1UK9A

Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with isovalerate
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
271
structure length
271
Chain Sequence
NLEIGKSILAAGVLTNYHDVGEGQPVILIHGSGPGVSAYANWRLTIPALSKFYRVIAPDMVGFGFTDRPENYNYSKDSWVDHIIGIMDALEIEKAHIVGNAFGGGLAIATALRYSERVDRMVLMGAAGTRFDVTEGLNAVWGYTPSIENMRNLLDIFAYDRSLVTDELARLRYEASIQPGFQESFSSMFPEPRQRWIDALASSDEDIKTLPNETLIIHGREDQVVPLSSSLRLGELIDRAQLHVFGRCGHWTQIEQTDRFNRLVVEFFNEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 2-hydroxy-6-oxo-7-methylocta-2,4-dienoate hydrolase
publication title A Series of Crystal Structures of a meta-Cleavage Product Hydrolase from Pseudomonas fluorescens IP01 (CumD) Complexed with Various Cleavage Products
pubmed doi rcsb
source organism Pseudomonas fluorescens
total genus 99
structure length 271
sequence length 271
ec nomenclature ec 3.7.1.9: 2-hydroxymuconate-6-semialdehyde hydrolase.
pdb deposition date 2003-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1uk9A00
4Q3KA 2ZYSA 3N2ZB 4Y2RA 5JAUA 3VDXA 2WHPA 4F5ZA 4Y2SA 1CPYA 1XZGA 3LLCA 3SC2A 4P08A 1MU0A 4M0MA 1BCSA 5AJHA 2J3DA 4FWBA 4HXFB 4NZZA 2QUBA 3HABA 1GPNA 1QO7A 2GBGA 5KWJA 1KEZA 2CJPA 1CLEA 5DYTA 1N1MA 2WG0A 4BCBA 2AJ8A 5JD5A 3GROA 1UXOA 5AKLA 2I3DA 2Z3WA 5EHQA 2YH2A 1Y7IA 3O4IA 1ZICA 2OCGA 5ALZA 5EGNA 1XZLA 1GKLA 1MX5A 4W63A 3WLAA 2XUQA 4Y2YA 2DHCA 1LPPA 4X71A 4JYMA 1UKBA 4XWGA 4DSZA 1EVEA 3VKFA 2WSLA 3FLBA 3WWPA 4BAGA 2H9YA 2I3ZA 5EIHA 3H2IA 4FMPA 4OYYA 4X6XA 1THGA 3ANTA 4CCWA 1LPMA 2HU8A 1UOPA 1HQDA 1Y7HA 3H19A 4M0EA 3G9TA 2OCIA 4UPDA 1UK8A 3AIMA 4EY7A 4QDZA 3IUNA 4WCVA 3A2NA 4CG2A 4KE6A 4JYPA 4AZ0A 3FYUA 1H2WA 2VJCA 1BEEA 2WG2A 5T4EA 3QMWA 1C7IA 1UK7A 2O7RA 1P0QA 1XLVA 4CFSA 5I8PA 5FRDA 1QTRA 2ZSIA 4N8DA 1XZJA 1I6WA 5DNUA 3RM3A 3WIOA 4KE7A 2I78A 1OXMA 2V98A 1EK2A 1MO2A 4FHZA 4ARAA 2B4KA 5JAPA 3C6ZA 4J7AA 1JMKC 3QPDA 5JARA 3PUHA 1YA4A 2PX6A 4ZWNA 4UHBA 3VJLA 3FLEA 1SFRA 5E4TA 3Q8WA 3BF7A 1W52X 3G0BA 2ZYRA 4Q05A 2ZJ7A 3ESAA 3OTQA 1P0MA 1VXRA 1WB4A 2WTNA 3MVEA 3D2BA 4DNQA 1DWQA 3U0VA 1L7RA 1AUOA 1E8DA 5K3AA 1N5MA 1BN6A 1W4LA 4XJVA 2XMRA 4L72A 5AOAA 2J3QA 1TRHA 3V1NA 1VLQA 4RE5A 1CUXA 1JU3A 5AKHA 3TGLA 1ZI9A 2OG1A 4MEBA 1WB5A 3D2CA 3H04A 3G7NA 1FFCA 1H23A 3WKAA 5HKBA 1UOQA 3HC7A 4G1FA 5HK9A 3L1JA 4NVRA 4H7HA 2WJ4A 1UZAA 1CQZA 3UUFA 4KEAA 1NU8A 4Q1VA 1A8SA 2YASA 2AJLI 4C87A 1LBSA 2HDWA 3H2GA 5K3CA 1LPAB 3EBLA 1Z68A 3AZQA 4U2EA 3FOBA 4G4IA 1ZIYA 4BE4A 2QJWA 2QT9A 4KACA 1R50A 3D4LA 1TCAA 2B20A 1XZMA 2ZSHA 2AJBA 3RKSA 2RONA 2W6CX 2AXEA 1DTEA 3L1IA 5A62A 4UBKA 4GI1A 2WLSA 4XVCA 1EB8A 5A2GA 4BATA 4UBMA 4KE9A 1D07A 3STYA 1HL7A 1VKHA 3W2TA 5JYCA 3CCBA 1P0IA 2WQZA 4J3JA 3IULA 1BE0A 2Y6VA 4AN1A 4LXIA 5D7BA 1CUYA 4H7DA 4KAJA 4U2CA 4UHEA 2WILA 3GBSA 1CV2A 3STTA 1ZGBA 2EDAA 3HSSA 1IMJA 1VZ3A 4HXEB 5T4BA 2HA6A 3DLTA 3FVRA 4QWMA 1GQRA 5AI4A 2WFLA 2QZPA 3ESDA 4UHFA 3VVMA 1J1IA 5LIPA 2HM7A 5AKJA 1NX9A 4KYVA 4FDMA 1ZI8A 3ANSA 5AIBA 1PFQA 1U8EA 1CUCA 3PI6A 1EDEA 2J4CA 4FFVA 2OAEA 4B9EA 1SCKA 4DTCA 1E8MA 3DOHA 4DLNA 1VZ2A 5AHXA 2WHQA 1QFSA 2JGMA 3RLIA 3WK9A 1YCDA 3FAKA 5DTIA 2XUOA 1DINA 3BJMA 2WUGA 1MJ5A 4B6GA 4OSEA 1TAHA 4IO0A 3BWXA 1ETHA 2HRQA 2DHEA 4W1SA 4G4GA 3NWOA 4E46A 4C4XA 3CXUA 3STWA 1DWPA 2CEKA 4PF1A 5AK6A 2PSFA 3R3ZA 3HEAA 3BDIA 4L9AA 4B82A 5AO9A 4DMKA 4C6HA 4DMCA 5ALFA 4CIBA 1LPBB 4A23A 2HFKA 4EY6A 4N5HX 4H7IA 5IVDA 3AINA 5CH3A 1WM1A 4PSUA 1QIJA 2GYUA 2HU7A 1DX6A 4G9EA 2XUDA 5LLSA 1EDDA 1CUEA 4QDTA 2QRUA 2XQKA 4L3WA 4OB8A 3F98A 1UOOA 1GPLA 5AK5A 5AH0A 4BDSA 1QIFA 4WFIA 2WIKA 4MEAA 4QNNA 3WYNA 2XT0A 4MWTA 2WM2A 5FDFA 5A71A 5IH7A 1LNSA 2VATA 3G8YA 2FUKA 4AX4A 5KREA 5CT6A 2XB6A 1DQZA 4FFWA 4AQDA 3I1YA 3FCYA 3CCCA 4A16A 1PV1A 5ALLA 2ZJ6A 1YS2X 1MNAA 1SOMA 3VXKA 4WJLA 4N5IX 5CXUA 5JZ9A 1YB6A 2ONCA 4UFNA 1SCQA 3KWJA 5LZ9A 1VE7A 2WKWA 1OCEA 3M83A 3WWEA 3I6ZA 4C4YA 3FWHA 5DYWA 5HFNA 2ACKA 4G4JA 3V9AA 1X2BA 5HQ3B 3OURA 1JJIA 1W1IA 5K3DA 4BTLA 3O9MA 3FSGA 4HS9A 4B9AA 1GGVA 2XUGA 4F0JA 5D6OA 5K5EA 3HRHA 3VISA 3BE8A 4BVLA 1XRMA 2X8BA 2V97A 4WFJA 2PBLA 3M81A 3KWFA 4J0DA 1CUFA 2PSHA 5AKGA 1LPNA 2XMCA 2EEPA 5AKEA 4DGQA 1CUBA 5LZ5A 4K2AA 2XI4A 1IZ8A 4UFOA 3C6YA 1FSSA 4H18A 3PF9A 5C8VA 1K4YA 1XZKA 3QH4A 4B83A 3V1MA 2PSEA 3D3NA 4HZGA 4UBLA 1ODCA 5CT8A 3E1GA 2ZJFA 4B80A 4B85A 3WL8A 1ZJ5A 2PU7A 3W06A 3V1KA 1XZFA 3K2IA 3F9CA 4DMFA 3V48A 5BWBA 5ALJA 5K3EA 4LHEA 3IVMA 2O2HA 1MAAA 3WWOA 2CZQA 4N8SA 1WHTA 2GBIA 1XLUA 4XX1A 2GZSA 5HF6A 3ZLUA 3H2KA 1YASA 1AGYA 1IVYA 4WY8A 4BE9A 1TCCA 3ZI7A 4YK7A 1ORWA 4BAUA 3DQZA 4PO3X 2RHTA 1THTA 1BN7A 1CUJA 4EHBA 1BU8A 2JGEA 2R8BA 2ACEA 5FXMA 3BL8A 1F6WA 3Q0TA 2QJRA 2Y1KA 1CEXA 1WCYA 4V2IA 2OCKA 1CQWA 5ISMA 2XMDA 3R3UA 4BCCA 1ZD5A 5JZSA 1QTIA 4HAIA 1E5TA 3C8DA 5LYYA 3WMRA 4P9NA 3IB3A 2PVSA 4JUIA 3QZUA 1VOTA 2BUCA 1HDEA 4Q3LA 3I6MA 5EHZA 4QDUA 2GBCA 3AFIA 2ECFA 1XZIA 3FLAA 4X92A 1EX9A 3PICA 4YASA 1XRQA 4UUQA 4DNFA 1CVLA 2C0QA 1VA4A 1XKTA 2FJ0A 1EA5A 3FNBA 4X93A 5HF5A 1YB7A 2C5GA 4JEIA 3I2IA 1QGED 5CT9A 1J2EA 3WK7A 3FSGD 5FP0A 1BEZA 1CR6A 3ZWQA 1CUSA 2XLBA 4FNGA 2Z5GA 3VJMA 4QLOA 3JYHA 2G63A 5LP1A 3QPCA 4X94A 4H7EA 1M33A 