4RQAA

Crystal structure of a hypoxanthine phosphoribosyltransferase (target id nysgrc-029686) from staphylococcus aureus (orthorhombic space group)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
181
structure length
176
Chain Sequence
b'MNSVMHNDLKEVLLTEEDIQNICKELGAQLTKDYQGKPLVCVGILKGSAMFMSDLIKRIDTHLSIDFMDVSSYSTGEVQIIKDLGSSIENKDVLIIEDILETGTTLKSITELLQSRKVNSLEIVTLLDKPNRRKADIEAKYVGKKIPDEFVVGYGLDYRELYRNLPYIGTLKPEVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxanthine phosphoribosyltransferase
molecule tags Transferase
source organism Staphylococcus aureus subsp. aureus
publication title Crystal Structure of a Hypoxanthine Phosphoribosyltransferase (target ID NYSGRC-029686) from Staphylococcus aureus (orthorhombic space group)
rcsb
total genus 54
structure length 176
sequence length 181
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2014-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rqaA00
1I13A 1I14A 5KAMA 3H83A 3LRTA 4MB6A 1L1RA 1QCDA 1O57A 3LPNA 5EUCA 2IGBA 1STOA 1I5EA 1PZMA 4X45A 1R3UA 4RADA 1A98A 1Y0BA 1G2QA 1QCCA 1WD5A 4WN3A 5ESXA 2DY0A 2H06A 4P80A 4IJQA 1VSTA 4RQAA 3QW4B 1UFRA 2WNSA 1L1QA 1ECGA 1Z7GA 2JKYA 1NONA 4P3KA 4RAQA 1LH0A 4RHUA 1P4AA 3ACBA 4P84A 3OZGA 1HMPA 1DKRA 4RANA 1QK4A 1U9YA 1BD3A 1G9TA 1UPFA 4RHTA 1YFZA 3NAGA 3ACDA 4RABA 1A4XA 1OREA 1HGXA 1QB7A 1XZNA 1JLSA 4RHXA 5BRNA 1GPH1 4P82A 2AEEA 4LZOA 1A96A 3HVUA 1OROA 1P19A 4RV4A 3OZFA 4OHCA 1W30A 3ACCA 4M0PA 1XZ8A 1BZYA 1UPUA 4RQBA 4RHYA 4X44A 2H08A 4JLSA 3DEZA 2GEBA 2VFAA 5K51A 1DBRA 1BD4A 5KAPA 3DAHA 4P81A 2FXVA 1XTUA 2JI4A 3EFHA 1ZN9A 2YZKA 1V9SA 1GRVA 4KN6A 1A97A 3MBIA 1QK5A 1D6NA 2JBHA 4M0UA 5JSQA 4M0KA 4ZFNA 4QYIB 1ECFA 3GGJA 2PRYA 4PFQA 5HIAA 5IAOA 3MJDA 1A95A 1ECJA 1VDMA 3N2LA 1JLRA 1G9SA 4RAOA 1OPRA 3KB8A 1G2PA 1ECBA 4LZAA 1DQPA 2P1ZA 5BQPA 4QRIA 1MZVA 2EHJA 3DMPA 4LYYA 1O5OA 1TC1A 1ZN7A 4WMLA 3S5JA 1XTVA 5ESWA 2H07A 1FSGA 1QB8A 1P18A 3G6WA 5BQOA 4RACA 1IBSA 1I0LA 1I0IA 1P17A 1A3CA 2PRZA 3GGCA 1NULA 4TWBA 5JV5A 5E38A 5BSKA 1U9ZA 4PAWA 1XTTA 3OHPA 4QYIA 1QK3A 4JITA 3M3HA 1ZN8A 4P83A 1DQNA 2XBUA 1CJBA 2E55A 5HKLA 1TC2A 2HCRA 3O7MA 3GEPA 1J7JA 1VCHA 4F8EA 2PS1A 4LYGA 2JKZA 5IPFA 2C4KA 1ECCA 4P86A 4Z1OA 4LZNA 4S2UA 1DKUA 1AO0A 4FYMA
chains in the Genus database with same CATH superfamily
1YC2A 5G0TA 1PE0A 4PCLA 3EDQA 4EITA 4TT3A 1KO5A 2FZGA 4ATNA 5JH7B 2PCLA 4L8WB 3I09A 5AVRA 2ZM5A 3KHSA 3H0EA 2XAUA 2BGGA 1ULHA 2Q5FA 1FY2A 2A1TS 2JGEA 3HCBA 4IIDA 4FB4A 5BN3A 4GLOA 1Z37A 3WZ2A 3AUJB 4DC0A 5K2MA 1LJ8A 2OXCA 4P7JA 4B45A 1SXJD 2C9BA 3TX2A 2LE0A 2VQ6A 4WNAA 1T5BA 4JT2A 4ND1A 3AI1A 3TM5A 1QRUA 3ORRA 5GZ6A 2ZB3A 3A1FA 2DUUA 3EIOA 5J63A 4NAUA 4JI7B 4R81A 2YJNA 3S8MA 3KTOA 1NT4A 1OBCA 5ITZA 2PSDA 1P62B 4QHSA 2R8EA 3NUGA 5D85A 1X70A 1QQAA 2Y27A 1IDN1 4B73A 2H9IA 1EB9A 1UAGA 1IQRA 1ZH4A 1E9EA 1LK7A 4N3NA 4AT1A 3G2LA 4LQCA 5HG0A 2XD9A 1G3RA 4I1YA 1KYQA 1ESCA 3BAFA 2VH5R 3FWYA 2PGXA 4DSNA 2VXBA 3MB5A 4LC9A 4LY3A 5BRNA 2QVCA 1UMCB 4RV4A 3EFBA 5JJBA 2ADFA 3IEKA 3EXFA 5E6RA 3DE5X 2Z2XA 1C7EA 3P2IA 4D4JA 3AUFA 1C30B 1DTEA 3EVTA 1Y6GA 3GMTA 3AWDA 1T2VA 1GTZA 3TGLA 3SN6A 1G5IA 2PM8A 3OJEA 3P0FA 4YMIA 1D2EA 3BFXA 4MW6A 4WCDA 4XE5A 5H02A 5BQFA 2F4VB 3KL2A 3X1MA 4UEOA 4JOCA 5LKRA 1GCUA 3CEPB 4ZAYA 3X2SA 4LF4B 2EWVA 3FSEA 3KXDA 3R6GA 4OA5A 2NM0A 7REQA 1Y6QA 3OIWA 2CL6X 3HBJA 3P94A 1WVMA 3PYLA 4NEQA 2PPLA 1AMOA 3JQDA 4WGGA 1NDUA 4Z9FA 3JQBA 1UBNA 2Y0BA 1ZM4A 4DQUA 2COEA 3ZX4A 1IRXA 3N8DA 1PWHA 5E7JA 2OCKA 2AX3A 4BGDA 2TMKA 2E6KA 2OK8A 3L07A 3KTDA 3CPHA 1TT5B 4KWIA 3IHWA 4R3UC 2PNJA 4BC1A 2HL6A 2YQ5A 4LYAA 3TR0A 1NJ2A 1R10A 1A9XA 1U7PA 2NZJA 1QZ3A 1FXWF 2D5LA 4ZU3A 5J4LA 2GWHA 3RVBA 3JQ7B 1KOLA 3BIWA 1EXMA 3L1VA 4N8EA 3WDLA 2R85A 5BQOA 4D9FA 3RKUA 4F06A 1FDOA 3GLVA 2WHXA 2CLCX 3IQZA 4AS1A 4GU5A 5JS8A 3P9IA 1QCYA 3GGCA 4A92A 2NW6A 3AQ4A 3L6EA 1CEXA 4EIWA 4QKQA 5KJFA 1X14A 1JFFB 1G7TA 4I50B 1P0PA 2AT1A 4K3UA 4MRPA 4NBSA 4U02A 2V8OA 1MVNA 2O3JA 3AOEC 1MOZA 5JPIA 1K7CA 1V8PA 3K3PA 3IDSA 1J9ZA 3FTCA 3ZHRA 1PBTA 1SMKA 1B0UA 1WQ1R 2CXOA 3LNTA 1G2OA 3D5QA 4XXHA 4FOLA 4FE3A 1IOZA 3FDZB 4UNIA 1FRQA 3FMGA 4CEJB 4RJJA 3RSSA 3A7EA 3RWMB 1ZH2A 4INOA 1IBRA 3RT9A 2HZ7A 5MN4A 3COJA 4B2IA 4KWCA 3C3KA 3R4CA 4YGYA 3RRFA 2QIOA 3PDJA 3PPVA 4KWHA 3GMDA 2YRWA 2C7VA 3ILXA 1MDFA 4IRUB 2VWQA 1FFXB 1FLAA 1KVTA 3P9QA 4IDEA 5CJPA 5HEKA 2BEWA 4L95C 4QG7A 2XXAA 1QE3A 4Q1VA 5GINE 2AF3C 2BFFB 2GETA 3CNQS 4GPIB 4PFKA 5DT2A 3FFTA 4ZPJA 1VP3A 1PJLA 4L4YA 2CBGA 4WPGA 3TRHA 3WWZA 2O0MA 5JQWA 2QTZA 4Y0AA 3L0SA 4Q6WA 3A27A 1HNZB 2BM9A 4E5SA 2RKWA 1JI0A 1ZNQO 2WIFA 3PNVA 3FG9A 2AFIE 2YASA 4N4AA 5ED4A 1KEWA 3MWEB 1CXZA 3T9FA 4RTLA 1NF9A 1EFPA 2OOKA 1VA4A 4IICA 4DB2A 5AJZA 1BOOA 1NJ8A 2OMEA 3AR2A 1EFTA 5L8VA 2V98A 4EPVA 4G1BA 3ZHCA 1KVSA 3VR5D 1EVIA 4I08A 1ZAYA 4GI1A 2I5PO 1KMHB 1KOFA 3A6ZA 3DBHA 3P9NA 3GFBA 2HMUA 2WVHA 5LN1A 1QVZA 1EDEA 2OORA 1TMYA 1ZOPA 2HR1A 2HKIA 5CLQA 1H2XA 2Y8EA 3K32A 5K01A 1RC8A 2Y1GA 3PQ6A 4LJKA 3W5DA 3H97A 1ORWA 2YDYA 2BKEA 3WL4A 1U1EA 3DAHA 4O1MA 4DLXA 1G5QA 1QP8A 2BSXA 4J6EA 3SSOA 1DUIA 4B3BA 5HX7A 2H4ZA 2FW0A 2WAOA 2OD2A 1FNDA 1Y89A 