2VATA

Crystal structure of deacetylcephalosporin c acetyltransferase in complex with coenzyme a
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
376
structure length
347
Chain Sequence
b'NRFEASLDAQDIARISLFTLESGVILRDVPVAYKSWGRMNVSRDNCVIVCHTLTSSAHVTSWWPTLFGQGRAFDTSRYFIICLNYLGSPFGSAGPCSPDPDAERPYGAKFPRTTIRDDVRIHRQVLDRLGVRQIAAVVGASMGGMHTLEWAFFGPEYVRKIVPIATSCRQSGWCAAWFETQRQCIYDDPKYLDGEYDVDDQPVRGLETARKIANLTYKSKPAMDERFHMAPGVQPIEAVSSYLRYQAQKFAASFDANCYIAMTLKFDTHDISRGRAGSIPEALAMITQPALIICARSDGLYSFDEHVEMGRSIPNSRLCVVDTNEGHDFFVMEADKVNDAVRGFLDQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYL-COA--DEACETYLCEPHALOSPORIN C ACETYLTRANSFERASE
publication title The Last Step in Cephalosporin C Formation Revealed: Crystal Structures of Deacetylcephalosporin C Acetyltransferase from Acremonium Chrysogenum in Complexes with Reaction Intermediates.
pubmed doi rcsb
source organism Acremonium chrysogenum
molecule tags Transferase
total genus 128
structure length 347
sequence length 376
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.3.1.175: Deacetylcephalosporin-C acetyltransferase.
pdb deposition date 2007-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vatA00
1W6RA 1GZ7A 2PSFA 5AK5A 4KYVA 1KU6A 3H2KA 2D0DA 2XQJA 2XQIA 1MAAA 5CW2A 1XQXA 4NMWA 1CUDA 1HDEA 3AIKA 4XWGA 4DNOA 4HRYA 4BCBA 2FUKA 3BJRA 5CT4A 2XUOA 1U2EA 4JH0A 1LBSA 4K5QA 3EQ9A 3HI4A 4MQMA 3WWDA 3G8YA 5DWDA 3T4UA 1TCAA 1YB6A 2ZJ7A 4ZWNA 2OCGA 2PVSA 4ZRDA 3G7NA 1XZKA 4X6XA 1WPXA 3WK8A 1K6EA 4Q3KA 1DU4A 2Z3ZA 1MX5A 1QIDA 1LLFA 4DMCA 5LZ5A 1XZLA 2QVBA 3H18A 4OU5A 5T4BA 4FNMA 2ZVDA 5CH8A 4OB7A 5D3ZA 3IIIA 5BOVA 2O2GA 1A88A 1YA4A 4K6HA 3OM8A 3WMRA 5T4FA 2WUFA 1Z68A 4FNGA 4OSEA 4IHAA 4FFWA 4GI1A 5AKGA 1CQZA 1PV1A 3LLCA 2XB6A 3O9VA 2Z3WA 5AKHA 4BZZA 4DGQA 1FJ2A 3HRHA 3QMMA 4CIBA 3GBSA 1AURA 1MX9A 5IVDA 2RONA 3YASA 1ETHA 1EVQA 4K6GA 1DT5A 1QIFA 2VQ6A 3R3XA 5DNWA 2HRQA 3P2MA 1GKLA 1BU8A 3CN7A 3D2CA 3I2HA 4MWTA 5AIBA 4FMPA 3W2TA 2WLSA 7YASA 4BBZA 5IVHA 3EQ7A 3LCRA 5IH7A 4X92A 3PF9A 3ILSA 2XMQA 1S8OA 4TGLA 1GGVA 3I6ZA 4FLFA 4TPKA 3ZWQA 1AUOA 5ALOA 1XZHA 2J3QA 3VXKA 4OUKX 4J0DA 1Q83A 5ALSA 4ITVA 2HHAA 3QVMA 4UHDA 3H2IA 3I28A 3C87A 1QIKA 4P08A 4AZ0A 2RI6A 2CBGA 2DSNA 1CUEA 3AJAA 1E3QA 1LZKA 4ARAA 5D7BA 2ZYSA 3PUHA 1J1IA 1O6FA 1MNAA 1QTIA 1A8SA 2HU5A 3BF7A 1FFEA 2PU5A 3H17A 4RPCA 2OAEA 2I78A 1CEXA 1SFRA 4B84A 4QDXA 2BJHA 2XQFA 4PSCA 5CRIA 1W4LA 5C8ZA 2QJRA 4LIPD 1JI3A 1QO9A 1UK8A 3FSGD 4J0CA 4CI9A 3STVA 4G9GA 4E11A 3AZPA 2Z8ZA 3WYDA 5ALUA 5K3AA 3WI7A 5H3HA 1MO2A 5AHXA 2IITA 3BXPA 3FNBA 1B6GA 1UXOA 2C7BA 2P8SA 4KEAA 4MWSA 1DQZA 4U2DA 1LBTA 2AJ8A 3G0DA 2JGFA 5AM3A 4Y2JA 4NVRA 3DQZA 2XUJA 1FSSA 1EINA 1YSCA 5AI0A 5JIBA 3GUUA 3IDAA 1ZGCA 3ZPXA 2OGZA 1IVYA 5A7FA 2PSEA 4V2IA 1AX9A 3PE6A 2AJLI 4UFNA 4JYMA 1R3DA 4DMKA 1XQVA 1IUOA 1CUIA 1W1IA 5K3BA 4X6UA 2OQIA 3OPMA 4AMZA 5CT8A 1YCDA 3WK7A 2PX6A 3QMVA 4AQDA 2DHCA 4AMYA 3TGLA 3FYTA 2CEKA 3WZLA 2V97A 2WU3A 2XMBA 4WFKA 2IIVA 4Y2SA 1B41A 1RP1A 1Y7IA 4BE4A 1IZ7A 5A6VA 4N5IX 5CTAA 2Z5GA 2BFNA 1Y7HA 1YB7A 4QNNA 5EIHA 3WJ2A 5KBYA 3EQ8A 4C4ZA 3R0VA 4UBMA 4BP8A 2PUHA 1BN6A 4XX1A 5F4ZA 1OILA 2XUKA 2WHPB 2V9ZA 1NU8A 5JAPA 3QYJA 1UKCA 2JGLA 3SX4A 4BATA 3DNMA 1VE6A 2EDCA 3OURA 4DSZA 4GEGA 3ZV7A 1IMJA 5A7GA 4EHBA 3QM1A 2W22A 5DYWA 3D7RA 2OPHA 1E8NA 2PKYX 2VEOA 2XUGA 3VISA 5AKLA 3FCXA 2ZYRA 2VF2A 4U2GA 1YASA 4DTCA 1KEZA 5JASA 1UK6A 5C7YA 5FPQA 1W52X 1UT6A 5IVIA 2CUTA 1GPKA 4P92A 5ALPA 1U65A 1Q0ZA 3BWXA 1WHTA 5LZ9A 3PDCA 3N2ZB 1HQDA 4HVTA 1VXRA 1EK2A 1FFBA 2Q0XA 1LPNA 5AI8A 1QIJA 1I6WA 1MU0A 5ESRA 5EGNA 5HQ3B 1P0MA 2DQZA 4HRXA 2FX5A 4H7HA 1DINA 1K5PA 2PM8A 3A70A 1R9MA 4MEBA 5AOBA 1FFAA 2WJ6A 3V1KA 2X76A 3H19A 3I2KA 5E4JA 3O95A 4HXGA 3Q8WA 2DQYA 1T4MA 1E66A 2YH2A 1JMYA 4U2BA 4UBIA 2XMDA 3STTA 2WM2A 3I2GA 3IB3A 2CZQA 2WKWA 2C0PA 4PSDA 2QUBA 1QIIA 4EUSA 2GBGA 3RM3A 1R50A 1LPPA 5AM2A 5AICA 4RE6A 2WFLA 3BDIA 3PF8A 2HFKA 5E4TA 5AI4A 3O4IA 5EHZA 3RLIA 4B83A 4K2AA 2HL6A 4QZVA 4P93A 3PUIA 4QEKA 2Y2VA 5AI6A 4W1QA 1YAHA 2ZYIA 1UOQA 3QPDA 4IO0A 2XT0A 4IQ4A 3IBTA 1CRLA 4GXNA 2YXPX 3AFIA 1H2YA 1XFDA 3R3WA 2VT6A 4BCDA 3PICA 5AM5A 2H1IA 3NUZA 2PU7A 3QH4A 2HRRA 3WK4A 1LNSA 5JD5A 4M0FA 4G1FA 4EY8A 4CG1A 4WFIA 1C7IA 5LZ7A 3I1IA 3MUOA 4A5SA 2QM0A 5HK8A 5ISMA 1ZD4A 3STWA 3G9XA 1GKKA 5AIAA 1T2NA 3V1MA 3AZQA 4Q82A 3LIPA 5DTIA 2PSDA 1CUAA 5EFZA 5HCUA 3DYIA 2V96A 4JUIA 5ALEA 1MTZA 2C5FA 2OG1A 2HDWA 4FDMA 2HA4A 4BVJA 4WCVA 1JFRA 3NWOA 3PFBA 1JJBA 1XZDA 4GHWA 5ALZA 4BYMA 4E14A 4BVLA 4BDSA 2ZJ6A 5JARA 1G5FA 4H7IA 5FXMA 4LHEA 4DIUA 1XQWA 4KR0A 1E5TA 4GW3A 4BTLA 1VZ3A 3QMWA 4Y2QA 4BAZA 4HXEB 4JYPA 4G9EA 4M0EA 1H22A 1XLUA 3A2LA 4W1RA 4L0CA 3WK6A 4Q3LA 5LKAA 1N5RA 2QJWA 3R3YA 1H23A 1H2XA 5ALJA 1TK3A 4DYHA 1TRHA 2XQKA 4Y2TA 2Y2UA 4KE6A 5JD4A 4YK7A 3DDUA 5EHXA 3F97A 3UMJA 4C4YA 1BROA 1FFDA 4CIAA 5CH5A 1N8SA 2QR5A 1WHSA 4KAAA 1YA8A 4INZA 4I19A 2O7RA 4KACA 4ARBA 5ALQA 1ACJA 3I1YA 1IUNA 1XKTA 3QPCA 5E2IA 1K63A 4Y2PA 1SCKA 3D5EA 3HC7A 3WKCA 2OAGA 3AZOA 1X2BA 3CCBA 1CUYA 5ALFA 2GYVA 1XZGA 4GLBA 3AIOA 2GYUA 2XUQA 3V1NA 2AXEA 3OOSA 4UHFA 5CBKA 4AXBA 5AK3A 5AOCA 4X6YA 1P0PA 