2OFXA

Crystal structure of the apsk domain of human papss1 in complex with adpmg and paps
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
205
structure length
205
Chain Sequence
HMATNVTYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKTTVSMALEEYLVCHGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKLFADAGLVCITSFISPYTQDRNNARQIHEGASLPFFEVFVDAPLHVCEQRDVKGLYKKARAGEIKGFTGIDSEYEKPEAPELVLKTDSCDVNDCVQQVVELLQERDIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetas
publication title Elucidation of the Active Conformation of the APS-Kinase Domain of Human PAPS Synthetase 1.
pubmed doi rcsb
source organism Homo sapiens
total genus 78
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 2.7.1.25: Adenylyl-sulfate kinase.
pdb deposition date 2007-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01583 APS_kinase Adenylylsulphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ofxA00
3OEHD 4B2LA 4DIEA 3FDIA 2QEQA 1W47A 5H1YA 5JHHB 1DAGA 4Q9IA 2GK7A 2FU5C 2GBLA 3AH8A 3MSXA 4ZCIA 2IYUA 3FKSA 1G8HA 4FCWA 4BFYA 1K6MA 4GFDA 3IQWA 3EARA 3RHFA 3D6TB 3W6OA 5KSZA 3IBYA 1ZUIA 2EWWA 3W90A 2GZAA 1CLUA 1LFDB 2RH5A 5JZVA 2RHDA 4DUGA 1NVVR 2ZIAA 2ZU6A 4TTPA 5FFMA 2D2EA 5K8LA 4A15A 4DEXA 1E2IA 1VDZA 4OJQA 2PT5A 2J1LA 4NU0A 3EIQA 1NVUQ 1S1MA 3SE0A 4AKGA 3U4QA 3PEUA 1SQ5A 1Z2CA 1F5NA 3VKGA 4YMVA 3M1IA 5EP1A 4GNKA 4KYUA 3CWZA 4GOKA 1U8ZA 4RD1A 2ZTSA 3SOPA 3QNUA 2HF9A 1HEIA 1GIAA 5E95A 5BYKA 3EXAA 3FWYA 2Q3HA 4JLNA 2AK3A 1DBSA 4RCYA 2BKUA 1IN8A 2P0EA 4MRSA 1GSIA 2QG6A 3IO5A 4NZYA 3MCAA 5BW8A 4EFNA 1XTQA 4PPNA 5FL3A 4D0LB 4PSAA 4Q01A 1CKEA 3PUXA 5HE8A 2OBNA 3RVBA 3LFUA 1GWNA 2CHVA 2GJKA 2Q9AA 3ZIAD 2DFTA 2Z4SA 3KTAA 5CYOA 1NG1A 5BN4A 5TB5A 1T8TA 1E69A 4Q9LA 4MKGA 2OO7A 1VG0B 1IQPA 5FTNA 4QBHA 2B7CA 4B3DA 4YXWD 821PA 4G5OA 3SYLA 1ZMXA 4AK9A 3B82A 3TSOA 1ESNA 4LV6A 2O8CA 2PJZA 2XNDD 2VA8A 221PA 4X8HA 4ZKEA 4FMCB 1TQDA 4TLCA 1E0JA 1QHIA 5JRZA 2WTUA 3HYRA 4JL8A 3HPRA 1NMZA 3A1SA 3AF3A 1RPZA 2OFOA 4CEIA 3BB3A 4LUCA 4DCNA 5AWFC 4PC7A 3C41J 5EXTA 2QAGB 3LD9A 4Z1MA 1R0WA 4W9MC 2DPXA 1P3JA 3QE0A 3L0SA 3LQRA 4BZXA 1KI9A 2J87A 3EZ9A 5IRCD 1RIFA 2ERYA 5L3SB 1E1QA 1E9FA 3NHAA 1QHNA 3P4YA 1KDOA 4IOLA 1CJTC 4I99A 3IO3A 4B47A 4PHFA 2WWWA 4BFTA 1UAAA 4JYCA 3AVYA 2I3BA 2V54A 4URVR 1W36B 2EWVA 2R65A 4HB0A 4Z8XA 4Y0AA 2R8RA 3FHCB 4CDGA 2ZI3A 1Q21A 5D3MA 5H70A 1HQYE 3B6EA 3LQQA 4HEJA 4IVQA 4PTLA 1E2GA 1NBMD 2ZS7A 2BBTA 1T4GA 1JXMA 4B76A 1XEXB 4C0BA 2JLZA 1QVAA 3TKLA 1SXJA 4C4PA 2CEAA 3FPAA 4L8GA 5CLLA 3T12A 3T35A 3X1XA 1RJ9A 1E9RA 4KFSA 4YONB 3FFBA 1OHHA 1X8KA 3A4MA 4AWXA 1KDRA 5DYGA 3AKCA 3CZPA 3RDPA 3ZZUA 2XX3A 3DEFA 4PZZA 1YZLA 3QF4A 3O8RA 3O47A 4OL0A 2R62A 2AK2A 2HV8A 3K0CC 1NIJA 1ZCBA 2OM2A 2F1IA 5E4FA 4AYWA 1PVOA 121PA 5KPDA 2V8OA 2ERXA 2MMGA 1UPTA 2ZSDA 4IDOA 1KI4A 4IKEA 1I2DA 4CT4B 1Q3HA 3ZGXA 2QBYB 2QORA 2QA5A 1GP2A 2WWIA 3KKPA 1YRAA 1HQCA 5L3QA 4Q4HA 2CL0X 1CEEA 3VHXA 4EPVA 5G41A 4CEJB 1FMJA 3GLFB 1CJVC 3DO6A 1E32A 4HI0E 5DN6A 5DLQC 2CCKA 1S4QA 4A6XA 1TMKA 3CPEA 3TMKA 1RKBA 3KZ1E 3TAUA 4F38A 4HAYA 4TYNA 1R0ZA 2VP9A 1C4OA 2ZSFA 3ADKA 3QPVA 4W5JA 1VYTA 1BO6A 2V1UA 3FMFA 3U60B 4ZCLA 2UZIR 1XD9A 4XSGA 5FBLB 2KBFA 3W8NA 1X8JA 1I2MA 4C0KA 2VHQA 2QRZA 2DWPA 3CNNA 1N6HA 3RSLA 3EPKA 4HUTA 1YZGA 2JJ1A 2WWYA 5C1BA 4RD4A 4BFXA 2SHKA 2ZJAA 2HT6A 1X1SA 2FPMA 5FUYA 3B1VA 5FBRB 3UXMA 2ZRMA 3TR5A 3GJ7A 1L7VC 5F2EA 5B64A 4XSHA 2RGBA 5JHGB 1WBDA 1N0UA 1Z22A 2IYQA 4LX0A 5FL7D 2FFBA 1Z07A 4TZ0A 4BRWA 1QHHA 3ZZTA 1E9EA 1WCV1 1XXHA 4PSKA 3HR7A 3LH5A 1M34E 1Z6XA 3K09C 2FSGA 4DSUA 4NDZA 3TIFA 4YLGA 2NO0A 3ECCA 3P32A 4DEYA 4JLDA 4BQSA 1AQYA 2QT0A 1S8FA 5D3QA 2GBLC 4XIGS 1CS4C 1JEDA 1ZM4A 3FFAA 4K46A 4P4SB 4US2R 3R20A 4GMDA 5JWHA 4BFVA 2A7QA 5KDLA 3AVTA 1Q44A 1Q20A 5LDDC 1JR6A 1G4AE 3Q9LA 4PC2A 3B85A 1KI7A 2EFEB 5H68A 5EJEA 1VG9B 3Q8XB 1OFUX 1XPUA 3FTQA 3KQLA 4Q47A 4LCBA 1UBCA 4M21A 3DL0A 3HWSA 2VP4A 1TQ4A 3D8BA 2CE7A 2Z0MA 3OIWA 3CRMA 4EFLA 3LDAA 3B13B 1F2UB 1OXUA 1N6PA 4TYQA 4P3YA 4V0NA 2RGNA 3GMTA 3WYFA 3DZDA 3T06B 4OI4A 4TLAA 3ZQJA 4GBMA 5KNCA 3EZFA 1W44A 1OLOA 2IS6A 3RSOA 1N0VC 1KI1A 1KYIA 2DFLA 1KJYA 3CNOA 2NTYC 1N5JA 3W8RA 5FTKA 3ICEA 2JIZA 4KV9A 1HTWA 5FTJA 3KX2A 2A5YB 4RZ3A 1GL6A 1E94E 4JL6A 4G5QA 1G8PA 3OFND 4UXHA 1U90A 5TMPA 1KO1A 1JQLB 3ZS8A 4QGHA 4BFSA 3CF2A 1NBME 5EE9A 1IOZA 3U7HB 4HLUC 4O25A 1QHSA 2ZRDA 3F5FA 3UIEA 3KJHA 4M22A 5J40A 2XNSA 1P60A 3RC3A 1E9CA 2ZRIA 3MJHA 2A2ZA 1EFRA 4I4LA 2A5JA 2F3RA 3P27A 4ZI3A 2QSYA 3AVXA 4UNNA 1HY3A 2W58A 1E9SA 4LHXA 3WNDA 4KFRA 3K70B 4ZKDA 4NPHA 4Y0VA 1NF3A 2HXYA 3RRMA 2GF0A 4EPRA 2ODWA 4MKHA 3DHWC 4UXJA 1P9NA 3SHFA 1IXZA 1P72A 3ONWA 1NI3A 3VR1A 2PCLA 2WOJA 3WRXC 4HATA 2W83A 2G83A 2MSEB 3PITA 1AS3A 2QGZA 2YHSA 3CR8A 3NDPA 2IEZA 1YR6A 4MQBA 4NYMR 4BRUA 4XWKA 3DM5A 3FVQA 5AUOB 5KSPA 3KKOA 1QHGA 421PA 2DR3A 5CDFE 1XMJA 5DIFA 2XXAB 2QMEA 3PUZA 1ESMA 4URZR 2WKQA 3QKTA 3RRNA 3BD9A 3FHTA 1CJMA 3I72A 3GLHB 4A36A 2FNAA 1TPZA 4BFWA 1OH7A 5CJ2A 3BH0A 4Q5IA 3TVDA 4TZ6A 2DBYA 4ZIRB 4BFUA 2RGXA 3PEWA 1RRPA 2IUTA 2OBMA 1JR3D 4BECA 3EZ7A 1QHXA 4FXPA 5FOWA 2QM8A 3NBXX 3PENA 1P5ZB 3AKEA 