1UK9A

Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with isovalerate
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
271
structure length
271
Chain Sequence
NLEIGKSILAAGVLTNYHDVGEGQPVILIHGSGPGVSAYANWRLTIPALSKFYRVIAPDMVGFGFTDRPENYNYSKDSWVDHIIGIMDALEIEKAHIVGNAFGGGLAIATALRYSERVDRMVLMGAAGTRFDVTEGLNAVWGYTPSIENMRNLLDIFAYDRSLVTDELARLRYEASIQPGFQESFSSMFPEPRQRWIDALASSDEDIKTLPNETLIIHGREDQVVPLSSSLRLGELIDRAQLHVFGRCGHWTQIEQTDRFNRLVVEFFNEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-hydroxy-6-oxo-7-methylocta-2,4-dienoate hydrolase
publication title A Series of Crystal Structures of a meta-Cleavage Product Hydrolase from Pseudomonas fluorescens IP01 (CumD) Complexed with Various Cleavage Products
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Hydrolase
total genus 99
structure length 271
sequence length 271
ec nomenclature ec 3.7.1.9: 2-hydroxymuconate-6-semialdehyde hydrolase.
pdb deposition date 2003-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1uk9A00
3DCNA 1ZI9A 2VQ6A 1DQYA 2GBGA 1CLEA 2XUOA 2OLEA 2Y6VA 1RWQA 1IUNA 4OB8A 5LKAA 1N5MA 3BJMA 4KYVA 2JGJA 1YB6A 1CUIA 1CUBA 1CUCA 5DYTA 3I6ZA 1UOPA 4BDTA 2VJDA 2BUAA 2ZYHA 4TVKA 3SK0A 5AI9A 2OAGA 4H7FA 1ZJ5A 2B61A 3FNBA 2D5LA 4KR0A 4UBNA 5LZ2A 4W9RA 4V2IA 4WY5A 1OCEA 1Z68A 4Y2JA 5AM3A 3AJAA 2Z3WA 3FLBA 1HDEA 4QEKA 1MAAA 3D59A 1FFDA 2WUDA 1CUZA 2QT9A 1CUEA 2PU7A 5ALGA 3EQ8A 1Y7HA 1U2EA 1B6GA 2ONCA 3WL8A 1AKNA 5JYCA 4C6HA 4B9AA 3WKDA 4UHEA 5K5EA 3DL7A 3STXA 3R41A 3STYA 1J2EA 1B41A 1LBTA 4XX1A 1Q0RA 1ZD5A 3FYUA 4QA9A 3E1GA 3WA6A 1XQVA 5JAUA 3UUFA 1XZFA 2PVSA 5FPQA 4BB0A 1E5TA 3DKKA 1P0QA 4EY5A 4RE5A 5A2GA 1Y37A 3K2IA 2XUGA 4M0FA 5EIAA 1EDDA 5ALHA 4UBKA 5LP1A 1JJIA 3GFFA 1IUPA 1CIJA 5A71A 3R3WA 1MU0A 4PO3X 2AJLI 2R8BA 1UXOA 4W1PA 3VJLA 4HVTA 1YA8A 5CT5A 3STTA 4GECA 5YASA 3ICVA 3I2KA 3WKCA 5EI5A 2PSJA 1G5FA 5LKRA 2PKYX 5ALFA 3NWOA 3N2ZB 1BEEA 3O4JA 3IUQA 2WIGA 5FKJA 1C7JA 3GA7A 1SCKA 4E14A 1FFEA 2X8BA 4FBLA 5FP0A 1OILA 3GELA 4S0XA 1HBJA 2B4KA 5LZ8A 3ANSA 1MNAA 2FJPA 1CV2A 5JALA 1VOTA 1LBSA 4E15A 2WTMA 3IIIA 1TAHA 4AQDA 1ETHA 1A8QA 1EB9A 5E4YA 5K3CA 4W63A 1GKKA 3C5WP 1X70A 2QUAA 1QIDA 2OGTA 5D3ZA 2XMSA 3NGMA 1J06A 3AILA 1UKBA 1QIHA 2XUPA 5CRIA 4OB6A 1EB8A 3C6XA 2FJ0A 1XKTA 4WCVA 4JUIA 4U2DA 2JF0A 1MO2A 2XUKA 4NS4A 2WUGA 3WJ1A 3GZJA 2XUJA 1BN6A 4H0CA 4BAZA 2HA4A 1JJFA 4ZXFA 5C7YA 1YASA 1DQZA 1JFRA 5HQ3A 4B7ZA 1USWA 3BE8A 3ESAA 2Z3ZA 3QMWA 2J3DA 5ESRA 4RNCA 3HABA 1TK3A 4H7DA 1ZI8A 4I3FA 1JKMA 1QFSA 3D4LA 5CMLA 1W4LA 1ODSA 5DYWA 3PF9A 3HLKA 4LXHA 4L9AA 4ZWNA 2QJWA 2DR0A 3F9CA 1AZWA 4X91A 3TRDA 2CMFA 4AO7A 5CURA 4DSZA 1VZ2A 3G02A 3ED1A 1R3DA 1MJ5A 5LZ7A 2V98A 5AKJA 4C01A 1ZD4A 2HA5A 3ZPXA 4ZV9A 4KE8A 2PU5A 4WFIA 5AHXA 2XUQA 2HFJA 2C5FA 2PSDA 1FFBA 3PICA 2ROQA 5K3DA 5IVKA 4UHBA 3DOIA 2EDAA 5AIAA 3HC7A 1ZD3A 3R3UA 3DNMA 4OCZA 3OPMA 4ZRDA 1XZMA 4M0MA 4AN0A 4OU4A 1TCBA 5HK9A 5FDFA 3FAKA 2PM8A 3RK4A 4BC1A 3GUUA 2GYVA 1KEZA 4K5QA 4BVJA 2X5XA 4FHZA 1VE7A 3NUZA 3D7RA 4CCYB 3BJRA 3F8SA 2XQGA 1IZ8A 3B3QA 3QPDA 1LNSA 1ZIYA 4X00A 1H2YA 3W05A 3AIKA 4GEGA 3WI7A 5E4JA 4BCDA 2XQFA 3HJUA 1XROA 2I03A 4GW3A 2Z8XA 4EY8A 4X6YA 3DS8A 1GPKA 3QVMA 4Y2QA 3WWDA 1EDBA 1ZGCA 4HRYA 1IZ7A 1CUUA 2PPLA 4LYEA 3L1IA 4TGLA 4FDMA 3I2FA 5KWJA 1EVQA 5LZ4A 4I19A 2YASA 1N8SA 2XMDA 1WOMA 2VSQA 3S2ZA 4KE7A 3ESDA 5ALUA 2OAEA 3PF8A 4LKOA 2HL6A 2RONA 4BBZA 4Q34A 3QMMA 3KDAA 4UFOA 5AI0A 4EUSA 3VJMA 5A6VA 5D6OA 4KRYA 5ALRA 3H1AA 1CUGA 1RYYA 3KXPA 2CB9A 2OQVA 3R3ZA 5JAHA 5HF6A 4INZA 4DNOA 5ALXA 2Y1KA 2JEYA 2C4HA 3T4UA 4CCWA 1TIBA 4QDUA 4Y2RA 4DSAA 1P0MA 5A7GA 4KACA 4BRSA 3HYSA 4FMPA 4IQ4A 4H35A 2WILA 5ALYA 4J0KA 4QDXA 2BJHA 4UBIA 4QDTA 5I9IA 3VKFA 4QWWA 2HRRA 3OURA 4DMFA 1SOMA 4KRXA 3PE6A 1JJBA 3G9XA 3D2CA 4GHWA 2O7VA 3R3XA 1EHYA 4EY6A 5ALQA 5F4ZA 4LHEA 1CQZA 5DWDA 3WYDA 3I2GA 5HCUA 1MNQA 4HXEB 4G9GA 4CI9A 1QO7A 4FNGA 4J0JA 5LLSA 2HHAA 2VJCA 4MEBA 4U2CA 5ALVA 2QZPA 2H1IA 3GBSA 2PUHA 4P92A 4H7EA 3C6BA 4J0DA 1LLFA 3M83A 3VXKA 1BCRA 2GYWA 3ESBA 2H9YA 5EGNA 2BCEA 4PQEA 5E4TA 3IB3A 1DX4A 2WJ4A 1SFRA 1CUVA 1JU4A 4CFSA 5JD4A 4F21A 3R3VA 3WKAA 1G66A 1U65A 5FXMA 4X71A 5ALZA 4I4CA 2XUFA 4JNCA 3B12A 2QRUA 5CTAA 3LIIA 4GLBA 2Q0XA 1UT6A 1CUWA 3IA2A 4UBMA 2VJBA 4PV7A 1ODCA 3C8HA 3IVMA 2HFKA 1LZKA 5AO9A 4OSEA 4X95A 5AK5A 3BF7A 3OTQA 4L3WA 2WTNA 1SC9A 1WPXA 4OPMA 4E11A 1GGVA 4J0GA 4HRXA 3Q8WA 4BCBA 4XIIA 1QFMA 5D3KA 4X3CA 4X94A 5FPPA 2XUDA 4AB1A 2OCLA 4MQLA 3I6YA 4OUKX 1XRQA 5SYNA 2HIHA 3CN7A 1P0IA 5AM2A 3O4IA 2RAUA 1VXOA 3BL8A 3V48A 1TKRA 5IVDA 5JARA 3JW8A 1K6EA 3WJ2A 1AQLA 4AXBA 1LPOA 2XMGA 4QE3A 2ZJ7A 4J0HA 1ACLA 2QUBA 3WZLA 1TRHA 2IITA 1DX6A 5AI6A 4H18A 5AKGA 4BDSA 5EHXA 1AUOA 1VXRA 2GBIA 1BN7A 2GZSA 4C87A 2CEKA 1BRTA 1MTZA 2XQJA 4CIAA 5K3BA 2O2IA 1NU6A 3ZLUA 1VA5A 3VJKA 3VDXA 1DT3A 4HXGA 2I3ZA 2DQYA 1VKHA 1GKLA 2DSNA 5EHNA 2HA0A 1QTRA 3H2GA 4EHBA 1R88A 4CG3A 5DNVA 4BE4A 3T52A 2JGMA 2B20A 1QTIA 3OC0A 5JD6A 2JBWA 4MWTA 5ALOA 3WMRA 3PUIA 2V97A 5JZBA 4B6GA 4C4YA 5IVIA 4Y2TA 2VT7A 1YB7A 4Q05A 1X2BA 5HQ3B 5SYMA 2XDWA 1CQWA 2RHWA 2QS9A 4WDQA 2OQIA 1XZHA 2ACEA 3A2NA 5HFAA 3O4HA 5CT9A 1GZ7A 