3BWBA

Crystal structure of the apo form of spermidine synthase from trypanosoma cruzi at 2.5 a resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
291
structure length
288
Chain Sequence
SELISGGWFREENDQWPGQAMSLRVEKVLYDAPTKFQHLTIFESDPKGPWGTVMALDGCIQVTDYDEFVYHEVLGHTSLCSHPKPERVLIIGGGDGGVLREVLRHGTVEHCDLVDIDGEVMEQSKQHFPQISRSLADPRATVRVGDGLAFVRQTPDNTYDVVIIDTTDPASKLFGEAFYKDVLRILKPDGICCNQGESIWLDLELIEKMSRFIRETGFASVQYALMHVPTYPCGSIGTLVCSKKAGVDVTKPLRPVEDMPFAKDLKYYDSEMHKASFALPRFARHINN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of spermidine synthase from Trypanosoma cruzi.
rcsb
source organism Trypanosoma cruzi
molecule tags Transferase
molecule keywords Spermidine synthase
total genus 82
structure length 288
sequence length 291
chains with identical sequence B
ec nomenclature ec 2.5.1.16: Spermidine synthase.
pdb deposition date 2008-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 3bwbA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3bwbA02
1R8YA 4FGZA 4JXJA 5FA8A 3TKYA 4QTUB 3BUSA 4R6XA 3KKZA 3NDJA 4X60A 1X1BA 1JQEA 1AQJA 4RVHA 3HVKA 4MTLA 3FTFA 2PX5A 3G2QA 4CTJA 5CCBA 3TQSA 1RJFA 3HVIA 4E70A 4PYJA 2XVMA 4GF5A 2UYCA 1X1AA 3DP7A 5MHTA 1XVAA 2JJQA 5HIJA 4PYNA 1KIAA 1R18A 1D2HA 2B9EA 5DSTA 3UJDA 5LQRA 1F38A 1EJ6A 2C7OA 3UZUA 4HGYA 2OO3A 1KHHA 3ELYA 5E2AA 3FUVA 2WA2A 4V0QA 4OBWA 4RTOA 1SG9A 3MERA 2XYRA 2JH9A 3DXXA 3B5IA 3KQQA 2IH5A 4PWYA 1KPIA 2H00A 3UWPA 2ZZMA 4A6EA 3DOUA 5FHRA 3FRIA 4DKJA 3JWHA 4FS8A 3UJBA 4RTSA 2IBSA 4C03A 1L1EA 2ZIGA 5C0OE 4Y30A 2ZWAA 1NV8A 2YVLA 3EVFA 3M70A 4XUDA 2NXEA 3K0BA 1U2ZA 4WXHA 4EQZA 1X19A 5LQCA 4E2ZA 2ZCJA 4R8RA 1Z3CA 3LCVB 2ESRA 1EAMA 1OR8A 4POOA 2JG3A 4PIPA 2VZ9A 4U7TB 3ELUA 3B7PA 4Z2YA 4PYOA 1NE2A 3PS9A 4H0NA 3L8DA 1HNNA 3AXTA 1QAOA 3FPGA 3LSTA 3T7TA 4MIKA 4CKCA 5CIYA 4RTKA 2C7QA 5D1HA 1NW3A 2QM3A 1JTEA 4RTLA 2AN4A 2AOTB 2BM8A 2QYOA 3HCDA 1QZZA 3EVAA 4Y2HA 2AVNA 1V39A 3THRA 3C6MA 2YXDA 1QYRA 2PKWA 5C9ZA 5U4XA 2OB1A 2E5WA 1O54A 3I5UA 2LD4A 3OPNA 1D2GA 2AN5A 2YXLA 4LG1A 5DX1A 5T64A 3UJ8A 4EMSA 2ZBQA 3KQPA 4HRAA 4HC4A 1WS6A 4YUXA 1YZ3A 2YUIA 5EMJA 1RJEA 3UA3A 1F3LA 5HIMA 4IV0A 3LBYA 3OFJA 4KDRA 3PB3A 3T7SA 4RSRA 5GIPE 1BC5A 3QOWA 3MCTA 5E8JA 2Z6QA 5DRYA 4RTJA 1MJFA 2JH8A 2FHPA 3MTEA 3PVCA 4R05A 1WG8A 2Y1WA 3KPWA 4FSDA 2OY0A 5FUBA 2ZTHA 3ER8A 5EZQA 3ME5A 5FA5A 2GA9A 3T0IA 3LKZA 3SR4A 2ZWVA 4RX1A 2AOXA 4RV9A 5DM4A 5K0JA 5K0GA 1FP1D 1G8SA 1NBHA 2PWYA 4CXMA 3C3YA 3DMFA 4QTTB 3OFKA 2XYVA 4M36A 4HTFB 1EQAA 2VP3A 5FULA 4ER0A 4EKIA 4HG2A 3E05A 4E30A 1JSZA 1N7IA 3FUTA 3O4FA 3FUXA 4BLUA 1I9GA 5CVJA 4CTKA 3RW9A 4RTRA 2Q41A 5KQSA 1SVUA 4X41A 2P41A 1BKYA 3QV2A 3UJCA 3FTEA 2ADMA 2HWKA 1UFKA 1XCJA 3BWMA 3ID6C 4RTQA 1SQGA 4EK9A 5E1BA 3P2EA 2IIPA 3PTAA 1G38A 7MHTA 3GXOA 3LHDA 3EVZA 3V8VA 2PX8A 5DTQA 2NP6A 2ZFUA 3GCZA 2IDKA 1DCTA 2EX4A 4O29A 1B42A 3CKKA 4X63A 3KPVA 3EVGA 3P9CA 4QVKA 5HILA 1AF7A 3TR6A 3A4TA 2CWWA 5EVJA 4RVGA 3B3JA 3DULA 4X1OA 2BZGA 5BP7A 4KDCA 5C1IA 3F4KA 3HVJA 4E33A 2ZZNA 2ZULA 2R3SA 4ER6A 2VDUE 1IXKA 3P71T 4C4AA 2NNWB 2PY6A 3KU1A 2QRVB 3P2KA 3DUWA 4CWAA 3MTIA 5DX0A 3GRRA 2AOVA 5EHGA 3GRVA 3LKDA 2AN3A 1WXWA 3I64A 4RTMA 5HZMA 1M6EX 4P58A 3SGLA 3ELWA 3KPUA 2PT6A 1RI5A 3CCFA 3LGAA 4XUCA 5T6BA 1RI3A 2B3TA 2HMYB 3LPMA 3OU2A 3O7WA 4PIMA 4RVDA 5K8VA 1ZKDA 2ZIEA 2NP7A 5FADA 4OX9Y 5GWXA 3BWCA 2PX2A 3HM2A 1FJXA 2QE6A 1VIDA 3HCFA 1P1BA 1BHJA 2AZTA 2GB4A 1BOOA 2YTZA 3EEYA 1JG3A 4FSXA 5GM1A 2G71A 2PJDA 2VDWA 3OU7A 2UYHA 3DXZA 3LDGA 2BR5A 2NXJA 3OE5A 4GOND 4GOLD 2IPXA 3ORHA 5DSXA 2IP2A 2Z6AA 2B2CA 1KP9A 3QOXA 4PONA 4R6WA 2HV9A 4G56A 2GPYA 2XYQA 2GH1A 3ERCA 1N7JA 1JG2A 2ZLBA 3EVCA 1VE3A 3M6UA 1INLA 2UYQA 4OBXA 3E23A 1Y8CA 2FK8A 5H02A 4DMGA 5E2BA 3GIWA 2PX4A 3EVBA 3O31A 5E9JA 5ICCA 1L3BA 1YB2A 3BT7A 4QDJA 2WA1A 1P39A 3HCCA 1JTFA 2B25A 3FTDA 2P1DA 1VP3A 1IY9A 2WK1A 3P9KA 5K0BA 5FHQA 1UIRA 3HCAA 4ER3A 3TRKA 3HTXA 2CMHA 1RI2A 5ICFA 1PRYA 4BLWA 2OPBA 4F85A 2AR0A 2ZW9A 5KS2A 1NKVA 2ONZA 1R6AA 1XTPA 1YZHA 5EKXA 1YFJA 2IFTA 3EGVA 3FUUA 5EMKA 5D1NA 1X1DA 3NW9A 5FCDA 4DA4A 4K6MA 3FTCA 3G7UA 5KQRA 3MQ2A 2C7RA 8MHTA 5EEHA 3P9NA 2G1PA 2IH2A 3TM4A 1M0EA 2IGTA 3JWIA 4KWCA 3TM5A 5EC8A 3A7DA 1AQIA 3V97A 4GOOD 4QVGA 4YMHA 2O0LA 3CVOA 3SMQA 5K05A 3LDFA 5GM2A 3TKAA 2PGXA 4E32A 1L9KA 3KQYA 4F86A 3G5LA 3THSA 3EGIA 5EIWA 5LR6A 4FZVA 1ZQ9A 3AXSA 2JHAA 4AZTA 4C07A 3R0QA 3KR9A 3KQVA 2FK7A 4YV0A 2ZVJA 3I58A 4KRGA 4OQDA 3A7EA 5ERGB 4KVZA 3TLJA 4CKBA 5K0EA 5CCXA 1KPGA 1XDUA 2PWPA 2NXCA 3FRHA 5DX8A 5LQJA 3R9XB 4EKGA 2KW5A 3P8ZA 5F2NA 3NJRA 5K0LA 3BZBA 5HIKA 2V7EA 4OA8A 3B89A 5E1OA 4MHTA 10MHA 2QY6A 3MHTA 2JHCA 1IM8A 1P91A 3X0DA 4BLVA 3PFGA 5B1SA 3KQTA 3DXYA 4BP1A 3I53A 4PYMA 5FTWA 2OXTA 2O07A 1M6YA 5EOVA 3VC1A 4U7PB 3VSEA 3WSTA 4QDKA 3UJ7A 2P3OA 3FPJA 4OQEA 5E1DA 5K09A 3HEMA 3OZSA 3PX2A 3G5TA 4P7GA 2IH4A 2BR4A 3MCZA 1FBNA 3LBFA 3OZTA 3KPYA 1AV6A 2AOTA 1WY7A 4C06A 4QPPA 4FR0A 3SXJA 5ICEA 3KR2A 3OCJA 1KPHA 5FWAA 4HSGA 4E2YA 3DLCA 5GIOE 3NTVA 2YX1A 4PGHA 4BY9E 3M4XA 2UYOA 2NXNA 1JSXA 3KR1A 2PXXA 5DM0A 5FQOA 3SSOA 5BXYA 2DPMA 1TPYA 3JWGA 2G8NA 3FUWA 4GC9A 3HCEA 1KYZA 2P3QA 3GNLA 3CJQA 