3IUMA 4J0IA 1XRPA 3ESAA 4UPDA 4X71A 3BJMA 5IKXA 4C88A 4BVKA 4Y2UA 2GZSA 1MNQA 1XZFA 2WIJA 1C7JA 3HZOA 3IUNA 2DR0A 5LZ8A 4Q1VA 1R1DA 2X8BA 4UBNA 4K6KA 4CCYA 5CH3A 1VZ2A 2HFJA 3I2IA 4YX9A 1H2WA 2XI4A 1DWPA 5ALMA 2Y6VA 6YASA 4MXDA 2GBFA 4H7JA 1JU3A 3BDVA 4U2EA 4PQEA 3G9ZA 5AO9A 5I9IA 3NOXA 3LS2A 2PPLA 5CXUA 4RGYA 5EI5A 3CXUA 4FFVA 4RE5A 1XZAA 3GROA 1UK7A 2C0QA 1ZI8A 2CKMA 3ESBA 5A7HA 4BRSA 1XQYA 5C81A 1VOTA 4QLOA 4XIIA 1BCRA 1EDBA 2ACKA 3R3UA 1CUFA 3WJ1A 2JGEA 3OG9A 5DJ5A 1BCSA 2UZ0A 5A71A 3HYSA 5T4HA 4QDOA 3GELA 2VTVA 3C5WP 3E3AA 4DSAA 3D3NA 5EIAA 1MN6A 2Y6UA 3WK9A 2AJDA 3WL7A 3C6ZA 2G5PA 2QUAA 5C8XA 1G66A 1GPLA 4G4JA 1EXWA 3C6YA 5K3CA 2XMCA 1ZI9A 3DOHA 1LZLA 4IH9A 4J7AA 2LIPA 1ODSA 3B3QA 2EDAA 4TVKA 3DEAA 1BE0A 3HSSA 3G02A 4QA9A 3M83A 5ALWA 3WIOA 2OLEA 2RGUA 4GDMA 1ZOIA 2OCKA 4L72A 1XZCA 4PF1A 1ZD2P 4C87A 2WIDA 4QWWA 2XLCA 2BCEA 3DL7A 3R3VA 2K2QB 1J06A 1MJ5A 1ZICA 4EBBA 1D07A 3ZLUA 4AN0A 4H7FA 1QGED 1CLEA 1DT3A 1ODTC 3HXKA 4AN1A 4YPVA 3C43A 3AILA 3FLEA 1A7UA 4O08A 3BF8A 3H1AA 3T52A 1KU0A 2WTMA 5DNUA 1EH5A 2WIKA 3D59A 5FKJA 1CUBA 2JGJA 5ALTA 1XROA 3ESCA 4B81A 3W9BA 1WPRA 2VJBA 2PBLA 1UZAA 1QJ4A 1YS2X 2QKYA 3M82A 2ES4A 1CR6A 2ZSHA 5BWCA 4BAGA 5DNVA 1EVEA 3KXPA 3MGAA 2WG0A 5JZ9A 3VJKA 1QZ3A 4B9EA 2ZSIA 1E89A 4F5ZA 2VAXA 1LPBB 4WY5A 3BIWA 3ANSA 5LZ4A 1MT3A 1BRTA 1Y37A 2OCIA 4ZREA 3GA7A 3KSRA 1VKHA 4G8DA 4J0HA 3EIOA 5HFAA 5JALA 3WWEA 2CJPA 1DWQA 4QLAA 1O6GA 1N5MA 3ESDA 4EB0A 4ZV7A 4S0XA 3FYUC 4X94A 4H7EA 2XQGA 2VATA 4KAFA 2WUEA 4LYDA 4EY6A 1QTRA 3F98A 1ZD3A 3F8SA 2GYWA 3C45A 1DTEA 4JNCA 3IUQA 2PSJA 4N8SA 1QLWA 5HKBA 3DCNA 3O4JA 2JIDA 3A6ZA 3EBLA 4F0JA 2XE4A 4C89A 4FLEA 3FVTA 1A8UA 2RHTA 3WL5A 3FOBA 4FWBA 1XRRA 3O4HA 3DLTA 5CMLA 1CUZA 2XUDA 4GWLA 2QZPA 5YASA 3X3HA 5AJHA 1QIEA 3R40A 5HK9A 1CUJA 1NX9A 3ED1A 3VKFA 2QT9A 2WIFA 3DOIA 2WFLB 2WHQA 3QBJA 1L7AA 4IH1A 1JJIA 4AX4A 3WL8A 3ZLTA 2BUBA 2RAUA 3V9AA 2WHRA 3D2AA 1CIJA 4MQLA 5AK6A 5LKRA 3HEAA 3G0GA 1WB4A 1CUGA 2HU7A 3C8DA 4CG3A 5K3FA 3STYA 1XLWA 3D2BA 5A62A 1LGYA 3I2JA 4FBMA 4X97A 4WY8A 4X95A 5AKIA 1MAHA 3RKSA 3W06A 2OXEA 5ALXA 2XUHA 4EY5A 1GT6A 5DYTA 3WIBA 4LYEA 3VJLA 4MYDA 2BUCA 1QFSA 2WTNA 1CQWA 1LPOA 1W75A 2VSQA 4UFOA 3VVLA 4BB0A 1BN7A 2BGNA 2DHDA 1Q84A 2BKLA 1EDDA 5AKXA 5AI9A 1GQRA 3Q0TA 4WDRA 1AQLA 2XMSA 3ANTA 2R8BA 5AM4A 3CN9A 2CB9A 1BS9A 1F6WA 2JF0A 4Q05A 4N8EA 2X5XA 5HF8A 4U2CA 1JJFA 2HA5A 2PL5A 4MEAA 4BP9A 1AGYA 3WKDA 4J0JA 3OC0A 3DL4A 3KD2A 1UFOA 1HL7A 4HZGA 1CUCA 1TQHA 4G8BA 4HS9A 1XZEA 1N1MA 1EI9A 2XMGA 5DYYA 1F0NA 4FTWA 5ALKA 1ZGBA 1R9NA 3A2MA 3F9CA 4OCZA 4PV7A 5K3EA 5JD6A 1SCIA 2WU4A 4HTAA 2GBCA 2QMQA 2V98A 1THGA 1ORWA 2JEYA 1XZBA 5KWJA 5ALGA 4H7KA 1CUWA 1RWQA 1FFCA 1IZ8A 2RIPA 4AO8A 3VDXA 3CCCA 1HPLA 3FLBA 3FYUA 5JADA 3WA7A 4OU4A 1AZWA 4W1PA 4X7BA 2OQVA 5JAHA 3WWPA 1JU4A 3STXA 5IVKA 5JAUA 4EY7A 3G9UA 1XLVA 4N5HX 5FP0A 4HXFB 1ZJ5A 2HA6A 2H7XA 2ZYHA 5ALIA 3VVMA 2J4FA 1E8DA 4I3FA 3H0CA 3K9BA 4FOLA 5JATA 4E15A 2C5GA 2B61A 2HA3A 3H2GA 2GBIA 1LPMA 2OGSA 3IA2A 1CV2A 3QZUA 1U4NA 3C5VA 2HU8A 4D9JA 1BEZA 4KRYA 2OCLA 1TAHA 5CURA 4UFPA 1QIHA 4MYSA 2VT7A 4QDUA 2YASA 5HF9A 2H9YA 5BWBA 1HLGA 1EB9A 2JBWA 1A8QA 1QIGA 1AMNA 1ODCA 5HKAA 4G8CA 3I6YA 4NZZA 2HA2A 3WWOA 2R11A 3UUEA 3MVEA 3WL6A 4UBOA 3WZMA 2HIHA 3FAKA 5J3JA 3WKAA 2FJPA 4UHEA 5ALNA 3E1GA 4DM7A 2XUPA 2QTBA 4B9AA 5E4YA 3C6BA 4Q3OA 4CCYB 3JW8A 1AC5A 5CT6A 2WG2A 3G0BA 1UOOA 4J0GA 3C8HA 4BC0A 5FPPA 1XZMA 1F8UA 4NS4A 1DWOA 4B0OA 4FKBA 1WB5A 3KWJA 5AH0A 5AKJA 1YAJA 3IUJA 2HM7A 4B6GA 1XRLA 5AKKA 4PO3X 5AKEA 1WCYA 3IULA 2G5TA 1CFJA 1F0PA 2VJDA 4Z49A 2CMFA 4E46A 5D6OA 3F67A 2C4HA 4X90A 1AKNA 4BE9A 4H77A 3PI6A 2PSHA 4UHHA 2G4LA 3D4LA 2B9VA 1UK9A 2B20A 2ORYA 3STUA 2JEZA 4PNZA 1EK1A 1JT2A 2HA0A 4LXIA 5AP9A 5BV7A 1QE3A 5K3DA 4MJ3A 1XKLA 3WA6A 4ZGBA 1CUHA 1VA5A 3R41A 1ACLA 5D3KA 5LP1A 2BAGA 4L3WA 4Y2YA 4Y9SA 4X00A 1TIBA 3FBWA 4H7DA 3C6XA 2XDWA 3GFFA 4WFJA 4GECA 4FLMA 3SC2A 4OYYA 3H04A 4B80A 2XMRA 4PW0A 5EIEA 1Q0RA 3F96A 5ALYA 4QWMA 3HABA 3V48A 4W1SA 2W6CX 4EZIA 4KAJA 2WUGA 3A2NA 4LXGA 2GZRA 3QITA 5C8VA 4FHZA 2WILA 4KJXA 3U0VA 5SYNA 2WSLA 2XUAA 3D0KA 3S2ZA 2FJ0A 4W9RA 4ETWA 1R4ZA 3HJUA 3I6MA 4I4CA 1DQYA 4BZWA 4OYLA 3OTQA 5FOQA 4X91A 1GPNA 1M33A 3DJYA 3B12A 4JEIA 3FLAA 3BE8A 4OB6A 4J03A 2VJAA 2Z8XA 4EY4A 1CUVA 5ALDA 5LLSA 5ALRA 4LXHA 3DKKA 5SYMA 5AM0A 1EHYA 2H7CA 2I03A 4U2FA 1BEEA 4X93A 5FV4A 2VJCA 1OXMA 2XUIA 3O4GA 4QDTA 5AI5A 4BCCA 4KE9A 1K4YA 1P0IA 4F60A 4J0KA 1G42A 3ICWA 5T4EA 2NW6A 1QFMA 3O9MA 1ZIYA 4IH4A 4BRZA 2QRUA 4DLNA 5LYYA 3L1JA 3I2FA 1ORVA 1XRQA 1SCQA 1LPAB 4BTVA 3E4DA 3TRDA 5AK4A 1MPXA 4X3CA 3AIMA 3JYHA 3GZJA 2Y1KA 3K2IA 5KWIA 1QO7A 1GQSA 2WJ4A 4F21A 3HLKA 4PSUA 4XVCA 3BIXA 1PFQA 4Y2RA 3U1TA 1THTA 3AINA 4UBLA 5KREA 4AB1A 1CUSA 2XLBA 4HAIA 3B5EA 2O7VA 4AO7A 1WB6A 3FSGA 5AKZA 4H0CA 4Y2XA 1J07A 4LKOA 4KE7A 4Y7DA 4B85A 4KE8A 3LIIA 4AZ3A 3G9TA 1IUPA 1VJ5A 3L1HA 5FUMA 2C58A 5CXXA 1EX9A 2WQZA 4H35A 4RNCA 5HZGA 4X85A 5JAOA 1YR2A 3M3DA 1JKMA 1CUXA 4XJVA 3DYVA 2I3ZA 4A16A 2QXUA 1XZIA 3G0IA 1TCBA 3SK0A 5DLPA 1HBJA 1L7RA 3HACA 2XUFA 5FDFA 2JGIA 2DCMA 3DS8A 1SC9A 3C70A 2E3JA 3MUNA 1UKAA 1EB8A 1H2ZA 5LZ2A 3WYNA 3BL8A 5JZSA 