3BWBA

Crystal structure of the apo form of spermidine synthase from trypanosoma cruzi at 2.5 a resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
291
structure length
288
Chain Sequence
SELISGGWFREENDQWPGQAMSLRVEKVLYDAPTKFQHLTIFESDPKGPWGTVMALDGCIQVTDYDEFVYHEVLGHTSLCSHPKPERVLIIGGGDGGVLREVLRHGTVEHCDLVDIDGEVMEQSKQHFPQISRSLADPRATVRVGDGLAFVRQTPDNTYDVVIIDTTDPASKLFGEAFYKDVLRILKPDGICCNQGESIWLDLELIEKMSRFIRETGFASVQYALMHVPTYPCGSIGTLVCSKKAGVDVTKPLRPVEDMPFAKDLKYYDSEMHKASFALPRFARHINN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Spermidine synthase
publication title Crystal structure of spermidine synthase from Trypanosoma cruzi.
rcsb
source organism Trypanosoma cruzi
total genus 82
structure length 288
sequence length 291
chains with identical sequence B
ec nomenclature ec 2.5.1.16: Spermidine synthase.
pdb deposition date 2008-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 3bwbA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3bwbA02
2B78A 4E32A 10MHA 4LWOA 4DQ0A 1EJ6A 1R18A 5LQRA 3K6RA 4RVHA 3OZSA 5K0NA 4ER0A 5ICCA 1VLMA 4MTLA 5LQNA 3EEOA 2BM9A 5FHQA 3PVCA 4MQ4A 5DLYA 3PFGA 3PS9A 3EVAA 3FPJA 4BP1A 2OYRA 4GBED 2ZW9A 2I7CA 5G02A 2NYUA 5FULA 2PX8A 1KYWA 2JH9A 5K05A 4OX9Y 1UFKA 1X1BA 4E2ZA 1QZZA 2P8JA 3EGIA 3CCFA 3H2BA 2IDJA 3SXJA 1I9GA 1DCTA 4POOA 4F84A 1O54A 3DP7A 5T6BA 2C7QA 5FUBA 3KKZA 3JWGA 1EJ0A 2VDVE 5HFJA 5M5BA 1VIDA 1WS6A 1BHJA 2V7EA 5GM2A 2P7HA 2ZFUA 3ELDA 3FUVA 5EQJB 3THRA 3UWPA 3BT7A 2P41A 5EMKA 4YV0A 3T0IA 5BXYA 3T7SA 4E2XA 5E9QA 4GOND 2GS9A 3DXYA 3UJ9A 2G70A 1FJXA 1SQGA 3WSTA 5BP7A 4KRGA 5FCDA 3BWCA 4C04A 1NT2A 2AS0A 1G60A 4PIMA 2GAFA 3Q7EA 5BW4A 3ER9A 3AXTA 4PYMA 3G7UA 2OB2A 3TOSA 1U2ZA 4WXHA 5K0BA 5DRYA 4RTRA 2BH2A 4GOOD 5EKUA 1BC5A 4RSRA 4BLWA 3VC1A 2AOTB 3UJ6A 5EZQA 3UJDA 1NBHA 1BKYA 1SUSA 4ISCA 3FPGA 5EC8A 1SG9A 1FP2A 1R00A 2FCAA 3E7PA 1JSZA 3GDHA 3IHTA 3M70A 3MTIA 3GU3A 4HSGA 5EZSA 1WY7A 1KIAA 3FPEA 2IH4A 4R8RA 3P9NA 2I9KA 1JG1A 3MQ2A 2CMGA 3EEYA 3EVZA 2PJDA 3F4KA 3FUTA 2OKCA 3QOXA 1L3CA 2K4MA 1JQDA 4E30A 3OE4A 3AWIA 3CC8A 3OCJA 3TQSA 5E1DA 2PKWA 1XDUA 1RI3A 2YXEA 5EIFA 2NXCA 2PY6A 3FRIA 3P9KA 1F3LA 1UWVA 4M36A 3ELWA 1BOOA 3G88A 5DRTA 4XCXA 3BKWA 3GO4A 3GJYA 2ERCA 3EMDA 3ELYA 3TKAA 3HVHA 4RWZA 5HZMA 2HNKA 4GUAA 2YX1A 5DTMA 2IBSA 3LDGA 3ERCA 2UYOA 3TLJA 1SKMA 4IV8A 4QVKA 1FP1D 3DMGA 5LQAA 4KWCA 3NDIA 3FYCA 4FR0A 9MHTA 1TW2A 2R3SA 3G2QA 5K01A 2XVAA 3DH0A 5E9JA 3NVKI 2ZTHA 1I1NA 3PTAA 1YF3A 3RODA 5F2KA 2QRVB 2E5WA 4GOLD 3P2IA 3R9XB 3HA5A 5JR3A 2BM8A 3FTCA 3FUXA 2CL5A 2JH8A 3KQSA 4FGZA 2PWYA 3HM2A 4MWZA 5IH3A 3SM3A 2OPBA 5EMJA 4BLUA 1JG3A 3EGVA 3GXOA 5CVDA 3HP7A 2A14A 3HCBA 4OQDA 3S68A 4YMGA 1JSXA 3G8AA 4YV2A 1N7IA 3GNLA 2BZGA 3FPHA 4AZSA 4PCLA 2HV9A 5K0EA 1MJFA 2KW5A 3TPZA 5HIJA 4DF3A 3SSMA 1P91A 1DUSA 1F38A 1KXZA 2LD4A 3CJTA 3QV2A 1ZQ9A 2IGTA 1AV6A 3NDJA 3PX2A 4LWPA 2O0LA 5DSXA 3KPYA 4RTMA 5DXAA 2I6GA 3C6MA 3DXXA 3CKKA 3V8VA 3P8ZA 2ZZMA 1IY9A 3MERA 4X1OA 3SVZA 3FTFA 4FP9A 3GIWA 2JJQA 1VBFA 1L9KA 1QAOA 4X63A 5KQRA 4PYQA 3MAGA 4KW7A 4C03A 5KS2A 1M6EX 4CKEA 2OXTA 2AOWA 3P97A 2UZ4A 5ICFA 3U81A 3OZTA 4R6WA 2IPXA 3TFWA 3EVFA 2EJTA 3KPJA 3A26A 5EMLA 3LBYA 1T43A 4RTQA 3G2OA 4KDRA 1MHTA 3TKYA 3DTNA 5CIYA 1RI1A 3OFJA 5K8VA 1ZGJA 1VE3A 3OU2A 1RI5A 5T64A 3MTEA 3TMAA 4EK9A 2IH2A 2ZLBA 4PGGA 4LG1A 2Q41A 2ZWVA 2PX5A 2HTEA 3V97A 3HCDA 4G56A 3TM5A 2G71A 3DULA 3EPPA 2YQZA 2YXLA 4V0QA 2I62A 2ONYA 4C06A 2AOUA 3I9FA 5E1OA 3KPWA 1JQEA 3GWZA 3MGGA 3TRKA 3HVKA 3LHDA 5FTWA 5HOQA 1Y8CA 5GIPE 3OU6A 2XYVA 3UJAA 5CVJA 2IP2A 2YXDA 4CWAA 3KQMA 5DTRA 4E31A 3KPUA 4EKIA 2G72A 2ZZKA 5HIMA 1R8XA 2P1DA 4GF5A 5F2OA 3T7RA 1Q0TA 1O9HA 3SMQA 1RJDA 3KQOA 1D2HA 1H1DA 3AJDA 4P7GA 5LQCA 3DMFA 1XTPA 1WXXA 5FADA 1YB2A 2VP3A 4QDJA 3EMBA 1QAMA 4EMSA 1ZG3A 3KQTA 2O06A 3G2MA 5CUQA 1JQ3A 5EG5A 5BW5A 4YV1A 1VQ1A 2WK1A 4P7JA 4AX8A 3KQWA 1KPHA 5DM1A 3OFKA 3HCFA 4ER3A 1KP9A 1VL5A 3CJQA 4PYLA 3B89A 4HH4A 1JG4A 2IDKA 5EHIA 1ORHA 2AN3A 3JWHA 3B3JA 2P3LA 2YTZA 4YUZA 3NWBA 4YUYA 2PT9A 1HMYA 2FYTA 3DXZA 1P1CA 1XVAA 2AVDA 2O57A 2CMHA 2PV0A 4PCAA 2HWKA 3EVCA 2YVLA 5DM0A 5FWDA 5EHGA 2ZBRA 4E2WA 2JG3A 3SSNA 4C05A 2Z6QA 5JUWA 1AQIA 2PBFA 3JWIA 5E1BA 1WG8A 4C07A 5EGSA 2GA9A 5K03A 3G8BA 4E2YA 2ZBPA 4R8SA 2DPMA 3HA7A 2PLWA 3R24A 4CXMA 3EVBA 4R6XA 5KVAA 2AVNA 1RI4A 3BKXA 1NV8A 3GGDA 5DM2A 3KQYA 2PXCA 1WXWA 2FPOA 2PX2A 4LECA 2VDUE 4U7PB 5E2BA 5CCBA 5DX8A 4O29A 2B25A 4XUEA 3HNRA 4OBWA 2H1RA 4AZVA 2ZCJA 3FTEA 5D1NA 4Z2YA 3BUSA 2EJUA 1EIZA 3KR9A 2NXJA 4RTOA 3NMUF 7MHTA 2OY0A 3TM4A 4CKBA 3LL7A 3LDUA 3NW9A 5C1IA 1XDSA 3G5TA 2CWWA 2QE6A 4FSDA 2P40A 2ZBQA 4OQEA 3LBFA 5P8WA 3ER8A 1VP9A 3HCCA 4BP3A 3I5UA 1L3BA 1VPTA 2O07A 2B3TA 3JWJA 5DPMA 5LR6A 2C7RA 3P71T 2ZIGA 1G38A 3M6VA 1X1AA 2QY6A 3I58A 3AXSA 2PX4A 1NW5A 4Y30A 1R6AA 4A6DA 3HEMA 2BR4A 2Y1XA 1N2XA 3FTDA 3LSTA 1EQAA 3DLCA 3RW9A 3LKDA 4K6MA 3DMHA 1EAMA 2GLUA 5EOVA 2NXNA 3FUWA 5EKXA 2Y1WA 2PT6A 2ESRA 3LCUA 2HR1A 5EIWA 4HGZA 1VP3A 4BY9E 3AY0A 4OBXA 1KHHA 1ZHFA 4IWNA 5CM2Z 4FS8A 1NBIA 3KQPA 2N47A 5ICGA 3CJRA 3KQVA 1R74A 1RJGA 2QM3A 4RTSA 3UFBA 3KR2A 2AOUB 2IFTA 4PGHA 4YUVA 4DKJA 