1GL9B 2VP0A 1T3LA 1SXJC 3GD7A 1GG2A 5FR1A 4B3CA 5JBQA 2NMVA 1NY6A 4Q9HA 2AD1A 4QBFA 4OI0A 4DZZA 3VTKA 1GKUB 2AX4A 3AP2A 1IY1A 3EIEA 2LWIA 1KSFX 4MGIR 3A36A 2YOFA 1Z8FA 2EW1A 1NLZA 4DCUA 4URXR 2BMJA 1OKKA 2B21A 2WSSD 3X2SA 1E79A 4A8JC 1IXRC 4Z54A 4DLXA 2HYIC 4CEHA 4F91B 4LYHA 2GCOA 1KDPA 2VHJA 3VU9B 3OHMA 2CHGA 2OLJA 1G7SA 3BWDD 1VCMA 4LJ5A 3R9XA 4M9QA 3C5CA 1ZM2A 4BLRA 1ZU4A 2J59A 1E2EA 1XEWY 5BN5A 1F6BA 1Z2AA 3TH5A 5HCIA 5JCZA 2IS2A 1ZNWA 5FI0B 2G9NA 1Q1BA 2PMDA 1Q1EA 2BMDA 4F7WA 2IYXA 3KUDA 4P4SA 5E7IA 3CF0A 3MWJA 5JJKA 3GCGA 1WA5A 2QE7D 2QMHA 5FOUA 4TT3D 4DJTA 3BJIC 3K70D 4DRZA 2QRNA 2YNMA 4QM7A 1OB5A 3DVLA 5FPSA 3PUVA 3SEAA 4KSBA 1Z6AA 3Q7PA 5JRJA 3PQCA 2IT1A 1SVLA 4CGZA 2XB2A 2YWHA 4I81A 4V0OA 3K0AB 3TRFA 2GXQA 2BCGY 3U3KA 2C78A 2ODNA 4O0MA 1OE0A 1ZD8A 2O8FB 5EP4A 3EA5A 4PZYA 1S96A 2DY1A 1R5OA 2GXSA 1VIAA 1XX6A 2JDIA 2ATXA 2W6ID 4L15A 1E2HA 2YWEA 2REXB 3K0FA 5IHPA 2JLUA 1ZINA 2C99A 2RCNA 2W00A 4QFMA 1A5TA 1A7JA 5J4VA 4PZLA 1Z63A 2A5FA 3CH5A 3NC1C 1ZM9A 4PXAA 4B44A 3QKUA 5K8IA 1KK2A 1XTKA 3GFTA 2NOAA 1NSFA 4MRRA 2P6NA 4RD2A 3IEVA 4FD2A 3I5XA 2EYQA 5AJXA 1G3UA 2NQ2C 4UNSA 4FWIB 3WY9A 4JLKA 5GADl 3AP3A 1R10A 1AGRA 1TEXA 3NBZC 3MLEA 1NVWQ 2OBLA 4FIDA 1DAIA 1D2MA 2ZAOA 1F2TA 1QZXA 4RZUA 1GNRA 2OV2A 1DAEA 2BM0A 3LXXA 4IEEA 2CCJA 2HJGA 5JEDA 4LYAA 2CL7X 4JLVA 3GFOA 5FUVA 1S3GA 1WP9A 3HR8A 4LK2A 2J7PD 4V0LA 2YZ2A 5HZHA 4NBSA 5C46F 2YWFA 3SYKA 4PQYA 2D74A 2XSZD 1DO2A 1OIXA 2QPTA 3IHWA 2WJJA 3BGWA 3QG1A 4KLNA 2PBRA 2QTHA 4KLZA 3QPWA 4KITB 4QHYA 1E2LA 2ZREA 2OCYC 2QAGC 2ZRNA 3IIJA 4TN1A 1E9AA 2GRJA 3VR2A 4TYWA 1KI2A 1XF9A 2DWOA 3MD0A 2RGNC 4EFMA 2DYKA 4GOXA 5DNYB 3DZ8A 2Q9BA 2GEDA 1G8GA 3UANA 1KSJA 2FGJA 2XB4A 5TV2A 3WBJA 2HLDD 4Q1BA 2KSQA 3TQFA 1SKQA 3P4XA 2GXUA 4XWAA 1RFLA 5ANRB 3WHKA 4XD7A 4AD8A 4F4IA 1WB9A 1GVNB 2J0UB 5FBWB 2RKOA 3L8YA 2CVFA 5EUQB 1W36C 1NVXQ 4OYHA 2I1VB 1N6KA 4LOAA 1JI0A 1P4SA 4DLTA 1SULA 1OFHA 5DH9A 1E2PA 4AIIA 1NLFA 4D0NA 1E4VA 1MOZA 4FWTA 4C0SA 3NEJA 5FI1B 3WRYC 5JI3E 1XPRA 2R6FA 4ESVA 4NYIR 3ZS9A 4KO8A 3VMFA 2IXFA 5TVKA 4AURA 4V0ME 2ZRLA 2EFCB 3OIUA 1N5IA 1COWD 3PR1A 3Q85A 3SQWA 4OHYA 4HSEA 4KAXA 4LJAA 5C4MA 4LJ4A 4B3FX 2OEPA 2B8TA 1HA3A 1G3RA 2WAYA 3PXGA 1AK2A 1H8HD 1NVVQ 3UKDA 2QSZA 1TUIA 4F4JA 4DLSA 3DM9B 2ZU0C 3LWNA 4LBWA 3ND8A 1U0LA 1G64A 2IUUA 4ITRC 1AIPA 4HDCA 4N1AA 4ZCMA 2VSFA 4W7SA 3JZMA 4B2PA 3THXB 4C0JA 4JYBA 3KQHA 2E1RA 1G9XA 5CK4A 4R71A 3RYTC 3QBTA 2D7DA 2WPDA 1VECA 1IN6A 1GAJA 1J2JA 1WE2A 5A0FA 4HZIA 2O8EA 4ZV4A 2Q21A 1E6CA 1CR0A 4TL7A 3NH6A 1FP6A 2P6UA 1RZ3A 2V6JA 2EFGA 4GMXA 2AWOA 3PJRA 1P2VA 3MGCA 2NO6A 4OHWA 4JLMA 3MRSA 4Q7MB 2YYZA 5CM8B 2D7CA 3RS4A 1K5GA 1FNMA 5G3YA 2F9LA 1SVSA 4B35A 1GRNA 5B58C 2CNWD 1XCGB 3SR0A 1GFIA 3GJ8A 3QEOA 3U6KA 5FBQB 4C0QC 3M4YA 3RS2A 1WMSA 2AL7A 2FEOA 4RFVA 2OT3B 2IHBA 3IHLA 5AR1A 1TNDA 2ZRCA 1GNPA 3C16C 3FB4A 3WBKA 5JECA 4D26A 3PEYA 3SS8A 2PJRA 1KAGA 2H57A 1NKTA 4GZLA 2H17A 5FPKA 2G6BA 4DVGA 4YC7A 1KNXA 3I73A 2AN9A 3MMPA 1RRGA 4M9ZA 3OE7D 4BPBA 1GDDA 2QL6A 3Q5EA 1E99A 3PV0A 1RVDA 3N2EA 2HYDA 4AKEA 1GNQA 1X3SA 1KO7A 3THWA 1KNQA 3OF5A 5JWRA 1ZVQA 2QY9A 4U7DA 2YINC 4TTQA 3IKJA 4DLRA 1MABB 3BE4A 4Q19A 3K9NA 1KMHB 2V7QA 1A2KC 2WJGA 1KAOA 3OEEA 3T1VA 3V4FA 3B5JA 4O2LA 4EKDA 4BEJA 3TE6A 4D25A 1L4YA 4HZUB 4A92A 3GLIA 4GL2A 4MRNA 4D81A 1VIYA 1II8A 2WJIA 2J7KA 1WDTA 4I1SA 1Z6YA 1VCIA 2O8BA 3UATA 5DI3A 4XJXA 1G21E 1P2TA 1DTSA 2VF7A 4A0HA 4ASUA 4EPTA 1Z47A 2J45A 5GJBA 2F55A 1R4AA 2GTPA 4YMTA 2IWHA 1D9XA 3TW4A 1Z0AA 2PH1A 3TUZC 4US0R 2CMKA 2J46A 4EIWA 2JASA 2C98A 3SN6A 1BOFA 4BASA 1JAIA 1W4RA 3PVSA 1RRCA 2FFQA 1E0AA 2QMOA 3T15A 2ZVQX 1HH4A 1LF0A 1LS1A 1TAGA 3QQ5A 3VX4A 2JAQA 2GZHA 1GZSA 4W5WA 4RKEA 4QJ5A 5DHAA 3WHLA 3D7MA 2FH5B 1TQ6A 3IQXA 2QP9X 3TR0A 1AZSC 1Z28A 4LV8B 2ZJ2A 5HKKA 4DB4A 5BYJA 3BFVA 3RWMB 4HLUA 4KXFB 1WBBA 3W3AA 1Z83A 3K9GA 3TLXA 4HB2A 1F48A 1ODFA 1T8UA 4MYCA 2ZJZA 3CKLA 1VG8A 6Q21A 3AKDA 3MJRA 2ZSAA 4LBYA 2QTVB 1VCNA 3W9YA 2HT1A 4IFBA 2ZUBA 4IEIA 4QOSA 4Q00A 1G5RA 2O52A 4PHHA 1KTVA 4HLDA 2YOGA 4OK6A 5CM9C 2KB0A 4NYJQ 2CXXA 5KSOA 4MGZR 2CJWB 2RGEA 2ZR9A 3QOFA 4Q4JB 1CRPA 4B3BA 1XZPA 1MV5A 2GAOA 3EG5A 3AVUA 2O0JA 3GLGA 4RY2A 4HAUA 3TNFA 1ZAKA 5FOVA 3W3ZB 1FOEB 4PC1A 3SFVA 2ONKA 5EXXA 4QJ4A 3R7WA 4DXAA 4XVUA 4F4CA 2ZE7A 1DEKA 1US8A 3D31A 1UBFA 3NKVA 4OI1A 5JS7A 2IYTA 4W5HA 3KFXA 2F43B 4FCVA 1U8AA 2GWHA 3IIMA 3QPUA 3AV0B 4WAUA 4PAOA 2JEOA 4XOIA 3HPQA 1G19A 1N25A 1YRBA 4RZXA 3NBFA 4OHXA 2BIFA 3BB1A 1IAQA 2A30A 3OIVA 2ZR7A 1N2CE 3QXHA 1O87A 1FX0B 2Z4RA 4JSTA 1BMFD 2J0QA 2Z43A 1JB1A 3ZIAA 3KXLA 4KHZA 1B23P 1IY2A 1J70A 1LF5A 2IBMA 1DELA 4UNPA 5CK5A 4WOPA 3DOFA 4IJMA 4Q1AA 2FE4A 1D6JA 3ETLA 2E87A 1XNJA 1G8FA 3C8UA 1KO4A 3F0TA 1I4TD 1IHUA 2JJ2D 2QAJA 2VPPA 1IONA 1YJ5A 3B1ZA 3KXKA 8OHMA 2VHUA 2XNDA 4WVFA 4AKIA 3LA6A 4BZPA 1KKLA 2J0SA 3K53A 3X1DA 4A8JA 4ARZA 1XRJA 2GESA 5IK2A 3VR3A 2FPLA 1PLJA 4KBFA 3GEIA 1KI3A 3UWKA 5B30A 3U6BA 1FL9A 1CXZA 5JFGA 1MKYA 3G82C 5JSZA 3A58B 4JLAA 3QBVA 4WXRA 3EPLA 2QN6A 1ETUA 4D4LA 4DHEA 3ZVLA 3BRWD 2QP3A 5LD2B 5TDHA 3B7GA 2C9YA 2GILA 2GKSA 1UBEA 4NP6A 1AM4D 4TYPA 4JS0A 5TARA 1W48A 