4OPMA 1R88A 2B4KA 3H1BA 1JMKC 1J2EA 1DX6A 3KDAA 2HA7A 4GBGA 1ZJ4A 4ZI5A 4CCWA 4DNQA 1ZD5A 4Y2VA 3S8YA 1L7QA 2ECFA 5ALHA 4C6HA 3ZI7A 4ROTA 2AJCA 2WHPA 4BC1A 4N8DA 1HKHA 3W05A 5FLKA 1X70A 1PJAA 2G63A 4ZV9A 5K3FB 1C4XA 1QOZA 4CG2A 3FVRA 2WUDA 1WOMA 1P0QA 2DHEA 3RK4A 1QIMA 1EDEA 4FBLA 3ZLVA 2J4CA 4UUQA 1VE7A 5I8PA 4C4XA 4UHBA 2D5LA 2VAVA 3H2HA 2YYSA 1U8EA 4OD0A 4M0MA 3N0TA 2BUAA 3WWCA 1VLQA 1UWCA 1YS1X 4H18A 3PFCA 3H2JA 4BDTA 4P9NA 3WLAA 3V1LA 2BGRA 3KOOA 4B82A 1CPYA 3SWWA 4CFSA 2QOEA 1RYYA 5AM1A 4DNPA 4A23A 5JYCA 4L9AA 3ICVA 2JGMA 1USWA 2WIGA 1SOMA 2XMZA 5ALLA 3IURA 2ZJFA 4DMHA 1X2EA 3TJMA 4BAUA 2ROQA 2J3DA 4Q34A 3UUFA 5AOAA 5EHNA 1G4HA 5JANA 4ZXFA 2IX9A 4W63A 4UHCA 1NU6A 4DNFA 3AUKA 5HQ3A 4YASA 1MX1A 2WFMA 5DTJA 5ALVA 1UOPA 2O2IA 1DX4A 1CUUA 2HADA 1ISPA 3O0DA 3FYUB 2JGKA 1XZJA 3LP5A 1TKRA 1VXOA 2H7YA 3WK5A 5I7UA 4G4IA 2I3DA 4WDQA 3IVMA 4B7ZA 2QS9A 1XRNA 1GXSA 4AO6A 3NGMA 1W76A 5HF5A 1VA4A 1EA5A 2ONCA 5K5EA 1XRMA 2AJBA 3RARA 4G5XA 3R3ZA 1TCCA 4J3JA 3TEJA 3E0XA 1E8MA 5HF6A 5A2GA 5CT5A 4UBJA 3QPAA 2RHWA 2O2HA 3JWEA 4DMFA 2QXTA 3M81A 3WKEA 4QE3A 4OB8A 3EF3A 3L1IA 5HFNA 5JZBA 1UKBA 5LIPA 1LPSA 3WQHA 5FRDA 1CVLA 2OGTA 1OCEA 3FWHA 2WFZA 4UBKA 2WG1A 3VJMA 3WKBA 3W9UA 1QONA 2EEPA 4C01A 3DD5A 5EHQA 1WM1A 4EA6A 3KWFA 4G4GA 2ACEA 1ZI6A 4KRXA 5AKYA 4WJLA 4B0PA 2WJ3A 2PUJA 5CT9A 2VA9A 3DKRA 1ZIXA 2DFPA 3G0CA 3K6KA 1K8QA 3FCYA 4QDZA 3W04A
chains in the Genus database with same CATH superfamily
1E1RD 1YBMA 4PO1A 1I4TD 2WPDA 3F4KA 4J7UA 2DOKA 5IC5A 2VRNA 2VQEB 4CODB 3NKLA 2BT4A 3A4TA 4B3BA 1BS2A 1KU6A 1CS0B 2I4MA 2JATA 4QAJA 3VZQA 3CMCO 3H2KA 4RK7A 3GHYA 3P20A 4LBWA 2XQIA 4P33A 5CW2A 3RS2A 2W42A 1XQXA 1RXEA 2YV4A 2ZBQA 4A2QA 1CTQA 1HDEA 3AIKA 4IILA 5BMVA 5JRDS 2LCIA 3SLGA 3EXHA 1MEJA 3R5KA 4IDQA 3DUFA 4YV1A 2Q5EA 2YWJA 1OU0A 2Z8YA 3JD2A 4BLRA 4N0PA 4EOGA 4QBTA 5CXSA 1OLUA 1LBSA 4IQGA 3EQ9A 4JJKA 3AR2A 4JH0A 4K5QA 5KJFA 2IU4A 5KQGA 4JASB 5IJZA 2BC9A 4D74A 1AQIA 2AE1A 4QXQA 2FRDA 1PHRA 1T43A 2WHXA 2WKSA 3FFBA 5D7NA 4ZWNA 2C3UA 5LPNA 1NAHA 4ZRDA 3OJFA 4IDGA 4PZAA 5TX7A 4ZDKA 2XB2A 4E2YA 1Y6ZA 3I76A 4ZEWA 3IR7A 1S6YA 2N1BA 2Q5JA 4I81A 4H3KB 4QYIA 1M1YE 3FYSA 1IPHA 3RTEA 4K26A 3T95A 1K0FA 1Y7TA 2N46A 3VYRB 4B4WA 5BUQA 2VCHA 1EWRA 3NIWA 1RKUA 1G8MA 1LLFA 1Z5PA 5K8IA 5AJVB 4DMCA 1AXGA 4LK3A 2ZSJA 3KQMA 3O03A 1XZLA 3IMGA 4WRRA 1XJCA 1MIHA 3WS7A 1Q77A 1IQRA 3D7NA 2HSDA 4OB7A 4TMTA 4XD7D 5IBRA 2XOXA 5BT8A 3VTZA 5T7BA 4WBNA 2VDNB 4EG1A 1DZIA 2BFBB 4WOPA 4LDRA 2PA3A 2WQ7A 4OQPA 3ZGLA 4PN7A 1HT0A 3SJZA 2GCPA 5A3RA 1SUFA 1T1SA 4W5NA 1LW6E 1Z36A 2G6TA 5JH7B 1IFXA 2PL3A 4L8YA 9LDBA 4GOKA 3QOYA 4IHJA 3D02A 4QUEA 1W44A 4IEFB 3QLVC 5BWNA 5K0JA 3B6JA 1QYIA 2BJVA 2PUDA 2ZJAA 2QGZA 4OSEA 4IHAA 4LNHA 3ZS8A 3EDYA 4X1IA 3VDRA 4JBXA 5GVSA 1SHKA 2A14A 2H1VA 2XB6A 1JKFA 2FW1A 3T3IA 2Z3WA 1L1FA 1DARA 3B9BA 4RESA 5AD1A 1U4SA 4GLLA 5DHPA 5E8RA 1SCDA 1FJ2A 2Z4TA 5TPWB 3WBBA 4B48A 1UJ6A 1RAFA 3ACDA 3OCCA 2IOYA 1TE2A 2P11A 2ZRFA 2RD2A 4LF5B 3SBOA 3R5JA 1LEHA 4LXQA 2YVAA 3QLEA 1Z16A 1N2XA 1W87A 3WICA 1Y9EA 1YDHA 2ADFA 2OCAA 3RF7A 4GZ6A 2FWIA 3BM5A 5IVDA 5FQNA 3YASA 1ETHA 1V16A 4HH3C 2X4GA 2CXHA 2BGJA 3VSCA 5DV9A 1ZW6A 2HWYA 2KBEA 1QRAA 1KE1A 5HUJA 1D1SA 3FUTA 2OZKA 3V2HA 2VQ6A 4RVDA 2HRQA 5DNWA 4D8WA 2HF8A 3HKBB 4BLQA 4HNUA 2O9JA 5B3LA 5C5EA 1D0VA 4ALNA 2GF0A 4NENB 4OFZA 5IKEA 3ZK7A 5CLFA 2FWJA 1KETA 1MABB 2FFAA 1Z2EA 2UYYA 4FD3A 4MO2A 4MRVA 3CRVA 4PG6A 2ZU6A 1ZD8A 4X6LA 4AZ0B 3CN7A 5JSFA 2WSSA 1VHJA 2VUUA 2C0CA 1KYXA 4ZAFA 2GZ1A 1KMHB 2XRMA 4JL5A 3W2TA 1MB4A 2PKQP 5JEEA 3NUQA 3IOYA 3KP1A 4YMHA 4KNYA 5K2MA 5KYUB 4X64B 4W5HA 4FN4A 5KX5F 1V2HE 3E23A 121PA 3U7HB 4QUBA 1T0JB 1XYYA 2MR6A 1JB1A 2QQ0A 3EEIA 3I5MA 3R6LA 4O1MA 2F3QA 4M1EA 4N5NA 5A9TA 3ZTYA 3Q5DA 3CLSC 1NR7A 4FYHA 2XMQA 1CDZA 5IBCA 1S8OA 1X19A 5IKPA 1Q2UA 4I2VA 4DCOA 3I6ZA 1ZGJA 1VMEA 1YCGA 2YS6A 4QBHA 1A1VA 4G5OA 1XI2A 3K5WA 4HFNA 2IK8A 2EU8A 3QEMA 3A8TA 1UFRA 2P5YA 4RJJA 1N2IA 4B7XA 4M6WA 1JAHA 2EWVA 4OUKX 3MILA 4JJZA 4JLKA 2Y05A 3WQRA 2H0AA 4CF5A 4TS3A 4MPPA 4GYYA 2LCFA 1I7PA 5LOVF 4LC1A 2CLDX 1K7EB 3BMOB 4MW6A 4UEOA 4XUCA 2DWUA 2OC4A 2JCXA 1IY0A 3C87A 3OSZA 3PQ8A 5JMPA 4NH4A 5LU8A 2VBGA 3MSXA 3WB2A 2R8OA 1HEIA 1NR1A 5HBGA 1E3SA 4HUQB 3NDJA 4CV0A 5IT9A 1YJ5A 3AJAA 4LCBA 5JRJA 1ZAYA 4JLVA 2CK3A 5LMNB 3K05A 2IBTA 3AYZB 5J2TB 4ARAA 3CZCA 4EHHA 4PX3A 1K9SA 1HZZA 1QHGA 3AEYA 3TZ6A 1KJJA 3K94A 4ZZ2A 3N39C 2ISSD 2DULA 3IT2A 4N5MA 2HQRA 5KTOA 4D82A 4LJYA 3IP9A 4ZVVA 1LDEA 3K1YA 2HU5A 1UMDA 2VYND 4BKMA 2GB4A 4I6EA 1BA3A 2OAEA 2GD0A 1JRLA 4GR4A 3V4FA 1CEXA 3WYCA 1J8YF 1E7SA 2PGNA 4CU2A 3RAEC 2EJVA 1IN1A 3K0CA 5L6LB 2G4CA 2Q3JA 2BJHA 3WGHA 4FX5A 4IV5A 4Y9TA 5G53C 3DE4X 4E7OA 1NW7A 5CRIA 3PENA 4UPVA 1TLLA 5C8ZA 3KL4A 1BHJA 1Z37A 2GAOA 1QO9A 1UK8A 2AR7A 1OIWA 1QQTA 3FSGD 1RXWA 3AB3A 3AHIA 1NP3A 2H59A 3CINA 4S1OA 2FLWA 4DIEA 5IAAA 3TB6A 5ADWA 4DRYA 1U1IA 5KVCA 3NHKA 5IWAB 3WYAA 5JVDB 1NW6A 3TN7A 4R01A 2RJOA 2PZLA 1T9HA 3MERA 3ODPA 4Z4EA 1S9DA 5AHXA 2IITA 4FYXA 4EYOA 3IDFA 3NDBB 3ZCUA 4BU1A 1U7DA 1EU1A 3CGGA 3ZWWA 1YDEA 3IO5A 1YXMA 4GBJA 3RC8A 3LGAA 1DQZA 1VFNA 3EEQA 4NBUA 3MWFA 3O38A 4KPGA 4NBKA 3GJ4A 4BO7A 