3BWBA

Crystal structure of the apo form of spermidine synthase from trypanosoma cruzi at 2.5 a resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
291
structure length
288
Chain Sequence
b'SELISGGWFREENDQWPGQAMSLRVEKVLYDAPTKFQHLTIFESDPKGPWGTVMALDGCIQVTDYDEFVYHEVLGHTSLCSHPKPERVLIIGGGDGGVLREVLRHGTVEHCDLVDIDGEVMEQSKQHFPQISRSLADPRATVRVGDGLAFVRQTPDNTYDVVIIDTTDPASKLFGEAFYKDVLRILKPDGICCNQGESIWLDLELIEKMSRFIRETGFASVQYALMHVPTYPCGSIGTLVCSKKAGVDVTKPLRPVEDMPFAKDLKYYDSEMHKASFALPRFARHINN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spermidine synthase
molecule tags Transferase
source organism Trypanosoma cruzi
publication title Crystal structure of spermidine synthase from Trypanosoma cruzi.
rcsb
total genus 82
structure length 288
sequence length 291
chains with identical sequence B
ec nomenclature ec 2.5.1.16: Spermidine synthase.
pdb deposition date 2008-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 3bwbA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3bwbA02
5G02A 5ICGA 3KQPA 2VDVE 2XVMA 3HP7A 1QYRA 3KHKA 1ZQ9A 3ELDA 1KHHA 4V0QA 5DXAA 4CTJA 5ICCA 4X60A 4E2XA 2PVCA 2QM3A 2R3SA 3P2IA 4ZTBA 3G8AA 2JHPA 2Z6UA 4KVZA 4YUZA 4BLVA 5E8RA 2YXLA 3JWGA 3OE5A 3G8BA 1ZKDA 3L8DA 3GRVA 3KKZA 3AXSA 4FSDA 5FA5A 4M7RA 2PSSA 5FWDA 5T64A 3SR4A 3U81A 2JHAA 4PINA 2AZTA 1XTPA 2UYQA 4LWOA 1MJFA 3TFWA 4RV9A 4AX8A 4C07A 5GIOE 3DXZA 1G38A 2IH2A 3DR5A 3HCBA 3EVGA 2OXTA 2HWKA 4HTFA 4PWYA 1BHJA 5DX8A 2NXJA 5FA8A 5LQJA 5CVJA 3EVDA 2P40A 2B78A 5LQRA 3ELWA 3MAGA 3LPMA 2PGXA 4E33A 2ZBQA 1EG2A 1KP9A 3P9KA 2HR1A 3TM4A 3T7SA 3C6KA 3BZBA 4X1OA 2BM8A 2BR4A 5GIPE 1M0EA 2ZIFA 1X1DA 5EC8A 2PKWA 5FADA 3I5UA 4XUCA 1INLA 4YV2A 2IIPA 5K0LA 3LDFA 3GRRA 4GOLD 2AOUB 3E05A 3T0IA 3RODA 1RI3A 3ID6C 4FR0A 4HH4A 1G8AA 3FPHA 1FPQA 2CL5A 4P7JA 1Q0SA 3HA3A 1N7JA 4IKPA 1I4WA 5F2OA 2BM9A 4M36A 3K0BA 5CVUA 3UJAA 4RTJA 4GUAA 5HIIA 5DWQA 9MHTA 4P7FA 3UJ7A 2PBFA 2QE6A 3DUWA 3KPYA 3UFBA 4PCLA 2JHCA 2PWYA 3DLIA 3TPZA 4E2YA 1UIRA 1NW6A 4ER0A 2AVNA 4HGZA 2IBSA 3GCZA 4QQNA 1JQEA 2VS1A 2XYQA 1VE3A 5EIWA 5K0CA 3DULA 2DPMA 2PY6A 4H0NA 1TW3A 4BP1A 4ISCA 3PB3A 4KDCA 4KDRA 3VC1A 1AF7A 3ERCA 3PTAA 4KIFA 4PNEA 1P39A 3SSMA 3EGVA 3G7UA 4RTSA 4OBWA 3PT9A 4PIPA 5EMLA 5FWAA 1KPIA 2VDWA 3I64A 5M5BA 3MQ2A 5K01A 2G70A 5DM4A 2AN4A 3C0KA 3M6VA 3R0QA 4PYMA 4OQDA 4C08A 3A7EA 2AOUA 5KVAA 1B42A 2ZBRA 5C9ZA 4DKJA 1VL5A 4IV0A 4E70A 4A6DA 5T6BA 1IM8A 5EZSA 4P58A 3FZGA 3S68A 3B5IA 5EMJA 5K0BA 2OY0A 2FPOA 3FTDA 3HCCA 2ADMA 2ZWAA 4CKEA 3THRA 3GRYA 5CVDA 3FPEA 3KQWA 2ZCJA 7MHTA 1M6EX 2ONYA 5K0NA 1SKMA 5DSTA 3EEYA 4DQ0A 5ICEA 2HTEA 1UFKA 3PFHA 2OO3A 5DT2A 2QRVA 4RSRA 3FPJA 4WVLA 3GXOA 3LKDA 3UJ8A 4HG2A 3G88A 1SQGA 5EMKA 3KR9A 4PONA 1WS6A 4NECA 5EVJA 2C7PA 4EMSA 1L1EA 4GOOD 3I58A 1SVUA 1XDUA 3Q7EA 5GM1A 3HVHA 1XDZA 3V97A 3P9IA 1VLMA 3OFJA 3BGIA 3O7WA 2OPBA 2H00A 4OA5A 1L3BA 3EVAA 2AN5A 4KW7A 1XCLA 2P3LA 5K8VA 3GIWA 3KQYA 5D1NA 3CVOA 1JQ3A 1NW5A 2ZZKA 5HILA 1AQJA 3E8SA 5FHRA 4F85A 1YUBA 1XJ5A 3FPGA 3C3PA 4R8RA 3GJYA 1XVAA 3JWHA 5E9JA 1OR8A 4YUYA 1RJDA 3NJRA 2B3TA 2ZFUA 4P7KA 3UA3A 3DXYA 5DTQA 2O05A 3A7DA 3DTNA 5ICFA 5HOQA 5K05A 1D2GA 4LWPA 5E2AA 2BR3A 3HM2A 4LG1A 3MB5A 4PYIA 1G6Q1 3I9FA 1X1CA 2QY6A 3LKZA 4R6WA 2OZVA 5DTMA 3KPUA 5E8JA 3BXOA 4BY9E 3MGGA 3BWCA 3D2LA 3MTIA 1M6YA 2VDUE 1NW8A 2OKCA 2UYOA 3OU2A 4AZWA 5BP7A 2GLUA 1EIZA 1EAMA 2ZULA 3OU7A 3B89A 3FUWA 4YUWA 3KR1A 3LCUA 5K0FA 3R9XB 1QAQA 3UA4A 4AUKA 3PX2A 2B9EA 3R6TA 4GBED 2EJUA 2XBMA 4UOEA 2YR0A 1MHTA 3BKWA 4U7TB 2UYHA 1KPHA 2NNWB 3MCZA 3QOXA 1G55A 3MCTA 3KQSA 3KQOA 3A26A 1KR5A 3GDHA 4PGGA 2HNKA 2AR0A 3T7RA 4B17A 4HGYA 4Y2HA 1F38A 5K03A 1VBFA 2DULA 4PYNA 5CD1A 4M38A 1WZNA 5IKMA 5K0EA 4C4AA 3FYCA 2NXCA 4CKCA 3RIEA 4YV0A 4IV8A 3E7PA 5DM1A 4R8SA 1BOOA 2FK7A 3FUTA 5DM2A 5U4XA 2C7OA 2HV9A 3Q87B 5EEGA 5EZQA 3A25A 3K6RA 3NTVA 3ORHA 1U2ZA 3B7PA 1JTEA 2QYOA 3CJRA 3OZTA 4DZRA 1O9GA 5IH3A 3SX0A 1NV8A 2EJTA 2ZIEA 2PT9A 3FUXA 5MHTA 3PLAE 4GQBA 1WXWA 2NXNA 4M37A 1PRYA 1KIAA 1RJFA 4ER7A 3GO4A 5LR6A 1BC5A 5LQNA 2P3OA 3P97A 3TOSA 1JQDA 3DH0A 3IYLW 2ZZMA 1VQ1A 4DCGA 3EVFA 4P7GA 5FULA 3LECA 2ZTHA 4CTKA 4RTNA 4QTUB 1SG9A 2Q41A 1UWVA 2AOTA 3TR6A 4E31A 1ZGJA 3BWYA 4F84A 3G89A 3GRZA 3P71T 3R3HA 4BLUA 2AS0A 5P8WA 2ZVJA 10MHA 4YMHA 5DLYA 3VC2A 1L3CA 5DRYA 1RI2A 3SMQA 4AZSA 4FT2A 2LD4A 2PT6A 3AJDA 2NXEA 2ZLBA 3LCCA 1IXKA 3P8ZA 1YF3A 3ER8A 2ZSUA 4GOND 3UJ9A 3REOA 3NW9A 4FZVA 2FCAA 3C6MA 3WSTA 4FSXA 2BR5A 3CJTA 4WXHA 3B3FA 5FQNA 1ORHA 1Y8CA 3SVZA 4FP9A 2E5WA 5B1SA 4QPNA 3EGEA 1YFLA 2AOXA 3FUUA 1FP2A 2OB1A 4RTQA 2OB2A 5GWXA 1XCJA 2NP6A 2PV0A 2P7IA 4KIGA 5CIYA 3HTXA 1R8YA 2WA2A 2O06A 5GINE 2R6ZA 5DX0A 5CUQA 1JSZA 1SUIA 5FCDA 5DXJA 2FYTA 2ZBPA 3O4FA 2I7CA 4YUVA 3HA7A 1DUSA 5EIFA 3HVJA 3KPJA 1YFJA 3TKAA 4DA4A 4HTFB 3FPFA 3NMUF 4X61A 3I53A 2I6GA 4BLWA 3CBGA 2ONZA 2ERCA 2PJDA 3T7TA 2JH8A 5DX1A 5EGSA 2GB4A 4PGHA 2IDKA 3DXXA 5CM2Z 5EKXA 3G5TA 2OYRA 5LSAA 1WY7A 2CKDA 2CMGA 5EMMA 5FUBA 1EJ0A 3CC8A 3PX3A 4PYLA 4RVHA 2P7HA 5HIJA 3FRHA 1D2CA 2PXAA 5HZMA 1N2XA 3EPPA 2OBFA 4RVFA 5EEHA 4DM3A 2FRXA 1L9KA 4DF3A 4K6MA 3OE4A 5E1BA 5EHGA 2GA9A 3EMDA 3M70A 