3MCTA 4ER5A 2JHCA 3MHTA 3DLIA 5DSTA 5B1SA 4PYKA 5DXJA 3HCEA 1XCJA 3P2KA 5CVEA 5FWAA 1NV9A 3IEIA 3M6WA 1D2CA 4HC4A 4C08A 4F86A 1JG2A 3LX6A 2FK7A 4P7FA 5CVUA 3DOUA 3IV6A 5FA8A 5K09A 3C0KA 3OPNA 3CBGA 3D2LA 4PONA 3A7DA 2CKDA 4MIKA 3UA4A 4KIFA 4FZVA 4RV9A 2UYQA 5D1HA 5GWXA 1QYRA 4QQKA 4QPPA 5E9WA 4C4AA 4PNEA 5EPEA 4U7TB 2AR0A 3GRVA 3MCZA 5CCXA 1X1DA 1DL5A 2H11A 4ER7A 4P7KA 1YFJA 5ICEA 4HTFA 3G2PA 3OE5A 3C3PA 4YUXA 1Q0SA 1ORIA 1V39A 3B5IA 2IIPA 3PT9A 4GC5A 5EVJA 5K0FA 3SR4A 2OB1A 3LDFA 3THSA 4QQNA 3C3YA 4E70A 1XXLA 3SX0A 4F85A 1ZKDA 5K0CA 4RTNA 4HG2A 4PYOA 5EEGA 3SSOA 4EVIA 3KU1A 2VDWA 3HCAA 4QPNA 4AZWA 3I53A 4V0RA 1JR4A 5DX0A 5E1MA 1XDZA 2FK8A 4PYNA 3KHKA 1X19A 3OZRA 4KIGA 2PXAA 3B3FA 1M0EA 3B7PA 1P39A 2NP6A 3A27A 4ER6A 3LGAA 2GPYA 2PXXA 3VC2A 2ZIEA 4BLVA 4UOEA 2P35A 1N7JA 4PIPA 1NE2A 1SUIA 2PWPA 2ZULA 2AOVA 1ZGAA 3Q87B 4CTKA 3HVJA 3NVMB 3K0BA 3RIEA 3UJ7A 5GINE 5DTQA 5GIOE 1L3IA 3T7TA 3KR0A 3QOWA 4MHTA 1QAQA 2ORED 3G5LA 1TW3A 2ADMA 2V74B 4FT2A 3PX3A 1TPYA 3E8SA 3KQQA 2FRXA 4Y2HA 3BZBA 1AQJA 3O4FA 4KVZA 1M6YA 2YUIA 3EVDA 3VSEA 5KQSA 2B2CA 4M7RA 2XBMA 2EG5A 3ME5A 3KR1A 2NXEA 1FBNA 4DA4A 5HIIA 3EGEA 1KPIA 1R8YA 1O9GA 4IV0A 4M37A 1JTEA 3GRZA 5HIKA 3FYDA 1NW8A 3FZGA 5K0JA 3NJRA 1SQFA 4AZTA 1KYZA 3PLAE 5K0LA 4GC9A 2EX4A 3BGDA 1L1EA 2WA2A 3FRHA 3BWBA 3LKZA 4RX1A 5GP1A 4RTPA 5E8RA 5FA5A 1SVUA 5FHRA 4AUKA 3R6TA 2DULA 3M33A 3REOA 1IM8A 1G8AA 2HMYB 4EKGA 1NW6A 4X60A 1EG2A 3EVGA 5EEHA 2AOXA 4EQZA 3R0QA 4PWYA 3M4XA 1YUBA 3UZUA 4H0NA 5F2NA 1PJZA 4RVGA 3NWEA 3M6UA 3L8DA 4IKPA 5FQOA 4XUCA 2ZIFA 1KPGA 4XUDA 2BR5A 4B17A 2Z6UA 3LECA 3TR6A 1G8SA 2XYRA 5DWQA 2NNWB 4CTJA 4RTJA 3A25A 5C0OE 5DT2A 3I64A 2FHPA 3M6XA 5IKMA 3A4TA 1NW7A 5H02A 3ORHA 2ONZA 3GRUA 2AN4A 4HRAA 1Z3CA 4GQBA 5E8JA 4KDCA 5LQJA 4PINA 3PB3A 3UBTA 1NKVA 2ZSUA 3E23A 1X1CA 2P3OA 4OA8A 4X61A 5ERGB 3SGLA 2C7PA 4M38A 3NTVA 4NECA 1YZ3A 5T67A 1RJFA 1WZNA 2P3QA 3ELUA 1D2GA 3LCCA 4DCMA 5CD1A 5U4XA 3B3GA 2IH5A 2H00A 3BWYA 3CGGA 3O7WA 1YZHA 4GEKA 5HILA 5K0GA 3HTXA 2XVMA 3DR5A 3DUWA 3KPVA 4WVLA 4QTUB 1JTFA 4L7VA 5E2AA 4HTFB 1YFLA 4OA5A 4JXJA 3OU7A 2PVCA 5DM4A 1IXKA 4ZTBA 5DX1A 2AZTA 2UYCA 5GOZA 3UJCA 4E33A 1P1BA 2AOTA 5CVVA 4A6EA 2XYQA 2G1PA 1XJ5A 4PYJA 2R6ZA 3LCVB 3E05A 3BGIA 4RYLA 3X0DA 3P2EA 4RTKA 4ATNA 4QTTB 3GCZA 3MB5A 2OBFA 5C9ZA 4R05A 4P58A 4DZRA 2BR3A 3FUUA 2O05A 1RJEA 2JHAA 1B42A 2IBTA 4HGYA 2YR0A 2ZVJA 5KYGA 3BWMA 4DCGA 3P9CA 1INLA 5EMMA 4DMGA 3HA3A 3UJBA 2PSSA 1FPQA 1I4WA 2GB4A 3UJ8A 5LQKA 2Z6AA 2P7IA 4CKCA 2NP7A 4QVGA 1G55A 2JHPA 1G6Q1 3G89A 3A7EA 2WA1A 2C7OA 4FT4A 4RVDA 3IYLW 4DM3A 4YMHA 3EVEA 3FPFA 3PFHA 3ANXA 2ZWAA 5HEKA 2F8LA 4PYIA 5LQUA 3UA3A 1AF7A 2OZVA 4FSXA 3P9IA 2ZZNA 4RTLA 5FQNA 2PGXA 2GH1A 2UYHA 1HNNA 2EFJA 1UIRA 2VS1A 1QANA 1KR5A 3ID6C 1OR8A 4RVFA 8MHTA 4GOMD 3HVIA 4QDKA 4X41A 3CVOA 2QRVA 3GRRA 1RI2A 3LPMA 2AN5A 3VYWA 4YUWA 3BGVA 3GRYA 2QYOA 3R3HA 3C6KA 2OO3A 2B9EA 3O31A 5LSAA 5MHTA 1PRYA 1NW3A 5GM1A 3BXOA 2G8NA 1XCLA 2VZ9A
chains in the Genus database with same CATH superfamily
2B78A 3PQDA 2BFPA 1XX6A 3I8XA 1J0CA 3NKLA 2ZK7A 4X54A 1RYZA 3SEQA 4EJFA 1RPZA 1E9FA 2FE4A 3V4FA 4QM7A 5IRCD 2QN7A 3NALA 3S5JA 1ETHA 1T2AA 2BBTA 4LRTB 2QM7A 2QZPA 4P0TA 4UFOA 4DWVA 3EEOA 4AJNA 2QTFA 1Y8QB 4AJEA 1YVDA 2XOKA 3RUDA 2ZQ5A 3EUWA 3LT1A 3P0JA 4GD3Q 2Z3ZA 4GGPA 4MW4A 1DIRA 5EGNA 3I8SA 5SZKB 1R50A 3WKCA 3X1ZA 4C3OB 2GKOA 2D1RA 2W9XA 4I6EA 1KWGA 1U0BB 1GVHA 4EB6B 4C7XA 1JXOA 1BAPA 1M75A 4UOQA 3JQGA 1KH2A 2A0WA 2XMZA 5DVZA 2X0EA 3X2EA 4BPRA 1YBMA 2R6R1 1B7GO 2P75A 5B2EA 4YMUA 3PIRA 5JNLA 3EFHA 1M8GA 2OSVA 1IMOA 1FP7A 1UP7A 3INNA 4HO1X 3VJRA 5ECWA 3CX3A 1VPEA 1Z07A 3MC1A 3NH9A 4CU5A 1NJFA 4RO0A 4EEZA 4QDXA 3FUVA 2QT0A 3NGMA 1U9IC 2ZUTA 5BXYA 3T7SA 3GDGA 5E9QA 1IBMB 3DZJA 5T4FA 4ZAYA 1MGOA 1UPUA 3A1SA 3I9KA 1FP6A 3RE1A 4M7WA 4DJEC 1OFHA 3D3JA 5FI3A 3RC9A 1FDIA 2AEFA 2OP1A 4Z4IA 3UK6A 4H3HB 1TAGA 3TDMA 1R64A 3CPHA 4R1LA 1U8UA 2JKYA 1I6KA 4K2HA 3AM1A 1WW8A 4LJ5A 5ALJA 1Z25A 4HQRA 1V6SA 2BRUA 3PUZA 4PFKA 1GPDG 4XIGS 2BFNA 2OC9A 4UDNA 3ZI4A 1NVFA 2XY4A 3M1AA 1B8UA 2P9YA 2PRSA 3L05A 4FSHA 5LLSA 5TMBA 2H9IA 3FPGA 4HB2A 3RVPA 2CDCA 2XRYA 5HQTA 1BMQA 4CIWA 2KPOA 3MLBA 2NO9A 3NDPA 2VHZA 4Y9DA 1XXHA 3K9CA 5EMHA 2AF4C 4CPDA 3IOBA 3F8TA 4PZYA 1MRSA 4Y1RB 3MQ2A 3D4LA 2PZGA 3ZFQA 2FJUA 2NO7A 4OF4A 4ZGBA 5LUAA 2JFWA 2EF0A 3KEMA 3VNAA 3F4KA 7YASA 1R5OA 1JQKA 3WDLA 1UDBA 3WLKX 1L3CA 1G3UA 1JQDA 2K4MA 1WMEA 2QRLA 3IP1A 4AICA 4BNKA 4MGZR 2YYSA 1GGMA 2Q8QA 4K9PA 1BN7A 1GITA 1GPH1 1ZJZA 2PKWA 1ZOIA 2W6OA 3N2YA 4JL8A 2BH9A 1E9VA 4AMGA 1BXZA 4EMTA 1RP1A 1SGWA 3T1NA 4OG2A 4QQRA 4B74A 2WUFA 3BKWA 5DN9A 4CMEA 1RW4A 1Z83A 2AG0A 2P8SA 4DW8A 3H65A 1BS1A 4XVCA 4GL2A 3LDGA 1K97A 1KORA 1DLIA 3W5DA 1MU0A 5AW0A 2QTVA 3NBFA 3W0LB 3KAJA 4MW0A 3OA2A 1DKUA 4D81A 3ITEA 3H2IA 4FFOA 3KSBC 3V48A 1NTOA 2W8BB 4HAWA 4GR9A 2HCTA 3DOOA 4S0ZA 3UAVA 5I7AA 1MJGM 5BV0A 1P4JA 2OHHA 3F3KA 2BHTA 4KHPB 1CC1S 3V7UA 2P78A 4QD3A 4YRBA 3KQSA 2CL5A 3CR7A 1A77A 2D8MA 4LX0A 4CM1A 1F2TA 4Y9UA 4WY8A 1G8YA 5F77A 3I0ZA 4A10A 3FMPB 2QA5A 2ZE7A 1DIOB 4TSFD 3QMPA 3ACBA 4OQPA 3LA8A 4RFLA 5KO2A 2X6QA 5KJEA 1IAVA 