3TJMA 5DNUA 2IIVA 4X93A 4DMCA 2XE4A 1XZDA 3DOHA 3STUA 4LXGA 3B5EA 2EDCA 3EIOA 2WKWA 4H7HA 2HRQA 4IHAA 3C70A 5T4FA 4OYYA 2HA3A 4ZREA 3U0VA 2DHEA 3DQZA 1WM1A 1G4HA 5FOQA 4BTVA 2Z5GA 1XZJA 4C89A 3QBJA 1GPNA 1AMNA 3BDVA 1QIFA 4ITVA 2PSFA 3IURA 4DIUA 4QNNA 1XZCA 1CUYA 1IVYA 2H7YA 4B85A 3WK7A 2O2GA 4LIPD 1THTA 1JMYA 2ORYA 4UBJA 3C6ZA 1LPSA 1EA5A 1M33A 2Y2UA 5T4EA 1ZJ4A 4MYSA 3FLEA 2ZSIA 5JASA 5HZGA 4H7KA 4B82A 4Y2PA 4KJXA 3D5EA 4Y2YA 5C8XA 2GYUA 1DU4A 1ZICA 2Y2VA 3AINA 2WIFA 5EIEA 4G9EA 5AOCA 2ACKA 2PUJA 1MX5A 3P2MA 4H7IA 3WLAA 2XUHA 3EBLA 2VAVA 4OU5A 3A2LA 1XQXA 5AICA 4DMHA 2WUFA 2EEPA 4J0IA 3W9BA 5KREA 1E8NA 4WFKA 3WKBA 3RM3A 4F5ZA 2WU4A 2GBCA 4G8BA 4W1SA 2ES4A 2DHCA 3FBWA 5C81A 3AZQA 1LPNA 2Z8ZA 3STVA 5K3FB 1H2ZA 3R0VA 4B9EA 2QXUA 5AKLA 2AJ8A 3H1BA 1P0PA 1OXMA 1T2NA 3AIOA 1X2EA 2RHTA 4JYMA 4ARAA 4FTWA 5AM0A 1Q83A 4FOLA 4AMYA 1XRMA 5AM5A 3I6MA 4EZIA 4U2FA 1R4ZA 4AX4A 4TPKA 1HQDA 1UKCA 3QZUA 4WY8A 2B9VA 3DKRA 1ZIXA 1K5PA 3BF8A 5AKZA 1QIKA 1CUFA 1QE3A 2ZSHA 5AKKA 3V1KA 3PFCA 5IVHA 4UPDA 3FSGA 1MPXA 4B84A 5AK6A 1EVEA 2HU7A 4A23A 1LPPA 3FYTA 5AP9A 5ALDA 1XRRA 4EBBA 1CRLA 1D07A 4E46A 5CH8A 2GBFA 3EF3A 4QZVA 5ALIA 2PX6A 3WIBA 3GROA 1QO9A 5JANA 5JATA 4B0OA 3ZWQA 4BE9A 3STWA 4F60A 1WPRA 4HXFB 1FFAA 4J03A 3DJYA 3F98A 5ALWA 3LCRA 4F0JA 2OG1A 1Q84A 5EFZA 5ALNA 3H2JA 4EY7A 5HF5A 2H7CA 2YYSA 3LS2A 5JZ9A 4RGYA 2WJ6A 5JAOA 2GZRA 4Y2SA 2HM7A 1EDEA 3EQ7A 1MAHA 3WL5A 2BGNA 2FUKA 1PJAA 4K6GA 3M3DA 4FFVA 3C43A 3WQHA 4BZZA 1DWPA 3IUNA 5ALSA 1WB5A 3K9BA 4LXIA 4P93A 1A88A 3JYHA 4GWLA 4D9JA 2XI4A 1JU3A 4QWMA 2CZQA 5K3FA 5D7BA 3BIWA 1YSCA 3CXUA 4BRZA 2XUAA 1MX1A 1YS1X 1O6GA 1QIIA 4DTCA 3QH4A 3QYJA 3UUEA 3G9ZA 1L7AA 4C4XA 2C5GA 4Q1VA 4IH9A 2G5PA 4Z49A 4U2EA 3FOBA 1FJ2A 3DYIA 3SWWA 3O9VA 1CPYA 2H7XA 4PSUA 4U2GA 2J4CA 1Y7IA 5CT4A 4EY4A 4ZI5A 1QIGA 1H23A 4NMWA 2WG1A 3HRHA 2VAXA 2BFNA 4HS9A 4HTAA 2PSEA 2PSHA 4NZZA 2WIDA 1NX9A 4U2BA 3C87A 4A16A 2AJDA 3CCCA 3H2IA 4AMZA 4G4IA 4B80A 2HU5A 5ALJA 4N8EA 1QIEA 4KE6A 3WL6A 3JWEA 1EK2A 1XZKA 4M0EA 4DMKA 3MUNA 1HL7A 1XQYA 2WG0A 3DDUA 2Y6UA 4CG2A 3G0DA 2XMZA 4RPCA 4OYLA 3G0GA 3QMVA 3WK5A 5JADA 4DLNA 1IUOA 5A7FA 1GQRA 5ISMA 1SCIA 3H2HA 2W22A 4G4JA 5FLKA 3HACA 1H2XA 1CFJA 4ETWA 1E8MA 4BYMA 4RE6A 3FCYA 1TQHA 5IH7A 2JGIA 2K2QB 2G63A 3IUMA 2C0QA 4L72A 1HLGA 3MUOA 2DCMA 1YAJA 2VF2A 1A8UA 5HK8A 1VJ5A 2J4FA 4GXNA 1F0PA 3M81A 1F8UA 1BEZA 1THGA 5AKEA 2HA2A 1ORWA 3WL7A 4Y9SA 3SX4A 3G9UA 3O4GA 1W75A 1KU6A 2WU3A 3AZOA 1XRLA 1HKHA 1FFCA 3MVEA 2JGLA 2CJPA 2LIPA 1CUSA 5AKHA 3HSSA 3YASA 3QITA 3KWJA 1G42A 2ZYRA 4FKBA 4X97A 2OGSA 3WIOA 4MQMA 5AI8A 1DWOA 5HKBA 2WFLB 3QPCA 1W1IA 3W04A 1J1IA 2V9ZA 4N5IX 1PFQA 3BDIA 5FUMA 4OB7A 3WA7A 5AM1A 1W76A 1F6WA 2I3DA 2XLCA 1EX9A 1E66A 3C5VA 1PV1A 1WCYA 1UK9A 2D0DA 3KWFA 2XT0A 1XZBA 3A70A 1DWQA 1QIJA 2HA6A 4L0CA 2BGRA 5JAPA 3ZLTA 1MT3A 4UHHA 5AK3A 1XZIA 3R40A 4G5XA 2ZJ6A 4BP8A 1AURA 4QDOA 3AIMA 5CW2A 4FLFA 1H22A 2HADA 3FYUC 3U1TA 4UUQA 3G0CA 3PFBA 1O6FA 1DINA 4ROTA 4Y2XA 2BAGA 1N1MA 4OD0A 1RP1A 2R11A 2WHQA 4X6XA 4P08A 4Y2VA 3DL4A 3DLTA 1H2WA 4G4GA 2VATA 4BAGA 5C8ZA 1BROA 3D2BA 1U4NA 2C7BA 1YA4A 1C4XA 2AJBA 1MN6A 5DTIA 2JGEA 3WWOA 1ORVA 1CR6A 3ZI7A 1XLUA 1UFOA 4ARBA 1Q0ZA 2WHRA 1ACJA 1EH5A 4IH1A 4J7AA 5EHQA 4MYDA 4MEAA 3G7NA 1CUJA 1W6RA 2CKMA 5ALLA 1BS9A 4AZ3A 2NW6A 2XB6A 1ZGBA 2X76A 2VT6A 2QMQA 4DNQA 1QOZA 4K6HA 4X92A 1FSSA 1DT5A 3E0XA 3C45A 3IBTA 4KE9A 4EA6A 2WFZA 5AKIA 5BWCA 4DNPA 4MWSA 2OCIA 3I2HA 1CUDA 4Y2UA 4FLMA 3FCXA 3G9TA 2VJAA 4AN1A 3C6YA 1WHSA 4B0PA 1T4MA 1E3QA 5ALEA 3HEAA 4IO0A 2WG2A 4YASA 2G5TA 4QLAA 4C4ZA 1ODTC 1ZD2P 3HI4A 2BKLA 3WWCA 3TEJA 1QGED 4IH4A 4YPVA 2WFLA 1SCQA 4ZV7A 2XMCA 4W1RA 3UMJA 2XUIA 2UZ0A 3C8DA 1QIMA 3F67A 4QLOA 2CBGA 5BWBA 2HA7A 4BTLA 3H17A 2RI6A 5BV7A 4G1FA 2P8SA 1KU0A 4MJ3A 1W52X 2YH2A 1A8SA 5AKYA 1R9NA 4O08A 3WKEA 3ILSA 2WSLA 3LP5A 1UZAA 3I2JA 2XQIA 2JGKA 5AM4A 4UHCA 4FLEA 5A7HA 5HKAA 4N8DA 2J3QA 4XWGA 3MGAA 3HXKA 1EINA 2DHDA 4XVCA 4DNFA 4DGQA 1JI3A 2OCKA 3RARA 1QJ4A 3F96A 5CT8A 2QJRA 4B81A 1UK7A 1XLVA 1N5RA 1LPMA 1TCAA 2C58A 2FX5A 2JEZA 2W6CX 5JZSA 3H19A 2XMBA 2ZYIA 3E3AA 2XQKA 2JGFA 3ZLVA 1LPBB 2OCGA 5JIBA 5LZ5A 1GT6A 4AZ0A 3V1LA 2BUCA 3VVLA 1LPAB 5ALMA 2AXEA 3KSRA 4YK7A 5K3AA 1S8OA 1I6WA 3I2IA 5ALPA 4UHFA 3FVRA 1XQWA 1ZOIA 4K6KA 1AC5A 1QLWA 3H2KA 3M82A 4AO6A 1K63A 4QDZA 4DM7A 1A7UA 1UWCA 1QZ3A 3QM1A 3DD5A 1EI9A 3X3HA 1LGYA 2WHPB 2PL5A 4PSDA 2RIPA 3QPAA 3HZOA 3IDAA 2CUTA 2WLSA 4KAAA 2DQZA 4KAJA 5H3HA 3FLAA 1XZGA 3OM8A 1MX9A 1YR2A 5ALKA 4YX9A 4BP9A 1BU8A 3V9AA 5LYYA 2HU8A 1UOQA 4N5HX 4BZWA 5AI5A 2I78A 3I28A 3FWHA 3WK8A 5FV4A 3OOSA 4BVKA 5T4HA 4PF1A 1E89A 2QR5A 2O7RA 3V1MA 5AOBA 4B83A 3A2MA 5CBKA 2OPHA 1VE6A 3D0KA 2ZVDA 1L7QA 1J07A 3A6ZA 3L1HA 3RKSA 4J0CA 3H0CA 4K2AA 5BOVA 5CXUA 4DYHA 4FNMA 2WFMA 5J3JA 3L1JA 3BWXA 3BXPA 4LYDA 1YAHA 1YCDA 4WDRA 4BAUA 1R9MA 1UKAA 2PBLA 1WB6A 5JD5A 1E8DA 1GQSA 5DTJA 3WK4A 3WWPA 1R1DA 3WK6A 4Q3KA 3ZV7A 4MXDA 3H18A 3WK9A 3ESCA 3Q0TA 1BE0A 1AX9A 3BIXA 3I1YA 2OXEA 5AKXA 4GI1A 5AH0A 1JT2A 1UOOA 3G8YA 5AOAA 1VLQA 4H7JA 3E4DA 4PSCA 3R3YA 3IUJA 2VEOA 4WFJA 1CVLA 3LIPA 1C7IA 5CXXA 3AFIA 3PI6A 2AJCA 4UFNA 3W06A 