1Z74A 1SUWA 3GT0A 3LT1A 3MXOA 5HBGA 2AR9A 3ANLA 2IOQA 3OLQA 4QASA 4RLQA 5AK4A 2ERCA 3E1SA 3UN1A 2CV1A 2H3HA 4I4NA 1Q15A 1RAAA 2HTFA 2NV2B 1N78A 4MP8A 1C8KA 4YIKA 1NLUA 1PNQA 2OAEA 2W37A 4YDSA 4AUKA 4DL9A 3RRJA 4LDNA 5IX8A 4G0VA 2W98A 3EVGA 2VRWA 1NJSA 3KLPX 3ZWDA 1PK9A 3EBLA 1Q92A 3KQSA 3U7IA 2PFSA 3SBOA 2IUFA 4E22A 2RGRA 1JPVA 2FJPA 4G4IA 4IOLA 1E3JA 3AM5A 4RACA 3IX7A 1GU7A 1M2KA 5AM1A 4BO0A 3HCFA 3AR4A 3B6KA 1T4BA 3TO5A 4HZUB 3ER6A 5T5QA 2VDMB 3B6MA 4JKIA 5E9JA 4GKVA 1NBWB 5HMMA 1GPWB 3BMNA 1I51A 2P6NA 3EVAA 3FPHA 2QK4A 4IJWA 4K9KA 3RK1A 3AFMA 4BFTA 1DSSG 3LPAA 2GESA 4FW8A 2ZUFA 5A9RA 1V5EA 4GKKB 5HK8A 4E2YA 3IPXA 4FLFA 4DMLA 1LFAA 4G8BA 2XX3A 3JARA 1Z2DA 2P8SA 3BTOA 1GDHA 3I5AA 4XYGA 3RAPR 2MSNA 3FOBA 2X0IA 3KOOA 5IMSA 2Q41A 2YZGA 4ZOEA 3TEMA 5H4GA 2R8YA 1XK7A 1HNNA 3MWGA 3ZQ4A 4CMIA 4OHXA 2E87A 1ABEA 1RQNA 2Y92A 4CKYA 1I14A 4N5IX 4WERA 4NQZA 3K9CA 5CW1A 5BP7A 1ZM2A 3BA6A 3UK1A 1WEKA 1UT5A 3JASB 4MV4A 4B3CA 1R3UA 1R4NA 5LQMA 3RSQA 3K15A 3KQUA 1O6FA 1MJGA 2IYEA 2O50A 1FW8A 2YN4A 4P4UA 2VYND 3B1JA 2G8NA 5AXAA 1DC4A 3B3GA 3HUDA 3UV6A 4URZR 1FE8A 1G291 1T0PA 5CFOA 1YDMA 3D6FA 3O8QA 4UASA 3EA5A 3IIMA 2HB6A 2WV9A 3L02A 4I55A 5JS7A 1IXRC 1I2MA 2Q8QA 3EQ9A 3MJ4A 4FXOA 3W5IA 5IZ4A 2ZITA 5KQPA 4FDAA 2AEJA 5B12A 4B76A 1DWPA 5TMBA 3V8RA 4WOPA 2ZRKA 3UWKA 2OILA 3UBMA 4MKGA 3EGIA 2H1HA 2RGNC 2QM7A 4TWRA 1ZJJA 2FN3A 4GP6A 4Q9AA 2J6BA 2WIAA 5EC8A 4WESB 1VOTA 1RZ3A 1TK2A 2ACEA 3JQEA 4IFEA 1Q11A 3EPPA 5A7HA 3TR5A 2BKXA 4KGVA 4WZAB 5HS4A 1IPFA 5MGBA 1QF6A 3DT9A 4AAYA 2RHTA 4CIXA 1UKAA 3AETB 5FNVB 1V2HE 2NSYA 2Q2NA 3HVKA 1T91A 4TV9B 3E1KA 5H5JA 1VJTA 1HEUA 1YQDA 3IMFA 1XMSA 1KDYA 1A8HA 2AE2A 3ZHSA 3OTQA 2B9VA 2IL1A 3VJLA 4J1TA 2KBEA 3TUIC 2TSYB 3JQ8A 1BCSB 2PY6A 3DJYA 4INPA 1MFPA 3SY8A 4UNRA 1Z2OX 1BJKA 1TA4A 1ZH8A 5CA0A 4LE1A 1D2MA 1CY0A 3S5UA 4DGSA 1A8PA 1D6NA 1GL3A 1UK9A 3TTTA 2XOKA 4GXNA 3CVJA 1CKEA 4RM3A 4D02A 4D3FA 1SD1A 1XVAA 1U8YA 1KAHA 1N9GA 4NDAA 3U13A 1ADJA 2H1FA 1VIAA 3MIIA 3QENA 5ICGA 1IM5A 2XODA 2GQ0A 3PFKA 1O5TA 1EFRA 3BD6A 3FPKA 4KE7A 2YC4C 3OQIB 4I8XA 1IVNA 2FNAA 1HDEA 2W2KA 1T9DA 1WXDA 3HBLA 3N2YA 1HDGO 1NN3A 3I23A 4FIZA 4GQAA 4H2DA 1QVVA 2YFKA 4O4HB 4QC2A 4R7TA 4OO3A 2FMIA 1VJCA 2E4YA 3E48A 3PF9A 1Y1QA 3SSAA 2OZVA 4HAZA 1O5OA 4R69A 2GVZC 1H3EA 4N7RA 4C05A 4IRXA 5HF6A 4EJ2A 5FTMA 1QB8A 2R96A 2ZWVA 3D9QX 4HAIA 4Q37A 1SK8A 2PSFA 2JFGA 1XNJA 1MP0A 4MQ5A 1SXJA 4BVEA 1KRXA 1R0KA 4BX2A 4C6RA 4HO1X 2FN9A 4LE0A 4N5MA 1UXKA 3TRDA 2WMDA 4F4HA 1GZUA 2MYPA 4QPZA 4TWAA 3PDUA 3T34A 3D3WB 4K9QA 4E5UA 5KVAA 1W73A 4ZVLA 1TU0A 3NTQA 2ZI9A 5TPZD 3UQZA 1GYQA 3K0AA 3ZS8A 4BNDA 1Y48E 5C7YA 3DUFA 4RX1A 3KZOA 4A7PA 3I5UA 1J7JA 2QTGA 1VCHA 3IQFA 4HAXA 4WSOA 4BQEA 3UGJA 1C9DB 1Y9JA 2MSKA 3NBZC 1UH5A 1O5IA 1XSEA 2A0FA 3OAAD 4CYMA 1GM5A 2WSSD 1MG5A 3JTMA 4IEFB 5T4EA 2QRJA 1MGOA 4XLLA 3ZCQA 3GBVA 1I8TA 2EBFX 4P7GA 4EPXA 3IOYA 4HQKA 1JR6A 1TI7A 1N9ZA 2HK6A 4O0LA 2QTVA 1U9IC 2ZDQA 4WBXC 1KDTA 5CYOA 2I7DA 4MX8A 1DTWA 1FUYB 1STOA 2W4MA 3E7DA 3H1EA 4JLNA 3RIMA 4AYTA 2HV9A 2YJTD 1DBQA 1NMEA 1JFLA 2P91A 1RWKA 3AIOA 1Y5RA 3R23A 1ZI9A 4C2BA 2CWDA 4K6OA 1ZIYA 1SUSA 4KH0A 4YUAA 2O52A 4L50A 1I10A 2C4HA 2ATVA 2NYAA 4JYPA 5INTA 2Q6IA 3HCRA 3F9RA 4ZVSA 4COKA 1MG0A 2PQ0A 1FSZA 3JQGA 4UBMA 4B4KA 1CJKC 1IIRA 1E1RA 3VR1A 4EYOA 3DNFA 4DVGA 3K5WA 4HC4A 1QP4A 2QMQA 4YP0A 4Y2HA 2FRVA 5KYTA 1P0FA 5BORA 5LB2A 4IJ6A 3ZIAA 5BMVA 3M6XA 1QOPB 2QP9X 2G28A 3ADKA 1NDQA 1JMVA 4EA9A 4DGQA 3A70A 4JC8A 4RDCA 3U9SA 1KERA 1P1FA 2Z8YM 3DMNA 3HDTA 3OU2A 4X1YB 4GP9A 4MW4A 3T3IA 1F4PA 3U4HA 3WL8A 4ALKA 4DCNA 5KYXB 1S4QA 1DBVO 1ZITA 3THYB 2R11A 1SCKA 1ODJA 4U63A 2P0AA 2AWOA 1DWQA 2P9ZA 1VL6A 3NOQA 4C6SA 3NXKA 3QW2A 1KKMA 4MPPA 1CPYA 3PPYA 1DDOA 1REQB 1EX1A 1FF9A 3GNTA 5E7IA 1ZGCA 3UAOA 3ZWMA 2JDID 3QLTA 3V55A 3VR3A 4KYUA 4AJHA 2BGLA 1KI7A 1I01A 2G5GX 1Q91A 4LJRA 1XKXA 3IVCA 1UT8A 1PJZA 4QQRA 5BRJA 3RR2A 4R8RA 3VR5A 4BNUA 4M0KA 3NYRA 4XD7A 3OC6A 3QHAA 2RAFA 3H13A 1R6AA 3BHNA 1W47A 3WADA 1CNFA 1NJ1A 2G36A 1SQFA 4H7KA 5CRIA 1RS0A 4TTRA 1Z6AA 3Q12A 3JTEA 1KPHA 4HWSA 4OBXA 3K0HA 4Y2RA 1Y7LA 3F3YA 3WIUA 4PR3A 1RKBA 3MINA 5BQPA 3RANA 3ZQKA 1U8CB 3KUXA 3QFFA 1FRFS 1KK3A 2D5AA 1LRJA 3NJ4A 1SA0B 1T2FA 4G65A 4JQYA 1K3UB 5G0WA 1FUKA 2IDJA 4WFJA 2R44A 4CNBA 5BOSA 4V0MA 1E3TA 1AQUA 3BXOA 2OO5C 4I5DA 5CNKA 4ENTA 3ZI0A 1C1DB 4DPMA 4ZYUA 1T24A 3T61A 4EPRA 4EWLA 3PXAA 2EFDB 2PAAA 4G5RA 1PNRA 4TGLA 2H18A 1Z15A 1VKZA 2AH5A 2ZRAA 4IDFA 4QICA 1LI4A 4LCBA 3KSRA 3OHPA 1PSDA 1U0GA 5AMXA 3BSFA 1Z07A 2XBUA 3AERA 5H83A 1CJBA 4EAQA 5EJ4A 3OLYA 2QXTA 1N2CB 2GN6A 1LC0A 2AG1A 2PMKA 2WE7A 3G7NA 3PD1A 4FMDF 3WNZA 5K6TA 1JMYA 1Y8RA 3NFRA 4C7OA 1IUOA 5EIHA 1XDUA 2DULA 1NVAA 1U1GA 2ZKLA 3FDXA 4MH0R 2VEDA 3KVRA 4FIDA 4UUMA 1TUEA 3KEFA 3ZU4A 4A26A 4C0JA 2YVQA 3A2MA 1KWGA 2QMYA 3UMJA 1C8BA 4K6HA 1Q77A 1R88A 4BL5A 1TDJA 4Z4QA 1OJ7A 2J6IA 2XWJI 1ACLA 2BELA 4GI3A 3GPDG 5IF9A 4QAJA 3AO0B 5BT9A 2BM8A 1GUBA 3G5MA 4MIEA 1NMXA 3T4XA 4GKJB 2KQUA 4EEKA 1Z5WA 2YV2A 1N6IA 4R8MA 1ZMOA 3N6VA 5DF1A 3G2JA 1UFRA 3UUEA 2GN8A 3LLCA 2QSJA 4B9EA 5KJCA 1X1SA 5FBLB 1Y7TA 4IZHA 1P4AA 5IXJA 1U2ZA 1T43A 3RBZA 