3FPFA 3UFBA 4PYIA 3Q87B 4P7KA 1XDZA 2PXAA 3DLIA 2CMGA 5HOQA 3OE4A 5JUWA 5KVAA 3R6TA 1YUBA 1SKMA 5EMMA 3REOA 2AOWA 2I62A 3U81A 2PVCA 3LCCA 5F2OA 2O57A 2UZ4A 2PT9A 1YFLA 5K0FA 2I9KA 3IEIA 2N47A 5LQKA 4DCGA 2ZBPA 2B78A 4WVLA 4GOMD 2GS9A 3EEOA 3BGIA 1NV9A 3G8AA 2OZVA 4XUEA 3S68A 4RVFA 4AUKA 4GQBA 4RTNA 1DUSA 4AZVA 2CKDA 3EGEA 1Q0SA 2EG5A 1PJZA 2PBFA 2VS1A 3B3GA 2OYRA 1KR5A 3AJDA 2PSSA 3PLAE 1HMYA 4F84A 1ZHFA 4BP3A 4IWNA 3G2MA 3PT9A 3CBGA 3DMHA 1UWVA 3NVMB 4MQ4A 5DLYA 3HA7A 4YV2A 3ELDA 3MGGA 4LECA 1EJ0A 4QQNA 1SUIA 3C3PA 5LQNA 3ER9A 1SQFA 2EJUA 2BR3A 5IKMA 1VLMA 3OU6A 3G8BA 3FYCA 3R3HA 4KW7A 1WZNA 3G2PA 3HP7A 3SX0A 4ATNA 2R6ZA 3GRUA 1ZGAA 2CL5A 4AZSA 2G72A 4YUYA 4LWPA 2FRXA 2VDVE 2BH2A 5CM2Z 1NW6A 1H1DA 3G2OA 3HVHA 2ZZKA 2FPOA 3P97A 3CJTA 1JG1A 4C04A 5DM1A 2P40A 3BWYA 5HIIA 3BWBA 4A6DA 5BW5A 4M38A 3UBTA 3GGDA 4LWOA 3E7PA 2P3LA 2XVAA 2YR0A 3M33A 4GC5A 4RTPA 2HNKA 3A26A 4YUVA 2OBFA 3CJRA 3B3FA 3K6RA 5HFJA 4OA5A 4YUZA 3BKXA 5BW4A 3HCBA 3LCUA 2Z6UA 1RI1A 5HEKA 2ONYA 3EMDA 1FPQA 3R24A 1G55A 3KPJA 2QRVA 3TPZA 4X61A 1ZG3A 3LECA 4IKPA 3BGVA 4FP9A 3NWBA 5F2KA 1R8XA 5DXAA 4B17A 2NYUA 1ORIA 3EPPA 1EIZA 5CVDA 4KIFA 4KIGA 1XDSA 3D2LA 3E8SA 5DPMA 5E9QA 4ZTBA 5LQAA 2JHPA 5DTMA 2DULA 2V74B 4QQKA 3AWIA 3H2BA 3CGGA 3P9IA 5FQNA 1O9GA 3FZGA 5EPEA 2FCAA 1I1NA 4GBED 1SUSA 3FPEA 5T67A 3GWZA 3DTNA 1JQDA 1G6Q1 3JWJA 1R00A 3ANXA 3FYDA 1O9HA 1I4WA 1VPTA 3T7RA 1NW7A 1JQ3A 4HTFA 1N2XA 3RIEA 1VBFA 1WXXA 2ZIFA 2ZSUA 5E8RA 1YF3A 3DR5A 1RI4A 4M7RA 4DF3A 3Q7EA 2C7PA 2GLUA 2OB2A 5EZSA 5DXJA 3TFWA 4CKEA 3BGDA 4YV1A 2EFJA 3IV6A 3OZRA 5GOZA 3RODA 5CVUA 1MHTA 5DRTA 4PNEA 4EVIA 2O05A 1Q0TA 2ORED 5CD1A 4M37A 3SSMA 5LQUA 5ICGA 3C6KA 4R8SA 3VYWA 5CUQA 5EEGA 2H1RA 1NBIA 1ORHA 3M6WA 4C08A 2YXEA 3KQSA 5K01A 3KHKA 5FWDA 4E2XA 1RJGA 3EMBA 5G02A 3GO4A 4L7VA 1NT2A 3GU3A 4AX8A 5CVEA 3GRYA 5EQJB 1X1CA 4GUAA 4YMGA 2PLWA 4ISCA 4RWZA 3GDHA 5K0CA 3MAGA 4PYLA 2AS0A 1R74A 9MHTA 3DH0A 1NW8A 3SSNA 3M6VA 3KQMA 3GRZA 3GJYA 3UA4A 1DL5A 1D2CA 3CC8A 3G89A 5DTRA 5IH3A 3VC2A 2P35A 2P7IA 3NMUF 2AOUA 4HH4A 3M6XA 3A25A 4XCXA 1NW5A 3AY0A 3KQOA 5LSAA 3UJ6A 3EVDA 2G70A 4QPNA 1G60A 5DT2A 3I9FA 5M5BA 4FT4A 2I7CA 2A14A 1TW2A 4HGZA 4RYLA 1JG4A 3LX6A 3TMAA 3LDUA 1RJDA 2IBTA 4FT2A 3SM3A 4AZWA 3TOSA 1KYWA 1G8AA 2BM9A 5K0NA 3KQWA 5DM2A 5GINE 3HA5A 2EJTA 3SVZA 2FYTA 1XXLA 5E1MA 5EHIA 2PV0A 3BKWA 3KR0A 2P8JA 2I6GA 4ER5A 1KXZA 1TW3A 2H11A 3UJ9A 1T43A 2HTEA 1FP2A 4YUWA 3MB5A 4GEKA 4V0RA 2PXCA 1EG2A 1VQ1A 3PX3A 4UOEA 3FPHA 4ER7A 4NECA 3NVKI 4MWZA 5KYGA 2ZBRA 1QAQA 1P1CA 2AOUB 3HA3A 3C0KA 5EMLA 4E2WA 1VL5A 5GP1A 2K4MA 3DMGA 5EKUA 2ERCA 4PYQA 5EG5A 4DCMA 3EVEA 4IV8A 2F8LA 3G88A 1XJ5A 5E9WA 5EIFA 1QANA 3LL7A 4DZRA 5EGSA 2GAFA 5JR3A 1L3CA 4P7JA 1ZGJA 3IYLW 4P7FA 3UJAA 4DM3A 2YQZA 2XBMA 3PFHA 5CVVA 3NWEA 1JR4A 1L3IA 2IDJA 3IHTA 3A27A 4PCLA 2Y1XA 1XCLA 4C05A 4E31A 4PINA 3NDIA 2OKCA 2AVDA 2P7HA 5P8WA 5DWQA 4DQ0A 2O06A 5K03A 3HNRA 1VP9A 1QAMA 3P2IA 3BXOA 4PGGA 4PCAA 4PYKA 2HR1A
chains in the Genus database with same CATH superfamily
1R8YA 1X8LA 2B6NA 5T8KA 5BWBA 1JPVA 1CUAA 1CUHA 4LHVA 4YRJA 1WE2A 4QQRA 4NMLA 3EHEA 3WP0A 4DCTA 1C7FA 1R6UA 1XZIA 2PCJA 1E2IA 3A32A 3CINA 3HJBA 3NBQA 5BORA 3RYHA 3B82A 1FFBA 4XH9B 5TS2A 5J2TA 4HMOA 1DO2A 3DZIA 4PYNA 1AXRA 3IUBA 2FN3A 2QJRA 4OQ4A 4F38A 1F2VA 4QGAA 5GJBA 1I7SB 1CQJA 4XWWA 3VYTB 2IWHA 5KWJA 2C2KA 1G21B 3PYXA 4GZ3A 4UPVA 3BJMA 3RNOA 3MERA 2WSYB 2YN2A 3WYFA 1MDBA 3B5IA 4MQ6A 3IT3A 4A8JC 4A6EA 1XEWY 4BVJA 4H7DA 2XWQA 4JP5A 1QRUA 1G64A 1FRQA 3WLEA 1AMOA 2PXHA 2C9YA 4YAKA 4I9FA 1BW9A 3AUUA 1HQKA 4BIIA 3RHZA 4G0WA 1GPWB 3INYA 2DFKB 2QTRA 5H80A 1TJYA 3BC1A 1QHIA 1T9BA 1CUFA 3K20A 4QULA 4POOA 5JCJD 2VZ9A 2ZYIA 4F21A 3ZI7A 4DMMA 4XPIB 5GJVC 1SUFA 2GN1A 4L50A 1B7GO 4H0NA 5I01A 1A82A 1QNLA 2G25A 3VQTA 2BKUA 3FOCA 1XD9A 3NM4A 3IVAA 2PUJA 3EGXB 4LBYA 5IJZA 4FDUA 3HL4A 1ZCFA 2AOTB 2FEPA 2HJ9A 3PVZA 2R5WA 1A2BA 1RBZA 1QZZA 3O0DA 5F1KA 3IE1A 3AV3A 4W1PA 1YQGA 1WVIA 2IUFA 3DEHA 5J3JA 4RC9A 2VK4A 3I5UA 3MTDA 2LD4A 4EMBA 3O8OB 1ORVA 5KNCD 4BWVA 1IC6A 3KLNA 2W71A 5DT9A 1QGDA 1FRFS 5G0WA 2PQMA 1QH0A 3OF2A 3HUMA 3ZX5A 4WZ6A 4NAHA 2IY9A 2Q4EA 5LZ7A 5IVPA 3K35A 4KE6A 5K6AC 1XFDA 4MICA 1NLYA 1PIWA 2CYAA 3JAWB 2AXNA 1JSLA 3LHSA 4OBBA 4ONEA 1WY5A 2JJ1D 1YKSA 3MTEA 3RM3A 1AQYA 1E64A 1PL6A 2BF4A 4X6YA 3CLRD 3M4NA 2FZWA 2J7PD 3QG5A 1HM5A 2CVQA 4M1EA 1USIA 3K0KA 5REQB 4BO4A 5FA5A 2GA9A 4MGHA 1UPXA 2QL5A 1KDOA 3D6JA 3I6MA 4LK3A 4ZVKA 3C5EA 4DCJA 2IZ5A 1ZOIA 5DDIP 4KV7A 3L4BC 4KU4A 1K7SN 3SWWA 1NIJA 2OMKA 4L9AA 1I9GA 4RGVA 1T9AA 3WLAA 1L4LA 1V7CA 2HQRA 2YV5A 1J5XA 1P75A 2BGIA 3IALA 3QV2A 2BJHA 5L6MB 2YCLA 1R2QA 1MVOA 3L05A 2Q7OE 2HHHB 1SQGA 4PLPA 3JQ7A 5HDBB 1JKJB 2JC3A 3MTAA 4JEHA 4P3OA 4RGYA 2ZJZA 1HT2E 4UBNA 3ZN2A 5L51A 1IYZA 2E2WA 3U13A 4TYYA 4Z7QB 1T8TA 3A1VA 4XIYA 4L8VA 3ZVNA 1TMGE 1KI6B 4DLKA 3NC4A 4A0FA 1CF9A 2C2BA 3CKKA 4MV8A 4D9GA 1FNSA 4C43A 3EEIA 4QEKA 3NKVA 4HQRA 1JEOA 1A9YA 2ZS7A 3A1FA 3U7EB 2HRDA 4FOSA 4GLOA 3FSGA 4HGQA 1OOEA 5ELLA 3MWDA 1OLOA 1U02A 3W8DA 1I6KA 1TUBA 3C5VA 4MQEB 4YJ2B 4R69A 5F4BA 4A73A 5CDSA 2GN9A 1EHYA 2PMFA 3DPUA 4CKYA 2LCIA 