2BZGA 3X44A 2HWWA 1QTQA 2Q5HA 1E9SA 4BAGA 3QH4A 2D1QA 2I4OA 3K9GA 1MJHA 3N76A 2B8WA 3VZBA 1V3UA 1FE8A 4DT1B 4NY1A 5DYTA 4WL0A 5DMXA 2DY1A 1SXQA 3IDAA 2FSVA 3PITA 2H2HA 3PX2A 1DC8A 1QO0D 2EBWA 4IDNA 3ZGLA 5JXJA 1M7GA 4KV7A 4TRNA 3GI1A 2W42A 1IVYA 4A8TA 3LY9A 3FTFA 1MQ8B 1XF9A 5D84A 2A9JA 5IAGA 3F9CA 1BSVA 4P2GA 2VH1A 5JCJA 4C6SA 4MVWA 5JZVA 5F21A 1LB1B 1ZM2A 1MTZA 2MWMA 4OMUA 2UZ4A 2HADA 4JB2A 2A0UA 1NXVA 4XLZA 3U7QA 1JWBB 2YXNA 2D62A 1T9ZA 4BNTA 4UEQA 4L73A 1DUIA 1DJPA 5C34B 4ARIA 2F3PA 3LBYA 2BUCA 5JECA 1FMTA 4KQMA 4KN6A 4H7DA 2FPWA 4RQTA 3WNVA 3RHFA 2ZBFA 1Q7RA 1OZAA 1JR3D 1OXSC 2P2DA 3AYXB 4BNUA 3ANMA 3DFIA 3S1AB 1BH2A 1NXWA 2P2YA 2I87A 4CQJA 1KIFA 2RHMA 4LG1A 1N7GA 2JH3A 4Y9RA 8ADHA 1PHRA 5AW3A 5IFKA 3TJZA 4KQWA 2COKA 3B1XA 3KPWA 3UB3A 1Y3AA 3ISTA 1SD1A 5DT9A 2D1SA 1ZD5A 1S3SA 4IL5A 4CWAA 1GSIA 1HFKA 5DTRA 2AN9A 2B1IA 1TM1E 5A9TA 3C5CA 3OZUA 2AD1A 2ZYVX 5K3FB 3W3AH 1BYUA 5AI6A 5BV2P 4GRDA 3EUAA 3FSEA 3GEHA 4RH1A 2C4WA 2R8PA 3FYUB 3KD2A 4BRZA 1GN8A 1KERA 1LVUA 5AJHA 4AZ0A 2PL3A 2WKWA 3PDCA 1YB2A 1LU9A 5D2CA 1Z62A 2O5RA 3WLEA 4NAVA 2WK1A 1WIWA 4HCJA 3WGIA 2RBGA 4JFRA 1EFAA 3UFXB 4DILA 2VTKA 3D8HA 3DCIA 1FYFA 1I4EB 1UQUA 3OY2A 4MI6A 3CRRA 2VNIA 2O3QA 2Q3CA 5SY9A 3ER6A 1U6KA 3NWBA 2E1PA 1E62A 4LGCA 2YHBA 3JZAA 2ZUUA 2WF6A 1AO3A 1CNEA 3U4QA 1EFUA 3J7AC 1N8TA 1C1DB 5CXXA 5EHGA 2DPHA 1UDXA 1OOEA 3DE5X 3JPYA 4OD0A 1EVEA 1DC5A 1V7PC 2BFOA 4TT3D 3ZDFA 3P2MA 4C07A 1ECPA 2AFIA 2PNJA 2GF2A 1JNXX 1RWQA 1QG2A 2A8YA 4JA0A 2FPOA 2WJGA 1VCHA 1ZRSA 4EJ6A 3P9SA 3MSXA 4CEHA 2W2TA 2XUZA 3KQKA 4NCIA 2PMEA 1S8FA 3C8MA 3DL4A 4FPXA 5AW8A 2W6QA 4P34A 1UFRA 3MRTA 5FKJA 2D00A 1DXHA 2HSWA 1GKKA 4D9KA 5D8DA 3PF8A 3MFYA 3M89A 1AUQA 2W2NA 1WY5A 3TM4A 3MTJA 1EJ2A 2HXSA 5BSEA 1IBCA 2E0IA 3ZWOA 1XDSA 3LX8A 1ZRMA 2C9CA 3R09A 3IAXA 3HP1A 4FYVA 4QJ5A 3NTXA 1T4BA 2A92A 3LGXA 3IA2A 1T1IA 4IH1A 4AUEA 4J49A 1CF4A 2OG1A 2C61A 5LMUB 4KDFA 5AKKA 2JJ8A 2NZ2A 4YMWA 2HPHA 3O0DA 3EXHB 4IH4A 1TQDA 3CZCA 3D54D 4P0QB 2W4IA 2Y1XA 5DULA 1QHGA 1M2VB 3MWDA 4TT8A 3NRJA 3PXCX 4LQLA 5K20A 3UG6A 1HR0B 4E4RA 1MORA 1ODTC 2ZTUA 2EQBA 2MYNA 5EJFA 3L46A 2Y1WA 1ZR2A 4EYKA 2XDWA 2CLHB 4LBZA 1XZQA 4LTMA 1AUXA 2PH3A 5BVGB 2PT7A 5G53C 1ULAA 1M0WA 2ZRFA 1NBIA 3G7SA 3SVTA 1LNZA 3TFOA 3Q4GA 1UDWA 2APJA 2XNDD 4PHFA 3UY4A 4FYWA 2CNBA 3UC5A 3LQFA 2GO7A 1VYHA 3CNOA 1SR8A 1JVNA 3C1TA 1CLEA 3F90A 3RFVA 3TMYA 1LTQA 4RGYA 2EKQA 4NZ9A 2C4VA 3QHQA 4CM8A 1PV2A 2BM0A 3HJTA 3EDQA 1SCQA 1WHTA 3NTRA 3PHLA 2O1EA 3SHWA 1JG2A 1XQ6A 1P2VA 3LX6A 4Q3BA 6GPBA 5GY7A 1FYDA 3SZMA 5JJIA 1EEHA 3IV6A 1RWNA 3U49A 1O5IA 1RTTA 1U6JA 4I55F 2BMJA 2BCJQ 3ZGYA 4JLKA 1W0JA 2NWQA 3B9PA 2FQQA 3JPWA 2F3RA 2XSZD 4EFDA 3OZBA 2HO5A 4IINA 3U4GA 2NAPA 2FZ5A 1HORA 1PK8A 4QPPA 5FRDA 5ARBA 2H07A 1U0GA 4N6NA 5CLQA 3TAUA 3H5RA 3H5OA 1KP2A 3KKNA 5KYVA 4P7KA 3TW6A 3WOVA 2EXXA 3HN7A 4EAQA 1YMUA 3NOOA 1K8RA 4R2JA 4NJMB 3DLHA 3IBSA 4F3TA 2Q5JA 3RYHB 5KNDA 3ZS8A 2EAUA 1GXSA 1DAMA 5EJ6A 2WTMA 1N5DA 3R76A 5CH3A 5EXXA 4HAZA 3ZNPA 3F7TA 1P3Y1 3KZXA 1RCTE 2ATEA 3SHTA 3ZZ1A 1P0IA 5FTNA 4HYTA 3VBEA 3L06A 3VDNB 1EXDA 4G09A 1QCZA 1A8IA 4F4CA 3TJMA 2YZGA 4QHYA 2E18A 2OAP1 4MKRA 2ZIVB 4DIOA 3PRHA 1ECJA 2JBAA 4FJ2A 1TL7C 2X0RA 2C42A 1QS0B 5JBQA 3HCRA 4UOEA 1JTVA 2F43A 2Q45A 2WMNB 4IIHA 4PC3A 2WJ6A 5BN3B 1NDHA 4OAQA 2QI9F 2RB5A 3HVJA 3I5AA 3DR3A 3HWSA 4MICA 1AQNA 1YJCA 5KKNB 5IYZF 3KL4A 3ABRB 1NXSA 4NCKA 2WF9A 4HLQB 2VSNA 1N33B 1D2RA 1F8YA 3A0RB 1LQTA 1J99A 4DUZB 2ZWIA 2EP7A 4BWVA 3EISA 3IUMA 3KOZA 2J5KA 3F7OA 3EVDA 4YYZA 1G8HA 2VHCA 2EFCB 2B2CA 3ORYA 1RBZA 2LUOA 5KQSA 2AYXA 4M9XA 4HDCA 2J5BA 5IUKC 5LP6B 2G6TA 4QGBA 1H2HA 1E3WB 3QVOA 2FQWA 4Z1MA 2JFXA 2NADA 4J2HA 4LUCA 4M37A 3ZBTA 4DLLA 2PYIA 5A03A 3FYDA 1G3MA 1NW8A 2PEZA 3LCJA 2H16A 4I1YA 2O2IA 4TYQA 3PLAE 3DEIA 3QM1A 3E0XA 1WKBA 3JASA 1N25A 3JZMA 2QS9A 3FRHA 5GP1A 5AW9A 4FYHA 3IELA 3DWGA 4F5YA 1XJWA 1IM8A 3AHJA 3C85A 4OP2A 3O5AA 2NYRA 4IUCS 3JW8A 4ECAA 3TX6A 4EKGA 2WMOB 3ZHUA 3Q41A 1MAUA 3CSDA 2X9NA 4D3FA 1Z5NA 1DEHA 2VJYA 1GLVA 3PFIA 4FR2A 1PJ2A 4I3HA 5AM2A 1JFTA 2AXEA 4EHJA 4ND7A 1U0HC 3HUNA 3INGA 4PRZA 2X58A 3LECA 1WXHA 4PR0A 5K3AA 3RRMA 3UVEA 1KIMA 1ZNXA 2HPVA 4NK4A 5K9ZA 3X43A 2FWMX 3HB1A 3OUTA 4IFEA 1NW7A 2PUWA 4JI5B 3LT2A 4GQBA 1U8CB 2JI8A 3HZOA 3C3DA 3H5TA 9MHTA 4WUVA 1E5VA 4NX2A 1QH9A 2I2AA 3NTVA 3EXAA 5CYPA 4JKIA 4MI1A 1WZNA 4D3ZA 3OBBA 2J6HA 3BRQA 1YZHA 2MSKA 5E6SB 4MV7A 1QTIA 1Q57A 4DEYA 1HC7A 2F1KA 3K6KA 4YXFA 4NI5A 1PFKA 1U2GA 2X8JB 2XGMA 2EL7A 4FD2A 4MW2A 1ATZA 3ICPA 2RGAA 3COZA 2W93A 2QG4A 2XYGA 1C81A 2XVXA 3RIXA 3R3WA 4FDUA 5GOZA 2UYCA 2PBLA 2CSXA 3ZLTA 1CR2A 3I76A 3MBKA 2PAAA 5BMVF 1BFKA 3GJXC 1O1YA 2B7BA 3EYAA 3PSHA 4YJ3B 1QP7A 4ERXA 2UUCB 3VO2A 3VGPA 3R6GA 4GX2A 3JQ7B 5H59A 4KRGA 3ICVA 3NLLA 3GJ7A 4ATNA 4OH1A 2O8DB 4WK6A 4JBYA 1JB1A 5IHXA 4KR7A 2Q1YA 1Q0RA 2ZB8A 3UN1A 4JJFA 5DM60 3U60B 1JF8A 4TLMB 4FEEA 4WOPA 1DP4A 1TEHA 1VYUA 4DSZA 1HDOA 1U9JA 2BW0A 4U2EA 3MM4A 3SJ7A 4CMBA 1I30A 3IDSA 3KXKA 2J3IA 1R4NA 2C5AA 2D8AA 2YMMA 1G4AE 2NM0A 4GI5A 5G0SA 4HN9A 4BO3A 4QBGB 4BRWA 1IK6A 3A7EA 3WGOA 1C0LA 1OREA 1VMAA 5B57C 2O5CA 4IOLA 1Y1QA 2FPGA 2P5YA 