4ER6A 3DMGA 2O07A 3NWBA 5BW5A 3R24A 4HSGA 4QDJA 2EX4A 5HIMA 5K09A 2B25A 2IP2A 3HCDA 3M6UA 4HC4A 2O0LA 4RTKA 2GPYA 1YB2A 5KQRA 5EPEA 1R8XA 1HMYA 1HNNA 4E2ZA 3RW9A 5C1IA 5CCXA 2IGTA 2K4MA 1TPYA 3BKXA 3BWMA 2ZZNA 3M4XA 1KXZA 4KRGA 1NW7A 4F86A 2P8JA 2Y1XA 3GRUA 4IWNA 5LQAA 2AN3A 1EQAA 1QZZA 3KR2A 3OU6A 2YUIA 3MHTA 3B3GA 3KQVA 1NKVA 2IPXA 4XCXA 4X41A 3DOUA 3F4KA 2PWPA 2V7EA 4GC9A 4QDKA 3KR0A 2QRVB 1D2HA 2G72A 2P3QA 2XYRA 3AWIA 3OZSA 4RTMA 3G5LA 2YXEA 2YTZA 2XYVA 4PYQA 3TM5A 1FBNA 3OZRA 4QTTB 5EKUA 8MHTA 2AOWA 2JH9A 3O31A 3H2BA 1VP9A 2YXDA 3ME5A 4EK9A 4YV1A 3DMFA 4MQ4A 2VP3A 4PIMA 1RI4A 4GOMD 4FS8A 5GM2A 1Q0TA 2AOTB 3LGAA 4MIKA 3FTEA 2XVAA 3EGIA 3OFKA 2WK1A 2G8NA 1R00A 2V74B 2GH1A 4R05A 2GS9A 1G8SA 1BKYA 4MWZA 1NBIA 3ANXA 3HCAA 3EVCA 5E1MA 2BH2A 1KPGA 2G1PA 4EKIA 5F2KA 1AQIA 3DMHA 1SUSA 2YX1A 3IHTA 3FTCA 2Y1WA 2NYUA 3NDIA 5CVEA 5LQKA 1I9GA 2IH4A 4C04A 3M6XA 3JWIA 5DTRA 3UJBA 5D1HA 4LECA 2AOVA 4E30A 3KQMA 2IFTA 2FK8A 4GEKA 4V0RA 4OQEA 4ATNA 3GNLA 5KQSA 2JJQA 4RTPA 2H1RA 3KQQA 5GP1A 1H1DA 4HRAA 1X1AA 3LBYA 4OA8A 5K0GA 3NDJA 2EFJA 2PXCA 3HCEA 1RJEA 3M6WA 4EQZA 1NW3A 5KYGA 3BWBA 4RWZA 3DP7A 4OBXA 3V8VA 1QANA 4RVDA 5E9WA 1DL5A 3LX6A 1AV6A 4KWCA 2ZW9A 5EOVA 2P41A 4EKGA 4CWAA 1ZGAA 4E32A 1EJ6A 1X19A 4MTLA 3UWPA 1TW2A 2P35A 3LL7A 4Z2YA 5BXYA 1NE2A 3CCFA 1P91A 1JTFA 4CXMA 3HA5A 3CGGA 3HEMA 2VZ9A 3G2MA 1JG4A 3NVMB 5E2BA 4BP3A 3UJDA 4RTRA 1DCTA 3IEIA 2H11A 3MTEA 1NT2A 1WXXA 2Z6QA 1VIDA 3PVCA 3GU3A 3ER9A 4RVGA 3TMAA 2NP7A 1F3LA 3NWEA 1R74A 4YMGA 3A4TA 3LDGA 3AXTA 4PYJA 2FHPA 1YZHA 4R6XA 1XDSA 3PFGA 5E1OA 1ZG3A 1RI5A 1O9HA 1P1CA 5DM0A 5C0OE 4C05A 3AY0A 3E23A 3G2QA 2B2CA 3OCJA 4QVGA 4A6EA 4DCMA 3SM3A 3EVEA 4RX1A 4ER3A 3CKKA 3SSOA 2PX4A 2PX2A 3JWJA 4FT4A 1JSXA 5HIKA 1VPTA 2ZIGA 4QPPA 5HFJA 3KPWA 4MHTA 1RI1A 4FGZA 3QOWA 1SQFA 2ESRA 3A27A 5EHIA 3NVKI 4AZTA 1I1NA 2C7QA 1QAOA 2HMYB 1IY9A 1WG8A 1X1BA 5EQJB 3BGDA 3G2PA 1R6AA 3THSA 2I9KA 2A14A 3GGDA 4QVKA 4AZVA 2KW5A 4X63A 3FTFA 3SXJA 3FYDA 2IH5A 3LSTA 5KS2A 3P2KA 4GC5A 1ORIA 3LBFA 5FQOA 3SGLA 5JR3A 3FUVA 4YUXA 4DMGA 2PX8A 1NV9A 1NBHA 2O57A 3LHDA 3IV6A 1N7IA 4OX9Y 3ELUA 5HEKA 3TRKA 3GWZA 3VYWA 1VP3A 1T43A 3HCFA 1YZ3A 5DPMA 5T67A 3UJ6A 3KQTA 1G60A 3KPVA 3ELYA 3LDUA 5FTWA 2PLWA 4O29A 2BZGA 4C03A 2EG5A 3QV2A 1O54A 3P9CA 2G71A 1R18A 3HVIA 3UBTA 3CJQA 5CCBA 3PS9A 1KYWA 5DSXA 4L7VA 4CKBA 1JR4A 1L3IA 5BW4A 3HVKA 4RYLA 4C06A 4XUDA 4E2WA 3UJCA 2IDJA 4JXJA 4QQKA 4PYKA 1FJXA 1XXLA 2IBTA 1ZHFA 2C7RA 3BGVA 3C3YA 2CMHA 3EVZA 3SSNA 5ERGB 2JG3A 5JUWA 5E1DA 3MERA 2YQZA 1Z3CA 3FRIA 2GAFA 3HNRA 3LCVB 3X0DA 2ZWVA 2F8LA 4XUEA 1KYZA 4PCAA 3G2OA 3TKYA 2WA1A 1V39A 1JG3A 3M33A 2CWWA 2I62A 3UZUA 2UZ4A 2PX5A 3KU1A 2Z6AA 4RTOA 5CVVA 4POOA 2UYCA 4GF5A 3OPNA 3TQSA 5FHQA 1P1BA 4Y30A 1RJGA 2PXXA 3B3JA 5E9QA 3DLCA 2N47A 1QAMA 4G56A 4PYOA 4ER5A 4U7PB 3EEOA 1JG2A 3EVBA 1PJZA 3BT7A 3BUSA 3EMBA 5K0JA 3VSEA 5F2NA 5LQUA 5LQCA 3P2EA 2YVLA 5EG5A 3P9NA 1FP1D 5GOZA 4EVIA 2AVDA 4RTLA 1JG1A 5DRTA 3TLJA 5H02A 2P1DA 2ORED
chains in the Genus database with same CATH superfamily
3N8NA 3V8PA 1P0MA 3CV3A 3HKBA 4XPIA 3NT4A 4M0LA 2D1TA 3ELDA 1E9BA 2W4QA 4Q24A 3WAKA 3LUKA 5HF6A 1NRWA 2WF5A 3CRQA 3W4IA 4BNHA 3M0EA 2J08A 1V16A 3G8AA 5JS1A 2GK7A 3FNHA 1HO3A 2DRIA 3CLTC 1CHNA 4Q3AA 1SB8A 2Z8ZA 5E8RA 5SICE 3VJMA 2X1HA 2JEZA 1E2HA 3SMVA 5FA5A 4JL8A 2ZS9A 3KT8A 4BECA 5L45A 5EZYF 2UUCB 3ZD6A 3H2YA 2FG7C 3Q3HA 1WSDA 3D81A 1CQJB 1W46A 2H8GA 2VQ3A 1JQLB 2XGGA 3HXPA 4G65A 3ZV7A 1KZ6A 4WDQA 4B7ZA 1FJGB 4ZZ2A 2C0PA 3QFHA 3WWDA 4YAUA 1JEOA 3IKVA 3A1VA 3ELWA 1WZEA 4PLVA 4XGRA 3DD5A 2ZBQA 4YT2A 1TO6A 4TV8A 2GBIA 5H83A 5GIPE 3NFRA 4A73A 4Z7QB 5L6LB 3GEHA 1ELOA 3AOEC 3PQDA 1M2VB 2RG7A 3B60A 1QYDA 4QOSA 3W4KA 3QPUA 5K0LA 3TLMA 4WEOA 1QOZA 1L6IA 3DW1X 3LKBA 3PV0A 2JLSA 2IPLA 3RC8A 4QUBA 4DN6A 1YI0A 4MYHA 3ID6C 1O9BA 1YT5A 1RYZA 2P0YA 3BGOS 3WKCA 1F8XA 1V8ZA 5TNXA 4CM5A 1AKMA 3LT2A 3HA3A 2O2ZA 4KWEA 4P35A 1DU4A 1KQ3A 1UJ5A 2ZGVA 2ACEA 1L7QA 2MT9A 2JZOA 3KJNA 1RHRA 3R44A 4QASA 3BWEA 3C45A 4CRWB 5JNWA 2PUDA 1T9ZA 3G9ZA 4PCLA 4HNSA 5ADWA 4AECA 1L0BA 3RYTC 1KVTA 3IVGA 3UT0A 3OEEA 2I7TA 1I8TA 2RGNA 3FD8A 2QY9A 3VR6H 1IN1A 5SZKB 5HPYB 2CXOA 1T1EA 3JQ9C 3KKNA 3EH1A 1Z7GA 2EQAA 4KDCA 5G3ZA 2RGRA 2VDJA 3V1LA 1O5IA 4WHMA 1MQAA 3FNRA 1XZDA 1V41E 3VVCA 3PTAA 3DAYA 2NAPA 4PNEA 2V8BA 4UHDA 5IDWA 5BN1A 4R0NA 1M6HA 3RBAA 1PJQA 1A8QA 3R7NA 2OFWA 1P2TA 4QM6A 1KERA 3MUNA 5E6UB 3DWIA 2P4UA 5FDFA 1A2QA 2V7WA 1ZRSA 4H17A 4R9UC 5AM5A 4BO9A 3GJ7A 3WZ2A 1C1HA 2W93A 1TLTA 1DVRA 4ERNA 1N9KA 2IPMA 1P9OA 2YJ6A 1PK9A 2IYQA 2VZ0A 4ZMBA 4GX5A 4P58A 4GR5A 1ONBA 4Q66C 2BD0A 4G01B 3S68A 3CQ9A 1LK0A 2B7CA 1DKMA 3AEYA 4EF4A 4TTSA 1DC3A 4ZZ3A 1M1YB 3GLSA 1K89A 1HYEA 3PPIA 4RDHA 3THRA 3WGGA 1EX1A 1WJGA 4AWXA 2QUZA 2C2MA 1GG9A 1PN3A 1B41A 1WPQA 2R1VA 3DCJA 3GXOA 4BCCA 4DA6A 4PS1A 5EFOA 3U3MA 5EMKA 3F3KA 2QJOA 1KEZA 1T8WA 3AR4A 1XRJA 5EVJA 2RGDA 1PT6A 1JW9B 1OF1A 1Y9EA 4JT2A 1XZAA 4ZI5A 3B3QA 4CMAA 1Z0KA 4JOBA 4MV6A 1JU9A 2HF9A 3H8JA 3O7WA 4I55B 4GHWA 1TF7A 4O4LB 4QOGA 4URFA 4YROA 1CJBA 3DNMA 1CDZA 4RCYA 5IC4A 1ISSA 2FWPA 4R98A 4CW7A 4LGMA 2JARA 1F0YA 1JQ3A 1JKXA 2MYPA 