5K0FA 4E7PA 5TMPA 1ZKMA 4CGZA 2IF0A 1ZOSA 3GLRA 4UBJA 2V55B 3L77A 5GTDA 1YHYA 1THMA 3TUZC 1Y6FA 4CM3A 4EG3A 1E2PA 2VDOB 2EW1A 5EINA 1KK2A 1TEXA 1YMQA 1U3WA 2PRSA 1TVEA 3SZ3A 3ZDQA 1OBOA 1XU9A 3C15C 3P45A 2JIPA 3MBKA 4OF4A 2XGGA 3EARA 1MOQA 4Q3LA 4M6WB 1G1AA 4X65B 2JRLA 3IDFA 3VC2A 3CNBA 1YUBA 5IDYA 3WYFA 5JWRA 1QV9A 4HQFA 1JZQA 3AFHA 3RS7A 3W5CA 3W5BA 4X71A 5KQLA 1OMOA 2MR6A 4U5QA 2D7CA 4LV8B 4I2VA 3OQIA 1C0EA 1M76A 2Y1OA 2YTZA 1Z4IA 1H1TA 1HSOA 2YHSA 4Z0PA 3HJRA 1SVOA 2ZYWX 3F8SA 3OURA 1FOEB 1OR8A 2AYXA 3MQ2A 3F5FA 1JH9A 4N40A 4HPJB 1OZGA 1XA0A 4MRMA 4GI7A 4NG4A 1ZMBA 5ALDA 4C14A 6ADHA 4R01A 1J25A 3HDYA 4ZYZA 3WGMA 3O6VA 1FXUA 1MIOB 2POCA 4ED9A 2WJ4A 1P4RA 1EXNA 1FFAA 2HMTA 2ORIA 3GA0A 2QRPA 3HKCA 3IBTA 3OTGA 4RD6A 3W8FA 1HFKA 2HHCA 2WFAA 3FKSD 4PQGA 1FVHA 4ENUA 4ZOQI 2QRNA 3ZCXA 1AUQA 4O4JB 3PKZA 5REQA 3BD8A 2E5FA 3FFWA 1H5QA 3W4KA 3HBNA 1TYZA 3AFOA 5JG7A 1P3JA 4D25A 4G8DA 3LECA 1BSVA 1M66A 1VDMA 4REOA 3GUCA 5FJIA 3NJ8A 5B3JC 1PEDA 3QF7A 3IJRA 4NK5A 2UDPA 4OGLA 4PONA 3RLIA 1SIOA 4ESHA 2VHQA 3NKVA 2VH2A 1IRIA 1C9EA 1P4HA 1XZDA 2OQ2A 2X1MA 4I1VA 5TT0A 3NTXA 1GUDA 1JIVA 1SQ0A 1J8QA 2ZDHA 2ZK7A 3PT9A 1V1MB 1PLLA 2FPPB 3AF3A 1T5DX 1Y8QA 2XYRA 5D6NA 3RSOA 1FRZA 3SKVA 2R8BA 4DIUA 1E9VA 3TNFA 2QTLA 1Y1SA 2VTDA 3W2IA 4DA4A 3R6WA 5FOSA 4X1KB 3EZNA 3L8GA 4MV7A 1UIMA 3TL3A 1W52X 2A0YA 4CKBA 5KVCA 1JAXA 5HRUA 3IKTA 1MC8A 3HYCA 5A04A 1FJXA 4FFVA 4O0MA 1VLZA 3O03A 2WM3A 1JAYA 1DAOA 4UEKA 4DFDA 3EUAA 5DJ5A 3P0HA 1F0NA 2QSUA 3GEPA 1M1NB 2PMBA 3IA7A 1U3FA 1YB2A 3UA4A 3R8FA 1DT3A 2PU5A 2R6JA 1QHGA 3OQVA 4M1SA 2WHRA 3I9KA 1Y98A 2MWMA 2WHPB 1L5NA 1QU3A 2BHTA 5CCBA 1D3AA 3RT1A 3COYA 4XIJA 3TZKA 1J56A 1WMDA 4ND8A 1OPXA 1M7HA 3LCJA 4R0MA 3H2ZA 1ZSNA 2BJHA 4D9HA 2C2XA 3CBGA 3EAFA 5JYDA 5KPDA 1YOVB 5CLJA 2SHKA 3R76A 3CF0A 1QUEA 5B1HA 3TI7A 4J75A 2I99A 4TTQA 5TGZA 3WLJA 2H5JA 2XPCA 1UDAA 1RBQA 4AG5A 1NI3A 2HJ9A 4NDNE 3P26A 1K75A 4QBFA 5EAIA 2PMDA 5FWAA 4X92A 4V0RA 5I7WA 2A0KA 1PG5A 3F96A 1EGVB 3DWEX 1UWKA 4FEGA 2VF5X 1QTRA 3IHTA 4U4AA 1Y80A 4PPYA 3UHOA 3X44A 3KEGA 4YJ3A 1OTYA 2ZSHA 3BMNB 3LI2A 4RGBA 2GJ8A 1NMSA 2BIFA 3CLHA 3W5JA 2YNMA 3FNFA 3L1UA 5JDIA 2W9XA 3I9LA 3JARB 3CU5A 3PI6A 1FP6A 2AI3A 3IQHX 4KVGA 2PN1A 4JC5A 3R77A 5KOYA 1I7PA 3JR3A 4XSVA 3CLUC 4MHSA 1MA0A 5YASA 5FWXA 1DEAA 2PMFA 4BVBA 2LZ0A 2P9GA 1BRTA 1HE3A 3WWEA 2Q4EA 1XWIA 2A5DA 3OOSA 4OHBA 2LWIA 4RQBA 1EQ2A 1CR0A 2QI9F 3PFIA 1HDOA 1NVXQ 1JKMA 1ZNYA 2HA6A 3F3KA 4KQGA 5KTOA 3DB2A 2J0EA 1V3TA 5LDHA 3X2FA 3UPTA 4H3HB 1K98A 2PQMA 1OXTA 1ZRMA 1SURA 3U3JA 3U39A 3AUUA 2CJWB 1FUEA 1XZCA 3CNNA 2RAPA 4EHFA 2HNAA 4N82A 1JHAA 3EIWA 3FIUA 2ZIUB 3EEOA 2HPVA 3S1LA 4YEDA 4ZARA 2HCTA 2Y0PA 3CRW1 3EZ7A 3U80A 5JD4A 2WJYA 4G4JA 3I4CA 5DE3A 5LR6A 4OMUA 1DCTA 1CG6A 2EGHA 2WMYA 3Q8KA 3S28A 1EFPB 1YZFA 2PBFA 3D5TA 2G9NA 4WGFA 3A4MA 4LZAA 1SC4A 1TKBA 2ID9A 3ECCA 2ZB7A 4KQIA 4M99A 5IT5A 2J59A 5JYEA 3FCCA 3FOAA 3NNNA 3QSYA 5ALZA 2B1JA 2P9BA 2Y2VA 1JV2B 5KO2A 3H6GA 5G41A 4COOA 2Q5CA 1MQ8B 1G6OA 1IBSA 2ZBVA 4YO7A 2WYVA 5G4LA 2NQTA 3W7VA 4AO7A 3TEJA 1U2DC 4WI1A 4E6PA 1I4DD 3THWB 1W5BA 4C0HA 2R65A 3Q98A 1FZQA 2B25A 4V0OA 3S7ZA 2RE8A 4LDQA 1XTRA 4XIIA 4GFDA 3IT1A 3HKDA 1FS5A 3WWYA 2I3AA 4EHHA 5B57C 5KCZA 2QTHA 4YROA 3MMXA 3VH3A 3C3PA 4R1UA 5E6SA 5EA2A 3AEXA 1IN7A 2D5CA 3CX3A 4CLOB 5TMEA 3U61B 4LEIA 1UAAA 1JEQA 3TE6A 2VP4A 3NHMA 4C6HA 4R51A 5E4YA 3ZPXA 1XQ9A 3C39A 3UXYA 1ARZA 3AR7A 3A1EA 1CHNA 5EHXA 1XTZA 4CR8A 4YUVA 3KD2A 4OU5A 4KBFA 4PYJA 2A9VA 1RCFA 1WU7A 3OWXA 1SKUA 4RD1A 3FLBA 5JMTA 1Y3FE 2MSLA 4NMWA 4XWYA 3E23A 4U8GA 1VJ1A 1CUAA 3CH5A 4DR6B 3OPQA 1RQRA 1R6UA 1T8SA 3ZXSA 1SHZA 4KPYA 3CF6R 2NYRA 4NZOA 3A1NA 3GCZA 2E3JA 4QPPA 2RCYA 1VE3A 2YY7A 4BLRA 1Y4ZA 2YXNA 3UFXA 1VIVA 4JB0A 4B0PA 4RK1A 3GP5A 3D1JA 4C7KA 1CVRA 3U7QA 2PNFA 1SXGA 2WUVA 4XWKA 4LF6B 1NLMA 4FMCF 4YJHA 1OAAA 4EKDA 2EBWA 2DH5A 3PCXA 1HV8A 1ODTC 3MTEA 4Y1RA 2G1KA 4KIWA 4ZI7F 2Z43A 1IK6A 3QY0A 4HNGA 2Q4DA 1CP3A 1J9EA 2XEDA 2ZRPA 1UC4B 1K5GA 1I4TD 3BMQA 1TJNA 3MELA 1X7XB 1RNLA 1JQAA 1MX3A 3OCUA 3Q10A 4W9NC 5DX8A 3L7BA 4LFCB 3BL6A 1A27A 1GLGA 1OH8A 1W36B 1UJ5A 1S8NA 3TLZA 1LPBB 1X8KA 2VKTA 3OETA 4JVSB 4QLBA 1E3DA 1UZAA 4BNIA 4DDKA 4NI5A 1NQWA 3TDMA 4UM5A 1JAIA 4JBWA 2QMUA 3C8ZA 3QUBA 1Q0LA 4D1YA 2XUGA 2R8PA 1H5UA 5FEMA 4E0BA 2VPWA 2GK4A 1XRNA 4HTFA 4YQEA 5KYYA 2QE7D 5FV7A 3HA7A 3KE8A 3O3OB 3WLKX 4H4CA 2LIVA 2ZM6B 3WDKA 2YJ3A 4UD2A 2HUPA 4V0KA 1BU8A 3EB9A 2AJDA 3O8RA 4UTPA 2HK9A 5KMGA 2M1ZA 2RHJA 2P8JA 5IAGA 4BMYA 5DGCA 3H7IA 3RUAA 1QRSA 3HBMA 5ALQA 1SZCA 4O02B 2IYWA 3LHSA 3SJUA 4NYJQ 1I5OA 2FWAA 1EX7A 1Z0IA 3IHLA 4MVJI 1N32B 1Z18A 3GJ8A 4BJ3A 5IEBA 3LGAA 3CIFA 4LF9B 3ZE7A 3CF2A 4NULA 1V9LA 2QM0A 1KQFA 1BX0A 2V7WA 2GFHA 2FZEA 2ZJ3A 1QYWA 1KMNA 5EHNA 1RAEA 5DBOA 4ARZA 4QTYA 1Y1KE 2WFLB 5I7RA 3LUHA 4FNGA 5K4HA 1ENYA 1SA0A 1IY2A 4YPVA 3P4UA 3Q0IA 1B15A 2EFYA 4IGEA 4PV7A 5K3SA 1BEUB 4KIFA 3S2IA 1W88A 2C78A 5DCYA 5LQUA 1TQ8A 3VZDA 4LRYA 1NULA 2W2LA 1NHGA 1K0FA 1OVGA 2PX3A 3RDPA 1RPZA 2EC5A 5LSAA 2NLOA 5JDCC 2IQ5A 5JZVA 1MMFB 1AS2A 1OLUA 4L8GA 4JITA 5K8LA 2A94A 3QFCA 4R1QA 3SYTA 1B1AA 4BBPA 4EDFA 2E55A 1SXIA 1XAGA 1DQSA 