1RP1A 2BUAA 1HBJA 3W9UA 5AI0A 3HYSA 3WYDA 5LKRA 5AKXA 4CIAA 1L7AA 2H7YA 1DT5A 6YASA 3H2HA 3H17A 2C0PA 4UHHA 4E15A 1MX9A 2HA0A 1K63A 1K5PA 3WK5A 3WKEA 4H35A 5JZBA 1CFJA 2O7VA 1HKHA 3C43A 2OPHA 3E4DA 5T4FA 3PFCA 4EBBA 4J0JA 4H77A 4H0CA 3PDCA 3WZMA 3IBTA 2Z8ZA 4Z49A 3C5WP 1CUGA 1JJBA 5AP9A 4ITVA 1U4NA 2V9ZA 1IUOA 5DYYA 1AC5A 5CTAA 2WFZA 5E4JA 4ZI5A 5ALWA 4FLFA 2VA9A 2XUAA 3KDAA 4OU5A 2GZRA 4X00A 2DQYA 4LKOA 3DL7A 2DFPA 4ROTA 3AIOA 3MGAA 2YYSA 1USWA 4ETWA 2OXEA 4BZZA 4L0CA 2B61A 1BCRA 4J0GA 3IURA 4AO8A 5AI5A 4Y9SA 1DU4A 1BROA 4OYLA 1A8UA 3HJUA 3WA7A 1AKNA 2VT7A 3KSRA 1R9MA 4BP9A 1QIMA 1CUAA 1AQLA 3S2ZA 1CIJA 4AZ3A 3PE6A 2WTMA 4EUSA 2XLCA 3C87A 3BJRA 3IUJA 3KD2A 4Y2JA 1VXOA 4Y7DA 1B6GA 3I1IA 2HHAA 3R0VA 5SYNA 2JF0A 4PQEA 4RE6A 2H7CA 3B5EA 4E11A 2VTVA 1QLWA 2WJ3A 4F60A 1J07A 1QIGA 1E3QA 3KOOA 5AI8A 4CCYA 3F96A 4B0OA 1XZAA 4ARBA 1XQWA 4MJ3A 5E2IA 3ZLTA 2J4FA 3N0TA 4ZV9A 2DHDA 4WY5A 5FUMA 3H18A 1XRRA 4BVKA 4GBGA 5EHNA 5D3ZA 1G42A 1W75A 4J0KA 3GZJA 4QE3A 5ALDA 5ALSA 1X2EA 4ZGBA 5AM5A 4NS4A 4UBNA 4GW3A 4W1PA 5AM0A 2OLEA 4RGYA 1PJAA 4C89A 1G4HA 4Y2PA 2WIJA 1EINA 1ZD4A 4B7ZA 1C7JA 4DNOA 4WFKA 1QE3A 1UWCA 1LZLA 1LGYA 2QTBA 3S8YA 3CN9A 3AILA 2W22A 3DYVA 1W76A 1EB9A 2JGJA 4AMYA 5I7UA 3GUUA 2XQIA 5ESRA 3WZLA 4TPKA 4HXGA 2BGRA 1XRLA 1KU0A 4P93A 1ZJ4A 5A7HA 2DCMA 5A7GA 3WWDA 4CG3A 1JMYA 1GT6A 2QVBA 5C8ZA 1G66A 4AN0A 3FYUC 1TKRA 2WUDA 3AJAA 2XE4A 3NOXA 5LZ2A 4GEGA 3WK4A 4BB0A 5HQ3A 1F0PA 2XUPA 2O2IA 4KJXA 2OQIA 3AIKA 1C4XA 4U2FA 1ZD2P 1AURA 3I28A 1DWOA 2RI6A 4FLEA 2RGUA 3ESCA 2WU3A 4U2BA 2OGZA 5ALUA 5EIEA 1S8OA 2VEOA 5YASA 3QYJA 3DL4A 3R3WA 2Y6UA 3R40A 2CB9A 2VF2A 4BCDA 1QFMA 5BWCA 5HFAA 3STVA 3LCRA 3BDVA 4G9GA 3FYTA 4KAFA 1IUPA 2WU4A 2I03A 4UBJA 4FTWA 4BVJA 2X76A 3TRDA 2PSJA 1H2ZA 2BUBA 4Q82A 1ACJA 1BS9A 2R11A 5HK8A 2VQ6A 1O6FA 5K3FB 2OQVA 1F0NA 3ESBA 5HKAA 5F4ZA 5ALQA 3EF3A 5CURA 5AM3A 1TIBA 3ED1A 4LIPD 2B9VA 4J0HA 4A5SA 4QWWA 3IUQA 3EIOA 5EHXA 1E66A 1QIDA 2X5XA 1N5RA 3HACA 5AKZA 1AZWA 1QOZA 4JH0A 4QDOA 2HA5A 2WFLB 1XQYA 1CUWA 2G5PA 1H2YA 2XMSA 2WG1A 4K6HA 5DNVA 2QKYA 4BRSA 1B41A 1WPXA 4S0XA 3WK8A 5CBKA 1Y37A 1DX4A 4K6GA 1MT3A 2VAVA 3DYIA 5I9IA 2C58A 5AOCA 1WHSA 1XQXA 5AKKA 2XUFA 5ALTA 1SC9A 3WJ1A 4GXNA 4LXHA 1BRTA 1TCBA 4EY4A 5C8XA 2K2QB 4BTVA 1MAHA 3BIWA 4BYMA 3L1HA 5JALA 3M3DA 3IIIA 2RIPA 3OG9A 1LPSA 2CMFA 2HFJA 4X91A 1QIHA 5CT4A 3E0XA 3WWCA 1ISPA 4J0CA 4X90A 3QMVA 4HRXA 4OD0A 3K9BA 5C7YA 5DLPA 1CUZA 2BFNA 2C5FA 1AX9A 4IH9A 5ALKA 3ICWA 3WIBA 3AUKA 3G0DA 4BZWA 2FX5A 3F97A 3GA7A 5FV4A 1Q83A 4PV7A 3A70A 2QMQA 4MQLA 4X85A 2AJDA 1CUIA 1JKMA 1HLGA 2E3JA 3STXA 1YAHA 3DOIA 7YASA 2NW6A 4AB1A 4EY8A 2BGNA 3D59A 2XMGA 1U65A 4UHCA 3O4GA 2CBGA 4CG1A 1ACLA 1UK9A 4KAAA 1K8QA 3QMMA 4W1QA 4Y2UA 4PW0A 5AIAA 3T4UA 4I4CA 4J03A 1QZ3A 4H7KA 1K6EA 4C4ZA 1AMNA 2FJPA 1SCIA 4X95A 1UKCA 2RHWA 4IHAA 4AO6A 5ALPA 5D3KA 3SWWA 5ALHA 1U2EA 3FVTA 3MUOA 4AO7A 1DQYA 3OM8A 4KE8A 3H2JA 3G0CA 2WIDA 2QR5A 5A7FA 4G5XA 1R1DA 5LZ7A 4GDMA 4C88A 1UT6A 4Y2QA 4BDTA 5BOVA 4BBZA 3O0DA 5IVIA 5BV7A 5AKIA 3RARA 4GLBA 4KR0A 4OB7A 3WJ2A 4OUKX 5K3BA 2PUHA 5ALOA 1LLFA 5FPQA 2H1IA 3F8SA 1A7UA 2BKLA 3BF8A 3W05A 1GPKA 1UFOA 2YXPX 5ALIA 4KRYA 2GYVA 2PKYX 3O95A 1Q0ZA 4G8CA 1ODTC 4D9JA 1YSCA 4YX9A 4B84A 4U2GA 5HF9A 3WKCA 1XZHA 2WUFA 1YS1X 3OOSA 1XZBA 5CXXA 3LIPA 3K6KA 4EZIA 2ORYA 4MYDA 3H1AA 3EQ8A 1QONA 3DDUA 4E14A 1XZCA 3ZPXA 1MPXA 5FPPA 3SX4A 3G02A 3WI7A 4AXBA 3ILSA 3WA6A 4UBOA 3C6BA 3C5VA 1R3DA 2XUHA 4QLAA 1VE6A 2XQGA 4W1RA 2WHPB 3B3QA 3BXPA 4UFPA 4EA6A 4P92A 1O6GA 1GXSA 2P8SA 1TQHA 3A2LA 4K6KA 4DMHA 4HTAA 5DTJA 4BP8A 1R4ZA 2QOEA 2G4LA 1YR2A 5CH8A 1XRNA 4X3CA 1E8NA 2JGFA 4BC1A 3G0IA 2OGTA 4JNCA 2XQFA 3H0CA 3HXKA 3QBJA 2QXUA 2JGKA 2VJAA 3TJMA 2WHRA 3DKKA 2Y2VA 3DCNA 4GWLA 4EB0A 3X3HA 1YAJA 3EQ9A 5ALNA 1E89A 2ES4A 3T52A 2HU5A 2HA7A 1YA8A 4FKBA 2C4HA 5CH5A 4DIUA 1FFBA 2OCLA 4BC0A 1FFEA 3WKBA 4QDXA 5HZGA 5E4YA 4PSDA 2HA3A 2V96A 1LPOA 2VT6A 3LP5A 4I3FA 4K5QA 3PFBA 2H7XA 4MYSA 4X6UA 3CN7A 3R3XA 1RWQA 4QEKA 5IVKA 2HADA 4ZRDA 1TK3A 3I2FA 4DNPA 1JFRA 3WL6A 3EQ7A 3JWEA 4B0PA 5AM2A 3D7RA 2WIGA 3F67A 4WDRA 1N8SA 1ZD3A 2JIDA 2HRRA 5ALGA 4M0FA 1QIEA 4FLMA 3DS8A 1UK6A 4RPCA 4Y2XA 4ZXFA 3FYUB 3V1LA 2CUTA 1VJ5A 3I6YA 3W9BA 5KWIA 3FCXA 3QVMA 4G8DA 3A2MA 4HVTA 5JD4A 4N8EA 3R41A 2XDWA 2QM0A 4IQ4A 3BIXA 4MXDA 1XKLA 3VJKA 1H2XA 4TVKA 1GQSA 5CT5A 3OC0A 4OPMA 1GKKA 4C01A 3KXPA 1QO9A 4FOLA 4XIIA 3WL5A 1ZI6A 2JEYA 3IDAA 3O4HA 1FFAA 4OCZA 5AM1A 2D0DA 2ROQA 3WKDA 5AM4A 3R3VA 2PM8A 5IKXA 1XRPA 2IIVA 5AK3A 1EHYA 5J3JA 1XFDA 3STUA 4X7BA 2IX9A 1ZGCA 1MN6A 1WB6A 5ALVA 1Q84A 4EY5A 4LXGA 2IITA 5ALYA 3UUEA 4DYHA 2JGLA 2VSQA 4Q3OA 1NU6A 2HIHA 3NUZA 5K3FA 4LYEA 1CUUA 3P2MA 1R88A 3B12A 3GELA 5FKJA 1JT2A 3DNMA 5CMLA 3YASA 5JADA 4TGLA 1XQVA 1EK1A 2GBFA 4QA9A 5EI5A 3H1BA 1CUHA 1P0PA 5JAOA 3RK4A 4DM7A 3M82A 5ALRA 2GYWA 4W9RA 5AI9A 5C81A 2ZVDA 4FBMA 5AK4A 4O08A 2XUKA 5FLKA 2DQZA 2WIFA 4MQMA 5LZ4A 3DD5A 2G5TA 1JI3A 4NMWA 3G9UA 4BRZA 2BCEA 3WK6A 1JU4A 2PUJA 2UZ0A 4CCYB 4QZVA 3D2AA 2Q0XA 4UHDA 4BAZA 4G8BA 5EFZA 3G0GA 4Y2TA 3A6ZA 1LBTA 1EDBA 3HI4A 3ZLVA 5DJ5A 2CKMA 2AJCA 3O9VA 1MTZA 1W6RA 2XMBA 2XQJA 