2WBLC 4OXNA 4EO7A 1A04A 3P9YA 4QFMA 1N2ZA 2P4EA 1SA0A 4RW0A 3ESXA 4A0FA 2VJMA 2A7QA 3PD1A 3MUNA 5BWOA 1PLJA 2VPTA 3P9IA 5AVXA 5EJ8A 4I55A 3V1TC 1TM4E 2VQ6A 2VS1A 3Q2OA 2MIIA 3RTDA 1Y6QA 3D4IA 5E3JA 2GCIA 3W3AD 1KVTA 4BBPA 2QPTA 4YHHB 4MLCA 3LPMA 1NQUA 4OJTA 2EKBA 1YRWA 3GRYA 3TD2A 4CDMA 4Z7JA 2X15A 4P82A 3ZV7A 1WMFA 3JARA 2C99A 4GWKA 4L16A 1VXRA 3IQIX 1QE5A 2MTBA 1ISMA 3QFSA 4TLDA 1AC5A 1TA0A 3TUZC 4PEVA 5G1OA 1JDBB 1XJ0A 3ISJA 3OZSA 4CMIB 1RC8A 3L8EA 4PCUA 3FVTA 3N2ZB 3OQVA 4I1IA 4UCQA 3ENQA 4CMAA 3T9AA 2KMLA 2XH8A 1GO2A 3UBMA 1OTYA 1HTWA 5SYMA 1U0NA 2BIFA 1GJRA 3C3WA 3IC5A 1O4VA 1Q16A 2J9FB 2XCUA 5C1OA 2PUDA 4QGFA 1K6XA 2GESA 3ML1A 1M6HA 2ATIA 3WK9A 1VC2A 2D59A 3EGIA 4G8BA 5HDQA 3HRKA 4HX2A 3SS9X 4ACAA 2V8OA 3DT9A 1ST3A 4YAUA 3A0UA 1KJQA 2V0CA 4QARA 2OV2A 3KHTA 5MN6A 3MJSA 1U1GA 4MYCA 4WZZA 3V8MA 1NF2A 2B0CA 3CY6A 4W8OA 2RD2A 1Z15A 2YBDA 1RZRA 3AGQA 2XVYA 2JBWA 1GUBA 1Z5PA 3E9DA 3ECAA 4FFBB 4U02A 5EYPA 3UWPA 3HCNA 3BT7A 4TS9A 1TOAA 1Z4JA 2HT6A 3LZDA 5B2FA 3EQ6A 2O7VA 3IQZA 2C03A 3U4DA 5IYZA 2PUAA 1SQGA 5BP7A 5C3UA 1EGVB 4JB0A 2WAXA 5ARDA 3F6EX 2QN9A 1RBYA 2QM8A 3O8OA 5BW4A 2BGWA 5FV7A 1Y42X 3O3MB 3AXTA 4DCOA 4KTVE 2QRZA 4UQLA 2XZOA 3ER9A 2JZCA 3O92A 4XWYA 1LS1A 2BFEA 3QEKA 5CG2A 1ZZEA 1NAIA 3HDJA 2X13A 1KR2A 4GOOD 1GDTA 4XDGA 3RPEA 2GZ2A 1NMXA 1QC5B 3O9ZA 4TTRA 1J0AA 2P69A 1NX9A 4N5NA 1XYVA 3ZEAA 4XARA 4I9NA 2FCAA 1Y7IA 1AKNA 4QATA 4B4UA 5KNLA 4F1JA 3DJYA 4Q1AA 1L5HA 4NJEA 1IZ9A 5AVJA 4DV4B 1NUQA 3NBKA 1IQUA 3RADC 4P0PB 1DEOA 1W2HA 1W88B 3VQTA 1XT6A 3RSOA 1LA2A 1H3FA 3H83A 3QE3A 3DONA 4GOXA 4KWHA 3O7MA 1JG7A 5L3ZA 1GTMA 4CBVA 5JXHA 1WF6A 2EU8A 4YAFA 2WSLA 2Q46A 4M1YA 5AI0A 5BWLA 1Z5ZA 3OUZA 3VJMA 4TYPA 2YVQA 1J4AA 1JLRA 1OAKA 5CJJA 2PUVA 5EIFA 2IITA 1R12A 5T41A 5KI6A 3S1LA 1UWVA 4C87A 4XCXA 1HEIA 4EH1A 4GMXA 5HXAA 1KKLA 2YWXA 3EMDA 1JT2A 3LLVA 2KYRA 4CLXA 1Y9JA 2GPSA 3DTVD 1HFEL 2JAPA 3LSYA 3QU5A 3RK4A 2HO4A 4DRXA 2HKIA 1CDDA 5G4KA 2R2GA 1BW9A 1X74A 3DKIA 4KUEA 4UULA 5CR9A 1TW2A 3CW9A 2P79A 2QZ9A 3OJLA 3H9JA 3WAKA 3R77A 1I4OA 2ZWMA 1FLDA 4RV4A 3JQAB 4N3CA 3R9XB 3K9NA 4DLWA 5JS6A 2Z8YM 2ZAMA 1YQUA 1RCUA 1D9XA 5CB6A 3FCXA 3KK0A 3NEPX 4FGZA 4XH9B 3C6YA 3AR7A 4Y6GB 3SM3A 3X3HA 4FC7A 4BX2A 1ZC3A 3VR5H 4S1TA 2A94A 4UZEA 4W5RA 1K7YA 2H51A 4AF7A 3Q6IA 1JSXA 3G8AA 5L51A 3BCUA 5JFTA 2WZDA 1UBEA 3LW8A 5BMVA 2NQ8A 4D8XA 2P9JA 3CN7A 2C78A 1QQTA 1AX9A 4XWKA 4DF3A 1NXPA 3SSMA 1XQVA 3HY4A 3MTBA 1DUSA 1F38A 1KXZA 5IP5A 1QU3A 2LV8A 1ZUHA 3BF7A 1TU0A 3H2YA 1UJ5A 3GNSA 3U7RA 3IAS6 1PJAA 2QAGC 3K1JA 4O4HB 3EBLA 4PLWA 5DI9A 1U3TA 4FMCF 3ZNQA 2VQFB 3I2JA 2ZSHA 4XZ3A 2ZZMA 2Y4OA 2QUKA 4A2WA 3SQXA 5IW8A 1C1HA 1YA8A 1SQ6A 2LGJA 2R8BA 3L7BA 1ENPA 4FP9A 2BKAA 4O4LF 4YCJA 3PDWA 4BTLA 1HA3A 2IS2A 1T5HX 3NCTA 2YYZA 1NY6A 2E4VA 1E63A 1GN9A 2HAEA 2AXPA 4YV7A 3K73O 3RAGA 1G6HA 1O94D 1RAAA 4Z4HA 2RI0A 3M2PA 1AKMA 5GONB 5A06A 3A6FA 3SBDA 3WYBA 4ZKDA 1QJCA 2CKMA 2UVQA 2FEKA 3V7FA 1UXKA 1W36B 4M86A 2G83A 4RANA 2J7PD 3DTNA 3DGEC 1VE3A 4O2AF 2B0JA 4WCFA 3T1HB 1JU4A 3HKCA 2WF8A 4NFYA 2QUZA 4QXMA 4DJFC 2H1CA 1TQ6A 2Q9AA 4JI6B 4B6SA 4BCDA 4L4RA 4GWLA 2OFOA 2IEAA 3BGWA 5C1PA 5FWYA 1CJCA 1D2EA 4HLNA 2AOUA 1KL7A 1LW6E 2PKCA 4TLBA 5E1OA 2Q8PA 2CK3A 4WFQA 1GGKA 5FTWA 1R0LA 1G0NA 1M34B 1A2QA 2QU7A 3FYTA 4OPMA 3VPAA 5L8VA 4R1OA 1R8XA 1TA9A 2P1DA 4U7WA 5JAQA 2WIAA 1B3BA 2Z5LA 4RABA 2XAUA 1BJRE 2QLJA 1TCUA 2ZYAA 4FYMA 2FFBA 3U81A 3DLAA 1XALA 3UUEA 3AI3A 4WLOA 3ZLUA 3G2MA 3FI0A 4IZ6A 3EQZA 3G0IA 3VDRA 2OESA 3LZCA 1EXMA 5FOTA 3FHTA 1KP9A 3CJQA 3RYIA 4PYLA 4QIHA 3DT6A 3KEGA 4X5OA 4CLEA 2JIDA 1P1HA 3LUHA 1DCFA 3WI7A 3VZPA 2RH5A 3E22B 2FRVA 3B3JA 2P3LA 2YTZA 3CLHA 3RSFA 1E9AA 4C0AC 2DSNA 1P2TA 4MUBA 3E9NA 4A2PA 4EATA 1XNQB 2C8VA 4F3CA 5FBQB 4FOPA 4WLVA 4OYRA 1RPJA 1H4VB 2IYWA 2VCHA 2ZB3A 4XQEA 4JI7B 1R88A 1ATIA 4XCVA 3A3PA 2YJTD 3U44A 5JCXA 3D8RA 2AMLA 2XHZA 3RIHA 3TW8B 1Z4LA 1PZHA 4NYIR 5AKGA 4ITVA 4PQFA 5A7FA 2XMBA 4R6XA 1FQWA 5KVAA 3BGSA 2ZE5A 2RK6A 2IV7A 3IKTA 5AVYA 2BJVA 3L6OO 1U7TA 5HPYB 3EWIA 2WDZA 2BTOA 2C4HA 3DDHA 4M89A 3TCNA 2QRQA 2CJFA 3B8EA 5AK4A 4LXTA 1EFVA 4DIEA 2TMKA 5FBZA 3ZIAD 1DTWB 5IAEA 1HNZB 2B8TA 2H4ZA 2XMRA 3G5TA 4J0GA 1MDFA 2WJJA 4HS9A 1RWKA 4B7AA 5P8WA 2Y2UA 1UMBA 1A5AB 1XRJA 1OPXA 4FBMA 3H3FA 5SZJA 5JG7A 5LR6A 2A4KA 1IZYA 4RMNA 2WF7A 2OA0A 4QHSA 4RLHA 3FOFC 3THOA 1M5TA 2BHRA 4J94A 2P2LA 3GH1A 3THYA 1G38A 2PQ2A 2PX4A 4JJGA 2ODBA 3ZDYB 5IVPA 1HLPA 4GKKB 5L6MB 2EW8A 5EWLA 3SQNA 4PZEA 2HRZA 4G89A 2XTNA 2IHYA 3WZMA 4E5NA 1QP8A 2AWNA 1P5FA 1ZO8A 3VPFA 3EPHA 4R7ZA 5JAMA 3GVCA 1SQ0A 1PGOA 3M2TA 3RSLA 4OLFA 4B9AA 3LY7A 3U4AA 1OWPA 4IKOA 1D1TA 2MSWA 1HFWA 4J2OA 1QIKA 2G3YA 2MINB 1PKEA 2CUTA 4KQIA 3RT7A 3AUXA 3TQTA 4EY5A 5LD2C 4Q12A 1TFUA 1W4AA 3CF4A 2Z95A 3TZLA 1E2GA 1EA7A 1H5UA 1SC4A 1WHSB 3I30X 4NMWA 4HLUA 4KQEA 5JBIA 1HT2E 5I8ZA 5EIOA 4A0GA 1YRAA 1JE0A 1WMDA 1ZCBA 2CUZA 3FOCA 4R1NA 5CVEA 4IJQA 3ZIUA 1T9DA 3M6WA 4MMXB 5K4AA 4J7XA 4RHXA 3ZJYA 5AHKA 4BHTA 5A5GA 1OV6A 5DOZA 5EWMB 3U7EB 1AUPA 2JZNA 4QWWA 4YPVA 2XUHA 4J03A 4YJFA 1CE8A 3CB2A 4GKJB 1NR5A 1EZ4A 1YBAA 1WDWB 2NIPA 3GD5A 4IV5A 4R1SA 3VVCA 4LTDA 1H4TA 4YRKA 