3WWEA 1VZ3A 1CUAA 3D2AA 4C88A 3TGLA 3VISA 3FVTA 4KAFA 4PNZA 2WHPA 1XLWA 2VA9A 4PW0A 4BVLA 2WIKA 5DNWA 1NU8A 4FBMA 1TCCA 1CEXA 4X85A 3AZPA 4UBOA 3W9UA 5HF9A 4J3JA 3ICWA 1K4YA 2XMQA 4Q3LA 4UHDA 4FFWA 5KWIA 1HPLA 7YASA 3H04A 3K6KA 4W1QA 3SC2A 2OGZA 2VTVA 5EIHA 4XJVA 4P9NA 3DYVA 1CUHA 5AIBA 1XZAA 2WUEA 2ZJFA 3N0TA 1LZLA 4GBGA 2DFPA 3D3NA 5CH5A 1XZEA 5K3EA 6YASA 1ISPA 1VA4A 3G0IA 5AK4A 1XKLA 3W2TA 2RGUA 2QTBA 4UFPA 5KBYA 5CH3A 3I1IA 5LIPA 1WB4A 2O2HA 5T4BA 3V1NA 2V96A 1UK8A 4WJLA 4Q3OA 5EHZA 5AJHA 1EK1A 1U8EA 4GDMA 1DTEA 3AUKA 5ALTA 1WHTA 4AO8A 1EXWA 3WZMA 3WYNA 2WIJA 2BUBA 3O9MA 1ZI6A 4UBLA 4N8SA 4X90A 2WQZA 5DYYA 5HF8A 1L7RA 4CCYA 1YS2X 1GXSA 1GPLA 3IULA 4A5SA 2JIDA 5I8PA 5IKXA 4CG1A 4HZGA 3KOOA 5I7UA 3VVMA 2WJ3A 3O95A 1F0NA 1XRPA 3PDCA 2QOEA 4Y7DA 1XZLA 4X7BA 5E2IA 4HAIA 2QKYA 3ANTA 3LLCA 2XMRA 1BCSA 1R50A 4JYPA 4Q82A 1JMKC 3FYUB 3FSGD 3O0DA 3CCBA 4FWBA 5FRDA 1IMJA 2ECFA 5CT6A 3DEAA 2QM0A 5AI4A 2HDWA 4BCCA 3OG9A 3S8YA 1XRNA 1AGYA 2C0PA 3KD2A 2QXTA 2E3JA 4G8DA 4JEIA 3RLIA 4EB0A 1QONA 4H77A 4ZGBA 5DJ5A 2XLBA 5A62A 3CN9A 2QVBA 3EQ9A 4CIBA 3F97A 4BC0A 4BATA 1UK6A 1CUXA 1K8QA 5DLPA 2YXPX 5HFNA 2ZYSA 4G8CA 1XFDA 4KEAA 3PUHA 2G4LA 2IX9A 5LZ9A 3G0BA 4JH0A 4X6UA 3NOXA 2WM2A 5C8VA 4NVRA
chains in the Genus database with same CATH superfamily
4BLVA 1F2TB 5DMHA 3TD9A 4YCMA 3PD7A 1TI7A 4CDNA 3C3YA 2CE2X 4QPCA 2BH9A 3NT2A 1DQYA 2GBGA 4LRSB 2LTAA 4XCVA 1CLEA 2R5FA 4MRVA 4ZU3A 5LQDA 2OLEA 4JC8A 1RWQA 4YXFA 1HO3A 1NUTA 3ETNA 4GBJA 4JEHA 5DGHA 3OJ0A 2ADMA 4G37A 4DIOA 2R1UA 3N8DA 1IOLA 2PMCA 1NFRA 1TQ6A 3EY9A 2ZANA 3E9DA 4KFUA 3CB4A 1E60A 1FQJA 1X1CA 4V0ME 2N46A 3BJMA 4KYVA 4DTIA 2A57A 2JGJA 4DYDA 1CUIA 2VHYA 1C3EA 4R5HA 3RAJA 4R40A 5DYTA 4BDTA 1GRVA 4L51A 4PBSA 2VJDA 2BUAA 3A1FA 5IFKA 2MIIA 4H4DA 1QB8A 3BERA 1EFPB 4W7SA 3RSFA 4ARZB 3D02A 1HI9A 2J9ZB 3EW7A 4KZPA 3VU0A 2C3OA 1OPRA 2YUTA 5EKUA 4D7AA 1VJCA 4EYOA 1S5PA 5BR4A 5E1OA 1N3BA 4GS5A 1BW9B 2O2XA 4UTVA 1EX1A 1L7OA 1V0JA 4JROA 2ZUEA 5LZ2A 4IUYA 3EEFA 2XD9A 3HL0A 2H59A 4X44A 3D1LA 3UENA 1FTYA 1BHSA 4YQZA 1DBSA 3ZCSA 2Z4SA 1D1SA 3RB8A 3MM4A 2PKEA 3CQ9A 4FMBB 1K7XB 1OCEA 2IYZA 3RHFA 3FFAA 2E0IA 5JW6A 4DR4B 5LD2C 1WV1A 1LKZA 2IJGX 3MAGA 1UDCA 2VDMB 4BMPB 2JA1A 1N0IA 4CLRB 3HCDA 4KPEC 4S2EA 1P5JA 1A9PA 2PY6A 2YL2A 5CB4B 1NVMB 1X1RA 2FZ5A 4TM7A 4OX9Y 3AGQA 3EZFA 1WZ2A 1RC1A 2LKCA 3NNNA 4DCMA 1YKSA 3OIWA 4EPVA 2WTUA 2B94A 5J47A 3B3JA 3DAPA 1MOZA 1M0WA 2LV8A 2O5RA 2GF0A 2XKBA 5AW1A 2XF2A 2ZSKA 4I55B 5JRZA 5KYWA 1CUEA 2C9DA 5C7IO 3PGKA 3C0KA 1IXYA 4RENA 1QQ5A 1AGXA 2B7LA 5H68A 1GLGA 4D9MA 1HM5A 2A1UA 2ONCA 3KSBC 1I1HA 3A28A 3MJRA 1JIKA 3MOGA 1N0VC 2JKVA 4FHCA 4MR9A 4TYQA 5EE3A 3TFOA 1N34B 4C6HA 1B8PA 4B9AA 3NHMA 4N3BA 5DI9A 3DZBA 3WKDA 1EGQA 2IZ7A 1FMTA 3PPXA 4TV9B 4UHEA 4CBVA 1M1NB 3DR3A 3R41A 4UQPA 5B3AA 4D81A 4EJSA 2CFRA 2G09A 3JARA 3HCEA 2VK2A 2YBDA 2IUYA 3KZMA 1DDOA 1U8XX 4QL3A 1M2VB 1W4RA 1J0DA 1R0BA 4ZXPA 5LBUA 4G86A 4XX1A 3TLGB 4KR6A 3HP1A 1WXXA 1K68A 4P35A 1SUCA 2X77A 3G8AA 1RKXA 3L0DA 1HUQA 1SBZA 5INTA 3OOJA 4HK4A 4RZUA 2R4UA 1XQVA 1W88B 4NBVA 5FOXA 1KDVA 3V5NA 1BHQ1 2JJ1A 2VA8A 3UUFA 2FMHA 3VR6D 2YRWA 3E5HA 5HMMA 4JJFA 3W6UA 3M70A 1SQ6A 5FTJA 4NOJA 1P0QA 5LA6B 4EM6A 2GN9A 3JRXA 4ARCA 2CUKA 4YMSA 3Q7QA 3T7TA 5C7LO 3K2IA 2ZXFA 2Q07A 5EKXA 5GJWC 3HBAA 3AVQA 1NRWA 4MP8A 4Y9DA 2OB2A 3JQ7B 2XSZA 4G3XA 4B44A 4DY4A 1EDDA 3FCSB 4MSUA 4UU8A 4QVIA 3UAZA 3R0JA 5ALHA 1EP1B 2QAJA 8ADHA 4I08A 3UOAB 3HNPA 2EJTA 3WMFA 2PE5A 3CX7A 1JJIA 3EPKA 3UGQA 5A71A 3GLHA 1JEJA 5KJ1A 3R3WA 5IYZB 1BXGA 3KUCA 1AK1A 1KZ4A 2AOWA 4ICIA 1BHO1 4RJIA 3E22A 1ZVJA 3DE0X 2X14A 2AWNA 2ODQA 3ZKWA 2VDKB 2DMRA 3EC2A 4P80A 4NP6A 1HT3A 4W1PA 4C7OB 4D3ZA 1G38A 2WAAA 3DB2A 5C4MA 3P9RA 4JBNA 4JBYA 5I7FA 1YHNA 4MHSA 1USKA 2P1DA 1RAIA 4Q9DA 2VPXA 4RMIA 1AV7A 2PZJA 4NRDA 5A9RA 2J87A 1BX1A 1P4AA 2XRMA 2ZSEA 3LDFA 4YWJA 3UMVA 4EKIA 2HAEA 4Z53A 1G5FA 5LKRA 1Y8QA 2YQ5A 1PZMA 4ZO4A 3LUCA 5JD3A 2ONZA 4B33A 3T3IA 3MCTA 4B7AA 4RC9A 1ZVQA 1BEEA 2L2QA 2JIBA 5JR3A 1IG3A 2O6HA 3LYAA 1C7JA 3FOAA 1SCKA 4MA4A 3BD6A 4RABA 1MC1A 4CF4A 1NQTA 1ZZEA 2Q9BA 2X8BA 3FZNA 3W3AH 4DG8A 3W5DA 3T94A 1QBKC 1RQ2A 1UP7A 5L3SA 2JH8A 3KRTA 4AMUA 3BXHA 4NICA 2B4KA 4RYLA 2WE8A 1MNAA 1GUFA 2QDXA 1C3JA 2R7AA 3ANSA 3BIFA 3BD7A 4KQ2A 4RHUA 4XJSA 4X61A 4BUZA 4CCAA 1YUBA 3GZTB 3OP1A 4M9QA 4H7PA 4YJFB 3KO8A 1R5OA 2WVJA 4EQZA 3MJEA 2KHZA 3EVAA 5IEJA 2NZYA 1TM1E 1ZH2A 2P75A 1AS0A 1EHIA 4KIJA 1Y80A 4PPYA 3U48A 1L8OA 3I01A 4PZAA 2QK4A 1FL9A 1M34B 1POWA 3AHEA 3Q3JB 1TAHA 4NQZA 1QQ7A 1XCGB 2HN9A 1ETHA 3HB4X 4YCSA 2A2ZA 5FR1A 4L8VA 4W8HA 4W99A 4DVJA 3H8JA 4BMSA 4QUHA 2F00A 5F7ZA 4C6RA 3KNZA 4WZAB 4XYEA 5ENVA 2B34A 5K3CA 1RHKA 4AULA 5I3ZA 2XEDA 4NBNA 4DBVO 3INYA 1HDZA 4PQRA 3HCAA 1BFUA 3RW9A 2JLYA 2HSEA 3ACBA 3EULA 2ODEA 2VHJA 2VP2A 1IH8A 2P0YA 3ROMA 3A26A 3G13A 3NGMA 3AILA 3Q3HA 2R6R1 4MV8A 4X8OA 4CR7A 5I4IA 1TJYA 2ZBQA 4HLNA 1VP3A 3SHFA 3UT5A 3ODGA 1NW6A 3QLUA 1FFWA 2R8XA 3AG6A 5DT2A 1WUKS 1MAVA 1GPJA 5HRAA 2Z3VA 4UNQA 1H6CA 4CM3A 1XKTA 4WCVA 5G0SA 2IS4A 1SXJC 3QKRB 4WKNA 4M86A 4U2DA 3C8ZA 1MO2A 3UJPA 1M7BA 1OAOA 4OGFA 3WOVA 1UPCA 4LJLA 5F1YA 