2VATA

Crystal structure of deacetylcephalosporin c acetyltransferase in complex with coenzyme a
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
376
structure length
347
Chain Sequence
NRFEASLDAQDIARISLFTLESGVILRDVPVAYKSWGRMNVSRDNCVIVCHTLTSSAHVTSWWPTLFGQGRAFDTSRYFIICLNYLGSPFGSAGPCSPDPDAERPYGAKFPRTTIRDDVRIHRQVLDRLGVRQIAAVVGASMGGMHTLEWAFFGPEYVRKIVPIATSCRQSGWCAAWFETQRQCIYDDPKYLDGEYDVDDQPVRGLETARKIANLTYKSKPAMDERFHMAPGVQPIEAVSSYLRYQAQKFAASFDANCYIAMTLKFDTHDISRGRAGSIPEALAMITQPALIICARSDGLYSFDEHVEMGRSIPNSRLCVVDTNEGHDFFVMEADKVNDAVRGFLDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ACETYL-COA--DEACETYLCEPHALOSPORIN C ACETYLTRANSFERASE
publication title The Last Step in Cephalosporin C Formation Revealed: Crystal Structures of Deacetylcephalosporin C Acetyltransferase from Acremonium Chrysogenum in Complexes with Reaction Intermediates.
pubmed doi rcsb
source organism Acremonium chrysogenum
total genus 128
structure length 347
sequence length 376
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.3.1.175: Deacetylcephalosporin-C acetyltransferase.
pdb deposition date 2007-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vatA00
5AKZA 2WIJA 4J0IA 2I3DA 2VSQA 2OLEA 3LLCA 3E0XA 3O4IA 5ALGA 1BN6A 2ZJFA 1CIJA 4X92A 5AK3A 2JGEA 4PNZA 1MTZA 1W52X 3FWHA 4TVKA 1HKHA 3HC7A 2EDAA 5FPQA 3W9UA 5JALA 4G1FA 2JEZA 4XX1A 4K6HA 1XZIA 4CCWA 5EIEA 4G4IA 4B81A 5K5EA 2D0DA 4EY4A 1R4ZA 3VJMA 4Z49A 1W76A 4QEKA 5FRDA 2C5GA 1PJAA 1CUDA 4NVRA 5ESRA 2QVBA 2XUDA 3U1TA 3L1HA 3PICA 1BN7A 1CQWA 3C70A 2BUBA 2J3QA 5EFZA 3CCCA 1CUFA 4B0PA 1UXOA 4FNGA 5CH5A 4H7HA 1J06A 2XI4A 4XVCA 2H7YA 2XT0A 1QIJA 1XZDA 4HXFB 5C81A 2C58A 4N8EA 3N2ZB 1IUNA 2WG2A 2ZYIA 2WIKA 5AIAA 5IVHA 5JAOA 1MAAA 1CQZA 2WG1A 5HF9A 2QRUA 1UKCA 3OURA 4H77A 5CT5A 4YASA 1TCAA 5ALVA 1XZAA 5DJ5A 5AM4A 1XRMA 1BCRA 4KAFA 1E8MA 4H35A 1W75A 3ZPXA 4GXNA 4G8CA 4JUIA 4W9RA 5LZ9A 1DQZA 4MWTA 4DSAA 1O6FA 1LZLA 5E4TA 1CUXA 4OU5A 1GQSA 5K3DA 2O2GA 3BJMA 1ZGCA 2HU7A 3WWDA 2OGTA 5AKXA 3S2ZA 3FVRA 1YS2X 4AZ0A 1ZICA 1QIKA 1DWPA 2HFJA 2OGZA 4X90A 1IUPA 4V2IA 3ANSA 1QIEA 1O6GA 5C8VA 2G63A 4UHFA 3VDXA 3SC2A 3QITA 1THGA 4DMHA 5DNVA 1SCKA 1XZJA 3WZLA 3N0TA 1P0IA 3JYHA 1KU0A 5ALNA 1JI3A 1H2XA 2C0PA 1CUZA 3FCYA 1HBJA 3I2IA 3KOOA 3I6MA 4FWBA 4ZV9A 1CPYA 4MJ3A 2X8BA 1L7AA 3IUQA 3G02A 1JU4A 4BCCA 2PSJA 4BVLA 1YB7A 1G4HA 5HCUA 4WY5A 4FTWA 1QIIA 2AJLI 1QFMA 1VA5A 4JYMA 4P92A 3W06A 3GA7A 1XZCA 2WHPB 3OOSA 1X2BA 1R9MA 3H18A 5HK8A 2XUQA 3WL7A 2H7CA 3G8YA 3A2LA 2HFKA 3WKEA 3ESBA 5CBKA 1ACJA 1OCEA 1RYYA 3E4DA 2QJRA 3D5EA 4HXEB 4RGYA 4K2AA 4G8BA 4WDRA 1FFBA 5EHQA 3DJYA 2IX9A 1XZBA 2GZSA 5LZ8A 5AJHA 5HFAA 2HA0A 1QZ3A 3R0VA 3H17A 1UKBA 3O9VA 1N5MA 2XDWA 4G4JA 5D3ZA 1RWQA 5LP1A 4UHHA 1EVQA 3QMVA 3P2MA 5AI4A 1CRLA 3VVMA 2QOEA 4QLAA 3QPDA 4WFJA 1EXWA 1WB5A 3NOXA 2HL6A 4B83A 1MX1A 3ZLUA 4DMCA 1XZEA 5IVDA 3A2MA 4NZZA 5AM3A 3WK7A 5C8ZA 3DOHA 4HZGA 1HLGA 3M82A 4ZI5A 2VEOA 3JWEA 2OCGA 3I1YA 4DMKA 1CLEA 4UBMA 1USWA 5E2IA 5CT6A 2HA4A 3ILSA 5AKIA 2HU5A 2FX5A 4M0FA 5T4HA 5AKKA 4UUQA 2VAVA 5A71A 2HADA 5DYWA 1SOMA 3QYJA 5KBYA 4UHEA 4F0JA 2VA9A 4MQMA 1EX9A 2XQKA 1QTIA 2GBCA 4BAZA 1R1DA 1JMYA 5T4FA 2R8BA 2PPLA 5DWDA 1CR6A 3HACA 4BDTA 3ANTA 3FYUB 1TCBA 1MNAA 4L9AA 1ZJ4A 3WK9A 5AKGA 2D5LA 1WB6A 4X3CA 3CN7A 1TQHA 3RM3A 4Q05A 4CFSA 3B12A 2VF2A 4QDOA 2V9ZA 3I2HA 3WKAA 5AI5A 4OCZA 4X6UA 4HTAA 2J4CA 5AKJA 2OGSA 4L3WA 3F9CA 5ALDA 1DWOA 3QPCA 1C4XA 1BE0A 2WJ3A 5D6OA 5A7GA 3C6YA 3WL6A 3DKRA 5AOBA 1EDEA 3KDAA 1QOZA 5BV7A 1CUGA 1IVYA 4CG2A 5HK9A 4B9EA 1E3QA 4CIBA 4HRYA 2PL5A 2WJ6A 1CVLA 5I9IA 7YASA 4KRYA 4Q3KA 2WUGA 2OCIA 1F6WA 4RE6A 1AUOA 1XRRA 2WLSA 1YR2A 1DX6A 4L72A 4KYVA 4ZV7A 1Z68A 1MPXA 3M83A 5ALUA 2HU8A 4Q3LA 2ROQA 4UBOA 3JW8A 4AX4A 6YASA 4K6GA 3I2GA 1A8QA 3G0BA 1I6WA 4FMPA 4W1PA 4BCBA 4Y2QA 1K8QA 5AP9A 5AI6A 3DLTA 4WY8A 4Y2TA 3S8YA 5A7FA 2XQJA 1AKNA 4AO7A 2PSHA 3DNMA 1UK8A 1X70A 3O4HA 4I19A 2BKLA 4G5XA 2RAUA 2BFNA 3UMJA 3ZI7A 5KREA 3D59A 3WKDA 5CXUA 5K3EA 3WIBA 3KWJA 2BJHA 3G7NA 4IO0A 5D3KA 3QM1A 4FFWA 1QONA 4Q3OA 2O7VA 3BE8A 3CN9A 4GHWA 5CT4A 1A8UA 2XMBA 3M3DA 3C8DA 4PV7A 3WJ1A 3C5WP 3PUIA 4UBLA 4UBIA 2CKMA 1CUYA 2G5PA 2HDWA 1EDDA 1QIGA 1K6EA 5K3BA 2WUEA 2G5TA 2GBGA 1E5TA 1LBSA 1MT3A 4FKBA 5JZSA 4Q34A 1N5RA 5ALQA 1ZI6A 1JT2A 2WUDA 2YH2A 5AICA 3PFBA 3B5EA 2J4FA 3FNBA 2PSFA 2HA6A 1QIHA 5ALWA 2VJDA 1ZD5A 4J03A 4D9JA 1J1IA 2ZSHA 4DIUA 2Z5GA 2WU3A 4OPMA 1CUSA 4C4YA 4U2CA 1VJ5A 2HA5A 5AH0A 3VKFA 1EA5A 4UBKA 2WTNA 4EB0A 3LIIA 4Y2UA 3ESCA 1UT6A 4C4ZA 2WIFA 3T4UA 5ALLA 3YASA 1JJFA 4WJLA 4GW3A 2VATA 2O7RA 1QO9A 2ECFA 3U0VA 5AIBA 4ZXFA 4G4GA 3BWXA 5ALIA 3KWFA 1ORWA 3EQ9A 1WB4A 3PE6A 3R40A 3UUFA 3CCBA 2K2QB 3G9UA 4ARAA 3FOBA 1HPLA 2WU4A 2PSDA 3VJLA 3AIKA 3K2IA 1XQYA 3ED1A 4OYYA 1XRNA 4S0XA 3WA6A 3T52A 4CIAA 5ALEA 3NUZA 2ONCA 3GUUA 3O4JA 1P0QA 3ICVA 4OUKX 2PUHA 3MUNA 1GZ7A 2Z8ZA 3WI7A 3O4GA 1H22A 4ZREA 2RI6A 4MXDA 2PUJA 3FYUA 3VXKA 1XZLA 3V1MA 4BVJA 2PM8A 3F97A 4PSCA 1HDEA 4CG1A 2OCLA 1WPRA 2OCKA 3MGAA 1AGYA 3KD2A 1C7JA 3WKCA 1AX9A 2HRQA 2QXTA 4U2FA 1UFOA 1YS1X 2HHAA 5DYTA 5IVIA 1TIBA 1VXRA 3FSGA 1W4LA 3STYA 4F21A 1CUUA 4U2DA 3G0IA 