3H3JA 4P82A 1T1IA 3QXSA 1V37A 1PWHA 3DAPA 2FPKA 5H16A 3FLMA 4UPDA 1AQJA 1CFZA 2H16A 2WG0A 3B2EA 1S1MA 3GJYA 5C3MA 1LX6A 3UA3A 3GH1A 3DXYA 4H3HB 3R09A 4GXNA 2VYCA 4EY5A 4INJA 2CY0A 4XRGA 1NG9A 4PYIA 1Q6ZA 4XM1A 2Q3EA 5DTMA 3UV7A 1NP6A 1VKZA 2M9MA 3HY3A 4I6GA 4OXRA 4D9KA 3D2LA 4MS4A 2Z1NA 5FOVA 8ABPA 2AQ8A 2Q5FA 1GLNA 4O4IF 4F3TA 1DX9A 1XDDA 1GG8A 4OH1A 5DM70 3STTA 5B4VA 2HK9A 1CJSA 3R8XA 1JJAA 1IQPA 4B31A 1JLLB 1P72A 2GNAA 2R85A 3A9CA 3PX2A 4M8SA 1KSFX 3A4LA 4JD5A 2ZI6A 4ZOQI 5B1DA 5CEEA 1WULS 3GFFA 3EBOA 1Q77A 5BO5A 4EGQA 1OPRA 2BFNA 1RYDA 4G1MB 3QKRA 4IQGA 5LDHA 2BGLA 1E1YA 3VAZA 2FSPA 1DAOA 3ORFA 1GFIA 1BFDA 1ZU4A 4O4JF 1QMGA 5HZHA 2FWRA 3H4IA 4PAMA 1C9JA 4P34A 3EUEA 5LIPA 2PEZA 3DM9B 2F3SA 4FYJA 1W19A 4IJWA 3NYRA 3PT5A 2KQUA 2XRFA 4IV8A 2R4TA 2W22A 4LX0A 1Z37A 3IXQA 7AT1A 3ABIA 2DLDA 4TLLB 5D87A 3D54D 1OWMA 3MLBA 2P2DA 4JVOA 4B9EA 1KKMA 1EVQA 2H48A 1JDNA 3DMPA 3PNBA 2ZDHA 1YCDA 1OLSB 2AXNA 4MPRA 5P21A 2E1PA 3C7TA 4A26A 1A5SB 3BDVA 1GZ7A 3ISVA 4DV2B 4F93B 2GCEA 4WNIA 3TXXA 4WK6A 2RGGA 2ZJBA 1ISJA 4KITB 4KP7A 1MKYA 1TI7A 1ZVMA 1X74A 5AKYA 4ZVRA 2QLFA 4BQPA 2FEKA 1XJWA 1GRCA 1T4CB 3VFDA 3KXLA 3JAMA 1X3SA 2Y0DA 5JSKA 4W8OA 2Q4TA 3AR3A 5IBRA 3HBAA 3O94A 4RIHA 2JAUA 4A3SA 3QKRB 3KQNA 3GFGA 4Q9LA 3LX4A 4AYTA 4WLUA 2WF7A 2ZI4A 1BMFD 1LSOA 1ONSA 2QUBA 2ZDGA 3GJ5A 3KLNA 4F84A 4ZN6A 2C07A 4DR3B 2TRSB 3QLUA 3GFVA 5DRYA 1PR5A 3SMQA 1U2GC 3BB1A 2HXGA 5TMEA 4EGJA 4FDUA 4IFIA 3WS7A 3IX7A 3KRTA 2M6KA 1ZVQA 4XUGB 3OZEA 3PGVA 4X85A 4JROA 3ANMA 3IKTA 2FRDA 4JJ6A 1CRLA 1BHQ1 3WL7A 4CLRA 3C6MA 3SQMA 3RTGA 3VOTA 3B3FA 4RQUA 5T5QA 5AXCA 1F8UA 2FSUA 4Z3DA 2PUHA 3K2BA 4MI6A 4NMMA 3KDPA 3DMDA 3ZDAA 1HYQA 2JFHA 1EKXA 1IZ9A 2OB2A 4B3CA 3W6NA 2PV0A 5KTNA 1EZ4A 1V3VA 4BAGA 3SC6A 2XPCA 4MVYA 3EUAA 2O06A 4LOAA 1E1CA 4MQLA 5DHTA 4TM7A 1NF8A 3WLFA 4BP9A 2CFCA 4QBTA 3RDPA 4BVGA 5J3JA 4ISBA 1PK7A 2GPWA 2HPAA 4BMNA 3FPFA 2Y68A 1JKIA 2VH5R 1QIEA 4ZOLA 3HYCA 1QVZA 2OE2A 5COAA 1BJKA 3OCWA 4JHLA 3SKYA 2ORIA 1RAGA 2YV3A 2Q7XA 3JD1A 2JFVA 3ADPA 1L8OA 2JIBA 4HUJA 3TOXA 1EVYA 4L3OA 1ESZA 4PYLA 6ABPA 2XB8A 3DB1A 1OC4A 1QGOA 2X3FA 2R6JA 5L4LA 5JAOA 1SCUA 1NKTA 5LKAA 4RHFA 3PXAA 3ER6A 1EJ2A 4KVAA 3FNEA 1TM1E 3I30X 1NXQA 1ODTC 4LRQA 4XJVA 2O0HA 5H1YA 5T41A 1YOBA 4MWOA 3LBNA 2FSFA 3R24A 3I2HA 5CG2A 1MDBA 4AMGA 1UINA 2QNBA 3RI3A 3S1SA 3COJA 5LYYA 3JPWA 4QBHA 5HA5A 2NSYA 1XZFA 3U9SA 1E94E 2CLOB 2IGTA 1QDUA 5ANRB 3WYBA 2C04A 4KPUA 1CZKA 2VJAA 3BXHA 3HJUA 2ILTA 3PR1A 1H8HD 3HCWA 5KO2A 4EECA 2HN9A 4F86A 1NVEA 2ODPA 4M99A 4UEJA 2JDID 2QRMA 2O20A 2ZT7A 4JYPA 1LDMA 4F1JA 2CE2X 3ILXA 4V24A 2JHFA 2IPXA 3RK0A 1FNBA 1B8UA 4KMSA 1TU4A 2C4NA 3F4KA 4UEKA 3U1TA 3IVRA 2VKTA 3D0KA 5CA0B 1NXSA 1O89A 2BDUA 3CYFA 3PIIA 1IQUA 1MG5A 2LV8A 4ETWA 2YTZA 1FBNA 4HWTA 2YWXA 1FU4A 4JHXA 4QTTB 1EB8A 8MHTA 4W8HA 1WD7A 1ZWKA 3SVLA 1QG0A 8AT1A 5GM2A 1CVRA 4QNRA 4TTQA 3Q3VA 1J9GA 4FS8A 4FYYA 2Q29A 3RS4A 2AOTB 3G8YA 4ZCPA 5TQ0B 2HADA 2HSZA 2VF8A 2YYSA 3BEDA 2PWZA 1E58A 2HJWA 3EXG1 4OGLA 1H0SA 2FEOA 4G5XA 4UDOA 4JLSA 3G0IA 3M9XA 4ODIA 1ZJZA 3AM5A 4WKNA 2V0NA 5JAMA 4KPUB 4BWGA 4ARVA 1RYHA 2VBFA 3BTVA 3R3JA 4CM4A 3PPWA 4GYWA 4YCDA 2V0GA 2F8MA 1CJCA 1AKUA 5I7UA 3NDIA 4HDQB 1ZITA 3EG9B 5LQKA 4ZJPA 3HCRA 1QSGA 1JEJA 4NS1A 5GQSA 2BFBB 3B9RA 3EEFA 3ZY5A 3RT9A 5DBGA 1KBZA 3BAFA 4JZKA 3EDMA 4F6RB 2HJVA 1XN1A 3TQQA 2Q6TA 2EP5A 4IHJF 2GARA 1T13A 2HSDA 3DQQA 4OA8A 1X9IA 1QH1B 4WH0A 2WILA 4F7DA 2Q0SA 5K0GA 3DBIA 1QGZA 5LDGA 4KXXA 4AO6A 1K8RA 3EDYA 3COZA 1ZH0A 3EY4A 1Q5PA 2OUKA 1EFPA 4GWGA 5EZYB 5FPQA 4CR7A 4L28A 3X1YA 1V45E 2CL6X 5JFOA 1QGDA 2QLLA 4GR4A 4TLEA 2KBEA 3RKUA 4B7UA 4BNUA 2P41A 3KYJB 1UAYA 3KZOA 3RSQA 1RHQA 2X8JA 3LPAA 2OXIA 1JB9A 1M2KA 1E18A 4AAYA 1TW2A 3IR6A 3PUJA 3LL7A 3TCNA 1F6WA 4QJ5A 4I7EA 1Z4OA 3LQRA 3UFXB 3EOBI 3JQAB 4DLUA 2FQYA 1NR1A 1SEPA 2Z3WA 1E0SA 1YUMA 2QI9C 4UZSA 3M81A 1MX1A 3OIUA 3SM9A 2IZ5A 3RRZA 1GNTA 1MQ8B 1NBWB 1PJ2A 1QIDA 1Q1GA 2KPOA 1SCBA 1QHGA 3FTQA 4LRUA 4UVIA 2VNHA 5LP6B 1GTRA 5EUMA 4JSYA 3KJZA 1CEXA 1D6MA 1XE3A 1JWLA 1H42A 5JD4A 3VR2A 4B82A 1WSWA 5D2CA 2PBRA 2QLTA 3QVTA 3PXGA 3MCVA 1E7WA 2P0EA 3AI7A 2QE7A 2ZWMA 4IH9A 3A4TA 1RWNA 1DKQA 2ZAYA 5B37A 3VKWA 4PQEA 1I0IA 1PNOA 2EW2A 4YRAA 2BF4A 1GAJA 1UKYA 2WD9A 3WAGA 5B7PA 3D3JA 5DW3A 2B35A 3KALA 3HFGA 3OSUA 2HZ7A 3A10A 3R6DA 3UC5A 4EHNA 4JJ4A 5I45A 2PX4A 1GPKA 2GZAA 2IYZA 4JUFA 5JD6A 1VA4A 4DZZA 2XX3A 4AWBA 3KSRA 3KPWA 1T2UA 3PJDA 1ONOA 3HG7A 4RQBA 3QOWA 4V2UA 1WQ4A 2QDKA 3M5DA 5TY0A 4FFBA 4MRAA 2C7QA 3H7IA 2CCKA 1CIVA 1NVUQ 5KWJA 3THSA 5JZ9A 4IIEA 3OP1A 5MN5A 1A04A 3NV9A 3FRJA 3ZQJA 1XO1A 1ATIA 5KS2A 1XZGA 3AU9A 1RXEA 3OMLA 5K1ZA 5TR9A 5F78A 4KB5A 3RFCA 1L7AA 2OZEA 2RDMA 4ITRC 2QXUA 1AG9A 3NUGA 2DPGA 3MK31 4R2WA 3T9FA 1XLVA 1N7IA 1UKEA 2QRJA 3DDNA 5BWBA 2D5CA 3WZLA 5G0VA 3VYWA 1XU7A 4EHLA 5EJEA 5T67A 2Q49A 3LPDA 3GLIB 4ZYXA 1RAHA 2ODAA 3M5WA 4P32A 1G7TA 4D9MA 2D2VA 1Z5VA 2Y92A 2VSQA 2OG2A 5D51S 4XVUA 2ZYHA 4DMRA 2FZCA 1CS0B 2O7VA 1W96A 4KUEA 1OXVA 5BUQA 1J2TA 2R60A 3Q3JB 4P80A 1DINA 3OQJA 3SZLA 5DSXA 1UC5B 2Y2VA 4O1HA 4F0JA 5LD2B 3I4LA 4NNJA 4XUDA 4FMCF 4MVJI 4BKQA 4EPXA 3PQ4A 1E9CA 3DP9A 