5BVGB 1OXBB 3K92A 1ZIDA 4LXYA 4H0CA 3RJ9A 1H3EA 4U8GA 3TPCA 4BAZA 3Q11A 4Q1FA 1Y9AA 1TEZA 1JJFA 3UMRA 2J5QA 3WNCA 4KWEA 5AW3A 5C7YA 2H06A 4TQUS 3ZDRA 1DQZA 1EEHA 4RY2A 3PNQA 5HQ3A 4OYHA 5HPYB 4CETA 3C3EA 1NJ8A 3MEQA 3RSZA 3BE8A 3PZBA 3KP1A 2ZI7A 1QKJA 1EFDN 5E1DA 4Z9YA 5FCDA 3GFSA 2J3DA 1E4EB 1Z4IA 4H7DA 5CM9C 1ZOPA 2ZBVA 3UC9A 1XD2B 3COYA 1NULA 3DDOA 4I2VA 4QFCA 1ZI8A 4W8OA 1O03A 1AHHA 2O1XA 3ZCXA 4H60A 1NOIA 2I34A 3SS7X 4E5PA 4XOIA 4J9UE 1R6VA 4PLVA 2QL7A 2ZYVX 4UNPA 1KPGA 2XDAA 3UJ8A 3LUDA 3OE4A 3OO1A 3WBJA 1IBLB 1M34E 4FN5A 1TVKA 2C2BA 3RV3A 2UYHA 2GZ3A 2ZWPA 1TJ4A 3JD1A 3KQQA 3J81k 1Q0UA 4NCKA 4QA9A 3UH0A 2YJ4A 4HUQA 1FDVA 4WZAE 4RD1A 5TS3A 1QGZA 3BAFA 4WV3A 4DLWA 5HZMA 1H2HA 3HLKA 5JFTA 5LP6A 3A1UA 3FRJA 4LSZA 2YNMD 5EZYF 5B6IA 2RHMA 3RC8A 1PR5A 2FUNB 3UQZA 1Z2OX 2QX6A 3OKFA 1AZWA 3LQQA 5I7VA 4M9RA 2OSVA 1QYXA 4JV5B 4KN6A 4L5JA 4XTRA 4D0RA 2CXOA 2TMGA 4ZZ0A 3DONA 4U9HS 5LCXA 4BGEA 4R1UA 5IAJA 2P2CA 3AGPA 1NUQA 4AO7A 1CQJA 3ZHRA 3OCJA 3GNQA 2O52A 2IDKA 3JYQA 2QAGC 3G02A 3LUGA 1DAEA 1DCFA 4OI2A 3S4YA 1R3DA 1G7TA 3WGIA 2OFFA 4NAHA 2ATXA 4LHSA 2OXFA 2P9YA 3DMPA 5CNJA 5AKJA 1G2IA 2GKGA 3ENKA 4H3KB 4KQMA 1E0AA 3S2IA 1ZD4A 2ABWA 5HUJA 3PS9A 4K8RB 3T7AA 4P7GA 1LBHA 3ZPXA 4M87A 3ZV5A 2HBQA 3S6JA 4C0QC 1HQCA 2PU5A 4WFIA 4FQ8A 1CYEA 1RMYA 1RI2A 1BA3A 1DXYA 3CC8A 3I61A 4FFBB 1FFBA 3G6KA 1FMJA 5K3DA 3UJAA 1XTQA 4NSNA 1JG7A 2V7EA 3CEPB 5AIAA 1B76A 1RQXA 1ZD3A 3CTMA 2IPOA 4IIGA 2I8AA 4PX2A 1B2RA 1YHZA 3OPMA 1V3UA 4AYWA 2R48A 2RE8A 2H16A 3M6XA 1IWBB 2BR5A 3UAXA 4ON9A 4JITA 3L6EA 5E3HA 1RYFA 4YCJA 4C43A 4TS1A 3AI2A 1MP0A 2Q1YA 4F91B 3FMPB 5EZQA 3QWAA 1KEZA 1PRYA 4E2YA 3FUXA 1JDJA 3ZY6A 2YJGA 3T1YB 1EE1A 3MZ0A 4JKOA 1FSGA 3FSJX 5CFLA 1FFXA 1Q7GA 1RXEA 2WB2A 4FHZA 1M2NA 4KVAA 4S12A 5M7EA 3E9CA 4TTAA 5IKOA 1RZRA 1WPGA 2J5KA 4EW3A 3D7RA 4FR0A 1P7CA 4CCYB 1N6KA 1D6NA 5HM8A 4OXNA 1RQPA 2XQGA 4Y1EA 4DT1A 1WZIA 1GV0A 3SY8A 3BFJA 3BE5A 4X1YB 1XVUA 3OCVA 5C1PA 3W05A 3MGGA 4GEGA 4HEJA 5HIMA 2LGJA 2OC9A 1EMDA 1W96A 4IKEA 5E7QA 3GEIA 3ITKA 1LWNA 1UBHS 3ZNOA 3AF5A 1H2RS 1W93A 4O5OA 1TM5E 4OSPA 4HBZA 4Y2QA 2V0CA 1QYVA 3S3TA 2IHJA 4DF3A 4EUFA 1EVIA 2IYXA 4YP5A 5E38A 3G9QA 2VF4X 5L4NA 2PPLA 4MS1A 3JQ9C 3EN0A 3SHOA 3L1IA 1ZYUA 2Q41A 2I4MA 5EA2A 4UM9D 3LA8A 3U3DA 1TJ5A 3IAXA 1ZN8A 2BEUA 2CEAA 3QU5A 1UIMA 5KWJA 4YRDA 1EVQA 1PUIA 2QZJA 1H85A 4C4AA 4JR2A 1U0JA 2AUNA 3OZWA 5FQOA 3K4PA 3MWDA 3QBTA 4I19A 5BT9A 4D9BA 1Z63A 1EUDB 4U7GA 2ZUSA 1PT7A 2Q4EA 2SCUB 4IHJA 1WOMA 2VSQA 4CMHA 3FA2A 3ZWYA 3AY0A 2QQ0A 1PT6A 3SCZA 4CMEA 2Q6IA 1WQ4A 5TDHA 2I9KA 3OZUA 1J0CA 1U5BA 3PF8A 5JAMA 1I33A 2HL6A 3ZVRA 1JR3A 4GX1A 1QO0A 1F4PA 1AK2A 3KDAA 5U9CA 2BMAA 2JL1A 3G2PA 3GZ4A 4EUSA 3VJMA 3RODA 1YQGA 4QECA 5D6OA 1OLXA 4KRYA 3H1AA 5C31A 4NF2A 1P39A 5B55A 1CUGA 1YB4A 2AS0A 2ZSUA 1P2DA 3KXPA 4FGZA 4HNRA 2F9LA 1ZUHA 4UEOA 5C37A 1OU4A 2QW1A 4DJFC 3L06A 4EUNA 2CJFA 1JEAA 3BFPA 1YMQA 3NTVA 3A31A 2Q46A 3WL3A 1Q1NA 2GM4A 1DBQA 5AVKA 4PIPA 4INZA 2FR8A 5U4XA 4TXLA 2Y1KA 4HN4B 3MWGA 4HVCA 5HZKA 1L9KA 2V7UA 1FU8A 4INPA 2BFBB 1ZUIA 3WHPA 1XJ0A 4JJIA 2NYVA 2YMQA 1QVAA 3BK2A 3FCOA 4NKRA 1WLYA 1GQOA 3VYTB 4D02A 2GAAA 4FOPA 3PTZA 1TIBA 3N70A 1C0LA 1V96A 3KPYA 4GI5A 1P0MA 2PRKA 1V9LA 4PLTA 3QG1A 2EIXA 4RJJA 3TVDA 4KACA 2VHUA 3C7DB 3HYSA 1UBEA 1YC2A 1ATZA 4BRSA 2BTQB 3HYLA 3N75A 4AJLA 4FMPA 3ZQJA 4Z4GA 1P81A 4R6WA 4E7PA 2BMJA 3MBOA 4A3SA 2BJHA 5I9IA 1B6SA 2O8EB 2YYAA 4OP3A 3SIWA 2KWIA 3HHPA 1RT9A 2MR6A 1U8AA 3SVLA 1PSZA 3OURA 4O2AB 1FMFA 3EXG2 2WQ6A 2AGVA 2C4NA 4P8RA 3EOAI 1ZW1A 4DJJA 3PE6A 3RRFA 2IYLD 3O73A 4ER3A 4OHYA 2JFFA 2X4LA 1OVMA 3GV0A 3DKPA 3AONB 4CEJA 4MCJA 1QHNA 1M2WA 3C39A 4DLPA 4JBWA 3C3MA 2HEGA 3PD0A 1R4MB 1E5DA 2BMFA 3PNKA 4HD8A 4AJNA 3KQVA 5F4ZA 4LHEA 2XRFA 1XA3A 2RGDA 4RMJA 1CQZA 3MAJA 4UQLA 2W2KB 3ZH2A 2NUAA 4DCJA 5FNVA 4BN4A 1G64A 4MWCA 4CKBB 4BNKA 1GYRA 4FW8A 1BTOA 4B6QA 3GUCA 3KTAB 1EQUA 1IJEA 1O5TA 4KWTA 4N3NA 3RF6A 421PA 1E7YA 3HO8A 5NLLA 3BE6A 4LGYA 1GN8A 2GHQA 4TS3A 1L5OA 4MJ7A 4KX3A 3AKYA 3OSZA 4J0JA 4R7ZA 4KQ9A 5THQA 1GNPA 1NNLA 3DDHA 5AQ1A 1CDEA 1MB3A 4K9RA 5I9TA 4D1YA 4RCVA 5ALVA 1OA0A 4NAUA 1ID8A 2CDNA 4AW9A 3KEGA 4ZDWA 4GRAA 2H5IA 3HDHA 1CCWA 4WZZA 3ZBTA 2N75A 2QN8A 4MWBA 3FPCA 3UA3A 2Q6TA 2UZIR 3C6BA 5J43A 1KAMA 3R5JA 3L93A 1MJHA 2AE1A 2AOTA 1LLFA 3L7IA 3NWEA 4MHOA 2GF9A 3M83A 5D5QA 1XDGA 1Q3TA 3F4KA 1OC2A 4RA9B 4JI5B 1ABBA 1JPJA 1KKLA 3E03A 3EHEA 4H0FA 2BFFA 2ZVPX 2H9YA 4OBEA 4I1SA 4ALMA 3EYWA 4J0QA 3A04A 4IFBA 4ONEA 2Q8PA 3O2NA 5E4TA 3I34X 2IEIA 4BLPA 1DX4A 3N8HA 4BN0A 4MO9A 5IAAA 4NZYA 1L3CA 1CUVA 1JU4A 2NM0A 2FZCA 1YJAA 4JC0A 4RVCA 1AQYA 4XKJA 4YJGB 4D3DA 4F21A 5K0SA 3ZU3A 1G66A 3E7XA 1P72A 1B1AA 2C1EA 1U65A 5E6RB 3IO3A 5FWYB 4IEEA 5FXMA 5HRCA 2IYNA 4DUZB 1V5WA 1CDDA 2D54A 2JK1A 5D84A 2W83A 3HMKA 4IXWA 3H5WA 1IPEA 4YEDA 2V6FA 2VUHB 5KAPA 3SBOA 4A73A 4YNBA 4EJ0A 2XUFA 4JNCA 5DBEX 1DRJA 4KLNA 5JSFA 3LIIA 2HMWA 3NOVA 2WW8A 5I3CA 3ZVNA 1TMKA 1OBCA 2G5GX 2Q0XA 3H1FA 4LJYA 1FZQA 4HGOA 4QO7A 1SY7A 3JSAA 1CUWA 5J4YA 2O19A 1Q14A 5GGXA 1N7HA 2CLLB 3PFHA 2OYCA 4CL0A 2E4VA 2BE7A 1N9KA 2JCXA 5FIUA 5AVTA 3C8HA 2H11A 2WF9A 4KODA 5JMOA 2NNWB 