4GLBA 3RARA 4QZVA 1ETHA 5DTIA 4C87A 4LKOA 4KEAA 3R3YA 3TRDA 4BC0A 3EF3A 3H2IA 3QMWA 4AMYA 4J0HA 3FSGD 4EY7A 4MYSA 1ZOIA 4N5IX 3VVLA 2C0QA 2V97A 1EK1A 5EIHA 5JIBA 1CFJA 1VZ3A 4KAAA 3NWOA 4HXGA 4LIPD 5AM5A 1LPPA 2UZ0A 5AKEA 1YB6A 4EUSA 1GT6A 1HQDA 4FLFA 4EY6A 2QUBA 1LNSA 2CUTA 5EIAA 1WCYA 4BZZA 1KEZA 5CH3A 4Y9SA 3BXPA 2VJBA 1DX4A 2QXUA 1FFCA 2WHQA 1ODCA 5LZ7A 1XROA 1CUHA 3FCXA 4DNQA 5JADA 2AJDA 4BCDA 4CCYA 4JYPA 4BRSA 1XQVA 5AM2A 5ALZA 4PO3X 1QFSA 2ACKA 4TPKA 4JH0A 5FLKA 4MEAA 4QE3A 4OD0A 2XUPA 3G0CA 3K9BA 5BWBA 5JD5A 4WFKA 1H23A 1CUEA 4IH9A 4DSZA 1XRLA 3HYSA 1ZJ5A 2WKWA 3W05A 2FJPA 2DQYA 1ORVA 1XZMA 4XWGA 1ZGBA 1AQLA 2QTBA 4EA6A 1H2WA 4BVKA 4J0KA 3HI4A 2RONA 4W63A 2DHEA 4X97A 3G9TA 3I1IA 1BROA 1E8NA 5F4ZA 3WK8A 3STUA 3G0DA 3D2CA 5AK5A 3EBLA 3AINA 4RE5A 2ACEA 4EBBA 4KAJA 4AMZA 5C7YA 1ZI9A 1UOQA 4KACA 3V9AA 1E8DA 1QLWA 3C5VA 4QDUA 2B4KA 4C01A 1ZD3A 1DU4A 4KE8A 3HZOA 3E1GA 4BDSA 4Y2YA 5HKAA 1VA4A 4K6KA 4IHAA 1LPOA 3PI6A 2QKYA 4NS4A 3MUOA 2WHRA 3EIOA 3BL8A 5HF5A 2HM7A 2Y2UA 1LPAB 4H7DA 1FFAA 1XLVA 3DS8A 3I6ZA 5AOCA 3Q0TA 1GGVA 5KWJA 5AI8A 1Y7IA 4J0DA 4F5ZA 4UFNA 2YXPX 2RHTA 3STTA 3BDVA 1THTA 3FLAA 1LPSA 3HEAA 5JAHA 1XZFA 4DNFA 1F8UA 1XQXA 2GYVA 1M33A 4OB6A 5HQ3B 3D2BA 5HZGA 1N8SA 1XLWA 5C8XA 3D2AA 3RK4A 4IH4A 4ZWNA 1YSCA 2B9VA 1AZWA 5HFNA 4AO6A 3A2NA 3ZWQA 2XQGA 1AURA 3I2KA 3EQ8A 1K63A 1BU8A 3A70A 1YASA 3G0GA 4BRZA 4LXIA 3WZMA 4OYLA 5CURA 1EB9A 5BOVA 5EHXA 1Y37A 2DHCA 1GPKA 3C43A 5LZ2A 4LYEA 1D07A 1VKHA 2WFZA 1F0PA 3L1JA 5ALTA 2OQVA 3C6ZA 2R11A 4AB1A 2CEKA 2XUOA 1A88A 4I3FA 4O08A 2DHDA 1XQWA 4ARBA 1J2EA 1S8OA 4GI1A 3WQHA 2QR5A 5DNUA 2VTVA 3TGLA 4X85A 3F98A 4Y2RA 5ALKA 1GQRA 4K5QA 4X93A 3R41A 1Y7HA 1WM1A 3WWOA 2BAGA 4ROTA 2ZSIA 1WHTA 4A16A 3H2GA 2PVSA 3FYUC 3WK5A 3BIWA 3ZV7A 3FAKA 4GECA 5H3HA 4Y7DA 3ZLVA 2WFMA 5AK4A 2OQIA 2Y2VA 4UHBA 3H1BA 4W1SA 3BF8A 3ESAA 2Y6VA 4FLMA 4MEBA 1OXMA 1N1MA 2I03A 2HIHA 2FJ0A 4Y2JA 3M81A 4FNMA 5JAUA 3I28A 5IH7A 3DYIA 4ETWA 3WKBA 2XE4A 3AZPA 4U2BA 5DNWA 2VQ6A 4P93A 2BCEA 3I6YA 1R88A 3C8HA 2VJAA 4YX9A 3FYTA 1A7UA 4OSEA 4KE9A 1ISPA 5FOQA 1Q0RA 1PV1A 5YASA 1ZIYA 2GBIA 4CCYB 2O2IA 5AOAA 5A62A 1L7QA 2PU7A 2PU5A 3IUJA 2NW6A 4MWSA 4OB8A 5JD4A 4ZRDA 1G5FA 1P0MA 3QPAA 1UK9A 4MQLA 1YCDA 4KJXA 4Y2SA 2BUAA 4B85A 4B0OA 3R3ZA 3D7RA 4C89A 4KE7A 1JJBA 4GBGA 1ZD2P 4QWWA 5JATA 4H7EA 4JNCA 2B61A 2XUJA 1DT5A 1EDBA 1MU0A 2B20A 4RNCA 4X00A 4X7BA 2ZYRA 4FLEA 3O95A 5CH8A 2PKYX 4H0CA 3C6BA 3BIXA 3PFCA 5JD6A 1LLFA 3WA7A 5FUMA 2YYSA 4FDMA 3QVMA 5BWCA 2QJWA 1Q0ZA 4C6HA 4BP8A 3SWWA 1NU6A 2XLCA 2HA3A 1K5PA 2CB9A 1QO7A 3QH4A 1QTRA 3R3XA 4C88A 2GBFA 1U65A 4AN0A 1G66A 4U2GA 2DR0A 4LHEA 2JGMA 1JFRA 5JYCA 2H9YA 2IITA 4XJVA 5LYYA 3TJMA 3GZJA 4DM7A 1LGYA 4UBNA 3V1KA 1B6GA 1B41A 2OPHA 2YASA 3ICWA 5ALXA 3I2FA 2P8SA 1VE6A 5E4YA 3STVA 3BF7A 4BATA 4INZA 5T4BA 2W22A 4H7JA 1A8SA 4F60A 2CZQA 2OAEA 4J0CA 4A23A 3IDAA 4UHCA 5DTJA 3AJAA 3WL8A 1J07A 5ALOA 4JEIA 5AKLA 3GROA 4H7FA 5HQ3A 3WK6A 1XKTA 1XZHA 1K4YA 1IZ8A 2XMCA 3O9MA 3BJRA 2HRRA 3A6ZA 4C4XA 4EY8A 1AMNA 5CT9A 1GKKA 3WMRA 4BTVA 2XMQA 4BE4A 1IUOA 1R9NA 3F67A 4BB0A 3AIOA 2Y6UA 2LIPA 3AFIA 2CMFA 1QIFA 2DSNA 4QDTA 3R3UA 1AC5A 3PUHA 3HJUA 3Q8WA 1JKMA 5JARA 3LP5A 2RGUA 5HF6A 5FXMA 3BDIA 4DNPA 4GWLA 1GKLA 5EHZA 3H2JA 4MYDA 3GELA 4AO8A 2Z3ZA 2WIGA 4QDZA 2H7XA 4B80A 2JGFA 5CT8A 1U4NA 2XMSA 5AK6A 2Q0XA 4Y2PA 3IURA 4H7KA 4DNOA 5K3FB 4ITVA 2FUKA 4X6XA 2DQZA 2PSEA 1G42A 5CTAA 3W9BA 3B3QA 3DYVA 1XRPA 1BEZA 3OTQA 3FLBA 3WLAA 2GYUA 1EHYA 4UBJA 3H1AA 1UKAA 2BGRA 1IZ7A 5JZ9A 4A5SA 4PQEA 1XLUA 4B9AA 2GZRA 5JASA 2H1IA 3R3WA 4PSUA 1C7IA 1LBTA 1HL7A 1SCIA 4AQDA 4E14A 2WTMA 2XQFA 1DWQA 5ALMA 1KU6A 2WUFA 2XUIA 2ES4A 1EI9A 3V1NA 3DDUA 2XUFA 2XUKA 3F96A 1VLQA 1XKLA 3KXPA 1YA4A 4BTLA 2G4LA 3IULA 4G9EA 3L1IA 4KE6A 1WHSA 3HXKA 3HRHA 2JGJA 1T4MA 4HVTA 4XIIA 2WIDA 4I4CA 2JF0A 2PBLA 5AI0A 3E3AA 3H0CA 4UHDA 1TAHA 5AM0A 4WDQA 3WJ2A 1E89A 3H2HA 5HKBA 4BE9A 1CUJA 1TKRA 1DT3A 2CBGA 4BP9A 3DEAA 2ORYA 2J3DA 4GEGA 3FLEA 4YK7A 1X2EA 5KWIA 1BS9A 4J0JA 4E15A 5J3JA 3AZQA 4QLOA 1U2EA 2OG1A 2DCMA 2QS9A 1RP1A 3G9XA 3OM8A 2OXEA 4DGQA 4BC1A 1OILA 1W6RA 4DLNA 3V48A 3PF9A 2AXEA 3ESDA 3RKSA 2WJ4A 4Q1VA 4RPCA 1MO2A 2PX6A 1FJ2A 3DOIA 3G9ZA 2WFLB 1LZKA 2JIDA 5CW2A 1Q84A 2BGNA 5DLPA 1QE3A 5ALHA 4X71A 2QT9A 4NMWA 3K6KA 4DYHA 4EHBA 5AM1A 4X95A 4FOLA 1JJIA 5EHNA 5SYNA 5LZ4A 1UWCA 2XMGA 4N8SA 4QNNA 5ALRA 1ZIXA 3TEJA 4H7IA 3H19A 2QUAA 1T2NA 5I8PA 5FDFA 4AXBA 1GXSA 3FVTA 2CJPA 2XMZA 1MN6A 1CUCA 1SC9A 2HA7A 4L0CA 1VE7A 3SK0A 4W1RA 2Z3WA 3R3VA 2JGKA 5A2GA 3DQZA 4WFIA 2C7BA 1JU3A 5AO9A 3STXA 4X6YA 3W2TA 4LXGA 4N5HX 3LIPA 3AUKA 4FHZA 1MX9A 2X76A 1FFEA 1EVEA 2W6CX 3IBTA 4E46A 1TRHA 3CXUA 5ISMA 4N8DA 3FBWA 5ALPA 5JZBA 2WM2A 3WIOA 1NU8A 5CXXA 5ALSA 4TGLA 4HAIA 3WWCA 3OG9A 4BYMA 1ACLA 3DCNA 3D3NA 3PDCA 5LKRA 1UK7A 1CEXA 5IVKA 5CMLA 3MVEA 1DINA 2JGIA 3KSRA 3UUEA 1UK6A 3NGMA 1QGED 1W1IA 3QZUA 4DMFA 4UFOA 4GDMA 1GPNA 1EK2A 2VJCA 2JBWA 4EZIA 4BZWA 3WWEA 5A7HA 5LZ5A 5LLSA 1CUWA 1IMJA 2XMDA 2OAGA 2QZPA 4FBMA 1MJ5A 3EQ7A 4M0EA 5D7BA 3VJKA 3WL5A 5AKHA 4QWMA 2AJBA 2V98A 1R50A 1FSSA 3C45A 5DYYA 3H2KA 1EB8A 3IVMA 5K3FA 2V96A 1L7RA 5JAPA 4U2EA 2XUAA 