4WN9B 5LZ5A 1O58A 1N1GA 1J21A 3EODA 2QP4A 4QUGA 1JBEA 2UZ3A 1XXHE 4FFNA 3KOMA 5BQXA 5IYZA 5AHOA 4YTEA 1QV9A 3ZWYA 5LZ9A 2DFLA 4BN0A 3AL0C 3VHRA 4B3SB 1U1FA 3M3DA 4I7EA 3OFNA 1SNYA 1IUPA 4LHWA 5JZSA 2Q4BA 4QM7A 1PK8A 3JALA 4RQAA 3NVKI 2H51A 4HAYA 1BS1A 2H85A 1TJ5A 1VGRA 3BMNB 3AFMA 1VKJA 2R7MA 2WIAA 3QU5A 1XTQA 4HAWA 2VF8A 4TQUS 5AHRA 5DBIA 5A4AA 1BX1A 5A5FA 2I4MA 5K0SA 2OVBA 2QUAA 3AO0B 4NLLA 1R15A 1MA0A 4JZYA 2BFBB 4ZYZA 2GZ2A 3DZKA 3HCDA 1GR0A 2WQ7A 5HF9A 2D00A 2W6IA 5TQ0B 1RAAA 4JEHA 3GFVA 3LECA 3THXA 3K0KA 3O8LA 1US8B 5B6JA 5CRIA 3IPXA 4IIJB 2XYPA 2QN2A 3LW8A 4PWYA 1IZ7A 5BWMA 2BI8A 3L07A 1H9BA 1UT6A 3IEIA 4HXFB 4J1QA 3ZC3A 4MEJA 4E31A 2Q46A 3HV0A 5KJCA 3DXFA 2DTDA 4J94A 2L42A 2PM8A 4FILA 3WRXA 5B4TA 1F8XA 2LKCA 3TIFA 4HYQA 2I2CA 3M33A 4RNCA 3BG5A 1PZMA 4GPIB 3KSRA 1G21A 1U6KA 4O4JB 5IUJC 1XZPA 1ZC3A 4PQEA 3V7WA 4Q1VA 5E0OA 5MFZA 4RD2A 3PUWA 4HNAA 4BE9A 4DMHA 1MOQA 1AHNA 3RIYA 4QAJA 1XXHA 1WG8A 4JLWA 4KG7A 1B0UA 2H5LA 3RHSA 4AFNA 3KWLA 1R4ZA 3I83A 2A1UB 1KL7A 3R3JA 2FQ1A 4Q7KA 2BTEA 5DTMA 1DX4A 1TX4B 2A78A 4NMXB 4UZEA 2NPFA 1Z2OX 3FCOA 3G2IA 3PHGA 4MQFA 4DZZA 3U61B 5FPQA 3FWKA 5LQDA 3SBEA 2YRXA 1Y1QA 3EY4A 3DEIA 1TO2E 2C0PA 4IUYA 5KEIA 3W78A 1UKCA 3U19A 1DBSA 5BN4B 3VZQA 1FF9A 4UFOA 3MRTA 4Q19A 4Y7CA 4FWTA 1KPIA 1WW8A 1DIOB 2Q5LA 3COVA 4Q7JB 5EZYB 1A5ZA 1I30A 4IIBA 3PXUA 1X1BA 1JN0A 3CNNA 1V3QE 3RKRA 4RTOA 2GXAA 4JVSB 4A8PA 1SMKA 3MFYA 5KHOC 4HF7A 1QQBA 5I8WA 5H5JA 5J1TB 3FWHA 1XNJA 2GJAA 4G0OA 2GKSA 2W4QA 3T9CA 3EPKA 2JAHA 4HO1X 2HQRA 2X9NA 4PSKA 3G02A 1BJRE 2FOLA 3MBOA 4R1SA 2P8SA 3DP7A 1P45A 1TGYA 3CONA 3DL2A 5E4JA 1UBCA 3UY4A 3P2MA 3RU2A 4QXQA 4WWHA 3WV4A 1RRKA 4M54A 4KLRA 2V3CC 3ZK9A 5GZ1A 5J43A 2NLOA 4UC0A 1KH3A 1U2SA 2HMYB 1WUTA 1QIMA 1DWPA 3IQZA 1XK7A 1AF7A 2VRWA 1E8MA 3A9CA 3CZMA 3N76A 3VR0A 3E0XA 4QIHA 4CMIB 5I7WA 4CV3A 5ADUS 1BNCA 4GO1A 2AH5A 4YRPA 3QP9A 1HNWB 2WFLA 2O5CA 2V4MA 1N1EA 2CJWA 4G0WA 2W2LD 1NAHA 1MDBA 1F6WA 2XRZA 3DOFA 3K0FA 1TW3A 1R5JA 4IINA 5HDQA 3TF5A 1Y1PA 3FBGA 1JHYA 1Z6PA 3OIGA 1DHTA 3ELYA 4YRFA 1SVMA 2IXDA 3I5AA 5L7WA 4ER3A 3QW2A 1NC3A 2G36A 3V48A 3UO8B 3GUCA 1Z5PA 3RVJA 1BJKA 2DFPA 2IQ5A 