4LVUA 1Z68A 4RHCA 1FZQA 1KI7A 1XAHA 2VBGA 4EW3A 1Z0FA 4Q4AA 3D9QX 5AP9A 2WJIA 4WBNB 3QEJA 4U0JA 4M60A 4BWVA 3TG2A 4RHYA 1M75A 3DZKA 4XUEA 4OHUA 5FBLB 3D2CA 4ND2A 4JLBA 4UARA 5CIQA 1HLPA 1ECFA 1CR2A 4CKZA 4ILKA 4DFDA 4Q1EA 2CMFA 2WW8A 4ZT3A 5B36A 2GO7A 221PA 1I14A 1W1UA 1EE1A 3FCOA 4LGCA 4TWIA 3FSJX 4S05A 3R5HA 1ZONA 3VJRA 3U1VA 4PZZA 1TZMA 4IUBS 3UK6A 5FL7D 1Y5NA 1T3LA 1GL7A 3C24A 1DBRA 2CDNA 1UBCA 4KNWA 1I1QB 4YNBA 3ZTTA 1A4IA 2Y9PB 3GIDA 4FS3A 5EL0A 1ADYA 3MUEA 3TOCA 1FYFA 2UUOA 3OD5A 2YVLA 4C6TB 1I7DA 4N76A 2QTVA 2IODA 3UTDA 4EVIA 1O4WA 1XV5A 2AVDA 1JLMA 3LRPA 3O1HB 3NATA 1T4BA 4Y6RA 4U4AA 1K98A 3MGBA 4UTRA 3LXXA 1XLWA 3PIDA 4XYEA 4D45A 3N0WA 3JD3A 4DIEA 4JQCA 4UCXA 1RYNA 3EOZA 4TYNA 1JQ5A 5HKKA 3FGZA 3KVOA 4HD8A 1C4OA 4JJ8A 2VK2A 1HXHA 3BD6A 7ADHA 2BKVA 4MVJH 1HLGA 2QM3A 5DOVA 1IWPB 1WXFA 1SC1A 3R7LA 1SBQA 1G3IA 3PENA 4XLZA 5HKKD 4U9IS 2QL5A 2X4IA 4DV6B 4RPHA 4TWBA 2I6QA 2D5AA 2HK7A 2HT6A 3P5BA 3W4JA 4YC7A 4CJXA 2ENUA 4MB2A 4BVKA 1E9FA 2WTMA 5GIOE 4W1QA 2YV1A 3JZDA 4L50A 5KYKA 2BKAA 3T5TA 3A1SA 5DX8A 3I5YA 1GYRA 2NXJA 3OEED 4D9JA 1JZTA 1ECLA 2P9GA 3QUQA 4G07A 1OBFO 4IBOA 5LQRA 1D4FA 3VR5H 4CR6A 4KOAA 3C6KA 3E82A 4BNTA 1Z28A 2Z6AA 1RPJA 1QQ7A 3HEAA 5BRJA 1B93A 1MRZA 2JFQA 3P96A 1THTA 3DTTA 2HEGA 1MJ5A 2DECA 4XUCA 3TLAA 1R50A 1D9ZA 3FJYA 2VDRB 4YRMA 1NTOA 1ABFA 1HL7A 2XQGA 3E1KA 4GUDA 2EZTA 4EUSA 2TMKA 2YNMC 1Z63A 2D3TA 4TYYA 5C80A 1N3YA 3ZHCA 1CQXA 5AKEA 4Y9TA 4RNDB 2FG5A 1Q0SA 4U2CA 4I5DA 4MRPA 3EMKA 4G9GA 3EIFA 4IKPA 1OHHD 2WYIA 3K0BA 2BFAA 4FYVA 3LBIA 5U4QA 3WBKA 4EVQA 2CXNA 5K99A 2W0SA 2ZIXA 4P1ZA 3FVTA 3N8GA 4AJLA 1TM4E 5DGDA 5CLHA 4E2YA 4RCVA 3NZEA 2WKRA 3WGIA 4P38A 1O1YA 3UXMA 2ECFA 3MRXA 5K45A 1E1QA 5JZMA 2XYQA 2J4CA 2LCFA 3SJ7A 3TLZA 2HMSA 3Q2IA 2PY6A 5FBHA 2LW7A 1XZHA 4RZSA 3WTBA 1XTSA 1YQTA 5ARDA 1QZXA 1L5HA 3EG9A 2W7TA 5GTDA 3X2EA 4KUGA 4GRDA 3F7OA 3KIPA 5F3RA 3AB7A 2QP4A 3EXEA 4JA0A 4BIMA 5ELXA 3G7UA 4WECA 4FI3F 3VPXA 5FWAA 1MVLA 3I28A 4BNMA 1QH8A 3BIWA 3QF4B 4C4SA 2OBMA 3E7DA 821PA 5JD5A 3C0KA 1N77A 2ZYVX 1V5FA 4JKYA 2O1EA 4UNNA 3TW4A 3MFDA 3BMXA 5EIOA 1KYQA 1K6EA 4FC6A 4E70A 3S1LA 2PUBA 1AUQA 1FVOA 3AG5A 3EOAI 4A82A 3BA6A 3IOEA 4MS3B 3Q10A 4PLYA 5T4EA 5AW7A 1RAIA 5L9AA 1OFHA 2G88A 4OGFA 3RVJA 3IDOA 3IDZA 3OPXA 3RVPA 3T4UA 1Y6JA 1LTQA 4HTAA 3S8MA 6REQA 3VNQA 2UUBB 1M6EX 2IS2A 2EV9A 3ZUGA 5CFOA 1V7CA 1UOEA 2F43B 3T3EA 3T1HB 2PMEA 3LIPA 4XVHA 3WL8A 5M2QA 4CIBA 5FF9A 3G3EA 1M0WA 2OK8A 1GTL1 2H0QA 2C9ZA 2Z56A 1QIFA 4IDAA 5CDUA 2YVAA 2Q07A 4N3NA 4LTDA 3WGYA 4EYQA 3RUFA 2PRSA 2GQ0A 2IYFA 3CUUA 1PG2A 2QAGA 2HF2A 2FPPA 5DK6A 1YNOA 4IXTA 3ZLUA 3NIDB 4E5MA 4QGFA 4BHTA 1NW5A 3U19A 2DUNA 2ICAA 4R51A 1R9GA 1XXHB 2WUVA 1YRLA 3K1AB 3HK2A 3L7LA 3R9IA 4FINA 2ZETA 4UUMA 1S2DA 4EA9A 4M8KA 2WD7B 2CNLA 2AFIE 2IEDA 5KYNA 2FW6A 1ACLA 5CW1A 5K05A 1OAAA 2VC2B 2G9VA 4KQCA 3PA8A 1GZVA 1EA7A 4JYMA 4LJ5A 4R1QA 4C1NA 1ETHA 1JEEA 1OPXA 5HDQA 3ZGYA 4DJDC 1J0BA 3H2HA 2V7UA 1WUYA 3TLGA 3HDTA 3MTIA 4LGYA 3X1MA 5IKEA 2YOGA 1WX1A 1Q74A 1SU8A 4H15A 1CEQA 2XWPA 4JL5A 3G6KA 3SZRA 2DCUA 3OKCA 2CD9A 1XHLA 2F64A 4F2GA 2A5DA 4QDTA 1VBNA 3LT1A 4MLZA 4LTNA 1PFYA 3H1PA 2GK4A 1Y33E 3QJYA 3YASA 2B9EA 3KXDA 2V7BA 4UHJA 2CHEA 2VRCA 4QQ8A 1N1EA 3L6CA 1SQ6A 5KB3A 2PD6A 4U7TB 3A1EA 1IQ0A 3WWOA 1KC3A 4YA6A 1MF7A 1AY0A 2XOKA 3FY4A 1U5BA 3VU9A 1YVRA 2UZ1A 2EAUA 3HMKA 4BMSA 1WNFA 4HAYA 3M4YA 4DJJA 1YK0A 1FE8A 3OZWA 3NM4A 4Y2HA 4ED9A 2FFAA 4M38A 5LBTA 4C7OB 3KUUA 3FX2A 3PEVA 1VJ5A 2HPVA 1BQ3A 3OOJA 4CV3A 5IJ0A 3CSDA 5K3EA 2C7OA 4DV7B 4S1WA 2ZTMA 3PF8A 4Q7JB 5EEGA 2GR9A 4TS3A 2NTJA 4JP8A 2FW9A 4ID3A 1IY2A 1Z06A 4E5NA 2PWAA 3WBJA 4HQLA 2Y4NA 5JCZA 4X3OA 3B1ZA 5HP4A 3H9QA 3GMDA 2BH9A 3W1EA 1REQA 1RJFA 1L4LA 3I9KA 5LR6A 4R1LA 1NP3A 2C2ZA 3K8QA 3PFFA 1KQOA 5IMBA 4DS3A 1YA6A 1B8PA 4RKEA 4M1QA 4MTCA 1QFJA 2VF2A 1C0PA 2IZOA 1Y8AA 2GXQA 3EVFA 3AOEA 4KH1A 1TM5E 3VH3A 1BS9A 4CQJA 2JKYA 2JFPA 2V7XA 3RKRA 4OLAA 4BFTA 1WCWA 1ZGJA 3V9AA 3CGWA 1QE0A 5C4IA 5L7WA 3TNJA 4PO1A 2X5NA 3IAM6 1QKJA 1B26A 4GX0A 3QXGA 4OMFG 4UMDA 3CW2A 3VYVA 1D5CA 4UBOA 5AM4A 721PA 2DE0X 1Y7TA 1R3DA 2GPTA 3EQ8A 1G20A 5DN6A 1AMOA 1P2FA 5BSUA 4ZQFA 4O2BF 3HGQA 4WXHA 3OH8A 4JGGA 3T94A 1Y0BA 4DBLC 4KGXA 1AE1A 1LNZA 5DYGA 2KHZA 4JUCA 1SXIA 3B1XA 4JT4A 5AWFC 5JTTA 2HSJA 4JX9A 1C1DA 2P7IA 3B13B 5L51A 3PNSA 1QGUB 1TUEA 5TGZA 1JEYB 2OV8A 3SR3A 2WA2A 2PWBA 4XQGA 2NX2A 3ANTA 2ZE5A 1N33B 5BWNA 2F3QA 1KJ8A 1YSCA 3CG0A 1C2TA 3S3TA 4BJ1A 1QF9A 2BMEA 5HTKA 4KXMA 5JNSA 1ESEA 1S3FA 1UT6A 1AHHA 4HRVA 4YJ2A 5KTOA 1T2NA 2BFWA 3MBIA 3WLNA 3EH2A 3H2SA 1PZXA 2C77A 2H4YA 4EY8A 4HL6A 5EGSA 2PLNA 4RJKA 5H68A 4BDTA 5IX8A 4NC9A 4C5CA 1WY7A 4ZQCB 4ASUA 2FDRA 1MGPA 1BU8A 4FDLA 4DSAA 5FI1B 4RF2A 4PO9A 2AUTA 3T38A 1EFVB 5CURA 1YO6A 1PV2A 4J3NA 2C8JA 3UICA 2C7VA 4EG7A 1N36B 3VZCA 1E69A 1RM5A 4C0SA 4MAAA 4ND7A 5JVDA 2M1XA 5BQOA 4UM9D 1AA6A 5DYYA 2PU7A 4QDJA 2IXTA 4IL5A 5JMOA 3ROGA 2O1WA 2O0LA 5C1DA 1KY5A 3HXOA 4GFDA 3ZVLA 2DWQA 3BCRA 4AMYA 3MWJA 3IUNA 4WFKA 2WF6A 1Y3HA 2IT1A 3FROA 3KB1A 1WZIA 5DM60 1DEXA 2K4MA 4D6PA 5K3CA 2EW8A 2ID7A 1RVV1 4YRCA 2JGNA 1Y1QA 3HVRA 5KTYA 4CEIB 2JCGA 4K9PA 1X80A 4LCJA 