1ESZA 1OJLA 4P4LA 1UAGA 4Q4AA 1BA3A 1PFVA 4QXAA 2VHXA 3ADCA 1HV8A 3JD1A 4DE5A 1Y4SA 4YECA 4LFAB 3WLOA 3J81k 1MB0A 5ILGA 3OPQA 1V0JA 4ER7A 1J5EB 1P6QA 2CXSA 2FWBA 3TW4A 4FB4A 2DBZA 3OE5A 2P11A 2XCLA 1Q0SA 5JSUA 3PTLA 3D3KA 2VJBA 2QN8A 3VNRA 1UPBA 1AE1A 4I5GA 5F98A 4OQLA 2OV1A 2X8AA 1SC9A 1OI3A 4LTNA 4B31A 4PYOA 3OTGA 1ZMBA 3WK5A 4FWTA 3M9LA 3P45A 3CNEA 5JCZA 3KJQA 1UMKA 3W2IA 4AIRA 3INYA 3N2IA 4S0XA 1AIPA 3Q88A 1V6CA 5ITVA 3HZHA 1SOWA 1DTEA 5AM5A 3B3FA 2YWRA 3D81A 1Z5VA 3JQDA 5K6TA 1DMSA 4RJ2A 3H1FA 1P39A 2PLFA 2R79A 4M54A 4O2AA 3LT0A 1QCDA 4DIBA 4PN3A 3UHAA 4XYEA 4Z9BA 2C97A 2YASA 2NVUA 2L0XA 1QLHA 1L5MA 1NVXQ 1RJ9B 3HLKA 1YQXA 4ZOLB 3JRXA 1XD2B 2EJWA 3MMNA 4U9IS 4RJKA 1GZDA 1YNSA 3HVRA 4EPTA 5I9IA 4R2MA 4O59O 3MMXA 4CF4A 4CKBB 4F98A 3PD7A 2C20A 1N6OA 2OCPA 4G9BA 5AOCA 4D0LB 2P68A 3QOWA 2HA6A 5YASA 1TW3A 2AC7A 4BNNA 5AM1A 3KQQA 4OOFA 3HGTA 5JAZA 2QBYA 3I05A 1GNRA 4GSYA 3M81A 2EIHA 2V5UA 1J0XO 3T7DA 1DJNA 1PJSA 1ZITA 4YJHB 2E6KA 1YB5A 4R2KA 1F1JA 5WRFA 3TLYA 5D85A 3USZA 3WX0A 4B3RB 1KMHA 1LLFA 2IXFA 1U8TA 3GLQA 4YCAA 2EYUA 2PHZA 1W48A 5JMPA 5HIKA 1GUZA 2ZR0A 2X0NA 4LRYA 4WA7A 5BVHA 1VECA 5F1PA 2WFMA 1ZIXA 3X1YA 1EYZA 2A3NA 1H8HA 1NWHA 4GC9A 3UUGA 2Q0QA 2QR2A 1GDHA 1QCYA 1MT0A 1YTLA 4N5DA 1I4TD 2ZE8A 3JYOA 2IXAA 1GG5A 1S8AA 2IP4A 2YJGA 3K1YA 3O4JA 2HZ7A 4XD7A 4XGQA 4YN3A 5JY1A 4EVSA 4ZRNA 4D43A 1Y8QA 5DYYA 2AOXA 2PZAA 5BWMA 2FW6A 1E98A 4PLHA 4H0NA 1E3TA 1U7WA 3ZX4A 2CLFB 1E5QA 3M6UA 3WIDA 2DR3A 4M49A 2UZ0A 4KMSA 3MS7A 4OGWA 1AA9A 4WEQA 4EB6A 5I7SA 3K09C 4RBNA 3WRYA 3GFPA 3FF1A 2AZMA 3L6RA 4MW9A 3X1KA 4ZHQB 1PR2A 3LDAA 3EXIB 4A03A 3RBZA 5BNTA 3GEPA 1JHAA 1NP3A 5E8JA 4URVR 5CH8A 3QX8A 5B7PA 2FU5C 3SC2B 3VR5D 4JODA 1ZIPA 1XMQB 2OKGA 3R3YA 4YMLA 1GKUB 3WNQA 5FFMA 3E3OA 1HT0A 2HSDA 3IUYA 4N54A 2ZUVA 4RC9A 1NBWB 1RM3A 1D2GA 3FHOA 4K9SA 4CF6A 3STXA 2H00A 4MULA 2C2MA 4RFSB 4KQCA 4D45A 5J4HA 4EYGA 1YFLA 2FMUA 3NWOA 2IXGA 5J63A 2AMVA 4ADSG 4C20A 4CR6A 1IUPA 2Y0CA 3U48A 2HMAA 4XWTA 3R3JA 4Z9AA 4F8EA 5L53A 3U56A 3UUWA 1TF5A 1Z2DA 1Q20A 2V3VA 2QTWB 4FHDA 4K0KB 2A0XA 2VWHA 3OOHA 5JEEA 2XNCA 3OPYI 2QE7D 5KPJA 1O6FA 1MAVA 5DDIP 5KCZA 1M10A 1PX0A 3CRQA 4WDRA 1E2BA 1SRQA 4C6RA 4GMFA 1TIBA 3C14C 4LY3A 2ZJ8A 4PXYA 5KVQA 1FBTA 1FP4B 1QKIA 3RKUA 1AQLA 2DPLA 4PWZA 7AT1A 4I9GA 4AX4A 3TE7A 1REQB 2FN7A 1QVVA 3ZLBA 3HKEB 3Q3VA 2IBTA 5AUPB 3WGNA 1YZGA 1UPAA 4NE7A 5CJ2A 4YWJA 1KMIY 1L5KA 4Z1OA 2ZVPX 1VZ2A 4H1UA 4KAJA 5B1HA 3ZY2A 1C4OA 1YDGA 2H8KA 3VKVA 1C50A 3HABA 3KT6A 3EFOB 2PSSA 1TMKA 5LYJF 2GWRA 5IF3A 2Z6AA 2P7IA 3NHRA 1BGWA 4CQMB 2V7GA 4KVAA 4P5DA 5K7SA 1V95A 4G1EB 1CQWA 2VWGA 2Z30A 5F7JA 1VLZA 3VPBA 4DMUB 3S7TA 4HNVA 2C7OA 1IBLB 4RNDB 3T3IA 1UANA 1ZVQA 3ZVNA 1JYFA 3EVEA 3PFHA 2ZWAA 3F49S 3WGHA 3O9VA 2GZMA 4CT0A 4HR7A 4U9HS 1HH4A 4Z0NA 1AXEA 2Z04A 2JCGA 3GLGE 3PVZA 5IVDA 1L5OA 4UUBA 2F6RA 1T1JA 1XZFA 1ARZA 2I4RA 2W8BA 4D99A 1YUNA 4Q5IA 2QKYA 5A5EA 4XB6B 5LYYA 1PT7A 5AQEA 1VDMA 2BCEA 3BIWA 1VFPA 1TO1E 4OQYA 1ECCA 5MHTA 3QPDA 2ZRAA 1ONSA 3ZTYA 3KQHA 1CRPA 3AH8A 1NBEA 4CUKA 1PW7A 3OIWA 1J70A 5EVCA 3VAAA 3EZLA 3TZCA 4EZBA 5B1YA 1AMOA 3VHLB 1KQPA 1RAFA 1Y63A 4OU4A 4PHTA 5A5VA 3EA0A 3LNTA 1HZJA 5LQNA 3RQIA 3G02A 1R0BA 3A6EA 2GETA 4RZSA 3ZHCA 4Z49A 3PJEA 3O83A 2LTAA 4KODA 4BWFB 2JLRA 4DT1A 4EGCB 2AJDA 1SXHA 3LTEA 3H05A 3T95A 1E2LA 2WSSA 3QHAA 3HKDB 5G02A 5AVOA 1ZL0A 4BNVA 4KO2S 4M1EA 4M6WA 5JZMA 2IUSA 5JNSA 3M5WA 2GZHA 4OHFA 5T3UA 1SZJG 2NU9B 4DA9A 1M1UA 1ILEA 3SXJA 5CDGA 3VNBA 5HM8A 3PFKA 4X97A 2OGTA 1QYIA 4MQ5A 4M0KA 4MS3B 1V26A 2QMZA 3G6WA 3K8OE 3EHDA 4IHJB 1KJZA 4EAAA 3SM9A 3QQ5A 4EW3A 1VLLA 1OFUX 2EZ8A 4KQFA 4YPFA 3S29A 3CLTC 3ELDA 3M1YA 1Z7EA 3P5SA 1ZBQA 2QZJA 3LHFA 3KT3A 2H7XA 4H7PA 3IEPA 1BDMA 3PFWO 3FGZA 2ECFA 2FSHA 1I14A 2YFKA 3A1WA 3DB2A 1H5QA 1JAZA 2O2GA 3DEAA 3Q11A 4HFJA 4DBVO 4EA6A 3IBGA 3DC7A 4HBGA 4RJLA 3S1AA 2HK9A 2JGDB 3TSAA 2GR9A 4CM5A 4BQIA 1BC5A 3TSOA 3NHMA 1RYYA 3K30A 4ZQGA 5IS2A 4TWRA 1HUQA 3GJ6A 4JJ8A 2O3RA 1SG9A 3TINA 3V00A 1Y5NA 3MTIA 3E7PA 4ARZB 1R8SA 7REQB 1OGIA 1EUDB 4OFXA 1LBIA 3QG1A 3ZDCA 3K70D 3G9UA 3EGXB 1XA4A 3EEYA 1M6VB 3KJXA 4MPTA 1E3QA 5H0IA 5K3FA 4AO7A 4HB4A 4MKXA 2WFLB 1VA5A 2OXIA 2YINC 3I9LA 3QOXA 4G0OA 4KLRA 5CP8A 3AWIA 2D7JA 2PWZA 1CNMA 4CEIB 2G63A 3HBJA 4M8KA 5EMNA 4KUGA 4CKCB 2X77A 3ABQB 3GEBA 3L02A 3P9KA 4E6EA 4EPXA 2W11A 5LP6F 1XTBA 4MZXA 5DHAA 4X92A 2VT3A 4UNQA 3UFXA 3WV4A 1WDTA 2OECA 4KLCA 1CS0B 5HZMA 3NYRA 4HQKA 5AHWA 1DU4A 2UV8A 4BNFA 3OX4A 3B78A 2FPUA 4J3NA 5LQAA 5EIXA 1JJIA 2Q9BA 1OXMA 3OD5A 2BGGA 5F5NA 1D4OA 1UCFA 2ZJ2A 5EXDA 4C2BA 4IG9A 2RAFA 3CISA 3RT1A 4X84A 1C1DA 1SUBA 1KO4A 1XD9A 2R6AA 3R0JA 2X1LA 4JYMA 1I0IA 4NQRA 2CUKA 4QXOA 2XE8A 4KVGA 3TR0A 5IJ9B 3LQKA 1PG2A 1CUJA 4A2QA 2ZIZA 2ZQYA 4WOJA 4OHCA 3F4LA 4YRQA 2VAWA 4XWOA 4EGAA 3O38A 1JEEA 5J47A 3AONB 4WLFA 4G97A 2DB3A 3TVYA 1VSVA 2A7XA 2VRBA 3P2JA 3V8QA 3RSGA 1XKLA 1QM5A 4PIVA 2B2XA 3HXOA 3UHPA 5ELLA 2W2PA 1L5ZA 3OMXA 4K6CA 5CFNA 1N2OA 4EGJA 4F3KA 1J21A 2BISA 5A71A 4NCNA 4RLFA 1OLUB 4PZCA 5K5EA 4DRZA 2FZKA 3JVIA 4QWMA 4RPIA 1GT91 2I6GA 2Z2YA 1OBHA 1W2WB 2WZCA 3V3KA 5GJCA 3RF7A 2OQRA 2QUJA 1D9ZA 3KZMA 