1ZLXA 4O3FA 3BSYA 1A4UA 3G0DA 4W7HA 3K70D 3I5XA 4YAKA 2ZDQA 1SKMA 4QIHA 4K6FA 2OFXA 4Y2JA 4CVNA 1F20A 3W4JA 3W2FA 4UCXA 1EX7A 2W71A 2Y93A 4QQNA 1MLDA 1ULTA 2VTEA 1JHAA 2CDAA 1EINA 1G19A 4X9XA 2IZZA 5AI0A 4YJ3B 1A27A 4MVJD 3SU8A 3MUEA 4UDYX 1M72A 4E31A 5EJ4A 3R7LA 3TW8A 2PSEA 4V2IA 3ZHUA 3ABIA 4BVFA 4UFNA 3UW1A 1E4EB 1ONSA 4IF4A 1IBLB 2IS2A 1R3DA 4CUJA 1DTWA 4AG6A 4PICA 2W4IA 1VQ1A 3FDZA 4G67A 1YT5A 4QPZA 3VNQA 3UHAA 3UJNA 3GRZA 2Z5LA 3ZH9B 1UAAA 5K3BA 4MKRA 5J2UB 1P9LA 1M6VB 3OTWA 1GNTA 3DP7A 5CT8A 3ZVLA 2AKEA 2R9VA 1IN5A 2OECA 3FYCA 3K70B 3GUCA 1Y4DE 3LZDA 4ZO8A 1XE3A 3K5IA 3PLRA 1RPAA 2WF9A 1I3MA 3MWEB 4AMYA 4EJ0A 3IQXA 4WTOA 3QUBA 2Q5OA 2Z6QA 3TQOA 3K16A 2CEKA 2OSVA 1QH1A 1KMNA 2XV1A 2C2OA 1N2BA 2XTNA 1MJGM 1OAOC 3NTRA 1D1QA 3C1UA 2BJWA 4D98A 2WOOA 1S1MA 1TMYA 3KUDA 1PD1A 4ZVOA 4TVSA 2IIVA 2WD9A 1QAMA 4IZIA 2VJPA 3ILXA 3KG2A 2ZR9A 3MT7A 4Y18A 1HFJA 4TWZA 4DWJA 5LSAA 3WTCA 1OW3B 3NTQA 2VT2A 2EJBA 5IYZA 1FDTA 1U5AA 1L5YA 4ZO9A 2IYVA 1KZ4A 2GX6A 3H5AA 1SM4A 2JFUA 4CR7A 2X86A 4BE4A 4NBLA 3WG9A 1O4VA 3LHDA 3WJAA 1BNCA 3R24A 3NGLA 2J3KA 1BH2A 3JD4A 4DLXA 5LYJB 5J1SB 1C29B 3ZZMA 3OF3A 1VBNA 4BNTA 1KPGA 2BZ1A 3L7LA 4S24A 4YHBA 2RC6A 1ZGAA 2VWHA 3TX6A 5EIHA 2H2GA 1Z8DA 3DVLA 3HCNA 3PFNA 4NH0A 2OAQ1 1M34B 1SEPA 3MCWA 2V7QA 1RRVA 2OFFA 3Q7PA 3GT4A 4UDOA 3SDZA 3VR1A 1PFKA 4PZZA 3ROFA 4DLTA 1M8FA 1XX6A 3CF0A 4PZEA 1I8TA 2XDYA 1E5QA 2B4YA 1K92A 1HI9A 1H8HD 2AFIA 2QLTA 1MJFA 1NU8A 5ANRB 2VJNA 5MGNA 3W6OA 4NG5A 1VMDA 2V4MA 3HA5A 4I1VA 4UU1A 4DJDC 5K01A 2C5AA 4DN6A 4AS1A 3H9JA 4LVOA 4NAVA 5K6TA 4DREA 1BJRE 2HW8A 3NTVA 4LV5B 1L4BA 2IHNA 1TTQB 2J3MA 2ZI7A 3K8QA 3L01A 5E1DA 5FIUA 3UK0A 1V41E 3T4XA 2PIDA 2YWFA 2EDCA 4GD3Q 3OURA 2MCFA 1N5OX 5KNBD 3EZLA 4DSZA 4KTTE 4JI3B 3JATA 4FS8A 2Y1WA 1V5EA 3INNA 5A06A 5L3SA 5A7GA 4JI8B 3VO2A 3H97A 2W22A 2HKIA 4HX2A 4JQCA 3NH9A 4F56A 1G64A 3D7RA 2FQQA 1T3LA 2IHBA 4MPJA 4CR6A 4EPXA 5NLLA 5LMUB 3KZ1E 3CQ9A 1K7SN 4FUTA 3I72A 4U7JA 4WN9B 5G0UA 1E6UA 3BGWA 5BQ5A 1Z4NA 3OOYA 1G5TA 2YJ5A 5KYXB 4PLPA 3WBFA 4BQFA 3LXUX 2J07A 1G21B 3RT9A 2XUGA 2H4JA 2HQSA 2CT8A 4W9NA 2JGDA 3G49A 4Z6KA 1D7AA 1Y1TA 3CO5A 1SD1A 3L8MA 4I14A 1P4JA 5KNDH 4RIGA 1F1JA 3VISA 1VTKA 1NUUA 4N82A 3IC5A 2ZYRA 4S04A 2P3SA 4FYMA 1HDCA 1X86B 1AQYA 2VF2A 1CJBA 4NJMB 1ZH4A 2VI5A 2Y1DA 3VU3A 4DCJA 1FA9A 1PJCA 2IY8A 1TJNA 1TJPB 4JI0B 4MQUA 2AOXA 2BR4A 2O3SA 1WCV1 4UUBA 1M0SA 1UK6A 3I30X 1XMXA 4G25A 4PLTA 2EX0A 4OOFA 4PQFA 5IXJA 4TL8A 1TYDE 1W52X 1H85A 1V8OA 2GCIA 5C4GB 3DZBA 3HCEA 3HO8A 1BW9A 3FR8A 3L9WA 3VHXA 1JPUA 2CUTA 2IGTA 4UATA 3ZBQA 4ALKA 5JNWA 4FGZA 1S89A 2CVZA 3O5AA 4MKGA 4F9GA 1A2BA 3R7DA 5HIKA 1DJMA 3QLJA 5EE1A 2JD2A 4KHPB 2RH5A 2B1JA 5ALPA 3GOHA 1U65A 3DZKA 3C14C 2VP0A 1XJWA 4MLCA 4UD2A 5EXPA 2ZKIA 4KVFA 3S1SA 3R5FA 4YJHB 1HFKA 4HVTA 5E8JA 3FFTA 3TFQA 3QX9A 1YMQA 1JAYA 1F0KA 5JT1A 1RACA 2QN3A 1EK2A 3QOFA 2P9YA 1XRJA 3VR5D 4O1HA 5L4LA 3N3AC 5E9JA 3OJWA 1U0GA 1NYQA 4YQEA 4YRAA 3V9PA 5I48A 4UAUA 1CR1A 1WDWB 1Z35A 4J94A 2HQOA 3O31A 1KOFA 3NVMB 3KQSA 3ECCA 1LPNA 3ZKAA 5H9WA 4CI0B 1T6NA 2I4NA 3HFRA 3HBLA 4WASA 5F2NA 4DUGD 3HU1A 1RBZA 1P0FA 2X5JO 2ASEA 3OEWA 1W5FA 4IZ6A 5GJVC 3GFRA 3NKFA 1YZYA 4ND1A 5DM4A 4DC1A 4DM4A 1SVLA 3PHHA 4C4TA 3ON5A 1P0MA 3BHIA 3ISJA 2P0YA 3DVRX 3ZY3A 1M2FA 1JFTA 4KXNA 2BP7B 1DINA 3A04A 3A70A 1JXMA 1M83A 3K09A 3T38A 5AOBA 3VAZA 3HNOA 1U6JA 4LJKA 3ROQA 1BU5A 5CYFA 4YRJA 1OTYA 2CLCX 1V3TA 2FWMX 2QM3A 3DTVA 3M4YA 1R5OA 4FN5A 1NT2A 3JD0A 4QHYA 2BZGA 3L18A 5DLEA 5LMZA 2NP7A 1MW9X 2AN3A 1T4MA 1ZMXA 2DQYA 4JJFA 3TTTA 1E66A 4DV5B 3D8NA 1WXQA 5ECYA 3TTXA 2PRZA 3C3WA 2I5PO 3R4VA 3TIFA 4UBIA 4GSYA 1A7AA 1XSEA 3I1JA 2WM2A 2AFHE 1M2VA 4OM7A 1JBQA 2A0YA 3C8MA 5JNTA 2JB9A 3GP5A 1NNI1 5C1IA 2HOQA 1VDZA 1CQIB 1NUPA 2FSHA 3N05A 3W6NA 2RK4A 1F2UB 2CZQA 3PFKA 4KPUB 3WNZA 5AW6A 1BWSA 2OQRA 4E2XA 5ELLA 5B2EA 4MA4A 2WKWA 1DJPA 4UMVA 2O3JA 1NV8A 4ZO4A 1JQKA 1X13A 4LE0A 1F6DA 1VM6A 2QUBA 3KZMA 4PLHA 4DDTA 4AG5A 1NNLA 3RHTA 1JEQB 2FKAA 2P77A 2DQ4A 2V6IA 3L49A 4OUDB 2ZRIA 3KUCA 4M3NA 3LDFA 4WIAA 3ZG6A 5CAEA 2WNIA 1PK9A 5BP7A 1TM2A 3NIBA 521PA 2YX1A 3LBNA 4G84A 3ZI4A 5I4IA 2JFXA 3QKSA 2WFLA 2WV9A 4QUIA 2PUTA 5ICCA 3HU3A 2QI9C 1X1DA 4IICA 4UEQA 1SD2A 1H4SA 1E92A 1NP6A 1ISJA 5GINE 3U09A 2R7KA 3CS3A 5EHZA 1D1PA 2OV2A 4CLRA 3ZE2B 4Q01A 3P9IA 3SHTA 3ITDA 4D3SA 2E6KA 5DXAA 3OOJA 2I34A 3K0AA 3IXLA 1PK8A 3UUGA 1GVNB 3OEED 2QLJA 3PUIA 5I01A 4HDMA 1WTCA 1C1HA 2CNNA 1CF9A 2Y2VA 1J33A 3GA0A 4W1QA 1YAHA 3JQ6A 3RAPR 2F4NA 4HSGA 1NFQA 1UOQA 2H06A 3QPDA 1TRKA 4Q3BA 4AIRA 5BSHA 3HKCB 2XT0A 2QZJA 4IO0A 3COSA 4IQ4A 4RU1A 2P41A 1QB8A 3VNRA 2NZYA 4XJSA 1GPDG 2JIOA 3AFIA 1XFDA 5DTQA 3T9FA 3JVDA 2AOUB 3BBLA 4MJXA 3UWMA 3I37X 1UP7A 3AI3A 1YA6A 4OQDA 3E3NA 2CB0A 2I4IA 3LOPA 3TW0A 1QB7A 3L6EA 4HADA 4MR7A 3S6JA 3O92A 1E6WA 1U8TA 5AM5A 5LA6A 5BORA 2CYBA 2M6RA 4KQ6A 1T9CA 2B7BA 2PU7A 1GR0A 2J7PD 4XDYA 3TB4A 3EGEA 3OAAA 3SG0A 3KVVA 4JXXA 5HF9A 1AA6A 3BE5A 5JD5A 4HWGA 4M0FA 3U60B 1BDHA 1LVHA 4YB8A 3HGQA 1TEXA 2P35A 2QRGA 4BCCA 4F7DA 3OU7A 3LCMA 4GGOA 4I55A 3BIOA 3L5KA 4YJFB 1W48A 2ECQA 2PA0A 4IDPA 3TOSA 2H1LA 1WMEA 1YH3A 3L7YA 3ZVKA 1NVAA 3NV9A 4H1WA 5EYPB 1R8QA 