4JT4A 4TT8A 3H5TA 4GH5A 4C4AA 4QJBA 3VR4D 2Y99A 3WZ2A 2H9YA 1QHXA 4XWKA 2ZT7A 3A3NA 3MTIA 2A5DA 2GBGA 5LLSA 1SD5A 1T8SA 1C80A 1KYIA 2DZDA 1ODTC 4PSDA 4FEYA 4MWTA 5JUWA 1Z88A 1JJBA 3DVAB 1JEYA 4OLAA 1IFXA 1EU1A 2IYPA 3PFBA 3P9RA 1YXMA 2JZOA 1SBCA 3OU2A 1D04A 1W4BA 4PIMA 2BDEA 4XR9A 2PGJA 1PFQA 1JXQA 3PC8A 1U7TA 1TECE 4INAA 5EJ7A 2HW8A 3O91A 5GWXA 1SVLA 3HM2A 5E7JA 1ZY2A 5BSTA 2FXIA 2G71A 2VDWA 4H1HA 2D7JA 1B2LA 3GB9A 4WXYB 4QUBA 5DSXA 2MDTA 4EEZA 1U1IA 1QIFA 4GT1A 5DNCA 4D99A 1HYHA 2EVWX 3EPHA 4TZ6A 2FETA 3BTUA 3F47A 4DIFA 2VWPA 1V4VA 1VLVA 2Q2VA 3ZFOA 3V8PA 4NBVA 4B73A 1QCZA 3LV8A 4L76A 4MUXA 1I4DD 3RU7A 1E0KA 4D1YA 4ZIRB 4ZI7B 4FYIA 4DWOA 1WUTA 5ALTA 2OK7A 3NAGA 3K6SB 3Q3CA 4BP9A 4S2EA 3FKSA 3WNQA 2NZ8A 3CUWA 1Z22A 3HCCA 2WJWA 3IO5A 3LUFA 1I7PA 2OHVA 4PSVA 1TEHA 1Z0KA 5EHXA 1VBKA 3C7AA 4BVEA 1GNTA 1M6WA 2GPJA 1TK3A 1HOTA 4HR7A 3RSGA 4ER3A 5B2EA 2ZETA 1X13A 4DSTA 3VKGA 1UBRS 3EFHA 2WIJA 4CN8A 1E2PA 1UDCA 3M49A 2XQGA 5FIUA 5KWSA 4S3MA 1YZFA 1YQEA 2TSYB 4BX8A 2XB9A 3QP9A 1E94E 2OA0A 1U7PA 4DA4A 1WRBA 3JYPA 1W36B 3MWEB 3OMLA 4HNUA 5H3LA 3PGKA 5D5QA 1FW6A 1M0EA 1I3NA 2QJWA 2ADFA 2B6HA 4LY9A 1IHDA 3ZE8A 1R88A 2ZDHA 3V97A 1OAOA 4KQHA 1MIHA 2EJBA 1YKFA 2NZYA 1OAKA 4RL4A 1C4KA 4JL5A 2Y2UA 2ZKIA 2IEGA 4DG8A 5FFMA 4YPVA 3W5BA 1C0LA 3OT1A 1QQ6A 5B3LA 4EA9A 1OH5A 2P68A 1FBTA 4NBTA 4ZI5A 1JEYB 2KBFA 4ALKA 2I2BA 4RDXA 4PX3A 1P6XA 3IPAA 2F3RA 3FRHA 2OCGA 3F3MA 1QO0D 3VC3A 1XJ0A 3N07A 5EIXA 2C57A 2WTNA 3VR6D 3ZJUA 4NOLA 4LRYA 3B89A 3P9SA 4OUDB 2QW8A 1XQ9A 3OEED 3VNQA 3X0DA 1P91A 3G79A 4CZ2A 4TZ0A 2C04A 1DIOB 4GKAA 4R1NA 1EWQA 3O8DA 3QEMB 4MH0R 2DSTA 2CDAA 1H8ED 1JB1A 1N4DA 1XZKA 4U7PB 2CK3D 1ZRMA 3LHIA 4LCBA 1V8DA 4TMZA 5HBRA 1V1RA 2P3OA 2HDWA 3E0QA 5BUSA 3F73A 3L6UA 3OZSA 1E1YA 3EZNA 3C5WP 5ADUS 4L1KA 1F4LA 3QVJA 5CLLA 3R6LA 1EPUA 5K5EA 1H0HA 1W4CA 3VDMA 2ZUBA 5GONA 4RS4A 3KJEA 2Q29A 5TQVA 1G21E 1OYVA 2DBVO 2WABA 2ZSHA 3SXUA 1GNLA 3UICA 5KMGB 3IL2A 1GCUA 1RP1A 3ISJA 3NTVA 4LRSB 3M4XA 2B7BA 1JXAA 5DM0A 3DF9A 1EP3B 1A4UA 1N6IA 1TE2A 1TU3A 3K9WA 5E9JA 1XWFA 1LZLA 3H9QA 5ILQA 3ROGA 3STXA 1P31A 4M49A 4GQIA 2G82A 1N33B 1S0UA 4LJ6A 2AHRA 5HOQA 2J4CA 1NXSA 2ORVA 2FSVA 1BWSA 3UHJA 2NTEA 1UOQA 1V7PC 3KLMX 4FI3C 4MAAA 1BVUA 3TVTA 2GD1O 4UHKA 3LVFO 2CUKA 5FOVA 1XAHA 4F9FA 1EJ2A 3BK1A 3GEHA 5HK8A 3AUSA 2VL7A 2NSHA 1YQTA 3UAVA 2B5WA 2OZLA 2PH7A 3C3DA 3KUCA 3LUBA 1Y4ZA 2FDXA 3B1ZA 1SBHA 4MVJF 4O8CA 4GQBA 4RTNA 3KSRA 2BSXA 2I2WA 3IMGA 5A4IS 3U19A 3M6IA 2J9FA 3KXIA 1DC4A 2Q9CA 2WMNB 3UM9A 1AH2A 2WAAA 3NUGA 8ADHA 2PL3A 3MFQA 3ZK8A 1GYPA 2H8GA 4Y2UA 1C8VB 1QR2A 3HI6A 4INPA 4G5GA 4IMJB 4HEA1 2VAVA 4J9UE 4N6NA 4EJSB 4F3YA 1MOQA 2A86A 2DHDA 3C5CA 4UJ5A 4Z1MD 1ZH8A 3NS7A 5CITA 3AC0A 5KIAA 1C81A 4JLJA 1GZ6A 2Z4TA 1E3WA 1QFJA 5B3JA 5LPNA 1NBWB 1W30A 4QPCA 1L7OA 1NVXQ 2VK8A 1PCXA 3MFDA 2CY0A 1XZQA 3ZDYB 3OZBA 3M7IA 2XTNA 2W4IA 3BWBA 2OCKA 2P1RA 3I34X 3OURA 4RMNA 4EG4A 3HDHA 2FOLA 5B7GA 4KGVA 3ZEIA 2Q3JA 3M33A 3WRWA 4BXOB 1ZUD1 5JY6A 5FUYA 4CV3A 1WWKA 3EDYA 1Y9DA 3N8GA 2WSBA 3BKXA 3LLUA 2GILA 2PA0A 4LYAA 2BEUB 2FNAA 4YIHA 3A0UA 3MT8A 1L7VC 1QDLB 2DMRA 2SKEA 1OBOA 3I2IA 1OXBB 1U1GA 4DARA 4LVOA 2MINA 3FYHA 3JYQA 3QPBA 2ENUA 3LBHA 1YJBA 3PV0A 4KIGA 1VMAA 1RRPA 1WXIA 1W2GA 1DJMA 4UCWA 5AVOA 4JL8A 4CEIB 3GLIB 4KHPB 4QQKA 4CFYA 4FX5A 4IXDA 3EX7C 2X1LA 1PV4A 3PQFA 3CGWA 4JC8A 4GBED 5CFOA 4LF4B 1SUSA 4FQ8A 4YMWA 4LF7B 3LY8A 3FCOA 2O52A 2ZAGA 4FMCB 4GRDA 4BB0A 4EVQA 1VPTA 3OUUA 2AEFA 2BJVA 2R6AA 4P80A 3VSBA 1TYAE 1Z2DA 2QYTA 3RAEC 2QN3A 3MXTA 4AZ0B 5ITVA 4PO3X 1AKEA 1BDBA 2QM0A 1T8UA 1LGYA 3SC2B 4WKBA 5KZMB 4LJ7A 1JVBA 4HOYA 3L8MA 1C1XB 5CVUA 4ZN6A 3AR3A 5IZ4A 1Q0TA 1CUCA 3R7BA 1G2QA 1VHTA 4WK0B 4PANA 5TE9A 4FCCA 3WLMA 4ZRMA 2VPTA 3DZ8A 3SF8B 5JD6A 5L3RA 4E5KA 4KO4S 2K7ZA 1QP8A 1QONA 2QTMA 1NUHA 2WT4A 3BCSA 3OEEA 3A3YA 4HADA 1CLUA 1ORHA 2Z98A 2Q0HA 4GX2A 5HXAA 2PZGA 1JU3A 3OQNA 121PA 2VPQA 4FR2A 2YMQA 1XZPA 3RRZA 3W77A 3C43A 3DYBA 4Y3UA 5EWMA 1KFJB 1O97D 3T5GA 2WLTA 4V0LA 3FMPB 1X1CA 1WUKS 2QNRA 4RWZA 4ZCRA 2G9RA 4BKPA 3V1TC 3QX3A 1GTMA 3OZIA 2OPHA 1T5OA 1ZL0A 3WBKA 1CF2O 3DE6X 1XUOA 4QA9A 1E1CB 2IHNA 1EGMB 3I8SA 3S2IA 2GEBA 4NV3A 3KWMA 5KINB 3EXFA 3EPKA 2R6DA 1ECPA 3ZJ4A 5DV9A 1FSSA 2K2QB 1J2RA 4YB8A 1KI6A 4DUZB 3DBOB 5CLGA 1Y5LA 3QK7A 3A25A 1RXYA 4Q3BA 2UYYA 4JNKA 3AY0A 5B3AA 4O2BB 4QGGA 5TXGA 1IN8A 3OQ1A 5DBEX 1V2HE 3A4MA 5JH7B 2WJYA 1F0KA 4NMWA 3RTAA 3U6KA 5L6LB 3ZXUB 4GPEA 2QBYA 3RWOA 1XD2B 1JDVA 2C78A 2A14A 3I2JA 4M1ZA 2BGRA 3GFVA 1TUBB 1P7VA 1U6JA 3L7CA 4U5XA 1K4YA 1XMQB 3TOSA 3EZ6A 5A71A 3ZV7A 4EL5A 3SYKA 1VZ3A 5BSUA 3T3NA 3VX3A 3M3HA 1M6NA 3HUFA 4CLRA 1T4CA 4DSZA 2HBRA 1H2BA 4ARCA 1TW3A 1ZVJA 2YMPA 2DFPA 3PXAA 2QE7D 3II6X 3NQ41 4WGGA 4JSYA 1OFUA 1ZVQA 4TV8B 1MR3F 4FU0A 4XYMA 1PFYA 1QAQA 5FOTA 3WG9A 4D4IA 3FOZA 3U60B 2UYGA 2J67A 3KUXA 4N48A 1NU8A 3L84A 5ITSA 2F3UA 2Y0DA 3UK7A 4HYTA 4FMBB 2H29A 3NR2A 5IZCC 3G88A 3T52A 2YRXA 3R7WA 2CFRA 2AK2A 4PQGA 1UJCA 1ZGJA 4MQFB 4UU7A 5D3MB 1TD1A 5CFPA 1J8DA 3GGPA 4NQZA 3ZFUA 4B6JA 4Y2PA 2R79A 1GGVA 1EFLA 1X2BA 1YI1A 3H8WA 4UCQA 5D6NA 1BCRB 2BGNA 2I2XB 2OAQ1 4Z49A 4DLLA 3N2YA 1ZM7A 4LOLA 