2VAXA 5K3CA 3QBJA 1QIMA 5LKAA 2X5XA 1LPMA 4KR0A 1BEEA 1UZAA 4J7AA 3H04A 2QMQA 1DQYA 2O2HA 4G8DA 4LXHA 3OPMA 3AZOA 1ODTC 1Q83A 4IQ4A 4OB7A 5AHXA 1MX5A 3VISA 4X94A 2I3ZA 4G9GA 4PW0A 3DD5A 5I7UA 1WOMA 2WG0A 4BBZA 3GBSA 1F0NA 3LCRA 5HF8A 1ZI8A 3C6XA 5A6VA 3I2JA 1CV2A 2GYWA 2XQIA 4H18A 1XZGA 4CG3A 1JMKC 1CUIA 4FBLA 3D4LA 1BCSA 1TK3A 2EEPA 2ZJ7A 3V1LA 1CUBA 2XUGA 1YAJA 3GFFA 1E66A 4P9NA 4PSDA 5AKYA 4QDXA 4B7ZA 2RIPA 5IKXA 4KRXA 4LYDA 2C4HA 2I78A 5ALYA 4Y2XA 3X3HA 2AJ8A 4OU4A 2QM0A 3D0KA 4B84A 1FFDA 3F8SA 1XFDA 1H2YA 2ZYHA 2IIVA 1PFQA 1NX9A 3SX4A 3DKKA 4BAGA 5ALJA 1ODSA 2WSLA 4FFVA 5FPPA 5EGNA 1MAHA 3IIIA 2C5FA 1XRQA 4BAUA 3WYDA 4ZGBA 4PF1A 2HA2A 1R3DA 3O0DA 3STWA 2ZYSA 2WQZA 3OC0A 1YAHA 3ZLTA 3IUMA 4IH1A 1U8EA 3AIMA 1UOPA 3RLIA 4WCVA 3HSSA 4Y2VA 2XMRA 2WFLA 1VOTA 4J3JA 4J0GA 4Q82A 2JEYA 3W04A 2AJCA 2Y1KA 1XZKA 3WK4A 1EH5A 2XB6A 1SCQA 3WYNA 2VT7A 1H2ZA 4P08A 2XUHA 3DL4A 1BRTA 3LS2A 5FKJA 1LPNA 5CRIA 1WPXA 4DTCA 4X91A 4M0MA 4B6GA 2ZVDA 4E11A 2WHPA 1ZD4A 4HS9A 4EY5A 1EINA 2Z8XA 1VXOA 4UFPA 1UOOA 3DL7A 5FP0A 5JANA 1LPBB 5ALFA 1TCCA 1CUVA 1QJ4A 2RHWA 4HRXA 2WILA 4B82A 5FV4A 3QMMA 2XLBA 1MNQA 5AI9A 3WWPA 5SYMA 1SFRA 4UPDA 1VZ2A 1YA8A 2E3JA 1P0PA 4QA9A 5LIPA 4AN1A 5K3AA 4W1QA 5EI5A 1CUAA 3PF8A 4AZ3A 1GPLA 2BUCA 3IA2A 5T4EA 2EDCA 3IB3A 3HABA 5E4JA 3HLKA 1DTEA 4CI9A 2DFPA 2VT6A 3AILA 2JGLA 3C87A 2ZJ6A 1QIDA 3IUNA 4YPVA
chains in the Genus database with same CATH superfamily
1CJCA 1E3LA 2W4IA 5AKZA 3TFWA 4BFCA 5LDDC 2AG6A 4A2CA 1XOIA 3WJ7A 3ZW7A 3USZA 4ERXA 4XR9A 5LQAA 1PI3A 1S2IA 2FR0A 2FAXA 2ORWA 3HRKA 4X8HA 4UEOA 1Q3KA 3JPYA 1UMBA 3U3MA 2YHBA 2WSSD 2ZSDA 3O4IA 1C0KA 2YWXA 1CEYA 1U02A 4ZOBA 2WU1A 1TMYA 1SB8A 5ALGA 4CKWB 4C6TB 4AZVA 2AN9A 4OP2A 5AK3A 2QU8A 5J58A 2OUIA 3NHMA 3TCKA 5BN5A 4X0EA 4A8JC 4LE0A 3RS8A 1NYLA 2I6GA 3DH0A 5JNRA 4MV6A 1SEVA 3WIUA 4F8YA 3CEJA 2ZULA 3FWHA 2N1MA 1XA4A 3MT0A 4YRFA 1TLLA 1T0BA 4P4SB 2DPYA 3UHPA 4MRRA 3FPFA 3Q5EA 5HZMA 1N0HA 3RS9A 1YB2A 2XVMA 1HF3A 1M6NA 4I1IA 3QX3A 3DG9A 3O7WA 4LK3A 1NI4A 3IILA 2YJZA 3KHKA 1P39A 4XDHA 3KKNA 3ZK9A 2Q9UA 4Q24A 3UB2A 3RVOA 2JEZA 1E59A 2AG1A 1TA0A 1PX0A 2H5EA 4HB2A 4K6HA 4CCWA 3F6YA 1YKSA 3AUXA 3PBKA 4YJGB 2L18A 5KYGA 3L4JA 1D2AA 1AT1A 4D0GA 3MWJA 1U3GA 2AC4A 3L7NA 3IV6A 2BIFA 5AHRA 3SQXA 1GNVA 1YT5A 4K6CA 2BZSA 4BNNA 2O7QA 4P3YA 5GONB 2K5UA 3L8DA 1PE0A 1T8PA 3URKA 4HAOA 4QUBA 3FFTA 2C5GA 2MSCB 1IN8A 4MI9A 4W8HA 4GI7A 2UZ3A 5BYAA 3ESXA 1BDHA 4MQ6A 4WZAB 2PQ0A 3UN1A 3ENZA 1N0VC 3L1HA 3DEKA 1BN7A 3AI7A 3C70A 3H5AA 4EF4A 1A3CA 1GDDA 4B46A 3A4LA 1Z8DA 3O1HB 4RELA 2Y8EA 3V2UA 1AV7A 3CCCA 5B1HA 2QAGB 2BEJA 2IHYA 2YMMA 3O5AA 2GTIA 2OSBA 1KARA 3O8QB 1UXOA 3MAJA 3ND7A 3F74A 4FNGA 3MTEA 4XQ9A 4KDEA 4QUGA 2HYIC 3HY6A 1DG1G 4H7HA 3TR0A 2GXQA 4A0GA 1AKYA 1PJZA 2WWFA 2FGJA 2P40A 3EOZA 4JVMA 4RVOA 1PX2A 2C7PA 2BRUC 2XT0A 2VI5A 2XGSA 1ISIA 4UXJA 4I1OA 1XZDA 4PN3A 3MNFA 2QA5A 3B1WA 3FYHA 3OT4A 4GYYA 4XJTA 3KQTA 5LWHA 1RJDA 2C58A 3M5CA 1J5EB 2O3JA 4ZVVA 2WZCA 1N2SA 4M99A 1HT2E 3N2ZB 5EJGA 3ZNQA 3K4QA 1YZKA 4EHFA 3G0HA 1SXIA 1Y9DA 3CNBA 3PNOA 4ESEA 4B5LA 3C3EA 3WLEA 5AIAA 1VHQA 1NRIA 1MAAA 1BX1A 3DXYA 3CM0A 4OBWA 4Q1EA 5KKAA 3T0GA 2QVZX 5JSYA 5I5EA 3GJ3A 3FPAA 3E3NA 4ZQGA 1ITZA 2WEKA 2F3SA 3PVZA 1Z0DA 3SC6A 3SEZA 1GQFA 3FUCA 3OURA 3ZBTA 4I8DA 2UZ1A 1YZ3A 4MITA 2JLBA 4PFQA 4FFPA 1GU0A 1ZU5A 3HKCA 3OOYA 1G6HA 5TF0A 3WB1A 4C1NA 1GFWA 1AGNA 1KZ9A 1ULUA 2JI9A 5DJ5A 2Q7OE 1NRXA 2ZJ8A 3IMFA 5AM4A 2GDZA 1ZNWA 1WOYA 1E9EA 4J75A 1BCRA 4RJKA 2OWEA 4UAGA 3TUJC 4A6DA 4BZQA 1CLUA 2JCYA 1AG9A 3FDFA 4GOND 4GXNA 2Q9AA 4JUIA 4EAQA 4IIDA 2QP4A 2SCUA 2YRWA 3MCUA 3QFTA 1DQZA 2DUMA 1LDGA 2FPMA 1YQTA 4MVJA 2FPXA 4MWTA 1V7CA 1O6FA 2ZJ0A 1JJ7A 4QASA 5F23A 4MRAA 4REMA 3VYRB 3B5JA 2FW7A 1JI0A 3MXTA 4DN6A 2LD4A 3I0MA 1SQ6A 4FI3C 4RDXA 5L3SB 3H2ZA 5NULA 4OFWA 3BTSA 1GQSA 3OPQA 1IPEA 5B2ZA 1MEEA 2YMPA 3DFUA 2WMOB 2YCLA 3BCSA 4IMPA 1I7LA 2HU7A 1NN5A 2XGGA 4R2MA 4CTOA 2FUNB 3P0IA 1I2CA 1Q77A 1UP4A 2FR1A 4LOJA 1Y9ZA 3PC4A 3UPUA 3DC7A 3ZGOA 4JBLA 4NI5A 2Z2ZA 4OHRA 1Y1RA 3FVRA 5D01A 3I73A 5EXTA 3S2ZA 3VSCA 2NP6A 5FOUA 4EG4A 5JJKA 4ZAXA 5K0GA 2EZ8A 2PL9A 1QIKA 2VJKA 1DWPA 4X90A 3FF1A 3CT4A 3I9OA 1IUPA 2GYYA 5CFRA 3ANSA 3C7TA 4MVJD 3RYHB 1Z3CA 2BW0A 4AMGA 621PA 1O6GA 5HNKA 4JJ6A 4MWBA 3GVHA 3VDXA 4YAEA 4AJ9A 3W6OA 2WI8A 3LC7O 3HM9A 1TE2A 1JN0A 1HT0A 4GC9A 4RENA 5EERA 2ATXA 2OD9A 3PC6A 5ER9A 1VCHA 1H0RA 3WXMA 4B4UA 4HLCA 5BW4A 5LXTA 2ECQA 2EL7A 2NXCA 5DNVA 3DJFA 4TS1A 1KDRA 2RDMA 2H4JA 3W8NA 5THXA 1WUHS 2VUIB 1XZJA 3JYHA 4UJ5A 1KU0A 4GR4A 1QV9A 5ALNA 1KE2A 3B82A 4X1YB 3ZH2A 4CCSA 4CN9A 4XUGB 1XK6A 3IHLA 1GD1O 1H2XA 2PSSA 1CUZA 1WU7A 4CMEC 1MB0A 3PUJA 1EQAA 2OGWA 1QPBA 1NKTA 4WJKB 4PYJA 1BMDA 3AIIA 1AVTA 2ZRLA 3I6MA 4FWBA 1QF7A 4MJ3A 4OO3A 4JYZA 3DEJA 3OIDA 4N0QA 3MPUA 1AHNA 2P9QA 4OHBA 3GJ8A 1N7JA 4IIJF 1T2AA 4TMXA 3RV3A 3SHTA 1QRUA 4O1HA 3CUTA 3IKJA 3L41A 4DYDA 1OYVA 2PSJA 4E51A 1FNMA 2R0QC 1MJGM 3CGWA 3CRQA 4H3VA 5IZ4A 2MHCA 4LXQA 1T5LA 4B4WA 1RQXA 3GPCA 1H0KA 1TM4E 3OCCA 3CE6A 5HCUA 2EV9A 2Z0MA 3OEHA 4WY5A 2GK7A 1NG1A 4K3VA 4Q9IA 4QG7A 3CW9A 2V5VA 1QFMA 4N40A 2YOHA 4F9GA 1T8SA 5CGZA 1NJ2A 3GA7A 1XZCA 1X2BA 