5ISMA 2HPVA 4MRRA 1ZD4A 1RCFA 2B1RA 3DDNA 1WW8A 2IEAA 3E70C 5AOVA 3STWA 3WGJA 1GKKA 1SXJD 3RIMA 2AZXA 5FFMA 3UG6A 2Q2QA 3F46A 3GJ3A 4ZHQA 4AKIA 1JIVA 2IDMA 3LIPA 4M8IA 3LX5A 1C3OB 5LUAA 2X1MA 4A03A 1S7CA 1XWFA 3NBFA 4O0MA 1CUAA 4HNHA 4ZT5A 3BQMB 2XR1A 4JA2A 2JDIA 3P8ZA 1M2WA 3UICA 3BPSA 2Q2OA 1TXGA 2B2XA 3MWJA 3UV3A 2B3TA 3OU2A 2MYPA 1WIWA 1NI5A 2QMYA 3EF1A 3L46A 4HYEA 5TEVA 2WZBA 3DAHA 4WOCA 1B26A 1MTZA 1GOTA 1T6ZA 1ORRA 1DWUA 1JWAB 2V7UA 2ZRAA 2C5FA 4RACA 2JLYA 1PE0A 4QODA 4LGMA 4TTJA 3AXTA 1DAKA 4KBFA 3UT6A 3SSOA 1JFRA 2RKWA 3IUBA 1M6WA 3NWOA 1SXJB 5JOQA 4H4DA 4A36A 1BMFA 2ZT8A 2AW3A 3G2LA 3K1ZA 3LXMA 4GHWA 2H3EA 5JMOA 1NR5A 2O8NA 5JQGB 2AF3C 4N76A 1L4NA 1VB3A 7REQA 3JQGB 4BGEA 1TKCA 1P1CA 1HE1C 2OBNA 3HVUA 4RZSA 3PX3A 2NYVA 3U4QA 2GCNA 3Q9LA 2R5WA 4UU8A 2O1WA 1ZH2A 4QYMA 2JBHA 1W1WA 1XP8A 5I7EA 2EBWA 5JCXA 2ZXUA 1FJXA 1BG6A 4G36A 4C7OA 3DB1A 3FOWA 3LLSA 2NUBA 3I0ZA 4H7IA 4O33A 3TVYA 4M1MA 1RBMA 4DIUA 1QQ7A 1UBHS 2K4MA 1Q20A 1GN8A 1E5TA 5GV8A 3QF4B 1G38A 1KI1A 1UBGA 5KQMA 4GW3A 1SC1A 3TRHA 1E20A 2EV9A 2XGMA 3KJQA 5FWYA 5IMSA 3VNSA 8ADHA 4MS3B 1SUIA 2QTZA 4BLPA 4XQ9A 3IODA 1RYMA 3L41A 2R751 3FZEA 1W4ZA 3L8GA 4JYPA 4D41A 4C2UA 5C1PA 1W5TA 2UUPA 3R4CA 5BNFA 2Z4SA 4YI3A 3DOCA 4EUKA 1GP2A 5I8WA 2P8JA 4Z1MD 1RWXA 3FKSA 4DC0A 3GYGA 1FMTA 5LLTA 1H2XA 3LJKA 4N54A 4YAJA 4ZAZA 1KXZA 5HWSA 3AHCA 4DYHA 1TRHA 2AMYA 2XQKA 1YF3A 1OXTA 4Y2TA 4KE6A 1SQFA 2QTMA 5JMTA 3UW3A 1U9ZA 2JGAA 4KLNA 5JD4A 5L45A 2W6ZA 2Q2VA 4RD6A 4ETIA 1DQPA 2B92A 1JE0A 1RQRA 2FZEA 4MZXA 3F97A 4CKCA 4PU0A 4MIEA 3TTUA 4GKJB 3RABA 2ONKA 3VU8A 4C4YA 1B0AA 5JSZB 4O63O 1TA4A 4DV0B 4B5LA 4MQEA 3RSGA 4OMDA 2CUNA 1I9GA 2C57A 4RWZA 4EVSA 1KMCA 1R10A 2ZIGA 1N8SA 2ZJ0A 2FVXA 2HLHA 2QTWB 2CMHA 2PYZA 2QR5A 3L84A 4RMGA 1J0AA 1AO3A 1NPTO 1S3IA 1OREA 3DLPX 3LT1A 3EZGA 4OIMA 2OHFA 4KAAA 1YA8A 3UK6A 3KT8A 1JSXA 3G2KA 4GQBA 4JROA 2YVLA 3UXMA 1MT0A 4RGBA 1ACJA 3QUAA 1XKTA 2FEAA 5FI5A 4NK4A 5EJ6A 3EQZA 1DAOA 1E99A 2QTVB 4EHJA 4GWGA 3SZRA 4CV2A 2D1QA 3OSUA 2P7IA 2VRWA 3RYFB 4Y2PA 1SCKA 5KJ6A 1FPMA 1XD2B 1NDHA 4CKYA 2HHJA 4YLEA 4S12A 5K51A 2Y92A 2HAEA 1EA7A 1O96B 1FZTA 2VJMA 2P4EA 3AZOA 4AVYA 3UHPA 3E48A 4CLOB 3CCBA 2EEZA 3PXXA 2B8WA 1I51A 3PITA 4C6SA 3EJWA 4JC4A 1CUYA 3QP9A 3VPDA 2GD1O 1GRCA 1SKYB 2QMUA 1PU2A 4P5EA 5ALFA 5LIRA 3OQIA 2I62A 4JC8A 4L75A 1T24A 2XF2A 1ZUHA 1G60A 4GLBA 1E64A 2VHVA 2XUQA 3FPEA 2P4QA 4EJSC 2HJHA 3PR3A 3OOSA 3V7UA 3JZFA 5CLIA 4XWKA 5IPFA 2VA8A 4GX2A 4BMZA 3EMKA 3CR3C 1RXCA 3KRTA 3MT0A 3RGWS 3H9UA 4X6YA 3H2ZA 3VO8A 5D5QA 3RIGA 2IV3A 4J0IA 5CVTA 4DV6B 4KP7A 1QC5A 1FDIA 2DZDA 4BNJA 2UVPB 1GAXA 3ESAA 4UPDA 1F3OA 3BJMA 1Y8RA 3IL2A 1DIGA 1Z82A 1EP9A 2JK1A 3ERCA 3PQ6A 3RREA 1VIYA 1CB0A 4REQB 5AVOA 3RVQA 2GZSA 4A7PA 4TTVA 3HB0A 1YJ8A 1AF4A 5A4DA 4JJ4A 1P7WA 1CQXA 3IUNA 5TRTA 3D3JA 4AQ7A 2OBMA 2NXNA 2XCRB 1OGJA 2PO7A 3MM4A 1HT1E 5K7SA 2ZRMA 3COJA 2X8BA 3TSOA 4KNVA 1X1QA 4K6KA 3GGCA 4FHFA 5DSTA 2OD9A 5CH3A 1VZ2A 3VH3A 3I2IA 2R68A 5J9FA 3A6EA 2H16A 3P96A 2GETA 2GD6A 2BEVA 4O0LA 1N6PA 3K71B 3I64A 4YX9A 4DLUA 1V7ZA 4IVQA 1CIPA 2A4MA 4JB8A 3T3DA 4HMOA 4QYWA 4DNXA 2Y6VA 3UC9A 3N53A 3PVZA 4L07A 5AVXA 3EXAA 1BFKA 2PS1A 2FW6A 4HTFA 3KB1A 2PPVA 1G2PA 2C9DA 3CZQA 3DBLA 1JU3A 3BDVA 1CJVC 4KDRA 4C7KA 1KQNA 1NW8A 1BCSB 2XGJA 4REOA 2GEVA 5KNCH 2PBZA 3SR4A 3OZCA 4AJIA 4DDMA 5C1DA 3UAOA 5EQDA 4X7PA 5AO9A 3DMFA 5I9NA 1IM8A 3EG9A 3KOMA 1FP1D 4JI1B 5HTOA 2Q9UA 2Z5FA 1Y34E 2D00A 3AU9A 3RS9A 1T9GS 1DKPA 1JVBA 3HYLA 2ILVA 1M8GA 5REQB 2AXNA 1JSLA 3CXUA 3NH6A 4HEA6 5HGJA 4ERNA 5AQ1A 1ST2A 1YJAA 3W0LB 1WUKS 1KPHA 1LSJA 3WQBA 2PAFA 3QW2A 2CKMA 2VUHB 3I92A 4LOJA 4OBBA 4BRSA 3HXOA 5C81A 4L8LA 4LTDA 1JJ7A 4TTRA 4YACA 2XOKD 5JWHA 5JZSA 2GOYA 3WADA 3IKVA 4QLOA 4ND2A 2O8FA 3HHEA 4L5AA 1OB5A 3UMYA 1GRVA 2HRZA 4YP7A 4CTKA 1TZKA 1CUFA 2FZWA 3A3PA 3DXFA 1TO1E 4ZYLA 3TKLA 3CX3A 3AK4A 2H1OA 2JGEA 7AT1A 1CR2A 5TF4A 5IZ4A 5KTSA 4J43A 1JHMA 2BKUA 3IUEA 3LUAA 4B3RB 1B2RA 5T4HA 4BN0A 3R9WA 3LYHA 2RJNA 1EHCA 3KJFA 4Z4CA 1V0JA 3QKUA 1KJNA 1II0A 3E3AA 5FOVA 2GPNA 1EUCA 3K15A 4FMBB 2DXIA 3KSDO 3D3NA 3ELUA 3B8EA 3H16A 1EFPB 1JZTA 1HLDA 2NO1A 4UDXX 3UKOA 3QEAZ 1RJ9B 3GZNB 4ND6A 1KK1A 2D8AA 3LK6A 1BFDA 4TSFD 1MXFA 3C3AA 3I01M 2Y9MB 4GZMA 4PYIA 3LHKA 2YC4C 3P5SA 4NEQA 1RNLA 3MB8A 3SAJA 4E3ZA 4OQNA 2OAP1 4G4JA 3A3OA 1E9SA 3A4IA 5DCUA 3LUFA 5K3CA 1OBFO 2R00A 2XW6A 1D1TA 1OFTA 4MAAA 2W8BB 1D8TA 1XMVA 5HJ7A 1ZI9A 1EQUA 1WMBA 1C14A 3DOHA 2BHNA 3ANYB 4IH9A 2FCRA 1I4LD 3KJHA 4H4EA 4ZVSA 4CF4A 1OPXA 2AYYA 2RB5A 4K8RB 4MVJM 1GYPA 4QTYA 1BE0A 3MJCA 1IBRA 1XNHA 4DR6B 5EEHA 1WDMA 1Y80A 2DHRA 3HRKA 4RK5A 3G02A 2AZDA 2J6HA 3QBEA 3D6TB 5ED4A 3ZGYA 1PAUA 3BCSA 1XHLA 1DAGA 1RYNA 1HTBA 2FSUA 2HC9A 4JDPA 4RA9A 4KPYA 5CFZA 4JLDA 4QQRA 2B8NA 3UMGA 5C1BA 4U9IS 1ZOIA 4R2LA 3DDSA 3EA0A 2C2HA 1E2IA 3W5SA 3KKLA 4CQMA 2ZE5A 4BASA 2ZRLA 4ZI7B 4C78A 3IQDB 1E9EA 4F71A 2Z6UA 2O07A 2YQ4A 4ANFA 4BLOA 2QA5A 3SX2A 4QGBA 1BKYA 1G5PA 1NYTA 5J4HA 2RHCA 1IHXA 1FB5A 2ETVA 2C7OA 2ZWOA 4AS2A 4TOIA 1ZOOA 2QN6A 4E07A 1X8KA 2X7JA 2N75A 2FR8A 2ZI6A 3D6AA 3KB2A 3R3VA 4IIYA 4TMKA 1J06A 1MJ5A 3EFHA 4XVRA 3W78A 1AMUA 2F8MA 2C5BA 1V8BA 2QPAA 4IS2A 1J23A 