1GTJ1 1VP9A 4RU1A 1MC4A 2Q50A 3BXOA 3N1UA 4A10A 4PCAA 1L5VA 4PYKA 1QIEA 1IL0A 3EXHC 4JXJA 1QIGA 2Q3DA 4NNOA 4Q4LA 1U98A 3ZFTA 1UAGA 3LGSA 3O94A 2F1JA 3MS7A 4HDRB 3AKDA 3BM5A 5HZKA 2E55A 3IKLA 2JIZD 4MTLA 1DQSA 5KNBH 1PT8A 1YJAA 1X0VA 3ENNA 1UM9B 2WRZA 4N7MA 1EUDB 4UHFA 4WLEA 1U3VA 4CBVA 3DP7A 5GMOA 1E4EB 3QUTA 4MCIA 3HHEA 3ZNPA 2ZWPA 1YDEA 5DSZA 2XMSA 3MIZA 3PHLA 5CIQA 4V02A 2X0RA 3GLQA 5LKRA 2F17A 3AGQA 3ILXA 3QRWA 2HJHA 1H4TA 3WMRA 4YRIA 4V0QA 3WKDA 3AKZA 3EISA 4RTOA 2JS7A 3IC5A 5EXDA 1VIVA 2XVYA 4XDZA 2I9PA 3KQQA 2O2GA 2DLDA 1KU0A 2JLQA 4XWTA 4A4DA 4R8VA 3NYRA 2XA2A 4WCFC 5HBGA 3PR2B 5CB4A 4ILKA 3I37X 3A4YA 1HKUA 2BBOA 3OKAA 2C2HA 3KDAA 3PSHA 4XGQA 1Z4PX 3VPSA 4BLTA 5HK9A 3D7RA 1XMXA 1XZCA 2WFLA 1D1QA 1SC4A 2Z8ZA 4D3SA 4JT8A 4CM8A 1CUUA 1OR8A 1KAOA 5ICMA 2QROA 5D3ZA 2BKXA 4IIJB 2GLXA 1FSPA 1V45E 1A4XA 1HZZA 3R7SA 2VC2B 3T7TA 1YQXA 4G0OA 4O4HA 4TTPA 4H3HB 1F8XA 2FSHA 1KK2A 2D00A 2HHAA 3DO5A 1T9HA 2HIAA 1H3FA 1V48A 2C82A 4NG5A 2AFRA 3VX4A 3OQPA 4ZAXA 3MOSA 5E4FA 4W8OA 3GY0A 1DJNA 4CMJA 1Y9ZA 3UJ8A 1PN3A 2IXBA 1A76A 5LYYA 3D4BA 1MB9A 4HYYA 1SBIA 4K9RA 5J43A 1RWBA 3WKCA 1FU4A 1Q83A 1RZRD 2PSHA 1WETA 2J7PA 2WOJA 1YTUA 1JMYA 2FX5A 3IAAA 1JJAA 3EXIB 3FCCA 3QYPA 4LSMA 4PG8A 2Z6QA 3K16A 2YYZA 2OV3A 3DFIA 2A7QA 3QOYA 4JFRA 4JYZA 2G5CA 5AHKA 4EPTA 1F2TB 2PH5A 3DM9B 3EBPA 3AUAA 4UFPA 1XKQA 3TTTA 4EW1A 3IUNA 4C0XA 1OPRA 1P7CA 3PCXA 3EW7A 3RVOA 3W3AH 4JI0B 2HA4A 4NPAA 1W4ZA 5FBWB 2XTJA 4J29A 1P17A 5LDHA 4XWAA 3SIPA 3ZU6A 2Z1NA 5K0JA 1J9EA 4IINA 4OHUA 4PZEA 5M7EA 3TSAA 4PZUA 4PHCA 4MDHA 1G8PA 3UMVA 1HEYA 2YXNA 1XYVA 3QVTA 4HYQA 4JQZA 4LY6A 3VNRA 4D4LA 5I7WA 4EKIA 2NN3C 4C5CA 1YDFA 2IHZA 1CS0B 1QM5A 2W6MA 4J03A 4MQEA 3SFTA 5ITWA 1BXGA 3GGOA 3FGZA 1BRMA 1KJJA 1Y8ZA 1XYGA 1P0FA 1Q3TA 2O0KA 5KOJB 3NP9A 1S8FA 3DC2A 5BV1A 3QGMA 3LAWA 4Q12A 1QKKA 1LB1B 1RPZA 4Y9UA 4ZVMA 3HP4A 4JLVA 3QVUA 1WW2A 4D25A 7MHTA 4M88A 1SR8A 1T3SA 1JEQA 3HU5A 3UMYA 2V9CA 3E27A 2ZQYA 3CEPB 1GFZA 3V3KA 1P18A 3DE1X 2C96A 1DUVG 1PGOA 4NI5A 1RWOA 4D74A 1A4RA 1RCUA 1M9NA 4ZQFA 1GFIA 2P9TA 3E5RA 3EC7A 3B3JA 3FCEA 4RVGA 5FUWA 2PKXA 4G0QA 4FEEA 5LQSA 4C7XA 1GCGA 3ZNQA 3HWX1 3WL6A 3HVJA 5CA1F 5HF6A 1T1SA 4W9MC 5JECA 3K1JA 3DQPA 2G9ZA 4MYCA 3ZHXA 3DUWA 4B7XA 2DH5A 2C9BA 2ILVA 2BFCA 4TM8A 2J3EA 1L5RA 3GJ0A 2GXUA 1VLQA 3VZPA 3EJWA 5K0SA 3MJCA 3R9WA 3EK2A 2GYVA 2WLSA 1QLWA 1SD2A 1Y8RA 2G3YA 3HMQA 4P5EA 4XUCA 2OQIA 4PQEA 4CM9A 2FRDC 2PX6A 1GL6A 4L4SA 4ZT5A 3R5TA 3ER6A 2WHYA 2PUAA 3HXTA 4ZVPA 1XL0A 2PX2A 1M1YE 3K92A 4N0QA 3FNEA 1U2SA 4IIYA 2RGBA 1L5HB 1LPAB 3HCFA 1GVNB 2YTZA 3WIOA 1BOOA 4KYIB 4MYTA 5GM1A 1M74A 3GJ7A 1KE2A 5KWIA 2BR5A 2FSGA 2PD3A 2IPXA 4MIOA 3B6KA 4IGIA 1LS6A 2IVFA 1EXNA 1U7XA 4ZEWA 3U9TA 4CN9A 4J0CA 1SD1A 3CSSA 3NJ8A 4IGEA 4TXLA 3U4MA 4TWBA 3AO0B 4Q05A 5LP6C 5T4EA 2VJYA 5KO2A 3QNUA 4PPYA 3OQMA 1VKJA 5GZ6A 2WT8A 4ZAGA 3W4IA 4Y6QA 5CU7A 5AJUA 2RKBA 4OBXA 1NASA 4HY3A 2XT9A 2DETA 2IU4A 2BHTA 1NNLA 3UBMA 2HCJB 5H59A 1M10A 3EW9A 3UB4A 4AQYB 2EKDA 2ZJOA 1NQXA 4AJ4A 3FLBA 4NL4H 3NBMA 2ZIUB 1DHRA 5CXUA 1BFDA 1G8YA 2RHTA 4CL0A 5IAOA 1LCIA 1ENPA 4CMKA 4G8JA 4MWCA 3PE4A 2R8EA 1LPOA 1YDHA 4D2IA 2BEJA 1FUYB 2CHUA 3PQ8A 1KETA 2YJ6A 4Q9IA 1PX0A 5FHQA 1Q17A 1N0UA 2O7RA 3TRKA 1CR2A 4FYJA 1OU4A 1NUTA 3CPSA 4HAZA 3UAGA 3W34A 5ENVA 5HTKA 1A7JA 1NKVA 1XTPA 4D8UA 1JR6A 4OP3A 4JBGA 2Q6LA 2X5KO 3S1LA 1NMYA 3ZDRA 3ECAA 4LXIA 1H1TA 2E4XA 4TSFD 5A5EA 1Z0JA 4Y1FA 4K1XA 1S2NA 4EGCB 2FZEA 3K0CA 3AUXA 4Z3OA 3TJMA 2IH2A 4QPJC 1TL7C 4IX9A 1PR5A 4CFSA 1X15A 3GJ8A 5HJEA 2BEVB 4ILEA 5JH7A 5BYJA 2F00A 4B8YA 4HF7A 2NU6B 4DEYA 1RCTE 2IEIA 1JLRA 1QQAA 3B5JA 3KYDB 4CLDA 1URPA 2GPWA 5HF5A 4D4JA 5J5AA 4KR3A 3C3XA 1TAUA 1EXWA 4JBWA 2WF6A 421PA 1ILEA 5F98A 1JQAA 3ANMA 1L9KA 1QRDA 4F72A 2GESA 3G5LA 2Y68A 3GAFA 1TVCA 3NYIA 4G1FA 4QXAA 4TYQA 2EFCB 1A5SB 2HPZA 4Y2QA 3ZWPA 1ADYA 4NU8X 2JIOA 4PLCA 4UXJA 2WNIA 4MVJM 3SJ7A 4QGSA 3FD8A 3VOBA 3NEAA 3W2FA 2LVBA 1GTG1 3CR8A 4O2BA 3JU3A 4MIEA 4RXMA 3D4NA 1KPGA 4Z86A 4BLOA 2NXCA 5LQJA 3R9XB 4RH0A 4J91A 5G40A 1N2EA 1S96A 1NR1A 3IRUA 4KRXA 5AM1A 3AIOA 3KZOA 4FFMA 3OQVA 4MUHA 4KK3A 1RLUA 4CV1A 4M1WA 10MHA 4P7BA 3MHTA 1QORA 2I2FA 3H18A 4H18A 3TD6A 5F9HA 3EFOA 3CO5A 5C3UA 1JIIA 4J0DA 5CAEA 3I61A 2ZI9A 3ICVA 3UJ7A 4I1YA 2VDJA 2H0QA 4YMSA 2JGMA 3SYLA 4CT0A 4QELA 3SC6A 1DS6A 4KQEA 3X1XA 4C06A 4E94A 1BMFA 2WJGA 5DK6A 5CT4A 3A05A 1QYDA 1AIPA 2CDCA 3V4ZA 4O4JB 3KJNA 3HGQA 2Q0QA 3G1UA 2A1UB 5FQOA 5JYDA 2COUA 2W8ZA 3V8EA 1KYZA 1GPYA 4F4CA 3EOZA 2HK6A 3KZVA 5AVXA 1VCHA 1XO1A 2VSQA 4XR4A 2H9AA 3ZI0A 4Y9RA 2DTEA 2CBXA 3MS2A 3REOA 2X8JB 2OV6A 1WDTA 2OWDA 1Z75A 2PZAA 3IULA 3U81A 2RSLA 1CQIB 4FNAA 1D5WA 3V7UA 3HYSA 1YL5A 2O57A 5K0FA 3UO8B 5C1BA 4HNGA 1CY0A 1E5XA 3ABZA 3UGQA 5CW2A 3ZGLA 5ERYA 1KQFA 3KU4A 3QY0A 1JFRA 1MFZA 4IXTA 5EP4A 4UOQA 5C2JB 1H0KA 3CWQA 3OHSX 5ALVA 2ZAYA 3NHZA 4RVFA 2NUTA 1XNGA 1RYDA 1WTAA 1Z74A 1OLUA 3ESBA 2Z09A 3SM9A 1R9MA 5J58A 2DT5A 1NBOA 2JFUA 4QYSA 1A71A 3QF7A 1N2SA 1ZDMA 1MQAA 3I0MA 4XDHA 4MTCA 5AKJA 3RJMA 1KFKB 5GONF 3SBDA 3I42A 1T4MA 1JFFA 4QUGA 2WHQA 4L0CA 1ZN9A 2NU7B 1J1IA 1I6MA 2X9LA 4H7EA 4WTOA 1DBWA 1N7GA 3O2JA 