1UK9A

Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with isovalerate
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
271
structure length
271
Chain Sequence
b'NLEIGKSILAAGVLTNYHDVGEGQPVILIHGSGPGVSAYANWRLTIPALSKFYRVIAPDMVGFGFTDRPENYNYSKDSWVDHIIGIMDALEIEKAHIVGNAFGGGLAIATALRYSERVDRMVLMGAAGTRFDVTEGLNAVWGYTPSIENMRNLLDIFAYDRSLVTDELARLRYEASIQPGFQESFSSMFPEPRQRWIDALASSDEDIKTLPNETLIIHGREDQVVPLSSSLRLGELIDRAQLHVFGRCGHWTQIEQTDRFNRLVVEFFNEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-hydroxy-6-oxo-7-methylocta-2,4-dienoate hydrolase
publication title A Series of Crystal Structures of a meta-Cleavage Product Hydrolase from Pseudomonas fluorescens IP01 (CumD) Complexed with Various Cleavage Products
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Hydrolase
total genus 99
structure length 271
sequence length 271
ec nomenclature ec 3.7.1.9: 2-hydroxymuconate-6-semialdehyde hydrolase.
pdb deposition date 2003-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1uk9A00
5AKZA 2DQYA 1DX4A 5BWBA 2V98A 1VE6A 3FCYA 1UKCA 3BWXA 2B4KA 1Y37A 3IB3A 4H7DA 3FLBA 3O9VA 5JARA 4DLNA 4C4XA 2QKYA 1XRLA 3I2IA 5AKJA 4WY8A 5DWDA 3AIOA 1VE7A 3N0TA 5JADA 4DIUA 2PM8A 3AIMA 2H9YA 5JAPA 2PUHA 5IVDA 3R3UA 1LBTA 4L3WA 1YAHA 5YASA 2OCGA 1UFOA 1BU8A 4Y2VA 2XMQA 1BCRA 5K5EA 2HA5A 4MJ3A 3WA6A 1N1MA 1QIJA 4U2CA 5T4BA 2WUGA 4B0PA 3FYUB 3IUQA 4FFWA 2D0DA 4K6GA 1QO9A 3V1NA 3WWCA 3STTA 1E8MA 2QXUA 2WG0A 4Q3KA 1O6GA 5FRDA 4GWLA 5ALPA 3W06A 2RHWA 2WIKA 3C43A 1CIJA 4CG1A 1CFJA 3VJMA 1FJ2A 3F96A 3IUMA 1XZHA 3C8HA 1JJFA 2XMSA 1WOMA 4JEIA 5HQ3B 3VISA 5EHZA 4K6KA 3CCBA 1W1IA 3V1LA 2WHPB 1B41A 4UHHA 2HA0A 4AMYA 3FBWA 2RGUA 5ALLA 1E8NA 1R88A 3C45A 4OB7A 2Z8XA 5LLSA 4MXDA 1RYYA 3CN7A 3R3WA 2WIDA 4UBMA 1MN6A 4CG2A 1AKNA 3M81A 3WL6A 4BATA 4S0XA 4Q34A 2JIDA 4OYLA 1JKMA 1E5TA 2WSLA 4X92A 2OCKA 4V2IA 5ALWA 1UOPA 4B82A 4K6HA 2G5TA 1MT3A 1UKBA 4MQLA 4K2AA 4EZIA 1YS1X 3WWOA 4GLBA 3HSSA 1DWPA 5IKXA 3QMWA 1ISPA 2IITA 5AK4A 2AJ8A 4OUKX 1EDEA 3VVLA 3S2ZA 1B6GA 3D4LA 4GHWA 3NWOA 5AICA 1W52X 4L0CA 5JZ9A 1XZCA 4KAJA 3O9MA 4KJXA 1MPXA 3HXKA 2RI6A 3BJMA 4FNGA 1WM1A 4Q82A 5JAUA 5I8PA 1LBSA 2AXEA 1DWQA 1LLFA 1J1IA 