3W04A 1JJFA 3NGMA 1CUDA 1H22A 3QPAA 3HLKA 4PSCA 1ZIXA 4GHWA 3AZPA 3ICVA 4X97A 3R3YA 3FBWA 1F8UA 1R9NA 3GFFA 1FJ2A 2VJBA 1KU6A 3VVLA 5A6VA 5FOQA 3MUNA 3PF8A 1QIKA 4KRXA 2JBWA 4U2DA 2QXTA 5AICA 5AKYA 3QITA 3C8HA 1VA5A 2XMZA 5SYMA 2C7BA 4IH1A 1EXWA 2WUEA 2Z3ZA 2HA4A 3WL7A 2O2GA 1WOMA 4UBIA 4GECA 1MNQA 4RNCA 4F21A 3I2GA 2ZYIA 5EIAA 1UKAA 1XZEA 1EVQA 2OGSA 4OU4A 3LIIA 1X70A 5T4HA 2Y2UA 1QJ4A 1QIIA 3WQHA 3I2KA 1MX1A 3DEAA 4CI9A 2BAGA 4B81A 1GZ7A 1CUVA 1A88A 3AZOA 5JIBA 1HPLA 4OB6A 4LYDA 3DKRA 1CRLA 1FFDA 3LS2A 1WPRA 3OPMA 2XUJA 3QM1A 4DSAA 3E3AA 1IUNA 1EH5A 3C45A 5JANA 4WDQA 4PNZA 3D0KA 4H7JA 2DR0A 1ORVA 1DT3A 4AMZA 4J0IA 3D5EA 1A8QA 5AI6A 5JD6A 5ALMA 2WFMA 2WJ6A 2XUIA 2XMQA 5ALXA 4YPVA 3C70A 2OAGA 1T2NA 2HA2A 2ZYHA 3JW8A 4Q34A 5CRIA 5DWDA 5H3HA 1XZDA 4FNMA 3G9XA 2QS9A 3U1TA 3SK0A 3G9ZA 5KBYA 2BJHA 1L7QA 4H7FA 2EDCA 2PPLA 5ALEA 5LZ8A 4ZREA 4I19A 5CW2A 1OILA 3DJYA 3HZOA 2QUAA 1EI9A 2JGIA 1ZOIA 2D5LA 3UMJA 3IA2A 3IUMA 5AOBA 5JAHA 1G5FA 3PUIA 1ODSA 1J06A 4Y2VA 3ZV7A 2PL5A 4X6YA 4ZV7A 3I2HA 2VJDA 2LIPA 4FBLA 1T4MA 2VAXA 2PSDA 1LZKA 5HCUA 4INZA 4HRYA 2HL6A 5JATA 1Q0RA 4IH4A 1IZ7A 2Z8XA 2DSNA 3O4JA 5JASA 3I2JA 5DNWA 5LKAA 5HF8A 4MWSA 2JEZA 1XLWA 1RYYA 1XROA 3C6XA 2RAUA 2PU5A 5IVHA 3TEJA
chains in the Genus database with same CATH superfamily
3RRNA 2HLDA 3U4HA 1SRQA 2AVNA 4L57A 5DI9A 3TUIC 5FEUA 2HWWA 1E3EA 2G40A 1RW4A 2ARKA 4Y2RA 3UH1A 1HUQA 2I6FA 4PIMA 4MIEA 4F5ZA 1FP6A 3E9CA 3OPQA 3U3JA 1J70A 1XZGA 1Z06A 3K9HA 4U39A 1RJ9B 1N4AA 3VPAA 4MAFA 1NC1A 3PEEA 5CLQA 5EC8A 1NYLA 1ISHA 3SC2A 1MU0A 2ZT5A 3E61A 1HK7A 1O54A 3ICCA 4I81A 1BCSA 3QKRB 1YDEA 4K05A 3BEDA 2R8PA 3L3BA 1SCUA 3VSEA 1G18A 2PGXA 2ZUFA 2NAFA 3C3BA 3N0VA 4NZZA 4MIOA 3IVXA 1JHVA 1UAYA 2K4MA 2JAQA 3HABA 3N3BC 4PYMA 1LSOA 3GT0A 1ZH0A 5KWJA 1P7ZA 2EV9A 4CV3A 3GN2A 2YV2A 3CIOA 2I67A 3NKFA 4N5NA 2O3TA 2AJ8A 4ZOLB 3SS9X 3OZBA 3TYXA 3VU0A 3C1UA 1NBOA 3WRVA 3ZI4A 3OF5A 1HNWB 3GROA 2MYNA 3L79A 3SY8A 1K89A 4EAAA 1RYMA 2I3DA 5AKLA 1RRGA 2VDPB 3GGCA 4W9NA 4ZYXA 2VJYA 1T6XA 1UMCA 3Q4GA 4EWLA 3AEQA 3GFBA 4O0LA 5FJJA 5HRAA 5HYVA 5TGTA 4ALJA 2P3SA 4YI5A 4RL4A 5T41A 1DWUA 3W8EA 4P2BA 3O4IA 3GJSA 1P2VA 2ZIEA 2B0CA 4RMNA 3TAXA 5E7QA 5ALZA 1IOVA 2KMLA 4KHZA 3GH3A 3ONEA 4Y9UA 4DCUA 2NO6A 5CEFA 1KJWA 3IQZA 4BP1A 1RABA 5I7FA 1U0BB 2FEKA 4U6NA 1JFFB 1DKQA 2ZAGA 1GKLA 2PKXA 1MX5A 4WJZA 2GHRA 2YTZA 3T9CA 1EDOA 5HJ2A 1V6CA 2AG8A 2I62A 4NYIR 4JITA 2IY8A 4GZMA 2X15A 2REXB 2H4WA 3II6X 2VDWA 1NFFA 3IOYA 4X71A 4UCXA 3RRMA 3UA3A 1BKSB 5JY6A 1IUKA 1XJWA 4KCGA 3IQXA 3MK31 3ZXUB 1DG9A 3UOWA 1G291 4GBMA 2B1QA 3VYSB 3OZRA 1ZNZA 3QEMA 1EVEA 5JS7A 4A0HA 5F98A 4BZXA 3WWPA 4PRLA 4BLVA 4DB4A 2W6ZA 4I1VA 4JX9A 1UJ6A 7MDHA 1ENOA 2VHCA 1NZDA 4FZVA 3JQ6A 2YMLA 4AURA 2AQ8A 2GT1A 2FEAA 2D7DA 2P67A 3GAFA 1M72A 1Z6XA 2Q5FA 3CNQS 3HGQA 4XZ3A 3SJAA 3TLYA 1GSOA 4WAUA 2BDUA 3CVUA 3VU1A 1THGA 4CCWA 4MUGA 1YZGA 4KPEC 4TROA 3TLMA 5L40A 1VL6A 2CMDA 4J49A 3JWHA 1C2YA 4MI3A 4AS1A 5G1OA 3HKEA 4IDEA 3VM6A 5T8KA 4EF4A 1IG3A 2G72A 3SJZA 3H19A 4M0EA 3V55A 3G9TA 1E2GA 3LY9A 4H1UA 4OFBA 4R5MA 5GV8A 3V4RA 2IV2X 3ZHQA 2IHJA 1KY4A 2J1LA 5H9VA 1VHTA 4ZAXA 1UK8A 1NF2A 2JIZA 5E8RA 1DG3A 4NBLA 4OKNA 4S0ZA 1A77A 5IU6A 3NS7A 2HF2A 1SBYA 3W5AA 4HVAA 3KKPA 4KX5A 4FCVA 1HMPA 4JYPA 1UXKA 4ND8A 1DL5A 3EQZA 4R31A 2C5SA 2I1VB 3DVRX 1IM2A 1X15A 3DLIA 2HI0A 4HZIA 1PLJA 3TR5A 5T4EA 3KQNA 1KI8A 2WT9A 3QMWA 3AKZA 1OQAA 2BE9A 3QHQA 1BOFA 4EVSA 3UFBA 3VU8A 1UK7A 2FLVA 1P0QA 1Z6PA 4CMJA 1ISFA 5BUZA 1KK1A 1ZN2A 2ERCA 1QTRA 3ED5A 3IAFA 1QAQA 2ZSIA 4JHXA 4LCJA 1G7TA 1X92A 3GRKA 4GKKB 2ZAMA 4FM9A 2A5LA 2PKCA 4N7RA 1I6WA 4R7ZA 2YXDA 4E5DA 3TIGA 2I7VA 3N76A 4BYGA 4C08A 3CUTA 2NPOA 4FZJA 3UV3A 1OFIA 3LYUA 4P3YA 3ZDCA 1ZVMA 2H4JA 4KIJA 3OCCA 4OM8A 3EXEB 2QRJA 3ZXXA 2BSAA 4BNMA 2NPIA 4RVGA 2Q4BA 5H59A 1JTFA 4R1OA 5KMGB 3LTNC 2QBYB 1Z6QA 3DBHA 1Y8RB 5JAPA 5TLSA 4B44A 1IHDA 2QW0X 2X4IA 3PBKA 4MJ7A 3ZWWA 4EFDA 1VP3A 4B7XA 3B6EA 3QTLA 2OC9A 3B2QA 3PUHA 2O05A 2PX6A 3C98A 4TXMA 4UHBA 3O5AA 3VJLA 4DDKA 5J4LA 1USIA 4W1RA 3LXMA 3FCCA 1SFRA 3KYJB 4E21A 3D54D 3OFSA 4C7JA 2MT9A 1TQ6A 3MWLA 1QFYA 2AFHB 3KOYA 3BWDD 4ITRC 4R6WA 4N76A 2ZYRA 4FQ8A 3C0KA 3ESAA 1U5BA 2HIGA 3K1TA 5EYPB 2FQYA 4PTLA 4EF6A 1P0MA 2N9UA 2YWDA 4JI0B 1WKVA 2WF8A 1FZTA 2GRAA 1T15A 4EGCB 3TBFA 1OI2A 3IAAA 1VXRA 2GAFA 1ZXLA 2Q3EA 3QWHA 1BHSA 2LGJA 1WB4A 3ILVA 3ORSA 4KODA 2Q8NA 4WVFA 4EI7A 1F06A 2WHEA 1IM8A 5BXYA 1JLLA 2P2ZA 1B4DA 2QTZA 3MMXA 1V16B 1L7RA 3NPAA 2XB2A 1AUOA 3LWDA 3Q8XB 1A3CA 1QF7A 1PWZA 2PVCA 1NOJA 4JYAB 1V6AA 4Z9XA 2VDMB 1V8BA 3UC9A 2X40A 4JKIA 1XMSA 1SG0A 5BT9A 3IEKA 3U60B 1RM0A 1JA1A 1G21B 1Y1TA 3EMKA 4K86A 4YV2A 2OB2A 2J3QA 1BJRE 2QRZA 3SNKA 1TRHA 1XVLA 4MOWA 3DBLA 2UUOA 4HCJA 5AKHA 2BBTA 3TGLA 1PD1A 1ZI9A 4ER7A 3N8GA 1QH1B 3I34X 5BSMA 2GARA 4TMTA 3RQSA 3ER9A 1UDCA 1PQYA 2L82A 4CF6A 3G7NA 2JANA 4ZMSA 4BGIA 1TVCA 1U0JA 4RGBA 3RUFA 1H23A 3FSEA 3C5HA 5HKBA 4XARA 2B94A 2OAQ1 4PLFA 5PGMA 4EHAA 3AFNA 3IDSA 1C3EA 2PEZA 3AVPA 1DAEA 1QHYA 3JTEA 4B3IA 5HK9A 4GYYA 3WLEA 3HWSA 3F3KA 2D06A 3ONDA 4AK9A 3AR7A 4PIPA 3A05A 4PLVA 3TFQA 5AYVA 3BZBA 1URPA 1QH9A 2BV3A 4R1NA 2OCYC 4LWQA 