3M6XA 2ATVA 3H18A 2W2LA 2XUQA 2ZWMA 4HJXA 4JCOA 1U2SA 2NU7A 2GRJA 3Q8XB 5HK8A 4AVYA 1Y80A 2Q3JA 1WL8A 3KEGA 1M34A 3PNPA 3ZU2A 721PA 2QTCA 3HJAA 5AWFC 4MYRA 3A2LA 2GPTA 2ZYVX 5FR1A 1XHFA 2WW8A 3Q2KA 5IXSA 4IICA 5HRUA 5CBKA 3NHYA 3CX7A 3KFVA 1U3FA 1ACJA 3ETGA 3KALA 4AKSA 4DLKA 3ZKWA 4D9FA 4LDNA 4DOMA 3MWYW 3BUSA 4WLVA 3BGIA 3OEHD 2Q1YA 3K05A 4G8BA 4K2AA 3LQRA 4KWTA 4WDRA 2AN3A 4GI2A 2XOKA 3KB1A 5DN6A 4G67A 1XZBA 1P80A 3SJAA 3A1EA 2FPIB 3BB1A 3B7PA 3A1DA 1HFWA 2HH9A 3KYDA 3LPNA 2X0FA 2BMDA 3A58B 1U5BA 2CE7A 2W2LD 2AMJA 4IHKA 4MJXA 3LH5A 5JUWA 3ZE1B 1GPUA 4M46A 2V9PA 4PZLA 2YY5A 4KXNA 5CDTA 3GD7A 1W88A 4GRIA 5B64A 1E6MA 1OZAA 1RWQA 2NXJA 2PGOA 2I4NA 1IY1A 3OLVA 3ZBPA 3VR1A 2ZCUA 4YO8A 1R6VA 3UVEA 5KDOA 1L4BA 4XFDA 4R54A 3PC7A 2JZCA 1GCGA 1SU6A 4HGYA 3OPYA 2CMDA 4LYYA 3G2KA 5FWXB 5K7SA 4Y0AA 2VBCA 2OHXA 4O4JB 1NI5A 5DVZA 4ZEVA 4OTZA 5DN6D 3P9YA 2HNKA 4WFJA 2XOKD 3HUTA 1F20A 1NBME 3KVVA 4D4GA 1B74A 3LCJA 3K6RA 1M2JA 3GX1A 1P2TA 2Q5IA 3NV9A 1RBYA 1N1DA 3DWFA 2D5IA 4ND8A 4QQ8A 4ZQFA 5IVDA 3VH2A 5MFZA 4NQRA 2WB2A 3U61B 2II6A 2C54A 2HK6A 4AP5A 3WK7A 5IJWA 1AUQA 1QYXA 5C8ZA 1N2GA 3OX4A 2FPPA 4FOOA 2UXCB 2COKA 3QKRA 7REQB 1OIWA 4NOKA 3A1NA 1WXWA 1HLGA 4ANFA 4D1YA 1GV1A 4BX9A 4POOA 1I7DA 1K6XA 1XXHE 4ZI5A 2Q9CA 3ZE7A 2WF7A 3JWEA 3GEBA 2OV4A 5EIWA 2OXTA 1V1MB 4DMKA 4UBMA 1ZRHA 1USWA 1QU3A 5K3OA 1JQKA 1O95A 1ISSA 5E2IA 5K6TA 2VPXA 4XGNA 2NT4A 2J6BA 1UMBB 1OBVA 1P19A 3JWGA 3O1JC 1JQLB 3VO2A 5D1HA 1UMDA 3CEAA 4FR0A 5AKIA 4XYMA 1RJEA 2EZUA 2FX5A 3HHPA 3KOUA 4J1NA 5FYQA 4DF3A 4EJ2A 1F5SA 1PDVA 1GLVA 2ZE8A 5E2BA 4AWAA 3ABQB 3F3YA 4KXYA 1XA0A 3WWZA 3AL0C 4HAXA 5JYEA 4UMFA 4M0FA 2NO9A 1P1CA 1JDUA 2F43A 4H6WA 2ETVA 1IEVA 4MR8A 1IXKA 4R83A 4FEAA 3FNHA 5BN5B 5T4HA 5DYWA 4F11A 1SOMA 2D1SA 4PR3A 5DXFA 3SX0A 3IVRA 3TR5A 4YCNA 2GKGA 4IP0A 4MS1A 3KJFA 4S1NA 4F0JA 2B3TA 5TY0A 1T9ZA 2RB4A 3IQXA 5CA0F 1AQJA 4MQFA 1EX9A 4IDQA 2UVDA 3IAXA 1O95D 2GBCA 2VXOA 3PL5A 1K08A 5T4FA 1K6JA 1N8TA 1NI4B 1YQGA 1CR6A 2PPLA 3KOWA 2Q2NA 5BQXA 1RRCA 1JF8A 2PMDA 4CKEA 5GZ1A 3CJTA 3DD1A 4U2KA 5EVJA 1ZJ4A 5BN4A 4UUBA 1ZP6A 2B35A 3MCVA 5JSZA 3PX7A 1RFLA 1WB6A 3G88A 1TQHA 2NO6A 2R1TB 2VHCA 1GZVA 2ZU0C 4M0DA 3J7AC 2WRZA 1TK2A 3L9XA 1ZVVA 5D2CA 1VMKA 2Q3MA 4EG7A 3AXTA 2QZ4A 4LTMA 2XITA 3LPLA 2NU6A 5KYKA 1E1YA 1ZINA 4C4AA 2AI2A 2VF2A 3JR7A 5D85A 3WDSA 5KOIA 3CR3C 5C1DA 1ZU4A 1H6CA 2JGDA 4LY0A 2C4WA 2R62A 3FPSA 3ZCQA 1OX6A 2JIOA 3CKYA 1KKMA 1N6NA 3D6UA 3LP8A 4HSEA 4LOHA 3WLOA 3DVSX 5AK0A 1EFUA 4CUZA 3BA6A 5DI3A 4ZIRA 2SBTA 4JXZA 1J39A 4PZYA 3PR2B 1A2QA 3F2IA 2OGSA 3A4NA 1U7XA 1LY1A 2VR1A 5LNK6 1G3MA 2IZ5A 3N2GA 4V0MA 3SZMA 4BP3A 2GN6A 2J5KA 3QBTA 1BE0A 2AF4C 2IVFA 4HDQB 4RIHA 2ZYGA 1OLXB 3AVTA 2ICAA 3PLNA 3LQ4A 4Z2AA 4OIMA 2JLVA 3I52A 5LA6A 5ICCA 4FR2A 3ZJVA 2HWYA 3AFGA 2O57A 3DKRA 3PSHA 1G8SA 4TKUA 3CNNA 2LUOA 4WNAA 5AOBA 1EDEA 3UWKA 1QOZA 4JGBA 4ZI2A 3ZD6A 1T4BA 3MWLA 5BV7A 1CUGA 1KJ8A 4AL4A 3H4IA 1A9RA 3DKIA 1LI7A 2WKPA 1NBEA 4EPTA 4YJHA 1IMOA 3DDHA 3ZWDA 5HK9A 3CEPB 1YTLA 4ND6A 3X1ZA 3SBOA 4MULA 3K9GA 1Y6GA 4HRYA 5CIWA 5CM9C 3R9XA 1XSEA 4IRUB 1RU3A 2PYZA 3OKAA 1EVKA 3L05A 4IKOA 1CNEA 5I9IA 1NRJB 1UP7A 3PFKA 2HDOA 5DF1A 2YDYA 4PPQA 2UZ1B 3H4TA 4AG3A 2B94A 1A27A 1T3HA 4I5DA 5IAGA 1PJCA 1VL6A 1XYYA 1PQYA 1SBHA 4PX5A 3COYA 1KDYA 3RU9A 2BH9A 1HMYA 5EP2A 2A9JA 1XRRA 4QGSA 3USCS 4BX8A 3QE9Y 4RVHA 1PSWA 2D1TA 3IHKA 1LVGA 3M4YA 2OL4A 4GOJA 3C7CB 2H5JA 1VKZA 1I33A 4PYIA 2M6LA 1S02A 4CKBA 3ZDYB 2FX3A 2IYFA 1JA1A 4KFTA 4DILA 2C9ZA 3OF3A 3SFTA 5JRDS 2AZMA 4TL6A 2O3TA 3LVFO 3PHJA 4JD5A 5DHAA 3KNZA 2WMYA 3Q3CA 5JXWA 1PZMA 1CS0A 4ABTA 1TUBA 2RGGA 2OUKA 2XDQA 2BMEA 2CCKA 5LPNA 3LLVA 1V8FA 1L7VC 2B0JA 3IP1A 1TOAA 2EFJA 2QL7A 3U7QA 2W43A 3FTQA 1OI2A 5HIJA 1FW8A 2VWGA 4Y2QA 1QXSA 4BLVA 1JTVA 2E4ZA 3ABZA 3QUBA 4Y2TA 3I9MA 1HR0B 2PKCA 5ERXA 3G82C 3KOXA 4NK5A 1L4YA 3DNMA 3JVDA 2J5XA 1Q15A 1SXJA 1UK8A 2QWXA 2PGLA 4M0LA 4JMLA 1W36D 3LZDA 1TZCA 4I19A 3R8CA 5FWYA 2QYSA 1SBYA 2BKLA 4FHFA 1JDSA 2HGSA 3AETA 4G0PA 4G5XA 4MIOA 5CLJA 2RAUA 4RD1A 1MC5A 2H2IA 1SU7A 4MS4A 4ZCMA 3RKUA 2V7EA 4Q4JA 4RHYA 4A0HA 5TB5A 3WKDA 1Z0IA 2H92A 3ISTA 4L4SA 2O8FA 6REQB 2IYNA 3C24A 1FS4A 2HHCA 3KX2A 3OZSA 1JEEA 2Q1WA 5DBGA 5FX2A 1U2GC 2NX2A 1TL7C 2GAOA 3G7NA 1FRNA 4I7EA 1A9OA 2CK3A 5E1OA 3I6IA 4FFWA 4JFRA 4BLWA 1CYEA 3UOWA 1A7KA 1E2IA 2OHJA 1LK7A 1XB2A 2FFBA 1T5HX 3CN9A 1SKQA 3MT7A 4OLFA 2M98A 3U6BA 2B37A 1SXJD 4FSHA 4R40A 1DAOA 5KZMB 4YQZA 5DO9A 4U7HA 4B6QA 4V24A 1NW8A 3D3WB 3SAJA 1XU9A 1YHNA 2O6HA 2HBRA 3G8BA 1YCFA 1LQ2A 2XWQA 4IJ5A 4O2AA 4PLTA 5ICGA 1QU2A 1XDWA 4WZ6A 2G5PA 3LUCA 4M8IA 2B1GA 3U19A 3E3LA 3TLYA 3EBPA 4RY2A 5JJCA 4WNYA 2FOIA 2RIRA 1ENYA 4R8LA 4GX0A 4YONB 2EKBA 4EVQA 3GEEA 2NU7B 3RK0A 3HBNA 1N5JA 4L4UA 5EZQA 4XGRA 4HVCA 4RJJA 2CK3D 1M34B 4ZAZA 5JC1A 1MT3A 1JA9A 1UWVA 5JZSA 1T5IA 5UKDA 5F2OA 2C4TA 2D7CA 1N5RA 5ALQA 4IF6A 3KL4A 4G37A 3B78A 1V1RA 4O4HA 2FWRA 3TTYA 3ZKWB 2PEZA 5G41A 1B1AA 4MV7A 4WOKA 4YJ3A 3OQIA 3BH6A 4PM4A 1JT2A 2ZEJA 3E1KA 3K20A 4JEUA 3LT0A 1S8NA 1VECA 3U4QA 3TLCA 4PZ0A 3F5QA 4CM9A 2XBMA 5EIBD 2NZUG 2QZ9A 4UM8B 3CWCA 1I8TA 5EP1A 4IINA 4D4KA 3THWA 3V8QA 1YDEA 1R9GA 4RCYA 1QV6A 