4JBYA 4TMZA 2BKEA 1DOAA 2C96A 2YKGA 4M9SA 5KUTA 2AHOA 2J5XA 5AUQA 2ZRAA 4DIDA 4RJLA 2JLXA 4MA4A 1OXXK 3T34A 3W6PA 2REBA 5KO2A 5FUXA 5KPJA 2FN4A 5G53C 3O8DA 2KBEA 2WICA 2ZS8A 2W0SA 4C3ZA 4K8OA 4MITA 2B7BA 2F1HA 3PFIA 3LBIA 4QC2A 5C4GB 3VR5A 1PJRA 2GNOA 1CJKC 4B32A 1FP7A 2HDNB 4KVGA 4WZAE 2EQBA 2IXGA 2W2VA 3RS3A 4Q1DA 2JATA 2CLDX 3KJIA 5EE3A 1QBKC 3QVVA 2ZQ5A 4OQXA 621PA 1EFTA 1PUIA 4JLOA 2I1QA 1L8QA 1QRAA 4UJ5A 4AY2A 2NPFA 1DADA 1LY1A 1NL3A 3M6AA 1W5TA 2XTNA 4JSYA 1U9IA 4FMDF 3S1AB 4B33A 1M2OB 2AKYA 1KZ7B 1TF2A 4Q7LA 4US1R 4CRWB 1UKEA 5DO9A 1QVRA 2MSCB 4E03A 5GJCA 1ZC3A 2WV9A 4TTRA 2F9MA 2O0KA 4V0KA 3ZVRA 4DSTA 3KB2A 5H8WA 4NYMQ 4LC0A 4QBGB 2KWIA 2AXPA 4GOJA 3QKRB 1M7GA 4YMUA 3CW2A 4KI0A 1KGDA 1SGWA 2JIZD 4JLJA 1Q57A 4L5BA 1XU4A 1I4LD 2HCBA 1OW3B 5E7JA 1UJ2A 3N5CA 2CCGA 3REGA 1ZCAA 3ZQ6A 1AZTA 3I1FA 1PV4A 2FSIA 4UJ3A 4I1VA 1OF1A 3T1TA 1G4UR 1NNEA 2BV3A 4M1MA 1K8RA 5AK0A 2Y8EA 3L43A 4RFSB 4CT5A 1G7TA 1W0JA 1PZNA 3CRW1 5TXGA 1ZC4A 4IVRA 1YKSA 2WIAA 5AJVB 2QAGA 1NLYA 2QGNA 5TY0A 1Z0FA 2KE5A 5BXQC 4G5GA 1OV4A 5IDVA 3SFZA 4UQOA 3E1SA 2OZEA 2JA1A 4KFTA 1NN3A 2C77A 2V55B 5L3SA 3GPLA 1CBUA 4JMPA 3CRVA 1LVGA 3H1TA 3UMRA 5J47A 4RD0A 4DSOA 3QKSB 1KIMA 5FL7A 1G16A 721PA 3Q7QA 3VKHA 5SZKB 3A4NA 1MR3F 2VL7A 4BGDA 1UKYA 1Z5ZA 3AKYA 4BZQA 4D6PA 4GDFA 5A4JA 4JZKA 2MSDB 1II9A 4BE7B 2FA9A 3OAAD 4O3MA 2X2EA 4QGFA 2D62A 2FDCA 1OXSC 4H9GA 4C30A 1LNZA 3THOA 4Q4AB 3CZQA 2FJUA 4G01B 1XEXA 2AXNA 3EW9A 2Z5FA 4DDUA 3GFPA 5EP3A 4CYMA 2C04A 4AI6A 3V00A 4XVQA 3LAWA 1V5WA 3HP1A 1H8EA 3CPJB 1OB2A 2IL1A 3EC2A 3FE2A 3ADBA 2QM7A 2ECKA 1IN7A 2VRWA 4OHVA 4X8LA 3M0EA 2FOLA 1R6BX 1FNNA 1V43A 2PT7A 3AUYA 3KKQA 4H1VA 4QHSA 3LO5A 3F8TA 4IDQA 2DFNA 5ELXA 2QBYA 3AVWA 1M8PA 1HT2E 3KUCA 1DO0A 2PZEA 2FX3A 4WZBE 3QI2A 3T5DA 2G1KA 3PIRA 1G3MA 2H16A 2WSMA 1DAKA 1TADA 4B71A 4CEJA 1XWIA 4OQLA 3KXIA 3GLFA 3X1YA 1OH8A 3GJXC 3MG9A 1XXHE 3QXJA 3B2EA 3SQXA 1EWRA 2CBZA 2ZEJA 1Z0DA 2AWNA 3A8TA 1R0XA 1U99A 1W5SA 3KL4A 3LVQE 5K8TA 3N2IA 5EUMA 3EZ6A 3OFNA 2ZI7A 2C9CA 1XMVA 4Q1CA 4Q1FA 1JAHA 1XTRA 3SJZA 1G7RA 4QG7A 1JBKA 3QSYA 1S2MA 1RRFA 4IHQA 2O8DB 4TQAA 3L0OA 3KJGA 2ORIA 4MDFA 4OI2A 4MKFA 2WJVA 2IHYA 2PX3A 4YQFA 4G0NA 2J0VA 5KU1A 4HB4A 2BCJQ 1KHTA 1G3IA 2XJ9A 4YDSA 5EZ6B 3THYB 3EPJA 4LPKA 2ZYVX 4LDJA 1XTIA 1KI8A 3K8YA 4UNRA 4QJ3A 3K9LA 5IF9A 2YWGA 2JLRA 1BH2A 2VBCA 2ZE6A 3A1VA 4TYYA 1ELOA 1AJEA 1KK3A 2FV8A 4DLWA 1HE1C 1MH1A 2CE2X 2IF0A 2LCFA 4ON9A 4PANA 2GVZC 3VR4A 3ZVMA 2V9PA 2ORWA 2IEYA 4EUNA 1E2DA 3QXXA 3AF2A 3RRZA 3TJZA 2FF7A 3LRPA 1U2RA 1G5TA 1IN4A 1G7CA 1Z0IA 2A78A 2BBOA 5GVSA 2ZRBA 1W4CA 1JXOA 4QNRA 1DVRA 4ZDWA 1FQKA 2XGJA 2P65A 5DI9A 2R6GA 3U44B 4BLOA 4QBIA 4CIDA 3B1XA 3QUSA 4LHVA 2ZRHA 1OXTA 2A5GA 3RS7A 3ADCA 3R9WA 1GOTA 3MWKA 2WVJA 1AKYA 3RANA 1A4RA 4AG6A 4PO8A 4JVMA 1UBGA 2GF9A 2J3EA 4EQ6B 2ANBA 2DWQA 1CR2A 3B78A 4UKDA 3U2QA 3LBHA 2ZETA 3IDQA 4HUQB 2REOA 4D0GA 1JR3A 3TBKA 4G3XA 2IS1A 1DG1G 1UEJA 4M1SA 1PLKA 2OSBA 1M7HA 4NYIQ 1OT3A 4L4UA 521PA 3DPUA 4X8MA 2CVHA 5KSYA 1NG9A 5L3VA 1IM2A 4HAVA 1KSGA 2XJ4A 1F2UA 1ZNYA 1FPMA 4DT1B 4EPWA 3A6PC 4LHYA 2B92A 3KKMA 1U9IC 4P0TA 1KJWA 1TU4A 5FUWA 3L82B 1OXVA 4FCTA 3QEJA 1GILA 2WSSA 4LYFA 1DAMA 4POAA 4PQRA 5AUPB 2P3SA 4MGKR 1C9KA 1YE8A 2QT1A 3DKVA 4M4SA 4BLPA 4A0GA 4C0AC 5G40A 3BORA 4M1KA 4GPTA 4IVPA 2PLRA 1L2TA 1KI6B 1OYYA 2A5DA 2OE2A 4CVNA 5LB2A 3LX5A 1G8YA 2W6JD 3SI7A 5KYKA 1LS6A 2X77A 4FN5A 4KYIB 2HEIA 1YQTA 4U02A 4BUJA 1YZUA 5EP2A 2AFHE 3AGQA 1T0JB 3U3JA 4ACAA 1Z29A 4EJSB 5KTYA 4GT1A 4AKHA 3H2YA 2GCPA 3KFVA 4XD7D 3W34A 4BLTA 1U98A 2OCBA 3I4LA 3WP0A 3NWJA 2ZUCA 4P33A 2HCJB 3BERA 1YR7A 4M1OA 3J81k 1ZP6A 4ZDKA 1I4DD 1WF3A 1AQUA 1ZM7A 4G5RA 3UMFA 2VP2A 1EK0A 2NZJA 2L0XA 2Z83A 3PUYA 4JBXA 1W0KA 2N42A 2DFKB 1S0UA 3U61B 1TTTA 4H1UA 4D80A 1UKZA 1BIFA 3HU2A 4RD3A 1EG7A 2CL6X 2WWGA 3K9HA 4OQNA 4B48A 1S9HA 1YZKA 2NO9A 5L3RA 3LLUA 2ZI4A 1TF7A 4ZI2A 3AVOA 2XXAA 4MUBA 5GJWC 2FZLA 1Z6TA 3FKQA 2KI5A 3GEHA 1XD2B 3GLHA 4A82A 3U4QB 4S35A 4XTRA 1VYVA 2OCAA 1TF5A 4DKXA 3O8CA 4G1UC 4KJZA 5EZ5A 4OQFA 1N6LA 4ZIRA 5HE9A 4A0FA 1P61B 2BMEA 1R2QA 1G20E 1P62B 1VHTA 1EXMA 3NHBA 4JT2A 2XTMA 3EASA 4XVRA 3L8ZA 3ICQB 1J99A 4MH0R 3SC3A 4NCJA 3W5JA 4C9BA 1KZGB 3KQKA 2XOKA 1KMQA 1Z3IX 4WXPA 2JLWA 1XMSA 4F93B 1SKYE 2K5UA 2GK6A 4UNQA 1T3HA 4WIAA 4B73A 3KDSE 3EIHA 3KKNA 4EAQA 3KTAB 3A1UA 1XEFA 1FTNA 1GRRA 2EYUA 4GZMA 3VU9A 2F3TA 1R8SA 1P73A 1FMLA 2ZYUX 2NO7A 3AF0A 2IYRA 5AJYA 2Z6VA 3EZ2A 3ZDQA 2O8CB 2XZLA 5JCPA 3CNLA 4FMDB 3ASYA 2IYYA 2OESA 1PLLA 3SDZA 3TK1A 1VHLA 2ZE8A 3U7FB 5J4HA 4MKIA 1OIWA 4M53A 5SZJA 2CLCX 2HLDA 4X8OA 4YMWA 1ZD9A 4CEIB 1R0YA 4E22A 5GVRA 3X1WA 4D2IA 3LY5A 3QG5A 2ORVA 2EFHB 4LI0A 3H86A 4FINA 1KSHA 4LJ8A 4BLSA 1MRSA 1OSNA 1R7RA 1E98A 4NKRA 1UFQA 2FSHA 2YOHA 4NCKA 1JALA 4MUAA 3GQBA 2N1BA 4WW0A 2PLFA 2ZJYA 3EWSA 1AN0A 2BBSA 3C5HA 2RMKA 3IUYA 2NPIA 4TLEA 1FUKA 2WKRA 3K0AA 3FKSD 4EPXA 5M04A 1A1VA 1EESA 4TWZA 4F92B 2O8FA 1RYHA 1TU3A 1COWA 1SVKA 1E2MA 1MT0A 2VHCA 1P2SA 4KFUA 4TSFA 5D3MB 1T5IA 3V4RA 4RKFA 3NBYC 3SJBA 4TL6A 4Q7KA 1HT1E 1HYQA 4PPQA 3LX8A 1QDEA 2CK3A 2Q0HA 3CX7A 4DUGD 3C7KA 2OAQ1 1SXJB 4LYJA 4EDHA 