3O21A 4JYZA 4GR5A 4IIBA 3IPXA 4EKYA 3Q3HA 3ENKA 4CKXA 4Q4DA 5LYJA 2AKEA 2PKRA 3I4CA 1AGPA 4C7BA 1E96A 2NV2B 3EDCA 3EXHA 4YJ3F 5T4EA 1XRPA 4G9GA 1GY8A 2R1VB 3GR6A 3L8MA 4ZQHA 2ZTSA 5HE8A 1M2VA 2ZIWB 4UU7A 5A3SA 4GI7A 1U2PA 1FFXB 3ZWAA 4F2HA 1PGPA 1KQNA 3IT2A 1S1CA 2DT8A 3WQBA 3QVKA 2IX9A 1XWWA 4RD1A 4B79A 5IWCA 1WCV1 3I3SR 4N0PA 1PUIA 4FGWA 4D9NA 2K5UA 2G04A 3L0SA 4HQNA 4JQCA 4COOA 5KAPA 3WLAA 3UT0A 4JLJA 5BVGA 2RH8A 3QLVA 4AZ3B 3UHJA 4UHEA 2ZWVA 3I12A 4MEBA 3TL6A 1RADA 4G56A 4LZAA 1T9GS 1YDMA 1LRKA 2NVBA 3PNPA 1FNDA 3RC7A 4DJTA 2F3TA 2G28A 2HWXA 3QE0A 1UR5A 4RGVA 4IOMA 2DU8A 4V0NA 3GWZA 3D43A 3CVVA 3N07A 3FI9A 2GTPA 3I2FA 4OMCA 4E31A 1DRKA 5EQTA 2C07A 2WJAA 1X7YB 4NYIQ 5FTJA 3WGZA 2PT5A 4B6JA 2WVHA 1G17A 3QIAA 3WXBA 4F71A 1IJFA 1D2HA 1JL3A 4MK4A 3KYJB 4UC0A 2XW6A 2E4WA 3BPSA 5GV7A 1XEAA 2VYFA 1E7YA 4YJ2B 2VSOA 1KZHA 5C1BA 5I7WA 1IJKA 1IJEA 1BA2A 3SR0A 4A5OA 1CZUA 3KQTA 4LSWA 2PR7A 1QYVA 3NKFA 4ICIA 2X42A 1HZZA 3AEYA 1DDIA 3BJRA 3PQFA 4IDPA 4B81A 1EDDA 3OFKA 4EFLA 3OEHA 1J24A 3KJIA 1OC2A 4Q3CA 3B89A 2V7QA 2P5TB 4BFWA 2ZCUA 2XAAA 2QY9A 3A6GA 4MVJP 1IUKA 4NJMA 4WNCA 5DISB 5TJHA 3GVXA 4R68A 2PT9A 1FNCA 3BE5A 3H9EO 3HUFA 2INGX 4OATA 3RYHA 3A9TA 3E1SA 3UGQA 1QP4A 4E5KA 3EPRA 1E2IA 2F48A 2WU1A 3EVCA 3GDFA 3KEOA 5DM0A 4AY4A 2JG3A 1KAGA 1N2GA 3BIJA 1JJVA 5BUCA 2F62A 2C4UA 1CLUA 1A27A 2G17A 2WI8A 3CPJB 4HH1A 5JPIA 2DG2A 3BE8A 3H9QA 3W4IA 3NYWA 3MELA 4X1IB 1XR3A 3WMRA 1J8YF 4DN6A 5KOJB 4Q1VA 2CLLB 3IPRA 2GM5A 1M76A 1O03A 3U7IA 2WVJA 1NV8A 2WM2A 3CR3C 1Z0UA 1QS0A 3ZE8A 4WASA 5CX1B 3SIRA 4B4KA 3T1VA 2D5IA 5JARA 3A6PC 3S7ZA 4A1OA 5BN3A 3QVGB 1U1IA 2B1JA 5PGMA 1KY3A 2V7VA 3ZQJA 1ZCFA 4H16A 1FX0B 1ND5A 5HGXA 3BX1A 2IP1A 2R751 5FLXA 1ULUA 4PNZA 3KRTA 3PF9A 4YRTA 2OL4A 2RH9B 4N40A 4I4IA 5BMOA 2HMUA 4I1UA 3HI4A 2G4CA 4RVCA 2HDWA 2WNHA 1A1VA 2B83A 4DNQA 3IP6A 3X1JA 2OHOA 4GVLA 3PHCA 2FPSA 4JD5A 4ISBA 4V0KA 1TZ2A 4BECA 5LP6A 4GMDA 5CDTA 5KREA 2W2LD 2BR4A 3D3EA 4RHCA 2R7KA 1CS4C 3G5MA 1BX1A 2EHDA 4JK3A 4OHPA 4XJVA 5TF4A 2HSGA 3B1WA 2GLUA 4G84A 4ZWNA 3C6QA 4S2UA 3VR2A 2QLMA 3KYCB 4AY3A 4LJ7A 5HQJA 3L0OA 2BP7B 1K63A 2GJSA 4AYTA 1ISSA 3H2HA 5ECDA 4AJJA 3OJEA 4YI3A 2JEOA 4MDYA 1O5TA 3RUAA 3TNJA 2J9YB 4CDGA 1X3LA 4LQCA 4YCLA 2P6NA 2IUUA 3TLGB 4GPTA 1BVYF 4B3TB 2FW9A 1DKLA 2VJNA 2BFWA 5BR4A 2QIOA 5LDGA 2PKXA 3UWKA 2O8CB 2I6SA 1S7CA 3MHTA 2VOJA 1RKBA 3I9MA 3PGA1 5DXJA 3NONA 5AQ1A 5C18A 1XCJA 1T5LA 1QMPA 1WBJB 3BFVA 4YAOA 4LISA 2JJ1D 1D2CA 5F7ZA 3VC7A 4BB0A 1OHHD 5CVUA 2O8BB 1NVDA 1EP2B 5H80A 4JLAA 3NC0C 5KTNA 2Y76A 2RIPA 1NMYA 2ST1A 3F67A 3IH5A 2VKQA 1B93A 1TVFA 2H3EA 3D6FA 1F4LA 1LWOA 2W2XA 2OUKA 2V7PA 2E21A 3C3AA 7MDHA 2CNWD 4A23A 3KV1A 5E6SA 1XRLA 1ZY2A 1IEWA 2ZTLA 4M1QA 3RJZA 1O89A 4EJSB 4QBHA 3RWOA 1NGSA 2WNIA 4QOHA 4H9GA 4PAGA 2X8JA 1V39A 3GFGA 2IIPA 3FSGA 3LUGA 3PHIA 5DGXA 4I36A 2MSCB 3NDRA 4JUDX 1H6BA 2GX6A 2DQKA 3ZZNA 1QSGA 3NC1C 1UK7A 2J67A 3DTYA 4HQ6A 5ALIA 4XSHA 3JQ9C 2P9HA 4YJ3A 4CGYA 5K2OA 1MO6A 3G8YA 2QTZA 3FDXA 4JA2A 5E7JA 3JQ7A 3O6VA 5GZ3A 2GUGA 1OBCA 1QGDA 3KIPA 2ACVA 3M4YA 4QOGA 1FVHA 3ACCA 3MOSA 5DK4A 1VLVA 2NZXA 4O4HF 2CV1A 1E1LA 5AESA 2I54A 5ICMA 1N34B 3LC7O 1GWNA 1X8KA 2QLNA 2WAMA 1FVXA 4E09A 1GQQA 1N9KA 4MAMA 1I5EA 5GJBA 1XWIA 3WWOA 4KXLA 5PNTA 3ZFNA 2W6JA 1PR0A 1EFLA 2AOVA 4JR0A 3FYHA 1XK7A 2VSFA 3NVMB 3P4YA 5GONF 2O8VA 5JLAA 2XKAA 4ONEA 2VF7A 2YRFA 2BI4A 3HV2A 4IDFA 2EGGA 2HMTA 4FFNA 1Y6JA 4Q9KA 4PS1A 3HYRA 4BVGA 1OTHA 1RXIA 3B2NA 1QIDA 5L3SB 3PX3A 1SU6A 1J2TA 4WN9B 5FUWA 4EUKA 1AQJA 3BZBA 3T9DA 5IJ0B 1J7JA 3UWMA 4MQ6A 4D8VA 4XGNA 1SBZA 2EG5A 3ZGNA 1S02A 1K5GA 4TUYB 3ZDQA 4V39A 4V24A 1CQXA 2CCKA 4BB5A 4YQZA 1OH8A 1JTEA 1DKQA 1LSUA 4RCVA 5IEBA 1G19A 1KWKA 2Z3WA 2KHZA 1G63A 3LVFO 4P54A 5A4JA 2NQ2C 4B3IA 4PR3A 3BTVA 4B3HA 1FDTA 1IXRC 4EM6A 4CMIA 3I62A 4EMBA 4YRAA 3R0QA 1CZRA 3ZDAA 3N8KA 3OQ6A 1ZN9A 2P9CA 1HOTA 3PJGA 4CLRB 1AKVA 2GEBA 4J1TA 2IYQA 1VBKA 2QF7A 2ZIFA 4LVNA 4IZOA 3LJKA 3TR6A 1IE3A 4EARA 4EFNA 4M1KA 5IASA 4BFYA 4RTJA 2EEPA 2D2VA 4R41A 5DT2A 3CCBA 5K8UA 5AVSA 2XZDA 2QT1A 4MXDA 5ESXA 4EENA 1YULA 3ZLVA 4G0WA 3F73A 3A06A 3E23A 5TRTA 2VP2A 3WBKA 4U8GA 4C3UA 4F46A 1GVNB 4FFBA 4C5AA 4PXAA 1U8AA 1GTL1 3FCSB 1CW2B 2JKZA 4DZZA 4M8LA 3HTXA 3MWFA 4YI5A 1WPGA 1GYPA 4MVJG 2Q07A 1JRLA 4TL6A 4ZALA 2O7SA 1BTOA 3I32A 1WD5A 3UK2A 5FPTA 3DYBA 4B7ZA 2V0NA 3FCAA 4MGIR 4R81A 3R8CA 3TZ6A 3ZDZB 1QX4A 4YRGA 5L3QA 3CG0A 4GSKA 1QC5A 4U39A 1KRHA 2AJBA 4HX5A 3SS8A 3P20A 1ODKA 2WILA 2AJ8A 5E3HA 3EG9B 1PJLA 3K92A 1MO3A 1V3QE 3P2EA 1S2OA 2RARA 4HYQA 4MRMB 1ZI6A 3UO8B 2DR2A 3FDFA 3D3QA 3FVVA 3RTEA 1W88A 4ZP1A 3HBLA 3UAGA 1GQSA 1I3NA 2GN9A 1CF2O 3CEPB 3E3LA 4K05A 4PQYA 1FFHA 2BHLA 1FUKA 1DQSA 3ED1A 4GYJA 4HXFB 4BWGA 5D51S 2VPZA 1FNNA 2H5LA 5EMMA 4EABA 5A7GA 1I4WA 1OI4A 1D2MA 2X4DA 2XMSA 3JATA 1L7VC 3QBVA 3E3MA 3E5HA 3PIDA 5TQVA 5TVGA 1IY8A 1QH8B 2CXOA 2CXHA 3PC8A 4QBIA 3MJTA 1ECLA 2CJPA 2Q2OA 4L9SA 3CH5A 4PLYA 1E6WA 1DFGA 3B6MA 4E1VA 1AF7A 4FE3A 2HT1A 5L7YA 1H93A 4TRRA 4M53A 4QUEA 3JALB 3IHWA 3O2SB 2BFCB 1NYRA 1THMA 1LLUA 2YUTA 2I9PA 2AZXA 3V6LA 4XEUA 5CG1A 2VRWA 3OLVA 3LMKA 3CVOA 1TKRA 5JDCC 4G0XA 3LU1A 