1RBZA 2FUEA 4GOXA 1FUEA 4H7HA 1FMFA 3L6EA 3G8CA 2WJ4A 4TMXA 1FTSA 4X1YB 3SIXA 5INTA 1UEIA 3CLTD 2Z5VA 2FWNA 1MW8X 2RGBA 1MO4A 4RMIA 2OV8A 1PFKA 3JY6A 2HMTA 1PJQA 1DC7A 4A8PA 4H59A 4AY5A 2WLTA 1MJGA 2NUAB 1D9ZA 4D2IA 1Z5OA 3ZWVA 5IT5A 1JWLA 2DBZA 4LRSB 1BYUA 2BHRA 3H3FA 2ZUTA 1T3TA 3TQSA 3WLNA 4C0JA 3VMMA 3MJ4A 3EGXA 1RHKA 1RHQA 3L2OB 4F6LA 5KYTA 3VJRA 2XGGA 4LRYA 5FTWA 3LWNA 4MO2A 3TNDA 4Q1VA 1L5SA 2OORA 3R5JA 3U9LA 1Y9JA 3MT0A 4JJGA 3WADA 1BFUA 2YASA 1S2IA 1HE4A 1ARZA 1X39A 1KERA 1B0AA 2ZS7A 2HRCA 2J3JA 3I01M 3LTEA 3N87A 4G1BA 5KKAA 2REQA 2IPOA 4G6ZA 4LNUB 1P5JA 2SBTA 3JASB 4Q5IA 2BEWA 1J0CA 3SCZA 5CHEA 1NRXA 2GPNA 5HIJA 3SHWA 2WJHA 3WSWA 5HA5A 4LHSA 5TPZA 3VUEA 4EGFA 3P0RA 3MHTA 4IEEA 4PZUA 4BQQA 3FOBA 4G4IA 2I55A 5DW3A 5REQB 3K1YA 4XR4A 1Y8AA 3WSVA 2QJWA 3Q1LA 4KACA 1XZ8A 2EZ9A 5L7YA 5AQ1A 1EGQA 2B21A 2O8FA 1O5OA 4JIGA 1POXA 1N25A 1WV0A 2C2HA 4J2HA 5HGJA 3U7HB 4CTKA 1LUAA 2ZSHA 4B3FX 1IQ0A 1BCRB 4EG8A 4JV5B 1NMSA 2EJBA 4V0NA 1GJRA 3OPNA 4KH1A 4UBKA 1WW2A 4GZLA 5ED0A 5F51A 5CFNA 1ADFA 4YP6A 5HE9A 2ZT6A 4ZFNA 1EB8A 2B8JA 1CEQA 4B5LA 3RT1A 1VE3A 3HXLA 4OJQA 4NESA 2XADA 4C20A 2GPYA 3J7TA 4LJKA 4J76A 2A5GA 3PGJA 3W9SA 3STYA 3BX1A 1SVMA 3Q12A 1HL7A 4O33A 4OK6A 2LE0A 3W2TA 4CMBA 3HVRA 5JYCA 4QPZA 2QAGA 5A0FA 1EFVB 1P0IA 4IHJA 4AY2A 4HBGA 4WKBA 3I42A 1HO3A 2P91A 2Q49A 4GG1A 3IVGA 4RVCA 4DF3A 1M1YE 2VLBA 1JQ5A 1DQRA 3H3JA 2JPDA 3KOWA 2IYQA 3HHEA 5EIFA 5SYAA 1Z2NX 3FFXA 2A0FA 2CEAA 1QUFA 1LI7A 3SE0A 1W73A 4FGJA 4H7DA 2CSUA 4D99A 4DXAA 4C7OA 2QJFA 1L4FA 1R4NB 4LAFA 4JP2A 3U4QB 4ILKA 4M98A 4XSGA 4B2LA 2F62A 4HLUC 3HBJA 5TSDA 1ZGBA 4FHCA 1YZNA 2QZZA 3HTXA 2EZ8A 2ALJA 4X9XA 4I50B 3IQIX 4EJ2A 3A3YA 3HSSA 2RCYA 2X6TA 1U2PA 3P9CA 3MWEB 1OPXA 1HZZA 1ZEMA 4Q3EA 2GBLC 1KO4A 5T4BA 2WSIA 2HBZA 3CR7A 4FINA 4GVXA 4POAA 4ENVA 3DLTA 2Q1TA 3HYCA 4QWMA 2NN3C 1KH3A 2X4DA 4CODB 2ZBFA 3HBMA 4C6SA 1FXUA 2BFMA 1QSGA 1J1IA 1J99A 2X7HA 3MGCA 3VVMA 5EJ6A 1L5QA 1H8ED 5AKJA 4KYVA 3TJZA 3QE2A 3IBGA 1H8HD 1RWPA 2IPAB 3IODA 4BKQA 2OHXA 3A10A 4DBLC 2C7OA 1EFHA 3K9WA 1ZBQA 3VC7A 3ZDRA 3ANSA 2ZB4A 3LQYA 4E5NA 2FI1A 4QELA 1KF0A 1RZRA 1P2SA 5FI1B 3AWIA 2LVBA 2BSQA 3AP2A 2H5JA 2OAEA 4B9EA 4YAIA 2BN4A 4Y6PA 4FHFA 1AB5A 4YT4A 3HJTA 3QKSA 1EUYA 3VI4B 4DTCA 1QGOA 1JHRA 3JZMA 3R3HA 1A82A 5JNWA 3AP1A 1TMKA 1QFSA 1IN5A 4HN9A 4I55A 3RSQA 3I83A 2EQ5A 1SKYB 1FFGA 2BP7A 2JGMA 2Q29A 3WK9A 3U49A 1GDDA 2FEPA 4CM7A 3TLCA 3Q3EA 1FP4A 2A1UA 5BMOA 1BWSA 4F71A 1JDBB 3T0GA 1EPUA 3KT3A 1YL6A 1GZDA 2HRQA 3I8SA 3R7BA 4IQFA 9ATCA 4W1SA 3AM1A 2QZJA 1G5IA 2VXBA 1VE1A 4A82A 4RTOA 2VSFA 4MQ4A 1NXOA 3D3WA 4HEHA 3NYIA 4LZWA 4LVCA 2J9FB 4GF5A 4S1PA 1TUBB 1DWPA 2CEKA 1TTHA 5CA1F 1XA3A 3IMFA 5ICCA 4OQNA 3PFGA 4MA5A 2AMVA 3NHYA 3CPJB 3HEAA 3FGZA 3BDIA 4L9AA 1ZCZA 2A88A 5AO9A 2D00A 4WSOA 4C6HA 1EESA 3VOAA 3EZNA 1W85A 5ESWA 4V0OA 3RGGA 4CIBA 1A0OA 1LPBB 2OYSA 3RHTA 4AZTA 3F6BX 4ZDIA 1XGKA 3CPHA 3UCEA 1CJUC 4D8VA 4EY6A 4N5HX 2VTDA 3REGA 1A8HA 2JLCA 3AR8A 4QG7A 4DUZB 5DWQA 5KTPA 2I22A 5EE9A 2DTEA 4NR0A 3EDCA 5LN1A 1WM1A 3MUEA 1U9IC 2M6RA 4LZAA 1JALA 1KEPA 3DR5A 3U3KA 3M4XA 2XUDA 4FK8A 3UH0A 1EDDA 2JK0A 1NW6A 3E5NA 4R2XA 3TB6A 1L5RA 4RV5A 4QJBA 3S99A 4MVJE 2XQKA 3AVQA 5JEDA 4Q02A 2IHVA 2V7QD 3EODA 5AK5A 1GPLA 3NEJA 5H9WA 5CDFA 5CEJA 5ES3A 2WC1A 1NATA 2FNAA 5DMHA 5B6PA 3PUZA 3BOSA 4IL5A 4PTZA 4WFIA 3V00A 5E0OA 1O9HA 4QNNA 3B6JA 2ZBEA 5TMDA 3WYNA 3TZBA 3ZQUA 5AW4A 2C8VA 4CKCA 4C1NA 1MG0A 4G63A 1KI6A 1Y9ZA 4Z1OA 2Z8YA 4AX4A 4PYJA 1A8PA 2OD2A 4N1AA 5CT6A 5K8UA 5KREA 1EWYA 4J4BA 1DQZA 4M1KA 5HOEA 3D1VA 2JIMA 4KP7A 4B3XA 5BW4A 4MW9A 2IODA 1NJ1A 3CCCA 4WOBA 1XN1A 4HWGA 3FHJA 1E4EA 1UZUA 4RPLA 1MNAA 1E79A 2OCPA 4JBWA 5EE0A 2Q3MA 3ZK7A 5JLJA 1B2RA 1G3UA 3EDQA 4RLSA 5KTSA 2IXGA 2DUNA 3GJTA 5F76A 1BVRA 1KWKA 1L7BA 3RIMA 2JIOA 4UFNA 2Q4OA 4UVGA 3FB1A 5LZ9A 5G4LA 3FDIA 2NVOA 2HCJB 1E20A 1H6DA 4D8TA 4WK6A 1Z62A 2P2CA 2V8BA 4V1CB 2ENWA 3K0AB 3CNEA 2X8LA 2PK3A 5I7AA 1VCHA 2NT3A 5HFNA 3BC1A 2A9RA 1KSFX 2HDOA 3ABZA 4FYWA 2LDXA 1CZUA 2X6QA 3F5DA 3M6LA 3CNBA 5HQ3B 2EQAA 4R4JA 3OURA 3H2ZA 3KB1A 2ZWVA 1M6VB 1UBTS 4BTLA 2FZLA 3BEOA 2PJDA 4B4VA 2D0OB 1MR3F 1XNHA 1SQ0A 3O9MA 1PZXA 3RTBA 4B34A 3R7AA 4NXMB 2A0YA 3D8TA 4JQYA 4A36A 1M2OA 2JHAA 3GLTA 2J31A 4F0JA 3IKTA 2BZ1A 1GNTA 4ONEA 5ELXA 2H00A 4BWGA 1WB9A 4O8CA 5A3RA 1XTUA 3EIWA 4X20A 4G0YA 4QBIA 3EPJA 4IAOA 1JLRA 3VISA 3GLIB 1FNBA 1W9MA 5A4IS 2WJPA 4G56A 3ZVRA 2Z2JA 2Q6LA 3NO4A 4UZEA 3IPLA 5F2NA 2VJQA 1SUAA 1US8B 1Y1KE 4MW2A 4HQ0A 5JFGA 2IYFA 4F11A 1Q2UA 3RYCA 4YQZA 1YL7A 3AL2A 3JSXA 1CF4A 3RJZA 3V7FA 2FZ5A 4URYR 3UJ9A 5AKGA 3KE9A 4KFCA 4LE2A 5JBNA 5LBIA 4DGQA 2WJWA 1GFZA 2ZJYA 2ZSFA 4FZ5A 3ETJA 4WD3A 4RJTA 1DPGA 2XI4A 1IZ8A 1EG2A 1GPDG 1A2QA 3L92A 5KTYA 3KYCA 5IN5A 1X3SA 1MB0A 3DV2A 4NYMQ 1FSSA 3CB2A 1E99A 4HRVA 5C8VA 4OP1A 3OTOB 3ANYB 4GPIB 1Z16A 5LMZA 3H6HA 1ILWA 1C9MA 2RG7A 4HDMB 3QJYA 3V1MA 2DAPA 2LXNA 3WRXC 1ZD1A 4B83A 3D3NA 1QP0A 1TZBA 4G2NA 5BUQA 3TW6A 3QBVA 1FFSA 1EFTA 2H2WA 3F7TA 1ZC3A 3H9CA 1F0YA 3BUSA 4Q24A 5ARBA 4RD3A 5ITZB 1V0JA 3FTEA 3AI1A 3PUYA 1QHFA 2NIPA 4IFIA 2X3YA 3E9MA 4TMFA 2Q2VA 3BGDA 5BSKA 1LU9A 1QVRA 3TSAA 1HETA 