1JFFB 3CLSD 2CXQA 3AI2A 3LKDA 4OJNA 4EBBA 5C1OA 5FCDA 3U5ZB 1JHUA 3ZLUA 2MSCB 2ORED 2Z98A 4NOLA 2ARKA 4YCDA 1RWNA 1UWKA 2B0JA 3O9ZA 1PNQA 1GTMA 1UC9A 4FHDA 1PQWA 2JIBA 2ODAA 4RKFA 2A9JA 1N77A 4NECA 4C05A 1DT3A 4Z7QB 1I94B 2MSLA 3QNUA 1OYVA 4RTNA 2BDTA 3NX4A 1UQRA 5IWCA 4XPZA 3T5DA 3BF8A 5IUKC 1QWSA 1ZK2A 1CFZA 2FRXA 3SJUA 4NYMR 1NN3A 1EEHA 3HJNA 2B25A 3AFOA 1EE2A 2F48A 3H5RA 4Q1FA 3D8UA 3DMHA 4OAOA 1ATIA 1Z29A 3UJDA 1K0UA 4EKYA 3D59A 1VPWA 5FKJA 5CU7A 5E6UA 1UBRS 3PCXA 5A4AA 4B81A 2ZGVA 2O7QA 1XF1A 1WPRA 3ROMA 4C03A 1ENPA 3UJ8A 4K9KA 4XH9B 2FR0A 2J9GA 3IEIA 1IDN1 3TZQA 1YS2X 4PBRA 4MQ6A 1CY6A 1KNQA 3L93A 3A4YA 1PKXA 5TJHA 2QKYA 1OH7A 4ARUA 2ES4A 1CVIA 3BTUA 4KFTA 1OLSA 3BRWA 3M1LA 5AW2A 5HJ5A 4D6PA 3AU8A 3M6UA 4FYJA 1U0BB 2PL9A 3U3KA 4WZBA 3DOUA 1NIPA 2C3PA 5K6AC 1K3TA 1H69A 1TFRA 3RG8A 4BVGA 1K9VF 1U2QA 2GRAA 4Z86A 5DNVA 1YZGA 4QPPA 1C9MA 1MA3A 3IKLA 1JDTA 3RW9A 4KDFA 3FPFA 3KXPA 1NLFA 2W98A 2I9PA 3MGAA 3MTAA 3AFMA 4D8UA 1FU7A 3FPSA 4XX0A 2OT3B 4BNDB 4QOIA 1TCVA 4NY1A 4R1NA 4CDGA 5C8DA 1E9AA 2VT3A 1RWKA 2ZI5A 3OLZA 3RSQA 4RTOA 3IS3A 2JZOA 3QXCA 3K8OE 2Q4EA 3QELA 1H5NA 1M0TA 1JXOA 2Q8QA 1UC8A 4EDHA 5I5EA 1Y37A 2O8CB 4MWBA 4AJOA 1YGPA 1SVIA 2CHGA 3AUAA 2ZAOA 2J48A 4MUXA 3RSLA 2AZMA 4TT8A 3L7JA 3UJCA 1UDXA 3DF9A 3HRIA 1V8FA 1DRVA 2M6SA 5JR3A 1AS0A 3ELDA 3HVRA 1P61B 1SXPA 1TUBB 3WWEA 4M46A 1N3LA 2JJ1A 1UQTA 1SRRA 1WHTB 3U7QB 1URPA 1DWQA 2AW5A 4R0VA 2W43A 5L3RA 2NVUB 1LV7A 4D2IA 3HA7A 3Q2OA 3CLTC 4Q19A 2QLMA 3SS7X 1E1DA 3PK0A 2JS7A 5BYKA 5CNJA 1ECLA 5KQLA 4ISBA 3KAJA 4LPKA 4X94A 3ZDQA 4F91B 3NTLA 5GIOE 2XQGA 3LTEA 3ANMA 3HL4A 1VP9A 3Q3EA 4KAFA 1DOHA 4KO2S 5G4KA 2RSLA 3VBEA 4B6FA 4WK4B 4LCJA 3TUIC 1OH8A 4H17A 1LDBA 2WU8A 2BL4A 1PWZA 1LI4A 1W19A 2JCGA 2P2SA 3L0DA 4TM7A 2IFTA 1RIIA 2JK0A 3CUKA 3K9NA 1KKMA 2BEUA 1PDOA 3M2TA 3QVXA 1T5TA 3B1WA 1YKSA 1N8NA 4BVHA 4JNCA 4ZO7A 3VDNB 1XN1A 1WCWA 4W8GA 4UNIA 4N8SA 2VWGA 3DMTA 1BDMA 4IIEA 1RKVA 1U9CA 1DZ3A 1E9FA 3B38A 3EBLA 3FUVA 4F0JA 4BNGA 2B9EA 1UPFA 4EX7A 3PC3A 4ZZ1A 5AHWA 1KEEA 2OB2A 3L8YA 2H65A 4YQZA 3PPIA 4C89A 4BXOA 1AN9A 1D2RA 3RSHA 3K8ZA 2XF8A 3R77A 4HAUA 2G70A 2HMVA 4KZKA 4FWBA 1XRRA 4OI0A 3EXIA 5CMLA 5AVKA 1E0JA 1EBBA 4EFKA 3JS5A 1CF4A 1XR3A 5CVVA 2UZ4A 3DLBA 1BYUA 1NXWA 2Z3VA 4N0DA 3FOFC 1E7WA 4TLDA 2E18A 5L7YA 2QRLA 2PUWA 5C8YA 4US1R 2CFSA 2O8EA 4HZIA 4AIIA 1RE1A 4OQQA 1UBEA 4KV9A 1Z88A 1BE6A 2V0NA 3WGIA 3GDFA 3CIOA 4V1CA 5HA5A 2QY9A 1Z5OA 3O8DA 3LXRA 5JJ5A 1CRPA 3WYGA 2PK3A 3DE6X 1R0BA 3C8UA 1Z2NX 1USGA 3ETGA 5DYNA 5CM9C 2F2TA 1CUJA 3FX2A 3BIJA 2QQGA 3UXYA 3R6WA 4R3NA 1KZ7B 1HLFA 4RKRA 3FHOA 5E9AA 2F67A 1C4KA 1RTKA 4QNRA 5DH9A 4A0FA 1V4BA 1QMGA 2ZT5A 1EVJA 4FIDA 3HE3A 3P9ZA 4X3OA 1LS1A 4YCNA 3QBJA 3GRUA 5DXFA 2D1YA 3QFCA 1WQ4A 3JQFC 4CM4B 3PLAE 1YRLA 3AKDA 1TGVA 3OTOB 1JJIA 4EK9A 1WZ2A 4AX4A 2QIOA 4LRTB 2XWBF 4H0NA 1NLYA 2QVCA 4EPYA 2JLWA 4E30A 4RH0A 4QGAA 3F0TA 4NCAA 1X94A 2WSYB 3U4DA 1JLLA 3G5MA 2IQ5A 3HKDB 2FPGA 4UM7A 2YV1A 4ZVPA 3T3PB 2WHYA 5TT0A 2FPPB 4EW1A 5AK6A 3SQNA 4GOMD 3SYNA 1IYZA 2PS0A 2HXSA 2NPOA 2X5OA 4LDQA 5B4TA 1G8AA 3S2UA 4L3OA 4FHEA 1WB4A 3R7WB 1GY8A 4TLMB 2I7VA 2Q99A 1U0HC 3QRWA 4DIOA 3EUFA 3GJ0A 3C8DA 4ZARA 4YCMA 2Q8PA 3GJ8A 4MIOA 2C61A 1XTRA 3EFOB 3PJEA 4C30A 4TL9A 1NZDA 4AFNA 1C9KA 3D2BA 2AMFA 1A5SB 4XLTA 3I2JA 2PRSA 5LUBA 1I7NA 4MTLA 3ZZNA 4CT5A 4FBMA 2PGIA 1R8JA 2FWBA 2WB4A 3BFVA 4WY8A 1ECJA 1PJQA 3LZ6A 3W06A 1WS6A 3Q5GA 4OOEA 5EIXA 3I53A 2JA2A 2W70A 3HV2A 3V6MA 3EGVA 4P31A 2QUIA 4H15A 3DCJA 5FWXB 3QXSA 4Q4JB 4P80A 1K75A 4P81A 4LHXA 1QFSA 2I66A 3H7AA 1VMKA 1ZA2A 3L8ZA 1CQWA 1LPOA 5DK4A 1XMQB 5BSGA 4XDHA 3R6GA 4B8WA 4UFOA 2I91A 3RTDA 1JSZA 1TTPB 2ECPA 1T2UA 3N2KB 3UWOA 2DHDA 4CG0A 3TUZC 2GH1A 5AKXA 5TJ9A 5AI9A 2MSEB 2R1VB 3D7LA 3WMXA 3X1WA 1Z4IA 2J9YB 2PFSA 4BLTA 5ICSA 1LFAA 1K5GA 1R3UA 3FIJA 1PFGA 2R8BA 4HNRA 4PCVA 5AM4A 1J39A 3OEHD 2AHOA 3OBBA 4PHTA 3MGCA 4ZKEA 2CB9A 3V32A 3WYFA 3HTXA 5J4LA 1P8AA 1H2AS 5K0BA 2RHHA 2CBZA 3CB2A 3FB1A 5KC9A 3BMNB 4U2CA 4WXEA 4RTSA 3BZWA 4TYNA 3F3YA 3S2SA 1X1TA 1OT5A 3RC7A 2ZKLA 4X1KA 4C5CA 4ZCIA 3KOZA 1VPLA 1OBCA 1QPBA 2I6GA 4MEAA 5EP1A 5TMDA 4WV3A 4BP9A 3EOBI 2JGNA 4OJQA 1XEXB 4J0JA 1V48A 1OXUA 3KKOA 1QZXA 3C3EA 4EI2A 2VTBB 3KD2A 1BFUA 1UFOA 3EZ2A 1J0CA 2FMUA 2IDJA 3FUCA 2YWHA 1HL7A 2Z5VA 4EQZA 1CR4A 4CM8B 1OV6A 1V3QE 1TQHA 2C3MA 3H6GA 3PFHA 3E81A 4G2NA 4G8BA 1EFAA 4V0KA 1EI9A 4DUGA 5M5BA 3EOZA 1JYSA 2E48A 4DIMA 1PUIA 4F8YA 1PRYA 1P6XA 4JWTA 3OY7A 4UUOA 5GP1A 4ZEXA 5KYTA 4NULA 5I7SA 2IZOA 4JJIA 4D02A 1PX2A 3H9BA 2JA1A 3BIFA 4IIBA 5F73A 2LDXA 2PZGA 4MK4A 4J4TA 2RGWA 1SVWA 1SCIA 2WU4A 3HUFA 4HTAA 2QMQA 2XTMA 4ZT3A 1CULC 2V98A 5GZ3A 2V6FA 1C80A 3LU1A 4NV1A 2QP4A 2JEYA 4YONB 3OLVA 1OBHA 1NN5A 5SYAA 3UOWA 4CMAA 1W6UA 5FAXA 1RWQA 1RHQA 4FXPA 1BA2A 3E03A 4RYLA 4EGCB 4BUZA 4M53A 4XA8A 1OF1A 4LRYA 4S1PA 4MLDA 4AO8A 3CLKA 3CCCA 1KS2A 3COYA 3Q7RA 4RTMA 1XC7A 1MVLA 1Y8CA 2V8BA 3AJDA 5F9HA 1FBNA 1K08A 5AK0A 2IIBA 4R84A 1RYBA 2SNIE 1SG9A 4K9PA 2CHUA 3IERA 3DC7A 3MOIA 4PVDA 3INRA 4L0QA 2AXPA 4R1LA 5CLLA 5DI3A 5HIJA 2KX7A 4LOKA 2HV8A 4L2IB 3FNQA 4ALIA 1T35A 3WWPA 2POQX 4LZWA 4DJAA 2UXCB 1PS8A 2PAAA 2W0SA 2V7GA 