5K4AA 3ZHYA 3HJTA 4WPGA 5SV2A 2DKNA 4IM7A 1UCFA 3KRTA 4HD8A 1JQKA 3W5IA 1X80B 4KKVA 1EP2B 2WD8A 3ZU3A 3L46A 1Y7LA 5IFLA 1QJ4A 4QBGB 3DOJA 5DOVA 5HQJA 3RUEA 3K30A 4OLFA 4TMTA 1RLMA 2D0DA 1W73A 5I7FA 5DM1A 1UKAA 3BWYA 1TX4B 1FRNA 2C5AA 3IBTA 4CYMA 3CB2A 4U39A 2W5UA 3FVWA 3VSAA 2OLKA 3GGDA 1L5OA 3BMOA 4LWOA 2O19A 1SXPA 8GPBA 3A26A 4KC0A 3IAUA 1NDQA 2CUZA 1S7CA 1GZ5A 4K8RB 4JOBA 4OIFA 2HQOA 5CEEA 4FFNA 4IIJA 4WBNB 1GDDA 5B30A 1XDGA 4KVFA 4R41A 1L8QA 3GEIA 5IVIA 2RJNA 4BTLA 4D26A 3GUHA 3NBXX 3PDUA 2Z08A 1V6AA 1AHIA 1KH1A 1YA8A 2EKZA 3HR8A 3KTFA 2I29A 3D6HA 1EEHA 4TXMA 2AX4A 1E1CA 3TAHA 2VTDA 4B3MB 4IDBA 2B8TA 4F98A 1FMCA 2NYUA 1V8OA 2C8JA 2O7VA 2Z4RA 3MRSA 2PJZA 4NEQA 4MR7A 4X90A 1XXHB 3BRWA 5AR1A 2OGUA 5FA6A 5KQGA 1TM5E 2FW0A 3AW9A 2CFCA 2FCAA 5EWMB 4BS9A 3FTQA 1JHUA 1PK7A 5DB4A 5EFOA 2VCYA 1Q7EA 2ANBA 2VHYA 3P20A 3PEUA 5AOVA 5LZ5A 3T7RA 2P4QA 4WK4B 5A5VA 1ORWA 4KYUA 3TLZA 4EGQA 1H1LA 1RI4A 1U2PA 1NVMB 3G3EA 4RV5A 1BHQ1 4XYLA 4BAUA 1WF3A 2XCUA 5A3JA 1DU4A 4KPFC 4AURA 4EBBA 2XZLA 1RACA 3D4PA 3OEHA 2NO1A 3H1EA 1KJ8A 3KG2A 5IXYA 4HQ6A 4G9EA 4TXJA 4BB6A 2RK6A 3CUEF 3DP9A 1RVDA 3OJWA 4TMWA 3RJZA 4AICA 1H2WA 4TKVA 2IV2X 3ZS9A 3OLWA 2VXCA 1HR0B 2CV2A 2W2QA 3O3NB 3O5AA 4YCNA 1XD2A 4KVAA 1TTTA 3LBAA 3NV7A 1EFVB 1P61B 4K87A 1GDHA 1XKTA 5DEOA 2CFIA 5CCDA 1Z6GA 1NATA 4DZTA 1QKIA 2MMCA 3ZLUA 4ND1A 5AVWA 4YMGA 3IAEA 4CLRB 3DBLA 1GGMA 2VN8A 1JAZA 3M6VA 4W9RA 2RHGB 4WOPA 4DMKA 4OO3A 4ZI3A 3MXOA 4LJ5A 1VDZA 3KKEA 4X93A 4EITA 2PWAA 4B76A 1ISJA 5B6IA 4II7A 4PZLA 1KMIY 2P35A 4F7DA 5JASA 1LBHA 2W2MA 3DFUA 3GLUA 5HM8A 4B1FA 2OFPA 3P4UA 1P2VA 2WNHA 3RSCA 5C5DA 3JQ9A 3SOZA 5ECWA 5EIHA 2X3YA 3GBPA 2O3JA 1DTWB 3WHLA 1K0FA 3DGEC 4TS1A 5J4LA 1G3IA 3P0JA 4NTZA 4ID9A 2C5BA 3QLVC 1K8ZB 2WWWA 3WGOA 4X65B 4GLLA 2PIDA 1HF3A 1OSNA 3D6FA 4DIEA 5EA2A 3JASA 5DGTA 3OQOA 4IFBA 5LUAA 1PG0A 4G36A 2JB9A 4I4LA 1FFSA 3B1YA 3BKWA 3C3WA 1Y89A 3TXXA 3D54D 2WI8A 4BNJA 2GA8A 1Z9BA 2VJQA 1YL7A 2FGKA 1BNCA 2O6HA 2ZUDA 4L6IA 2A30A 3KLOA 3FF4A 4GEKA 4MGZR 4FBLA 3X43A 3M9LA 1VQ1A 3GV0A 4NJEB 2B4YA 4W63A 5A0VA 4I2VA 3ZDEA 4ER7A 1UJNA 1W5FA 1YK0A 4X7BA 3AX6A 4JU9A 1IHXA 2OCBA 3IJ5A 3N5CA 4FPXA 1SJ9A 3L1UA 4O2AA 5FF9A 4A0RA 5BWOA 1U94A 1EDOA 4MOWA 1H8EA 2RJ3A 4B81A 4Z2AA 1EFPB 2IYLD 4Q3LA 3FNBA 5EGSA 5EPUA 4EUNA 4Z5XA 2VJNA 3O7MA 1O96A 2JCVA 4DWWA 1L3IA 5EUBA 2IDJA 4Q9DA 1T6BY 3WB0A 2YOFA 2ZU6A 3NDIA 4DLRA 3VPCA 1O2DA 1Z25A 3MPUA 2Z5VA 2C5HA 4CPDA 2IY8A 3R3JA 1J8FA 5CH5A 4EJ2A 2DWOA 4HZGA 5C81A 3UW1A 4FGZA 4BDTA 3HXLA 4XOUA 4Q39A 2WMDA 2ZS8A 4E11A 3QVSA 1J8MF 3EC1A 1NOIA 1NQTA 2CNLA 2Q28A 4IHJA 5F21A 3S4YA 2JCYA 2JJ8A 4BP8A 4CTJA 2VXYA 4R83A 3HVIA 3B6JA 3KTAA 4FFBA 1T5BA 1R4NB 3OM0A 5KWVA 1MN6A 3U4QB 2Y1EA 1ZM4A 3HB5X 3HFSA 2IQ5A 3OZ7A 5DBOA 3IDFA 3T3EA 4F0JA 1QCYA 2E1RA 1T29A 3LZ6A 2FQYA 3HY6A 4HNSA 1GSAA 2H17A 4QGFA 2QAIA 2BGGA 1KHHA 3A1DA 3DSRA 4I5DA 3WTBA 1KFBB 2B69A 3ZEAA 4URYR 4WN9B 3WL8A 1VA5A 2QLFA 3GPCA 4FYXA 1UZLA 2I8CA 4QYXA 1E1MA 1TOAA 3WZLA 1R0CA 2OVFA 4IUYA 3EQ2A 4J0QA 3ND8A 1KVTA 3W5AA 1CS4C 3KZXA 3VU9A 5AW8A 3CN9A 2GZ3A 4AN0A 2XHEA 4WXHA 3DHNA 5HZHA 4XIJA 4GL2A 1N75A 4MV1A 4R5MA 3DKPA 1G2OA 3LCVB 2UXCB 2O5CA 4GD3Q 4RD1A 1SK8A 2EV9A 3ZWAA 3CZ5A 1Z47A 3OM8A 5DYNA 1I24A 2M6RA 4DLXA 1PUIA 1VLZA 3STUA 3L8DA 3WS7A 2J9ZB 1RHKA 1YQQA 2PUEA 1S3FA 3OTQA 3EIEA 4WADA 4N7JA 3BXPA 4RTLA 4PFQA 3LUKA 2BM8A 1TYEB 1G5QA 1NXOA 1JR3A 1OJ7A 2AG5A 3P2YA 1T10A 3DS8A 2VK2A 4LZPA 3THRA 3TNDA 1E1NA 1QYRA 2PKWA 1RHRA 1V3VA 2V3VA 1PL0A 1Z62A 3HJRA 5ES3A 1Z12A 4XYEA 5TGDA 1JBKA 2E5WA 3W78A 5KREA 3C3BA 2L0XA 2PGOA 4EMSA 3ZIAD 1KF0A 4EJSC 2GNOA 4RHFA 4FB4A 4MW9A 2AEEA 3AVYA 2HBYA 5L8VA 3HXKA 1E8DA 1F06A 4Q9LA 4DM7A 4QDUA 3T7SA 3O8LA 3RUDA 5AVUA 1ZXBA 4CKWB 4YONB 4XSVA 5CB8A 2ZANA 3U56A 1E7RA 4I3HA 4TVSA 2YDYA 1DB3A 2D5IA 3I4CA 2Y1WA 1R8JA 3LPAA 1JQBA 1O08A 3P2OA 3TAUA 3RF7A 2PPVA 3M81A 3A4LA 1FRZA 1E0AA 6AT1A 2JGLA 4JBYA 2Q5HA 4M1KA 5ALYA 4LXYA 2B5VA 1FFXB 4M9CA 2GPBA 2QZPA 5JBNA 2IBSA 5DI9A 2YMLA 5G41A 1CQIA 2PQ0A 1JL3A 2UZ0A 5B1YA 5FORA 2GHTA 4KAJA 2IBMA 5I45A 1K92A 2BP7B 5JPDA 1JU9A 4U2FA 3VHLB 5M29A 2ORWA 5AM0A 1Z2OX 3PFFA 2QX7A 3E1SA 5D3QA 3ETLA 1ZOLA 3EXG1 3R1IA 1AHHA 3H2GA 3JWEA 3PNLA 1X80A 3HQ4O 3EF3A 3L0OA 4LSGA 3O38A 3CPJB 2Q8QA 1RBMA 4LV8B 2XYPA 4M0PA 3C7DB 3EVZA 2ZT8A 3NHWA 2PX8A 1Z4KA 5IJ9A 4LJLA 2XUFA 5CT9A 5AW0A 4I6GA 4UQLA 3PHJA 4MW0A 2PH3A 2HWWA 2XOKD 3BQMB 3AU9A 1MJGA 2B8NA 4P32A 2DT8A 1JFTA 2XZDA 3FI9A 1HURA 1JR3E 3RV4A 3ZWMA 1TEZA 2OWEA 4HNAB 3L8GA 3ZH2A 3HKEA 3R5SA 5U4QA 4E33A 5MFZA 2H9IA 1ZM2A 2BFDA 3QH4A 1NMSA 4FHCA 4WUVA 1I4LD 2NNWB 2Y6UA 5F76A 2LWIA 3C1TA 5AVRA 1RQLA 2JLZA 4Y7CA 2R6R1 3JQGA 4UNNA 2BBTA 1X7DA 2AN3A 2MINB 3BMQA 3SX4A 4IMIB 3K0AB 5CLQA 4F6RA 5FBVB 4RTMA 1DARA 4EF5A 4UBOA 3R20A 4FZJA 4D0SA 2W8BB 3I9JA 1CU1A 1XXHA 3KJZA 4IZIA 4QGHA 4UREA 1YJ5A 3A1SA 3PRHA 1CB0A 1TVFA 1RD4A 2YZ2A 4PRKA 3GL9A 4KMSA 1B8UA 5KDDA 1DJOA 2C03A 3U3DA 3E22B 1DT5A 1MABA 1Z5UA 4K9PA 4R7ZA 5IM4A 4FR5A 3S2EA 3R3YA 4ARUA 4DLSA 2XMDA 1O89A 3I12A 1Z4NA 1ZICA 3A11A 3OA0A 1WZEA 4R3WA 3WWDA 4B47A 4B0PA 3H0CA 3P0FA 3C14C 4C6RA 3QA9A 4KAAA 2PUHA 1N7HA 