3FOFC 3RBAA 1TUGA 2HUNA 2QMYA 1T5IA 2WD7A 4N6NA 2A9JA 2ONYA 3WYEA 4NMXB 1AKYA 1D4OA 4F3KA 3K70B 1K5DA 2AXQA 4GVLA 1U0TA 2EZTA 1GD1O 1XZFA 1K88A 5FWYA 2DEUA 3ZKWB 1Z2OX 1KMNA 1UOEA 1X7GA 2Z0MA 3PNSA 2VSNA 5BWBA 1HFJA 5KVSA 3NHZA 3QEBZ 5K3EA 1EHCA 3EWIA 4EENA 1Z4MA 1E1CA 5DRTA 2MMGA 3L6RA 1AGPA 2VNSA 1OPRA 3O03A 4YRBA 1T4CB 1T3LA 3WHKA 1H2HA 1XLUA 1RHRA 4OFZA 1PV4A 2FMHA 2PX2A 1HT0A 1QNFA 2XA9A 3U7QB 3NIWA 3WXMA 2Q0QA 5LQNA 1HE5A 3LCMA 1AGYA 1IVYA 1EGMB 2N75A 1BDHA 3R20A 4HJRA 3OHMA 1QHXA 1SHJA 2EGUA 2HREA 2VOJA 1PTJC 3BAFA 4MV6A 4BE9A 4G0ZA 4D6PA 1XNRB 5FTMA 2I2FA 4BLUA 2RB4A 3LA6A 2HT6A 1WVIA 4ZK6A 1NUQA 1O2DA 1XYGA 2ZLBA 2D62A 3K5WA 1KNXA 3GJXC 4DBVO 5CP8A 1O94C 3L40A 3ZHVA 3JQBC 5I7OA 4GOOD 1JDPA 2FW9A 2RHTA 2UYQA 1THTA 2YV1A 5BVHB 1NN1A 2VP4A 3LC7O 5C32A 4BJ1A 1J0EA 1SZJG 4NBNA 2JB9A 2A0KA 1TF5A 4UNQA 1C8BA 2IYTA 2VKTA 3WMWA 2W90A 5DK6A 1WVGA 4O8ZA 1Z0DA 4K9PA 3RC2A 3MIZA 1EP3B 2IUUA 1M1NB 2ZIZA 3ESRA 3PXBA 2ZVPX 3EMVA 1I4TD 2QN3A 1PEDA 1SOAA 4OMFG 1DDGA 1WCYA 3E53A 4BGUA 4M1EA 5JROA 3DAFA 2JJ2D 3EIQA 2JCGA 2FUG1 3O0TA 1FRZA 1Y1LA 2IHZA 2TECE 4M1OA 4BVBA 1HH4A 1CQWA 2RC6A 3KUCA 1H4VB 2VK1A 2XMDA 2O50A 3GA0A 2P9JA 4OHKA 3ADKA 4Q3BA 4BCCA 1NG1A 5IJ9B 4CXMA 1SXJE 1ZD5A 3ZCXA 1OJLA 3C8DA 3OU7A 3QPBA 4KJZA 3NAQA 3O8NA 5LYYA 2AUNA 3LKBA 1I0IA 4P83A 5E1BA 3MELA 3QUCA 2JKVA 4NAHA 4ZOAA 3EAGA 1KAOA 2XTNA 3BERA 1QCDA 2I8CA 4HDKB 3CR8A 5IUKC 1UFRA 4ECAA 4FE3A 4KVZA 3FMGA 4NG5A 3MJFA 4G86A 4KV9A 2XT9A 1RXSA 1TW3A 5DLQC 4Q3LA 1ZU5A 3ROKA 3T1NA 2GEFA 5D87A 5JNVA 2GBCA 2VWHA 3QPWA 2CXPA 3AJ8A 2Z6VA 1BRMA 4J0FA 3U9TA 1NF3A 1EX9A 2BZ0A 3L8GA 1GPMA 1PZGA 1QRSA 1YACA 2QLNA 4DNFA 2JLWA 3MQ2A 1NOIA 2Q6IA 1VA4A 1YR8A 3KV3O 2ZZKA 4KUGA 4YUXA 2P6UA 3UKJA 3QY0A 4D9KA 2AKYA 2BTOA 5AHOA 1KI9A 3EQ6A 3JYLA 1SWVA 2AN1A 3CGGA 4K81B 1OLXB 1YB7A 3ENVA 3KBOA 1DKMA 4R68A 4ZAGA 4MB2A 4DXHA 1Z2AA 3N7AA 3OQ1A 4GX5A 4JEIA 1HT3A 3F9IA 4RJLA 1Q22A 1QGED 5DN9A 2AV6A 4S24A 4ZAFA 5CT9A 3X1KA 1J2EA 3RTGA 3WK7A 4NBRA 4BFCA 4E31A 2ZRNA 3B8HA 3D8RA 4QQNA 5K09A 1BEZA 2H17A 2P9YA 3R0IA 4IIJB 3OQ6A 5KSPA 3RB8A 3WFJA 3ZWQA 4IGKA 1R0ZA 2Q5OA 3MCAA 3OESA 4V0QA 121PA 4JLUA 5JO9A 1ZGGA 3RJ5A 3ZCQA 1A9YA 4BFTA 4F7DA 1QV6A 1SVNA 3V3TA 1VMIA 2Z5GA 3QLEA 3KJHA 3AOEC 3P9NA 4QLOA 4BNJA 4PLGA 3V97A 1A7KA 1LX6A 4PLWA 4CG0A 3ZCUA 5LP1A 1HORA 1KJ9A 4JP8A 3NIFB 4QYTA 4GEKA 1L5KA 3KKMA 4FGLA 3ZBPA 1LLCA 2P1RA 3I09A 3ZN2A 3PQ8A 2GAAA 1N5DA 4LDPA 2KE5A 4I5DA 3KKNA 4MB0A 5CA1B 2YWJA 4Q18A 3QUAA 1UBLS 3C3MA 3UMGA 2CDBA 2X41A 3IEXA 1NDUA 1R5NA 5JQWA 5LKRA 1DAIA 3K9GA 5SZKB 3MYRA 1CKEA 1TM3E 3TZQA 2MMCA 1NY5A 4KC0A 1MJNA 1NBEA 2A5DA 2DFDA 1QX4A 3FR8A 2OMKA 4DW8A 1O95A 1L7AA 1LI4A 1DT5A 1V9CA 1P61B 2QM3A 1EK0A 1B15A 3H2HA 3T1QA 3KUKA 3INRA 4UHHA 1M6EX 4D9CA 4E15A 2BE7A 5HBGA 3ZCVA 4DR3B 3TUJC 1DNPA 2JCSA 2VP0A 3NX4A 4ALIA 4F4CA 1VJTA 1E0AA 4QECA 1NJ8A 2FP4A 2MSNA 3QHPA 3PQ2A 5F2KA 4F6RB 4NECA 2R8EA 5ICEA 4WZZA 3VQTA 3K8QA 1JPVA 1B43A 3WK5A 2NYVA 3TPCA 1QAMA 4TS1A 5JJ5A 4U7DA 4GBED 1NJFA 3KDSE 2A92A 4M54A 3CGWA 5CJPA 1CFJA 1HKHA 4YJGB 2YCLA 2CHGA 3AETB 4O4IB 3IKJA 1FSFA 2OPHA 5JDIA 1NXXA 4WLOA 5T4FA 3R7NA 3TR6A 1T25A 3TVYA 1NVTA 3UKDA 2VQFB 4P0QB 1GTG1 5ILGA 3MBKA 3ORYA 2C9YA 1JDJA 1WXXA 3NIBA 3NTUA 4LY6A 4IDBA 4P7JA 3IBTA 4QTTB 3R75A 1JFVA 2Q46A 1E6WA 2Z8ZA 3Q3IA 4UEOA 3SC2B 4HT3B 4Z49A 1G8KA 5F5NA 1FX0A 1BCSB 4JUFA 4M99A 4P4GA 4UUBA 4ZAVA 5AP9A 3KSAC 1IXSB 4EELA 5BVGB 2HMSA 4IHJF 3GMSA 3FCEA 4FFOA 2NU6A 5F1KA 1KYTA 4X64B 3FZEA 2WTAA 1AC5A 1XYVA 4WZAE 4JLAA 5CTAA 3O8CA 3PWZA 3JCZA 3BKXA 1E32A 1DXYA 1DEAA 2FWRA 4FLFA 4K40A 3VC2A 1JU9A 2RKOA 1V11B 1MA3A 3OO1A 3GVCA 4BGVA 4MWCA 1O87A 4CM1A 2V6JA 3ZVKA 3JRWA 2GZRA 1MJFA 4JAVC 4X00A 4MEJA 3DL7A 3IE2A 4Z0HO 4YPFA 5BNWA 3IP7A 3AEQB 4RY9A 2DFPA 5K05A 3DMHA 1NW3A 3AIOA 3VSBA 3HN6A 2IDJA 2RJOA 3OT1A 3N8NA 2CXOA 4IEIA 3FOEC 5LBTA 3O92A 2HF7A 3P1JA 3G0HA 2OXEA 1KP2A 2RMKA 5D2CA 4MV1A 3R6GA 4LFCB 4CLRA 1EQ2A 1VSQA 4J0GA 5F33A 1T4GA 1WQ1R 1ZS9A 5AI5A 4Y9SA 3NT4A 3ZGVA 3PUXA 1F0KA 2Z2XA 1P8AA 3PE4A 1E96A 1KR5A 2B98A 5I4BA 2ODPA 5HXAA 2MOKA 3PXUA 4B09A 3LX5A 2VDWB 2H18A 3HJUA 1A7AA 4E09A 4RTQA 3WA7A 3IQFA 4B2IA 1AA6A 3IJPA 2QMUA 1QM5A 4BP9A 1QIMA 1CUAA 2C1EA 1R6DA 2DF8A 3A14A 3PR1A 4MX8A 2G28A 1AQLA 2PKRA 1X13A 2G8LA 3LVFO 2A7XA 3OQJA 3IXLA 2VPTA 3PWKA 4I55F 4R51A 4WRRA 2OK7A 3BB4A 2XNDD 1JSLA 4G26A 4RF5A 4D41A 1F2TA 5ECWA 5KJ6A 3BWMA 4UVIA 3T9AA 1G7CA 3V7UA 3JR7A 3Q6NA 4ZVVA 2D0PB 4F8EA 1U7PA 3PE6A 1T8TA 5JPIA 1MPTA 5BSTA 1QOPB 4ZEWA 1Y9DA 3HBAA 4LHYA 5IJ0B 3LU1A 4U6QA 4PX9A 1HQCA 1Q12A 3IUJA 4B75A 3QX3A 3I61A 4H0FA 5DRYA 3ZHYA 1EE1A 4Y1GA 2WE7A 4ZCPA 1DADA 1Z8FA 2X1HA 1VXOA 3DE7X 4L8WB 4PLYA 1TJ4A 1HDRA 1DKNA 2AYYA 2WTXA 1I3CA 2GRJA 4BEBA 2R00A 4EO4A 4UMDA 5L8VA 1RKVA 3O8DA 3LPCA 3T5DA 1NT2A 4UARA 1W2WB 2CBZA 1UPXA 2E9SA 4JQZA 4RE6A 3HVJA 3RIYA 2H7CA 4YJKA 3OWHA 3A4TA 1PS8A 2WKSA 3UAVA 1XJCA 5C80A 2WQ6A 2FPLA 3DHVA 1RRPA 2YFHA 4S1OA 5AJXA 5ARCA 2QP4A 1QLWA 1EYZA 2GFQA 1JZQA 2FHPA 2QVZX 1F8FA 3BAZA 2AWOA 3GLQA 4MHSA 4F60A 2F1OA 3HZHA 1QIGA 3D3QA 1QG2A 1E3QA 3EBPA 4HDCA 4CL0A 5GJVC 1N6NA 4QGGA 5M5BA 5T7BA 2QRNA 3T4EA 