3BIWA 3O4HA 6YASA 2GBFA 4W1SA 4DYHA 1TCAA 3UUFA 2PSFA 3FLAA 2CB9A 2RONA 1U8EA 1XZFA 5CBKA 4E11A 3DQZA 3T52A 3W9BA 4ZWNA 4LIPD 3AZPA 1KU0A 1WHTA 5ALRA 1CUAA 5CRIA 3DL7A 5ALIA 1CUDA 1CUCA 1HBJA 4Y2YA 4ZI5A 4H7EA 1BEEA 3ESCA 2DHEA 4DGQA 5EIEA 2XUGA 4PSUA 4FLFA 3LIIA 1HQDA 4I3FA 4HTAA 4WDQA 4W1QA 5HFNA 2EDCA 2WFLB 4BVKA 2XUKA 3VDXA 2VJDA 2ZYRA 2WG1A 2E3JA 2XUDA 2HIHA 3WKDA 1DINA 2ONCA 1XQWA 3X3HA 1W6RA 3R0VA 4ITVA 3G7NA 5IH7A 4BP9A 2WILA 3K2IA 1EB8A 4YK7A 4J0GA 2HM7A 3G0DA 3WK6A 3QZUA 3DYVA 3VKFA 3DEAA 4NMWA 5ALFA 1DX6A 4EBBA 4WDRA 1QGED 4XJVA 2IX9A 3QPCA 1XRMA 2ZJ6A 3I28A 1MNQA 4Q05A 4PO3X 3AILA 5AI9A 1QIIA 4TPKA 2B20A 5C8VA 4X85A 1W75A 3G0GA 4U2BA 4ZGBA 4ZXFA 2PL5A 3I6ZA 3O4GA 4ARBA 1IZ7A 1GKLA 1VKHA 4FLEA 1ZD5A 3HRHA 4OB8A 2XMCA 5AK3A 4CCYA 1CVLA 3VJKA 4A16A 3PE6A 3DS8A 2XQFA 4IH9A 3CXUA 2HFJA 1BE0A 4QLOA 4GECA 5CXUA 5HFAA 3ILSA 4NZZA 5D7BA 3D59A 1QOZA 3O95A 1GPLA 2BGNA 5AKIA 3HI4A 3C8DA 2WHRA 3LS2A 3O4IA 4FNMA 3GELA 1QFSA 4BAUA 3S8YA 5JAOA 1ZD4A 1QIMA 3IUJA 3C70A 1CUXA 1YSCA 1H22A 1MTZA 4X6YA 1P0QA 3QITA 5FKJA 3F67A 3GBSA 3VJLA 4BE9A 4HZGA 3R41A 4FKBA 5CT8A 5ALTA 4H7KA 1DTEA 3G9XA 5AKLA 2XMRA 1IMJA 3G02A 1NU8A 2VT7A 1UWCA 1XZMA 4FOLA 1UKAA 3WK9A 1SCQA 2DFPA 1TK3A 3G9ZA 2Y1KA 4QE3A 5C8XA 1ZICA 3OPMA 3R3YA 1IVYA 2JGEA 4JUIA 3WYDA 5LZ4A 2V9ZA 2C0PA 4J0JA 3FYUA 1LZKA 2OQIA 2PSDA 4X6UA 5CT4A 4PV7A 1ZIYA 1R3DA 1H2YA 3EF3A 3MUOA 1H2ZA 1IUPA 1EHYA 4XVCA 2HA7A 1DU4A 1F8UA 4C6HA 1DT3A 5CXXA 3R40A 4B9EA 1EVEA 5HQ3A 3E1GA 4BC0A 3O0DA 4J3JA 1MJ5A 5EGNA 2WHPA 1Q0ZA 3PF9A 5AJHA 2OQVA 4P93A 2PX6A 3AJAA 3G9UA 3STUA 3WK8A 4UFNA 4Z49A 1FFCA 3C6YA 2HA3A 5LKAA 5H3HA 1XFDA 1ORVA 3KWFA 1DQZA 4AZ0A 4BVJA 4HVTA 4W1RA 3V9AA 5ALMA 3WWPA 2WHQA 3WKBA 3AFIA 5EHQA 1ZJ5A 2XQGA 5AIAA 4RPCA 4PNZA 5SYNA 2QM0A 1K5PA 3H19A 1BROA 3I6MA 4HS9A 2VQ6A 3Q8WA 4AO6A 2CBGA 4ROTA 1GQSA 3OTQA 3ICVA 5I9IA 3W04A 1MAHA 3KD2A 1TQHA 1DT5A 1ZJ4A 4I4CA 3PUHA 2BGRA 2HU8A 4W1PA 2XI4A 3L1IA 1ETHA 2QUBA 2XUQA 2G5PA 4KACA 3VVMA 1CUGA 1XZKA 4U2EA 4IHAA 5AI6A 2QOEA 3I2HA 4I19A 4H0CA 5JIBA 1ACLA 4J7AA 1CUZA 1JT2A 5CH5A 3GZJA 1KU6A 2XMDA 1UZAA 3PFCA 3H17A 2XMGA 4CIBA 4BBZA 3OG9A 4KAFA 4G1FA 5LZ2A 5CT9A 5AKEA 2QMQA 2H7CA 