3BS4A 1H8HA 2G1JA 4PHGA 1W49A 2ZRPA 1EFUA 2BHRA 2OLKA 5EQTA 1E1RA 4DDTA 5KDOA 2IYZA 3MWLA 2XTZA 1T3SA 5DGXA 2GDJA 1TUEA 4PPGA 3QF4B 2F1JA 3HU3A 1CP2A 3TW8B 1DAHA 2QROA 2ZUDA 2WWFA 2UKDA 4LSGA 3UMSA 1NMYA 3IPYA 2G0TA 4A2QA 1S1CA 1P75A 1JECA 2PCJA 3QJYA 5UKDA 2ZXUA 3MAAC 2QPAA 4QL3A 5FPYA 5L3QB 1OFTA 4Q4HB 5DISB 2IX3A 2C5LA 3FMIA 3A37A 2EVWX 1D9ZA 2WIBA 1GKYA 1ZJ6A 2WWHA 4M8NE 4KU4A 2VLIA 2OFXA 3E70C 1GTVA 3A1TA 3VQTA 1CU1A 1U0JA 3K1JA 3WYAA 4B2IA 3I32A 1GM5A 1X8LA 2ZE5A 1ZM3A 2CNWA 4ZPXA 3FGNA 4DLZA 3AM1A 4M1TA 3WP1B 1Y3AA 3K0SA 2IUSA 5BN3A 3I8XA 3QVUA 4DCSA 5KNDA 2C2HA 3K0EA 4XH9B 2QPOA 2OG2A 4KBGA 1XCMA 4D82A 4B43A 5HCNA 3B9PA 2GA8A 4RZ2A 5DYIA 4V02A 2CDNA 4Z1MD 4GP6A 1NIPA 3PEVA 3Q72A 2J0UA 1SHKA 2WZQA 5JWOA 4D4JA 1XD2A 3OE7A 1VMAA 4RSGA 4TMXA 2G88A 4LHWA 2XZPA 3BIFA 4URWR 2O0HA 2GZDA 5B2ZA 1E1QD 2ASEA 1G3QA 2CLSA 2IYVA 2WKPA 3IIKA 2F1RA 2YV5A 4DLUA 2WMNB 3Q3JB 3VAAA 2HJVA 1QHHB 2G3YA 2FWRA 3OEHA 3GJ3A 1XXHB 3NTUA 2VP5A 1IJFA 3QY0A 3CX8A 1SHZA 2IYSA 1KK1A 2NO1A 5HZKA 3K70C 3C15C 3RLFA 2IYWA 1NP6A 1ZNZA 2R6AA 4NCHA 1PUJA 4GSYA 1DG3A 2ZJ8A 4DCTA 4DCVA 1SXJD 1N3BA 1Q3TA 2ZRJA 1FTSA 3GJ5A 5FOTA 1OHHD 4ABYA 4OK5A 3CRRA 2R9VA 4M1YA 1CTQA 2FG5A 2F6RA 4RVCA 3VFDA 2VSXA 4IOKA 1KJZA 1W2GA 3NVAA 3THXA 3DMDA 4B3GA 1EFHA 1IY0A 4UXIA 4P32A 2WAXA 4O2RA 1YR8A 4M2LA 4B75A 3DDCA 3RS0A 5IK2D 5FTMA 1ZYUA 3AUXA 2OFWA 4LHZA 1OFIA 2GEVA 3I3SR 4U00A 4AYXA 5G3ZA 1ONBA 2IW3A 3MWYW 2QQEA 3OIYA 1ZUHA 1IN5A 2FGKA 1YZQA 3L2OB 5DN6D 2NGRA 5P21A 2E9SA 4WZ6A 3TAHA 2W0MA 4D4MA 1T6NA 3QENA 4YXWA 4DDWA 1DPFA 2NIPA 4LJYA 3SJCA 1XCPA 3GLIE 3A1WA 1OH5A 3TSZA 5B57C 4QHTA 1TL7C 3FHOA 2C8VA 3E2IA 1LW7A 4MYUA 2H8KA 2X1VA 5DE3A 2CHQA 2RGGA 3RNLA 4E5UA 2QUZA 5FH9A 3UK6A 2FPKA 1LV7A 1OH6A 1UEIA 4HAZA 1J8YF 3BFKA 4LJ7A 2IS4A 1HURA 1KO8A 2JJ1D 5FPTA 1SVWA 4ESHA 1NKSA 3SYNA 3W5IA 4FMBB 5JJLA 1DS6A 2ZVPX 4NMMA 2ANCA 4KODA 5LB4A 4CZ2A 5E3HA 4DBLC 1EX6A 2H92A 3P20A 3AQ4A 4Q21A 2JLQA 3LXRA 1Q1ZA 2QTFA 4C2UA 2AFIE 2GAAA 3TVTA 2PZGA 4JKYA 1MABA 2TMKA 4JJZA 1KMHA 2C95A 2YC2C 1JPJA 1XPOA 2EFDB 3R9IA 2PMKA 1XBTA 3DOEA 3U3OA 3AVVA 3UG6A 3RABA 4HZUA 4Q18A 2QU8A 1G6HA 5EE5B 4P4TA 5HTKA 3ZZ0A 2ZI9A 1BMFA 5CJPA 1NBMA 4PC6A 3CB4A 1JJ7A 2BDTA 1KY3A 4LC1A 3D3QA 1Z0JA 4IRUB 4LJ9A 4I1OA 1KO5A 3LLMA 4N0EA 4NH0A 2GJ8A 4MGYR 3H0KA 1MRNA 1SVIA 2O5VA 1NJFA 1CR1A 2BJWA 2H7VA 2JJ2A 2WWXA 3IILA 3U3MA 2J9RA 5BQ5A 4L9WA 1GUAA 1ZIOA 3BAFA 3CRQA 2NZ8A 1W0JD 4RD6A 3BH7A 4NYJR 4ZO4A 3FOZA 1NN1A 1A82A 2ODEA 2WHXA 4QXAA 4URYR 5JLJA 3GLGE 1IXSB 2XAUA 1ZUNB 1MO4A 3RWOA 3HYTA 1EX7A 3PUWA 3E5HA 3LNCA 2GJAA 2RHMA 3ZD6A 1D8TA 1YZNA 1D2EA 3AEZA 4L9SA 4LZZA 4LRWA 4ILEA 4EJSC 1SVMA 1MO3A 1YR9A 2B8WA 4CEHB 3I92A 5FOXA 2GCOB 3REFA 5CDFA 1FQJA 4IDPA 3U7EB 4XWOA 3C4JA 2VIIA 5CLQA 3ZJYA 3SU8A 4DWJA 4OQMA 1W36D 1Q12A 1NY5A 3AF4A 2GHIA 2ODBA 3T1QA 5JI2E 5KDDA 3B8HA 3FMOB 3G5UA 5J4KA 2P5TB 4DSNA 4M9XA 3P26A 1WQ1R 2V4ZA 1KDTA 1SXJE 1XD8A 2ZSBA 4G5SA 1RW4A 2ZYWX 3JZAA 4TMVA 1JJVA 1ZU5A 4QRHA 1EFRD 1VPLA 2CJWA 3AGPA 4PR0A 3CO5A 4R7ZA 3RS5A 1W4AA 2HXSA 4Q4JA 4R2IA 3WMFA 2RGDA 2UZ3A 3HJNA 1H8ED 1YU9A 2BBWA 2QNRA 4PQFA 3AF1A 2OXCA 3TUJC 1L4UA 2A3RA 2A9KA 3U5ZB 4BWYA 1M1YE 1XFAA 1F3OA 4JVNA 3LBNA 5GJVC 4DDVA 4MYHA 4BEBA 3BK7A 3VR6A 1CJUC 1SKYB 4A2WA 3KB1A 1F60A 5JMTA 2R6DA 4YMSA 3L0IB 3R8CA 4N0DA 4R2HA 3U7GA 3CF6R 4I1UA 4HB3A 2F43A 1AS0A 1NN0A 2YVUA 1P9RA 4TLDA 2LKCA 2GEUA 3TGPA 1XJ0A 4OHZA 4JVSB 1YZTA 2VQSA 1GKIA 1KKMA 1E2KA 5KOYA 3ZVNA 1KK0A 4LJ6A 3WMEA 1FX0A 2ZRGA 2XITA 3K0FB 3LW7A 4DC9A 4QKQA 3R8FA 4P31A 1N6IA 2RAPA 1Q0UA 4GRAA 4LPSA 4JL5A 4ACBA 1AGPA 1AKEA 1U8YA 2ZR0A 4TMTA 4Q7JB 2J41A 2DHRA 1ZIPA 1JEEA 2ZJBA 1BS1A 1ZD1A 4QGAA 4TLBA 4KSCA 2OAP1 1E4YA 1N5LA 1II0A 2V6IA 1JQJC 2FEMA 3DMNA 5F9FA 2QP4A 4OKSA 2RGCA 1IBRA 1DE0A 3B60A 5E7MA 1C1YA 2V1XA 4XTCS 2WJHA 1HV8A 5CIQA 1F2TB 3UPUA 4Q9JA 3BFXA 2WJYA 1RYFA 1J7KA 2AR7A 1N6RA 3BB4A 2ZYTX 3WXMA 4LV5B 2BEJA 1OKKD 4YDHB 4A0RA 1D5CA 2G77B 3W6NA 3NG1A 1E79D 4HDQB 3SZRA 1M74A 3KQNA 2RGAA 1QG4A 3VKWA 3EA0A 4DLYA 1T0HB 1P6XA 2BEKA 5CIWA 2OILA 1T91A 3JVUA 1E3MA 2N46A 3AVQA 4C7OA 1BKDR 1X1RA 1X6VA 4WA7A 3TUIC 1FUUA 2JCSA 4PX9A 3CH4B 3VNVA 5SZIA 2F7SA 1E96A 4PC3A 3WMGA 1JNYA 2VSOA 5FPHA 3GP8A 3VNUA 2ZJOA 2ONJA 4C0LA 4IOJA 4NCNA 1GL7A 2IXEA 4D4KA 5KNBA 1LTQA 2AD5A 4HAXA 4Q1EA 3DKPA 3OAAA 3TSWA 5A5GA 2JJ8A 5FR2A 4AC9A 1UDWA 3BXZA 3GJ4A 1Q22A 4B6FA 1CF4A 3LV8A 3FYHA 3EX7C 3ZYCA 2WMOB 2H1LA 1MO5A 4HDOB 3I61A 2ZROA 3ASZA 1VKJA 4C7OB 4R9UC 2YJTD 2IC5A 3HU1A 3QIAA 2IWRA 3S1AA 3B9QA 3SJAA 4PAMA 4E07A 4IOMA 4AG5A 1UM8A 3LVRE 2VYFA 4II7A 4FMCF 3FMPB 5FTLA 3RRYA 5EE1A 4K81B 1XP8A 3P1JA 1W7AA 1SZPA 2WOOA 2JDID 4Z8YA 1OJLA 2GXAA 3AP1A 1XDBA 3JVVA 1UKVY 2BVNA 1X86B 1CR4A 5FOSA 4NTZA 3CWQA 1NN5A 2G0NA 1N0WA 3QKRA 1TQ2A 2ZS9A 1XZQA 4TMKA 3UG7A 4BLQA 2ZSEA 4A9AA 1N6OA 2FSFA 4LBZA 1TX4B 2Q3MA 3IEUA 5JEEA 2XZOA 1W2HA 4WBSA 4A2PA 1O3YA 5EXSA 3RAPR 1XEWX 2QMUA 4PFSA 3Q5DA 4B3XA 3CX6A 4TQUS 2O8EB 4RFSA 2HUPA 1VTKA 4JBWA 4HLQB 5J5CA 4RCZA 4PPFA 1N6NA 1G41A 2IK8A 1G5PA 3QXSA 1UADA 3RC8A 4JVLA 1J90A 4V03A 4V0MA 5KHOC 1E2JA 2FMXA 3BH6A 1G291 1BYIA 3BOSA 4NONA 