2VJDA 1U5BB 2RC6A 4KV7A 5K3SA 4M1SA 4MAFA 3H9GA 4CM8A 1DCMA 4EEXA 2W2TA 3KBOA 5EZYA 1Q95A 4O4LF 1ZD5A 4XVHA 4J03A 4U4AA 3ONWA 1CQPA 1T3TA 2R6CA 3CUVA 3OKCA 4RTMA 1W88B 3MWGA 2O59A 5CNKA 1OASA 1OGIA 2RGEA 2JAPA 1LRJA 2WU3A 1EE1A 3BG5A 4QGAA 4QKQA 1TGYA 1JEAA 4RPHA 2PT6A 3R23A 2UU9B 4MR9A 1CZRA 2QTWB 4QUHA 3TNYA 1G7RA 2PJDA 1CUSA 4NAUA 4CM9D 4JEMA 5JS7A 3NRCA 3QMPA 3ZJUA 2OHHA 5GV8A 2HA5A 2IEGA 3CRVA 3VKFA 4F4JA 5B7GA 1YC5A 1HEUA 4MAMA 5IT9A 3I4CA 4FGLA 2J67A 4ND8B 1SVWA 1QUFA 2W8ZA 4UBKA 2EXXA 1GPMA 2V7GA 5LCXA 5IT5A 3M4NA 4COOA 4MDYA 2NV0A 3WQRA 4BRUA 3KFLA 5MGBA 2Z2KA 4DCMA 4Y2UA 3IUBA 2FPPB 3ZXUB 3KTDA 4E4YA 4GC5A 1UT6A 3AR6A 1DIRA 3EZ2A 2GDJA 1GJRA 4AD8A 5K8IA 4PANA 3PZRA 1Y9AA 4LJAA 4TT3A 3T4UA 4OYRA 1Y5IA 2RJ3A 3YASA 5IKEA 2FUG6 4M8LA 1UJ5A 3USES 2VATA 3TIFA 2N42A 2XRZA 4JA0A 3LUAA 2V1UA 5JH7B 3GIWA 3K5IA 3EH1A 2FZCA 1VYVA 1FQWA 2HBZA 1H3NA 2VEDA 3U0VA 2YV5A 1SA0A 3N8HA 4HQNA 2ZTSA 3TX2A 1UMDB 1W34A 4GMXA 4QXMA 5AIBA 1MV5A 5A9SA 3VDRA 1EMDA 3HYLA 4HAVA 1PSZA 4I4TA 4TV8A 5K8TA 1JWLA 4AI6A 3R8FA 4OHZA 1ORWA 1PUJA 2F43B 4YV7A 4IXNA 2H17A 2WJIA 4KLZA 1PZXA 4TT3D 1W9HA 3CCBA 4MS1B 3UHAA 4KZPA 5DBHX 1N2CE 3G9UA 2DP4E 1XMJA 1Z45A 3L7DA 5IK2A 1H4TA 3I5YA 2QDKA 5DHUA 5DM60 5DHSA 1RJ9A 3LXMA 4CM7A 3G1UA 2HQBA 3VJLA 5C4GB 4KFSA 2DWPA 5HE8A 2OWDA 3SIRA 4Y0NA 1JJVA 1O95C 4CKEB 5IFLA 3QXJA 2MYPA 3WAJA 1XQYA 5BN4B 4R9RA 1IUKA 3FSEA 3LPCA 4IFTA 4YAWA 4R6XA 4POAA 2Y1OA 4OYYA 3R3HA 1G5HA 1DC6A 3PRJA 3PQ5A 4RXUA 4FB5A 4HDKA 4YQEA 2QD1A 1VBNA 2PXCA 3AJ8A 1KO7A 4FDLA 3ROEA 4IG9A 4BN0A 1XPRA 2AUMA 2QAIA 4AUKA 4U8HA 4AY6A 3A9RA 2NU6B 1FK8A 2XGMA 2YZ2A 4JL8A 4KG7A 2ZRDA 2XNCA 4OVKA 2NZJA 3FDZA 1PAUA 4F4DA 5IK2D 1YFZA 5K0CA 2JGDB 2VQDA 4PZDA 3BGDA 3ICVA 5E8JA 4OUKX 4RIIA 1E1LA 1RE1A 3KR2A 4UCXA 4F04A 4BWVA 1W96A 4G36A 4ZIRB 2J32A 4JKOA 3T1YB 1EE9A 3JATA 1NBIA 5DI3B 5ICFA 2GBPA 3WI7A 5B37A 2RI6A 4EGAA 1JFLA 5HZHA 3CZMA 4GUDA 4MXDA 1WXIA 3QPWA 3TDMA 2YHIB 3N2GB 2JAXA 3RRFA 1GR1A 2P6OA 2IY9A 1RWWA 2FZ4A 3NFRA 3F6SA 2RJNA 3O8OA 5FA5A 3K9QO 3CVXA 3V1MA 4PLYA 3DONA 4BVJA 1IBLB 2PM8A 4PSCA 3TQOA 2H54A 1ZMTA 2OB1A 3R3JA 4IOKA 4PSVA 4Q03A 5HHTA 3GC6A 4D25A 2C9MA 4CG1A 1I2BA 1I32A 1N2ZA 1WPRA 2OCLA 5IM5A 4E31A 5DK4A 3O4VA 1LDEA 1RWPA 3N0WA 3TL3A 4Q4HA 1C7JA 2AMYA 3VMMA 2O54A 3VPHA 1I10A 2M1XA 2GPYA 2DG2A 3RAGA 1U11A 2BFDA 2HRQA 4LQDA 2DFLA 4U2FA 1UFOA 1CP3A 1M54A 1QVRA 2DZDA 1X92A 4LRUA 1ZH8A 1AKVA 1VXRA 5IVIA 1ZH4A 2FR8C 3PYXA 1W4LA 1YS4A 1Q7GA 1EUCA 4IBOA 4WKPA 3CUKA 1ORHA 3WGMA 5F2NA 1JPJA 3R9XB 4YLGA 4WHMA 3RG2A 1SUSA 4OLAA 1MJHA 2EF1A 5KQPA 4ARUA 4ODIA 1EFAA 3QX7A 4P3XA 3A1UA 4QZVA 3JARA 5DTIA 1RM5A 3S7ZA 4LVCA 2JBHA 3D8TA 4KMSA 2HPHA 3X2FA 4KEAA 3TLGA 3UCEA 2ZYDA 4XWTA 4GP9A 2HIAA 3GOHA 4HVLA 5ULLA 2HK8A 2QI9C 3HU2A 3PJFA 4D56A 5CDFE 5JNTA 4F4CA 2WAXA 1E2GA 1UL1X 3D4PA 3ROZA 4KR9A 1WKVA 1EJ0A 2HLPA 1PNRA 3EQ2A 1K1EA 1P7VA 4GYWA 3O1IC 4J0HA 4EHKA 4IDEA 1RRFA 1RZVA 3FDJA 2DPXA 2LGJA 4IIBA 4MYSA 2CZGA 2YWFA 2P3QA 3EDYA 4ME6A 4AWXA 4CKBB 4MROA 1VMEA 3TL2A 2GD6A 1NXSA 2NN3C 3FHOA 5BPHA 3VHRA 3DNFA 4Z54A 1JX6A 3GHYA 3PEUA 4YALA 4YRPA 5G3ZA 1ZCZA 4RHXA 4HZUA 1TUBB 1VZ3A 1Y5MA 1YRHA 2BI7A 2PZMA 2IT1A 4FCCA 4KAAA 4FEGA 3FR8A 4YI3A 1LPPA 2UZ0A 1XLTC 2XDQB 2VXYA 4JOSA 5AKEA 1ID8A 1H93A 1WW2A 2CKDA 1G59A 5H9VA 1TIPA 4C0LA 4UCFA 1T9DA 4XCQA 2X3UA 3DE5X 4G85A 1IG0A 1BXZA 2W8BB 2BEUA 2I8LA 5EIAA 1S3IA 3RVRA 3BMCA 2GVDC 4KJZA 5TPWB 3MSXA 3WGHA 1JLLA 1KIMA 1XVUA 3REOA 5ED4A 1A9SA 3R0IA 2YL2A 4MW0A 5HUQA 1QQ5A 1SXJB 2CD9A 1PGOA 2QXUA 4HAWA 4RX1A 1HK7A 1QOPB 5FWYB 1EWYA 4FHEA 1Y81A 4TMVA 4URZR 5JADA 4OL0A 4JHXA 5LDGA 1E1MA 1P7CA 2DKOA 1W36C 4QREA 3MHTA 4DV5B 5TMPA 1V48A 1XAIA 3CRNA 1MAUA 3F5DA 1VFPA 1TZJA 4LOLA 4Q1CA 1TQDA 2O8FB 2LCIA 1GOTA 3KR0A 1E1KA 1Y33E 4WZBB 3RSOA 3ESYA 5IXYA 5K0ZA 2P2SA 1Z8HA 2ORVA 3O47A 3FPCA 3F71A 1IJBA 4GP6A 3DLAA 3W5AA 3RJMA 1UXHA 3Q3VA 5FLKA 2FP4B 2HJRA 1RWBA 2PUVA 2CGEA 3EARA 3AESB 4OD0A 4QE3A 1QHYA 5EHIA 2HSDA 3PQCA 3F5FA 3NTVA 2AFVA 1HKUA 3JVIA 3U4AA 1ZX1A 2HK7A 1H23A 2CSUA 3LE8A 5B5SA 5IPFA 2QRJA 4C2UA 1SXJC 1U8XX 3DEYX 2QRZA 3D3JA 4PPGA 2IHZA 5DIFA 4O2AB 3HYSA 1EEHA 1XT6A 4JHLA 4RM2A 2PFGA 3ID6C 2JLSA 3LUBA 5AJXA 5ELMA 4LJ7A 1IULA 1TT5B 2GK3A 4MW5A 3SS7X 1EP9A 2FQ1A 3DZKA 3UJPA 2A9QA 3GR6A 1DRVA 3WMFA 2K4MA 4G1VA 1G60A 1G2IA 2YJ6A 4RH3A 3TDKA 4EX6A 1UDXA 4Y1GA 1JT9A 5HKLA 5KHOC 2AZXA 5A0FA 3CG0A 4AJLA 1NNEA 4JVNA 1RFGE 3B53X 4P3NA 1XDGA 1TKAA 4AKEA 4N9QA 5LP6A 4G0NA 4ALLA 1BJKA 1ORVA 1V1RB 2OR3A 2AKAB 3BD6A 4H0FA 4O4HB 4XWGA 2B8JA 4DBLE 1H2WA 1P2DA 3MK31 3OF5A 1HLFA 3OQIB 5GONF 2ZK7A 2FY8A 2BJWA 2FN8A 4MDHA 2QT1A 4DA0A 1V16A 3U4QB 1N34B 4X97A 2IZZA 3BWCA 3IPLA 4V0LA 5KYYA 1PDOA 2V7TA 4RAQA 4DADA 4A82A 4MUNA 3LSTA 4N41A 5CIQA 2FKAA 2INGX 4CM8B 5B4VA 3P2OA 4XD2A 4Z7OB 2NZYA 2ZTHA 5EZYB 2BGJA 1C14A 2DPGA 2PFKA 3HN2A 2C8VA 5FPYA 1TCUA 4C78A 3CINA 2B7LA 3R09A 1DKMA 4IZ6A 4AMZA 2TMGA 2ALJA 1ELOA 1Q7EA 1Y8RA 3Q11A 2C88A 1ZI9A 1PV4A 2C04A 2YW2A 4PLWA 5DM4A 5T41A 1QQBA 5BW8A 3SKVA 4OQEA 4QDUA 2REXB 1ZK0A 2ZVPX 4MR9B 4GLLA 1A5ZA 1FFWA 1DU4A 3D4NA 5BP7A 1CP2A 4R3UC 1QH8A 1TM7E 3E1GA 3NJ8A 1M10A 4TXHA 4A8PA 3K9FC 2FPUA 