4H7HA 5AK5A 3UT5A 1OUMA 1LWOA 4R8MA 2CLHB 3H5VA 4HNRA 3G9UA 4XEHA 3IXLA 3E23A 3R3SA 4G07A 4G5QA 4LF5B 1C7EA 2F4NA 1J2UA 3C74A 1EM6A 2AX3A 4EP1A 1J24A 2R86A 4B8ZA 4WLVA 1TM2A 2JGRA 3VYSB 2HHLA 4QDJA 1KRXA 3R76A 3HM9A 4URUR 2CUTA 2Q5QA 5K0BA 1CJBA 4JJZA 5HMMA 3GPLA 1S8OA 4EYEA 1UIRA 3PXDA 3BE5A 4YJ3A 1ZS9A 3C3MA 1U0TA 4R68A 1U11A 2D3TA 2X0NA 5E6SA 1YZHA 2XUAA 5EKXA 3CVVA 3DV0A 2AGVA 2YWCA 3IP7A 3ZHUA 4ZJZA 1R10A 5AKZA 4BQFA 2GJSA 2F1HA 3G7UA 1QG4A 3AEQB 4MB0A 1EB8A 3AJAA 3LC1O 3KOWA 5B6PA 2V45A 4KIWA 3NRCA 3TM4A 3DAYA 3D5TA 5FUMA 3JWIA 5DTIA 3SK0A 4NYIR 1GTSA 3WRYA 1RMYA 1ECCA 5JBIA 4F5YA 3HKDB 2INGX 4HWTA 4KITB 1O5OA 2E4UA 5TGZA 3N2KB 1CUXA 4QXRA 4Q4CA 5I9LA 1NT4A 1I1OA 3LF1A 1U9JA 1OBHA 5J5VA 4AF8A 4BFLA 5JARA 1L4KA 1Z56C 3RCBA 4ROSA 1M83A 5SY9A 2BTQA 2R2AA 1QPZA 2ATVA 3ZG6A 5JTUA 2PLNA 1RDFA 1XC7A 4KRGA 4P3XA 4EVRA 3PHCA 4DIUA 2GEVA 4LCJA 4D3ZA 1DJQA 4YK7A 4XAQA 4NHEA 3D7LA 1S6YA 2RI1A 3EIWA 1S5PA 4JN6B 1G3MA 5F2NA 4TOIA 1C7RA 3OSZA 4YDRA 2V7EA 2C9DA 3I05A 4KXYA 2HXGA 4XASA 5E1OA 3RS4A 5HE8A 4F4DA 1BVHA 4P35A 3NAMA 2BUBA 1I5RA 3DXYA 3HKCA 3VOSA 1M6YA 2DY1A 2IZ1A 2R84A 3IUYA 5EQTA 1U6KA 5YASA 4D5GA 4F96A 2JD0A 5IKEA 4YJHA 1AGXA 2ZUVA 4MWSA 1UBFA 1UEXC 3HC7A 1A9XA 1D2EA 3JQFA 1BS1A 1HRKA 4HAWA 2JJMA 3RK0A 4PV7A 1RXEA 1XHLA 2F3PA 1VBMA 1BCRA 1YMQA 2CLOB 5TS3A 3ADCA 1OH7A 3RYFA 3KR2A 3OCJA 4MV3A 3SJCA 4TZKA 4C0LA 2YX1A 1HC7A 3BE8A 3F98A 3NRBA 1AKNA 4FHEA 1MX9A 1IBMB 5C18A 4L4YA 3S8MA 1X7WA 3F9IA 1QV6A 3FUWA 3UFBA 1SXJE 5LZ2A 1B8NA 1JJ7A 3F6YA 4DRYA 4HFJA 5EMMA 1SKMA 2OCXA 4DR1B 2PVCA 3RFXA 4ARBA 4O3MA 4MQMA 1SOUA 1P9LA 3HUUA 4L8FA 3ZE9A 1Y1RA 3UATA 3FCSB 1GRVA 3IJPA 1KKMA 3GFTA 4GPBA 3K0EA 5DN6A 2B78A 1NBMD 4HDKB 4I3FA 3W06A 2GS9A 1R6VA 3V8MA 1KA9H 1QO9A 1XU9A 1JHZA 2AR9A 3OI7A 2Q1SA 4WL0A 4ZAYA 3T06B 3WLSA 1Z45A 4W1QA 4WN9A 2X22A 3P5SA 1M7BA 2VS1A 2C9ZA 5ARCA 4LY3A 1WNFA 2YZ7A 4NBLA 1XZMA 4W8HA 1W6UA 2B21A 3DMHA 3UWDA 5IANA 1E4EA 1Q0PA 1XWIA 3SHTA 3F7NA 2BFPA 4LZAA 1Y7HA 5C1DA 5KYXA 4IJKA 3B2QA 5IKOA 2WFLB 3D9QX 4GR5A 4JWKA 4RFSB 4FDTA 1OWNA 5GONB 4YP1A 3RSLA 2CL5A 2ZR9A 3U5TA 4DXDA 4C9BA 3HBLA 2V9ZA 2D4AA 4IBOA 1M8JA 3ZLBA 2DU8A 1OFGA 1RHQA 4ARSA 4MMXB 2GCGA 2VCHA 3UC5A 3JQAB 2YV3A 3RYCA 2ENWA 3T35A 4X3CA 5D2CA 1U0RA 3TLGA 3OSUA 1YOVA 3E7PA 5JMWA 5KNDA 4GC5A 1NN0A 1ULZA 5UKDA 2OBFA 3LA8A 5CPFA 5JWHA 2N46A 1G8KA 4U6NA 4DUGA 3DE0X 2XRYA 4RKWA 4EL0A 3E7DA 2ZU0C 2QZ9A 1YUNA 3LK6A 1KZ4A 4QX6A 1II9A 4PLVA 3ZQJA 4RLFA 2A1IA 4I1SA 1Z6YA 2Y05A 3Q3VA 3BK7A 3ENVA 1Z5GA 4G0XA 5KYKA 3T1YB 3CPEA 4KAXA 2MOKA 4O4JF 4P33A 1WXDA 3HS3A 2APJA 2AEJA 3FDXA 3LY9A 4HAUA 4FP9A 1R8XA 1RYZA 2FDCA 2XB2A 3MSXA 4N5HX 3IQDB 2FZ5A 3EQ9A 3HSSA 2HLDA 4N5MA 4RK0A 4RNDB 1UMCB 5CT5A 4WA7A 1YIDA 2EIXA 1W87A 3O8NA 4R1SA 4UEKA 4AJ9A 6ADHA 3ACCA 3V1NA 3ZGOA 3QU5A 1E98A 2FMIA 5AWFC 2MSNA 3OECA 1HA3A 1MOZA 4KSCA 3OC6A 3AYZB 2J87A 4KQKA 3ZHSA 4ZYVA 3GT0A 3GRKA 3TE7A 1DWPA 1EDZA 1N2XA 2VJMA 4LMPA 3SDZA 3IAHA 3AVXA 2OUIA 3KB1A 4OOEA 1TAHA 5CFZA 2GLUA 2OB2A 1O3YA 4WY5A 3NEYA 2ZE5A 2TMYA 2JCBA 5DYYA 5TT1A 3ZOZA 3UPUA 3IVGA 1LRKA 1TB4A 4Z0PA 1JQLB 2ORED 2WOOA 4OXNA 1GZDA 1XK6A 1G1AA 4URWR 3EA5A 1E7YA 3LM8A 2TECE 4R8SA 4BFZA 3B13B 2FGJA 5EEGA 3FNQA 4IMPA 1P77A 2AJ8A 5KTPA 2Z5GA 1NJFA 4F5WA 2YXEA 4JXKA 2B1RA 3UWMA 4D9NA 1Q7BA 1DBPA 4MULA 4PX2A 2EU8A 1KNQA 2XVZA 1EVLA 4P4SA 2VT3A 4ETIA 2VWGA 3W5SA 3MPOA 1AUXA 1R74A 4H4CA 3U61B 1Z26A 4M99A 1SC6A 9MHTA 4ZGBA 1FQJA 1NX6A 3K9LA 3WK4A 5AW3A 4IYRA 3C48A 2H4FA 2HNAA 4OYLA 3P4YA 2E6KA 1Z6TA 4QTXA 1NP6A 3HRHA 4DJTA 1NW9B 1TF5A 4E07A 1P1RA 5JQGF 2LV8A 3G5UA 1KY4A 2JFZA 2PSFA 1UMDB 3BIJA 3BMQB 3QLJA 4FOOA 4IOLA 1RQGA 2F64A 5I7AA 1BMTA 5ULLA 3KWFA 1AK2A 5KNBD 4BKMA 4M0LA 4Z1OA 1E2QA 2WTBA 4JIMA 3ZVMA 3U7QA 2AG1A 1SWWA 4S04A 2VAPA 3P2MA 1TW2A 1UQRA 1ZI8A 4UUQA 2Z4SA 4NH4A 2GAJA 1W59A 4Y0NA 5BQ5A 1A4IA 1HT0A 1NXPA 3OQ6A 3G0OA 4H77A 3SM3A 3AF3A 2X0EA 3TRFA 2IIQA 1DG9A 3K15A 3NTRA 1CE8B 4RZUA 3N53A 5CG2A 2EJTA 1EVYA 1GNSA 1UBJS 4BC1A 4P31A 4HAOA 4EMTA 3PQ6A 1CUWA 1LV7A 1PS8A 2I6GA 1CZUA 1AHPA 3VPDA 3JQGB 3T0FA 2HTEA 1N1EA 4I14A 1Z4OA 1KY2A 5I8ZA 4CUJA 2RHBA 1T8RA 2VDOB 5SICE 4Z7OB 4D45A 2FRVA 5FOUA 1QHSA 2WKPA 1RC8A 3CKLA 4R1OA 3S5JA 1OI4A 2K4MA 2V4MA 4OL9A 5EG5A 4X8MA 2F8LA 4AKHA 3THXB 1CDDA 2XQVA 3AI3A 5JR3A 5F64A 4HQLA 4CLXA 3AONB 3PBKA 2XBMA 1MIOA 1JI3A 1W75A 1ZM9A 3AR2A 5AHRA 5EIEA 3BGWA 1QKJA 4X20A 1GPJA 2QU8A 3AT1A 1VM6A 3QG1A 5FL7D 1R15A 3PHGA 3EGCA 1BHO1 3UT5B 1B4DA 3HNRA 3MJEA 3L1KA 2X8AA 4A9AA 4OHWA 4RZQA 1NWCA 4X85A 1YZNA 4GQAA 3GAAA 1LPNA 4RE6A 4WKOA 2KHZA 2P27A 4Q6WA 1E3QA 2CHVA 5A3SA 3TKYA 4JK3A 4PY2A 3BUSA 2AQIA 4MWGA 4DBZA 2IYFA 1M33A 1RLTA 4U5QA 1ZZGA 1GSIA 4KODA 3NDJA 4X92A 4X60A 1W5AA 4UVHA 5GGYA 4D0RA 1YZKA 1UT8A 1UOOA 1X77A 2PX5A 2FZLA 5TARA 3NHLA 1W36D 1L7DA 4KNWA 2AH5A 4EG0A 4HX9A 2ZSDA 1BE8A 3QPCA 3TK1A 1ZIXA 5BOSA 1L7NA 3VISA 3W3ZB 1YKGA 3RBVA 4J0EA 4CMBA 4RSHA 3EGDA 4LPKA 1JLLB 4FFOA 5BT9A 1N34B 4CHTA 2NXWA 4GI5A 5BNFA 1BCSA 3HABA 4F3KA 2WA2A 2HU8A 3ACBA 5CDTA 4OMUA 2XRZA 1TQ6A 2YH2A 4TXHA 4PAMA 4S35A 4DLAA 3ICPA 2IYQA 2Q5CA 3OX2A 4OGFA 4UFOA 1DFHA 2FPPB 4WX2B 1ZH0A 