2ZPTX 1BYUA 1XMIA 3MFYA 2IF2A 5C2JB 3KJEA 3CR7A 1W0KD 3GJ0A 4TL9A 3QKSA 3I62A 3T1OA 5JJIA 1U94A 1NSTA 3CBQA 4LY6A 1XTSA 1A2BA 1YVDA 1E2QA 5K8UA 3HDTA 1P2UA 2HF8A 5L8VA 2BOVA 1N5KA 4R98A 3GLFE 4M1WA 3IPXA 2ATVA 4GI7A 4JIMA 1E0SA 2VHTA 4Q4LA 2VO1A 1R5BA 4FI3C 4Q4AA 3QF7A 4NCIA 2GVDC 4IW3B 1U81A 4KCGA 4N3NA 3NDBB 4NHOA 5BWMA 2PEYA 4C2TA 3BBPA 3NH9A 2X8AA 1FZQA 4IXMA 2QE7A 2RB4A 2GCNA 4TT3A 4MDEA 3T61A 1OPXA 5LBIA 1OIVA 1XTJA 2P67A 2FFHA 3THWB 1R5NA 2LKDA 4J0QA 3MUFA 4C0HA 1W46A 2VTKA 1AS2A 1KY2A 1B0UA 1HUQA 2GETA 1RC8A 3EC1A 3I8SA 4EPYA 2P2LA 1E2NA 2VF8A 1MO6A 5CB8A 2QENA 2VP6A 3V9PA 1DARA 2XOKD 2UVQA 4NL4H 1QF9A 2I4IA 5IT5A 3ZD7A 3H84A 4FW9A 5AJZA 1FFHA 1Z0KA 5J4YA 4BFZA 3GLIB 1U0HC 5J4LA 2D4HA 5SZHB 2QI9C 1II8B 1WXQA 4PSVA 2PL3A 2BWJA 2W6IA 4A1FA 4DLVA 2O8BB 1Q1QA 1XJQA 4AYTA 5DI3B 1NRJB 2JLVA 2ZAMA 3X1ZA 1YHNA 1ZNXA 3EAQA 2V3CC 2B6HA 2WM9B 4JLBA 2AKAB 4DB2A 2DCUA 2PZFA 1E9BA 3PCRB 3B1WA 2W6JA 5DSZA 4ERNA 4Q02A 3OZXA 1OYWA 3TQCA 2P5SA 3NXSA 2WPDD 1JPNA 4KVAA 2VH5R 2ZJ5A 4P4UA 4OBEA 3G0HA 2FZ4A 2O8DA 1CRQA 5FBVB 4PO9A 1EWQA 4TMWA 2JGNA 4JT4A 3UWOA 2X19A 1G18A 4OK3A 1M6NA 3ZH9B 3ADDA 2D2FA 4CW7A 1XJCA 1Z06A 3IBGA 3THYA 5HPYB 1CULC 2EU8A 2JLSA 1SVOA 2R2AA 2J7PA 1JR3E 3NEYA 2ZANA 1ZBDA 3CLVA 1GITA 3GEEA 2Q3FA 2Q9CA 4JJKA 4MYTA 2XSZA 2QZ4A 1T9HA 1AA9A 1VYUA 4NE2A 2BC9A 1QG2A 3I5YA 3EWAA 5HR5A 3EPHA 2BJVA 3PG5A 4QNMA 3VHLB 4HAWA 2YC4C 1G1MA 1EFCA 3N70A 2FFAA 1IJEA 2X2FA 3F3YA 4QGGA 2OXRA 2WBLC 4TSFD 5CYPA 4ZDJA 2IYLD 1S3SA 4JLPA 4Q48A 2GJ9A 5LD2C 1E2FA 2CK3D 4E09A 1H65A 4URUR 3WNBA 4A4DA 5AJWA 2Q6TA 3A4LA 3U44A 3K0CA 1ZRHA 3SBEA 1DAFA 4IDHA 1P7CA 1Z6GA 3KQUA 1E1RD 2ZITA 2OCPA 4QM6A 5CITA 3GLGB 2PEZA 4PO1A 4A6PA 1E0KA 4PAQA 1FW6A 1NMXA 2OHFA 1UDXA 4EQ6A 1D2NA 2R44A 3AVPA 1TEVA 5DHFA 3C14C 4MRPA 4LBVA 3R7WB 2D3WA 2ZM5A 2H18A 4HUQA 4B6EA 4U5XA 1R8QA 5CB6A 2VEDA 1US8B 1K5DA 2KJQA 2V7QD 2ZRFA 3SHWA 1EGAA 3OEED 4HYYA 4OJKA 3CPHA 1GRQA 5AUNB 3CUEF 3VX3A 1NJGA 1WRBA 4ZDIA 2BMFA 4Q03A 2C9OA 5C18A 4DT1A 3H4MA 1KOFA 1Y63A 1S9DA 3LW8A 1J8MF 2D06A 4IDNA 4LWZA 3L0PA 4LGMA 1VCOA 2QQ0A 4Q66C 4PHTA 2OUKA 1ANKA 4ASUD 4B34A 1CIPA 1E9DA 3QXCA 4B74A 3IGFA 2MMCA 4S2EA 2W2TA 2ZRKA 1W4BA 3CIOA 1RJ9B 4TL8A 5F3WB 3BC1A 4HLCA 1KI6A 1VG1A 4Z51A 1QHYA 5F98A 2DB3A 3U3RA 3SNHA 2GJSA 4GP7A 4M0LA 3CM0A 2P6RA 2JLYA 3T5GA 2ZI5A 4L16A 3WYGA 2NG1A 3OESA 1P9WA 5EE0A 3NC0C 4A8JB 4ARZB 4EJSA 4CF7A 3ND9A 4IXNA 1UF9A 2PX0A 1RE0A 3GLHE 5JS8A 1M7BA 1XB2A 2C03A 3ZLJA 2BM1A 1G6OA 4IFEA 5LPNA 2H5EA 2IA5A 3AB3A 2R6CA 1LB1B 2W2XA 4JKIA 5EXPA 3SBDA 1ZW6A 2XEXA 5HKKD 4TQ9A 4Q9KA 3WNCA 5JSZB 3CONA 1W1WA 3O8BA 3K09A 5F9HA 1T5LA 2ZI6A 4MRVA 3NIBA 3GJ6A 1HE8B 1G17A 3B1YA 1Z08A
chains in the Genus database with same CATH superfamily
4S1TA 4B2LA 1A4XA 3NIGB 5FV4A 2QEQA 2IH4A 1DLIA 1YOVA 3WLKX 3C7AA 5JHHB 4J3JA 1P0CA 3SSNA 2C5AA 2CYBA 4CM8B 4ZCIA 4QOIA 2IYUA 4GOMD 3WSWA 1ZVJA 2P79A 4J0IA 3FKSA 1G8HA 4Q9NA 4DDHA 4HNUA 4I3GA 1P19A 2V5VA 3SQLA 2CLHB 3LZDA 1X7YA 4BFYA 1H9AA 5KTSA 1G38A 2A67A 3CEJA 2F48A 3IQWA 3SC4A 3DYBA 2P6OA 3D6TB 3IBYA 1ZOIA 3ABQB 4H7KA 2EZ9A 1Z4MA 2GZAA 3FCYA 4OEHA 4W5OA 4M36A 5CA0F 5JZVA 4NDAA 2W2LA 3INRA 1N1GA 4LVUA 2ZIAA 4DUGA 5K8LA 3BRSA 1QOQB 5ALHA 4FR5A 4JU8A 2BI8A 4IUCS 2J1LA 3R5HA 2FR8A 2FMUA 1NVUQ 1RXCA 3SE0A 3S40A 3ZWDA 1SB8A 1RRMA 1YWGO 4GPD1 3UWMA 4FW8A 2HO5A 5C8YF 3DFMA 3G5MA 4KYUA 3CWZA 1VZ2A 3C5VA 5LIRA 2V7XA 3OQJA 2ZTSA 4F5WA 4RZHA 5H02A 5IM4A 3PJGA 5HF9A 3CTPA 2HF9A 1HEIA 1GIAA 1QO0D 2VH1A 5CGZA 1THGA 1Z9BA 2PKYX 2Q3HA 1KYTA 4I9FA 5DN9A 3WOVA 3W2FA 4DIOA 2ZZMA 4OY3A 4ENTA 3H9GA 5E4JA 2WABA 3JQQA 2QG6A 4C4SA 1B8VA 1VQ1A 2NUPB 4MQLA 5NLLA 1MX3A 3IO5A 2PGLA 4X92A 1M2FA 4FJ2A 3E61A 1KQFA 1CB0A 3DDOA 4YR7A 2R7MA 3AEKA 2J07A 2ALJA 3L7DA 4Q01A 5G4KB 1EVYA 5EJ2A 2E21A 2P9HA 1CKEA 4YAKA 2OBNA 3UVEA 2CFRA 1GWNA 2CHVA 2HRZA 2I4RA 4G0YA 2PRIA 3I2JA 1E4OA 4JOBA 1BFDA 4G23A 3ZIAD 1U2TA 1RWPA 3KTAA 4M6WB 5HUQA 3DXYA 1T8TA 1E69A 1K8YB 4KMRA 4P0QB 2OO7A 3HO6A 3BMNB 3HWWA 1I0LA 3FBWA 5TGTA 6LDHA 1USGA 4M3NA 4DVJA 2X58A 2WF9A 5BT8A 3ANSA 1BSVA 4LE2A 2ZUVA 3VZDA 2QZ9A 3TSOA 1D4AA 3BA1A 2PJZA 4M1EA 1IQ0A 2LRHA 3T3DA 3S3TA 1FFYA 2W43A 4G26A 4ZKEA 1E0JA 5JRZA 3HYRA 1AGXA 3HPRA 4JL8A 5DSXA 5LP6B 2VK4A 4EOGA 5K8CA 4CEIA 2BR3A 3KYCA 1HOXA 2VJNA 1PRYA 1W4LA 1RKUA 3EQ2A 3EMKA 3H18A 3STUA 5F23A 2POQX 1C7FA 4W8HA 1QIEA 2GEBA 2OC9A 4ZIRB 3QE0A 3EGOA 2O59A 4H1HA 3LQRA 5DVZA 4BZXA 4MCJA 1KI9A 1PQWA 3JQPA 4GXRA 1JZQA 2F67A 2G4CA 3NTQA 4HDKA 2XCRB 5IRCD 4DMRA 4P2BA 4JJ6A 4XRRA 1CS0B 1E1QA 2OPHA 1QHNA 1ZISA 4I99A 4EF5A 4GX5A 3F3KA 3G8DA 4J2TA 3R09A 5B1HA 3EF3A 4PHFA 3L4BA 2WWWA 3C4VA 5LQJA 1IUOA 1CZOA 4N5NA 1QYWA 1TLLA 2INGX 3LHIA 2V7VA 4JYCA 1T9GS 1GKKA 2I3BA 2YV1A 3CZ5A 4G0ZA 2V54A 3SM9A 5DM60 4EX7A 5CB4A 4Q6BA 2ZI3A 3PI7A 3TQOA 1E1KA 4CLRB 5D3MA 5H70A 3IJEB 3T4XA 4PTLA 4TMFA 1U3VA 1E2GA 1DP4A 1KH1A 3KZNA 4PSCA 1HLFA 5CFLA 3A2MA 1SR8A 3JATA 3OU7A 4B76A 1UZUA 4IIYA 1QVAA 1GAEO 3AZQA 3I9FA 3FLBA 3ND5A 3NEAA 4N4AA 3TKLA 2NXCA 2CEAA 5BWCA 4ZTZB 3A1EA 4CU5A 3X1XA 3N28A 5HZMA 1RJ9A 3ROGA 2ETXA 4AMZA 3FFBA 4XQ0A 1OHHA 2QVCA 1PJ8A 3R76A 1KDRA 