1U8CB 3QW4B 5IBCA 2OBYA 4L6CA 1CFZA 1Q11A 4IHAA 1U0BB 1ISFA 1OFHA 1OKKA 4OJQA 4XQGA 1LPOA 1Y4AE 1WXFA 2B4RO 3TQTA 1TTQB 4XSVA 3MUOA 3NDRA 1VHLA 1FRZA 1SPXA 3MQ4A 4FYHA 5GY7A 3V8EA 5C5DA 3FWKA 5CFQA 5C8YA 1FS5A 4OBXA 4FI3F 2PAFA 4RQTA 1P5RA 3GJSA 1Y8CA 4IDPA 3CNEA 1MP0A 4O2BA 4H7DA 1FFAA 3I6QA 2MR6A 3B1JA 3DS8A 1V4VA 4Y1EA 3ZZMA 4LRWA 5AOCA 5GGXA 5JPIA 3Q0TA 3U62A 2WOJA 3A31A 1GGVA 3DVQX 1I0LA 3UJ6A 1QZZA 1ADJA 1ZDMA 2ZBGA 5KWJA 2XADA 1NJGA 3EVZA 1Y7IA 3GLIB 5KNDA 5JZVA 3CIOA 1GCOA 1CXZA 1ZOPA 2WT4A 4WUTA 4Q9LA 1QE5A 1VIMA 1SA0B 2RHTA 4RD2A 1OKKD 2OD7A 1NBAA 3BDVA 4TMYA 1RLUA 3HEAA 5A9SB 1O77A 3WB0A 1KJ9A 1Z73A 3OY7A 4I4TB 4JC4A 2RHBA 5LUAA 2VHWA 3CY6A 3L7LA 1XQXA 1MKYA 2QQFA 1M33A 3LFUA 5EYPA 4OB6A 4DQXA 3AU8A 1GQQA 2NOAA 3Q87B 4DCSA 4FOPA 1QYWA 3S70A 4BJ6A 1ZN7A 3K4HA 2ZB7A 4H1HA 4WLFA 2K7FA 1FYEA 2Q50A 1JEDA 1N8SA 2W2OA 2L17A 1NLUA 1UJ2A 4BMYA 5C5IA 2W6OA 3D2AA 3KSZO 4QQKA 1A50B 3JVUA 2H1OA 2CJYA 1WF3A 4IMRA 1G63A 2ZIWB 3ZHCA 5KNDD 2AW3A 4IH4A 3DW1X 4MHSA 3ZV5A 1ESMA 5AVTA 1Q1AA 3VDNB 2WJYA 1PZEA 3T7KA 4JB2A 1KK2A 1GN9A 2VIIA 1CDZA 3H1TA 2QSZA 2GZHA 4E5YA 4ZYXA 5CG1A 1KWKA 5BR8B 3M5WA 1RR6A 1K63A 3HB0A 2ADFA 4P8RA 1GZ4A 2ZT6A 1M2HA 2CLIB 2XYPA 4HPJB 1X42A 4EKIA 5CB6A 3HZRA 2NU8A 4QUAA 1B73A 2E6KA 2FPOA 4BRZA 1ZO8A 3OLXA 3FKQA 4EP1A 1GQOA 1NUSA 3N0RA 2O8BA 3FDZB 4EJMA 2G08A 2WF5A 4HMOA 4MKFA 2NVUA 1YR9A 3DV9A 4ZYWA 5EHXA 3M7IA 4PCAA 5GGYA 4AZTA 1GGNA 2ZT5A 3O92A 3RJ5A 1FE8A 4E2ZA 1IJFA 3B2QA 3A25A 3KOZA 1NJ5A 5LZ2A 2JDID 3RSZA 4ZTBA 2HR1A 1YZQA 4IDGA 2BLNA 5HM6A 4JI3B 4KKVA 5KSYA 1EM8A 3MZ0A 1EP3B 1FP6A 3ZHYA 2ZIFA 3B8EA 5ALTA 4E7OA 3N3BC 1SHLA 1J7JA 4I3FA 2DY0A 4O08A 5GP1A 3RJZA 2ZRKA 4AB1A 4E5SA 2XKKA 1XQWA 3ICCA 4RA6A 3BFVA 2VDMB 3UQYS 3OA0A 1LW6E 3IEUA 4Q4HB 4DA9A 4CKXA 4C06A 1USUA 3FZEA 1QPZA 1RPNA 2OO7A 2EZ9A 2QR5A 3ANYB 3OZGA 4V0QA 1NQUA 2I4IA 2O0MA 4BO9A 1OU0A 5EZ6B 4R8SA 4DLRA 5BMVA 4CU2A 1GQRA 1T8TA 3AHCA 4K5QA 4X93A 4JV5B 1FUIA 4GMDA 1A5BB 4KLNA 2B2NA 1HE4A 4MIKA 1AXEA 3WWOA 2BAGA 4ROTA 3QNUA 5DGDA 1YMUA 4DSTA 4FYVA 3EHEA 1WRBA 4MPDA 2APJA 5K0JA 4G1UC 2PVSA 4IWNA 4CT5A 3KYBA 2VHQA 3OH8A 3R1IA 4NDAA 4MUKA 3S8EA 3WK5A 2HEGA 1MRZA 5DHRA 1ZKMA 2P4HX 4L57A 1S2OA 4OJNA 4UNNA 4YAJA 4CNQA 1OH8A 2C9BA 4CTKA 5C4IA 4I9UA 2YRFA 2OQIA 2HWXA 1HYBA 4L9RA 5I7AA 2Y2VA 4UHBA 3H1BA 1ZR2A 4UUNA 3RIEA 3HCBA 3BWDD 4BECA 1ZNQO 4UPEA 3ABOB 4Y7CA 2VUHB 3D4IA 2YNMA 3IAS6 2XZLA 5TDHA 4UXIA 2PGNA 2XT9A 1J33A 1KJZA 4QO8A 1XPOA 2FJ0A 1ZGHA 4CWAA 4EKNB 4K03A 4ZO8A 4HZUB 5EJAA 1SH7A 5IH7A 4ETWA 3SXJA 4C5BA 1DQNA 3FMPB 1C2TA 1OBHA 5GTDA 1VDMA 3IDSA 3V4ZA 3FD8A 2AR0A 4I1RA 5DNWA 4L9WA 4O4JF 5THQA 3TTTA 4YR7A 4U7PB 1G8HA 1KP2A 2VJAA 3QLVA 4M83A 4B44A 3PQ7A 2FFAA 4MI1A 4XZ3A 1MB4A 3GFTA 3K0FB 2JRLA 1PFVA 4KU4A 4N48A 5FT9A 1WO8A 2B4TO 3BMCB 3FYTA 2W48A 1JLLB 3UF0A 1ZGZA 1A7UA 4K0KB 2YNMD 1RLTA 1SEPA 1QX3A 4OSEA 2BY4A 3WISA 4B45A 4MP6A 1DL5A 2R8PA 3S2SA 4DCOA 2YVKA 1ISPA 3NR2A 4TZKA 5YASA 3F6PA 4KQ1A 3SICE 4YI5A 4TTVA 1J70A 1UANA 4URHA 1B4DA 3K9HA 1VE9A 4TUYA 2AOVA 2FDRA 1DAHA 2PX4A 4QOJA 3RVBA 5IWAB 3PC3A 3SS8A 1H8HA 5B53A 4R3NA 3AEKA 2BHTA 3Q6IA 4LVNA 1C8VB 1ESEA 2I4RA 5CB4A 2J0UB 1IM8A 1WDWB 1HOXA 2GERA 1Y3BE 4L0QA 3Q9LA 5EA2A 4MRVA 2IX3A 4V3BA 1I5OA 1S3SA 1C0EA 2JLQA 3AGPA 1J49A 5TGZA 2NW6A 1QRTA 1TUGA 4JQZA 4RTJA 1N9GA 3MRTA 5KWEA 3H5TA 4ZRDA 1T2EA 2VN8A 3A7DA 2RD2A 2ECKA 2G71A 1FFXB 1Y1PA 5AVZA 5L3VA 2ACWA 1QH9A 3E0QA 1VG9B 3DZCA 1Z35A 3PQDA 4K28A 3E9CA 3GJ0A 4FFMA 4Y9DA 4EELA 1LRKA 1FBNA 4MQLA 3NVAA 4IQ0A 2VSOA 4KJXA 4LWZA 4EGSA 1F8GA 3PGMA 2J6HA 4Y2SA 1H8HD 3QHAA 1TEZA 1L8XA 2RGDA 1EFVB 1TO1E 2I6SA 4B5KA 1F60A 3R3ZA 5IUKC 4IFBA 4QXRA 3HQ4O 2FOLA 3GARA 1XVAA 3C2QA 5I7EA 1YV9A 4CMGA 4C4XA 1JDBB 1N2JA 2XF8A 3DCJA 4LFBB 5TV2A 2RGBA 5AJUA 4E32A 5LP6B 2YN2A 2DCUA 1X1EA 2P6UA 3JQ7A 2B61A 3RVMA 4JR0A 1BMTA 5IUNC 1P44A 1VPDA 3AOEA 1OFUX 1Z8NA 2QU7A 5CTJA 4QFDA 5ITZA 3BK7A 1SBNE 5EEHA 1EDBA 4QBIA 4FMDB 1J09A 3GLFA 1PYOA 3T7TA 1JSLA 1DQSA 1V16B 1G8KA 1ZNXA 2GFHA 4M88A 4X45A 4X41A 3O8CA 1FTNA 1LS1A 1L4LA 1Z2CA 1Z36A 1Z7WA 3DOFA 1EVLA 2Q1TA 3MUEA 3IUYA 3DAGA 1NW4A 3NP9A 3E2PA 1USIA 4QIHA 3FUVA 2RHMA 4DY6A 1MA3A 1C7FA 2KSQA 4N4AA 3DXZA 2J3HA 4WA8A 4L9SA 3VBEA 5B58C 2HZ7A 2R4TA 3MBOA 2BP7A 4KNVA 3OTGA 2A5LA 3P9XA 4RC9A 3E9DA 2DLCX 3RREA 3W1VA 1OAOC 4UTVA 1Y8RB 4LF9B 3WMWA 1KEUA 3R7LA 3ZWCA 2ZI6A 3PFNA 3RU7A 5BWCA 3B60A 3QFHA 3VR2A 4R0NA 3WBFA 3B38A 3ZGNA 4MP3A 3RVDA 4Q15A 4RS4A 2NVBA 2BFCA 4YCDA 3DLBA 3LWZA 2YJGA 3OQBA 4OQ4A 1TTHA 3NEAA 1MIHA 4R51A 3AVQA 4G5HA 4TRMA 4BFZA 8ATCA 2D3TA 2JAUA 3S99A 2HA3A 2H65A 5TXGA 2GZAA 2WWIA 3LMKA 4K9RA 1QO7A 2OVFA 4JS0A 4RWZA 3U56A 5C8YB 1YUBA 4NENA 1TF2A 4C88A 5KYWB 2QGFA 3PUZA 1SXQA 1U7WA 1LDMA 3W8DA 1OROA 4PVCA 4F84A 3QFCA 3EPHA 2DLDA 4ZEWA 5BQ3A 1RXYA 4GVLA 4LYGA 4RL6A 3TXAA 3VDMA 1W8DA 1WDTA 1BOFA 5JHGB 1MFPA 1XU4A 2J5BA 1GGHA 4U2GA 5TQVA 1F7UA 4KQWA 1EG7A 3EZNA 3VR2D 1FFSA 4BQIA 3IJRA 4RMIA 4W7HA 4M4SA 3NWJA 3QJGA 1K0UA 1GG8A 3P2JA 2WQ6A 1CQJA 1GZDA 1R18A 2XCQA 5IDYA 4RYLA 1ZH6A 3IMGA 3FUTA 5LQNA 3JXEA 1YMQA 5DV9A 3NOQA 1W0KD 3TJMA 4RY0A 4DPLA 4MVJF 2ZUEA 4BNYA 3NW9A 1C50A 1TZ2A 3GZNA 3GMSA 3H5NA 