2PU7A 1QYVA 2XBLA 3AR5A 3DOUA 3OIYA 4I5EA 1FNMA 1C1DB 4MYDA 2QPAA 1CEQA 4UHEA 2OYSA 2ZIGA 1PJBA 5AI8A 4PXAA 4ZU1X 3R7WB 4EGFA 3EASA 1VKRA 1T2NA 1QF7A 1T5DX 2OBNA 2P30A 3COYA 3ETEA 4HCJA 3SLRA 3VR3A 4KPEC 3VU0A 3WQQA 4B48A 1D9ZA 1L8XA 4MVYA 3O4RA 4XD2A 1JECA 1LBTA 2B4KA 3LZCA 3UK2A 4ZZ0A 2LNDA 2WVGA 4R9VA 5ALJA 1IBLB 2CF5A 2YWXA 3F6BX 3A37A 9LDTA 2A92A 5HQTA 3M82A 1U7OA 4PF1A 4RQUA 1DI0A 2AN4A 3U0VA 5A9SA 3IPCA 3REGA 3GJ3A 5LNK6 1R6TA 3W5CA 4YYZA 3PX7A 1EDEA 2YXDA 3ZYZA 1PWEA 4JY7A 5C9ZA 5JVDB 1GUDA 2H07A 4IGKA 2ZZNA 2JI7A 1V47A 1Y8QB 2CC2A 2JAHA 3Q9NA 1YZ3A 5EMJA 5ITZB 4BUCA 1IB0A 4Q7MB 2YASA 2XCTB 4N40A 5BV0A 3ZJYA 3G17A 2BBWA 3IA7A 1OD6A 1C9NA 1QLHA 4PLWA 2GAIA 2BUCA 2QMYA 1UBUS 2QD3A 2R2GA 4QFDA 3WHKA 3PNQA 1OBCA 2DHCA 4D0GA 4KEAA 1WUHS 5CGZA 5AP9A 3SNHA 4DVGA 4O4IA 1WB6A 2BLNA 5IC5A 1H5NA 4MYRA 1B8OA 1UQTA 1REQB 3EPRA 1QVZA 4KXVA 4F2GA 2YHIB 4YY3B 4EW2A 4U2BA 3K0AA 3ILSA 4DUPA 3SVLA 2ID7A 2C20A 2LRHA 3FDFA 4CKCA 3QUCA 5THKA 4JLMA 2Z3VA 5L3ZA 3WLRA 4HTFB 4N6GA 2D5LA 1N3IA 2MU1A 2XITA 4RA9B 1DIAA 3JR7A 4GLJA 3W8FA 2MHCA 1T15A 2PAAA 5AUNB 4BMXA 2E89A 1J8VA 1AURA 3FTEA 3ESCA 2PGLA 1VPEA 3KD3A 3NV9A 1XCJA 3BWMA 3ZWQA 3GD7A 3KSDO 3F6SA 1F0PA 3OQIB 3V7WA 1QZUA 4M0UA 4WH0A 2CSXA 3AFNA 4K9NA 3ZJTA 2DEUA 1Y4DE 5BMOA 5HS4A 5T5QA 3EYWA 1LLCA 4H59A 4W5NA 3AERA 3G0DA 4DHEA 4BNGA 4UVEA 4EYKA 3CUSA 2G36A 4QAQA 4MS1A 3U4GA 5HQ3B 1T6YA 4NLLA 1OB5A 2QTVB 3JTEA 4D57A 1Y6ZA 5A4DA 1AKYA 4AULA 1J7JA 1G4HA 1N5LA 5COAA 1WCXA 1UC9A 3LT4A 1Z7WA 1G9SA 1PWYE 4HXEB 1IZZA 1U9YA 2ZTUA 5AYVA 2CWWA 2C3YA 3HBMA 3RIYA 5C5EA 2CV1A 1N5MA 3B70A 5BP7A 3ZWKA 5ECDA 2EW2A 3EVTA 1G98A 2D74A 2OD9A 3LIIA 4Q34A 1E0JA 3S7ZA 1RE1A 2VDUE 3CF2A 1IXKA 4E4TA 1RTTA 1GN9A 4K6OA 4ND8A 1G3UA 1RLJA 4EPVA 2HSGA 1KNXA 1WXFA 3ZXIA 4CLOB 2FZKA 4FLMA 4RACA 4TMKA 3LG2A 2W6JD 2PUWA 1DXHA 2WJVA 1EM8B 2HLPA 2QL7A 3AEUB 3RE1A 3TTSA 4YRRA 3D0KA 2QB5A 5JT1A 1PSWA 3OLXA 1MLDA 5IG2A 2O7QA 2YJ5A 4PNHA 1MC5A 1L4MA 1V96A 2QAGA 4F4IA 1O0CA 2N9UA 2ZXEA 1V16B 4L4RA 4RZ2A 1GNPA 5K3DA 2DX7A 1IBRA 4Q7EA 3F9RA 2JW5A 3EEYA 2HJWA 3A1CA 2ZIXA 1D4ZA 2NU9A 3JD2A 4XCVA 4AXBA 5KNBA 1EVKA 4RKQA 3RUFA 2HV9A 2II6A 4XCQA 3PD1A 2X9VA 5HF9A 2JA1A 2Y71A 2DJIA 1UKYA 5TT0A 1SOAA 1TVMA 2BZ0A 2CL7X 3DAFA 5ALPA 3UUFA 2EYQA 1ZD8A 2QRGA 4IVNA 4Q4AB 2B4AA 4S1TA 2ZOSA 4WJKB 1DZ3A 4URHA 4YAOA 4WXEA 3TQHA 3UT0A 3ZCUA 4C3ZA 3MCVA 2VYCA 2GM5A 3N8IA 1UFQA 1EFCA 2QLNA 4YH1A 3L6RA 5D3MA 4DGQA 5BN4A 1UXKA 1RAFA 4WWHA 4HEQA 3K1YA 3DE3X 4ENUA 3UKJA 1W581 1BXKA 2O3RA 3RC3A 1SH7A 3BD6A 3TZBA 5JS8A 1HT1E 1TJPB 3LF2A 3HTXA 1T3HA 1NF3A 2RCYA 3Q7SA 2VH1A 4PPQA 3MJDA 3L9XA 4UMVA 3TPCA 3ZTYA 5IK2D 3A2LA 2ONZA 3O4VA 2PBLA 4KLCA 1R6AA 5BN1A 4LJSA 5F12A 4BUJA 3K1AB 4QGBA 5AXCA 5CFRA 1OX6A 3LPLA 2Q0SA 4K6MA 1Q1GA 4FSHA 4OKSA 2BONA 4HEA6 3MZ0A 4OHPA 5JMPA 3O03A 4ECEA 2G1PA 1PQUA 2IOYA 2R47A 1P19A 4BMPB 1AX9A 7REQB 1C9MA 1Q16A 4MPDA 4QOSA 4IIXA 2DWUA 1BX1A 3LUPA 5CPBA 1RZUA 4G1EB 4GDFA 1JYEA 3DQQA 1L7PA 1S1CA 1A9XB 1BDIA 1GRRA 5K05A 4L9WA 3AHJA 3BVPA 3L5KA 5C5IA 2HTFA 2PPLA 1X7ZA 1JQJC 2OHIA 4R81A 1G21A 3G9QA 3ZGXA 2J41A 1I30A 4ZT7A 1YHYA 4ID3A 4IGFA 1IH8A 3IDSA 4R0VA 3AJ9A 1F2DA 3L7OA 1Q15A 4D4MA 3TLJA 2ZVJA 4PC3A 1D03A 2FPXA 2I0FA 1MG0A 2OVBA 5LB4A 3USCS 5G4LA 2WWXA 2ZSFA 5EYPA 3EH2A 2Q9UA 3FA2A 3V1LA 2F1KA 4JXXA 3UXYA 2I7VA 4UTXA 4J49A 3UJHA 1B00A 1K5PA 3IAXA 3EWSA 1O5TA 2GZHA 3QIAA 4TYMA 2MSDB 3TLAA 1PVVA 5KJ6A 2J31A 2FOIA 2GWRA 1ZNYA 3K09A 1V2GA 3DW1X 4PAWA 1B41A 3ETNA 1WXQA 1PG2A 3FYTA 4AF7A 4JLKA 4X1IB 3IR5A 4EAAA 2QRUA 3NTOA 3EXEA 4I6EA 4O5OA 3RDPA 2O5RA 1CX9B 2PD6A 4A0SA 5BR8B 2G9UA 1WEHA 4W6QA 1WY7A 4BZPA 4LTMA 1CRLA 2PSEA 4EHIA 4YCSA 2B4TO 5HNKA 1KR2A 3PFIA 2CXTA 3BH7A 1T4BA 1CUEA 1UPCA 5IHXA 1YS1X 4GYWA 2G7ZA 2AYXA 4V24A 2NW6A 3V1MA 1ZN2A 2VKTA 1T2EA 5BW8A 4QZVA 3ABRB 5HWSA 3DZGA 3S1AA 3O1JC 5J4HA 3DLHA 1G20E 2RGWA 2VRNA 4AAYA 5DGIA 2FR8C 4PYIA 3Q87B 4OXRA 3ZE6A 3QPUA 3DLTA 1YQWA 2QX4A 1KJIA 3EXIA 1O58A 3AUFA 3DDUA 5J5CA 1UANA 1JLKA 1FC0A 2ODTX 5KSWB 5HSGA 4OU5A 5LQKA 1GYRA 2PZKA 4HUQB 2JIMA 3F8WA 1A5BB 4MA5A 2YJ3A 1HY3A 3PEEA 3QYFA 3LS2A 2AI3A 3DZCA 3RTCA 3PDIB 3VO8A 2F9FA 3QNWA 3TTVA 2IODA 4D4GA 4YACA 1TQ2A 1NBMA 2NO7A 3UH0A 2C9MA 1AS0A 3B60A 1VPVA 4XIFA 4DRXB 5A4AA 3SXPA 2IHYA 2I76A 3G2MA 1DTSA 3PT9A 4Q3KA 5I9NA 1WUIS 4PFSA 5JS1A 1UPBA 2FCRA 3ANLA 3BBLA 3PGVA 4X64B 4PPGA 4XDYA 2NADA 4FWTA 4TMVA 2BR3A 1LPSA 1MW9X 2DF8A 3KXKA 3PXCX 4LZZA 5SZIA 4P0QB 3UXEA 3WX0A 1MRNA 2B30A 1WZNA 3AOEC 3MWJA 1F7VA 1N6KA 4I7EA 4Q9NA 4CCSA 2DBZA 4KYTA 1DIHA 1T1IA 1HSOA 5CA0B 4NEHB 2BH2A 1WD7A 7ABPA 3TOZA 4GMXA 4YREA 1QOZA 2PKQP 2NQ2C 3P97A 1FDRA 1UWCA 2WFAA 3QBDA 3WNBA 4F84A 2XNJA 3FAZA 3U7RA 2JLBA 3PUXA 1QGED 2BM1A 4ZYTA 1LH0A 4QHTA 3ND5A 4NBKA 4W9NC 4J0IA 5BMVA 5U9CA 3M2TA 1T36A 2YR0A 2VTKA 3CUYA 1PR2A 1PT7A 1T24A 4KRFA 4OA5A 3HADA 3MVEA 1U3TA 1OW3B 3HVUA 1RI1A 1E7MA 2YV4A 1FJGB 3ONEA 1KWGA 4HPWA 1FPQA 4LC9A 4E09A 2R7LA 3TRIA 3S29A 3RC1A 1K86A 3IXQA 5TJHA 1Y63A 2HT6A 2WDPA 3BSSA 4C89A 4HMPA 2YRFA 3DTTA 3WB1A 2FE4A 4KOEC 4RMGA 1PFVA 4MCAA 4RF5A 5DI3A 1XDSA 1Y8RB 1U0SY 1OASA 4LDNA 1XEWX 2QVZX 3OJLA 5F9MA 