2P8JA 3QUTA 3NIWA 4KUHA 2A4KA 1GGFA 2O50A 4ZCQA 2DVMA 3V7FA 2VK4A 4M22A 2IU0A 1OFGA 3HB4X 2FU5C 2HSEA 2CVOA 4GEGA 4I1VA 4EBFA 1JSCA 3OIYA 3MTAA 1NQOA 1E60A 3IALA 2J0UA 2OVBA 3VR2D 1M7GA 4L02A 3ISTA 2GMWA 3K9CA 2B1JA 2D4AA 3L0PA 4GMDA 4L4XA 2AG8A 4PRZA 3PTLA 5J5AA 4AS2A 4OQ4A 4ZDJA 1JA9A 4J4TA 4Y1GA 1YE8A 4R1TA 3H97A 3ZIDA 4F45A 5BNZA 2BGGA 1XRSB 3H2BA 4XDGA 3FWZA 4YDHB 4TLCA 3JYLA 2JIQA 4N0EA 3HC7A 1R0XA 2GCGA 2HA4A 3HKCB 4HZUA 4L27A 4GX1A 5KYUB 5A6SB 3QI7A 4INAA 3E48A 2WK1A 3AKDA 4WGGA 2I2CA 1NYLA 2IU3A 3P9XA 4V39A 1LFDB 3ZWMA 2XQJA 4WZBB 1NUTA 3UY4A 4D4MA 2VCYA 3ZBTA 3NTUA 5CVCA 1TYAE 2BWJA 3EVCA 2KBFA 3ROTA 1JL3A 1WCIA 2JK1A 1YRBA 1KEKA 1OI2A 4S24A 4UBLA 2X77A 1KOJA 5CM9C 3QNWA 4YHBA 1SUSA 1LB1B 2NO7A 2YX1A 4ZV7A 4B8YA 3JASA 1F2DA 1PKXA 1W4BA 2LR0A 2I80A 2WTAA 4OUKX 2QZPA 1QYIA 3VU0A 4IZIA 3SZOA 2OQ2A 2QL9A 5AUOB 4RVUA 2J59A 5C7IO 4E30A 1A2KC 1JAZA 4QRDA 3ZIAA 2RGWA 2WUGA 3H1BA 1GSHA 3EA4A 3DOJA 4A2WA 5IS2A 1NUPA 4PWZA 1VHQA 3NT5A 1FMTA 3CSUA 1GTMA 2PZ8A 3W2GA 4PRLA 1IH8A 2ZTUA 4OHFA 4BLOA 4G5YA 1ZBDA 4EQZA 4DTIA 1F12A 3DP7A 5F1PA 3TNYA 1LVUA 3HPQA 1U8AA 2XIJA 4J2TA 4ZOLF 4B4UA 3I0NA 2FUKA 3I61A 3DE6X 4XSHA 2BFEB 5IKOA 4F56A 2H0RA 5CR9A 3T06B 2OORA 4P7BA 4TUYB 1L4KA 2YV4A 1F0NA 3I83A 4R31A 4D9NA 4DC1A 3T5PA 4BJ5A 3ONWA 3K2QA 3B8HA 3AQ4A 2PGDA 4HJXA 1JTFA 3KFXA 2DQZA 3PSHA 3G9XA 2JJYA 3NC0C 4L9RA 1OLXB 2XITA 4RK1A 5B6IA 1P1KA 2V5VA 2AFHB 4Q7LA 5LB4A 3A9RA 3GH3A 3KTAB 5CB4F 4DEYA 4IDPA 2SECE 4EG3A 1G0NA 3GJZA 3O5AA 4LA4A 2O0JA 3DZDA 3I9OA 4F8YA 5A06A 4PO8A 4MVJM 1DC7A 4INPA 3HFSA 1R74A 1ECCA 3AEZA 3GZTB 1Z7EA 3LDGA 4XEUA 4YMGA 4KXWA 1CUFA 2QMEA 3EAFA 4O4JA 3DEHA 5KYYB 1PVVA 4JWTA 2PH1A 2PL1A 5DO9A 2G6TA 2HFJA 4ACAA 3E23A 3ZCSA 5EY5B 5IRCD 2B2CA 1K4KA 2NU7A 4GE3A 4RX1A 1Z75A 3EGXA 4F12A 3BBPA 3I12A 4H08A 5J9FA 5FWNA 1Y1SA 2WVJA 4DA9A 4GMKA 2VVTA 4QSHA 5IAAA 2ESRA 3FKQA 3NVKI 1V3TA 1VHDA 3IIIA 1X7ZB 3K09A 1IY9A 1GZ5A 2B8EA 3BYZA 1COZA 3JVIA 1BMQA 4QBKA 5ICMA 1T6NA 3O26A 1LJLA 4YUXA 1WP4A 4S1NA 1XU9A 2VDWB 4CKYA 2YWCA 4Q9AA 5IDXA 2RHHA 4NH4A 4DLAA 2G4LA 2B4RO 3ELUA 2DPLA 5JD3A 2WFZA 2J33A 1OH5A 2YWGA 4ZXFA 1OU4A 4H7FA 4NZNA 4OTZA 2C4VA 3BG5A 3QVGB 4KVFA 4BAUA 1KKUA 3RH0A 1FX0A 2P9FA 2G25A 1AC5A 2G0NA 4O2BB 2JFBA 1L7NA 4I4IA 2VRWA 2CZGA 1K6JA 1VLHA 1YB7A 2GDZA 4K9SA 3UMGA 4AULA 4QT4A 1LSSA 4BU0A 4CMEC 1GQOA 1M2JA 2B5OA 2BGWA 2VYVA 2BE7A 2GAOA 4MUHA 3QLEA 3E53A 3C3CA 5EYPB 1BEZA 3JYQA 5EYPA 3OO0A 5IAJA 4ROSA 3VPHA 1FJXA 3CLKA 1YB4A 4UU0A 4BOYA 1RABA 2MHCA 4J75A 2EWMA 1GD1O 2H4JA 4KBYA 2JCXA 2QVGA 3IV7A 1I1OA 2QZ4A 4UMVA 4AD8A 2PRYA 4DB4A 4Q05A 4D99A 2VUIB 5AVJA 1E79D 3G02A 1A9TA 2I9PA 1JQAA 1T6ZA 2L17A 3E5NA 3KVNA 4J16C 4QAJA 1OVMA 1NAHA 2RK3A 3GJ0A 2RD2A 3LU1A 1U8XX 2VYND 4MR9B 1PR6A 2CNOA 3VNBA 5IEJA 1I5RA 4IZ6A 4KQMA 2WYOA 4MV3A 4KL8S 3ADBA 1MA0A 3E84A 4WZAA 3WRXC 2GYWA 1S3GA 2XA1A 2GPBA 1F5NA 5C4GB 4QYTA 2VJNA 4KR0A 3W5AA 3G0HA 3BHNA 1FYEA 4BRZA 2GYYA 1GL3A 5BYAA 4U7PB 1O6ZA 1PF7E 4CIWA 1B1AA 3MCUA 1GVHA 5BV7A 1QRAA 3LWZA 1KSHA 3N0XA 2EBWA 2H4FA 3TFQA 3L0OA 4LXTA 4R1NA 5KYXB 3EWSA 1LX7A 2ATVA 3LI2A 2IGBA 4WXRA 1OX6A 3ZH2A 1UFVA 3IVXA 4QHTA 3MPOA 1GFWA 3BOSA 4B3SB 1NLZA 2IYPA 1Y89A 4R16A 1RQXA 3M6LA 4DSUA 4HNHA 4KAFA 1EPUA 2E37A 1UANA 3GW8A 5B53A 4EEXA 5TT0A 4KGVA 2DMRA 4HEQA 1ZQ9A 2H9YA 4G2NA 1IOWA 2VYVD 4PG4A 3LLVA 1MT3A 2P4EA 2R3SA 4Q3CA 3DEIA 1RQPA 2WHPB 4KVZA 1R7RA 4MVWA 1UK6A 3E3NA 3H13A 5I47A 3G8BA 4MMZB 5J23A 1B16A 3KKZA 3H0KA 3SR4A 5BQPA 1WQ3A 1PD0A 1IRIA 3N76A 4LWOA 4ZAFA 1SIBE 2X13A 3TIFA 4AX8A 3AFMA 2SNIE 4BEJA 1M34A 1ZUD1 3SF8A 1MH9A 2J9FB 4RS3A 3UO8B 4FFPA 1UDXA 1NLUA 1XEWY 3EQZA 2HJGA 4Q5IA 2IS4A 1X7HA 1RBQA 3Q6MA 1RPZA 1HFWA 3M83A 1Z2CA 3ICPA 2OGZA 4MUEA 2WIBA 1BW9A 2BR4A 1SR8A 3SHTA 4FOLA 1D1TA 3U60B 2ID8A 3HSKA 4HB0A 5FADA 1O6BA 3G2NA 3OT5A 1BX1A 2W90A 5KYWB 2OOSA 3NETA 5EUBA 4H6XA 5TE9A 1PYDA 4ONEA 4CMIB 2IYTA 2WMYA 5MGNA 1WOYA 4WCDA 2H5EA 2V3WA 1VLQA 3FPHA 4BNLA 3TRIA 2ZKLA 2AK2A 4PLTA 1E3EA 1IBCA 2IYYA 1FP4A 1N7JA 3VYTB 3AW8A 1MORA 1JMVA 2OV1A 3F97A 3DB2A 3MOGA 5HIIA 4C0HA 4EJ0A 9MHTA 4QIHA 2E89A 4GLLA 3HJFA 4A8PA 1AZLA 2PS0A 4ZC1A 4H4EA 4KO1S 5JPDA 1Z88A 2POCA 1UIRA 1NOIA 2LXNA 2V6IA 2AKAB 3GYGA 5K0TA 1T1RA 5EIBD 1QX3A 4P84A 5HK8A 2OVFA 5C51B 1ZU5A 1SK8A 4GI1A 3SVTA 2XV1A 2XTJA 1UKCA 2XQFA 1TW3A 3PB3A 3P9QA 1GZDA 4FJ2A 4I9HA 2EP8A 4S2EA 1N8SA 1ULTA 2BFDA 4N01A 1TDJA 4D56A 5I7OA 4YASA 4W4TA 4NTZA 4CFSA 3D02A 2FPWA 4OBWA 3PT9A 2R5FA 4PIPA 2JATA 4JELA 4DLKA 4E1AA 3HKCA 4HZUB 5KYUA 1QC5A 2FN3A 2PD4A 2PPVA 3O8RA 2FVXA 1LI5A 3DEKA 4YRDA 2KYRA 2XHZA 3FCSB 4JXZA 4KN6A 1KU0A 1UDCA 1VL5A 3L7NA 5C3UA 3T5CA 4HF7A 3VDMA 3WNQA 5BUSA 4BB0A 3A6KA 3VA7A 4QYWA 1G2PA 3SF8B 4Q3NA 3CKLA 1E3JA 4RVSA 5K0BA 3FTDA 1B8VA 1JB1A 4L8WB 2I6FA 4JQYA 4RD4A 2VH2A 1ZNWA 2ECOA 4AT1A 2ZCJA 1WD5A 1N2ZA 3BXEA 3KD3A 1IXYA 4BKUA 4D3SA 4EB6A 1ZGGA 3RV3A 3GMTA 1I80A 3MMNA 3GNSA 3FZQA 1M2VA 4FOTA 3ZX4A 1RC8A 1JIXA 2Q1TA 3VU8A 4EMSA 2ADFA 1SVUA 1W9HA 2QL7A 4ZYWA 1TC1A 5J2TB 1KS9A 4D0SA 2FPXA 3OPQA 4F9TA 4LYEA 3ZDDA 4NICA 4IJUA 1Z6AA 4XYBA 4LHWA 5ADUS 4EFDA 3MT9A 2A0KA 1NF2A 3FGOA 2GEDA 1ISRA 2D1RA 