4Q6BA 3A6JA 2JLXA 3P7MA 3N75A 4FR0A 1EBUA 4Q9KA 4JR1A 1JKIA 1PGQA 1FX0A 1GTL1 3FHCB 5LMZA 4I3HA 3F7TA 1HFJA 2QZZA 3NANA 1NYTA 3P2JA 2JIOA 4IQ4A 3NAMA 2EX1A 4V39A 3LGXA 3PQ7A 5C0OE 4MLPA 4JSTA 5C1BA 1DAMA 2XH8A 3OFND 2Z0MA 1SUPA 5LZ7A 3G2MA 2ZR9A 4ZGWA 3DOEA 4X6XA 5HF9A 3UB4A 1I13A 1IEQA 3B1KA 5FOQA 3AETA 4NH0A 2ROQA 2ZI3A 4W5TA 2CVPA 3PXBA 4Y9RA 4LJ7A 5I7SA 2GHQA 5GADl 2X22A 2WLTA 2PGLA 3A37A 3DEIA 1YDFA 5BSTA 4PRZA 3R74A 3V3TA 3FOZA 5KQRA 3UT6A 3WWPA 2B7CA 4KXXA 5FRDA 4PC3A 1J8FA 3INTA 2WIDA 3KYIB 3NHKA 4J1QA 4MR8A 4S04A 2Q9UA 2W5UA 3TEFA 1KFBB 4U6NA 3Q3EA 4MCIA 1PRYA 4LAFA 1EZZA 3CRQA 1JLKA 1ZIDA 3QKUA 4P84A 2B2CA 3N3AC 1TFUA 4OK6A 4S0ZA 5HKBA 4ZVOA 4U9IS 2FVXA 3M6FA 5DHPA 3M7IA 5DN6A 1IN8A 1LDYA 1YIDA 3HFGA 3MWDA 3ANYB 3MS4A 4MLZA 4BPRA 2OM2A 4HPWA 3O9MA 3EXEB 4KFUA 3HKBA 2VXYA 4US1R 2IV3A 4KVFA 1A96A 1GN8A 5AVWA 4RTNA 1IVSA 4PM4A 4IVQA 2QTWB 4IHAA 1CDOA 2J3DA 3H99A 2JJ2D 2B8EA 3COPA 2O8DA 4EHLA 3B2EA 1IK4A 1JQBA 1EQUA 2ZT5A 1K6EA 5IVIA 1GZDA 2HT6A 4KYVA 5FOVA 5LKAA 3DWIA 4IWXA 5CJJA 3FLMA 3L46A 3EGCA 1BCRA 4JI5B 2WICA 3EG5A 1YUMA 3BWMA 3N74A 3Q6IA 4QQFA 2CSUA 1QO0D 1T3HA 2OMKA 3QM1A 4OOFA 1WV0A 1A9RA 2Q49A 3LHFA 5HZGA 3WK6A 3DE3X 1AHNA 1S7CA 1AS0A 3ZHQA 3KQYA 4FSXA 4I46A 3ZTWA 3U5ZB 4EB6A 2B36A 1T8UA 4EQZA 3FPBA 1NYQA 1K2VN 5ALLA 2CF5A 4KLAA 3VYUB 4GM4A 4FDMA 2IXGA 2XECA 3Q8WA 4PS1A 5DPMA 2PT9A 3LNCA 1S2LA 2DWPA 1J39A 3ZXIA 4B6SA 5K8VA 2PLWA 3OZXA 3KSMA 1HLGA 3DVAA 4MR9A 3WJ1A 4BU1A 3HJTA 4FK8A 4ZI3A 3GP8A 3R9XA 1VM6A 2QRGA 1ZLXA 2Q8NA 4HH0A 1L5SA 5IP5A 4GT1A 4BRSA 1P2TA 1JDSA 3RAJA 2BGJA 4BO8A 5AHOA 3QNMA 1M6EX 3IQIX 1Z88A 2B82A 1TTPB 2FA9A 3KYCA 3LDGA 3PPIA 3G0BA 4J91A 1AZLA 1WXEA 2ZROA 9ATCA 5JLJA 4QYIA 1FTSA 1NFFA 2GFIA 5IH3A 5IKPA 2IXBA 4XYBA 3LX5A 2HSDA 5CT8A 3ZE2B 2PYIA 3KBBA 1DG1G 5CAEA 4ENWA 1J5EB 3T95A 4A0GA 1YR8A 1K9VF 4MKIA 1JQ5A 1PR0A 5E3HA 4QEKA 3RNOA 1Z39A 1TCUA 2K2WA 2Q9BA 2PJZA 4LYGA 3DTTA 5IPFA 4S35A 3FF4A 4IDCA 1PLJA 2N46A 3DEHA 3D4IA 4LPKA 3SXJA 2GB4A 1N6LA 3H8WA 5JC8A 2FP3A 3VR4H 1R8QA 1IAVA 5EJEA 3E5RA 2Y99A 4N0DA 4PYRA 4BNLA 1TW3A 1JPJA 3FY4A 4JVMA 4QTTB 5CYGA 1P5FA 1SIWA 2FMHA 2QPAA 3GJ6A 5M7EA 1AOXA 2C7PA 2JA1A 5TT1A 3JQCA 4BVFA 4H9GA 2FVYA 2BZ1A 3HU5A 3I32A 2W6ZA 2K7ZA 1Y34E 1DIHA 2PFKA 4QSHA 2NO6A 3EVFA 1PDOA 4ZOBA 5AKIA 1CJTC 4LF7B 2TECE 1WY5A 1X9GA 1EP3B 1U1IA 4P53A 1SWWA 1UBTS 3HA2A 2B4RO 1YTLA 3AF2A 3N2GB 2XI4A 2GPBA 1KOJA 2H2FA 2A1UA 2PEZA 3GOHA 4BO9A 3C6KA 3H3JA 3I73A 3NVKI 5F4BA 2JCGA 4PZUA 4BNZA 1QK4A 4KN9S 4X20A 5JAUA 4NMLA 1E2FA 1W35A 5L45A 2I4MA 3CB2A 5AVXA 1C7FA 2C96A 5SY9A 3JRWA 4PLPA 2PKYX 4PLCA 2EU8A 2WYOA 5T8KA 4BFSA 3SDZA 1JU3A 3K1AA 1DDIA 3IV7A 3ITEA 1HE1C 2H1LA 1U7ZA 2A30A 3N53A 4BFWA 5CVTA 3WBFA 1PGPA 2H51A 2OEPA 4FDVA 4BXOA 3HO1A 2XZDA 3CNEA 4M8LA 3K8QA 3RNLA 4WJLA 2X23A 1BMFA 2IEIA 1MC4A 5CDFA 2W6PA 3NCTA 2V6FA 2VHTA 4L74A 2HT1A 1OZFA 2Q5LA 3OICA 1BW9B 4LTDA 4O63O 4YQYA 1N25A 4LJ8A 5DIFA 3WSWA 2CMGA 1FDWA 2MMGA 2O8NA 3ENZA 4BLSA 1PWZA 4C78A 5A03A 2I62A 2X6QA 3JY6A 3QJYA 1QORA 4MR8B 2F90A 5H3CA 1JDZA 1T2CA 3CCCA 1KYXA 2J9ZB 3SU8A 4HQ0A 4QECA 2VK4A 4S1PA 4KQ9A 3WWOA 4X94A 4KFTA 4LXHA 4XUCA 5F64A 2O8BA 4GC9A 3WYNA 2IYUA 2RFLA 4ASUD 1VG9B 2XR1A 4EUEA 2PJUA 4KVAA 5D7NA 4OOEA 3RQIA 4FYVA 5IAOA 3ZCUA 2AMVA 3SK0A 4C4TA 4C01A 1DQRA 3AK4A 3R0ZA 4KK4A 3V1UA 1CD5A 3CUUA 4OBWA 3TLKA 5HM6A 5LA6F 2F4NA 4YAIA 2A67A 1J1IA 3U7GA 1JBEA 1LLQA 2ZUDA 4I9NA 1JZTA 5AUNB 4FFRA 1A7AA 2NYUA 3AJRA 3UC9A 1U3UA 3ZHZA 5K03A 4J0KA 3H9GA 3W1EA 1DNPA 3LY5A 1A8SA 2R7LA 1AQNA 2DB3A 3I62A 3EPHA 2J3EA 4Y3UA 1OFVA 1HL7A 2XSZD 1G6Q1 1V2GA 3MTAA 1QFYA 4NYJR 4WK4B 5TF0A 2VJMB 5JV5A 2R9VA 1HLDA 1NAHA 1B1CA 1F0KA 3K6KA 3D7RA 3EZ6A 5D86A 1I4LD 1IY8A 1K4KA 1ZGZA 4PHTA 1JVSA 1VKJA 3WLNA 4QTZA 4D57A 4ZQBA 3HKEA 5HJEA 3L4BA 2GAJA 1P7YA 3LIIA 4RK4A 2IJGX 5EYPB 3PXCX 1L5QA 1AK2A 4ZO7A 2O2HA 1KYYA 4R7ZA 1WCXA 4LHXA 5B2FA 5IUJC 3AEYA 2JGRA 5KVVA 1QFXA 3PK0A 4MUFA 5I7HA 1UPXA 3AUXA 5CVDA 1AMUA 3E2MA 1NJFA 3AJAA 1FQWA 3REOA 1V0JA 3DMHA 1EDOA 1UQTA 4U7PB 3H83A 4JENA 2DKFA 4QUDA 3CR8A 4CUKA 1MV8A 1O57A 1X87A 1D4FA 2C5HA 1XLWA 5KNBD 2PGJA 4NEHB 5BR8B 3AZOA 3NDBB 2X8JA 2D54A 3ETCA 2X8JB 1GA1A 1WG8A 2O57A 3MYYA 5EJFA 3LU1A 3EC1A 4MI6A 2G77B 4IOMA 4TTSA 5IEJA 2VUSA 3C1OA 2E4ZA 1ZHOA 1FQOA 2PX0A 2GWRA 3TCKA 2QN1A 4NPHA 4M60A 3GQBA 5FDFA 3C3WA 4RNDB 3F7NA 4QBGB 1K4MA 3RC3A 4RZ3A 3DHYA 4KQEA 2ZBDA 3CZ4A 3D8HA 4KXFB 3PCRB 4MI9A 2OCPA 1GPAA 1IY0A 1XZAA 2WA1A 3LKVA 4P5DA 4ZGBA 3OKCA 5FYQA 3S2EA 3WISA 2PZLA 2HXSA 2YFYA 3RJZA 2ZZKA 3WK7A 2REBA 1GGKA 1MFZA 2E9SA 1RIIA 4GBED 3T3OA 3DLBA 1OWLA 5IANA 2PZMA 3V8QA 1ZD5A 4EJSC 1DKPA 1Q1NA 3AVQA 3GLIE 1T2UA 5DOVA 3ZGOA 3QNUA 1WHTB 1XG5A 2I4RA 2AG0A 1MXHA 4FHDA 2AIRA 4HY3A 4MUNA 3ABIA 1UP4A 1M6NA 1IEXA 4A82A 2GD1O 2C42A 3HU1A 1LW7A 1NQVA 1RCTE 2ESRA 1V26A 2QXYA 3GJSA 1EXWA 2IE0A 3EQ8A 2DR3A 2H00A 3IT3A 2F3QA 1FYFA 1C0IA 3ON5A 4AZWA 1ZGHA 5I5GA 1E6MA 1E2HA 1HDYA 4J94A 4K1LA 1YI1A 1SULA 4BX8A 3LF1A 1I80A 1CF9A 5F3WB 3SLKA 4YRSA 1JG3A 2NV0A 2WM9B 3ITDA 4ID9A 2WIJA 3WV5A 4M1KA 2W8BA 4DLLA 2E1PA 5L4NA 3FNGA 2DJ5A 8AT1A 5ICSA 2CV2A 2RGXA 1KORA 4H6WA 4OU4A 1L9KA 