3W79A 5LB2A 1POWA 1KFBB 2M1XA 4NZMA 1HRKA 2DKFA 1SG6A 4N0EA 2V7VA 4QOGA 3G9UA 1ZQ1A 1XLVA 3TZBA 4IXMA 4TQ9A 3WGOA 3OJCA 3VPBA 5CYGA 3COVA 2RGEA 5FP0A 2YZMA 1OXBB 4ZYYA 1TAUA 2OK8A 3ZJ4A 4R7ZA 4DIDA 1NMZA 1Z7BA 1ZJ5A 1UZUA 2HA6A 2H7XA 2OC9A 4P32A 3AEUB 1O7JA 4M7OA 4R8VA 4I3FA 5L53A 2YFKA 4AJPA 4DANA 1J8VA 1TM1E 1L5NA 4FOLA 1KAEA 2EZUA 4MGIR 4URHA 721PA 2ZBGA 3NFYA 1CZKA 2JCBA 5GJWC 2Q21A 2ZUUA 3G2NA 2C5GA 1WD5A 1WHSB 1NQXA 2NZ8A 3A10A 4KQ2A 3G8AA 4EG8A 6GPBA 5FTLA 2O19A 1SKQA 4HHEA 5BN5A 2GBIA 1FYVA 1G20B 3BREA 4HFJA 4DWVA 5J59A 2WSIA 3TNFA 2J6CA 3K0FA 5FA5A 4DMRA 2I4TA 4M88A 3MWYW 2WWIA 4CQJA 5KTNA 3C5VA 4D9JA 1BEZA 1T4BA 4KRYA 3C74A 4XYBA 3L0IB 5C80A 4ABTA 4ZT4A 4GZ3A 2JHGA 1F7UA 2IHYA 4PX9A 4ENQA 3L4EA 5JJCA 3M5WA 2EKZA 1YU9A 1PZMA 2H4ZA 3FTNA 4CTNA 5B7GA 1L8XA 4MTCA 3UJ6A 2H9YA 5BWBA 3EQ2A 4LGVA 4PYRA 2ZATA 2G82A 2PRIA 3K92A 2NXJA 1O08A 5FTJA 3NHLA 1SGWA 3N6RA 2Y1OA 2WNHA 1Q0TA 2FFRA 2F90A 3ANNA 3G13A 4DQXA 4O4HA 4B74A 4NWIA 2E9SA 4G8CA 4NEGA 1ZN8A 1SO8A 4HPWA 2ECKA 2I2CA 3I6YA 3ILYA 4ED9A 4F84A 4OQMA 2FW0A 3SMVA 5JWOA 4I36A 3BTSA 3WWOA 4BEJA 4L8VA 2P78A 1IU9A 3U9LA 1M1NB 2R11A 2YYAA 1DC4A 1PR0A 1XZ8A 5BVGA 3CPHA 3R8FA 3WL6A 1SN7A 4DA6A 5ICEA 5DIFA 3LVFO 5J5CA 1A9QA 4WX2B 4X20A 2D1SA 4K9RA 1QGZA 2B5OA 4I8IA 3VR4A 5JLJA 1B76A 5J3JA 3X2EA 3HUEA 5WRFA 4HB4A 2ZIAA 2I4OA 1I7QB 4C04A 3EAFA 4U7DA 1UDWA 3DBHB 4FFSA 3REQB 4B9AA 5CXQA 4XQEA 3GRRA 4JUCA 4MPDA 1AC5A 5CT6A 2WG2A 3C6MA 3R7AA 2YN0A 3TTWA 3VO9A 2OHXA 5IM4A 4LXYA 2RE8A 1EX1A 1J5EB 3VC2A 3HGTA 3QLTA 1U7ZA 3TBFA 4BBPA 1IB0A 3PQ3A 2IHTA 3UATA 3CX7A 3KQVA 3OQBA 4U7GA 1Z0UA 4B0OA 5CCXA 2NXCA 3BSWA 4JYZA 1BC5A 1OMOA 3E7WA 1DDOA 3DEJA 1IEWA 1V7CA 2Z09A 4J76A 1WB5A 1C5KA 1U3WA 2G77B 5IT5A 1ZNXA 4KXXA 1H3FA 4MSUA 5KNLA 4P5DA 1AG9A 1YAJA 3F6YA 5CFNA 2HM7A 4B6GA 2EWWA 3UCFA 4ND3A 2FW7A 1CY8A 5AKKA 3QWFA 1PGOA 2W2VA 3D7KA 4AULA 4P3YA 3M5CA 1RKXA 1EAMA 2G5TA 3F5SA 1OFIA 5DI9A 1XNQB 4IIJB 2ZBVA 4RA6B 4CTOA 2YVKA 4Q9HA 4Z49A 1D9XA 2CMFA 3FYHA 4HDCA 3BXGA 2V58A 4OMFG 5GONB 3ADCA 4DUYB 2AGVA 2WB2A 3F7NA 4J7XA 1Z74A 3KEQA 4HAYA 5A04A 1LY1A 1RKQA 1GFWA 2JKVA 1C0EA 4J3NA 3TD6A 1E3JA 3VR3D 1FRZA 1H1LA 3BERA 5BYJA 3BWDD 1DI0A 4DR3B 1DC8A 4RH3A 4U8HA 4ZQCB 1AO0A 5FTWA 4CT4B 3PUKA 3SI7A 2GERA 3MTIA 4ZOLF 3CRNA 1QNFA 4ZYXA 4F9FA 2B9VA 1UK9A 2NTEA 2J7KA 2HK8A 3D3QA 4AWBA 5B1EA 3ZX5A 4ARSA 2L17A 3KQKA 4FWTA 1K1EA 2V3VA 1G3IA 5DVZA 1K7FB 3TSWA 1JT2A 4Z1MA 1NL3A 5AXAA 3T7SA 3UVEA 3A6KA 1NXQA 2HA0A 3MJTA 3V8NA 1VGQA 2WC1A 3H4MA 2C1XA 5AP9A 2QF7A 3OZFA 1SULA 2OHOA 2E85A 2SECE 4ZTBA 3BL6A 1QE3A 5TQ2B 1OOEA 5KTYA 2EF1A 3N0RA 4LHSA 4YP5A 1XZPA 3FNFA 4JFRA 1IXYA 1ZWLA 1BYIA 3EWSA 1R4NA 4GI7A 4WKBA 5C31A 4UTRA 4UZFA 3WP1B 4CL2A 1K6IA 2UYOA 4HWSA 3U3DA 5AJXA 3B70A 1KDOA 1QX4A 3CNLA 3HDHA 2H4HA 2R8RA 3VSAA 2VYVD 4KBYA 5LP1A 1DJOA 2I87A 2RHGB 3BQ9A 1NUTA 1W0JD 4KMOA 4D9IA 3RADC 1KQPA 1GN9A 1HQCA 3IMEA 3EGXB 2MU1A 4P3NA 4Y2YA 1JHXA 5AVJA 5B3AA 3KM0A 1Y3DE 4Y9SA 1JEEA 2JANA 1P1BA 4PZPA 1AY0A 1BJKA 3OX3A 1TC1A 4Q1EA 5HS4A 3KZCA 3UNXA 2DGDA 5LMCA 1XA4A 1R6VA 1NLUA 1OX5A 2QNIA 1XEWY 2IUTA 1JILA 5EXEA 3N7TA 3TLCA 1OWOA 4B80A 3O8QB 3S55A 3TVTA 1JALA 1LNZA 4OKIA 5K05A 1AIPA 3OJEA 4N12A 2XMRA 4BN4A 3GG2A 4DTIA 1BQ4A 3T1VA 5EIEA 4PRLA 4Q9LA 3CEPB 5C7OO 5JDIC 1H8ED 4LFAB 4MMXB 3U56A 5D1NA 2QZ4A 3C39A 3EZ6A 2QE6A 3RODA 3TI7A 3QJ5A 3V48A 4CHTA 2O23A 5B1IA 1B74A 4F6RB 5KTPA 1IG0A 2CDCA 1LBHA 4KAJA 4YXWA 4BO2A 1G2OA 1L5VA 1A4IA 4LXGA 1KYQA 3FRJA 2DR3A 3QITA 3Q41A 3D1JA 4NNJA 1SD5A 3HDJA 2RBGA 4E12A 2WILA 2MDTA 1Q12A 3OIFA 4L4UA 2UDPA 4N0MA 4XW2A 3UK7A 3KQLA 3NAZA 1Q57A 4LMPA 1T1EA 2GR9A 5SYNA 4DQDA 1CDEA 5FYDA 3MTQA 5CHEA 4DEYA 3VZBA 4QOHA 4FYYA 3BTOA 5C35A 1F3LA 1L4YA 2E4UA 1W46A 1R4ZA 2O20A 5HOQA 5KB3A 1ZBDA 1NG9A 5GGYA 1KAQA 4P0QB 1IZZA 4I4CA 4XEHA 2R65A 3HM2A 4BZWA 2OWEA 4P4LA 3I9LA 2IW3A 4OX9Y 4EGJA 3HJFA 5DM70 1LFDB 2BELA 3JYQA 5K3OA 3FMGA 4KQFA 3RIYA 4LDZA 4ZC8A 2YJZA 3B9RA 3ZQ4A 4KV7A 4Q9NA 1NP7A 1C3EA 2W6JD 4LQ4A 2QVZX 3B12A 4UAGA 1JGTA 2WZCA 5HQJA 4BMSA 1Y4AE 2GEJA 4LZPA 3M1AA 3VBCA 2C03A 4M87A 4ZK6A 5FADA 2Y1FA 5EHGA 1KK2A 1JE1A 3OIGA 2UYHA 4WSOA 2I8AA 5BOSA 1RRPA 1EUQA 3GN1A 3BKWA 2OZEA 1X7WA 2OWDA 3KAQA 1S2LA 4YRBA 3KHSA 1GARA 2J5BA 1UMBB 4R1UA 2Z6VA 1II8B 4EJSB 5CEFA 4OLJA 5TEWA 2NIPA 4B4VA 1NTRA 5DHRA 3ZIDA 3OWOA 5SYMA 4A8JA 1EHYA 2EZ4A 1V4NA 3H75A 4CQLA 2V74B 1NVUQ 2YOFA 4YYEA 1KP2A 1SIBE 1BEEA 4MV5A 3K0KA 2BKXA 3ISTA 1ZRHA 5IZCC 1ZCJA 4NMMA 4QDTA 1PEDA 1W36B 3HP4A 3W8EA 4GX0A 4F3YA 1ZSNA 4G0UA 2Q1TA 2ZDHA 2G1JA 4Z4GA 4LZLA 5EKTA 3RVKA 5BWLA 1H0HA 1R0WA 1TTHA 4IOMA 4WPGA 5CFMA 2PR7A 5HFJA 1ECCA 3NWEA 2NU8B 5T4EA 4KQWA 2I4RA 3MTGA 3GLFA 1ZIYA 4Y1FA 2J5KA 2IPOA 3KLOA 2AJTA 2QD5A 3T5BA 3VZSA 4AM8A 4NYMQ 1S8FA 1P73A 5D86A 2Q7XA 3CJQA 2O0MA 4JJ6A 1AH2A 4GE0A 2SKDA 2QRUA 4N6OA 4BRZA 3ZWMA 4DLNA 4HUTA 5JH7F 6REQA 3VC7A 3H05A 2FMHA 4NOJA 4C0BA 2BMJA 5CDSA 3KR0A 4MUKA 3VAAA 4E5PA 1QGDA 2ATXA 2QTNA 4V3BA 1H2RS 1XRQA 3TSYA 5BN4B 4C2TA 1LPAB 1ADBA 4INAA 3TRDA 2R4QA 1OT3A 2YHUA 3WGZA 3LUGA 2AI2A 4UHJA 1E98A 4D57A 2RDMA 2V8OA 2D2VA 4M37A 3GFTA 1XG5A 2F9MA 4U9HS 4I9NA 3RS5A 3GX1A 2Y1KA 3K2IA 5KWIA 2H0RA 