4LZPA 3FOCA 1J5PA 1SWWA 3RDPA 3ZZUA 5JS6A 2XX3A 1RJWA 1R88A 3FCAA 4WXMA 1GGJA 1UIMA 2NUAA 2QNIA 2QYSA 3N3AC 4X6UA 5GOTA 2HV8A 5KTRA 2PMEA 5KTOA 2OM2A 3BXEA 2EATA 4NDNE 4E5NA 1N4AA 4HWRA 2V8OA 4JUIA 5KPDA 2ZSDA 4GKKB 1ZXLA 4IKEA 5AM1A 2QBYB 1P9LA 3LHSA 1QS0B 1ZGHA 3PJEA 5C9ZA 3WBBA 3KKPA 4IQFA 3U4IA 4KOEC 4IH4A 3TE7A 1UZMA 1Y9AA 2ZUEA 5H83A 2VZ0A 3W6ZA 5G41A 5LNK6 2DQSA 3VSCA 4N01A 5JNLA 2EX0A 2R8XA 1GZVA 1RYEA 3KYIB 5DLQC 2CCKA 4PINA 1QANA 1S4QA 3CPEA 3KJXA 5EIOA 3UM9A 4UHBA 1HQDA 3KZ1E 3CIFA 3JZIA 3PHJA 3WNZA 4J0EA 5ARDA 5IBCA 1ABFA 4R6XA 4F84A 5KYGA 1D2GA 2O7NA 5C52B 5ESWA 1H66A 1NBAA 1BO6A 2HRDA 5AI0A 2VKQA 2BFEB 3HO8A 5SY9A 4LXIA 2I9KA 5KS2A 5LJLA 2DWPA 2PANA 3K31A 3OE4A 1QGAA 5EMKA 2AZMA 1B6GA 1N6HA 2VHXA 4RHTA 5F7XA 4KMMA 4WGGA 3AR7A 1YZGA 4PBTA 4O02B 1GZDA 3JYLA 2XA1A 2N3ZA 1L7OA 5JCOA 5BPFA 4RD4A 3K5IA 5JDIA 2WWYA 5I7AA 4DLPA 4UU8A 4HH4A 1ULTA 1TUGA 3K05A 2WDPA 1QHEA 5FBRB 1L5KA 3UXMA 3TR5A 4CGYA 4EGSA 1MQ9A 3GJ7A 5ILOA 1ODJA 3RSGA 2B1GA 1VMIA 3BWXA 3WGKA 3OT1A 2FFBA 1CDEA 2NAPA 3R5TA 4UE6A 4BRWA 2BGRA 5ADVA 4TZ0A 3H0CA 2V7BA 2XMGA 3EQ9A 3HR7A 4BP1A 1BCRA 1T0BA 1T9BA 1Q0QA 1M34E 3MTIA 4K6MA 3RKUA 2R97A 2WTMA 3GRVA 1V35A 1JG7A 4DTIA 5THQA 4RQTA 1KQNA 4QOGA 1FVOA 3ZU5A 5EVCA 1X15A 3WQHA 4CPDA 5C7OO 3EF1A 4H77A 1AQYA 1CY6A 2IHZA 3NETA 3QTBA 1EX9A 4XIFA 3RUHA 4JBIA 1XCJA 2EGUA 3G0CA 1H1LA 1ZM4A 3CZCA 3BCSA 3JALA 3AIIA 3R20A 1HGXA 4BFVA 3DUFA 4FBLA 3HC7A 3L6UA 4CV3A 1Q44A 1Y9ZA 3HFJA 3PFCA 1L5GB 4PC2A 5JSQA 1P80A 4BXOB 4B8WA 1QPZA 1EIWA 3EB9A 2RFLA 5BV0A 4WECA 1OFUX 1XPUA 3WSVA 1CRZA 1KXZA 5K3DA 5GV8A 2QAIA 4Q47A 1M6EX 2PNJA 5I3CA 5KJFA 1VJRA 1M33A 4LCBA 3USZA 3T0IA 3HWSA 1K97A 2O3UA 1N5RA 1TQ4A 2UUPA 1Z37A 2VP4A 2H63A 2CE7A 2HRCA 3ESYA 3OIWA 2OAEA 3TMAA 3NIFB 3WKBA 3C6ZA 5M3BA 1M0WA 4BC1A 5HIAA 4J3NA 1E77A 3L3BA 1OXUA 4BNFA 3LUDA 5HKOA 3EF0A 4ZHQF 3B6KA 3MHPA 1Y6FA 1N3YA 4MS4B 1AK9A 2Q4RA 2RGNA 3DZDA 3VDNB 4ID9A 3LF2A 4YQYA 2IS6A 1SQSA 3HZOA 1N0VC 1XL1A 1KYIA 3RYIA 3CNOA 4DPMA 3E7XA 2PX2A 4O8ZA 1N5JA 4L0MA 3U0VA 4ZGWA 5LQRA 3LGXA 1ZN2A 3OY7A 4IJQA 4Q9AA 4E51A 1RLUA 1G0OA 3LO8A 2XNHA 3H19A 4UXHA 3OSZA 5TMPA 5H7XA 5KNBD 3O4VA 3A05A 4RV5A 4PR3A 4QGHA 5EE9A 1WY7A 1IOZA 2DLNA 3EY4A 3T7AA 4ALNA 5EJ7A 1NURA 3GPCA 2HA0A 1R4NA 1GUYA 2ZRDA 4LK3A 5IF3A 2IZ6A 3DP7A 1TIKA 4ND8A 4PSUA 3BE5A 1RMQA 5AOBA 5JSUA 9LDTA 1MT3A 1EFRA 4I4LA 3PICA 1HT0A 3P27A 5J43A 2QSYA 2CLLB 3PDJA 3FWZA 4UFNA 3VVCA 1YVEI 3VTAA 5AVZA 1XA4A 2W58A 4NABA 1RXVA 3IVRA 3TZQA 1RQ2A 2HXYA 4F11A 2GF0A 4EPRA 1TJYA 1VL1A 1RPNA 3VR4D 2CXOA 2VNKA 1UUFA 3FUCA 1PSZA 4HQ0A 1P9NA 3LCMA 1U7WA 1R6DA 5CFZA 3A7EA 1EK2A 1V47A 1NI3A 3ONWA 2A35A 1JS1X 1NATA 3PD0A 4LE0A 2WOJA 4RK0A 4HATA 4IUBS 4LSWA 4FEGA 5TGDA 2QJWA 4Z53A 4TV8F 4FGZA 4YV7A 2QGZA 1BX0A 1JKIA 4GGPA 2IEZA 1K9SA 1TK3A 4J94A 4FZJA 4C05A 3NCHA 2CKMA 1YRWA 2OORC 3KKOA 4B2YA 4DRYA 2JGKA 2XKAA 1I1OA 1XMJA 3N58A 3OA2A 3P4UA 4PFQA 2FZ5A 2OOKA 3GJQA 3QH4A 2WKQA 3BEDA 3PDWA 4PXSA 3QKTA 5IBRA 3TZCA 3U7IA 1E59A 4ZQBA 1H0KA 3RRNA 1U3UA 3BD9A 3FHTA 1E3TA 3GLHB 2WU3A 3PNBA 5KKNB 3OQIB 3H3XA 1TPZA 4YPFA 3UYKA 1QWSA 3HSYA 1HDXA 4Q3EA 4OF4A 5CH8A 1VA5A 4QNNA 2FXIA 2EBUA 4LMAA 2J4CA 3CEAA 3KE9A 5F73A 2M1XA 1KDVA 2OBMA 4QQNA 3PEWA 3EZ7A 1QHXA 5DHUA 5FOWA 3G8AA 5DF1A 4R9NA 2VP0A 1BDBA 1SXJC 1GG2A 2F3QA 1KHHA 2Q7XA 4PXYA 5A71A 3RVQA 3W1VA 3MBKA 1KDZA 4DZZA 4GXQA 3D43A 1GKUB 3H1BA 4IG9A 2M6KA 1ZUNA 4FYXA 4GMFA 3WICA 5T8KA 3M8KA 2OQ2A 4ML3A 4MGIR 2G5TA 2Y76A 2MHCA 3A36A 4PZEA 2CSUA 1Z8FA 1HFEL 1ONNA 4IJ6A 5DW0A 5AT1A 3IL2A 2ZDGA 3W05A 4DCUA 4YUYA 2B21A 2WSSD 3ZV5A 4JP2A 4F3RA 1YZHA 5FWXA 2IH2A 4DLXA 4L6CA 4EMUA 2HYIC 1SA0A 2YJ6A 4IICA 2VHJA 4NPCA 3KLNA 2ZBEA 3OHMA 3ZE1B 4G25A 3ZTWA 3ZY4A 4EJFA 4F3TA 1VCMA 3HUTA 2Q46A 4X20A 4EZIA 1FDSA 1T3ZA 2Z95A 5AKYA 4NZZA 2XUDA 4M9QA 5F1OA 5K0BA 4XCVA 3RTBA 3COVA 3GFVA 4QZVA 1MFPA 2UYGA 5ALTA 4KIGA 4BLRA 1VOTA 4MW9A 3I0NA 4FFDA 3ZDDA 1RXYA 2QIPA 2ODAA 1JLLB 1KEUA 3ODGA 1Z2AA 2FB9A 2NX2A 1MTZA 2VJMB 3EGDB 1V11A 3IOMA 2BMDA 1U0GA 5B1YA 3AU8A 4Y9DA 5IKPA 4P4NA 4L72A 4EELA 1SCIA 2G8NA 2RB5A 5JAOA 4HF7A 3WHPA 1NW3A 3K70D 2QRNA 3K8OE 2QX9A 4O8CA 4QM7A 2GN8A 4DUPA 3ZDAA 2BFCB 3DVLA 3SS9X 5FPSA 3EQ8A 4L2IA 2APJA 5G02A 1Z6AA 2XUAA 2V98A 2A14A 2FOXA 3VC3A 2VUSA 1DHTA 2W5UA 3NTXA 1UC9A 2XB2A 2AC7A 2YWHA 1M73E 1RR6A 1DWOA 1AF4A 2IKQA 3SR3A 2BCGY 2HNAA 1V9LA 4IYRA 2C78A 1H85A 1VKHA 5AVYA 1SFRA 2P2CA 5EP4A 1JFFB 1NRXA 5BW6B 2HQBA 1Z0UA 1S96A 1QR2A 1R5OA 3HCWA 3JQGA 4IYJA 2GPJA 4B0OA 3MUNA 4O4HF 5I7FA 2ATXA 3I9V6 1E2HA 1G8SA 4ZJZA 2JLUA 3H1AA 3TVYA 4DYHA 9MHTA 2C99A 3CCFA 4EY7A 4QFMA 4WOJA 5L9AA 3IP3A 5TF0A 4EJMA 2G7ZA 4J1TC 3CVVA 3NC1C 1T26A 1ZM9A 2VWGA 1IQUA 2HNKA 1Y48E 1EWTA 3V8VA 5K8IA 5HVNA 2P75A 3GFTA 1A9OA 1NSFA 2O3TA 2W90A 1OY1A 3EBOA 3L06A 1XU7A 2EYQA 2NQ2C 2OHGA 4RNCA 4WUTA 4EFDA 1ZMTA 1OV6A 1RAIA 1M10A 4HGQA 4MW1A 3QFCA 3UKOA 1AGRA 2Q1SA 3RRFA 1NVWQ 1F51E 1PL0A 4HWGA 2WAOA 2ZAOA 1D2MA 5LDGA 3COWA 2QM0A 5FLKA 2VHVA 3IB3A 1ADCA 1QZXA 1PNRA 1LJUA 4JJEA 4QLOA 3OJFA 1HXHA 4KQ6A 1BVUA 4WKCA 4UTOA 3LXXA 4A5SA 4WJLA 5FBZA 3LTEA 2GZ1A 3JSAA 2XR1A 3NRCA 1CETA 1S3GA 