4G0ZA 3LH5A 2FW9A 2YVUA 4C2AA 4US0R 3PGJA 4HOYA 3FYCA 5AO9A 3BREA 1IL0A 4ZO9A 3IPLA 4OSEA 4NYMQ 2XWJI 1AT1A 2CXUA 2F3TA 3OTQA 4IOJA 4L2IA 5IKPA 2DTDA 4HAYA 4QUEA 5FYQA 1USUA 3DFUA 1FYWA 3K73O 3O1LA 3EF0A 4LZOA 4HWRA 4KMSA 4EHNA 4CKWA 1XPUA 2YWBA 3NHYA 2OZEA 4P4SA 4A03A 1A71A 1NNI1 4NBUA 4NPHA 2J3LA 4U7WA 3GMTA 3KC2A 2CLFB 4OMFG 1Y81A 3BXOA 2I6GA 5FBHA 3AB7A 1N4DA 4EG4A 4NDAA 2V3WA 5GONA 3SIRA 1M2OA 4JLJA 5DLEA 2WOOA 1GGNA 5CVDA 1QFMA 3O03A 1BOOA 1UUFA 5AHOA 3V7NA 1ENYA 4EPWA 3NDIA 1VPLA 1Z6GA 3TGPA 4IUDS 1IC6A 3PA6A 1ZCFA 2C8KA 2XUDA 4AWAA 3T7DA 4DJTA 4LE2A 1IJBA 5JNWA 3SC6A 1GITA 4Z6KA 2LWIA 3KX2A 4CI0B 2FMTA 1R37A 1QAQA 3ZCPA 4YHHB 3OZCA 2X0NA 1EWKA 2B5VA 5LP6F 2XNHA 4NU6A 1FW8A 1D1QA 1TVMA 2HIHA 3CN7A 1P0IA 3N39C 3Q3CA 1G8PA 4HJXA 5LYJF 3RUAA 4WCFA 5IN4A 1E4OA 2VH2A 5TT1A 1OA1A 4WZBE 2ZSAA 2H7VA 3DWIA 3L7AA 3AIIA 4MR8A 4U7DA 2KS6A 1A7KA 1VXOA 2NTVA 3EXEB 1V25A 4J43A 1K4MA 2JIZD 2WD7A 1XB2A 1NI5A 3D64A 5DCLA 4P3KA 3V48A 2FN3A 4A26A 5GOZA 4XPIB 5BN4B 2FPUA 2XJ4A 3GI1A 2G07A 5CFQA 3HJFA 2Q3CA 2JLWA 3F8WA 5KX5A 2WVAA 2R68A 4ENWA 1WZNA 3BKXA 1L4YA 2ZJ2A 4PLZA 1SUDA 4YGYA 2IUUA 2G06A 4DRZA 3OFJA 1JH8A 1WDLA 1LPOA 3DL0A 1N5DA 3DE1X 3O8DA 4W4TA 3IVCA 4JMLA 5FA5A 2VNSA 4RQBA 5DH9A 4GYKA 1SUIA 4BECA 3PCTA 3ZEAA 5L3QA 5JBIA 2COKA 1ACLA 3WIOA 2XNKA 2OV2A 3E8SA 1JF8A 5LXTB 2B82A 4LOKA 1E3LA 2YWFA 1J8DA 2IITA 3IEKA 3AW9A 3NOOA 4YFVA 4Z0NA 1V8OA 1Z38A 2BFAA 1EU1A 2OXCA 3HADA 3NHBA 5AI6A 1RJFA 1JQDA 3ABQB 1FNMA 1NVVQ 4YBRA 5EPUA 2IA5A 1UC4B 3H65A 1GFWA 2R6AA 4C87A 3IOEA 4MV9A 4QULA 2CZGA 4DSNA 2CEKA 3VH1A 2FSHA 5DBGA 1R00A 4RANA 2A5JA 2IE0A 4NDZA 2AMFA 3CEAA 3TOZA 4CIAA 5SZKB 4DQDA 2O2IA 1NU6A 3FUVA 3HCCA 4MGHA 2ZE6A 1T1JA 3EBOA 1CZUA 4HGRA 1KE2A 3VDXA 4D4HA 1UXIA 1A5TA 1L7BA 2BRUC 3DD1A 4AZTA 2ZRGA 4L8YA 4AF8A 2JFHA 2ZB7A 5KJEA 1HTWA 5B58T 3SZUA 5KYKA 2ZRMA 1FP2A 3K32A 1SVIA 2EZ8A 2HA0A 4URXR 1LW6E 1E1RA 4ETMA 2OEPA 3A10A 3GIWA 3FPEA 5FOWA 4BO2A 2PYZA 1V45E 4GGMX 1GQ2A 2PGAA 5JYDA 3UAWA 3CVXA 4PWZA 4N76A 4PPFA 4NL4H 1VE3A 2HC9A 4FR2A 2V7PA 3WOHA 3R7DA 3UBMA 4DZZA 4K88A 3HKCB 5HKKD 2JGMA 2Q5FA 4LFAB 4ZODA 3THWB 2B20A 5EMKA 1QTIA 2F9MA 5AVUA 3OC0A 4QFBA 4CV1A 1ARZA 2FSFA 3CLTD 5JD6A 2P8JA 1XTTA 4MWTA 2CFTA 1DDIA 4NV1A 4NARA 3SDSA 4X1KB 2XZTA 1PIWA 5FBZA 1ZCZA 2Q9UA 3TLJA 2A5DA 3ECAA 3JASA 1NONA 3PUXA 3T61A 1L6IA 2FG7C 3H83A 3P19A 3PUYA 4MA5A 4B6GA 1ECPA 1UMCA 3C4JA 5IVIA 1YB7A 1CJUC 3QLVA 4YXWA 3SR4A 2GZ2A 4Q05A 4YT8A 5BSMA 1X2BA 4S05A 1ZGJA 3KJHA 3KCQA 4C0KA 3I4LA 4KV9A 5KNBA 3PQ4A 1R6TA 3ADCA 1AUVA 1CQWA 1RBQA 1YVUA 4OAOA 3OY7A 1RS0A 4WDQA 1MF7A 4ZXFA 5G0VA 2NP7A 1B15A 3RYHB 1VLMA 1A50B 1RXUA 5JEDA 3TJMA 3ET4A 4X41A 5K4AA 1MFPA 5DNUA 1RADA 4G63A 2Z57A 4WMLA 4CMJA 1F1JA 5CK5A 1HFKA 2AEEA 1DHTA 1H0RA 1XZDA 4IVPA 3STUA 1NQVA 5JJKA 4I7EA 3B20A 3B5EA 1ZK0A 4KN5A 3RJMA 2H4HA 2EDCA 4IHJF 5C8YB 3EIOA 3VO9A 1V43A 4YMLA 5KWSA 1EHCA 3GW8A 4RXUA 3ST7A 1G4UR 1C9KA 5T4FA 4B7UA 3G85A 1OX4B 1PR1A 4OLHA 2XYGA 4OYYA 2WZQA 2A9OA 5FL3A 3RS3A 2AFIB 2ZATA 3GJZA 3NB0A 2ZUUA 2C7QA 3IESA 2DHEA 4DBLC 1DKNA 3DQZA 2GLXA 4R1PA 4EO7A 4GG1A 2XF8A 2P0AA 2ZQ5A 4RPGA 4DDUA 2Y9PB 2Q7XA 2BFMA 2JDIA 3GLFA 3CEMA 4C89A 2V8OA 3OZVA 4IZHA 1MIOA 5DU2A 4DR1B 4P2GA 3IEIA 3DG9A 2IU3A 4RCZA 2V4MA 4B79A 2PLWA 4OL9A 3CNOA 2QG9A 4HWSA 4IS3A 5KJCA 4ITVA 3IURA 1KH1A 4PBRA 1IRXA 1WUTA 4OKNA 1BO6A 2FQWA 1MA3A 1CE8A 3WK7A 2O2GA 2I65A 2RKBA 4GR5A 1XVLA 4PZZA 4FD2A 2ZDQA 2VVTA 5ADVA 3QEMB 4X54A 1DKUA 1TYZA 4FJ0A 4J3NA 4ZI2A 5K03A 1PSWA 4BU0A 3HN7A 1XF1A 4C21A 4CGYA 4PR3A 5E9JA 4X8HA 1XP8A 1YUMA 1M33A 4I6EA 4M0LA 2BLLA 5EKSA 2Y2UA 5IJ9A 3C7AA 2KX7A 3CYFA 3HYNA 5DN6A 4Q16A 4E6PA 3CLRD 4B17A 4XFJA 2ZSIA 4NV0A 2HV9A 2W11A 4MVJG 4M8SA 1J39A 3V8MA 5EZ5A 4DPMA 4JB3A 3DLBA 1XCMA 3GWGA 1JW9B 3N6VA 4RFVA 4TLAA 4H6WA 4F2PA 3BD9A 1X80A 4AD8A 5HTOA 2XT6A 4ZIRB 2AC2A 4E5MA 4YT5A 3AUAA 4HG2A 4A2CA 1X77A 2J9RA 4DLLA 2IHVA 3R9WA 1ZICA 4TT3A 3Q5DA 3RSHA 4RVDA 5K8TA 3HQ4O 2IPMA 3IDZA 3E9RA 3P2YA 5FNVF 4ZCSA 3VU8A 5ADUS 4CQMD 4KXQA 4YLGA 3AINA 5JPIA 4B8ZA 4RVHA 4O02B 5KJFA 1G3MA 4NXMB 3DV0B 1Y5RA 1REQA 2R66A 5TGDA 4G9EA 2WHXA 1Z0IA 3AF0A 2O48X 5AOCA 2PUJA 5IM5A 4NPCA 3U4QA 3B70A 3GB9A 3KOMA 4JVLA 2I55A 2V4UA 1CU1A 2WSSD 2GTHA 2REQB 3LSTA 3V7YA 2VHVA 1TF7A 1XQXA 2RGAA 3V4FA 2ATIA 2CYBA 2DTEA 4DMHA 3W4IA 1QORA 4V38A 1ISMA 2OFOA 2WTXA 4EIWA 3MBKA 1Y6RA 2IGBA 4UE2A 5ETJA 1Y8AA 2Q7DA 3BILA 1UKVY 5JE8A 1MOSA 3Q6NA 2TECE 4YMIA 3WKBA 3BK7A 2WKQA 4D98A 2GBCA 3LBAA 3F3MA 2PT6A 1VCOA 1Z6YA 3EIXA 1JH9A 4W1SA 2ES4A 4KIFA 1D04A 4O1MA 5A9TA 4B3RB 2PL9A 3STVA 5K3FB 1BWRA 4PLCA 3LO8A 4DKXA 5EJ7A 1HEYA 4NYIR 3NGLA 3G2OA 1I4WA 1MJNA 2AJ8A 3H1BA 1CP3A 1GO2A 4GZMA 4QYIA 3ZJ4A 4BIMA 1Q0SA 4EGAA 5LMCA 2P2YA 3CFYA 3L1VA 1F51E 1ACMA 5CUQA 3ZGVA 1OXMA 4CL3A 1OGJA 2GK7A 3W3AA 4OQPA 3AHIA 1JMVA 3AIOA 1NVKA 3I09A 4E3WA 1T0JB 2RHTA 2B2XA 3F0TA 3INNA 3AJRA 4Y1FA 4DB4A 4OF4A 3G5UA 5AM0A 5C7OO 2PUTA 1Q83A 4FOLA 4PC1A 4AMYA 5BR8B 1N0WA 3HBJA 4ME6A 4PGAA 3F5DA 1U9ZA 3MN1A 4L28A 4EFMA 4YMHA 2XCUA 1UXGA 2NTYC 1C0IA 1XHLA 2PS1A 3I6MA 4Q19A 5FJJA 3WHLA 1VL6A 3JZDA 2P5UA 4X7MA 2HPAA 3IAHA 1U3WA 3G5AA 4PFJA 