3NXKA 2LZ0A 3G7UA 4RA9B 4YDSA 1J39A 1AK2A 1DAPA 1JR2A 1XZLA 3BXZA 1IG3A 4DV4B 2C04A 5BT9A 3BK2A 5FWNA 1VG0B 3HA7A 4E5UA 4IGKA 5DRYA 4I5GA 1HDXA 2I4IA 4MS4B 3TRKA 4C07A 3Q3HA 1Q1AA 5IM4A 3T6KA 1U2ZA 2PUEA 2QTHA 3CKYA 2QHXA 4MV8A 1I2CA 3F7NA 4AY4A 4IH4A 3CVYA 1NKTA 1SBCA 2X2OA 2CN1A 5EOVA 1EGVB 1QJCA 2WUWE 3OEYA 4GMGA 5GM1A 3REOA 3U9SA 3VSDA 3OZWA 1IPEA 2FFRA 3FTPA 1P5ZB 3BTUA 3JV7A 5JZVA 4KWHA 4KXWA 2Z4RA 1PTJA 1H6CA 4QTYA 1T8PA 1E2NA 1Y5IA 3FSJX 4RQUA 1ZJ4A 1ZUD1 2OGWA 3GAZA 4ZHQF 5G3YA 3ZZMA 4B43A 4EO4A 4XIIA 3EEOA 2ZBQA 3L1JA 1JLLA 1YL5A 1UJ6A 1BE6A 3IPAA 4D99A 3P4UA 2EIHA 1OXXK 2QYHA 1J9EA 1RLOA 4TQ9A 2BEWA 1NRWA 2FF5A 3HXPA 1LI4A 1NN0A 2NXJA 4HTFB 4I1SA 4MEAA 4PYQA 2Y6UA 2PGAA 4D0LB 4CXMA 3ZJTA 4X1YB 5DNEA 3HNOA 3WVNA 1KEUA 4IXDA 3C8ZA 3KJFA 3BAFA 1ENZA 1KR2A 3DGFC 4Y2GA 5FFFA 2JI7A 3IHKA 2QT0A 2CE7A 1NI3A 4KFRA 5AI0A 3R20A 5GOZA 4DCNA 4BRSA 4RF4A 1W75A 1Y8RA 1N6LA 3CVVA 5BSMA 2W11A 3G5MA 4CMBA 3I6IA 3MUFA 5IC6A 1UFOA 4C7XA 4PFJA 5BV7A 1QX3A 5P21A 5A6VA 3FRIA 1TA0A 1J42A 4WLFA 1FLNA 1NVKA 4W5QA 4BNKA 4ZVSA 1FFGA 2LRHA 4CQMD 1WBBA 2NTEA 4NZYA 1UZLA 1VIMA 3T1TA 1WXWA 4FYKA 2XB9A 2CLSA 3KQSA 4MOWA 1RQPA 4INOA 1E20A 1GRNA 1OD6A 2O8VA 3F1KA 4LXGA 1LF0A 4JR1A 3W6UA 4AIIA 2DPGA 4WBNF 2BOVA 4LNHA 4E5DA 4XWKA 2IOYA 4AP5A 3OT1A 1AKUA 4BQRA 2YXBA 2FP3A 3BTOA 3MLBA 4IX9A 1P1RA 5LKRA 3OPYA 3WYEA 4DEXA 1C3LA 3RC9A 1K6XA 3D64A 1EHYA 5AM5A 5LL6P 3PIIA 3K4HA 2ZPUA 3DMNA 2F1KA 3NKLA 4NARA 3STYA 4AN1A 1RPZA 1DIHA 1GPLA 2VJNA 1U9CA 1WZCA 1XA3A 4LJRA 3GHYA 4QGAA 5GWXA 1NRJB 4PHHA 4YUWA 1JEAA 2XWPA 4Z51A 2DVMA 4OAOA 4HWKA 1Z6QA 5ADWA 1LSSA 4P0TA 5JSKA 4JV5B 1RKVA 2BBWA 1Q17A 2ESRA 2II6A 2YWRA 1NWHA 5IC5A 5A9SA 1RYEA 5EP2A 3OCYA 4MRNA 2COEA 3NNSA 5ILGA 1VGQA 3L01A 4KTTE 5CYGA 3IQXA 5EPOA 2ID4A 1EM6A 4UBKA 1ZQ1A 1EDEA 1NP3A 1W5SA 1WD7A 2JGNA 4XARA 4RKWA 1U4NA 5F2OA 3KPJA 1QVZA 2A9PA 3BH6A 3GROA 3VV2A 4A2CA 4TLMB 1M2OB 1AM4D 3IBGA 3QSGA 4LBYA 1ODCA 3DAGA 4WNCA 1Y5MA 2ZP1A 3BEOA 4F85A 2EDAA 3B6JA 3FTDA 2VJDA 1NJ2A 3AHGA 3FSRA 3BWXA 3EA4A 3U4IA 5EHGA 2WIGA 1DKUA 1M6VB 1W4RA 3GJ5A 4RPLA 5E2BA 5IVDA 4IYRA 4B45A 5FWAA 4X92A 4MQEB 3WLQA 2Q4EA 1XLWA 3GF4A<