1ADGA 1EE2A 3UY4A 4M8LA 5C46F 3ETHA 1P5RA 1DAOA 2ZCUA 3SYKA 1WG8A 4GWGA 1DO2A 2Q0QA 3H9EO 3TDKA 5JASA 4YHHB 4INAA 3E82A 4KLNA 1XDWA 2LV8A 3GDOA 1KOJA 5ADUS 4JY7A 5JH7A 2ZREA 1DJLA 4KXXA 2ZRNA 3WE7A 1WQ3A 4IJ5A 4MINA 5L7YA 1KI2A 4JXXA 5BN3B 1UODA 2DWOA 3G8BA 1N2ZA 5DNYB 1S8AA 3D1LA 2W70A 2GEDA 4F85A 1G8GA 1QJ4A 4QASA 1IB0A 3M70A 4H7EA 1R8XA 4I4TF 4BNUA 4MQEA 2CD9A 3TQFA 4AZ3A 2AUMA 3ENWA 4PSDA 3L0DA 2VTDA 3BMQA 4AD8A 3MQ4A 1WB9A 2GDZA 2Q6KA 2ZDQA 2BGTA 2PZBA 1IEXA 3B20A 1KQPA 3RRXA 3U31A 3IUQA 4MDYA 1QH1B 1Y89A 2R48A 4L51A 2Q3BA 2I1VB 3I5AA 4OYHA 4P22A 3RARA 5FOQA 5KYUB 5KZMB 1RM4A 4YUAA 1OFHA 3I6YA 5E2BA 1ST3A 1NLFA 2K7ZA 4D0NA 4DC0A 5LQKA 1V6CA 4DG8A 3D4BA 2Q4TA 5FI1B 4WNCA 4EHFA 2PX6A 3V2GA 1XQ1A 5H0IA 3E22A 4KO8A 3W79A 4CM4B 4HNHA 5TVKA 1UAYA 3OU2A 4ZRDA 1AQLA 4L3OA 1HYGA 1O03A 5A0VA 1N5IA 1COWD 2PRJA 3PR1A 2XADA 4YN3A 5BO5A 1Q83A 4E5KA 4W63A 2XQJA 3C39A 4BMNA 2JCBA 3OUUA 4LJAA 1SPBS 3WWYA 5A9SA 1FY2A 2A57A 1Y5LA 5GP1A 4EB6B 1A9RA 1TVKB 2QXTA 1G3RA 1CFZA 4MVJI 2QE6A 1C81A 4RTNA 2I2FA 1H8HD 1NVVQ 4LOJA 2EC5A 4MI6A 3JYOA 1J5XA 4LBWA 3U4DA 5JDCC 3ND8A 4XJVA 2EP5A 1FMTA 1PEDA 1HNXB 2IUUA 3ZCVA 4ITRC 1ZMRA 3KPYA 4JI1B 4ZCMA 3UB2A 4W7SA 3RJTA 4UW9A 2Y0EA 3KQHA 3R7DA 1EXDA 3C7TA 2FDRA 4ER3A 3RYTC 3PDHA 3QBTA 1W8IA 4ZV7A 1EWYA 1GNTA 2C97A 4UCFA 2D7DA 2WPDA 1A2QA 2BE7A 1VECA 2QU7A 4EJ6A 3IHKA 1IN6A 1WE2A 1H1TA 1H0SA 1O6FA 2Y1FA 4PZCA 4LSMA 2ZUUA 1E6CA 1CR0A 1F9EA 4TL7A 1MC1A 1TYEB 3QV1A 2IYNA 3OCUA 1PZMA 1PGNA 5IZCC 5IPFA 5DTJA 3WKCA 4GMXA 1GPUA 1IVNA 1I36A 2AWOA 2Q27A 3U7QB 2NO6A 3PJRA 3PYLA 4JLMA 3M1LA 4Q7MB 1U5AA 2JFPA 3H99A 3A0RB 3GCWA 1SEVA 3NM4A 1QQ6A 1I5EA 4GAEA 2XIJA 1K5GA 4UARA 5G3YA 3NAZA 1L7RA 3JWEA 4M7WA 3O8LA 2IE8A 5GPBA 5B58C 2B37A 1ZMOA 4Q34A 4IX1A 3GJ8A 2YWXA 3AG5A 4J75A 4LDAA 1CUAA 4A16A 1UCFA 4UTNA 4HX2A 2VH2A 3NIDB 1HZZC 3LYAA 4C0QC 2JCVA 5KNDD 1WMSA 2AL7A 4F5EA 1W5FA 2XMDA 2VJPA 8GPBA 2ZRCA 4L3WA 3WBKA 1TA9A 3PEYA 5F33A 1PTKA 3SS8A 3G6KA 2PJRA 3TSCA 1SO8A 2I65A 2H57A 4KB5A 2HLNA 1XTUA 3ZWXA 3SSAA 3OCYA 1NKTA 3D64A 3ESCA 1PHPA 4CQMA 4X65B 2PUFA 1WCIA 3DEKA 4FBGA 4M9ZA 4NCXA 3VOTA 2QL6A 5AI6A 1E99A 2XWPA 3ORHA 3TZEA 3ZWBA 3O4RA 2R6JA 1MAHA 4H6PA 4LMRA 4AKEA 3D6AA 3NOXA 3JD3A 1L1QA 4X63A 4D3YA 1X3SA 2SNIE 3OKPA 5GONB 3THWA 3IA7A 4AG3A 1AHIA 1BX1A 3P52A 1ZVQA 2G17A 5EWJB 3PYXA 1G1AA 3FSGA 1CQZA 3ZE2B 4EENA 1KVSA 2PXCA 1E5VA 4Q19A 4ONEA 5F5LA 1QH9A 3BXOA 1A2KC 3HJRA 4RW0A 1VPEA 1NVAA 2QX4A 4LQCA 5BYBA 2V3VA 5JYEA 2UZ1B 1L4YA 2YNMC 1PFVA 3NRJA 4D25A 2A1TR 4GL2A 3F5QA 2Y9MB 4MRNA 2N1MA 2PUCA 1TD9A 5BQFA 3N0VA 2OC4A 3TNYA 3HDHA 1WDTA 4JXZA 1WMAA 3COZA 1Z6YA 4BXOA 2O8BA 9LDBA 1SK9A 3H1EA 5DI3A 3LTNC 3WQSB 1P2TA 8ATCA 1X2EA 1U11A 4X97A 3QE3A 3SIRA 2R3SA 1QFYA 4G37A 4IWNA 5DTMA 3HKBB 4DUZB 1TAUA 1T4CA 5I9IA 5GJBA 1Y6JA 2F55A 1DT5A 2IWHA 3GRFA 4UHFA 3F97A 2PH1A 2XQGA 1T5OA 3TUZC 1PYOA 1GPYA 2CMKA 3G0OA 3WA6A 1EMDA 3EYAA 1NUTA 1YAHA 4HV4A 3IQHX 5ED0A 3OMLA 1OLUB 2QMOA 4GKJB 2K4MA 2QUHA 1OXKB 2WTAA 1XV5A 2H2WA 4L5AA 2PWAA 3QQ5A 5HIMA 1E64A 4I5EA 1ZK4A 3A32A 2WW8A 1NTOA 3Q8WA 3WNQA 3QTLA 2YIMA 2NTJA 2R7LA 4M87A 2VG8A 3EW7A 3PRJA 3WHLA 3W2IA 1E1MA 1U2ZA 1P3DA 2PVCA 2QP9X 3TR0A 5A62A 1A71A 3Q8LA 4MWBA 2YRXA 1CE8A 1W59A 3G9TA 5FJJA 2B2NA 4QTYA 3WHIA 1OA0A 4TQGA 5DCYA 3LVFO 3DHVA 3TZBA 2BZ0A 3HI4A 1ADYA 2ODTX 3M4XA 2COKA 5BSTA 3LUHA 3K9GA 1OTHA 1C1XB 3BCHA 1ODFA 3DE4X 4G1MB 3KU1A 4NMLA 1WW8A 1T8UA 3ZI4A 5E9AA 2ZJZA 1U0FA 5CVDA 1PGPA 3CKLA 1PJLA 4EO4A 4POOA 2C1XA 4RANA 3THRA 4JJIA 3VRHA 2ZJ4A 3OTHA 4F0JA 5K99A 1I7PA 2V96A 2ZSAA 4E3WA 1VCNA 2XQIA 1G9SA 4X41A 3EHEA 4GS5A 1BFKA 1I2ZA 2QSJA 4KN6A 5D86A 4PHCA 4ZQGA 3S2ZA 4LDZA 2KB0A 3L7KA 5BSGA 5T3YA 1B74A 2CJWB 2VNAA 3OOYA 4C6TB 1CRPA 2CFTA 1CQIB 4D44A 1E3WA 4EJ2A 3K8ZA 4GHWA 4O2AB 5FO1A 2HWKA 2O0JA 4AN1A 3GLGA 5EAIA 3TOSA 1BEEA 4HAUA 1UMBB 3KT3A 2LGJA 5FOVA 5ARCA 4EHDA 1FX1A 4Y1RA 2IEIA 3OZGA 4B9EA 3SFVA 4DIUA 4KQHA 2B2CA 5SYMA 1QYIA 2GLUA 4DV6B 1C2YA 1DQYA 1Z62A 4J76A 4MWEA 1BMQA 5GGYA 3PE6A 1RYZA 3D31A 3NKVA 4C21A 3JYPA 4OU4A 4P35A 2I6SA 1R66A 2GWHA 1O0SA 3IIMA 3WL8A 2CKDA 4WAUA 2P3LA 3IEPA 1G19A 2VPWA 3MGKA 4I5DA 3VGPA 1TLTA 2V7UA 3HACA 4IINA 2I4TA 5H3LA 2Z8YA 3BBLA 3OIVA 1HNZB 5ABPA 1I5OA 3QXHA 4E1BA 4K87A 4OSEA 4F96A 2Z4RA 2CLIB 3L7JA 5JXJA 1RHMA 2R5FA 3MD9A 4YMIA 2NUTB 4JQOA 3SX0A 4A8HA 4F8EA 2Z43A 3KJFA 3SD7A 4AUMA 4I6GA 1RE1A 1I9CA 2AE2A 3L8GA 1IY2A 3QVWA 4KHZA 5TPZA 3KZXA 3VVBA 3WVNA 5KYXB 1DELA 2POCA 4PX2A 2J3QA 2XRYA 3FSRA 2EZTA 3UCEA 4DTCA 3IMFA 2LVBA 1BXGB 4Q1AA 1EINA 2JI6A 3HKCB 1QP4A 5IKMA 3ETLA 5B55A 3BMXA 3R6DA 4HTFA 2E87A 4TLLB 3D81A 1LZLA 1XNJA 3A04A 1YASA 3O73A 2FZWA 4IPTA 4DLNA 1U7XA 2C4VA 5LQAA 2XRZA 3B1ZA 1ZGBA 2BGKA 3IR6A 2XNDA 3ZK7A 5AH0A 5LFAA 2SECE 4DRXB 2J0SA 3K53A 1TFUA 3AR2A 3IAM1 3MWDA 1MX9A 4FFNA 5EMNA 1YR1A 2C5HA 1R9JA 2W11A 2W2KA 5FWYA 5TQVA 4AN0A 1APBA 5HRAA 4GM1A 3LIPA 4KBFA 4DGQA 1YDHA 2YHBA 5B30A 2IU6A 5CNIA 3U6BA 3O83A 4G63A 3D0OA 4X1OA 2NVOA 2HK6A 3MTQA 3A58B 3E7WA 4LC9A 4WXRA 4XJSA 2QB5A 3BGOS 5JALA 1P29A 3BRWD 4QDZA 4FNMA 1CNFA 2PBLA 3B7GA 5TDHA 1YCHA 2C9YA 3ZWVA 3LY7A 4TYPA 4CMEC 2HHLA 