5H4HA 1I2CA 2EQAA 3T3PB 3PRKE 2W5UA 4IMIB 4TPKA 3ZUGA 2FW8A 2I1WA 3ZJVA 5FX2A 2OOSA 2D8AA 1Z6PA 3HI6A 3PE3A 3P0EA 4DG9A 3NM5A 4Q1AA 1ZUNA 3EIFA 4IDPA 4LMAA 2JFBA 2PA0A 3M1AA 1ZIXA 3QFFA 1J5PA 1EZ4A 2FPPB 2H1VA 3L4EA 4JLNA 3ZYCA 4B09A 3M9XA 3DMDA 1ZL0A 4OREX 1AUPA 1G3RA 1E2QA 3KOXA 3WVNA 1P3DA 2XA2A 2YWJA 1CUFA 1QE3A 3MTBA 3OSUA 5FQNA 2LXNA 3U4AA 3V1KA 1OGIA 1R6UA 2WVHA 1IWPB 4NENB 3SI7A 1ISIA 1OREA 4LOIA 4UVGA 3F74A 3VGJA 1Q16A 5AVVA 1X39A 5GONF 4EEKA 1KQOA 5ESWA 3V97A 3VNRA 1OGYA 5TSDA 3ZXSA 1C0PA 1NJ2A 2DH6A 2HPVA 2X5NA 2B4YA 3FSGA 3ND5A 4NIMA 4QNRA 2BBWA 2JGRA 2WKSA 3LLUA 4HGYA 5AR1A 3L7NA 4YAIA 1GR0A 1MH1A 3QUBA 3DLIA 1KZYC 1K5DA 1P2GA 1VMEA 2BONA 4EMSA 4ERXA 4M8IA 4ZCIA 3B6ZA 5CG2A 3QU4A 3N0WA 4ZVUA 3T3OA 4XX0A 3AT1A 4EHJA 2XKAA 4PHCA 7REQB 1JHZA 4E4RA 3GEDA 1NY6A 1LBIA 4LV6A 4OOEA 1W29A 4CM5A 4R7GA 4MZXA 3ESQA 1R0RE 4EI2A 1F9EA 4JVOA 4QFDA 2CDRA 3T5PA 2GBFA 5F9MA 1E3WA 2MDTA 3EGXB 2DETA 3NW9A 3P2EA 1NLFA 2PYIA 5GQSA 3ZE1B 4BLRA 2AQKA 3CGWA 1HYEA 4DV4B 2PWBA 3GROA 1QO9A 1X7YA 5JATA 3K1AA 1KSHA 2YY7A 3REOA 2RMKA 3GYGA 3PPYA 1SXJA 2ZFUA 4IKPA 3W0LB 4BE9A 5KX5F 3STWA 1YDWA 3IUBA 3T0GA 1M76A 1MC5A 5KDLA 1KZ9A 2IW1A 2CHVA 3T15A 1HNXB 1PX2A 5I9BA 3T1TA 2YDYA 3GT4A 3ISVA 1RI3A 3RSCA 5G1PA 4X7PA 3NNDA 1R8JA 1NGSA 4C0AC 4HDMB 4UUOA 4EMBA 3C1UA 3F49S 3F98A 3PI7A 3VPHA 5ALWA 1KMCA 4F0JA 1DELA 2EKLA 3BA1A 1LK0A 3LUAA 2XDQB 5ALNA 4MUHA 3VKUA 2DPXA 4C7JA 2JAHA 4IFEA 5ED0A 3CNBA 3OLZA 4R81A 4OM7A 5HF5A 3AVWA 1F60A 3AM5A 4OMCA 2FE1A 3A9TA 5D1NA 1ZK2A 2UUPA 1RLOA 4RGYA 4D6YA 4RKQA 4BY9E 2NO1A 2QP4A 2HM7A 3D81A 3FNHA 3IAM6 3NYRA 3LZ6A 1AJEA 1R4NA 4WERA 5IARA 3EQ7A 4PHFA 1YBMA 2X5JO 1UZNA 3OTIA 4BVFA 1GLVA 4DHWA 4F1KA 2BGNA 4EEXA 1C80A 2Z1MA 4Z1MA 5JAIA 2FLWA 4MJXA 3EEOA 4YQYA 1DC4A 4DDTA 1PS0A 4K6GA 3FDZB 4OKSA 4FDUA 2IPXA 2P4UA 2IK8A 4ZALA 3OX1A 5DBFA 5TNXA 1EG2A 1JKFA 1JLRA 4YLEA 4I46A 1PG0A 1DWPA 1XVVA 3IUNA 1NJ1A 2MSNA 1LDGA 3Q7SA 4WKPA 4YT4A 3GGPA 1L7XA 3DH0A 3QTLA 4MINA 4TV8B 5E8RA 4DQ0A 4A36A 4LXIA 5DSTA 1GILA 1A88A 1BD3A 1FX1A 1OC4A 1QHHB 1MB4A 1QZXA 3I37X 3JR3A 3PWZA 3DT8A 3RFXA 4ZHQA 4CRWB 1C14A 4UD6A 1TE2A 4A0FA 3MJHA 2H1SA 3MMNA 4MJLA 4DRXA 4FEAA 3UTCA 1ZHOA 4CV0A 3RYTC 2JJ1D 4FHDA 3AWIA 2HJVA 2ZROA 3BIWA 3PDWA 5CAEA 1ZM9A 1KAEA 5AVXA 4RDIA 3P0FA 3PC2A 3HKDA 5TB5A 3RG8A 3WB9A 3ZHBA 4PYJA 2H4XA 3LQFA 5TQ2A 1Z7YA 3KOWA 3EOZA 4YECA 2ZITA 3Q7EA 4RQTA 1KEUA 2I1LA 3HA2A 1W36D 3B9RA 1TNDA 1KAQA 1A2BA 2DC1A 4LAFA 1QKIA 1U90A 2XTMA 5G53C 1MTOA 1UJ2A 1JIIA 2XIQA 4IX1A 2GCPA 2O07A 4O4HB 3F6BX 3LOPA 1QBGA 3T5CA 1L7AA 2QQGA 1XAHA 3C74A 3NIBA 4IILA 5EJ6A 2XSZD 2ID9A 5CPBA 3LYUA 3DGFC 2W6QA 4YB8A 4O2LA 3W4KA 3ZZTA 3BBPA 1MB9A 1O97D 2GM5A 3F6RA 4QGFA 4MLZA 5JCXA 3EZ2A 4BKOA 1W87A 3MUFA 3ON5A 4Z49A 4KGXA 2C2MA 4UTRA 1J1UA 2M9MA 5TF0A 3K6SA 4L6IA 1OH8A 2ZR7A 1PEDA 2XZDA 3O9VA 4XWOA 6GPBA 4UCFA 1N2CA 4QEDA 3GJ4A 1N3IA 4L76A 3NRCA 1U1DA 1NASA 2J4CA 2BM9A 2JW5A 1YNOA 7MHTA 4FT2A 1W73A 1DEAA 1G6Q1 2PH1A 1F8FA 2ZYUX 5IAKA 4CU2A 5CDFA 4CR6A 1P74A 1JEYA 1HDRA 1N0UA 2VRNA 4O59O 2EL7A 3JQAB 2W7TA 3HRHA 3PX3A 1TQ4A 4LDJA 3KELA 3MMXA 3O8BA 4TQAA 3WYCA 2WJPA 3P9CA 1IPHA 3D2LA 2XW6A 3F5SA 4W5HA 4F8EA 2O2SA 1U7PA 4QUBA 3HUTA 3ZC3A 1X8LA 4W9NC 4U00A 5IDVA 2CBXA 5EWJB 2CLKB 1RYNA 3DAHA 4TWRA 1SZPA 1OXUA 1DC7A 3O8OB 3KHSA 2VDPB 1T29A 2O7QA 3I04A 2ASVA 3TLMA 2HK9A 2HF7A 3N76A 4GPD1 4QQNA 4RFSA 3NKLA 3HXTA 1AXRA 2JG3A 3P2OA 2AMYA 3I58A 4HBGA 4MITA 4MRRA 4RF4A 1RQNA 1D4OA 1D7AA 1JSCA 2BEVA 4WN3A 3JQ9A 3ADOA 3K70C 3PHBE 5AHKA 2BMEA 4DDHA 2QE7A 4TKLA 4MV0A 1E1LA 4LDRA 4NJEA 4LJ5A 4M0EA 3DHEA 4QU9A 5DN9A 3SP1A 4JLSA 3JQFC 4BV2A 1WKBA 3JV7A 2YOHA 2CMHA 4JLMA 4ZEXA 1RHRA 4M7PA 2GSWA 2P6RA 2BZ0A 2AD5A 2WF7A 3D3QA 3DLPX 3TPZA 3COPA 1N77A 1OFTA 3MPUA 3TNYA 1Y4SA 2IL1A 4CVNA 2VDNB 4XM0A 2Z8YA 2ZRFA 2KMLA 4NDNE 2E55A 4CTJA 3HDYA 3KJQA 4KZKA 3U9SA 5GV8A 3C1OA 1DFIA 2ORVA 3A9RA 2HDNB 5AD1A 5KOHB 1GGMA 2ZI6A 3HACA 4P81A 5KS2A 1JR4A 4ZVLA 1CFJA 3FF4A 3ZG6A 5CFZA 1TQHA 4Q18A 4RY8A 1ZD8A 3FR7A 2DWCA 1AZTA 4IXDA 2CJWB 5B3JC 4HDNB 2FK7A 1BS2A 4JCCA 4F4JA 4WLVA 2AUTA 5K3OA 4CQLA 3P26A 4FE4A 2YDXA 3RVQA 1OH6A 3KYJB 2Z5FA 4DC0A 4TWBA 2XD4A 1AZLA 1NPTO 2I6UA 1BFKA 2R97A 2BBTA 3OQOA 2BFDA 4MIEA 4JJGA 1KFEB 1U1EA 4L85A 3IQFA 1Z7BA 1AGRA 3Q9UA 3H1PA 1CRPA 3PQEA 4AJIA 3M2TA 4C14A 4JLKA 1G2PA 3FJYA 3L7OA 3N2YA 3PWTA 2B1IA 2SKCA 1XG5A 3FZGA 3N7AA 4JUCA 1HE8B 1F8UA 3C3BA 1BEZA 2ZJ5A 3FNEA 4P7FA 2QLNA 3TWOA 2A67A 5IH3A 3Q7PA 3D3WA 1Z15A 3IDSA 3KLMX 3Q8KA 1NW4A 3NPMA 2GBLC 1ORWA 4OUDB 4Y6LA 1J00A 1XO1A 2GEFA 2GFHA 2GN6A 2ZLBA 1US8A 3PD1A 1P1FA 3WLEA 4B4KA 3CRNA 4S24A 4ND2A 3WLLA 5DIFA 4B73A 3ZLJA 1IY1A 3U0BA 4A8JB 1X1DA 5G3YA 4FGSA 1KU6A 1L7VC 2VPIA 2RHRA 5F5XA 4DQXA 5TPWB 2ERXA 4M0UA 1E3TA 5SZIA 1PFYA 2F62A 4K7JA 4RD2A 3NDPA 3IP8A 3OUTA 4YACA 1M2GA 3K0KA 3SQOA 1Z5VA 2IYSA 5DM60 3JQEA 1JLMA 5DOVA 4RJTA 2NU9B 2QWXA 4LDNA 1TU3A 1RBZA 1LLCA 4UU0A 3IVAA 4PAQA 3IEMA 3HSSA 3SKXA 1G16A 5EFOA 3YASA 2UYGA 2AR9A 3R9KA 2NVUB 3O8QA 4F3RA 5JECA 3KWJA 4ZAXA 2XUZA 1IY9A 4MUEA 1EM6A 2NTEA 3VC1A 2QRVB 4BNYA 3PVSA 3UIEA 2O8DA 1BVUA 4RS3A 1NVXQ 3RFVA 5J58A 3SZRA 2IELA 