4R54A 2J6HA 1BO6A 2VAMA 4KH1A 3II6X 4QG3A 1TEZA 2FSGA 1UKYA 4HDCA 4UUOA 4PAOA 5IW8A 2G0AA 1KR5A 4JJ4A 2OQRA 4G6ZA 4LTNA 5SZIA 2H2WA 4XUGB 2BI8A 1ADGA 1D2GA 3KZCA 4BO1A 4U7WA 1A8QA 5ALHA 3UPUA 3KZKA 2GCEA 4K9SA 3AF1A 3NBMA 4PVDA 5CVCA 3CW2A 3DONA 4YV7A 4DV5B 1XPJA 2JBWA 4KB5A 4WA7A 1O94A 2C2ZA 2I6SA 4B2PA 3M6MD 3LVQE 3AKCA 3DB1A 3IRVA 3KXKA 3O73A 4FFWA 3ND6A 4MROA 1N3IA 1G9XA 2JGFA 4DQ0A 3RF7A 2PZBA 3MILA 1Z12A 4HMOA 2FMXA 3D7LA 3G17A 4HB4A 2R8ZA 4WUVA 1EXDA 3MJHA 2WT9A 3S68A 4L51A 3FYUC 2H57A 2FQXA 3IEIA 2UVDA 4HLUA 1TYBE 3R7AA 2OCBA 1INLA 3GJ0A 4PFSA 1AKYA 4RLFA 1BWPA 1WDTA 4CKCB 2C57A 3D5EA 2VJYA 1GT6A 1SUIA 2P4EA 4ENSA 1OXBB 3Q4GA 4TWJA 2QL5A 5BRAA 3MW8A 1F8XA 4CGYA 4FONA 1WCV1 3QBJA 4QNMA 5FI5A 5GV8A 3E9RA 3EIHA 1HF3A 4B3XA 4GS5A 5FA5A 4G1CA 2QN6A 2ZT6A 2GUGA 2FZ5A 1WNFA 3IP3A 1XPRA 1M2FA 5HOQA 1PT6A 2X9VA 1A2BA 3OI7A 4EKYA 4DCGA 2QT0A 4K9RA 4RAQA 2VTVA 3U17A 3QEKA 2VSFA 1ORTA 1KU0A 1USWA 1VFPA 4R98A 2W6JD 4RCVA 1MD9A 3TL6A 3WIEA 2X5KO 3O31A 5I9SA 1T9KA 5CCDA 5FADA 5LP6C 4GMFA 1YE3A 3HVIA 1FSFA 2WYUA 1KEZA 5JQGA 4ARUA 4K87A 2GERA 5IT9A 4JLUA 1Y42X 1Q0PA 1IC6A 3HXQA 3IIKA 3OEED 2Z6AA 3CS3A 2P77A 5CG1A 5B3KA 1G19A 5BSHA 3GLGE 2PR7A 1L7QA 4PSKA 1HYEA 5B64A 10MHA 3EG9A 4PN3A 1OC2A 5K45A 3DLCA 2FOIA 2IVZA 3HZOA 2G80A 4LVCA 4U7JA 2R8XA 2JLCA 1O3YA 2YXBA 3RD5A 4IUDS 1V41E 4N12A 1ES9A 2ISSD 3C7TA 3T9DA 2F9MA 3K6RA 2DTXA 3QOXA 5LB4A 1ZCAA 2VP9A 1G98A 3W9YA 2GMWA 4RZHA 1W6RA 4Q05A 2PSHA 1CR2A 4NENB 1VJDA 3PLNA 3C7AA 3IAUA 4LOLA 3A6DA 3PC8A 3TLCA 4DUYB 5J1TB 1B6TA 1SU7A 4RPJA 4HVCA 4IBOA 1ODLA 3SJAA 4KN6A 5FAKA 4YR9A 4RELA 3TF5A 2QPTA 5FFMA 3BE4A 3E2IA 2OENG 4P7FA 2I0FA 4DCUA 3ZJYA 5B7QA 3NJRA 2DTEA 4AM8A 2QG4A 3KKQA 2HHAA 2P9YA 3PBKA 4I55F 3TOVA 4CVNA 1UBRS 1ZIPA 1J0BA 1C5KA 3CSUA 3TCNA 4BO7A 1ORDA 3IHKA 1S01A 4O4HA 1GAEO 1TD9A 1APBA 4Z8YA 4GP7A 3R6DA 4JQSA 1FQJA 1KJ9A 2R1TA 2X2EA 1JBKA 4MRAA 4MYCA 1DV1A 4NXMB 4A0HA 4DHWA 2Q5JA 2RGYA 5KSOA 2PL3A 1PGJA 4KPGA 4CDGA 1VFNA 3DVLA 4Q4LA 1SELA 4CT0A 5MGNA 1E2QA 2NSLA 1KJZA 1MRNA 2JFHA 1Y1PA 3EH1A 1CZOA 3G8AA 1FTGA 3N76A 3PEVA 4CI0B 4DIDA 4F60A 4TTIA 2BKAA 1RQPA 4LSMA 2JGKA 3K0EA 2IHTA 1G7RA 1KZ6A 3GFSA 1N8NA 4JT8A 5DDIP 1HDZA 1E4VA 1XZLA 1BYUA 3T4EA 5KJEA 3HCPA 4DRXA 1E98A 3C8DA 2QM3A 4Q34A 3W9UA 1A2OA 2Q2WA 3JQPA 4LCJA 5AKZA 1P7PA 2GK7A 4BP1A 5HYVA 8ATCA 2PU7A 2LTAA 3B53X 4F4UA 1NBMD 4X93A 4YAOA 3QOYA 5JHGB 5KSPA 1U3GA 2ZB8A 1RM5A 4HK4A 2Q4RA 4Q02A 3V4VB 2OLKA 1E2KA 3FMVA 3UV3A 3ODGA 4OHKA 4AW9A 3G5AA 4D44A 1X7DA 1Z3IX 4YA6A 1RRPA 3AUSA 3CO0S 3FYUA 3RKSA 2H17A 5IULC 4ZAZA 2GPTA 2JJMA 3E27A 1E4EB 3TB6A 3DEAA 4BHTA 4BFVA 3PR2B 5ARCA 1U0TA 2LW7A 2IV2X 4IEIA 1VSTA 4KKXB 3IIEA 3PUKA 5B2EA 3KSZO 1QYDA 3O47A 3RSLA 2WWXA 3T7RA 4CG3A 1GA6A 3AIKA 2ZYDA 3O95A 2WHQA 2HBZA 3Q2IA 1M5UA 4H1TA 3M2PA 4NVRA 5TSDA 5HWSA 2JJ1A 5CD1A 1VYUA 4AJIA 4DWJA 3QQ5A 3A4VA 4WASA 2VPQA 4AUEA 1N57A 3I37X 3ICPA 1MEEA 4POAA 1ZBDA 2QP3A 4UZEA 5B1DA 1M33A 2XNHA 3LC2O 1VMEA 1T9GR 4Q9DA 2G71A 1MGPA 2AOWA 2QEQA 3MHTA 1W0JD 3KOWA 2DECA 2BDTA 4BOYA 1UJ6A 3HHPA 2EKDA 2IH4A 3TKAA 1TAQA 2JGDB 1VC2A 3DA8A 2FWRA 4MRVA 1RMQA 4EMBA 2PZGA 4MDFA 1P73A 3LC1O 4INAA 4GL2A 4XJTA 3AR3A 1E9AA 4IO0A 3SQMA 4BZQA 4IH9A 2ZAMA 4AY5A 4ENQA 5FTLA 3D31A 2PIDA 3AEZA 3TXAA 1DT5A 2E4WA 2VNJA 4Q1AA 4QU8A 2IEAA 2GPWA 3HADA 2GM9A 4MVJD 4D4GA 1ISGA 1W34A 2RGWA 4EK9A 2BUCA 4P58A 3DL0A 1AUPA 4ACAA 4YTEA 1UPAA 2OHIA 1R2QA 4QHTA 4EQ6A 1X7WA 1X7WB 1IZ7A 1ZH0A 3BICA 3D8UA 4OV6B 4RENA 1QOQB 3V32A 3W9BA 3RFVA 5BVGB 2AUNA 1S8AA 3CWCA 4EB3A 2G76A 4PIMA 4CFZA 3QUAA 2ETXA 4HDKA 1BS9A 6NULA 5K0ZA 4A2WA 5ALSA 3QYAA 4EPWA 4I0WB 5DSXA 2GCOA 3P4XA 3MWEA 5HP4A 2ZGVA 3DHEA 1NQOA 3AY3A 1PZHA 4Q0MA 3VX3A 3WLAA 2JVIA 2KYRA 4FUQA 3AHIA 3TQRA 1M67A 1NNEA 3F4LA 2FZ4A 3HEAA 3O38A 5A4IS 5L3QA 3ADDA 1K2WA 1EVEA 3IUPA 5B53A 4TRMA 2JJYA 2BGKA 1GAXA 1QWOA 2C2GA 1GZ6A 3PYMA 3K8YA 2J0QA 2B5OA 3F6PA 5EJIA 4MP6A 4GPD1 2UZ4A 2DU8A 2FPKA 2JAWA 2R6FA 4IMJB 4QFDA 2PGAA 2I22A 2F8SA 2XYQA 3AERB 1SEVA 1ZN8A 4ZOLA 2A57A 1CYEA 3V9PA 2Y77A 3GD7A 1PVVA 3KOMA 4JP5A 1PJAA 3H0KA 4TZKA 4ESVA 5KOHB 3PQ3A 2AFVA 2ZB4A 3CV3A 5BNIA 2WIKA 4HGOA 4ZCTA 2CZQA 4AZVA 2PQ2A 5JE8A 5KDLA 1TIBA 2PPVA 4AKSA 1K6IA 4FYMA 4L27A 5JZ9A 3EJ6A 1JEAA 4MA4A 3PQCA 3HJCA 1GPBA 2VUIB 5TVGA 5KTRA 4C2TA 2MYUA 3PIIA 5AKKA 4BNJA 4BO2A 4URVR 1Y4AE 1OA1A 3AHDA 2VWHA 3B70A 4GIBA 4Z4CA 2NZXA 4HVTA 1P0MA 3CZAA 1SKMA 3LQFA 2FKNA 3DTYA 3UGQA 2WD8A 3KXPA 2QSYA 2Q6VA 2X9QA 3MXTA 3ORQA 5J40A 2GJ4A 4QGHA 2P0EA 3OM8A 5B4TA 2A9KA 4K88A 4PQEA 5LA6A 4EG7A 4HMPA 1GAWA 4OHFA 4KCGA 4L78A 2D3WA 3A14A 1YAJA 3FUUA 2CKMA 3JQBC 4WX2B 4HWPA 3A3OA 4HADA 3VI3B 3PJRA 2IZ7A 1QRAA 5DXJA 1K5PA 1NI4A 4FCTA 4DG8A 3P0IA 1XKTA 4IQ8A 2A9RA 1GFSA 2Q1YA 2YWCA 3GCGA 4JEMA 4EGAA 2UAGA 3ZHTA 1OI7A 4JS0A 4D7AA 5IK2D 1WRBA 2OE2A 1ABFA 2A1IA 4MWEA 3G0CA 1IOVA 2R751 2VHXA 1H8HA 3A25A 2K6GA 1R8YA 1ZI6A 4WXRA 3RHFA 1QFMA 2IYOA 5C7IO 5LP6A 3WGIA 1KBZA 1MAWA 3V4FA 4C04A 4CEHA 1DBSA 3I01A 4RPLA 1UFKA 4JJ8A 3JATB 4V02A 3I39X 3AV0B 5C8YA 3QZUA 2Y67A 1KFKB 3OFNA 3C3MA 1LSOA 2D0IA 3DEZA 4MSUA 1E8DA 1BXZA 4IEEA 1Z3CA 2A1TR 2APJA 3J80A 3N07A 1VIDA 