4KKVA 3INGA 2O2EA 2IXAA 1Y3FE 1CQJA 1HDXA 1QIIA 3F8SA 4LYAA 4R8MA 4K88A 5BSEA 2R2AA 1HG0A 2B3TA 1ZSNA 4K6CA 2RONA 5BYJA 4DQUA 1CC1S 4UE6A 4FK8A 3ICVA 1VMAA 1XBTA 5LZ9A 2ZRKA 1GU0A 5AKGA 4RJIA 5AIAA 3MTGA 1QS0B 3V34A 2OZVA 4CKEB 2GASA 3HJCA 3KPUA 3VBEA 3ZGNA 4EHDA 1QB7A 5FUWA 4IGAA 2RG1A 5H3LA 4R7TA 3T0FA 4JIMA 2CT8A 4JLNA 1FFDA 1D8AA 3P52A 1D4ZA 2L18A 4PU0A 1Z5GA 2OBYA 4DG9A 1JQKA 1L7MA 1KYXA 3BH7A 4U5QA 5ALSA 4CGZA 2XMGA 2GKGA 3OJLA 1XG5A 1RRPA 4P22A 3CVYA 4NXNB 2R65A 5DBHX 2MIIA 4EI9A 1F4LA 1VSVA 2JL1A 3T3MB 3T35A 5KTKA 3BQMB 2I29A 1M10A 2QZSA 2P30A 2Y1KA 3IJEB 2XW6A 1ATZA 3ACBA 1N5LA 2JGEA 4XJXA 4Q93A 1BEEA 1Z5ZA 2BGMA 3IDQA 2BUAA 4ZDKA 2JFGA 4OK3A 3OJWA 4M6WA 1H5QA 1UPXA 1NVVQ 1GV1A 1TKRA 1RZRD 1BWRA 1PL8A 1U8FO 2RHLA 5TQ2A 2IZ6A 4KEAA 5U4XA 2R68A 4NNOA 2FSVC 3H1EA 1HR0B 1KEEB 1QUFA 2R96A 4XA8A 4CT4B 3B7PA 1ZC3A 4F46A 4GL2A 1F20A 1YUNA 2C4WA 3T7AA 5MHTA 2DFLA 4M37A 4AL4A 1ZICA 2P5YA 2Y1EA 3AOGA 3NIBA 3DZBA 1TKCA 1S8FA 2IYLD 3UGQA 2RI0A 1OBHA 3K0AA 4KMOA 3TD9A 2OORC 3L8YA 4C76A 1USWA 3GT7A 1HX7A 4DQVA 4XEHA 5FULA 1S6YA 4IOKA 3ZZ1A 5TJHA 2H5JA 3RNLA 4DGSA 1UFQA 3T1YB 5T4FA 3RARA 2XB9A 1UKZA 4FWIB 4FNMA 2GVNA 3P71T 3PSAA 2O5CA 3A9TA 4N7MA 1DQZA 3N0TA 3NQ41 4UTXA 2DFTA 2HJRA 4Q9IA 4XZ3A 4YMHA 1D1QA 3B9PA 1CZLA 2ZRNA 4P3NA 1DJQA 3TLXA 1MAAA 2EG9A 2VBCA 3H9UA 4AFNA 4DV0B 2DT8A 3LCCA 2PRJA 4GWKA 1U99A 4BFZA 1FTSA 2G1UA 3QE9Y 1EVLA 2E6KA 3H9GA 2COKA 3N3BC 1CFJA 3PPXA 4H7DA 3U26A 5MFZA 1KEEA 4FSXA 4NJOA 4OCZA 3P1JA 5D3QA 1YQDA 1G21E 3HI4A 1W88A 1OY1A 1ZD5A 2B37A 2HCBA 1CRZA 3KBBA 5EN4A 1WEHA 4IEIA 2NU8A 4R2XA 5KMGB 4KV9A 1WUKS 1NNI1 2WU8A 1G2QA 3ASVA 2I2WA 1VCNA 3ZJYA 2FG6C 3D8BA 5GINE 1HF3A 1CRWG 3OIVA 3RAFC 3ZPXA 3VDQA 2Q5EA 2WLTA 1IHOA 2FYTA 2ZBPA 3PGXA 3WR5A 4MPPA 4F3KA 5EINA 1DUSA 5EIFA 4E09A 1YBFA 4TUYA 5IVIA 4IGKA 4GNRA 3CNQS 4OHPA 1XYVA 1FW6A 5DCWA 2VJBA 3I53A 4BKOA 4C4OA 1N5MA 1ZUNB 1QWSA 1IN5A 1RMYA 3DFUA 3JPYA 3LBAA 3H5LA 2X76A 4D26A 4Q6WA 3KJGA 3G5TA 3SIRA 2C2WA 1U4NA 4BWYA 1OFIA 1UPUA 2V3VA 3EPPA 1D09A 2PKQO 5D86A 5C8YA 1WPGA 4YCCA 3AVOA 1C30B 2PVPA 4W6ZA 1NVFA 4F98A 4LW8A 1SNYA 1N8NA 1US8A 2VXCA 3MINA 5JSZB 4DC9A 3R6GA 1OA0A 4WNAA 4AROA 2JGDA 2P62A 1WABA 2FPPB 2W5UA 3GVPA 3QM1A 1G1AA 4YWJA 5G3YA 5KQLA 5ARCA 1QVWA 4JODA 5DB4A 5E0KB 1QHHB 4PAGA 4EHJA 1HNNA 4OGKA 4DLLA 1PEDA 4EPYA 2H2GA 3JCZA 5CCXA 1IBMB 4MS3A 3HXQA 2CSXA 1QH0A 2PTHA 3BSYA 5KTTA 3QEBZ 1BYUA 1NN0A 3DQPA 3ICWA 3K16A 3PGKA 3S99A 4DL9A 2V8OA 2Q3HA 3R7FA 1U9CA 3FDIA 1ZD3A 3P0RA 2C88A 2QTHA 3S5JA 6REQB 1QZZA 3R9WA 4ND5A 1IULA 2GF9A 3AG6A 4K9OA 2JD2A 3CEHA 5JCJA 5FWYA 2PIAA 4L76A 5AW9A 3COSA 2G72A 5KNDH 4CT0A 4ZYUA 2J45A 1ZRNA 1L6RA 1TJNA 4QOIA 4TVBA 4ZVLA 1D07A 3QIVA 3UGKA 1MIHA 2Q2OA 1VKJA 3GOHA 2YN4A 3MJVA 5F21A 2AOWA 4FB4A 2IVZA 2PYZA 3PXDA 1G3MA 4WKCA 1E66A 3DMFA 2WIAA 3G85A 5AKLA 1RI4A 1YR3A 5HNKA 3D6AA 3UK2A 2NZJA 1QNFA 1TTQB 1WP9A 1TCVA 3EW7A 1X77A 3HP4A 4H18A 5TGTA 3BD9A 3KHSA 4JXKA 4BAZA 4TKMA 4HH0A 1E4VA 1JAHA 3H8WA 4LJ8A 1PJ3A 3IBSA 1VBKA 1PO7A 4ZARA 5ESDA 3NHMA 3V8RA 1PQUA 1KPGA 1O77A 1V11A 4P3KA 4EKIA 1PNQA 2Y0BA 4UEOA 4BFUA 4ETNA 2V45A 5WRFA 4E2FA 2B34A 5FBKA 1KH1A 2Y1WA 4G24A 2LGJA 3H5AA 3UJNA 2Q5CA 1K7YA 2KWIA 2XOEA 4R83A 3M6XA 4RZIA 1UP4A 4FE7A 1VDZA 3BC1A 3CF4G 3NBKA 1YBVA 4YFVA 3VSBA 4K46A 3KQMA 4MUXA 1GPLA 2IWHA 2D7DA 4DJTA 5BSVA 3CA8A 2QQGA 4LJ7A 1WXGA 3MJHA 5EPOA 3VZPA 1IB0A 3EGCA 6PFKA 2G9RA 3NKVA 4MVXA 4OB8A 1KMNA 2QTBA 4PSUA 1B76A 2ZAIA 3M6WA 3PHIA 4MUIA 1KI4A 1YACA 2QIPA 3GFSA 3KLPX 4US2R 1EBUA 4RO0A 1D8TA 4KWCA 1XJCA 4FBLA 1FZTA 1ENZA 3EIXA 3G8CA 1PTJA 3LE8A 2JIOA 4L8VA 2YWDA 3QKSA 5F12A 4Y6LA 4D44A 3DE1X 4CL8A 1MAUA 2YWFA 1UQRA 1LLUA 3INYA 3SFVA 3UJ3X 1QO7A 3M3HA 2CB9A 4UHBA 1IJBA 5FO0A 5DNYB 4F60A 3IR7A 2ERXA 1Y3BE 1FTWA 4O1MA 3ZCVA 4EMBA 2JRLA 4I4CA 5HQ3A 3QHAA 1NATA 2BUCA 2VOJA 5LUAA 5C8YB 5ENVA 3MAAC 3B7WA 3NHLA 4CMKA 4M9ZA 2FMUA 3ZFOA 3C3AA 1TVKA 2IE8A 3SZGA 1X8JA 1F3LA 1Z2PX 2P9JA 2ZUSA 2NP7A 3AZPA 2BT4A 2OHVA 1PTKA 1KAEA 2UYGA 3AXTA 3NBYC 4CIDA 2JLVA 1WSAA 3PFGA 4MLPA 5DCYA 4EARA 7REQA 1M9NA 1OWPA 1VJGA 1ZYUA 1QRUA 3F6YA 1Y5IA 3OCJA 3WGZA 4NBLA 1LY1A 2QGZA 3SM3A 1Z62A 1NYTA 1DV1A 4LHYA 3N8DA 1W49A 4NARA 4CI0B 1BD4A 1YL5A 5IDQA 4RABA 5MDHA 3FOAA 4QPPA 3RVDA 1JI3A 4MHTA 3NBMA 1QBKC 3SIWA 2JHGA 3R2JA 4ZV4A 5HHTA 3FLBA 1QAOA 5J4KA 1HM5A 3BGDA 3GVXA 1T2DA 2O3UA 5EIHA 1FS5A 5KJCA 3RUCA 3JRXA 4NYMQ 4CMEA 3FUVA 1V95A 5IN5A 4WBXC 3C3WA 1WMFA 2YIDA 3DE5X 3AUSA 3AR6A 3HB9A 4JJEA 4Z54A 3Q3EA 3U17A 4M8LA 2KE5A 2PH7A 4N49A 5ER9A 1N7HA 4AIRA 2OGTA 2FDCA 4UFNA 4P0TA 3NRBA 4ENQA 4WWHA 1E1RA 1RVDA 1HQCA 1QWOA 2BTQA 2H1OA 1VG0B 4LIPD 1GP2A 3B53X 4Y9RA 2BEJA 4XB6B 4C7OA 4P3OA 5CDTA 1BAPA 2PGAA 3I5AA 3SYNA 3MQ4A 1AGXA 3A6DA 4ICIA 1QDEA 4QGSA 2PUCA 3ABOB 2RGCA 1VKNA 3RREA 3I5MA 3QA9A 4GKJB 2RHBA 2W83A 4LJ4A 1DTWB 1SKYE 3IO3A 3D3EA 2WWRA 5AJXA 1ST2A 2NUPA 2GAFA 1AF4A 1ZN9A 2D5LA 4PAWA 4CCSA 2F8LA 2B94A 2IHJA 2IU4A 2WM3A 4O4LF 1QQTA 2YINC 4WLNA 1R3UA 2FZEA 4JU9A 3PJEA 4MGKR 4Z6KA 1KWKA 2I3GA 1BE6A 4OSOA 4H3KB 4LC0A 1JG3A 2HNBA 3F1LA 1CCWA 3IO5A 3G2LA 3MRSA 4AO7A 1XRQA 5KJEA 4BQNA 1LW7A 4LJAA 4BTVA 4ZZ1A 