3MOIA 1G4AE 4MAAA 4BPRA 3G5MA 4YWJA 3A6KA 2H6EA 3MAGA 1JPJA 4XVHA 5ERGB 3GLGE 3PEYA 2XCQA 3O74A 3I2YX 3S55A 3TG2A 2WV7A 4DSUA 1P5ZB 2WWWA 4C3VA 2Z08A 2HXSA 1CQPA 1KDPA 5EZYB 1QCYA 2P68A 4N7JA 4ZDJA 1AK2A 2YY6A 3ZLTA 1B6TA 2PS3A 2CJYA 3IQHX 3FSRA 3IT2A 3UN1A 1RXYA 3BHIA 4KQGA 3U1BA 3SX2A 3SSMA 5K0BA 4C29A 3QXJA 4FEYA 3PDHA 1D0IA 3TD9A 2A0XA 2OHJA 4Q9DA 1IWPB 1H5NA 4GPTA 4HWSA 1E1MA 2FN9A 2SNIE 3M0EA 3DM5A 1NUUA 2OZPA 2Q07A 3EW7A 4BMVA 1L3CA 4LWPA 4CTNA 4UTVA 4QUDA 1MEJA 1NP3A 3KOZA 2RH9B 1KEUA 4NJMA 3EFHA 4JOSA 4MP3A 3NVAA 2YJNA 5H5JA 5JS2A 2CHFA 5FUMA 2G6TA 1OLSA 4YRKA 1XRRA 4J07A 1IJFA 2F43B 4F04A 2ATEA 4HPWA 2Q1WA 1OC2A 2H4ZA 4S04A 3COSA 3WRYC 1GUDA 3H84A 4IZIA 3N05A 3ZE8A 1ZG3A 4URFA 3PVSA 3T54A 3T6KA 4BKOA 2GLXA 4P81A 4N5DA 5KOHB 4AYTA 2AHRA 4YVFA 1UUFA 1YIAA 3T0IA 2G8NA 1U5BB 3C7AA 2LNDA 3CLTC 2PJUA 1P7PA 3FDXA 1XPRA 4J0KA 1W7AA 2NG1A 3GZJA 3OEWA 1S3FA 4GR4A 4BEJA 2IYYA 3VTAA 4UBNA 4JMLA 3ZS9A 1Y8QA 1KDYA 2BPOA 1NPDA 4CDNA 3PXCX 3N1UA 3N59A 3RANA 4W1PA 4EUNA 5AM0A 1ZN9A 2W83A 2O9JA 1SC6A 4XWOA 4KXQA 5KKNB 1K06A 4MW4A 2L19A 3MWKA 4V0KA 3ILHA 1LCIA 4TUYA 2I4TA 4ZO9A 4AF7A 1GSIA 2BELA 2O8EA 5D5PA 1Z5UA 3OJXA 3D1JA 2ZRJA 1XTVA 1D4FA 4L74A 3V3KA 1J2TA 4OP2A 1DOZA 1C9KA 1TMYA 4Y2PA 2YWHA 2FRXA 3EXG2 4GRAA 2NNLD 1YHZA 4PSVA 1U3FA 3B9PA 3PCXA 1YRWA 3QLJA 4QAJA 5DNCA 1ZD4A 2Y1CA 3IDOA 3NOOA 4KLNA 1YHYA 4B7ZA 1C7JA 1T36B 1UKZA 5H3LA 1DIGA 5C1IA 2OXIA 3VSAA 4DNOA 1UWCA 1LGYA 4CMKA 3CN9A 3R8CA 2ODTX 2GZAA 2GSWA 2I4IA 3DYVA 4JLVA 1IN4A 3CVXA 1TQ8A 1W76A 4Z4EA 2QTFA 1JEOA 1L7PA 2ZBGA 4C4OA 3RYCB 3GLHE 2JGJA 4BQIA 1E3IA 2I7DA 3KVVA 3F71A 4HXGA 1CJCA 2BGRA 1MTOA 5GONA 3S2GA 3LZ6A 1VSUA 4Z53A 5TMPA 1U2DA 4BO0A 3EMDA 1PK8A 3OY2A 5KQMA 1M3SA 3DEZA 4C7VA 1VMDA 2PRIA 5LQKA 1SXIA 2IE8A 3T1HB 1L4NA 2BHLA 4MVJH 2SICE 1H9BA 2Q9AA 1SB9A 3NPMA 2QK4A 4M3NA 1XK6A 2BDTA 4QYMA 1G66A 4DDWA 3I73A 4LYAA 3MJSA 1G55A 4YMIA 3R7FA 3VPHA 4D25A 1TC1A 2NGRA 3IA7A 4YRZA 1FBTA 2PT9A 3V4OA 4DDMA 5KTKA 1P9LA 5FBZA 3SZGA 3VX4A 3UPTA 3TSZA 2IVFA 1IEVA 5LZ2A 1I10A 2Y1GA 4GEGA 4KOAA 1SCDA 2GZ3A 4KSBA 3QQPA 4W7IA 1DPFA 1JHAA 4BWYA 5TEWA 3Q98A 4FB5A 3DMTA 1PZEA 2J67A 3HU2A 3KDPA 3D6HA 3P4XA 2QUZA 4UUPA 5JFTA 2O2IA 3MCTA 4KJXA 4RHXA 5DX1A 1TXGA 1ECGA 1DAOA 1JQKA 2NQTA 4U2FA 2ZUSA 1RWOA 4D5EA 3EGXB 3RLFA 3I28A 2RI6A 3TBKA 4DCCA 2QD4A 1PJ3A 3K5PA 4QUBA 4DQLA 2L17A 3HWX1 1R0WA 3LRTA 2OLKA 4FLEA 1WSDA 3D6AA 4FILA 3IUPA 4QU9A 2NZXA 1MAWA 3FROA 4GC5A 3HG7A 5DK4A 2OGZA 1M2WA 4HMPA 1KXJA 3VHRA 4RXUA 1OD6A 1AKEA 2R8XA 4EQ6A 2CVOA 3P2EA 1L7DA 1Y48E 5GJBA 4EJFA 4ZYZA 4GGMX 2VF2A 4BCDA 4C4RA 1KK2A 1PQWA 3GRPA 5KSYA 2FFAA 2BKEA 1K7SN 5DLDA 4LOAA 1S01A 5HFAA 1JIUA 1BDBA 4D45A 3PDJA 4V1CI 5JC1A 3BDVA 2O6LA 1SU6A 4G9GA 2K6GA 3I32A 4FGUA 4FNAA 3O4VA 4OXXA 1II0A 4LG1A 2O8FB 4A3SA 3TZ6A 3EZ9A 3V8QA 1KP3A 1TA4A 3WQBA 1ZU4A 4WWHA 1G3RA 4CTOA 3X1JA 1N4DA 5I9NA 4IDAA 3AVXA 4QOFA 3AGQA 1UMBB 2C2ZA 4RTLA 3TAHA 1QYWA 2IE0A 4RQAA 2GXQA 4YAWA 4NPAA 4Q82A 2WUVA 4GPEA 1R2QA 1S4MA 1MGPA 4GM4A 1PVOA 2R1VA 1ZA1A 3IEUA 3GUHA 2VQ6A 2GK6A 5FUQA 3C85A 4YRDA 3V8EA 1YFZA 2O19A 2BFBB 4WH0A 1PWHA 4FDTA 1NUAA 3JD0A 2XXBA 3O7MA 3HVHA 1QVZA 2COKA 1LQTA 5K0SA 4IHJB 2DT8A 3GA5A 4TTSA 3RFVA 4Z0NA 2SKDA 5CM8B 4WPGA 2G1PA 3TZCA 3EF3A 2FE4A 1WLYA 4GH5A 2C2BA 1YNOA 3NOQA 5B1SA 3QIVA 4PTYA 3I12A 4KNWA 2A4KA 4RA6A 3KSUA 2V59A 4HGRA 1KQNA 2ZE8A 1JSZA 3PHBE 3U7IA 1RRMA 1A9TA 3E8MA 4A5SA 3NP7A 1AZLA 4QWWA 1G5TA 5HZHA 1BYIA 1M76A 2X23A 3PX7A 4KDEA 4Q1AA 3O2JA 4TLEA 3RV4A 5EHXA 1KS2A 3UJBA 3LYHA 4HSEA 1NYQA 3SXUA 2DETA 3RNOA 1KZ9A 2WI8A 4LF8B 5C18A 5KVCA 2PTHA 2JBAB 2Q41A 3BT7A 1S2MA 4PZ9A 3GRAA 2NZVG 3V9PA 2UXDB 2OL4A 4OLHA 2GK4A 4YMUA 1T29A 1CUWA 5AQEA 2JKZA 3PDWA 1Q95A 1PGPA 2AF3C 2HJSA 3AJRA 2XMSA 4EJ0A 1E4VA 2YCBA 3OU2A 4K6HA 4M89A 1V25A 1X74A 1X9IA 1YU6A 3PWSA 4L78A 3KTDA 4BRSA 1WZCA 5J58A 1B41A 1JQEA 4GSLA 1Y0BA 3R0XA 3WE7A 5BW8A 4Q1CA 4S0XA 4ZP1A 5K7SA 5JVDB 3JALB 5CBKA 3CM0A 1IJBA 2Z9CA 3TLBA 4QVIA 4WADA 4QUKA 1K7XB 3ZCRA 1MT3A 4HPXB 3RS2A 4MB6A 4FEAA 1FS4A 1V35A 2OBBA 2C58A 5T3YA 5EWMA 2VG8A 1GCAA 4TV8B 1D1TA 4X1KB 3ROEA 3RRFA 3JQQA 4OHVA 1ZM2A 1VHWA 5FUYA 2PKWA 3J81A 2P2SA 1EFUA 2XJ9A 3GG9A 2ZZMA 4BFYA 2BP7B 4LXHA 4R2JA 4GP6A 3SM9A 5DFAA 2BMAA 3R1IA 3L7NA 1RLOA 4AJLA 5C8XA 5KKCA 3CEHA 4RS3A 1ACMA 2R5NA 4TS9A 2BM1A 1GFIA 1D1SA 1RWMA 3DUFB 3FNRA 3GX1A 5C35A 4B4DA 2A5FA 1ESCA 5B7PA 2WOJA 3U7JA 3EHDA 2WE8A 3IIIA 3PC8C 4G1VA 1YL5A 4PHHA 1JIQA 5GPBA 4FC6A 1MQ8B 3UHPA 2CMFA 4D82A 3L0SA 4ZYUA 5LFAA 3CVWA 2ZE6A 1K92A 2HFJA 2Y8EA 1LDNA 4PXAA 1TTTA 4XWKA 1O08A 3U7EB 3LBAA 5LLTA 3B13B 3E0XA 4PBTA 1L2TA 2HTEA 2UYGA 4GYJA 3AR3A 1AMUA 2C7GA 4HVCA 4Z2YA 1X8LA 3DEKA 3BL6A 2B35A 4OD0A 1CQJA 3GO4A 2FKAA 2GWHA 2J5XA 1GIAA 1YR6A 2YWEA 3IMCA 4E5VA 3W5IA 1W85B 4U2KA 1EVZA 1LSJA 2DM6A 4ASUD 4Y3UA 1ZH8A 1C0PA 2A9OA 1Z0UA 2XZDA 1N57A 3AT1A 5B58T 3MAAC 4GZ5A 1YRBA 1W2HA 3SI7A 5LOVB 4LOHA 3LWZA 4D43A 4RGVA 4BZWA 5IKPA 2FX5A 2JJYA 3B6IA 3F97A 1GQQA 2WJVA 3O1IC 1N2BA 3UYLA 1VL1A 3QVGA 1UJ5A 4OFWA 721PA 4IVQA 2F59A 4A2WA 2VYFA 4XM2A 3BGIA 1GU1A 5B53A 2AXPA 3WOVA 2WNSA 4ML3A 2NOAA 1Z0JA 4PN7A 4BN0A 1CUIA 