5GGXA 4YRTA 2D2IA 4OQFA 5AK3A 3AWIA 3QHQA 4R2JA 1ST3A 3TIFA 1M8FA 5DJ5A 4TROA 5B55A 1RFGE 1UDBA 1Z34A 2O2EA 1XI2A 4MQBA 3NDBB 2ZWIA 3WAGA 3JWJA 4LMRA 5IEBA 2O8BB 1O9HA 3F7TA 1AD2A 2N1MA 1JQ3A 3BD9A 4G23A 4OJMX 4RKEA 1SB8A 4BECA 1XCPA 1SUPA 2G08A 1ZH2A 3LO5A 4RA9A 3FOWA 4OQPA 1YF3A 3PFCA 4EY5A 4UATA 4F92B 2WM3A 1YZQA 3VC7A 4KREA 4AY5A 3C5HA 2WFMA 1YZLA 2XX3A 4EVIA 3ZIAA 4G5OA 2G80A 4URFA 5LYJF 2YJ4A 1JDBB 2CD7A 2NTVA 2IKQA 3QPWA 4Q82A 3W6ZA 3JPWA 1EA5A 1LD3A 1YRWA 4JJKA 1VG0B 5JSZA 2CDRA 4BXOA 2AMFA 3BMOB 1JR3D 3WWZA 4C08A 3BSFA 4J43A 1N8SA 3R4VA 3WWEA 2H6EA 1JGTA 1F6BA 1BHSA 2XXAB 1PE0A 4EY7A 4BNVA 2BP7A 3B1JA 5G2OA 5A0TA 2FJUA 5FI3A 2OC4A 4UM9D 1HMPA 1W52X 3CIOA 4DANA 1H22A 4RH3A 1EJBA 3GDHA 1RS0A 2OKGA 4PYLA 1OT5A 4HDNB 4WK6A 4DDUA 4PC2A 1OLXB 3D0RA 4DV0B 3RBXA 1YRBA 1BKDR 2Z2KA 4OYYA 3SC2A 2AW3A 1GNVA 2OUKA 4E22A 1TGVA 1P1KA 1PGNA 3L6DA 5TNXA 4CG1A 1NMEA 1F6DA 1M1YB 1XRJA 1S2LA 3I62A 2HM7A 2XCLA 5J1TB 1CZOA 4WKGA 3RADC 3GMDA 2YWEA 1SC9A 4URXR 4TLMB 2ZRKA 3OIUA 5CJJA 5LOVA 4N0MA 4FQ7A 6REQA 3DMYA 2HYIC 2X0KA 1M5TA 4G5RA 5HE9A 2X86A 4RYLA 4XYBA 1QX4A 1I2DA 3LDUA 4FLFA 4E21A 4YPOA 4KDFA 5AJHA 3R0XA 5DWDA 3Q72A 2EZ9A 2I1WA 3K8QA 3LC0A 4C29A 4Z4CA 5JANA 3G6KA 2WMOB 4JI1B 3D59A 4BMOB 2C2OA 2SCUB 2DERA 4YQFA 4QOFA 4A1FA 3AETB 3T3IA 4YUWA 3MTBA 4TKVB 3G13A 1WX1A 3H75A 4NK4A 4EELA 4CIWA 2HBZA 2FJPA 1CUDA 1SVWA 2FMFA 2FW8A 4I4CA 4OQMA 5E3IA 3R5KA 1M1YA 2AOUB 3HA3A 4YJDA 4DYHA 3MJRA 3QLTA 3E3OA 4GU5A 3SN6A 2WUVA 1IQPA 1UJ5A 4N5IX 3UJ3X 1ISGA 2VTEA 4UE3S 1T35A 3X1KA 2VT2A 4YAJA 4IV8A 3CUTA 2P1ZA 1YS7A 5C8YA 2XE4A 3G7SA 4V1CB 1VE7A 3QEAZ 4DM3A 3IYLW 4MVJD 4UUNA 4ZT4A 4EX7A 5IXSA 1KKUA 4IHKA 4MJLA 4J4TA 1V26A 3D43A 1R0SA 2FB9A 3IILA 4YCJA 2WZBA 1JS1X 2AVDA 2QMUA 2Z6VA 1QAMA 1U1EA 3TG2A 1LU9A 2HLHA 4BGDA 1QWSA 3VGJA 4HN4B 5SY6A 1ISFA 1MFPA 2AD1A 3NM6B 3IUEA 3IESA 3LFHA 3PC3A 4HLDA 5BOVA 4GBJA 4UTNA 2OBMA 1E89A 2EC5A 1LEHA 2X15A 4GBGA 4GZ6A 4Z9BA 3THYB 2Q46A 4HVTA 1Y4AE 3O9ZA 1RJFA 4FFSA 2BBSA 1J0XO 5KAPA 3FMFA 3WOVA 2JJQA 3JQ9C 4UFNA 2QZZA 3SIWA 3RUPA 4F4JA 1GD1O 5FBHA 4KSBA 2YNMC 5LQRA 2IP4A 3DZBA 2K7FA 1THZA 4L0MA 5DP2A 4H7FA 1Z0FA 5JI2E 1O4VA 4NNJA 4Y9TA 3VAZA 1EWVA 3A10A 4G9BA 3JZMA 1HZZC 5LBIA 2JH9A 3DXXA 1XMSA 1KPIA 4M0KA 3SI7A 4YALA 5CURA 1S4MA 1U5BB 1NTOA 2QVBA 2VJDA 4MO2A 3I3SR 4R9NA 1LNZA 4G8DA 3LTNC 4Z4IA 3DB1A 2A4KA 2O9JA 1U2ZA 1HKHA 2A67A 2V97A 2BPOA 3NB0A 3R9KA 1YB4A 4Y6GB 2X0FA 2C1XA 4ME6A 3FMOB 4GXTA 2G28A 3S7TA 1DCMA 1OLSA 2HCTA 1XP5A 1HNNA 3AXTA 4M7WA 2Q3HA 4OATA 2ZVPX 4KQ6A 1QRRA 1KI2A 2L18A 3FLAA 4L95C 2FSPA 4NATA 3T34A 4C4PA 2QVLA 1STOA 2PHZA 1QH8B 3DZDA 2BYTA 3MLAA 3KAJA 5F52A 2NV0A 5E95A 1CQWA 1Q1QA 2IDMA 1SMKA 2OM6A 2PKQO 3PJGA 2YCBA 2ACVA 1NUPA 1K9VF 1O54A 3H6KA 5B3JC 2O0MA 1U5BA 2ZEJA 3WYCA 4TWJA 1NVEA 1GV1A 4F06A 4PG7A 1GV0A 3BJIC 4PHFA 4COKA 3PGMA 3QMPA 1CEXA 3GWGA 3OH8A 4C3VA 3LBYA 5BSEA 3GGGA 2VP9A 3B9BA 4HNAA 3V33A 1WW3A 2AK3A 4XDGA 1W76A 1ZGGA 3F5MA 3O9MA 3MWKA 1DDOA 1DKLA 2JH8A 5TQ2A 3TOXA 2RGAA 2PYDA 5E0KB 4EUEA 5BVHB 1RYEA 1XVTA 2WSIA 2KWIA 2WR8A 1ADFA 1M73E 1DELA 1Y5RA 4O4HB 1NU6A 1HYBA 3F4LA 4K7JA 4LN1A 4NFHA 4HN9A 1R0BA 1QG6A 3CEMA 3WXBA 4QDOA 1X7YA 3MBKA 1SOMA 1M2VA 1FFEA 3OHMA 3PA8A 4TKUB 5G0SA 2Z8YM 2V8BA 3U3XA 3ENZA 4TVOA 1SHLA 1N6PA 1Z4LA 1ESDA 4XFKA 3BH6A 2DRIA 2ZWMA 3E05A 1DAIA 1Z8HA 4GZMA 5CDYA 4BX0A 4MLDA 1QGAA 1A98A 3AEKA 3CS3A 4CTKA 4DV4B 1TA0A 1R12A 4B09A 4H7KA 2HF7A 3I6ZA 1KC1A 1Q7TA 3DPIA 4LPSA 1L4GA 1O95C 3MJ4A 1BH2A 3H3XA 4BFCA 1FFYA 1NONA 4NCKA 1IVNA 3AF0A 4LRXA 1OREA 1GGNA 2I6FA 2G1KA 3C8UA 3VDNB 1L4NA 5A3RA 3WLKX 1PVOA 1K6MA 1O9BA 1QQ7A 1Y7TA 3LWDA 4RDIA 4U2DA 4DHWA 4L28A 1J2TA 1B42A 5AQEA 1IXYA 4F04A 1O4WA 2FX3A 2W11A 3TD9A 3LT5A 1UPUA 4BMZA 4E5SA 2CXXA 2AXQA 5HKKA 5AVYA 2GZ1A 3UB2A 1DGQA 2CBZA 2AHOA 2O2JA 3HE3A 4X1OA 3VPGA 3IOBA 1KH2A 1GUAA 2X13A 3SKXA 2HQBA 1UBHS 5CYOA 4EATA 1PJ8A 5C8ZA 4LW8A 1MX1A 3JRNA 5T4BA 4UAGA 3GGCA 4HFRA 2BCJQ 4X94A 2QTBA 1Z7YA 4CT4B 2HGZA 1A1SA 3VR3D 5FV4A 4H4DA 4JWTA 7AT1A 2EYUA 4UXIA 1P0QA 1JIJA 2FEWB 2BDTA 2PEZA 4DMFA 2R48A 3DG9A 1YE5A 2B3TA 1XZFA 2IPNA 5GAJA 1FTYA 2I71A 4QG7A 4F2WA 1K4MA 5JAUA 4O2AB 1SIOA 1EI9A 4JLDA 1VMDA 2DWPA 1MVLA 1VGRA 2QGNA 3DEYX 3KKQA 1K68A 1N6NA 4IDDA 4JMPA 2Z57A 4JUCA 1B1CA 2AKAB 2QE6A 1P1BA 1TZCA 2AZTA 2B1JA 2GB4A 2Y66A 1NI4B 2ZRPA 5IN4A 1V9SA 5KYTA 2LDXA 2B1IA 2BZSA 2HLDD 1ZD4A 2O1SA 2FX2A 1QWOA 4Y6LA 1Q14A 5EMHA 3PEVA 1GKLA 2JNWA 2O3SA 2FWRA 4EHKA 1KJQA 2NZ2A 1AA9A 1UR5A 2AC2A 3I30X 2W2VA 3JALB 3S1SA 1UMCA 3A6KA 4KL8S 3TBKA 1HETA 1K66A 1AUVA 1P74A 5AKHA 1QZTA 4IDNA 3UPDA 4ZODA 1SU4A 5EERA 4EFLA 2Q4BA 1TEVA 2NO9A 2RHHA 3DT9A 4JOQA 1Q7GA 4DUGD 2CGEA 1P9RA 4CM1A 3IURA 3PRJA 1Y4SA 4XYGA 4GYJA 2PCLA 1SVOA 5ALOA 2B25A 1TADA 1KDYA 3TSYA 3WTCA 4H27A 2Y6VA 4QJ4A 2XUIA 3LFTA 4DVJA 1OGJA 3REQB 1DRJA 3BHIA 5JXGA 1XNHA 5FL7A 4AYWA 5LNK1 2WEKA 1U2RA 1ZM3A 3GMIA 3JRWA 1OYOA 3R5FA 2Y8EA 4MB2A 4BNUA 3HBFA 3OIWA 4M76B 4BQEA 1Y42X 3COZA 4IG9A 5BPHA 3H6HA 4D56A 2H7CA 4LGVA 4R0MA 2W83A 2TMKA 4JVMA 2ZCVA 2LCFA 2VNAA 2NVUA 4TN5A 4WINA 3HCRA 4ZVVA 1QG2A 2BGTA 4ZT3A 5A1JA 3U7FB 2XXAA 1UP7A 2ZSAA