2AN5A 4FB5A 3R9XA 2CDNA 3DAOA 5AJYA 3TKLA 4PTLA 1QNLA 4FFPA 1I7DA 4Z4GA 3WHIA 4GZ5A 1X1RA 1YHNA 1Y5RA 2P9FA 2HU2A 2W5UA 3AFIA 3KWMA 4O4IB 3ZBPA 3L4KA 4ZEXA 1TJPB 2WT9A 4LF8B 3HL0A 4EY4A 1N0VC 4JEUA 5HQ3B 4QOJA 5JDIA 4RVHA 4QASA 4ESHA 2YJ4A 4PTYA 4BYGA 4R7TA 1BEUB 2I34A 2BM9A 3B7WA 1N3YA 3D3WB 4YXWA 5ADWA 1Y1PA 3H4MA 2WM8A 3MJEA 3R0ZA 3DEYX 1NBMA 2NYUA 1GPUA 1DB3A 4DNFA 1USUA 2VNJA 4O4HA 4OX9Y 5GJWC 2VZ0A 4A5SA 4GYYA 4EG4A 4WRRA 5BN4A 2WM9B 1QIFA 2CJYA 4ZAVA 4JWKA 4RKQA 3HO6A 1I9GA 4G4IA 1KY4A 3UPTA 4M99A 3RG2A 1K98A 5JISA 2D3TA 3OKPA 2GHIA 3THRA 4OHMA 3H16A 1AV7A 1PDVA 2VHUA 2CXRA 2XVZA 1ACLA 3BRSA 2Y1FA 3JR7A 4W4TA 2G70A 5GONA 3ZTTA 4RE5A 4DV1B 2GZSA 3BGOS 2FB9A 2BJHA 4XI9A 1UK6A 5KQGA 3ZFRA 2LKCA 3A36A 4BMOB 1CZLA 4CMHA 1E6CA 1PNOA 1CY2A 2Y0DA 3LUCA 3WE7A 1MX1A 1A76A 1XEWY 3OHSX 4NONA 4IUYA 1RAHA 2ERYA 4RSRA 5FORA 2EW1A 3R7SA 2VUSA 2A9FA 1HDXA 1G18A 3MPUA 5KNCA 5AHRA 1P4SA 3HUTA 3KYDB 4ZOLF 1JSZA 1EZ1A 2NV0A 2VHVA 4IXDA 3GU3A 2H1IA 1E89A 1Z2OX 2LCIA 4ZTUB 2WUEA 1TUGA 1E2HA 1M34A 4LBYA 2PQ6A 5IBCA 4PLFA 4EHBA 4UU0A 3UCXA 3FPCA 3FUTA 4H0CA 3U3RA 2C31A 2QYTA 3QXHA 1GNPA 5INTA 3W5AA 4E30A 1SIBE 4C2AA 1L7PA 2DETA 3TQSA 2DSTA 1P72A 1ZAKA 4FYXA 3TOCA 5I4IA 3BSFA 1G6KA 1XCPA 2NXCA 2GD0A 1NXQA 2FZWA 2H52A 3WYNA 2UUPA 4RS4A 5DSZA 1KJWA 2CLMB 5FB3A 1C4XA 3GO4A 3LZ6A 3GJYA 3PNKA 2ZSDA 1QRDA 4TQ9A 4EITA 2X0IA 5TDHA 4YYEA 2HNKA 5ALVA 3DOJA 3QLUC 4W1QA 2JIOA 5JQGB 2UYOA 5IKEA 3OC6A 4L0DA 3RJMA 1EJBA 5B6JA 3MINB 1LK0A 4TYMA 4UE3S 5DXFA 4NG5A 3A1VA 1OFIA 2BT4A 3LOUA 4NCBA 3HJGA 3QUSA 2ZM5A 5A4DA 1PKXA 1XLTC 1NI5A 3OPMA 4GOLD 2E5WA 3ASZA 4MPDA 2W71A 5JR3A 4JT9A 3VTAA 3OCCA 1I2ZA 3ZHBA 4MWZA 1BDJA 1FFCA 1RRFA 4G0NA 4RD2A 4KXWA 4Y2TA 3UW3A 4X66B 4W7SA 3F5SA 5LDHA 5G41A 1F8XA 2WTNA 4ZKEA 1D8AA 1GZ3A 3C6XA 3RTGA 4BCCA 1ZH0A 5BSHA 2C2XA 2HI0A 2IYPA 4L4SA 1P8JA 4URUR 3AEZA 1YR1A 1OROA 5CM9C 4G5OA 1X13A 5I6DA 4L5IA 2XUGA 1H69A 3FSJX 1KA9H 1PTJC 2VYND 2O6LA 3PNSA 5HS6A 2CFTA 5IAKA 1GPYA 4I4NA 3NDJA 2C9BA 4NBNA 1EWKA 1YRQA 3N7UA 2OV6A 1DTWA 3H5AA 3EGWA 3ZWKA 4KXVA 4BVFA 1DBSA 1TJ4A 3IBTA 4L0QA 3T94A 3DE7X 3H1TA 5ITZB 2DR0A 2VJCA 1VHLA 2YVKA 2XGJA 1D7OA 1G8PA 2IK8A 3MAGA 3OE7A 5F1YA 4C03A 4DUPA 2IZZA 2UAGA 3FVQA 3ANTA 2BBOA 4MCJA 1YZNA 3EWSA 1ADJA 2GMWA 3N6VA 4J91A 2OXTA 3OIYA 4UW9A 1DNPA 2EWVA 2CLSA 2JLYA 3QXXA 4UTZA 5KKCA 4TYNA 3B1YA 1XNHA 2Q5LA 3QFCA 4HK4A 2Q7XA 3NM4A 3GRCA 4NOLA 1OZFA 1SKAA 1RYFA 1FZQA 4ZYLA 4JUBA 3AIOA 1SHKA 1N0WA 2WFZA 2XOKD 1MT3A 1Q0UA 4BLPA 4CCYB 1RI5A 1YZLA 3H9BA 1E0DA 3VNQA 4F91B 2C59A 2VXBA 2MINA 2WAAA 4GM0A 1YDWA 4O3FA 4AKSA 5EQFA 4HWOA 1OI2A 2B6NA 3A2KA 1XRNA 1WHSA 5TGZA 4RGQA 3LHDA 4E7OA 3B5JA 1YH3A 2ORYA 3OU6A 4HMQA 5EPOA 2BSQA 1E3MA 4EKIA 1FTNA 1QGYA 2NUAB 2EL9A 3Q6NA 2X8LA 5ERYA 2H2WA 2IRWA 1O9HA 4FDLA 4WK2B 5EWMA 2FW7A 3A3OA 4ZC1A 3ZZ0A 3B1FA 2G7ZA 4LHSA 5COBA 4RL6A 3DMFA 3SLRA 3CYFA 4O5AA 2L17A 2QW0X 1CFJA 3X1MA 4BNLA 4OIFA 2IYUA 4J0EA 2O06A 3IT1A 3ZHTA 4HAVA 4OQ4A 3SJCA 3MIIA 4A7PA 5ER6A 3HO1A 1S9DA 5E7QA 5C81A 2BF7A 2Z58A 2Q9CA 3MT0A 4TKZA 3Q12A 4LJRA 5B4VA 5CLJA 3V8NA 3K2EA 2QVLA 5DBHX 3ZW7A 1JJBA 2XODA 4KH1A 4LGMA 4D79A 3MJDA 4FEAA 1GU7A 3FCYA 3V4VB 1C3OB 3GW8A 4H08A 1OE0A 3QEJA 3IOEA 1AM4D 1IEXA 4Q9JA 2YW9A 1BWPA 5JYEA 3GJ0A 1EESA 1ZNYA 2YVLA 4OLJA 3NHZA 5AUOB 3AUKA 1EVYA 2RC6A 2EBUA 4GECA 1HQKA 4RYDA 1OGYA 3AIIA 1JJFA 2BRUC 3ZWMA 1L7OA 2YXBA 3JD3A 5D3ZA 4D9EA 2QN2A 1SPXA 2IYLD 1H94A 3W1EA 2EOAA 1BHSA 2HJVA 3HA7A 4PHCA 5BSVA 1KAEA 5I9NA 4FM9A 4CXMA 5CYFA 5GMOA 2BMVA 5FPKA 2PSEA 1G66A 5JWRA 3R4CA 4FW9A 4ZYXA 3DAPA 3PGKA 1JFSA 1BCSB 3V2HA 2FSSA 4BLRA 4IDCA 4IHJF 4JDUA 4JBNA 2OAGA 4YWHA 1RJ9A 4GZ3A 2H1RA 2VSQA 2V7WA 4ZOLA 3DT8A 3EC2A 5HCUA 5TPZA 1Z8DA 1J8FA 5SY6A 1HKUA 4D0GA 4E11A 5HZHA 5KVSA 1FMFA 1WRBA 3EY4A 1CT9A 2OBNA 1O3YA 2E87A 4J0DA 1MIOB 4N7BA 4CKBA 5AM3A 2GILA 2J9GA 2P5SA 4JSYA 1RYDA 3OO1A 1RQGA 3PFCA 4R16A 2BGKA 4M1WA 2CV0A 1L3BA 2JDIA 2FSFA 1SVWA 4YREA 3VU9B 3ZPXA 1OAOA 4MQFA 4DNOA 4CMEC 5I7UA 2VDRB 4DJDC 5ES3A 4Y30A 4BVAA 4YJHA 2BKEA 3I2IA 1E7MA 2PPLA 1S2GA 1S8OA 1ULTA 1PG5A 1QE0A 3FTDA 1GEEA 3ONVA 1Z73A 3QVJA 3EDOA 2NTJA 4INPA 3VSBA 2I6XA 5CBKA 3CVXA 3OHMA 1LVHA 3FGPA 2ZSFA 2B21A 5EOVA 3GT7A 1CG6A 1O95D 4YX9A 3EA4A 3DDOA 3E35A 3UK7A 3S2YA 3FMGA 4EUFA 1JEYA 4JL5A 4LDNA 4AQYB 3T34A 4I5IA 2J0EA 1N6KA 4HKTA 2FPXA 2RGGA 4PLGA 2HHHB 2IS4A 3ZWQA 1HQCA 3SY8A 3O8CA 4AKIA 2IPNA 4QRIA 3NBXX 4A6PA 1C7IA 1U3DA 3CIOA 3RGGA 5AW7A 5JCJD 2FSIA 2P65A 1SVLA 1WR8A 1XKTA 1JBQA 4U7GA 5DSTA 5THXA 3FKSD 4D44A 4P31A 4UVIA 1PLKA 4KFCA 4ZHQA 1PJ4A 3STTA 1C9JA 3EXIA 4F86A 3K16A 3IVGA 4GX1A 3RFUA 3NWPA 1IZ8A 5FPQA 4MWTA 5FUMA 2FSVC 3RLFA 1IDN1 1M2WA 2X23A 4DY4A 5BUZA 1R4ZA 1DAFA 3A7DA 4MIYA 3DFZA 1W4LA 1TIKA 4TSFA 3GARA 4I7EA 5D1HA 3VM6A 4RXMA 1M8JA 5E4JA 5LFAA 4HGQA 3ADDA 1E0AA 4ZCIA 3W78A 2F59A 4BO4A 1N6NA 5EPEA 1YVPA 1TCAA 1SURA 5CCXA 4RFSA 3QPBA 3KJEA 2UXDB 4RZHA 2X19A 2W98A 3OJ0A 4Q6WA 5NLLA 4C89A 5AVQA 4IO1A 3V1MA 1LGYA 3SR4A 5CT8A 3BH0A 3HYSA 3NX4A 1ZKMA 1RQNA 1TUBB 3C3YA 4R3NA 5C8XA 1O6ZA 3SX0A 3UB2A 1U5CA 1U5BB 2CHEA 2HN9A 3GXBA 1NVUQ 5FWXB 4Q3EA 1I3MA 3VTFA 3HJFA 4G8DA 