3FB1A 5TARA 1W48A 4RQUA 4TMZA 2BKEA 4C7OB 1MEEA 1BRTA 2GD0A 1D0IA 3PIIA 4Q15A 3WRWA 1I3LA 2FUG1 5KUTA 3BGSA 4XCQA 4DIDA 4OKIA 1U28C 4RJLA 2JLXA 3LK7A 3O95A 3DFFA 4DMHA 1OXXK 3S2IA 3T34A 3HCCA 1K8XB 4UEOA 3NHFA 4P34A 5FUXA 5AD1A 2FN4A 3O8DA 4OH1A 4RPLA 2W0SA 3ZTYA 2WLTA 4MITA 4PM4A 2B7BA 2IOFK 2D6FA 5C53B 1ZGAA 3R3YA 3VYVA 1CJKC 3DZCA 3H1PA 1FP7A 4N0QA 1WHSB 4MB0A 3BGVA 1SCJA 2AZXA 2OFPA 2I29A 3R5FA 3HYLA 3SX2A 2WQ7A 2DPLA 1QBKC 3PUJA 5EYPB 2CMHA 621PA 2FFRA 1EFTA 1PUIA 2GNPA 3ZXSA 1XR3A 3ZJ5A 2PQ2A 3CURA 1KBZA 4MWDA 1DADA 1Z3CA 1GVHA 1R64A 5BQOA 2XTNA 3L9WA 4UUAA 5K3BA 4HXYA 1L9KA 1GCUA 2ZWOA 3HB5X 3QLEA 3CUSA 1MO2A 3T9AA 1O95C 3DBOB 3O1LA 2PUAA 2VUUA 4US1R 3KLOA 3EFOA 4DMLA 5KMGB 3I42A 4DR1B 1QVRA 4E03A 1G6Q1 4RA9B 2XNCA 4C4RA 4YJFA 2WKWA 2PAAA 2XYGA 4V0KA 3T9DA 3GQVA 4CT0A 2YFQA 5B2EA 3KB2A 4ZFNA 1DG9A 3DOIA 5JQGB 5H8WA 2FW1A 2J3IA 4IY1A 4LC0A 1SBCA 1ORDA 2NNLD 1GTJ1 3S2SA 4KN5A 4BNYA 4L4SA 4EHNA 3H4TA 4KI0A 3B7PA 5I51A 1KGDA 4EY5A 4IRXA 2UZ0A 3Q7TA 4R2XA 3OLYA 3L46A 4RTPA 5A7FA 1KR5A 5KVQA 3OJWA 3REGA 1ZCAA 4GX1A 2OXIA 1NHWA 1O1YA 1RQLA 3LKZA 3VNAA 4D96A 4EG5A 2H4WA 4I1VA 3AHEA 4OJYA 3SHTA 1VC2A 1LBQA 2FRDA 1RTKA 4D3SA 4D98A 4Z1OA 1ACLA 5KKAA 3ZXYA 1T2CA 4LOLA 3L43A 4D4HA 4NECA 4CT5A 1V1JA 3JR3A 1NOKA 1OGJA 4BUZA 4B6SA 1HDGO 1ZC4A 1HEYA 3GVCA 3O84A 1RXIA 1RZUA 2WIAA 3DH0A 3RHZA 3NCTA 2BFWA 5CIYA 3AQIA 1DO8A 1AC5A 1ISHA 1OV4A 1ZXBA 4E2ZA 2HBYA 3QV2A 2OHIA 2OZEA 1XZHA 3FOBA 1PR3A 2C9DA 2C77A 5L3SA 1N2IA 1E5QA 1XRRA 3V7NA 1X7XA 1GUDA 2C0CA 3FUUA 1JLRA 4BO0A 2LTAA 1RQGA 2Y4OA 4FWBA 3QKSB 1KIMA 2H06A 5FL7A 4AXXA 1SQ6A 2H1SA 4CM1A 4HVLA 721PA 5L4SA 1JSCA 1L4GA 3UT0A 3AESB 2BPOA 5CURA 5C81A 3ACCA 3BTVA 1W0CA 3AKYA 4I4CA 2DLCX 5F5XA 2FPPB 4LRTB 1JTFA 1II9A 4X62B 2M6RA 5E38A 2D62A 1NBWB 1Y6QA 1YRQA 2X1MA 4H9GA 1LNZA 4JAVC 2P2NA 1QX3A 2QRHA 1O6CA 3CZQA 3I0MA 2W2OA 3VDXA 1XEXA 3G3EA 4FYKA 5K3FA 1SCAA 2Z5FA 3HO1A 1RQPA 2X8JA 4QDOA 1VLHA 5EP3A 5BQ3A 1UKCA 3V1NA 5IJ0A 1SCBA 5EQFA 3V00A 2J3LA 3LAWA 2AC2A 1K0FA 1QFSA 2WHPA 3K2QA 2V58A 3HP1A 3FH0A 1PQPA 4RLSA 5E6UA 1QP0A 5T64A 2C0PA 2XGSA 3EC2A 4C03A 3PNOA 2QM7A 2OZLA 4ZWNA 1X87A 4X8LA 2F3SA 3BICA 1NHGA 4OHVA 5KI6A 3ZU6A 5DASA 3GNSA 3Q12A 3GEPA 3EDCA 1R6BX 4OBXA 1BE8A 2YX1A 4J7CA 1QBGA 4BPRA 1FSSA 5JFOA 5JDCA 1PS0A 3AVWA 3GAZA 4HNVA 3A9SA 5D1HA 5K4HA 1MC4A 2H3EA 1M8GA 3QPCA 5B53A 3ZQUA 4BBZA 4EK9A 3AHJA 3T5DA 3ZOZA 3PIRA 1F38A 2HY7A 3GBPA 3W8EA 2WSMA 2IKSA 1DAKA 2C92A 2MR6A 2QL7A 3H5RA 2WSLA 3KXIA 1JT2A 3NNDA 4OQLA 4QAJA 4XX1A 3GLFA 2HFKA 5ALIA 4R2JA 1NM5C 4S1PA 3A8TA 1ESCA 3SXPA 3A6KA 2Z8YM 4CLOB 1CY0A 1YCDA 4G1VA 4DV5B 1T5SA 2WD7A 4ODIA 4OQPA 1T6YA 3LVQE 4URHA 3UMCA 2XODA 4CJXA 5CAEA 5IZCA 3TRIA 4DR2B 2R87A 1V95A 2C9CA 1XMVA 3AHHA 1N3LA 3N39C 3OD5A 1OT5A 3AONB 5ALPA 1JAHA 2KHZA 5GGXA 1WMEA 1PT8A 4C3UA 3SC6A 3N7UA 3NC4A 4FYPA 3T38A 3RJMA 3QSYA 2O8DB 2Y1XA 5BWNA 3UFXA 2I54A 1OCEA 4GBED 3KJGA 1QRSA 4HEQA 2QJOA 3SYTA 1JQDA 4UTZA 3AETA 4OI2A 4A91A 1YJBA 5C1DA 5JAPA 3OOHA 4MKFA 2IHYA 2P9ZA 3VR5H 2C9BA 3QRWA 3OWOA 5C31A 4ARBA 1TPYA 2A84A 4Y9TA 4DQ0A 4BNIA 4BNDA 1HZZA 2ZYVX 3OLZA 4H4CA 3RJ9A 1XTIA 1KI8A 4KVFA 4IGFA 4W5TA 5IF9A 1RAEA 1VE1A 2JLRA 3N0TA 2VBCA 3S6JA 3SXUA 3ZCQA 2VJYA 1QYXA 4ZCQA 1ELOA 3QELA 2LW7A 2XYQA 5BT9A 5TT0A 3WLMA 4D8WA 5AJHA 2I4NA 2JGFA 2DUJA 3LP6A 4ON9A 1T24A 2ADFA 4EG1A 1Z5UA 3OQHA 4AU1A 1K27A 3O8OB 1UZLA 4Q3CA 1WIWA 2TECE 5T4EA 2FF7A 3ZZNA 2CJFA 1B2RA 4N39A 1G5TA 4WINA 1G7CA 2G67A 1T1RA 4LFCB 1HETA 2BSXA 3P7MA 4ZDWA 4WL0A 2P65A 1UC8A 4GGOA 4GQBA 5DBEX 3V4SA 4ZVTA 3LDFA 1AXEA 2FUNB 2AEJA 4K6HA 3B1XA 3I53A 4GUAA 4QBIA 2X9GA 3JSXA 4ZVRA 3RVLA 4O5OA 3MWKA 3NP9A 2X13A 3INGA 3N74A 4KV7A 4PYNA 1A4RA 4KQKA 4CKCA 3GYBA 4JVMA 5ER9A 2B9EA 2R8PA 1JEYB 2VKTA 2ZETA 4FT4A 3CUYA 5K3CA 3WYDA 3RG2A 3ZHYA 2I2CA 2ACWA 1FVHA 1XDGA 4EMTA 3TBKA 1I13A 3ZXIA 4G3XA 4EW3A 3UV6A 1K7CA 3VUFA 1LLQA 5SY4A 4OHUA 4L4UA 3FPBA 2PA0A 1NG9A 1IB6A 2CVHA 3QOXA 5EMJA 4ZVVA 5L3VA 1KVRA 4EG7A 1XDSA 1XVIA 4KVZA 5CU7A 3NGXA 5AKHA 1KDYA 5DK4A 1F2UA 3L5OA 4XWWA 4YJGA 4EPWA 1XAHA 2B92A 1U9IC 5FUWA 1CD5A 3HB7A 1JDBB 3V8BA 1PR9A 3ZLBA 4BFLA 1PR4A 4I1YA 4FGLA 1CERA 1GILA 1KY5A 2IY8A 5DKFA 3K20A 4M4SA 3DKVA 1FW8A 4JNKA 4YRJA 4M1KA 2OVFA 1DRUA 3ZYZA 4IVPA 3QW2A 2PLRA 2WYIA 3KD3A 4W1PA 4XJTA 2A5DA 4HADA 3U62A 1OAAA 2CUTA 3LX5A 3SI7A 2W6JD 5EWMB 1AKVA 3WV5A 1XEAA 4NZ9A 3MFQA 3D4PA 4J29A 4KYIB 3FYTA 2XXJA 2JAOA 4CTKA 1YZUA 4IHJA 4HYTA 2AFHE 2NPOA 4BMVA 3AGQA 1Y7IA 4AJJA 3M2TA 1GN8A 3GAMA 4YJ3A 1L1RA 2C31A 4Y2JA 2OZKA 4RLHA 3VOSA 1JVSA 1JIVA 4JC0A 4XD7D 4XGNA 3T94A 1GTSA 4BLTA 1ESZA 2OCBA 2OGZA 3I4LA 3H3JA 3WP0A 2AOUB 4H1TA 1EYZA 4MPTA 4C6HA 2ZUCA 2VDWB 5KOHB 4KK3A 3ER9A 2VF4X 1H2RS 2ASVA 2IDKA 2EKZA 3LHKA 3LQYA 4JKYA 1MDBA 4F04A 1RP1A 4ZAFA 1H3FA 1Q11A 1ZM7A 2H52A 1YKFA 3AM5A 4G5RA 4MULA 2Z83A 1YOVB 3PUYA 3WZLA 4Z9XA 5EZYA 1B0PA 2D2VA 4U7FA 3R0IA 1BA3A 1VJ5A 2N42A 2VT6A 3H5OA 2QL5A 5HKAA 1XMPA 3S1SA 4GOLD 1S0UA 3W6UA 1TTTA 3HG7A 4H1UA 3PEEA 4OQDA 1X7YB 4KWEA 3QMWA 3ZDZB 1ZY2A 3FOFC 1EG7A 4B45A 4GYYA 3K9HA 4OQNA 3T9CA 4B48A 5ALKA 1YZKA 5E2AA 3SEQA 1DTEA 1RRVA 2O8NA 1XMXA 2G5G