3Q5DA 4K2HA 4XGIA 5EYPB 3RTCA 1VTKA 3V1KA 5JLAA 1B6GA 4HDRA 3COJA 2IGTA 4BGIA 2DPLA 1GNTA 3KAPA 3CZ9A 2OP1A 3ZK7A 5ALXA 1P3Y1 4X64B 2Y66A 3I2FA 3UT0A 1HORA 1NC3A 3BF7A 1QHIA 2H1SA 3STVA 4BUZA 1M1YA 1UC5B 1ZM2A 2HQ1A 2PZEA 3PPVA 2W22A 3PWZA 4CCAA 1S9HA 1A8SA 1W5TA 2ZUCA 3I64A 4MLCA 4F60A 3NC1C 5LC1A 4BMDA 3WL6A 2RH8A 2ISQA 3P9RA 3KXDA 1X14A 2ID9A 3P0FA 2H4YA 2HSZA 1V0JA 3ASUA 2C95A 3ENQA 1WQ4A 2X86A 5LXTF 1YQQA 3AEUA 2GO7A 5FPSA 4A1OA 4TM7A 2O8BB 1NLMA 2H1HA 3MTGA 5AKLA 2CW5A 2GSDA 3AH8A 3GROA 5DRTA 3GJ5A 1U94A 3FPLA 4A73A 4CQLA 4EO7A 3HTXA 2NVUB 1XR3A 3RAJA 1NJ8A 4HNHA 3WK6A 3GCXA 4E2XA 1KAEA 1XZHA 2PKWA 5J23A 2O1XA 2FOXA 2W9XA 2IYRA 3HXPA 2W98A 1KRXA 4ZAWA 3DAFA 1AMNA 1BZYA 1KXJA 4JY7A 1FDOA 3TBFA 1J21A 4JZKA 3ZJ4A 3MGKA 4JGIA 2XMQA 3WLLA 4GEKA 1H8EA 1SCNE 3ICQB 2G07A 10MHA 4DR6B 3RRBA 3AIOA 3RTEA 3Q3HA 3G8AA 1PQUA 2Y6UA 4MUHA 5E6SA 2AOWA 2PR7A 3ETDA 1MHPA 5FBVB 5K01A 1Z62A 1W1UA 2ZRGA 1TF5A 3ZV4A 2ZUVA 1ETUA 1WA5A 2AA3A 4RA6B 4RKFA 2DSNA 4TTSA 3VZPA 4GQBA 4JXKA 3MAAC 4F12A 2R6ZA 1VHDA 4WOCA 4LJSA 3L49A 4WE3A 4CW7A 4QJ4A 1MFZA 4FT2A 1PK7A 1AV6A 5TGTA 2J9RA 1ZRNA 1MQAA 1CSEE 4M7WA 1RXIA 4MCHA 2J5RA 1PGPA 1JKMA 4XDZA 1VLLA 5JARA 5L4SA 3BJIC 3V8PA 2RGUA 3FG9A 2IHKA 4OKIA 3BDIA 3UANA 5BOSA 4GDFA 2YZKA 4GWLA 4WOPA 1QHHA 1L7MA 2ID7A 1ZW6A 1H8ED 2YJ5A 3H2JA 1YHYA 3MERA 4IZIA 1C80A 2QGZA 1XF1A 4O4IA 2GHTA 3N1UA 2FWAA 2BGKA 3L46A 1W93A 1L7BA 4TN5A 2NPOA 2HMYB 1LK0A 4H3SA 3AF0A 2JFGA 4A6EA 3OFSA 1NXTA 4HN9A 1N3YA 2IHVA 1NM5C 2JGFA 3K1TA 4PNPA 3TM5A 2YWDA 1U4NA 4R31A 3BB3A 5DXJA 3A6KA 2O52A 4KXXA 3AVWA 1UEIA 4NFYA 2Q0XA 3LXUX 2FTKE 1JAXA 1CERA 1IHUA 2JCBA 3IURA 4QXPA 4DRXB 1M6YA 5E7MA 3UPDA 1QHGA 2BGGA 2Q46A 1G8JA 4WLUA 5K3FB 1X1QA 5FTJA 4TLAA 4FW9A 3JWJA 3V46A 1N5LA 4QUKA 3WLHA 3T9FA 4EECA 4GMKA 1QNFA 1KWGA 3W9BA 1XCBA 3LHSA 3B3QA 4HX5A 3AFNA 5KO2A 2Q3FA 2K2WA 4YCBA 3ORHA 3WNQA 4W9MC 3FLBA 1IN5A 2FNAA 3M3PA 4J43A 3WLAA 1AS3A 2GYUA 3HU1A 1ODIA 4KQIA 4UBJA 3H1AA 1P4SA 2IOYA 2JD2A 5DGCA 1XC7A 5KNCH 1CZLA 3SCZA 4L50A 3UV3A 1ECJA 4YRSA 2R8OA 3LY5A 1AMUA 4PQEA 1R00A 1U9IC 4PO8A 2GZRA 2QTVA 3IV9A 1M2WA 4BQEA 2Q6KA 5H80A 1PTJA 3CLTD 5KINB 4TMZA 1EWKA 5I3CA 3PFHA 4RMGA 1CRZA 5CGQB 4BOYA 2H31A 3O6VA 2YNMC 3AL3A 2Z4RA 4BVFA 1EFRA 1LBTA 1MIOA 2I67A 5M34A 2EFCB 3PNKA 2O8DA 1SCIA 2Q7XA 4FKMA 4JQSA 3SE7A 3HH8A 1PUIA 3QVVA 4TUYB 5FPHA 4MOWA 1XQ1A 2XCUA 1G20E 2W6QA 4UREA 5GM2A 1ZM4A 2W4QA 5ALMA 1N3LA 1GDHA 1HDIA 1KU6A 3JAKA 1RI3A 4GX5A 4ZYZA 3IAEA 3Q1LA 3UMCA 3I45A 3NHZA 3TJZA 1OXXK 4EJSC 3FTFA 4KXQA 1MO3A 1PJLA 2GWRA 4G0WA 1EI9A 1KOFA 2I3BA 1M8KA 1YCGA 4OQQA 3V1NA 2XGJA 3RKRA 2FWIA 3F96A 3NDPA 4H4EA 1XKLA 3GG2A 2QVCA 3RUCA 3LNCA 4BTLA 3JD3A 1XTJA 1RRPA 3IULA 5IF9A 5KKNB 4IS2A 1U9YA 4D9HA 4A0RA 3HA2A 3CH5A 4ZVPA 4KE6A 2KB0A 1NHWA 3HJNA 1JDNA 2H06A 3TNFA 5DBFA 1SZDA 2QTFA 4XIIA 4KREA 1D04A 5D5QA 1K89A 2A0WA 2WJGA 2ZQ5A 3EY4A 4CDNA 5FH9A 5LQJA 2QNBA 1SUPA 4QVKA 1C3JA 4XR4A 2PBLA 3BM5A 3ADBA 1JPNA 5JFOA 4IX9A 1SKYE 4CKCA 3ZGVA 1GYPA 4LUCA 4QU0A 1TAHA 1HURA 4F8EA 5BORA 1H2BA 3HADA 1SBIA 5F3WB 3PPYA 3H2HA 3CLHA 3VYTB 1D2EA 3NWBA 3Q3JB 2F2TA 2QMUA 2GN1A 1QMPA 2ZP1A 1OT5A 1CUJA 1E9SA 3JQ7B 3OX3A 4G84A 1Y3DE 2ODTX 1Q7RA 3S40A 1TKRA 3ROKA 1SIUA 3N6XA 5CIYA 1UBRS 3REQA 5ITZB 4LMPA 3DEAA 3UPTA 2JLUA 4Y6GB 3FLMA 4GEGA 2HMWA 1ILEA 4INAA 3NVKI 1I6MA 4RSRA 1UBEA 4YK7A 1X2EA 4D46A 2FKNA 2PTHA 3D7NA 4YXFA 5BSWA 2R60A 2IXDA 1TEXA 1BS9A 3BIOA 2CJFA 4EUFA 2IOFA 3UTCA 1GAXA 3L6OO 3TRIA 1BDBA 1CYDA 3W90A 2WKRA 4RKEA 1G1MA 1HWYA 3ROGA 1ZLXA 1UBOS 2IBMA 3F5SA 2O05A 4DWWA 2BP7B 4GNRA 1W2WB 1KA9H 1E2QA 1AK1A 1QSGA 4UCQA 2PN1A 1A4UA 1D4FA 4MGZR 5DB4A 2DBZA 3HM2A 3REFA 3G9XA 1U9CA 3T3PB 3G5TA 4E03A 4ZTZB 2P67A 2IF2A 2RARA 3SJZA 3PX3A 1OR8A 1NZFA 4AZWA 4B43A 3FUWA 4BC1A 4B7AA 1D7AA 3QEMB 2QI9F 1SHJA 4MW2A 5LA6F 1VC2A 1M6HA 4L8GA 3I62A 5K6AA 3NT4A 3SGLA 3UWPA 3V48A 5IHXA 2BFCB 4X1OA 1OF1A 3K9LA 4XWKA 3SOZA 4D8YA 1IK4A 1NASA 3ORRA 1E3MA 5E6UA 4OXIA 3U7JA 1KI2A 2A58A 1HDYA 4MVJM 1LS6A 1UZNA 4NENB 1TVKA 1V5IA 1XD2A 4Z4CA 4GOLD 3FPKA 4HGRA 1Y98A 1CE8A 2HF2A 1JU9A 4MP8A 4GSKA 4EHHA 3BAFA 3EG9A 3C14C 1O89A 5C5EA 2H1WA 2J9YB 2NGRA 3OZWA 4HHEA 5HBRA 2IU0A 1FJ2A 1OJ7A 1QVVA 3UC5A 3G9ZA 3EDOA 1E62A 2GPSA 2WFLB 3A6DA 3SBEA 4CF7A 1TQ6A 2IBSA 1Y7LA 2GR9A 3A4TA 3QKIA 4PPNA 3H5RA 4TX1A 5PNTA 4ACBA 4EITA 3S81A 3PKIA 4HNGA 4E0BA 3TW8A 1LZKA 1WULS 4YQYA 1CQJB 2BL4A 2OZLA 5F4BA 3FH0A 4MKXA 3TZQA 4D5EA 4WCDA 1NNLA 5JXIA 2QTRA 3L7AA 3CRRA 5AJYA 3JQGB 4RFSA 2FWJA 3TD2A 5AUNB 4M8KA 3NMUF 3W5JA 4S04A 3GBVA 1XEXA 3GZNB 3HL4A 4X71A 5CDYA 4WXMA 2HJWA 4MVCA 3VYVA 4ENPA 2X2PA 5DOZA 3K6KA 4QPCA 2ZLBA 1DAFA 2YR0A 4FS3A 1R12A 1H1LA 4UMDA 3E23A 1RYZA 3ZN2A 3A6LA 4DWOA 2DBRA 3O73A 3FF4A 2AFIA 2HIMA 3ZHUA 2YV1A 3CTMA 1LBEA 3CEHA 1UODA 2XEXA 2ZSAA 4DGSA 4BWFB 4WCFA 4BGDA 1UWCA 4EG6A 4C76A 3HK2A 3DTYA 2R7LA 1XP8A 2FSHA 1UF9A 3U81A 4XYEA 3MIZA 3C8MA 3R0JA 2EATA 1CZNA 4J3FA 3ZDCA 5EXPA 3H83A 1UKZA 2G80A 1KNQA 4AS1A 4NHEA 3GRAA 4D82A 3FVTA 2CJPA 3COZA 1MN6A 4JUFA 2FW1A 3T9AA 1GUZA 1GUDA 3T1VA 4M49A 4GG1A 3AHIA 3JSAA 4RHCA 3SHWA 1CUCA 1SC9A 2CWWA 3OF2A 2QG6A 1L4FA 3ZIUA 2JI4A 1JMVA 1KQFA 5HM8A 