1PVDA 3AKYA 5B7QA 4REOA 1NMQA 3AFIA 4HDKB 1OBCA 2ARKA 1SOWA 4RFVA 4NS4A 2B0CA 2BP7A 2G7MC 4PLWA 3RC9A 2OO5A 5FHQA 1GPWB 1KFCB 3OZDA 4Q39A 4ARZA 4BJ3A 1A9OA 3AB3A 1LC0A 3EIOA 1SUWA 2C54A 2JFNA 3QVGA 1VFNA 4Y0AA 1RRCA 1RRMA 2PH3A 1I2BA 3MJTA 3LA8A 3MJEA 4HB4A 5FI5A 3RSSA 3HUNA 1FYWA 4KXFB 1DOHA 3BT7A 4KWHA 3P9NA 1FP1D 1QXSA 4EY3A 4RTLA 2GNPA 1JG1A 3SQLA 3L43A 3ISJA 4B4KA 3P19A 4LY3A 3IUBA 4IJKA 2H54A 2I8AA 3PXCX 2OR3A 4O3MA 4W9RA 3UXEA 5G02A 1R16A 4M98A 4U39A 5D5HA 1VYTA 1UM8A 1C41A 2OC4A 5J4VA 1KQGA 2WYWA 2ZK7A 2DHEA 3EZ7A 3LQKA 2PR2A 2Y27A 1MX3A 3WO1A 2XWSA 4EDFA 1SULA 3B51X 3AF6A 1B0PA 1DQYA 3N75A 4JC8A 2ZG6A 1D03A 2JGIA 5DNVA 1ZKDA 5EE9A 5FWDA 4CKWB 3AXSA 3FCCA 2LZ0A 1KAHA 3ZZUA 3I9JA 3FIJA 1EFKA 2AZTA 1XTPA 2UYQA 5L3RA 3RFTA 4HVLA 2OCPA 2XKJE 3D8UA 1BROA 3DR5A 4M7PA 3EVGA 4HLNA 1QHYA 4YT5A 4QICA 3S29A 4AKTA 2HWKA 1PJBA 2LKDA 3T34A 3X1JA 4C3UA 1N5IA 2JZCA 1GN9A 4K2AA 4PRKA 2NSJA 1KZGB 3CRZA 4YIHA 2HQ1A 2EJCA 3KTAA 3MFQA 4UU7A 4R8KA 2PSJA 2O1XA 1Q7BA 1UC4B 4MWBA 3KL4A 3MTDA 3PNMA 1X1DA 5EC8A 1Z33A 2E49A 2XQKA 1ZOPA 3A1DA 1R27A 1YVEI 2QP3A 3W8EA 1Y9DA 4I55A 3RRJA 1KBOA 3GRRA 5JDCA 3EPJA 4FEGA 3HJRA 2VK1A 5AI5A 2Q4OA 4BVJA 3VNVA 1T29A 4D96A 3VR5D 2CL5A 1SCAA 3NBFA 3VUEA 3RSOA 1Y9ZA 2Z5FA 3EK2A 3WOVA 1W59A 4CETA 5KPDA 2KJQA 1QONA 3PXXA 3R6LA 2DPHA 3F3YA 2QE6A 4Q9KA 4C2TA 5T3YA 2ALJA 3L4KA 1GUZA 1K2WA 1UXJA 3L7OA 3R0IA 4JNKA 4N8DA 4MEJA 3U7EB 1FRZA 1YA8A 2GN1A 1IB6A 4IXMA 4EMTA 5FH9A 4RD0A 3GJ6A 4KRXA 4QQNA 5E4JA 3S5UA 1IL0A 2YHSA 5BSKA 1PV4A 1YR2A 1YAHA 5TARA 4UDYX 3D7RA 5F73A 5BRNA 4B2IA 2ZIUB 4KLNA 1L7PA 2REQB 4DAOA 4X44A 4LMAA 2DFPA 3Q7QA 4RY0A 5ALKA 3L46A 2HO5A 2F9FA 4K0KB 2C5GA 3H16A 2ZYAA 4P3PA 2BEWA 3A3NA 3OHMA 2G70A 3EEQA 4UQOA 2P1RA 3WLQA 2AN4A 4G26A 2DF8A 4C3OB 2PGOA 1E99A 3DLTA 1JA0A 1Q7EA 4PG8A 1GU1A 2QORA 4A6DA 2PR7A 1ZQ1A 4QJBA 4KWIA 5IANA 3F4LA 3KDSE 5IPFA 3VR6D 2XGMA 5DWDA 3M6FA 5D3KA 1PZGA 3IP9A 3OVMA 3EVTA 3RASA 3NNSA 2N46A 3B5IA 2GRAA 3AR9A 3H3XA 4WRRA 2OY0A 4HAOA 2IXEA 3RANA 4IR7A 2OECA 1T35A 1G19A 4FHGA 1ESNA 5D3MA 1GNPA 2EJBA 1JPVA 3ZNPA 4EI7A 3EDQA 1SVKA 2WF9A 4NJEB 5ALWA 3VMMA 3WZMA 1EESA 4QRHA 2OO3A 3GUVA 4YQZA 2IV2X 3FPJA 1M1XB 5KYWA 2GZ1A 2I6XA 1U7TA 5L8VA 3QU9A 4M9XA 4OQLA 3RK1A 4OI0A 4Y9SA 1X39A 4LMBA 3ZZNA 5FOQA 3MHPA 1L1EA 1K3TA 2G67A 2YYZA 5EXPA 3Q7EA 5K8TA 4MKHA 1T9AA 4NKRA 4DEXA 3NOVA 4O3FA 1K08A 4KSYA 4NZYA 1QPGA 1GZ6A 2W2OA 4G97A 3N59A 3S4YA 1XCLA 2IPNA 3V8BA 2FEXA 3AGQA 2CUNA 4C89A 4CM9D 3GIWA 3E9CA 1IVYA 4HK4A 4F96A 3U16A 4LXXA 1SOAA 1A1VA 5CYOA 3INNA 4F85A 2B4TO 3WRYC 1H8HA 4BV9A 3LUCA 3C3PA 5BY2A 2PAFA 3LQ2A 2XA2A 4QGGA 4EO9A 4RSMA 4KXQA 4CV0A 2XA9A 2EOAA 3I8OA 3T1OA 1OXUA 4L5AA 2VWPA 4R9NA 3R7BA 4DTCA 3KETA 1CUJA 2BR3A 3KELA 2ZU6A 4WT7A 3OMXA 2G1AA 1EMDA 3KC2A 1U3VA 2QENA 5FBWB 1GQ2A 2JGMA 3LKZA 3LQ1A 5ADVA 3CEPB 1SK9A 2OCLA 2X23A 4ZQGA 2PMDA 1W5TA 2CXUA 1UM9A 2EKLA 3AQIA 4CUZA 1YR1A 2OCXA 3C3XA 1TK9A 2A7XA 4LDNA 4PYRA 1AMNA 3G49A 5HFNA 3DYIA 4UXIA 5G4KA 1F8FA 4HXYA 1YZKA 4XIGS 3E3MA 2OESA 1PJ8A 1SELA 1N0IA 4MVCA 1Z4LA 1PYGA 5FORA 3I92A 2AGVA 3SQWA 1HOXA 1CUZA 2O7NA 1LCIA 1HZZA 1O0SA 1TM7E 1WVMA 1EJBA 2D0PB 4JSTA 4AW9A 3PITA 1M8PA 3SK0A 4HNRA 1F2TB 1ZUWA 1WF6A 1ULSA 3DGFC 3VR3A 3KQSA 2CLHB 3CO0S 4J9UE 2FPLA 1E8NA 3MNFA 5GY7A 2HQBA 3FBGA 3NGXA 4UBIA 4AIIA 2C5FA 5CNIA 4IUCS 4B17A 4JV5B 3HJTA 4MS1A 1JHOA 4N6NA 3NOXA 4LSGA 1ECBA 1JHZA 1L8AA 1Z4JA 1KEWA 2NXCA 3FPKA 3O3NB 4HFNA 1GEGA 2DY1A 4QUJA 1XELA 4BLSA 5CD9A 2F1RA 4O59O 5A9SA 4A0SA 1G64A 1M2WA 1YASA 1IU9A 3ROKA 3T7CA 4ZTZB 2OAQ1 3RUPA 1JTEA 3CJRA 4S0ZA 2O6HA 2XT6A 3SX0A 3DBRB 2O8VA 4EYEA 1K9SA 4Y2VA 5ALTA 4KQ1A 1A50B 4DY6A 3DG9A 4F3RA 4I4TA 3IUPA 2JAPA 1JDBB 1N2EA 1XSEA 1Y9AA 2PZAA 4L0MA 1EWQA 4CBVA 3R75A 4W5WA 3CW9A 2K7FA 3LECA 5EWLA 1P1JA 1UBFA 1FSPA 2FDXA 2ZAOA 1J33A 4LNHA 3IURA 3MWDB 3B1KA 2NO4A 3OOSA 1NLFA 4WD3A 3RRFA 5KREA 4FMDF 4GLOA 1JAXA 2G17A 4BNZA 4BLUA 3D2BA 1VPEA 4Y1RA 1CS4C 3G13A 4W5QA 3LX8A 2VNAA 3VC2A 2AW3A 3TTWA 3HO1A 4TS4A 3I6IA 2A30A 4FT2A 4HAUA 1KHTA 4MKXA 3QEMB 2GT1A 1LNSA 1W1IA 2ZLBA 2GVZC 3E1GA 3QXXA 4IO1A 1IXKA 3E7FA 4UC0A 2ILVA 4W1PA 5A9TA 4DLPA 5F98A 3FOCA 1CNFA 2E7ZA 4V0OA 1NVAA 3PC4A 3SX2A 4L7QA 5CNMA 3X43A 1TTHA 5B64A 2LCIA 1Y8CA 5EHZA 5KSWB 4YJ3A 1ZSVA 3ZEAA 4WK4B 5KBYA 2ID4A 4YLYA 3GJQA 4RM2A 4YMVA 4FIDA 5CB4A 1NVGA 3I3OA 2C0CA 2ZUVA 3CISA 3O4IA 2FPRA 2E4VA 3W6OA 5DNCA 4EVRA 3WWYA 4OP1A 2WNHA 4GYJA 2J9YB 4ND8A 3SXUA 3FGNA 4GLJA 1ZIPA 4TMWA 4EYKA 1FDSA 4JLWA 3WV4A 1W85A 2EKPA 2ZITA 4XD7A 3GGPA 3GJ4A 4DA4A 5EP2A 1WAMA 3W05A 4DUGA 3CBGA 2H29A 1A7JA 2WAMA 3DPSA 1I4DD 4GI2A 4X54A 2JH8A 3KVRA 4YYZA 3ZQKA 2QD5A 3FETA 1IN8A 2PM8A 2HUNA 2YBEA 1B14A 2C8KA 1XWWA 3DO5A 2NSHA 3PE3A 2HLNA 4H7KA 4TGLA 5AVOA 4B7XA 3OIDA 1D2CA 1A76A 3C7KA 1N2XA 5INTA 2OBFA 1H0KA 4JS0A 2YZ2A 4K6MA 5E1BA 4DCVA 4MV7A 2YZMA 4GLBA 3VOBA 4DADA 3TEJA 1KY4A 1TU3A 2Z3VA 4DLXA 2A3NA 2IU6A 3IAM1 5CH8A 4W5RA 3F71A 4HAIA 4B45A 3AR7A 4AY6A 3O3OB 1SUFA 5A03A 5ALMA 3RW9A 1XALA 3HR8A 1UAAA 1I5OA 2UVPB 5FO1A 1TPYA 1XK6A 2G7ZA 4N4AA 4OJYA 1KE1A 8OHMA 4RY9A 1KAMA 3RYCB 1NW7A 3CCBA 4CE6A 2BJHA 4QXOA 1RLJA 4E7OA 