3WGVA 1J2EA 2OO7A 3F47A 2PEYA 3LAWA 1FP4A 3B6ZA 4MVJI 4MH0R 3HL4A 3WK6A 5JSYA 1M1NA 3AVOA 3B1VA 1EINA 1RJWA 2CC2A 3AL2A 2EHJA 2Q6LA 3H86A 1PFYA 1KVRA 3EAFA 3EIQA 3EFOA 4O2RA 4TVKA 1SMKA 3NT4A 3MG9A 3ULKA 3WWZA 2WD7B 3W9BA 4CQMA 1JR3A 2XB2A 2Q5IA 5ERXA 1U4SA 2FZVA 2NYAA 1BCRB 1LFDB 3PKZA 1RT9A 3B9BA 2JFGA 1RRPA 2HQBA 3K0BA 4O8CA 5H7XA 4MJ3A 5F73A 3RBAA 3UJ7A 3ISVA 3T7TA 3QTLA 2Y6VA 3WHKA 2Q0SA 3ND8A 4X3PA 1P7WA 4JAVC 2CFRA 4ESEA 1R2QA 4H4DA 5K6RA 1ADCA 4DCNA 1YK0A 2ASVA 4WX2B 1ZSYA 5DNYB 3VSEA 2VYCA 3QXSA 3F97A 4FZ5A 4DARA 3K70B 1WA5A 1KRXA 4N76A 4DA4A 3H5NA 3EGEA 5BXQC 1C9DB 1KPIA 2IE0A 3TZBA 1HO3A 4QICA 5DIFA 3U19A 2GCOB 4HGNA 5AVUA 1OUMA 5FO0A 2O1XA 3EIUA 3TIXB 3R5KA 3B6EA 1KYZA 3UV7A 3DOIA 4U7HA 2Q3HA 3IB6A 4LC9A 4PFQA 1R8JA 5K0LA 4DHEA 3ZWVA 1L1EA 4OM7A 3VBCA 1LPSA 1BWRA 3DLPX 3VOSA 4I81A 3E5RA 1Q77A 1OYYA 4YMSA 5ALSA 5LZ8A 2EGHA 1PNVA 2XA1A 2XRMA 2OGSA 3L40A 3QTBA 1RP7A 1XCMA 3WK8A 4F4IA 3CLUD 3L4BA 3BJZA 4YJ2F 4DV6B 2A30A 1MF7A 3QKIA 3JQBA 1UM9B 3EULA 4FVTA 3HKDA 3PEEA 2QD5A 2PMFA 1T36B 1Y8ZA 1KI2A 1I5RA 1RHUA 1WNTA 1W581 1X7DA 4URXR 4RXUA 3IRVA 4EL5A 1PZEA 4TXMA 1PQPA 1OLXB 3I64A 1FTQA 4TT3A 1EK5A 1QHEA 2HSZA 4MS3A 3H4VA 4LOJA 2JFUA 3UWDA 4DYDA 4CTNA 4IHJA 4UZFA 5K0ZA 3NU1A 2O2CA 1Y7HA 3HHEA 4BEVA 2QUBA 4L2IB 4WI1A 1SIWA 3A9SA 2XDAA 2FPKA 2ZSEA 4XIIA 3HGMA 3IPYA 3K8QA 4DDMA 3NTLA 1QV6A 4HRYA 2QTAA 3KWJA 4QNRA 2GNOA 3B3AA 3DD1A 3IP3A 1CF9A 1GYRA 3Q2IA 3NHPA 4EKNB 4F96A 1DKPA 1RFLA 3KPVA 2GRUA 2Q0XA 2HYDA 5LCXA 2GM9A 2D5CA 3VOBA 3QY9A 4BC1A 1MX9A 4QNNA 5EP1A 4JP8A 1XV5A 1LZLA 4Q16A 2V98A 2Q4OA 5IM5A 4F4JA 2G1PA 1VLJA 4E14A 2VBFA 1FCJA 3AJAA 3GG9A 3IV7A 3TGLA 1C1XB 1XRRA 4ARZA 4HXYA 3ROTA 7REQA 2D2XA 4JLDA 4RTKA 5LKRA 1E7SA 4JYBA 2GN4A 1EUDA 1XTVA 4HAXA 4L9AA 4LK2A 4RA9B 4R9UC 3EARA 2B69A 3FUUA 2HA2A 2O05A 1P3DA 2AYZA 4P58A 3RTBA 3ROQA 3EGXA 1W0JD 1M6VA 2WKPA 3HCOA 1OJ7A 1Q2XA 3KJHA 3QYFA 3DS8A 4FYYA 5ALTA 4G2TA 2WFLA 3CZ5A 5ALOA 4QJ3A 1J42A 1J56A 3D2BA 4DCGA 2OPHA 4JJKA 1YXMA 4NTZA 4DY6A 4CEIA 2DGDA 3NKVA 4UU8A 4B80A 1ZQ1A 1VJCA 3MAJA 4GGOA 1Y5IA 2R11A 4N7JA 1G21E 4CKCA 5HF5A 3KVRA 1KEUA 2X7HA 3OQPA 1H85A 1NJGA 2WSBA 2X2OA 3H99A 4LSMA 4QOSA 4QU0A 4MWOA 2WA1A 4QO7A 3RNOA 4BL5A 3IYLW 4DNPA 2FQYA 1USVA 1VSQA 1CS0A 3CF6R 1OPRA 2LDBA 3FPFA 4IIEA 5EPUA 4A16A 3DKPA 3N0VA 1WNFA 4LDZA 3SKXA 3QUBA 1E1YA 1YRLA 4XAQA 3H2KA 3MLAA 1DS6A 1PFQA 3HACA 4JI2B 2EFJA 2ODTX 1T4DA 1C30B 2WYOA 3UH0A 2IELA 1OR8A 1QDEA 5JADA 1U3GA 2BHNA 4S1NA 4LV6A 4HAYA 4QL3A 3GRRA 1KF0A 5DF1A 2X8BA 2I6TA 1KBZA 4M1SA 3ZJTA 2VJDA 1DX6A 2QDKA 2X22A 3T6KA 3VPGA 3W5CA 4DDVA 1VIMA 2WWHA 1XKXA 1PZNA 3EGOA 3HN2A 1PX2A 1VPVA 5AKLA 2O7NA 1IY2A 3HZRA 2XSZA 2BMWA 4NCHA 4WJZA 5J4VA 4BLQA 4C6HA 1DARA 3JS5A 4DWOA 4DIUA 4GXQA 5IXYA 1XNGA 4MS4B 4FOLA 2XT9A 5IDYA 2DWCA 4CM7A 1JJAA 4TRMA 2V6BA 1NSYA 5AHXA 1OLUA 2KBFA 5JXGA 3HB7A 1KYWA 3AR2A 1UFKA 3DVLA 3QXGA 4KK4A 3PVSA 1YS2X 3GLTA 1RFGE 1T5IA 2CW5A 1A4XA 1G3QA 2IDJA 1ZPDA 3OKCA 1WB9A 4UCFA 4NHOA 3VO1A 4D4LA 1O54A 2DHDA 4F84A 5JD4A 3U4MA 2DBRA 2IU6A 5DBEX 4KQ9A 1NLZA 1YR8A 4W1RA 1FB5A 1J5PA 2V7EA 4CCSA 5ALXA 4N39A 5EMKA 4DA0A 2R1VA 3D6UA 1B74A 3ZVMA 4LE1A 1Z6YA 1II9A 3G0GA 4LJ9A 1FFXA 2WE8A 2PGJA 2YWCA 3B85A 3NUGA 4RD6A 4Z7NB 5CEFA 4C04A 3OQNA 3A1DA 3LBNA 1CV2A 3IUNA 1JSRA 1NU6A 5CEEA 2WG0A 5JC1A 4REMA 5A6VA 2H7CA 3C24A 4BOYA 1A9ZA 4UUQA 1V43A 5DRYA 1IEVA 2JIQA 2QVZX 2GN0A 4BUJA 1X8LA 3G9QA 4LVCA 4O8ZA 3L1VA 1NBHA 4ZOAA 4H7IA 1DQZA 3FIUA 2D0OB 2XMQA 3VHQA 1T2UA 3JXEA 4HSGA 3MJ4A 4WSOA 1ODSA 1VHWA 2H1VA 1DINA 2A1UB 2FSUA 4N65A 2XZPA 4X8HA 5CNMA 4OL0A 5T5QA 1I2DA 3EXEB 1S0UA 4JZKA 4HEJA 3W5HA 1U7OA 3ZXUB 1AK2A 3IIKA 6ABPA 2UVPB 1H6CA 3INTA 4QHTA 1O8BA 5HYVA 1X7YA 3RANA 2CE7A 5TSDA 4OQMA 2YC2C 1YR7A 3Q8WA 2GJ9A 3SZRA 1KZ1A 1Z7BA 5AXCA 4YJ2A 1A9YA 1TQ2A 3KSDO 2JLSA 2PY6A 1GUYA 4TUYF 4YMTA 4O6VA 2R6CA 4B5LA 4N0DA 1QFJA 1Y34E 4OJNA 1GFWA 5ALGA 1TYCA 4CI0B 4YA6A 2FX2A 3ELYA 2DQ4A 4Z8XA 1GNQA 3D0RA 1RS0A 3KFVA 2OGZA 4Z4EA 1XTUA 4IP0A 3TLJA 1SUCA 1T8WA 3DHWC 3HYLA 6PFKA 5IPFA 4Z9YA 3PBKA 4XKJA 1LLDA 4Q0MA 1SBQA 2QL6A 3K32A 2QLBA 4OJQA 2P6PA 4FNGA 3RODA 3CRZA 4I46A 2JA1A 1U2GC 1OIXA 1RHQA 2X7JA 2ZJ6A 3DZIA 3ESYA 3QENA 1E2NA 1GQOA 4UBNA 1PVOA 3G1WA 3KZKA 3TQIA 1BVUA 2SECE 3QVLA 3IR7A 3D0KA 4X1IA 1TKCA 2SKDA 4WNIA 1JG3A 2IV3A 3GXOA 4BMPB 5JSZB 5LZ4A 5KOJA 4CEJA 4KOAA 4Q9HA 3ROEA 3S68A 4YMGA 3HKBA 4MPRA 4RIGA 3V2IA 3JQFC 4QXPA 3QUQA 1V5IA 1VMKA 1VI5A 1DOZA 3HE3A 1X7GA 2XIJA 1Y8RB 2HNAA 5CX1A 4FYKA 1E92A 3SG0A 2BMFA 1H05A 2C3OA 1R6UA 1LK7A 3QVGA 2QSYA 4J2TA 1WKVA 4FXOA 4G81A 2J33A 3IE2A 4HJXA 4P80A 1FX0A 4LWPA 1RQ2A 5CT4A 4AFNA 1PV4A 4RTMA 2D3WA 4JJ6A 2JASA 3AV0B 4MI9A 2WOJA 4TTQA 3TTXA 4ARAA 4L0MA 5AOBA 2YFQA 4EZIA 3DW1X 1J22A 5H3LA 1KDRA 1U0FA 1F12A 4LBWA 4F2GA 2AG5A 1AKWA 1UP6A 2IDZA 4IVQA 4DVGA 4XJTA 1B26A 1W5SA 5K3EA 3F5DA 5BQ3A 2XV1A 5JCOA 3DPIA 3TRHA 3E70C 3RJTA 1MC5A 2XXBA 1SVKA 5DNUA 4ZZ1A 1B1CA 4ZT2A 1TLFA 1NXTA 5F9HA 2VUHB 4ACBA 5FP0A 5LM3A 4R2XA 1YRBA 4YPOA 821PA 2XQJA 4QRDA 1EHYA 3KYCA 4NMMA 2HRRA 3PE6A 4BLTA 4L3WA 3WB2A 1V8FA 3V7NA 3I9V1 3A6ZA 2IF2A 4CTMA 4GZLA 2GXUA 2AG8A 3MTEA