3WGHA 1K68A 2EP7A 1VB5A 3L4SO 5JATA 1F60A 1N2SA 2C4WA 4QBIA 1ZEJA 4OATA 2GXAA 1IJBA 1EP1B 4GYWA 1ZXBA 4QDZA 2YWDA 4MYDA 1S0UA 3D54D 5GIOE 2QLNA 1SVMA 3W5UA 1ULZA 1WW2A 2C8VA 2GX6A 2OKCA 3DQPA 4UOQA 2AN3A 5DNWA 5JDIC 5LIPA 2P78A 4URXR 2YUIA 3FWNA 2ZSUA 5EKDA 5K2OA 1OASA 4YT5A 4HLUC 3MTBA 3V7NA 4D41A 4EHBA 1X7HA 2WB4A 2JZNA 4KEAA 4NOLA 5AICA 5E9WA 4YCMA 4G1UC 5KYYB 4CQMA 1TX4B 5AXCA 3M82A 3OZ7A 3FPEA 2BR3A 4QWMA 3TIXB 4PS0A 4JYAB 2WJHA 4ARCA 2GEDA 3MWFA 3B48A 1PR1A 4HOYA 2A9OA 3A4NA 3PA6A 3S8YA 4GPEA 3GFRA 4A6DA 5L95A 3EK2A 3IXQA 2C2MA 2P35A 2FW7A 4FQ8A 3G6WA 3FPCA 1EFKA 4GQBA 4WNAB 3A3NA 2HM7A 3VHXB 4OLBA 1CB0A 2QVZX 3M33A 5I8ZA 2H92A 3L7YA 3R3SA 4HQRA 1D6JA 3EGDA 1DOZA 2C4NA 3LLVA 4U5XA 1L7DA 2PX8A 3K6JA 5EZYA 3STTA 3WA6A 3KJGA 4AJNA 3ILSA 1YJCA 2CFOA 2AB0A 1U3DA 1SG0A 4ZK6A 2EZ4A 1RLMA 1H2RS 4I1OA 4AF6A 2BI7A 5T3YA 3ZTYA 2C2KA 1C9KA 2RSLA 3IAAA 3K8ZA 1NV9A 3M5WA 3PGA1 4LISA 2W2TA 3CSSA 4GLFA 1ZSYA 3R9IA 1CJMA 1J20A 1L4EA 3L5OA 4IMRA 4ZCSA 2PKRA 2HDWA 2OBYA 5SV2A 3C5CA 4AP5A 2WJAA 1NUTA 4MOWA 1TD1A 5DN9A 1LLUA 1PFQA 1O0CA 5G3YA 3U40A 3BGOS 4ZT6A 4UHCA 4C7XA 3UW3A 4UBLA 2EFHB 1SCNE 3OOWA 2AG5A 4ND4A 5A4KA 1AB6A 4RW0A 8GPBA 2OUKA 4BKRA 1DG9A 2OWEA 1YACA 2DQKA 3LWBA 5K3DA 1EA7A 4EYEA 1H66A 3TOZA 4OHOA 3VH4A 2V6MA 4OSOA 2DHRA 3FVWA 1ZJ6A 2Q27A 2O8VA 2WD7A 1ND5A 2RBGA 2PDAA 2G07A 1VIMA 2EIHA 5G0VA 4FFNA 3EDRA 4KLZA 2IP2A 2JFBA 1QG6A 2C7BA 4NFHA 4ZCMA 4LFBB 1L4HA 4ME6A 2Q3LA 1W85B 2VH1A 3IRUA 4ARAA 5JIBA 2ZAOA 1XIVA 4GF5A 4WBNF 1VSVA 4URWR 2JFYA 3OFSA 1SKYE 1W87A 3M6VA 1WB5A 4IGIA 1T0IA 3WRXC 1U0SY 3L92A 4KIUA 3VR4D 3PA8A 3B1FA 1P80A 1JHRA 3AESA 4FOSA 4D9CA 2VLIA 2O05A 4IXMA 4ABTA 2R4TA 4MWDA 2BMWA 4IFBA 4UQLA 1W30A 1FW6A 4JUBA 5CGZA 1EPUA 5FLKA 3A9RA 3MS2A 3MGAA 1U8FO 5G4KB 1P74A 2VC2B 5G3ZA 3G9XA 3L6RA 1FDUA 2RG7A 4AQ7A 2FP4A 1TQ2A 1AUXA 2ALJA 2I87A 1KGDA 2B61A 3OY2A 5F33A 1YI0A 1KTIA 4BMDA 2YIMA 4GYKA 5K8CA 4HLNA 1EM8B 4Z7OB 1YK1A 3HUFA 4ZO4A 4FDLA 3E58A 2GNPA 1TO2E 5AKYA 1PP4A 5LIRA 2QT1A 2OB1A 3EEQA 2EYQA 4OHVA 1QX3A 1QGUA 3EW9A 3NYWA 1KK0A 4II2A 2D0OB 5EPOA 1T4DA 2Y1LA 3BCHA 3H1FA 3WG9A 1NQAO 1RRVA 4M22A 1KC1A 4D96A 1NXQA 3OWOA 2A58A 3QKRB 4L4SA 2FWBA 1JLLA 1AG9A 1OPRA 3EDYA 4EO7A 4N7JA 2QQ0A 4PZCA 5ES4B 1OTXA 1XL0A 4C4PA 2Z2ZA 4XFKA 4YLGA 4N48A 2R6HA 1KSJA 1QMPA 1M1YE 4MR9B 4OM8A 3P19A 4BCBA 3BRWA 4D45A 2CN1A 5HK9A 1A71A 1U5BB 1XJ5A 2MYTA 1SO8A 2B7BA 2P9QA 2PKWA 3FR8A 1L5ZA 3E03A 3VAYA 2JGNA 1SJ9A 1J97A 1LPPA 3EGXB 2ZTSA 4JLOA 4O2BB 5HJ2A 5A2QA 3TR6A 1WZEA 1OX4A 3LDUA 1SBQA 4DWVA 3GJRA 4MA0A 5CNJA 3E7PA 1L7BA 5JUWA 2GAIA 2BMFA 2VL7A 1JHOA 1DQNA 1L4LA 2Y6UA 5I9IA 3VH2A 4AZSA 3CLRC 2IIPA 1ZUHA 4UXHA 1Z83A 1CYDA 3PXXA 3VYSB 3O1LA 3ANSA 5CD9A 5G53C 1EHIA 4O59O 3RVDA 4F3NA 4HLQB 4BFLA 2QZ9A 4C7MA 4QO7A 1XPOA 4M76B 4TKZA 2HSWA 2X4DA 2ZR0A 5A62A 5HZMA 3C8MA 1R4MB 4K6MA 4JU9A 5CB4B 3MWJA 5JVDB 1MX9A 4NU0A 2H0AA 1V45E 1VZ3A 2PCJA 4Q5IA 3RUCA 1EU1A 3Q87B 1WU8A 1XTPA 3FI0A 3SIRA 4D81A 2WUDA 4R2WA 5JD5A 1K92A 4EEXA 2XWPA 3B3JA 4ZPXA 4DTCA 3ZDDA 1CEYA 5L6MB 3GO4A 1WD5A 3TSOA 1A4UA 1URPA 1NMYA 4B46A 2E2WA 2C4MA 1M74A 4MYRA 1QH0A 3EUWA 5JPCA 2DX7A 2NVUB 4OXQA 2EBUA 1WUIS 4AUNA 2EEPA 2VF8A 2PKQO 4EBFA 1XD2B 4MS3A 1ICIA 1L7MA 2LXNA 2QAJA 2H5EA 3IB6A 1VL2A 4Y98A 5A3RA 3MT0A 2BFOA 1RQLA 3N58A 4YXWD 3AOEA 3M6LA 2UXDB 1XJWA 2JH3A 1YRLA 1VB3A 2X4LA 4EO4A 1NW8A 5IKEA 1T2DA 5JTUA 5KPJA 3W3AD 2PD4A 2Y1KA 2E82A 2ZIGA 3W0LB 3V8EA 2JLRA 3ACDA 3NH6A 1CK4A 2BMVA 3N8HA 2NO1A 2UZIR 4F56A 4IIHA 4Q4JA 5CHYA 5FPYA 3K30A 4WBNB 3A1UA 3HSYA 5K0CA 3HMQA 2J4FA 3MNFA 4B34A 4DSAA 3AEQA 1M0SA 2EL9A 1WCYA 1OJLA 2PT7A 2YS6A 1YJQA 1DXOA 3AM4A 1Z4JA 3WGYA 4LPSA 4UW9A 1CRPA 3O9VA 4RSRA 3JD2A 1NQTA 4MWGA 3LY9A 2HLNA 2VRNA 1SHUX 4OH1A 3DSRA 3P0RA 1DQYA 1K8RA 4FGZA 5AT1A 2QR5A 3RIEA 4C4YA 4CLEA 4NX2A 1TUBA 1SVWA 5LBIA 1GN9A 3U19A 1ORHA 4YMUA 3RRZA 1VRVA 1TMOA 4KQHA 5ALNA 3ABSB 3CE9A 3DF7A 4P98A 4C4XA 4CZ2A 2HU2A 1CUDA 1U2RA 2BFBA 5TGTA 4TKVA 1K9SA 1FX0B 2LBPA 3ND9A 1P2BA 1SBZA 2GM5A 4GSLA 3U7QB 4DBZA 2FPRA 5AVVA 1W85A 3RREA 1I2AA 3GL9A 3M6WA 5EE0A 3A4LA 1K6XA 5JISA 1LC3A 3ZH2A 1QHSA 3GT3A 3PEFA 1N3YA 1PT8A 1Y5IA 2VDKB 3D64A 4K1XA 4XX1A 5K99A 3VKHA 3DL2A 1F4LA 2QD5A 3ZIUA 1XB2A 4A9AA 1U65A 2W4IA 2IDMA 3GGDA 2ZRJA 5FPQA 3ZVRA 3D6AA 3NC1C 3WZLA 1XJ0A 4D4IA 1MDBA 4DQXA 2G4LA 1VIYA 2IYSA 4ARSA 4W5QA 1BN7A 3W8NA 1BDJA 5IWAB 4H1WA 5BN5A 1ANKA 3V4RA 2XOEA 2XEXA 3DMYA 4XUDA 1RMTA 1QC5A 2FWPA 5DCLA 1R0BA 2OY0A 5FBWB 3BORA 5CFRA 3O8OA 3CSDA 3EMDA 4MEBA 4TV9F 4MWZA 3BJEA 4Q18A 3VDRA 2E7ZA 3WBKA 5ARBA 3E81A 3WHPA 3A6PC 3VSDA 1UFOA 1HURA 2P3QA 4NENA 3R75A 3WYGA 1F6BA 2NO9A 3MA0A 4HB0A 5LLDA 1T35A 3ZVLA 3SQXA 4OYRA 4L28A 2EHDA 5DBIA 1ZVVA 1WF6A 2PSJA 3DVRX 2VHEA 3C7DB 1LNQA 2PS1A 1JQEA 4POOA 2ONKA 4YXWA 2XA2A 3WIBA 5AYVA 2C03A 1HQCA 4ZCPA 3IOBA 5U4QA 4CIBA 5CDSA 1JIKA 3EGWA 1Q22A 1WXWA 4AI6A 3H18A 5I3CA 1OKKA 2KPOA 2PUHA 4AO6A 3EXHB 2IW1A 1TL7C 1PJ2A 3YASA 5BWOA 4MTCA 1Q3TA 1RJ9B 4PPNA 5H9WA 3EASA 4IW3B 4BIIA 4LK2A 4XM1A 3GA7A 3TQIA 1DCKA 4OY3A 4R1PA 4XWTA 4BMOB 3QWIA 4V2UA 2IYLD 4NJMA 4CQLA 2YXDA 2CL5A 3HLTA 1WULS 4MW1A 4X6LA 3ONWA 4KLNA 5JVDF 