3A4YA 2IYPA 1R74A 3A9CA 1NW8A 1JKMA 1HLGA 2NYUA 3DPUA 4FGKA 2P0YA 1YAHA 1QYIA 3DOIA 3O3NB 4FMBB 2YJ5A 1SD1A 3D8HA 4BJ6A 5FH9A 5HW0A 3HA7A 4AB1A 1KYYA 4UEJA 1DCTA 3UIEA 1CFZA 2YFYA 5I8ZA 2SHKA 4CKCB 3IIEA 1Y7PA 1O8BA 1ZUIA 2JJ1D 5FYQA 3O4GA 3UJPA 2CLFB 1DIBA 2ECOA 3Q3VA 4JI7B 2Z9DA 2W4IA 1BMDA 3H8SA 5JHHB 2ZM6B 1B3RA 1ZEJA 4LQDA 1QYDA 3A04A 1Q91A 2CK3D 3NP9A 4KDCA 4HV4A 1B76A 4MIKA 1XEFA 1E4EB 1YJQA 1L8XA 3EIUA 2Y1DA 2I7TA 1KFBB 2AX3A 4Y2UA 5A06A 1HYQA 2O6HA 2XWQA 3KCNA 4I4CA 4J03A 1VRCA 4FFSA 4MUEA 3K15A 3V7NA 2A58A 3H2BA 2FE1A 4TLCA 5I45A 4PZLA 4E2YA 2RJ3A 3KJGA 1GZ6A 1KEVA 1XCPA 4W7SA 4DAOA 4EFMA 1FU7A 4L4UA 1WKCA 1WVMA 3ZU5A 1SCNE 1SCIA 3GCXA 4ND1A 4Q7LA 3QKTA 4KQMA 3SSAA 3T3IA 2RAVA 3D43A 1K0UA 4G0VA 1GGJA 1FFWA 3IE1A 4LWOA 4LZJA 3SWWA 3H1FA 1N6LA 2OLJA 2A1TS 4F12A 3FVTA 1BJKA 4RD1A 5JSQA 1M2EA 1WMEA 3AVYA 3F3MA 1E6CA 3LCVB 3PRKE 3Q3CA 4LTDA 3QG5A 1DQYA 3H8JA 1RQ2A 3D7KA 2ATCA 2NV0A 3AM4A 1RKUA 1NJ2A 1Z22A 4NE9A 5MFZA 1VBKA 5FI3A 4IYRA 4QSMA 1GTJ1 1MABB 1A98A 1XTZA 4BVEA 2PMCA 4X20B 4O2BA 3N28A 9LDTA 3EGOA 2Q3JA 4F6CA 2GPSA 5F7XA 3RD5A 4LV5B 1R1DA 1OZGA 4MUIA 4KK4A 4C30A 3K9CA 1M1YA 4O4HA 4MV4A 1FLAA 4I4NA 1LJLA 5GM1A 4DG5A 2EJUA 5BOVA 1AHHA 4REQB 2PGNA 4JJIA 1DBIA 4E5MA 1T9BA 4M9XA 2YWBA 4U4AA 3VPFA 4CL2A 1KL7A 2ZB2A 3TL3A 3G7SA 1AKUA 3C7TA 1Z9BA 3W4KA 1TO6A 1E9DA 2ZI7A 3OCWA 4LE1A 3WJ2A 3T4XA 5FTKA 2PUHA 2QPTA 3IKMB 2ZIXA 1CERA 3H5AA 2CVZA 4PHFA 5HDQA 4AG6A 1Q1QA 1B73A 3HKCA 1QH8A 1A7UA 1I13A 3BF8A 4E4RA 3KL4A 1Z5PA 2EP7A 2XVAA 3IAXA 5F5XA 2YUTA 2YXPX 3L4BA 2XGSA 2I66A 1JXQA 4UC0A 1JIXA 1GL6A 1JQDA 4AY4A 4KRYA 5JCZA 2GYVA 4RKQA 4YO7A 4C7KA 3DP7A 5FA8A 4BY9E 2KHZA 4XUEA 1UEJA 2PKYX 4H60A 1K2VN 3C5CA 1Q0ZA 4F86A 4GO1A 4D9JA 1Z0SA 2LIVA 5JH7B 2FH5B 4UUOA 1U28A 3ACBA 2QM7A 4RZ3A 2EATA 4Y30A 3OJ0A 3W3AH 5ENVA 4JDUA 3ZYCA 4B84A 5IXSA 4I9HA 4U2GA 2AI2A 4MVWA 4Q4AA 3S27A 1PBTA 5CAEA 3FYHA 1E1CB 2IPXA 4IOJA 3VDQA 2E4XA 4D4MA 1TU3A 1TX4B 2IDKA 2WKPA 4QNRA 3TLAA 4NU8X 1YXMA 1P75A 2P69A 1IZYA 2FN8A 5KJFA 1XT6A 1EWQA 4L5BA 4EW6A 5CXXA 3A9WA 4WLUA 2BMEA 3LLSA 2IZOA 4EZIA 1MEOA 1PE0A 2HK6A 1F51E 1GGKA 2Q7DA 4NZYA 4LN1A 4RKRA 4X84A 3TI7A 1ZL2A 1Z63A 3JQAD 2XTAA 1GTZA 2P78A 1HDXA 2QAIA 3GCDA 1FDRA 3ASZA 3IILA 1A97A 3EPLA 4XD7D 1USGA 2G3YA 3A0UA 3ZWXA 5IUJC 3BTOA 1A7JA 4G67A 1NKSA 4EF5A 1D5CA 3UXMA 4DQUA 1U7HA 4AXBA 4G23A 3T1YB 2IWHA 2OXCA 1H5UA 4P84A 2XA1A 3OOHA 3LOQA 4UBOA 1I36A 2QZSA 5HUHA 1QLJA 2TMDA 3C6BA 1KI2A 1PR3A 4GQAA 5CNKA 2XZPA 3RF7A 3OFNA 2XUHA 4FJ2A 1GL7A 2QYTA 4I1UA 4TZ0A 2YHAA 4GPBA 2MSWA 4PLZA 1D7OA 1VE6A 4OMCA 3I9V1 4EATA 1DUSA 4UFPA 4JVSB 3AF0A 4Y6LA 4P4SA 1ZR4A 4JD5A 2FEXA 4J90A 3RKUA 2N1BA 1O6GA 1GXSA 3LBNA 1NW5A 4O2AF 4FNOA 4XOUA 3DO8A 1G4UR 2Z30A 4K6KA 3OM0A 1UM8A 1KNQA 4JBNA 5TR9A 2OK8A 3VGPA 1QGDA 4MVJA 4TUYF 5DVZA 4UUNA 5FPHA 3AK4A 1WTCA 3UB3A 3O38A 1NI3A 1UBRS 1XRNA 4OLJA 5F52A 5JCJD 1JE0A 1THZA 3QU4A 3GUVA 4B2PA 5JRJA 4D4GA 2VF8A 1KHTA 3RTEA 1VMKA 4TXLA 3H87A 3R3SA 1PWYE 1U4OA 3H83A 3QBJA 3WYGA 4DCNA 4B4OA 4L4RA 3R8XA 4GRDA 3W79A 1VB5A 3O2NA 4H16A 4XM0A 2R4TA 3RVRA 3SYNA 4S05A 4G5YA 1XMVA 5AFSA 2VJAA 1HKUA 2WHRA 4BMZA 1LX7A 4Y9TA 3ZH9B 3HB1A 2AC7A 1ZSNA 2F1RA 4F4FA 4KQJA 1DDOA 1T9GS 1XZNA 3MMNA 5BY2A 3AUYA 3T7KA 5E3HA 2HMAA 1U80A 4WBSA 3F78A 2DZDA 2YVKA 5GONF 3CLUD 2C9ZA 3G2NA 4QRHA 3K2EA 1RBMA 4GL2A 1O03A 3HU5A 3PCTA 4NCIA 3ESQA 3R6DA 4DIUA 1FFBA 2OCLA 3FGNA 5CJJA 4ZI7A 3ZTYA 1YMQA 3I5YA 1FFEA 5PNTA 1EVIA 3HUDA 1OWMA 1WEKA 4LZLA 4IV0A 5F1YA 3MCWA 3BGWA 1KVQA 5IYZA 5HZGA 4QARA 1BHO1 3E0QA 3E23A 3JQGB 1NASA 4PSDA 2H2IA 4YJDA 2RHMA 3UWDA 3NHKA 4LCEA 4ATNA 4Z99A 1IB0A 3NBZC 4MQEB 4E1AA 1AV6A 5SY9A 4PLCA 1AS2A 2P62A 3ON5A 3H5NA 3P96A 1MC8A 3PFBA 5JXJA 1SVOA 2H7XA 4BEWA 4MYSA 1Z73A 3ZKAA 4J1QA 4X6UA 2YHUA 3GJRA 4Y98A 1NI4A 2YN2A 3T3DA 3DYBA 4AS3A 4EPYA 2V3CC 1KAHA 2V9CA 2ZRDA 1C0IA 5AVKA 4G0WA 4N18A 1TK3A 2VHUA 1YA6A 3Q7QA 3WL6A 4M7RA 4QNMA 2XB9A 3EIEA 3L77A 1P19A 5B3JA 1QC5A 2YOFA 4AJIA 3VYWA 4WDRA 4R16A 5CNIA 4B8YA 2P3QA 1DO8A 1JDTA 4PONA 5KYYA 2X86A 3KEQA 1ADGA 2UU9B 4FYHA 3OZCA 4TKUB 1CJMA 1EKXA 1RADA 1ZINA 1ZD3A 1V1JA 2QR3A 3UQZA 3HP4A 4XIGS 1EXNA 3HCCA 2HRRA 3EZLA 3HKBA 2CFRA 2EGGA 2R1ZA 4GXQA 5C3UA 3HU3A 3U3DA 4WBNB 5IVPA 5LLDA 4CQMA 1KOGA 2YRWA 3H65A 3HYTA 3KQHA 2IGTA 4QC2A 3NYRA 1YE3A 1QGUB 2RSLA 1SVSA 4FLMA 5CDGA 2FP4B 5CFOA 5KWVA 2HRDA 1E3LA 2IOQA 1UK6A 3PX2A 3ZU6A 4Y2XA 4JQCA 3N3AC 4ZXFA 1ST3A 1FVXA 3LVBA 4WQMA 3FYUB 2LW7A 1ZM3A 4L51A 2CUTA 4ZVLA 5IP5A 1C8KA 1VJ5A 2QN8A 3W9BA 3X2SA 1FLVA 5KWIA 1BVHA 2ZANA 1PWXA 3QFRA 2BWJA 3P20A 2C5HA 1ID1A 3KB2A 5F21A 4PIVA 5I3CA 4CEIB 3QVWA 3K0CC 1M2GA 4HVTA 4RWEA 1HQKA 2UUCB 1WU7A 2HO4A 4KNVA 1COZA 1VIAA 4B48A 1S2OA 5EERA 3QE0A 3NHBA 3CPSA 1RQLA 4KQWA 1A9SA 3SYRA 1FX0B 3CW8X 2O3QA 2FPRA 5IK2D 1YJAA 3OLVA 1NM5A 3C8UA 5LL6P 1QFZA 4OMUA 1M73E 4KFSA 2VDUE 3ONNA 4YRCA 3FNGA 3VPDA 3KXPA 1QO9A 5HEKA 4ND6A 3ZCSA 5KSWB 2B6NA 1FVHA 1QRAA 1U2ZA 1W30A 1SU4A 1ZI6A 3N2KB 4K87A 5LA6B 3GNLA 4WV3A 1NVFA 2AT1A 3GFGA 3OLQA 4NFLA 4RMHA 1MB2A 2G77B 1SULA 4B7UA 2Z57A 3S6JA 4BO9A 4E7OA 4G1EB 4E4TA 2ROQA 3NUGA 3S8MA 2H1CA 3WKDA 2PX3A 5AM4A 3C3EA 1FTWA 