1D2RA 3ZIUA 3P27A 5LP1A 2CHGA 1PG5A 2VCHA 3KOXA 4X91A 2FP4B 4UZFA 1LZKA 1VL2A 2PD3A 5EKTA 4X41A 3K0EA 1EX7A 1WTAA 3KOMA 4GC9A 3KS9A 3OZSA 3QX7A 3A3KA 3LV8A 4MUYA 5A05A 3PHLA 2RMKA 1LWOA 5TRTA 1HE1C 2VPTA 1X9HA 3EZLA 2G80A 2GN6A 1K7EB 2X3UA 1T3SA 2G36A 3PWZA 3VOSA 2IYEA 3K70C 2JH9A 3JQDA 1ZNZA 4WA7A 1VMIA 3IHLA 4FYIA 4PICA 4MQ4A 4K2HA 4ENRA 1J1UA 1A8UA 3IOBA 1AQNA 2B8JA 4MGEA 3FTEA 3DFIA 4LHEA 2E4WA 2Q5QA 2XVAA 3I04M 3TR5A 2X5JO 1V5IA 1ZJJA 4K28A 4OBBA 4HSEA 1P0PA 3CEAA 4GRIA 3S2UA 4EGSA 4V02A 3WGUA 5KNBH 2FLVA 4L4YA 1DO0A 4DG5A 2P2SA 5E1MA 1K3FA 4L08A 4UREA 1PT8A 4LXIA 1AGPA 2CLDX 3IHTA 2VSXA 1ADBA 4MRMB 1FFGA 2GFHA 2WM8A 3R77A 4OIMA 4XLLA 3GRKA 2DWPA 1DKUA 1X42A 3JQGA 1MZVA 2VQFB 4PR3A 1CVIA 1K2VN 2ZYIA 3EIWA 4TZKA 4IIJF 4B35A 1QF6A 3II6X 3TAHA 1RXCA 4UAUA 3SF0A 1B0ZA 2CJWA 1ISPA 2HRQA 3P9ZA 2AN1A 4GSYA 2XD4A 3F2VA 4OAPA 4KYIB 2V5AA 4X84A 2FSGA 1OYWA 4AP5A 4MWDA 4B34A 2X15A 3FYSA 3F7TA 3IUYA 1ONPA 1FEZA 1B74A 2ZRHA 3CVXA 1HKUA 1VBMA 1TRKA 3H1AA 3R6WA 2H9AA 4FFVA 3BEOA 3KM0A 2IUSA 2RJ3A 3LZ6A 1DDGA 3HZOA 1COWD 4KRYA 1WV1A 2ZUTA 4FHEA 5EJGA 3IAXA 3UMRA 1W87A 1YDGA 2VHWA 2PLRA 2OCDA 2WMDA 5TX7A 3T5DA 3D5TA 5HWSA 3A14A 4K9QA 3HA5A 4DR1B 4JBLA 4EG1A 4H27A 1TJ3A 4II3A 3CH6A 4YYEA 3MA0A 4HVCA 4Q4CA 3NC4A 3FNFA 2ENWA 3IUQA 3BFPA 2BEUA 5K3FB 1SCKA 2CFIA 1C9DB 5H9WA 1PIWA 3AUAA 3QF7A 4MIEA 3PU6A 4PLZA 2PMCA 5JCJD 4IDEA 2ZJAA 1W47A 2VQDA 3CF6R 4N9QA 1GPMA 3TW8B 2AI1A 2WWHA 1LPAB 2H5IA 4R6XA 4YDSA 3B9BA 2I4MA 1X7GA 4NEQA 4A92A 3OQ6A 3AY0A 2A0WA 1K9VF 2NACA 1MB4A 1Z2EA 2C31A 3IT0A 1SD2A 4XE5A 2DTXA 3SSOA 5JNLA 2PX2A 3ZGVA 3SOZA 1L7XA 1W52X 3GFQA 4ON9A 5HRCA 4PSCA 2UDPA 4HAWA 4RELA 3THWA 1E7SA 2UXDB 5HMLA 4ZXPA 2WB2A 4J3JA 4KLAA 1QKIA 5B30A 2BHRA 5BVHB 2QNRA 1G3QA 4DMGA 1EM8A 1TM3E 5G4LA 4DKXA 2G63A 3M3PA 1PX2A 4AJPA 2OSVA 1OLSA 1GRNA 2Y05A 4JQSA 4OMCA 1JJIA 5CX4A 2FSHA 1N92A 5F4ZA 4NP6A 4OVKA 4W1SA 5DTIA 3WLPA 5AW4A 3CS3A 3KQTA 4RMNA 5JANA 3KPVA 2B30A 1ZAKA 4J16A 2CNDA 2OAEA 1KR2A 2XRMA 2G71A 3OX3A 4NU0A 3U37A 4CDRA 1FP7A 1SKYB 1Z2AA 2W2PA 3PS9A 5CCBA 3RVRA 1G7CA 2QPOA 5TQJA 2O2XA 1L3IA 4QDZA 5FWXB 4X7PA 4Y6SA 2A58A 2RGUA 4O1IA 3HDJA 4ZCLA 3WYFA 3FIUA 3GCXA 1BXRA 3WMFA 2C2KA 4R9VA 4B6SA 3BGVA 3DPUA 2JG3A 3TLBA 3T5GA 5E1DA 3MSCA 3RJ5A 1ZVVA 3FJ1A 3ZFRA 4HAXA 1PP4A 1S0UA 1TAQA 2WUEA 3KYCA 5EWMA 3L8EA 1QO9A 4RY8A 3W9UA 3G1WA 1FQKA 3NTXA 4YRKA 1U7DA 2QVYX 4BQIA 4FN5A 3A6FA 3N8KA 2R8BA 3PC8A 4RDIA 4X20A 1ZGHA 2SCUA 5A0VA 3T99A 3RHSA 4B3IA 1FF9A 3C4VA 1YZTA 2ZSEA 3KZ1E 3O1LA 1YDHA 2VHVA 5EUQB 5GGXA 1UCFA 4O0MA 4D3YA 4OB6A 3ROPA 1T34A 2Q2QA 2CFTA 2XMDA 4V0MA 2Z2IA 5BQ5A 3AIMA 3GLIA 3DLCA 3D3WA 1U6KA 1U5BB 1WCXA 2QS9A 4FLMA 4G5RA 1I3LA 1NVVR 4JJZA 3WVNA 2UUAB 5DWVA 2FXVA 4RXMA 4ZYTA 1YQQA 3RWOA 1PS0A 3VSEA 4UVDA 5F2NA 4WZZA 2AC4A 2LNDA 3WHIA 1WKVA 1EK0A 4JLDA 4UZEA 3CWQA 2JJ8A 2VJMA 3D6FA 5F5LA 1SZDA 3PRJA 4RESA 3TLJA 3ZV5A 1G9TA 1ZM2A 1CQIB 2ADOA 1WR8A 2QROA 4LQDA 3WL4A 2F90A 1KO8A 1L7RA 1AURA 3BK2A 1BD3A 2H57A 3QLTA 4V0SA 3ZDBA 2YASA 4XWAA 1U9IA 1WSBA 4QHYA 2FFQA 3L01A 1GITA 2CDRA 3OJ0A 2GUGA 1YR6A 3A37A 3BDAA 3M4JA 5J5VA 1RHUA 5SYMA 1JHDA 2GHIA 2IW1A 1KMHB 4EB3A 1RZVA 5KOJB 3PGA1 3ZIAD 1I0LA 4FTWA 5AK4A 3QBTA 3L8DA 3C14C 3RFUA 2IYAA 4P98A 1XDBA 1Z15A 1XMIA 4UHCA 5IC6A 3HBFA 3ZWCA 4D1YA 4TSFD 3QE3A 1C4KA 1J42A 4U6QA 2YY7A 4F91B 1G9XA 1HZJA 1HNZB 1VL6A 2EBHX 3BS4A 1DP4A 2CD7A 1JF8A 1TK3A 2BGIA 3EVDA 1CJKC 4L9WA 5KHOC 3KNZA 5E7IA 3PHHA 1CJVC 1QGAA 1TJ4A 2G06A 2DPXA 4MYDA 4WADA 4WLVA 3SLKA 3ZDRA 4B6RA 5DFAA 2I2XB 4EI8A 4D92A 1INLA 6Q21A 3TR0A 2ZSDA 2JK0A 4ENSA 2R00C 3KYCB 4GOLD 5EWMB 4YRJA 1V25A 3Q98A 4URVR 1LBIA 4PGAA 2VP9A 3MZ0A 1C4WA 2QG6A 3DL7A 1KVSA 1QX4A 3N86A 4C7BA 1QP7A 2IOFK 4GR9A 5C1OA 3KLMX 4AU1A 3F47A 3I8SA 1JBQA 2KB0A 2PK3A 2A33A 4KI7A 1E5DA 4NYIQ 2A0UA 1Q20A 2IBMA 4DLVA 1OXSC 1SCQA 4JC5A 2JHCA 2R751 3BJIC 2CMDA 3DLIA 4PBRA 1SC9A 4OATA 1MRSA 2B7BA 4M54A 1E4EA 2FWNA 4PX3A 1J7KA 2IBSA 3WJ7A 4KQJA 1RPAA 2X3YA 3CX7A 4WN3A 3G9UA 1VE3A 1DAEA 4IF4A 4HNGA 2V58A 3K8YA 4W7HA 5FA6A 4F6RA 4TV9B 4H0NA 1ZK1A 3HKDA 3O4RA 4RHXA 3IRUA 5J2TF 3EXEB 4B79A 1YZGA 4I55F 1Z08A 5T6MA 2Q5HA 1F4PA 1KORA 2D2XA 2VUSA 1V1JA 3OLZA 3PRYA 4TSFA 3W2EA 2R97A 3RYFA 2XTNA 5M5BA 4ZICA 4LFCB 3N7AA 2EQBA 3GPIA 4DIOA 4J94A 5KVAA 4RORA 4OQDA 2WC1A 3V3KA 5C9ZA 3OKAA 1IM8A 1RRKA 2Q1WA 2EYQA 3C3EA 1MAWA 1Y8RB 2FMIA 3GP8A 2XAUA 1WBDA 1VB3A 3O4JA 1FDWA 2ZIXB 3IQWA 3L07A 1NKSA 2HGZA 2Q3MA 4B7AA 4GM4A 1VIMA 1ISGA 1FMFA 1U3WA 1S7GA 4GMXA 5A5GA 2ADMA 3GRYA 1FSSA 3FMIA 5HBRA 2C59A 1GGNA 3MILA 5DEIA 3U44A 4DW8A 4IINA 2WF8A 4NATA 3ZDXB 1PFUA 4I9FA 4JN6B 5LBUA 1GPYA 4KXNA 1DQPA 5F23A 2BFOA 2A9JA 4RLHA 2PJRA 2GPAA 4LF8B 1AHPA 2GD6A 1EG7A 2A7QA 3HACA 1DCKA 4JVSB 3TN7A 3TW8A 3V97A 5CFZA 1J8FA 3BFVA 2R48A 3CKYA 3OFJA 3GDGA 5BSTA 3AVYA 3VV3A 3FFAA 4YJHB 2G83A 4WL0A 1C5KA 1E2UA 3CVJA 2BLNA 3EEBA 3F67A 1IUPA 3QU2A 4Y2GA 4YXWA 1UBNA 5BN3B 6CHYA 1YB6A 1UKBA 1M83A 3FPGA 4L75A 2WOOA 3F46A 3P45A 3HB0A 3MYYA 1XVAA 3WLTA 2YQ4A 1X92A 2QGFA 1P6UA 1Z35A 5HOQA 5JQGF 1W0JA 4AUNA 2P2GA 3U56A 1XCMA 1Q16A 2P67A 2C57A 3A0RB 3AIIA 2A86A 1FNNA 1YJ5A 4FUTA 4YR9A 1V48A