2J0VA 3K4HA 1T3SA 4G07A 1KY4A 2I22A 2GAJA 1SBHA 1UR5A 1VLVA 4MQMA 1E1QA 4B87A 2FMXA 2JC3A 1R9JA 4CGZA 3OFKA 4FN4A 2DFNA 3FJOA 4Y1GA 4KN8A 4RVSA 3JVUA 3TQHA 2YHAA 3RU2A 5LDHA 1W1IA 1EVZA 1B93A 1WXFA 4WW0A 4W5JA 5KSWB 1P6XA 1ZOOA 2D5CA 2GRJA 3WBFA 4PFKA 3T1NA 4R68A 1U7DA 5CA0A 3E8MA 5AXCA 4EYQA 1I6LA 3ZH9B 1DP4A 4G85A 4ENTA 1HRDA 3GJ3A 3UB4A 2IS6A 3JQ6A 1VSBA 2FF5A 3F46A 4QD3A 3FWZA 1KNQA 4GAEA 2FU5C 3GQVA 2QSJA 2UZ3A 3P2JA 4Q4DA 2COEA 5K4HA 3NONA 6ADHA 1T8UA 2FDRA 1T2UA 1ECLA 1CNMA 4NFHA 4EB6A 3AYZB 1N2OA 4EFNA 3UANA 1HGXA 1QQ6A 1SVWA 2OD2A 4S1OA 2QN3A 2C5AA 2XT0A 1S3GA 2YWXA 2I66A 3ZD6A 1KYVA 1QIJA 1F48A 5ELXA 3U3KA 2IX3A 1T2DA 4QAJA 3V1TC 1J25A 1G55A 3PT9A 2NPOA 4XR9A 2ODWA 3IMCA 3O2SB 1OZGA 1O89A 3DVQX 2JVKA 3GCXA 3TRFA 3GFTA 4E12A 1P1RA 1XZIA 5CFOA 3KXLA 4LWPA 3R40A 2AKAB 4PLPA 3R6DA 1C3VA 2Q9AA 1HDXA 3TD2A 6REQB 3KUDA 1GARA 4BL5A 1RZRD 3IB6A 3ZWCA 2P62A 2XT9A 2EZUA 3DSRA 3G8DA 1CQXA 5DWQA 3ASUA 4NATA 5K0FA 3SPXA 3EGVA 3B82A 3FYUC 3LUBA 2V7GA 1B8OA 1SO8A 1Q0LA 3AP3A 1IIBA 3IMKA 3EXAA 5B1EA 4HYTA 4MPDA 2EHJA 1PP4A 3EDYA 5HW0A 2ZJ8A 3DBHB 3G0CA 3PFBA 2ZR8A 4H9GA 2FMUA 2K7FA 4DDWA 2BAGA 4OD0A 4W7HA 5KNCA 1RP1A 4CF5A 3HB5X 5IRCD 2OCYC 2QXYA 1DO0A 2WHQA 4P5EA 4TMWA 3WLIA 5JZVA 3H5VA 4P08A 3U17A 1IDOA 4BJ1A 2PSSA 2HZ7A 3QX8A 4CQJA 5KYYA 2O5EA 4G4GA 2FUCA 4BO7A 4C06A 3LDGA 2VATA 2FSVC 1Z39A 1R27A 2C5HA 4X1IA 4DMRA 3FMIA 2QTHA 4F9TA 2VHTA 3FGNA 1BROA 3A1VA 3JAKB 4UULA 4AKGA 1U4NA 2FFQA 4Q9NA 1NLUA 1W46A 3U6KA 4Q3NA 4QOGA 1FXUA 3IVRA 5EXPA 5FO1A 3T4PA 1KBQA 2O0HA 4LSGA 3SNHA 4PZYA 3AR5A 5BW6B 1DAGA 2QRMA 3CINA 3AVPA 2A58A 1WA5A 4RMGA 1MN6A 4Q24A 1CZOA 3TGWA 5BP7A 5JMPA 4RGVA 3WWOA 4G01B 4CLOA 1BFDA 3T3GA 3UTDA 1XT6A 4Q03A 3W7VA 5JSHA 3ZVMA 4BMCA 5I6DA 1U3DA 3VR1A 4A27A 3TM5A 3IEPA 2O06A 1PQUA 2V55B 3DEJA 3GLRA 3OTWA 4IH1A 4CM4B 1Z2NX 4J7AA 5EHQA 4MYDA 1WY5A 1JR3D 1QO0D 4G5FA 5BN1A 3EGDA 1BAPA 1IN5A 1H94A 1N75A 4LYHA 5K99A 3QE4A 4HLCA 3GXOA 3FWNA 4MRAA 4RIIA 5K0EA 4YUWA 4RTOA 1BVYF 1DIGA 4ZHQF 3GEEA 4M0CA 2ODPA 1MLDA 3IKLA 4R2JA 2RB5A 1JBQA 4Q48A 1TM7E 3JRNA 4R9VA 1FQOA 1PGPA 2NW6A 2XB6A 5C4GB 1O9GA 2NLOA 2VZ0A 3LT2A 3JQPA 4Z3KA 1V6AA 2X76A 2KSQA 3FG9A 5BWNA 2VT6A 3WGMA 4Q4AB 1QVWA 4DNQA 1QOZA 1M1YB 4TRRA 5DTQA 5F9FA 1CRWG 3NRBA 5F33A 1QYRA 2KE5A 3E0XA 4LI3X 4MQ5A 3MCAA 4Q02A 3WIUA 3JWIA 2YWDA 4JA2A 2O3JA 1F12A 1FEZA 4RULA 4CLDA 3VZRA 4Z2AA 4OQEA 2OORC 5J5AA 4L4YA 1GCUA 2ZI5A 4NYJQ 4WNCA 5BN3B 5CEFA 4UMFA 1N33B 5EIFA 5TR9A 3T4EA 1WHSA 4R98A 4UJ5A 2NZWA 2IPAB 3LPAA 3TFWA 2CLIB 3UFXB 1T4MA 2A3RA 2QIOA 5JHHB 3PTAA 3HEAA 5K1ZA 1AF7A 3NM6B 4N47A 3H75A 4XSVA 4BE7B 2D2VA 1JLLB 2WG2A 3BVPA 2ETXA 1N8KA 1BG6A 1G4AE 1XI2A 2WJZB 4RMHA 2G5TA 4PYMA 4YASA 4KPFC 1ZD2P 3G5MA 2BRUA 3AESB 2VWQA 2B6HA 4QJIA 5EXEA 2LP4Y 4U6SA 4ZK2A 3ABZA 4GVLA 4KWHA 1OLSA 3PHIA 4YPVA 1G0OA 1YBHA 2NUTB 3WAKA 3O4RA 3THYA 1ZJWA 4W1RA 4FI3C 3RS4A 1IWOA 3JX9A 4Z9AA 3BTUA 3TW8A 3A7EA 1K7SN 2QG6A 3C8DA 3TX2A 4M6WB 2JBAB 4QLOA 4EGCB 3LVFO 4H6PA 3LLSA 5BSEA 1ZMRA 2P69A 3K9HA 2P9ZA 4HDCA 3UAOA 5EZSA 3VV3A 5A4KA 1AO0A 1QQAA 2O0MA 4BTLA 4NXNB 4A8HA 5AVWA 1QAOA 2QGFA 4L4RA 3CVWA 4G23A 4DABA 2Q2VA 4G1FA 1FQWA 1KXZA 1KU0A 2EF0A 2REBA 3DF9A 3NC1C 1FU7A 1LDMA 1XD8A 1W52X 2IOHA 4L3OA 1VE9A 3X1KA 2HTEA 1RPZA 3VR5A 4LY9A 1A8SA 2B99A 1OYVA 4O08A 2GAIA 2WSLA 3NHZA 2PD3A 2XQIA 3LWBA 3DZFA 4G4SO 1T5IA 1V1MA 2GHRA 4FLEA 4IIJB 3RWMB 4TLDA 2QD3A 4AYXA 1PL6A 1VHWA 4HQ0A 1MW8X 3MRSA 1L4EA 1GPMA 2J3QA 1B00A 4JQOA 1QRAA 4ND8B 3ZE0B 1N9GA 4E2ZA 1DKQA 3AEZA 1L8XA 1L8LA 1R8SA 3V4OA 4B4OA 1CS0B 1Y6GA 3SXPA 2Y66A 3OIGA 1NTRA 3L4BC 1RQ7A 2FJUA 1WY7A 2GGSA 1BOFA 3AUSA 4GNKA 2IE8A 2C61A 3RARA 3TFQA 5JS8A 3WFZA 2OD7A 2QZZA 1UJBA 4B81A 2FMFA 3OKAA 1XLVA 4IYRA 1N5RA 2IFTA 1YDHA 4JHLA 1RWKA 4BP1A 4RIGA 1AKTA 2P79A 3V80A 3W6NA 3WP0A 2YHIB 1QWOA 1KTIA 1X1AA 3NP7A 1OLUA 4BMDA 5JZSA 5FWXA 2ZYIA 1JYFA 2PL1A 2ZBUA 3P96A 2XQKA 4FDVA 4LZLA 4YREA 1QVRA 3LQ4A 2Q5EA 3FGPA 4MV1A 5IJ0A 4LV8B 3RU7A 3GCZA 4YAKA 3OCXA 3RVNA 4F6RA 1XHFA 5ABPA 5JIBA 4JJ4A 1L4NA 1VL1A 2GNAA 3M9WA 3L77A 1N5OX 2J9FB 1EGVB 3VPCA 3ZTTA 2PLAA 3CR7A 4LCJA 1FMCA 3X44A 2W93A 3BZBA 2XECA 2H48A 1S8FA 4WXPA 4AP5A 3BRSA 1HT1E 2AXEA 4B35A 3KSRA 3OQMA 2I91A 3MOSA 4NZPA 3VOTA 1YI1A 1FS5A 1RLTA 3I62A 1C4KA 1KR5A 2HDHA 4JENA 1QGUA 1YDMA 4PYRA 4WCDA 4QRHA 5HIKA 1U8ZA 3B7PA 4ZU6X 3ZEIA 5DI3B 3WGVA 4C6TA 3EGCA 4YRKA 3FVRA 1Y1LA 3RUEA 3Q10A 1XNJA 2F3RA 9LDBA 4WN9A 2Z98A 5H3CA 4F2HA 1O1YA 3AC0A 1NQ5A 5JUWA 3M82A 4GX2A 3EZ6A 1UWCA 3H9QA 4QPZA 1APBA 2QW8A 2V6GA 3NWBA 2ZSFA 1EAMA 2W6PA 1FBNA 4I1VA 3QM1A 4GKAA 4RK5A 3DD5A 1QG0A 4QXOA 1EI9A 2C5SA 3DFKA 3EVTA 1CR4A 2MT9A 3KCNA 4D5GA 3CSUA 1M1UA 1YIAA 3FKQA 3FMGA 3N3AC 1L4FA 1PJSA 3AR2A 4LF9B 3VC7A 3WTBA 1VQ1A 2V6BA 1DLIA 4PC3A 3IDAA 2X7HA 3Q9SA 1QGAA 1EZZA 2I6QA 4CV3A 2O8BA 4LJ4A 2PBZA 5I7RA 1KI7A 4O3MA 4NULA 2VPWA 1H6DA 1VKJA 2IPLA 3CSSA 2B9EA 3H2SA 1N7IA 3FLAA 3NATA 2UVPA 1KI9A 4KAJA 4PPGA 4OXKA 1SEVA 1PW5A 3FYHA 1YR2A 1GUYA 3JQBC 2PGIA 4DUPA 1RKBA 4ZFNA 2GRUA 3DKIA 1Z4PX 4YX9A 4I4TB 3L0IB 1UBUS 2CHFA 3EFEA 4F4HA 3VNVA 4BFSA 3FKJA 1JU9A 3V9AA 2NX2A 4D41A 4ZZ3A 2HU8A 4IGFA 3ZJ5A 4RTQA 