5IVKA 4AYXA 3OCCA 2PWYA 1OF1A 1WMFA 5FO0A 2PUGA 4JP1A 4PY2A 4U2EA 3TQTA 2ZSDA 3I42A 1U7HA 4J0DA 4B33A 4S3MA 4JJ7A 5AVTA 1QDUA 3CR7A 1GWNA 4Q3OA 4V0LA 1P5RA 3WQHA 2AUMA 1R16A 4LMAA 1VMIA 1YZGA 4RANA 4OQMA 3C45A 4OL9A 1YB1A 1ZUWA 3HR4A 1KH3A 3EW7A 3K2EA 5BYAA 3HTXA 2I1LA 1ZPDA 1ESZA 2QV0A 1DKQA 2Z4TA 1JUDA 2JKVA 4OQFA 4EZBA 5K0BA 3AEKB 3KXLA 3FB4A 1E9RA 1MO6A 4F9FA 1NFQA 3DVAB 1WETA 2FZLA 3QX9A 1QGUB 1RE0A 3RJ5A 4FM9A 2GYUA 2Q9CA 2ES4A 4G9GA 5F3RA 1T10A 4AZTA 5F2NA 2DERA 2XZOA 4PYIA 3GAMA 3CUKA 3KYCB 1QSGA 3O8DA 4WINA 7AT1A 1BFKA 4Q7MB 3T1YB 1JB9A 1Y3BE 2AZXA 1JHQA 2O7QA 4TM7A 1GYRA 3IURA 3LBAA 4AZ3B 3PSHA 1EIWA 1NF2A 3DOHA 3AUKA 4ZO6A 1Q17A 1M6VB 1W59A 3R5TA 3PEYA 5I8PA 2BD0A 2GJKA 4BUCA 5A9SB 3LA6A 5BXQC 1Q0SA 3PJGA 3NGLA 4MZDA 4I5GA 5GZ3A 1P1RA 2IWHA 1KETA 5A5VA 2HBQA 4OYHA 3A1VA 3M2TA 4QLOA 3UK2A 2PKCA 2ECKA 3SMQA 5CA0F 1A04A 1I2ZA 1XFAA 3ZR4B 1AM4D 2O3QA 4FT4A 4ZFNA 1KAOA 2C7GA 3COWA 4CEHB 1XDGA 4XJVA 5AOAA 5AHWA 3KQKA 1Z9BA 3BB3A 3S44A 3I58A 1VJRA 3VU1A 4HB3A 1ITZA 3IT2A 1L1EA 5T67A 4FGKA 3CH4B 2PD6A 4IIJB 1U0EA 3ZGXA 5DWVA 4D82A 3ZHUA 5A0VA 1KI3A 4PIPA 4U6SA 4X1YA 1NVVQ 3RFFA 1RKXA 2BI4A 4XFJA 2Y68A 4CT5A 3TW6A 3HVJA 1ML4A 4DRXB 1KJIA 2ORED 3ZJ5A 2H7VA 2VRCD 3VYTB 3TAXA 4DDTA 1MJ5A 3QPWA 1PFGA 4FOOA 3SDSA 3ZU2A 2HYDA 2C20A 3CUTA 3UYKA 1BMFD 2CUKA 4KO1S 4GRDA 2PHZA 3O82A 2J9RA 1R6DA 3VJMA 1LQUA 3ZOZA 3NEJA 1PQ4A 1A1SA 1ORVA 2VHVA 3AJDA 4KXQA 3TJMA 6PFKA 1VG1A 2RC5A 1GHTA 3A4YA 1DWUA 4JY7A 1O6BA 3MCZA 5SY6A 3SLGA 1BVRA 1E89A 1F8YA 1QO9A 1XZGA 2BF4A 3ET5A 4N7BA 3ZGNA 4C0KA 3U3KA 5KTKA 4PCVA 1ZR4A 1BKDR 1BXGA 3IPAA 3OBBA 3OM1A 1YS1X 3DLAA 2BWJA 3U7HB 5E9AA 1FYDA 2J31A 1FDIA 2Z09A 5JJ5A 2B8JA 3R1IA 4JODA 4M36A 4KLCA 3PUHA 4G41A 4GPAA 3UJBA 4NV0A 3RFXA 3RVKA 4MGHA 2HFJA 3PUWA 4JI1B 5CR9A 4F96A 4RY0A 5AXDA 1K8YB 2RAUA 1HNWB 1R4NB 4WFKA 3HY4A 4K5QA 1UM9A 3E9CA 4ES6A 1Z0UA 4BFYA 1IZ9A 4FFDA 4XIGS 1GAJA 1SC3A 5EMNA 1U90A 4WOJA 3VHXA 1HE4A 2YMLA 1UM8A 4LRWA 1JI3A 2QY9A 2WJWA 3LF2A 4MUBA 4WECA 3VPGA 5AKHA 2DCMA 5KNLA 4LYEA 2Q4TA 4HDMA 1Y3IA 2V5VA 2AMJA 3FB1A 1NUUA 4ZEOA 3PDHA 2W2NA 2XY4A 2YOHA 5L4LA 2VT6A 3QVOA 4QUGA 3RS3A 3DWGA 1KI1A 4BMZA 4OPMA 4WOBA 4ECAA 2J3JA 3PX3A 4B7CA 4OD0A 1LLCA 4S1WA 1MAVA 2QUJA 4KNWA 4OKIA 1EGMB 2OESA 3TTUA 5JEEA 2QJTA 3S1SA 2VJOA 3PU6A 2V7XA 3EY9A 4RK0A 2PXCA 3WGJA 1NMZA 1X7ZA 3KD3A 4UHKA 2ZBGA 3NI2A 3GEGA 2HREA 2H1WA 4X62B 4OMFG 4LF5B 4MPJA 4PNZA 4RPHA 1UBSB 2R6DA 3VGPA 2X2OA 3ICWA 5FT9A 4EJ0A 2WQZA 1UKCA 1CR6A 1YU6A 3M1YA 1QJCA 3B6ZA 3SQNA 2JCBA 2A84A 1OWOA 2FDRA 4CLRB 4QRHA 4DLZA 1WBDA 4WJKB 4GMXA 3VTKA 1OX6A 4MVJP 1NVEA 1RAIA 2C1EA 4DEYA 3DAPA 2WPDD 1D04A 3DGFC 1OWPA 4BZPA 3IODA 4OXNA 1C7IA 2XA9A 1EEHA 5AI4A 5GOZA 2BF7A 3IALA 3IVMA 4QJIA 5D51S 5K3AA 1GA4A 2BP7A 2ZSEA 1HT0A 2Q3EA 3HCCA 4JLVA 4DA9A 1NI4B 2W00A 2QTVB 2ZJ6A 2H5LA 3UATA 1JT2A 4RA6A 4Y6SA 4DUZB 1IU9A 1W4LA 3FGNA 4K9MA 5JS2A 3EXG1 4OJKA 2XKJE 4FB5A 4URUR 2OO3A 3A6LA 1VE6A 2CHUA 3LSTA 3OJCA 3OJLA 3TE7A 3G79A 4EOGA 4KMMA 3CLUD 1AK1A 3BFJA 1EE2A 1ONOA 4GRIA 2AN4A 4ZYLA 1GNQA 2XMCA 2X86A 1HL3A 5JRDS 3KZVA 2JFVA 2XDAA 4KMSA 2IYTA 3COSA 5C53B 4JXZA 3SE7A 5A4MS 4EFNA 2ZUVA 2FFAA 1CZUA 4M9SA 1JQ3A 1CFJA 2ZBEA 4RH3A 2BTQA 2ENUA 4C43A 4KQ1A 2HJWA 3AG6A 3C85A 3ONVA 4N5DA 4KG7A 5DBFA 1IM2A 4ZQGA 5BMOA 1PV4A 1RXEA 4GUAA 1TCVA 4N6GA 1F8FA 3TFQA 4TXHA 5CT9A 3OEYA 4GPBA 3URKA 1GL7A 1NXOA 1VBFA 4QPNA 4I8DA 4J3JA 1F1JA 2ATCA 3BXPA 5AXBA 1NTRA 3MJFA 2G8LA 1KZ7B 1P9RA 2PRKA 2RARA 3MAJA 3PL5A 4HP8A 1CY6A 2JKZA 2HU7A 4UAGA 3RYIB 5K5EA 2QVGA 3P2EA 2R5WA 3EMVA 1N0UA 4HEJA 4O3FA 3OCJA 2V6IA 4V0ME 1W1WA 1G8JA 3RVRA 4BV8A 1EK1A 2HJHA 4UDYX 3WJAA 1N7GA 2OV3A 3DKRA 4GH5A 3ESBA 3V4OA 2D1FA 2EP8A 3RE1A 3ZHBA 2JB9A 3DNMA 1YZKA 3GX1A 1E7QA 3RVPA 4IIFA 4E4TA 3G9UA 4DJJA 3J81A 1OH6A 1PJSA 4BQSA 1E8MA 2D13A 2JD0A 1ZUIA 3KU1A 2W8ZA 2OECA 1P9OA 3ZKAA 1RXWA 2ACWA 2QUIA 3DEYX 1B3RA 1II8B 1II8A 2QUKA 3Q7QA 4IJQA 1H23A 1V16B 3DO5A 3TCXB 4XD2A 1WBJB 5PNTA 3WRYA 3LTNC 2WD9A 5IJ9B 1PVDA 1JZSA 1GPLA 1YR3A 4JK3A 2FW8A 2NACA 2ZBFA 1CS4C 4YP6A 2NNWB 4V0SA 3TBHA 5T64A 4YRIA 3I30X 5MFPA 4CEIB 1BDBA 1KJYA 1XMVA 4EO9A 5CB4A 3HP1A 1EVQA 2O1SA 4MUIA 3P4YA 4BVJA 2F3PA 3CX6A 4TLEA 2C2WA 2C61A 3DBLA 5HQJA 1XDDA 5AI6A 3TQHA 1MB9A 5IBQA 5HFAA 4G63A 4OAPA 2B1GA 4KGZA 1YKGA 2JGAA 2NG1A 3HA5A 4RK6A 3U1VA 3EEIA 1XTIA 2BL4A 2VUTA 4TTVA 4NBRA 1YL5A 1PV2A 4ML3A 5FLEX 3SM9A 5C3MA 3SHOA 4ETIA 3WLTA 1CCWA 5BSVA 1J2YA 2AI1A 1Y8QB 2OYSA 1E1KA 3IPRA 4M0PA 4QRDA 4RUKA 4UCQA 3OQOA 2XRMA 4HZUA 4RULA 4G0WA 4BWVA 3TJRA 4MW0A 3ASVA 2MCFA 4CF4A 2AZDA 4QUJA 3WLSA 4QUAA 4RJIA 1Z5OA 4FZRA 1CNMA 2R62A 3P9KA 3ZWCA 2BFAA 4F2PA 1POXA 2QORA 3W6PA 1W4RA 3EODA 1YGPA 3QKWA 5C4MA 1H93A 3RG8A 2J5QA 2YBEA 4OLJA 3BZBA 2M6SA 1A7UA 3B7GA 4GNRA 4IILA 1V6SA 3GROA 3IP9A 5I45A 4F4JA 3R2JA 3T94A 4HAVA 5GPBA 1P3Y1 1AGPA 5AH0A 5BYKA 4CG0A 1PJBA 1H9BA 1LJLA 1RADA 5D1NA 2CCGA 4Y1FA 5LDGA 5TS2A 3S2YA 3GPCA 4M2LA 2D4AA 4GEKA 1KHHA 5EVCA 2EYUA 3VOAA 3KALA 4D4HA 3DAFA 5LJIA 4IZ6A 2GBGA 2IY9A 4LRXA 1V6AA 4ZAGA 5ABPA 1E5VA 5GJBA 3KT3A 1R27A 3RUFA 1I4OA 2TMGA 3KJZA 4DM7A 1Q3HA 2QLMA 4HGPA 5IAAA 1Z38A 1UZLA 