1QVVA 4P82A 1TAUA 1RXUA 2DHQA 1XRPA 2QP3A 3U26A 3G2HA 4W5QA 3ZEIA 3EA0A 2UUAB 4LF6B 2BEUA 3NLLA 2QG9A 3WGVA 1O96B 3P4UA 1ATIA 2ZP1A 1NF9A 4GMGA 4C7BA 3SZRA 1H2BA 3V5NA 3IXQA 3SHFA 3H9BA 2X8WA 1BVUA 2XUZA 3D4BA 2B92A 1SRRA 1DC3A 1VSBA 1ETUA 2ZRKA 5JYBA 5EWLA 2D2EA 1FYFA 1Q84A 4R84A 1O6BA 3NGXA 1SR8A 1W0KD 1BXZA 1H1LA 2QTVA 2BGWA 3DQQA 3PKIA 4EY3A 3UK2A 3A58B 5HVNA 1C9DB 3HM2A 3KJIA 1WV1A 4JELA 3UUEA 4EI9A 3G5AA 3S7TA 1Z7YA 2Z56A 4DYHA 2FK7A 4BQNA 2JIRA 4Q3OA 2HOQA 1S5PA 2PS1A 3KJZA 3JYPA 3T0FA 1HLPA 2HIHA 3NUZA 3LO5A 1M2KA 4KN6A 4RZXA 1Z0AA 1C50A 1FJGB 1HI9A 2IT1A 3EXHA 2EVWX 2R4QA 5IM4A 5FKJA 3DNMA 1SXJA 5CMLA 3ZWDA 1OXSC 1SZDA 3QKUA 1NXTA 3E3OA 3RFTA 1YZ3A 2MCFA 1XQVA 5IZCC 4R41A 4DAEA 3MILA 3IH5A 3PJEA 5ICGA 2RDMA 5KI6A 4C78A 4CF5A 1QZZA 2AH5A 2C77A 2GBFA 1ZHHA 1MENA 1B8OA 1M8PA 2CJXA 2AW5A 2I7XA 2MINA 3AI2A 4JB0A 4O6VA 2HY7A 2CVFA 4YIKA 4LXXA 2JLXA 2ZJ8A 2Q6KA 2FSFA 5F7ZA 5BRNA 2FN3A 3KWLA 1KJIA 1GUYA 4J7XA 3O21A 2ZETA 1WSWA 4OA5A 1P0PA 1T8RA 1FRNA 5IWAB 2HSWA 4OQEA 1G6OA 2FPWA 5AI9A 3AHIA 1HYGA 1MH9A 4FFLA 3A9SA 2A0WA 3C8ZA 4KYIB 4XQCA 4ZAWA 2YZMA 4O08A 4X1IB 4B3GA 3MAJA 4K28A 3MWGA 1ZMBA 5DT9A 4Z9YA 4H3SA 2DYKA 1M0EA 4AX8A 5K6AC 4WL0A 4JKOA 1VJ0A 4DLPA 5EMHA 3MPUA 4K9OA 1GV1A 3ZBUA 5F9MA 3WFIA 1VKRA 2BCEA 2OOKA 4FN5A 2PBFA 3WK6A 1NUSA 1BQ4A 4GQIA 4KWCA 4DSTA 3N8DA 1NUPA 4MA4A 3MLBA 3LQ4A 5E2BA 1TU0A 1JZSA 3JYOA 4A6PA 4QZVA 3C41J 2Q0XA 4NCJA 4UHDA 3RK1A 1NR7A 3O1HB 2HCRA 4E1VA 1I7DA 3CS3A 4LSMA 4Q4HB 3Q8MA 3E1KA 3G0GA 1G21E 4PM4A 1XEXB 5D5QA 5HNKA 3A6ZA 2X8JA 1C1HA 2P11A 4JCOA 2CLSA 3GK3A 3K1AB 1VPVA 4RK6A 4GKVA 3H05A 4YREA 5LR6A 1X9GA 3HDYA 4UEKA 2AJCA 4B32A 1CC1S 2QTCA 4HFRA 2F3QA 2O20A 4H3VA 2XMBA 2X77A 5HJEA 2OD9A 1PQUA 2O0LA 4MI9A 5E4FA 3ZJYA 4NENA 1QPBA 2V0GA 4UQOA 4WE3A 3U7RA 5EIXA 4F84A 2HRZA 3KR1A 3HLKA 4GMFA 1JNYA 5EKSA 2OT3B 5KYUA 3U0BA 4ERNA 1ZDMA 1ZIXA 5J5VA 1KORA 4JLOA 5HUQA 4IRXA 4DILA 2G67A 1RBQA 3R3YA 2CSXA 1Y42X 2QJOA 10MHA 1JEAA 3C3KA 1MOPA 1L5GB 5BP7A 1T2VA 1WIWA 3LSTA 5SY6A 3C48A 4NU0A 4LKRA 1Q0UA 4DY6A 3S4YA 4KH0A 3P2YA 4KG7A 2R2GA 4NNJA 4QBFA 5KU7A 5LDHA 3OX3A 4QYXA 2WF5A 1OBOA 5K8VA 3S3TA 1QIKA 3WP1B 2FQXA 4O2AB 3MG9A 3E7PA 1M75A 1WZNA 3DC2A 3JAKA 3OE1A 2QXTA 4H4EA 4QGHA 4PAQA 4ZOBA 1UBHS 2DWOA 2OPBA 1GQ2A 2O4CA 4I6EA 4X7RA 4GP7A 2QL7A 3TEFA 5HKKA 3K6SB 4TUYB 3NTVA 1K66A 2H0AA 1GCGA 2O0KA 5DNEA 3HH8A 3Q6MA 2O8EB 1P29A 3V4FA 5EUMA 1TK2A 3T9DA 3IEMA 3RV3A 4Q0MA 1YUBA 2JDID 1XTIA 3BSWA 3OTHA 3U5TA 2PJRA 1NBWB 3QFSA 5D6NA 1DJMA 1WOMA 3I9OA 3MTQA 3AI3A 3FRJA 2EX1A 1IWOA 3MSCA 4I4TB 4I9UA 4R98A 4RFVA 4XYGA 3WLJA 3LF1A 4E5PA 2ZYIA 5EIAA 5L7TA 2OHGA 1UKAA 4O2BF 3U17A 3AUXA 1NL3A 5BPFA 4I5IA 1EVQA 2OGSA 2R8ZA 2TS1A 2PLWA 2FR0A 2YXNA 2QGFA 3A9RA 3F5SA 3GJ6A 3LIIA 4G2TA 4YJFB 5H83A 4KR2A 4CV2A 5DTQA 4BNUA 3SD7A 1W47A 2FLWA 4WZAA 3BWYA 4O4HF 5FFFA 3WL3A 4ZCIA 3G1TA 5EPEA 4X8OA 4BMPB 3GT3A 3KZNA 5JMWA 5L53A 6REQA 4LJRA 2ORVA 3SQDA 1B74A 2AC4A 4JCCA 4B3CA 3O4FA 1K8XB 2WSSA 4QRIA 4Q7KA 2DMRA 3LLUA 5G0SA 4WXYB 5BSRA 2ZVJA 4XAQA 4YB8A 4U7WA 4LF9B 1OX4B 1XHEA 3ER6A 1AZTA 4ZCTA 1FBNA 1OTHA 3QV2A 1Z7EA 4QASA 2QMEA 1DJPA 1JIVA 2YDXA 4I8DA 4DUGA 4DREA 3IKVA 4JSYA 2VYNA 1XHLA 3DHNA 3GPIA 3GDGA 4CM3A 2AEEA 3DKRA 4F91B 3PNMA 2GA8A 2HEGA 1B0UA 1B0PA 1KFCB 2I3GA 3FBTA 3ZOKA 3T5TA 1D2NA 1SUIA 2XX3A 1WPRA 3KB8A 1A9ZA 3OD1A 4LTNA 5DDIP 2QU7A 5EIOA 4NDNE 2GM5A 2H9IA 3PNQA 5DX0A 1W36D 1JV2B 2BKXA 2ORED 1PZMA 2FF5A 1AD2A 4RVDA 3C45A 2GD2A 3FPHA 4JLDA 4QFMA 3WFZA 4C6TA 2W2OA 4NYIQ 4EDHA 1ZHOA 221PA 3SDZA 2IBMA 3BQMB 1C1DA 3RSOA 4YLYA 5HR5A 2R0QC 1ES9A 2RGGA 1T9HA 2GFIA 4PE5B 3DCIA 3HJCA 2QX7A 3JVUA 5DHUA 4CT5A 2CXSA 4AMZA 4J0IA 3VZPA 4KKXB 5AT1A 3L7JA 3ZYZA 3EGDA 5ALMA 2QI9F 1ABEA 5COQA 3KT8A 5F3WB 3OIVA 5DH9A 3RLIA 1V5EA 4BIIA 2LWIA 3P2IA 2QHXA 1L5ZA 2OAGA 1WBDA 1T2NA 2HA2A 1HMYA 5EE5B 5ABPA 1GKUB 1I9GA 3NHRA 1CS0A 1UBKS 1BKDR 3WG9A 5CD1A 4QPDA 5TF4A 3TE6A 1P2DA 2ZYHA 3A36A 4QOHA 3JW8A 3SYTA 2AN3A 3MS4A 4C21A 1QOQB 2QY9A 4OUDB 4P98A 2HCBA 4IHKA 1S89A 2VUIB 2EFEB 5FHQA 4WNCA 2D5BA 2DJIA 2XOKD 3NTXA 3E8XA 4HDSA 4XFKA 2XYVA 1FEZA 1USKA 4DN6A 4DUGD 2FPGA 3IOCA 3JTMA 4PS1A 1L8AA 2L2QA 3LUCA 4H7FA 4PZPA 5HRUA 2WJJA 2EDCA 4L2IA 3ZDDA 1T13A 2Q0HA 3EJWA 4ZREA 3FJOA 5JZMA 3UENA 4J16C 2R1VB 3CJTA 5ELLA 4V3CA 1OILA 2EP8A 4HNAB 5IT9A 1C9EA 4IOMA 4FZ3A 3BXOA 4JJAA 3VA7A 4CIVA 4Z9AA 1MEEA 5JDCC 4EMUA 2IIQA 2W6IA 2WMNB 3MBOA 3WP0A 1CSEE 1TLFA 3BCUA 2PNJA 5JPCA 2D8AA 2WZQA 1DO0A 1I30A 2VJNA 1SKYE 1VG9B 2YC4C 1G5FA 1SVIA 5AOBA 4YQEA 4BO4A 1ODSA 4OJNA 1DEXA 4F9EA 4Y2VA 3M33A 3QE9Y 2VEDA 4CGZA 3ACDA 1DKUA 4PC6A 4IOKA 1GL9B 4RDIA 4DARA 1E2UA 3BXEA 4RTMA 1GAQA 4MVJF 3GLGA 5DHTA 4YUAA 5AJYA 4YT8A 3CV3A 5IDVA 3RUAA 4YAEA 1C81A 2LIPA 2JFPA 4HWTA 2Y0CA 1T4MA 4BU0A 4CE6A 2JFZA 4X62B 1VPDA 2F55A 3MMSA 1HT2E 5L7WA 2D0IA 2ECQA 2Y76A 4BN5A 4C07A 3ZV3A 1GEGA 3NV9A 2PQ0A 4INZA 4J1NA 3Q5GA 3G59A 5TE9A 3SQLA 4ZQHA 1XTBA 5J47A 2WBLC 3SXUB 3TS1A 2WF7A 4WCDA 2IL1A 5B6IA 4OXIA 2ZI4A 3EISA 1YQWA 4ENSA 3L6CA 5CFPA 2Z8XA 2W43A 3DE6X 2DSNA 5DXJA 1F7UA 3SHTA 4CMIA 5KDDA 3F6PA 2ZG6A 4Z2AA 2GN6A 5JASA 4RD6A 7MHTA 4RJJA 5LKAA 1IL0A