4ADSG 3G2NA 4O63O 4K9SA 3OIYA 4BEBA 1YZKA 1XXLA 5DTEA 4ALJA 1YQTA 1FXWA 4HF7A 4JB2A 3U62A 3UQYS 4AKEA 3TLCA 2MSEB 4NZNA 2VSYA 1TL7C 2WRZA 2BF4A 4V3CA 5JSUA 3PQ5A 5KSYA 1ONBA 2BR3A 3EA4A 4BO4A 4DIMA 3B1ZA 3BJEA 3RYIB 5KYNA 4YP1A 5CA0F 2H2HA 2VPPA 1VYHA 4KQJA 1RIFA 2JH3A 4FT4A 1PL8A 1BIFA 4IG4A 1RHJA 4RK1A 4BVKA 3HXMA 4MP6A 2IPNA 1V1JA 4U7FA 1NJGA 4HL6A 2AX3A 4M3NA 4PF1A 1E89A 3GZNB 2RI1A 2EFEB 8AT1A 2O7RA 3KT8A 4QPNA 3RRYA 1A82A 3PVZA 3P71T 2OPHA 1DO8A 3FOCA 1XTUA 1DC8A 2ZYGA 1F3OA 1TT5A 3EMBA 3LBHA 1L7QA 2DJIA 3DPUA 2X41A 1SH7A 3A6ZA 4GMGA 3QU9A 4FHGA 1U2GC 4JY7A 1YF3A 5ILOA 5K9ZA 2PJZA 3JALA 1T24A 4ND5A 1YR3A 1E1RD 3KT0A 4DYHA 1I9GA 3WRWA 4D3SA 1GUBA 2I29A 1QVZA 3V4LA 1JR3E 3TBFA 2A8YA 4P7JA 3L1JA 1GA4A 1COWA 2WINI 2Z2JA 1NN5A 4OXRA 5L3QB 1BXKA 1IHUA 3S2GA 2AZ4A 4KPGA 1XQ6A 3NHUA 1X74A 2KBEA 1RAGA 3KEMA 1FNBA 3VZQA 2JCSA 1SCUB 3ICCA 4IO1A 1V2GA 3G2KA 5A1TA 1EUYA 1UKAA 5IPFA 1WB6A 4UUPA 4LUCA 1GQSA 4J0FA 4MS3A 4OHXA 4AU1A 5IHXA 2OK8A 2RKWA 3WWPA 1Y4ZA 1JSZA 1SKYE 1R1DA 3PYXA 4RTLA 3GVIA 2B37A 4HY3A 2J0UB 1L7DA 3ECSA 3FH0A 4KH1A 1SQFA 3O1JC 2DPYA 4POAA 4Q3KA 3RHSA 1UZLA 3WK9A 4A0SA 4FHFA 1U6JA 3T1VA 1YE8A 4OATA 3DW3X 5KNBD 4BTEA 4MKZA 3PP8A 2RHJA 2XOXA 2QTVA 1XQ9A 2QG4A 3R8CA 5LU8A 1GG5A 1T34A 5LQRA 3WGJA 4DR3B 2J59A 5CHYA 1KYYA 1UOOA 1DTSA 2VRWA 4P32A 3Q9NA 1VLQA 1NUPA 3JYPA 4H7JA 5BSVA 3E4DA 5HJEA 3CT6A 3RVKA 5I7WA 5MFPA 1IHOA 3R3YA 4BVAA 2VEOA 2WAMA 3KKLA 4OP2A 3IC5A 3EISA 4C3ZA 4RTMA 4C76A 5DKFA 2A30A 4ZZ1A 4RYDA 1QV9A 1R0WA 2C78A 3DZIA 1C7IA 4XQGA 2I80A 3SKYA 3E4CA 4WSOA 2QMOA 2O2CA 1CR2A 3LKDA 1W34A 3PRHA 2PS3A 1RABA 1SBCA 2HU2A 3SSMA 1W35A 1GNSA 3PNPA 2ZRQA 4GXTA 3UO8B 3ZQ4A 4DV2B 1GVHA 1MX3A 1QX4A 2JDID 1TVEA 3D2AA 3QMPA 4HQOA 3RAGA 1ZM3A 4C88A 4DJAA 3BWBA 3MIIA 1H1DA 1QGYA 4A0RA 3VISA 4B6FA 1MOQA 2YXLA 5AVYA 2XIJA 3RRXA 3IMEA 3MCVA 3AL3A 4PNZA 2WHPA 3CCFA 2CLSA 4RKFA 2YFKA 3TR5A 3CS3A 1R0CA 2DFTA 2OMEA 2CXSA 3AR3A 4N5NA 2IVFA 4BVLA 2G08A 4EPTA 1LU9A 3Q88A 3OX2A 1YI8A 2R8OA 5EYPB 3K9WA 1DOZA 1FYVA 3M33A 4L5BA 4D3FA 4DCNA 1L4KA 1SXGA 3A7DA 3LKVA 2C1XA 3OBIA 3IERA 1EJ0A 3C3XA 3Q12A 4IDGA 4PVCA 4Q4HB 4RO0A 1P4HA 2FEXA 4C5AA 4E2XA 4V0QA 1CEXA 1UAGA 3BHJA 3ZUPA 1GNLA 3QF7A 2FXIA 4I14A 2DERA 2I71A 1X7WB 4LZJA 1LS1A 3ZKAA 1QFYA 2C3PA 2MTBA 3LPDA 3Q0EA 4BNXA 5HDQA 1SBIA 1IM5A 3DEIA 2QRLA 4UE3S 1JX6A 4WX2B 1C7ZA 1QG6A 1G5HA 3UV7A 4ACAA 3KJEA 4TWAA 1EQAA 1NSFA 3QF4A 1TOAA 6AT1A 1RNLA 1DL5A 4A6DA 4COOA 3W5AA 1PL7A 3WMEA 2P9QA 4KAXA 1QU2A 7YASA 3QX3A 3H04A 4CM8B 2R2AA 4ZEWA 1P31A 4B31A 3OFSA 1OFHA 2H4FA 1Z2PX 2OGZA 2WWXA 4GC9A 3BL5A 3QHPA 3WLTA 5FUVA 3HN2A 3KSDO 1P7PA 3DXXA 1BMFA 3N0TA 2ZJFA 4LE1A 4E30A 5KNDH 1X0VA 1MZPA 2EARA 2DFPA 2NZXA 4D74A 4LOHA 1KF0A 2P35A 2PT5A 3IA7A 3L7MA 4G0NA 4MVJA 4ETIA 5BOSA 1KL7A 3NFYA 2IZOA 1IONA 3BGVA 1YZTA 1D0IA 2YC2C 4AQYB 1VA4A 1WPQA 1T5SA 2CFOA 1PWEA 1ECJA 1E2UA 3LVRE 1T8RA 4MW0A 3EASA 1R8XA 4PG4A 5DRTA 1DAOA 1WABA 4ZQFA 3WNQA 4E09A 4EA9A 1HYGA 3O93A 4RTPA 1ANKA 1BMDA 3CRQA 3D1JA 2OBXA 4IINA 2FPMA 1M72A 2C29D 2P2DA 4HUJA 3UM9A 2O20A 4MKHA 4ZT2A 3RFFA 3AV0B 1FC0A 4LTMA 2ZIFA 4PRLA 1QLHA 5J4KA 1AS2A 5KTRA 4ENQA 5DCYA 3QVGA 4WK0B 2XB9A 3X1DA 2RCNA 5LIPA 1UAAA 2JAOA 1X7XB 3SF8A 3V1NA 4JIMA 3RUPA 3AUXA 1D4ZA 1LDNA 1EUCA 1UMBA 4X0EA 2CL6X 4YO7A 4P0TA 1K88A 3TAXA 1YTLA 4G5HA 2WTAA 3B48A 4HYYA 3DA8A 3HWX1 2QM3A 1EK1A 3P9YA 4YJ2A 2DBVO 3JATA 1U8EA 4MARA 1HNWB 2X2EA 4JI6B 3AUKA 4PRZA 5ALTA 4DA7A 1M8JA 1WHTA 2G71A 3O7WA 4QO8A 4ETNA 3W4JA 4OSOA 1C9DB 1Y8RA 5JBNA 3DL2A 3PUZA 1SIBE 1P6UA 2R1TA 1SC3A 4WUTA 5CG1A 3S1SA 2DM6A 1C9MA 3NJ4A 2ATVA 1XAJA 1DMSA 1EAYA 1Q1EA 3FY4A 3W3AD 1HDYA 4EF4A 1H4TA 2WIJA 1ODKA 3RS7A 5B2ZA 1CT9A 1UIRA 3GUYA 2GR9A 5IWAB 4N8SA 1W47A 4RIFA 2B5OA 4PAOA 2AF3C 4ZYLA 2WQZA 4RD0A 5G4KA 2OO3A 5DYYA 2M6LA 1IG0A 4E5NA 3OCWA 3U3MA 2J33A 4LWOA 5J2TB 3GOHA 3S2SA 3TRJA 5G40A 1KJQA 4W9NA 3RVMA 3OQBA 2BGUA 1M2KA 4BQRA 3M5PA 5BWOA 4JUBA 5IKXA 5FLXA 3A14A 2UXBB 4HZGA 4YS6A 1YKFA 1M74A 3HPRA 3K30A 2QTTA 2YXDA 3WLOA 2VDWB 3QVOA 4MZDA 4TTTS 4BLTA 2GQ0A 4KBGA 1VRWA 4QKQA 5C18A 3OWHA 1NXTA 3UAVA 1AN0A 1PV4A 5L8VA 2QOEA 2B21A 2ZRPA 3ZHXA 4EUHA 1QP7A 5EHIA 4D4LA 4HAIA 2E6UX 2QKYA 3H5IA 3Q40A 4Y30A 5BV8A 2C7GA 3LLCA 4DV0B 4ARSA 2NWQA 1YCGA 1R50A 2XHEA 3Q98A 5COQA 3E82A 4IJKA 4MMYB 3QEAZ 1WX1A 3CWZA 4G5SA 2FPWA 2C3UA 2QVXX 1D0SA 4Q82A 3QA3E 1E6WA 1F2VA 4TOIA 3OI7A 1GGKA 2O2ZA 3RE1A 1RVDA 2D7JA 2RG1A 3FSGD 1NKTA 3JVDA 5T5QA 1MJGA 1LDEA 4XVHA 1IMJA 1M0TA 1RKQA 3FPHA 3EXFB 4NG5A 4C0XA 2PO7A 3A8TA 4I2NA 4YC7A 5CT6A 4PEVA 2PZMA 2Q5QA 2O3QA 4PYOA 5AI4A 3AF1A 4ZAGA 2XXJA 1RLUA 3RBXA 2JJQA 4BCCA 1K0UA 3NRJA 1RFGE 3KV3O 4NU5A 3EWAA 5L9AA 5G3ZA 3QVVA 2J0SA 2P4QA 5T57A 4HNUA 1VKNA 1V71A 1L5YA 3MS2A 5IT4A 4JEIA 5CX1A 1QX3A 1Z4LA 4LGVA 4ZAFA 1SIUA 2RBEA 1E3SA 4RW0A 3RLIA 1TFRA 4H77A 2B6NA 5DJ5A 2DFKB 5BR7A 1A76A 1KEEB 3LK7A 1SQSA 4JOQA 4LNHA 4Q1BA 4RIEA 3NHWA 5B3JA 4WK4B 5FAKA 1SXJD 5BVHB 4BC0A 2BDTA 3SXJA 2WYVA 2MSCB 3PR2B 4C22A 1L1RA 3PIIA 4WESB 1K8QA 1T1RA 1RC8A 3C1TA 3PDHA 3VGPA 5DLPA 4B3SB 3R4VA 3QUTA 3T5MA 3UHFA 1XFDA 3ABSB 2IX9A 2AXPA 1U6KA 1N2SA 5SY6A 4J1TA 1PR2A 3T7SA