4MV9A 1B6SA 4IRMA 5C5IA 1HT2E 1R4MB 1N78A 1GQSA 2Z0MA 3E27A 2WUVA 2RKBA 2C95A 2OV1A 4PSUA 5E6RB 3WGTA 1CZNA 1TQ8A 3KBBA 5C0OE 3AERB 1JAXA 1T5HX 2BFCB 3LYLA 3IAAA 4KIWA 5HJEA 3U1TA 1THTA 2AG5A 2QTAA 3NRBA 2OB1A 4E32A 2QL7A 3G1WA 4TLAA 4UBLA 3TOVA 5KREA 1ZNQO 4OH1A 4TWAA 5BWMA 2V45A 1ZH6A 5EMKA 3UT5A 2AFHA 5BVHA 4FHGA 2V3CC 1IXZA 3BGIA 1RDFA 3B5EA 3RU3A 4CUZA 2C2WA 2WJJA 3RIXA 3N8HA 3QY9A 2O7VA 2JFVA 1WB6A 3GEHA 5EHIA 3AI7A 1LDYA 1XTSA 3B3FA 5AKZA 1ZCFA 2C9OA 4H0CA 2H5EA 1IATA 4ADSG 1JNYA 3K73O 3L7DA 4Y7DA 2DEUA 4OK6A 4OBWA 4BQIA 2EFEB 1VGRA 5IARA 1YBHA 3KJIA 3LBIA 3WY9A 2G09A 4PG7A 1VJ5A 2WMDA 4EKEA 3P45A 4MV0A 5TMBA 1JDBB 2GN9A 5HZGA 4X85A 5EWJB 4AYTA 1E9RA 2VG8A 2AN5A 4KYUA 5JU6A 2BKAA 2LD4A 1G5RA 2ZE8A 3G6WA 1P5HA 4RZXA 4YRQA 2V9CA 5ECDA 3AWIA 4IIFA 1CUXA 3ML1A 2IYWA 1O5OA 4TSKA 2G80A 4XJVA 2RJ3A 4J9VA 4MVJP 4GM1A 1ML3A 5ILQA 3GPIA 2IRWA 2WF8A 3AJ8A 2WKPA 4ZPJA 1JU9A 2IODA 3FDIA 3M1IA 3Q6NA 3EPHA 4YAEA 4KITB 2VRBA 1SBIA 1SU7A 5F21A 2D5AA 1XZIA 1E7YA 2GHRA 3G8BA 3G0IA 3I23A 3ONFA 4IEEA 3UJ9A 4DPLA 4HGQA 3SK0A 3AR3A 2WJYA 1NVVR 1NIJA 2GILA 1M5TA 4GAEA 4H27A 5IAJA 3I9KA 4JN6B 1UKEA 1MTOA 3AR7A 4LYYA 5AUPB 2V4ZA 5DLPA 2E4ZA 2CL5A 2H31A 3ZBPA 3DE5X 1EUDB 1ZISA 5H16A 4TV8A 4QFDA 1QZUA 2CNKA 5DHUA 3BA1A 3A1EA 3K6JA 1ESZA 5IUNC 3C70A 3DT6A 4JLSA 4AC9A 3WLPA 4FGJA 3MMZA 3SM9A 1AQUA 1Z0FA 1H2ZA 2X19A 3PGJA 4R4JA 2XITA 3A2KA 4YP6A 3BL8A 4FDVA 1UJ2A 1YI0A 1KKUA 1M2OB 2JAPA 3GJ7A 2ZIFA 4G24A 1R88A 3AHHA 4XJXA 4D9GA 5DHAA 2B6HA 2GEBA 2IJGX 4I2NA 4M98A 2GBLA 4TRRA 4HYYA 4ZU6X 2FYTA 5TPZA 1I1OA 2P68A 3OWXA 1P1IA 2W0MA 1Z7EA 2R5FA 4B2IA 4BV8A 1UJNA 1VFPA 5DW0A 3ZCVA 4PSAA 1CDOA 1GUBA 3B6MA 4MW4A 821PA 3AEQB 4ZI5A 1JKJA 1KY4A 1X1CA 4Q7EA 3RASA 2YIMA 5DGDA 4R71A 5AVRA 4R68A 2YBDA 1V6CA 4CKZA 1N33B 3IKMB 1BDIA 3SLKA 1E6KA 4JLNA 4EF5A 3CU5A 1T9BA 4NMXB 4JLAA 4TKUB 2BFFB 5ALHA 4BFWA 1HNXB 4ROTA 1D4AA 1JQ3A 2A6PA 2AJCA 2BRUC 2WHPA 3EG5A 3R20A 4X7MA 2C7QA 4TV9A 4BC1A 1PG5A 3QA9A 1STOA 4JFAA 1XNJA 3W05A 2PWBA 1FX1A 2NTJA 4AYWA 1PEAA 2NO4A 3QKRA 2B1IA 1ZUWA 2AUMA 1Y5MA 3LK7A 1PJAA 3VU9A 1DHRA 5F1PA 5CB4B 2G63A 2IF2A 1BDBA 1E4VA 1P39A 2ENWA 2QT1A 4F5DA 3GRAA 3LA6A 4ZV9A 3MA0A 1QX3A 3NDIA 5JVDF 1P5ZB 4OY3A 5G3YA 1JH9A 1P62B 4BNWA 3RS4A 3MTJA 5LBUA 3QVGB 4TMWA 2VHCA 4M86A 4KXWA 4ZD6A 3PIRA 3MBKA 3PXEA 1WOMA 3HN7A 2ONJA 1XYVA 1GL3A 2O2XA 4QC2A 2JJ2A 3MK31 1FDRA 2E82A 2QYTA 3RWBA 5L3VA 2J4CA 2GZ3A 1VE7A 4UUQA 1TW3A 5I8PA 1SQSA 1JWLA 4WNYA 1RZRA 4M1TA 1Q0UA 4FMDB 3UV6A 1GHTA 1RRKA 3A3KA 4LC0A 1YO6A 3FR7A 1YR9A 3NUGA 2OBLA 5LNK6 3JARA 4MINA 3CH4B 5EQFA 2A67A 3N0TA 1T9AA 2BUAA 1P2DA 3M6MD 1SUEA 5M3BA 3WWCA 1XALA 2QL9A 1NVTA 2ZRGA 3NJRA 4YJ3F 4DV2B 2D7JA 3BJIC 3EXHC 3FPLA 2X9LA 4WFQA 5JQWA 4HI0E 3GFVA 3OO1A 3B6IA 1JHVA 1GRNA 3F6RA 3KOOA 4A0RA 1CPYA 3WLMA 4JEMA 1EWQA 1G8FA 3G59A 4LX8A 1H66A 1M10A 1NURA 5CFOA 3IXMA 2FRDC 2YZKA 1CW2B 1YZQA 2FNAA 3A28A 3DEYX 3F7MA 2H6EA 1QO0A 3NXSA 2J5RA 4PZUA 4YUXA 5IDXA 1KIMA 2W2LA 4RC9A 4R9NA 2FMIA 4M21A 3VR4H 2RB4A 2VP3A 2J4DA 3GQBB 4F8EA 1QG4A 5C37A 2PGAA 2ZRKA 3G2JA 2I9KA 3GUYA 3CLTD 1TF7A 1USWA 3KVOA 4JKIA 1Q1AA 1W85B 4YECA 3WC4A 3EVZA 5CFRA 4TUYB 5KHAA 4JELA 2PX4A 5CW1A 2IYFA 4HQNA 4OYHA 4GSKA 3W5VA 4ALLA 1BVUA 2LTAA 1P2SA 3L0YA 1P45A 4OLFA 1I0ZA 4CKWA 5HRCA 2FSVC 4YCBA 5K09A 4MVJF 1NXVA 4DMHA 5JS6A 4YEDA 3ZIAD 3TGPA 2ZM6B 4I1RA 4ER6A 3L5OA 2J3DA 3KR9A 4G1VA 4PYQA 2QR2A 2XB9A 4E09A 3KLBA 5AOAA 5JANA 2P9CA 2IX9A 3KFXA 3K2BA 2ZSFA 2NT4A 3EPJA 4DNFA 1EFVA 1ZJWA 3AUKA 3DPIA 5FX2A 2FUG6 2FPLA 4YASA 2JAOA 1N2HA 2MMGA 2XTZA 3HNPA 2J3JA 5DTJA 2G72A 1RQNA 2PMFA 1KHHA 1DE0A 1NOKA 1C30A 2RHLA 2Q7DA 4B75A 1DX4A 4ZZIA 2AUTA 3G23A 4GBMA 5LYJF 2SHKA 3VKVA 1NXXA 5E0OA 3A06A 3H8VA 3PIDA 4DLSA 1AQNA 3O0DA 4DL9A 3OLYA 3AETB 2XOEA 1CK4A 3ZJUA 1YOVA 2VQDA 1TD9A 2O2CA 5BSFA 3RVOA 4FE3A 5KSWB 3D6NB 3MJRA 4FJ1A 4MS1B 1RHKA 1V71A 4IOKA 5BR8B 1YQXA 4EO7A 4R8KA 3WLIA 5SY6A 1M3SA 4E5SA 2Q9BA 4LY9A 1TKRA 4NXNB 1LH0A 1FU4A 4DLYA 1M67A 2JKYA 1X7YB 4JI4B 1PL0A 2R4UA 1Z6PA 3WK5A 1PWXA 3S2GA 4KB5A 5IBQA 4UXJA 2GO1A 1C8KA 2XDQA 3E9DA 3LUJA 3OCUA 1V6SA 3QU9A 2Z83A 4JD5A 4EG0A 3O8CA 2V1UA 2POCA 2ZB7A 3O7WA 2ONCA 4K86A 2RGBA 4W6ZA 3HK2A 3GLHB 5CHYA 3PKZA 3AFGA 1I10A 4KGVA 1Z0AA 3RARA 1PJ4A 4G5XA 3U3JA 3NDPA 4J3JA 4P36A 3TQSA 1L8AA 2E7ZA 1GRQA 3SSMA 1ZLYA 3DG9A 4C07A 2I2FA 1KQFA 5B7QA 5A2GA 4LYJA 1YR7A 3QVVA 2FQYA 5D8DA 4AAYA 1GCGA 3QPAA 1CQJB 2JAQA 3S99A 4EBFA 4M0LA 2ONYA 3QI2A 4U7TB 5FUXA 3SS9X 1SHJA 4AF6A 2YV3A 1DBPA 4U7HA 3NBMA 1S2NA 2RHWA 4CM9A 2O2HA 1AGRA 3LHFA 1HC7A 2HYIC 2Y0EA 4PRYA 3WXBA 3R8XA 3NXKA 3KFLA 5BUSA 1N9GA 3KSAC 3GP3A 1LWOA 5JZBA 1L5FA 4ZAVA 1YV9A 2B99A 4LDPA 5LIPA 1LPSA 4G9BA 4JQSA 4LG1A 4KQMA 2FRVA 3VYUB 4CMKA 4GPAA 2HHHB 4WWHA 3F5FA 3FJOA 2WFAA 1YGYA 2XRZA 2D0OB 4LUCA 5EJMA 2VDWA 3D8HA 4YHHB 2HR1A 2P9ZA 1RLMA 3B1JA 1CVLA 3COWA 2PLRA 3USZA 3M49A 5LQUA 2DR2A 2VSNA 1H9CA 5CLHA 1UDBA 1W0KA 2NO7A 2WFZA 2WG1A 4HLNA 3T7TA 2ZYUX 3CPJB 3H4VA 1E9DA 1MF7A 4PYKA 5A3VA 1DUIA 1QONA 4DYVA 4PAMA 2NZJA 2X14A 2ZCJA 5K8UA 2J0SA 2DLCX 2JHPA 1FXWF 1T5LA 3IJEB 2EHJA 5DBHX 4RCVA 1HZZC 3TR5A 2RG1A 4OEHA 1L6IA 4DWWA 4NZOA 1XXHB 3D4PA 2BEWB