2EQ5A 5JCPA 1L9KA 2Z3WA 4H3HB 4HEA1 1QGDA 4PQRA 3H9BA 3KCNA 4ENSA 3DQZA 3BXEA 3S29A 3RC3A 4NPAA 3DL0A 1EFLA 1FZTA 1ZK2A 2PRSA 2WSMA 1ATIA 1NMYA 5D87A 2BHLA 1BA3A 1EZ4A 3SEAA 5A02A 3BREA 3FMOB 3W2TA 5EIHA 2VJNA 1YXMA 3EGCA 4CTMA 2F9FA 2FCAA 2CJWB 3JD2A 1D2NA 1FNSA 1MX9A 2IEZA 3OQHA 4FHZA 1GILA 2W37A 3AHFA 5E6SB 5F7JA 3R44A 3HVKA 4F93B 1Q16A 2ZI4A 4U1RA 2R86A 2PV7A 1B7GO 1EVEA 3FZNA 4MVJH 4O2AF 1L5KA 3LPAA 2FEOA 2OOKA 5ISMA 2BEWA 3ZY5A 5EWLA 2BBOA 4YFVA 2G25A 3NOVA 1TFUA 1NN3A 1WD5A 5JZBA 4X63A 4XM1A 2PJRA 4QBTA 4GLFA 3HSYA 4LZZA 1T6ZA 2ILTA 3GPBA 3WIOA 4TGLA 4B2YA 5KTYA 4I4NA 2PUTA 3UHJA 3QWBA 4HAIA 1ZM9A 1PJRA 3WWCA 5LLTA 3GY0A 3FFAA 1KRHA 4Q93A 5BOSB 1Y1TA 1QHFA 1UADA 1P9WA 1QHHB 1VG0B 2VDVE 4Q7JB 2GVZC 5JBIA 4D02A 1U5AA 2PT5A 4Y2HA 1UFKA 2PLFA 2PS1A 1JDZA 3DVRX 4O4HF 1NW9B 4O4IB 1ULTA 1NPTO 4E08A 4RTLA 3BE6A 2NG1A 1GIAA 1Y3IA 3I5MA 2YJNA 4YJ3F 3WLQA 4F6LA 3KT3A 1EAMA 2X4IA 3ORYA 1KO4A 3UMRA 2O2XA 2Q5FA 2WQ7A 4E5NA 3AFHA 4FIDA 1N36B 5JR3A 3AG6A 5J1SB 3V00A 1IRIA 4L51A 4Q9AA 3HP7A 2X5OA 1J97A 6PFKA 4FFBA 2VDQB 2CL6X 1QGED 2JEOA 2O20A 3CSSA 3ESRA 3JALA 1DOZA 1KH1A 2JCVA 3R4VA 4UFOA 2VHJA 3WNVA 1B6RA 1MTOA 5EZYF 1RAGA 3K92A 2DECA 4FUQA 3RYIA 2JBWA 4BNXA 1DAMA 3Q7SA 4Y30A 1JIKA 1I7PA 3AEZA 3ER6A 3FNIA 1L7DA 3NBQA 4JJIA 4MRMA 1OYOA 2SKCA 3BSSA 5LZ5A 1NXWA 3WLSA 1CUWA 2QRVB 3ZY3A 2CLSA 1SD5A 4FW8A 1HQCA 2FW8A 4PYNA 3TG2A 4QATA 1HRDA 1OGJA 4C0SA 1FNBA 1N3IA 3PQEA 1YFKA 3MEQA 3HBAA 4KQMA 3EQ7A 4GP7A 4UEWA 3FGOA 4DC0A 1UKYA 5DM2A 3K0CC 3SP1A 4N65A 1HY3A 4GMHA 1E20A 3BS4A 2HRCA 3GMDA 1TEVA 4JP2A 2QTVB 3WDKA 3AI2A 3N70A 1R50A 3KU4A 3ZY6A 2E4XA 2DFDA 1IZ9A 1QQ6A 3C45A 1O08A 3L8GA 3MJVA 3PDHA 4K81B 4K9OA 4QSMA 5DGHA 4ML3A 3E4CA 3WRYC 3DKPA 1PVOA 3LUKA 1X1TA 4WX2B 1MIOB 1ZM7A 4JVLA 5KAMA 1LEHA 1RT9A 3KJXA 5FDFA 5JAPA 1YDFA 2P30A 3ZQUA 1WXGA 1SVLA 3PXEA 1EQUA 1PL8A 4KQHA 3R76A 2QL5A 2VAXA 2GLXA 1D9ZA 3EGEA 3QBJA 1SKMA 4R2WA 2FMHA 4DUZB 4A36A 4IJMA 2N75A 1KAGA 3PEVA 4BO6A 2YMQA 1JZSA 2VCYA 2AX4A 4FYMA 4YRRA 1NVGA 2ZJBA 4KR0A 4BMPB 1RI2A 1S4QA 4QARA 1DQYA 1GL7A 4WY2A 3HR4A 3GUZA 4M1QA 2A59A 1RXVA 4D3ZA 3SU8A 3MTIA 2QM7A 4FK8A 4I4TF 2MJLA 4RVNA 4TV8F 3SE0A 3V4OA 4LZLA 5AQ1A 1T34A 4ZYUA 1Q83A 3O90A 4IQ4A 2GNOA 2H5IA 1G21A 3GQBA 1PTJC 5HRCA 3AM4A 5FL7A 2JKVA 4EQZA 1U8AA 1C0LA 2I99A 3FI9A 2QVLA 1YB1A 2C7VA 3VYSB 3DD5A 4JUAA 5I7UA 4CIWA 1BGXT 1PQ4A 2C2WA 4IDCA 1WOMA 2GEVA 2HAEA 2QSYA 1FOEB 3K70B 1KYXA 2E2WA 4GF5A 1T0JB 5CD1A 2ZZMA 2IYSA 1IE3A 5BV1A 1KYYA 3CS3A 3O2SB 4CKCB 1GKUB 1BA2A 1U0JA 3DZIA 3S2YA 1ZI8A 1C2YA 4N6OA 3I2JA 4RD3A 1PT6A 2XQIA 1QRAA 4H18A 2GJKA 1V47A 1ST3A 2DTXA 5C8DA 1Z5GA 1YUNA 4WERA 1EGMB 1UAGA 4X20A 4M9SA 5CPBA 1LF5A 1RHKA 4YMVA 4FPXA 1AA6A 1BE8A 2Z56A 2QQGA 5FL7D 3WGYA 3R8XA 3REQB 3T5AA 2Z6QA 2OV6A 1NV8A 5A1TA 2Q5JA 3O75A 1A2BA 1E4EB 4MW1A 2V6BA 5EJ7A 5DP1A 2YJ4A 3PD7A 2BMAA 1BVYF 1U9ZA 5B58T 1GP2A 3TSOA 3TZEA 1S2GA 4OM8A 2AKEA 1B8PA 4R1OA 5E9AA 4WESA 4N6NA 4Q7KA 3DP9A 1ZVJA 4QOFA 4TTAA 4ETIA 4PAQA 1KE1A 4P9NA 3U44A 4PSDA 4BKMA 3IEVA 5G53C 3HCNA 1N25A 1Z6XA 4A27A 1K2VN 4P80A 2Z95A 3R7WB 3JQ8A 3FTEA 1UBLS 2QLTA 4TL9A 4JROA 1O58A 1CF4A 2H2DA 3D9QX 4BS9A 5ALYA 4XASA 4Y2XA 3DNPA 1Q6ZA 4NABA 2EOAA 2FFQA 3KKKA 1E7MA 2QM0A 3TJRA 3D0KA 4N0MA 5FL3A 3DEHA 2NSDA 3LK7A 2PL1A 3V6LA 1FFDA 4LHYA 3IELA 4W5JA 5IP5A 3RUHA 2WSYB 2UXDB 1K4MA 1L0BA 5E6UB 2WVGA 2H4FA 2J87A 3WMEA 3ZIAA 1Y4DE 3QXCA 4DLZA 1IEWA 3DKKA 3Q15C 1YWGO 4BFSA 1NVEA 1TVKB 1XD2B 4EG0A 5KQLA 3P19A 3TNLA 1U8TA 1QWSA 3OSUA 3HO1A 3I39X 4QULA 1Q3HA 3EG9B 3W2IA 2XB4A 3MRXA 2WSLA 4PX3A 5LMCA 3KQLA 1EWVA 4H9GA 5BYBA 3DZJA 3GJ7A 2PR2A 3QGMA 5FPPA 4B3IA 5TEVA 5EGNA 1OC4A 3GO4A 2H11A 1SCDA 4WN3A 4QFCA 4MO2A 4RCZA 1VE3A 4PZAA 1O9GA 4G25A 1XZNA 3TW8B 4KQGA 4H6XA 4BAUA 1HV8A 1E2PA 2OZLB 2JFQA 1PJ4A 2PQ6A 2MWMA 4ZGBA 3RRMA 5CAEA 2DSTA 3O0DA 3VC7A 1XJCA 2IYQA 2F1IA 4JEHA 2ZYSA 4II2A 4RFSB 3CUWA 1DX9A 3ZIAD 1CTQA 2V3WA 4CDRA 4OXQA 1NQOA 1XEXB 1ANKA 4KWCA 1YAHA 2C5SA 3NB0A 1GA4A 1AGPA 4DZZA 1DS6A 5TQ2A 2WWVD 2GO1A 4ZOQI 1W49A 2OLJA 2VF7A 3M1YA 5C3UA 5BV2P 5JMWA 1FDIA 1JHAA 3RLIA 4WCVA 1GRQA 1RW4A 1LBHA 1LVUA 1O8BA 4HJRA 3AVOA 2JKYA 1JNYA 4M53A 2AFIB 2NO1A 2F67A 2KX7A 3I9LA 1NFFA 5K4AA 1C1DB 1XTVA 3DVAA 2XMRA 3QVJA 4WCFB 3EBOA 4LGCA 2VSXA 3UNXA 5IYZA 4E5VA 2JEYA 4KIWA 3H5LA 3W04A 4EZBA 2XECA 1IU9A 1OSNA 3BBLA 2LRHA 1SCJA 2XB6A 3BKXA 1QR6A 5JAQA 3VPFA 1PF7E 2ODWA 2BT4A 2IFTA 2QPLA 3EFBA 5IX8A 3PGKA 4QTZA 1TMOA 1N6HA 3D8NA 1ZJYA 2HF9A 1TVMA 3SFZA 2RFLA 1Z47A 2I6QA 2M6RA 1L5MA 2XUHA 3LHIA 4NBRA 3HJFA 1RQPA 1WSBA 3EW7A 1LPNA 5EESA 4ZOLA 4G26A 3KXLA 1NURA 4RD4A 2Y1FA 4FWTA 4BQFA 3QQ5A 1K9VF 4GGOA 1N5DA 3ZEIA 1K0FA 1QWOA 4Q1BA 3EXIA 1B6SA 1EWRA 2QD2A 4TTPA 4OGKA 4BNJA 4EG3A 2PRZA 1NTOA 1P5JA 2YV4A 4KCGA 4OI1A 3PI7A 1YL7A 3SM9A 1EINA 2OZPA 1VXOA 3MFYA 1WD7A 4QVGA 1UOOA 4NXMB 1FXWA 5FP0A 3T0FA 4D9BA 5GIPE 5ESDA 5JANA 5IF3A 1LPBB 3IGFA 5EIOA 3J80A 3ZQ6A 4IXTA 1U2PA 2VSYA 2AEJA 2EU8A 5ALFA 1SZJG 1CF2O 1VI6A 4CM4B 4QPZA 3AVPA 4IJKA 4XEUA 5JSUA 1KGSA 2WILA 1E6WA 3ZWVA 4TLEA 4F3CA 9ATCA 2QBYB 1P1HA 5AVWA 1QCYA 2G7MC 4E09A 3UGKA 4NC9A 3QMMA 4OMFG 2FZEA 2XRMA 1RLJA 1RCUA 1T1EA 4NOLA