4O4LB 2WNHA 2NIPA 3RSGA 3UJDA 5J3JA 2JARA 5CB4F 3LX4A 5A1TA 4UHEA 2G9ZA 5K8UA 5C81A 5FL7D 1WCIA 3NV9A 5C8XA 3KC2A 1VKHA 4C0XA 4D26A 1XF9A 4RDHA 5AUOB 3I83A 3BL8A 1B0AA 5EKUA 3A3YA 3GRVA 4YFVA 1B0ZA 1W0JA 5LQRA 3WI7A 4EP1A 2F3RA 3IILA 2REXB 4UVGA 1NNLA 2CXTA 3WGGA 1W1UA 2NV6A 1G8FA 1JDBB 1VPEA 2YS7A 5BVGA 3HJNA 1YVRA 2HSEA 2RGGA 2R6AA 2VCYA 4WEQA 4OHUA 1Z62A 5EIBC 4EVQA 1JAZA 2C4KA 5B6IA 4JFRA 4N3CA 4QU5A 4EJSB 1W9HA 2ET6A 2GARA 3TVYA 1JS1X 3QJ5A 3GBSA 2AI2A 1JB1A 4K26A 5ALYA 3RRNA 4KZKA 1YRAA 3T3PB 4RMNA 5KYGA 4E14A 2BFMA 3QKRA 3VC3A 3H8SA 1S8FA 4I19A 2RHBA 5KQGA 3NWEA 1TADA 4KXWA 3L41A 5LPNA 1U6KA 2A5GA 4XQ0A 1Y7HA 5BN3B 4CI9A 3W8RA 1GDTA 3TIIA 1AZTA 3QG5A 1HX7A 2Q8PA 5CCXA 5AK5A 3TPFA 3OZVA 1L5GB 1AA6A 3KKLA 1JHDA 2BVNA 2VWGA 3M3PA 4OXYA 1B6SA 1E7WA 1XLTA 3MSCA 4GG1A 4UHDA 3WIVA 4BGIA 1QHHB 1YKSA 4D8WA 3ND8A 3Q6NA 5BR7A 2IUSA 3URMA 3LP6A 2DUNA 3BB4A 3TVTA 1DP4A 4AJ4A 5CURA 1Z5UA 1XJQA 3IQGX 2HEIA 4IG4A 2PRJA 3FROA 3EPKA 1TZMA 4FYKA 2LV8A 4RHTA 3GRZA 4Q82A 2ZS9A 1Y33E 1U4NA 3DBIA 3IESA 3BK7A 3WRYC 1Z2NX 1K27A 1YCFA 3QBEA 3DH0A 5GM1A 4FEAA 3OE7D 2ZPUA 5ADWA 1QE5A 4C7VA 3DE1X 2HA0A 4ZD6A 2JI8A 4QAQA 3H17A 4LGMA 3PENA 3V8BA 1O6CA 2DBRA 2C83A 4F91B 1USIA 1RKUA 1TCBA 2YHBA 4E11A 1Y4UA 2CBXA 3WAGA 4BLPA 4L3OA 1D2NA 1GPKA 3UJ3X 3V34A 3AI2A 1R8SA 3KE9A 1GNPA 2IZ0A 3I2YX 4YWHA 4CTNA 1CY2A 4JELA 4P81A 1U5CA 1PR2A 1ZN9A 1PGOA 1ZZGA 3H2GA 1FFDA 1NOKA 3SF8B 1J22A 5CYFA 2FLKA 5DTIA 2GN1A 1JKFA 3VSBA 2A3RA 2W70A 2XE4A 1PR9A 1EVJA 4WV3A 4CG2A 1UKBA 4ZVRA 3OJWA 1DMSA 1KARA 3NO4A 3CT6A 4JBNA 3EXAA 4WT7A 1BQ3A 1EESA 2PRYA 2IVFA 2OZKA 5DX0A 5HHTA 3LE8A 2VI5A 3CN9A 1PHRA 4NBNA 2HN9A 3O2SB 4MGYR 4ZIRA 4C5BA 1CUUA 4NTZA 1FUUA 4RTQA 2HLDD 2XGJA 2J4CA 5ALKA 1BOFA 3RABA 3EMKA 3E70C 3G5LA 4BIMA 4WFQA 5J59A 3F8WA 3H9QA 5AK3A 5EL0A 5K3EA 4CUZA 4AKGA 4Q3KA 1M0EA 4R2KA 4OSEA 2WHEA 1A7JA 1JR3A 1C30A 1T0JB 1WQ4A 2H4JA 2IKSA 4HNRA 4LYJA 2OHVA 2QJOA 4PTZA 4KR3A 4S12A 1TJ5A 1HM5A 1PZEA 3SQOA 1HFEL 4AZ3A 4ZMBA 2FQWA 1CUHA 4I50A 2ZRIA 4Q66C 3PPWA 1VCMA 5CH3A 1AKRA 1ZA2A 4AVYA 1E1QD 3QOWA 3S2UA 3VO2A 1HXHA 5A2GA 3LQ4A 4IWNA 2ZR7A 1X3SA 1QFZA 1BN6A 3JCZA 3RRBA 5FPKA 5D3MA 4YNBA 1RM0A 5B7NA 4R31A 3CTMA 3UWDA 1ZVMA 1BXRA 2X40A 4OXXA 3VPFA 4EUFA 3TB4A 4ZICA 1T1SA 3PHCA 2Z5LA 4OKNA 2P62A 3NKFA 1XQYA 4Q21A 4X3PA 3TZCA 5F7ZA 3RUPA 3M83A 3CJRA 4XFDA 5JXIA 2W0MA 2P90A 2QHXA 5B58C 5I3ZA 2OZEA 5BXYA 4U0KA 3FN4A 4BNYA 3KB6A 3VNUA 4YJFB 5L3ZA 1YMVA 1NN5A 1B8OA 3ZWWA 5AJYA 1UM9B 3QI7A 1T0UA 1DCFA 1E0DA 3KUUA 3SBXA 2F17A 1P4SA 3FDJA 3DE6X 4WUTA 3GA5A 2XCIA 3BERA 3E8XA 5EQDA 4WZBE 4UZSA 2VZ0A 4J4TA 1P8AA 1ULUA 5EUBA 4EHJA 1DC7A 3GLHB 4YMVA 1WD7A 1MHTA 1QYIA 1YOBA 2ATEA 4GOMD 3UT5A 2J6CA 2Q6OA 1BX1A 2XWQA 2F3SA 1N1GA 1EWYA 1GSHA 1V6CA 1XRQA 3K0AB 4DTIA 2FB9A 2V7QA 1OILA 2WAXA 3M9XA 4NFLA 1IB6A 4PRLA 4QUIA 1OB5A 3ZN2A 1MO3A 2YV3A 3WXMA 4HH1A 1QB7A 4PYNA 2H7XA 4RA6B 1YF3A 1GPH1 2B94A 3WGLA 2PBLA 3L0BA 2DPYA 2XSZA 2ZSJA 4PU0A 4YECA 1GNLA 5EXTA 4K86A 5TPWA 5IU6A 1Q1AA 4QDKA 5CH8A 1E1CA 2IIQA 3LH5A 1KDRA 2V97A 1N0WA 3DFMA 2CDNA 1FC0A 3S1AB 4CQJA 2I8CA 2L69A 1ZKDA 4KFRA 1XTBA 5T57A 2HMYB 1V1RB 4DRZA 5DBGA 5L3QB 1O4WA 2P5SA 3N2ZB 3VR4A 5DFAA 2Z8XA 5BN5B 4HQOA 3KR9A 2X7JA 3QTLA 4DQLA 2P4QA 4JNCA 1BE0A 3KQTA 5T41A 5J5VA 3W2TA 2OZLA 3BRSA 4DV2B 1KO8A 1ZXXA 4BTLA 2O5CA 1GUZA 1YT5A 2BHLA 3KT0A 4MAAA 4C89A 1RYBA 5EG5A 5LUAA 4IWYA 4MRNA 3IUNA 4AKEA 2CZCA 5HKKD 4B3IA 1A5SB 1DQPA 4RXUA 3NPMA 3W2FA 2NP6A 1JNYA 1RYZA 3W3AA 4JT4A 1E60A 2GNAA 2M9MA 3U4GA 3WGOA 2QW0X 5KKCA 2PUFA 2Z1NA 1N1EA 4YRAA 3AUTA 4X6YA 4X0EA 3LBHA 3KIPA 1J00A 3CJTA 3ZEIA 4GDFA 4U2FA 1BAPA 2DQ4A 5ITVA 3GK3A 2AOVA 2WF5A 1WXXA 1SB8A 3E15A 2Z04A 4Q1FA 4U3JA 2Q0HA 3QU9A 2WVGA 4ZT2A 1K89A 1FEZA 4F3RA 3O75A 2Z2KA 5F1YA 1C1XA 1CJUC 2BZSA 1KEUA 2C1XA 2I76A 3OD1A 5AI5A 5EI5A 2UVPB 2UYGA 1JJAA 1Z45A 3CKLA 5E4TA 5FFFA 1ST3A 2QJRA 3O8LA 2FRDA 4I1PA 2AVNA 1TO6A 4JGGA 5FBHA 3WB9A 1DKNA 1EHYA 3DCIA 2DC1A 4LKOA 3OUUA 1PDVA 1ZSVA 3A7DA 3HCNA 1T9BA 4HH3C 3VZPA 5BW4A 3NHBA 5JCPA 4XWWA 1F0YA 3EBPA 4DY4A 4WBSA 1JJVA 3PE3A 4MQLA 1LLFA 2I55A 4QJ4A 5AK0A 1XXHB 4H6PA 1VSBA 3TOCA 4YRBA 4TTPA 1JLLB 4N8SA 4BKMA 4CL3A 2IHUA 5AW0A 4OGFA 5HSGA 5AJUA 1MH9A 1S2GA 2XRYA 2P2LA 4ZJYA 1G2QA 1M6HA 1YS6A 3DDHA 4UCWA 2WWYA 1MJNA 4AKHA 3DOCA 4YB8A 1RLTA 4Z3OA 1HE8B 1KJWA 3V9AA 1X6VA 2V4ZA 4A36A 3ICVA 1R0XA 3QUCA 3H4TA 4CIYA 1T1EA 1BEEA 1SKAA 2CHGA 2D1QA 2IE8A 3G89A 4FTWA 5J43A 4F7DA 1NONA 1W5EA 1ZD8A 3AR8A 3NG1A 4TWIA 4CM4B 3MB8A 1PFVA 3AW9A 5DYWA 1QVAA 2XE7A 2K2QB 4LSZA 3WGTA 5FTWA 4E1AA 4JHXA 1C14A 4E7OA 3MN1A 5F35A 4HX9A 4JEIA 1XVTA 4S24A 2QAGA 4EYKA 3EY4A 1DO0A 4IGAA 5K0LA 3RSHA 4X24A 1DX4A 4ZIRB 1LF5A 2AL7A 4QE3A 2PUTA 1NZDA 2HXYA 2J46A 2XA1A 1ZG3A 2FQQA 3L8DA 3LZDA 1YDEA 3PGVA 4JA0A 3D2BA 4KGDA 3ZXUB 3THXB 3QFTA 4OHCA 3ROPA 4F9TA 3ACCA 2HQSA 2EATA 1T9ZA 3NTUA 2X0RA 5EY5B 1QPGA 3NEPX 3R8CA 4NYIQ 4RKEA 3E2PA 4PF1A 1V7PC 2NTYC 1VLLA 1CUZA 2LIPA 1PWYE 3HXTA 2ZUWA 2G40A 4NKRA 4IX1A 4GEGA 4XPZA 2QGZA 2TYSB 1NKSA 3ELWA 3GDWA 4J7UA 2FTKE 4HJXA 5DNVA 4JCOA 1AKUA 4DLBA 3GMSA 2G1PA 2J5KA 2RGBA 1E1YA 2XXJA 3IAM1 1P0QA 1X1AA 2D3TA