5AH0A 4G4IA 4KRXA 4BP8A 1XZIA 4QDZA 3WLAA 4DNFA 5JATA 1CUYA 1ODTC 2DR0A 4G5XA 1ZI8A 2FJPA 2J3QA 4PQEA 2NW6A 1G4HA 5ALSA 1L7RA 2XUFA 2XUIA 3EIOA 4BDTA 5AOAA 5T4FA 3U0VA 4BZWA 4HXEB 2X8BA 3SC2A 3WYNA 1VA5A 2K2QB 2GZRA 1BEZA 3C6ZA 5AI5A 1EVQA 3NOXA 2Z8ZA 1WPXA 3QPDA 4B7ZA 3G8YA 3H1AA 2PVSA 2PBLA 5JD4A 3D0KA 3C5WP 2YH2A 5DLPA 5A7FA 3R3VA 2WFLA 2RHTA 3ICWA 3TJMA 2VJAA 4B81A 1H2WA 3KWJA 2VTVA 1A7UA 3D2CA 2HFKA 5LIPA 3EQ9A 3K9BA 4WFIA 2FUKA 1XQYA 3RLIA 2B61A 5FXMA 4HRXA 4X95A 1HL7A 3C6BA 1EXWA 2VJBA 5LKRA 1W76A 4LXIA 1XZLA 3AZQA 1EH5A 2DHDA 1VXOA 4RNCA 4WFJA 4U2GA 1ZD2P 1VOTA 2BUCA 3E3AA 2GBIA 5ALGA 1SCKA 3KOOA 4X93A 4OU5A 5FLKA 4UFPA 4D9JA 3R3ZA 4BZZA 1J06A 1JFRA 4FWBA 1LPAB 5EI5A 5EHNA 2R11A 2GBGA 1CUVA 2C4HA 4ARAA 1E8DA 3VXKA 4X3CA 2WIJA 2GBCA 1XZAA 1D07A 1JU3A 4BC1A 3ZLUA 1FFDA 3STXA 1AC5A 3KSRA 4KE7A 1AX9A 1BRTA 1EB9A 4AZ3A 4NVRA 3WJ1A 5A6VA 3FVTA 1GZ7A 4UBIA 5CT6A 2JGLA 4B80A 4P08A 2YASA 1IUOA 4JNCA 4Y2JA 4W63A 5HF9A 1G66A 4AB1A 5DNWA 4ZRDA 3EBLA 3WWEA 5DJ5A 1CUJA 4QWWA 5CTAA 3IA2A 1AZWA 3ZLVA 3QPAA 2OLEA 4QDUA 1PV1A 2GZSA 3OURA 4RE6A 1XZGA 4X91A 5DTIA 4X6XA 3WL8A 1O6FA 1CQWA 1JMKC 1AURA 3FCXA 2ACEA 3QMVA 3SX4A 5D6OA 3QH4A 4FHZA 1LPNA 2XLBA 3WA7A 4X71A 2WIFA 1SCIA 4EHBA 5AM1A 1CUBA 5AM4A 4B85A 1UK7A 3DD5A 5FP0A 5FV4A 2JBWA 2C0QA 5DYYA 3BF8A 4HXGA 1EA5A 2ZYIA 5ALEA 5ALHA 3WL7A 2DQZA 1JMYA 5KWIA 5T4HA 3V1KA 1E3QA 1THTA 3TRDA 3CN9A 3L1HA 5ALDA 1QO7A 3HJUA 1R1DA 4Q3LA 4DSAA 3HYSA 1YCDA 2ZJ7A 4CFSA 4H7IA 2VF2A 1CEXA 4XIIA 2WG2A 3LCRA 3YASA 5HZGA 1FFBA 4OSEA 4FLMA 5CH3A 4JH0A 2XUJA 4BTVA 3MGAA 3R3XA 4WY5A 3QYJA 4RE5A 4AN0A 5ALVA 1LPMA 1VA4A 1ORWA 5ALJA 2XDWA 1GXSA 2OGTA 4HAIA 1LPOA 2B9VA 2XE4A 4EB0A 3OOSA 2PUJA 1Q0RA 3ESAA 4ZV7A 4EY4A 1SOMA 2X5XA 1YS2X 1BS9A 3F9CA 4C89A 4LYEA 4LKOA 3IIIA 1Q83A 1GT6A 4OD0A 2XUPA 4C4ZA 4J0CA 2HHAA 2WU4A 4IQ4A 1XZBA 4TVKA 3FLEA 2RIPA 1MX1A 4UPDA 3WZMA 4PSCA 2AJDA 1QFMA 2ROQA 4UHFA 4X94A 5EHXA 1K4YA 2ZJFA 2HDWA 1CPYA 2JGKA 4QLAA 5E2IA 1IUNA 4A23A 3DNMA 4WCVA 3KDAA 3PI6A 4F60A 4MYDA 5A7GA 5K3CA 2PSHA 5HF5A 2HADA 2VA9A 2X76A 2QRUA 5LP1A 2PSJA 3ANTA 1EK2A 3WQHA 2OCLA 1YR2A 2LIPA 5FPPA 3NUZA 1ODSA 1UT6A 4G8DA 2W22A 3DOHA 5AM2A 4C88A 2VAVA 1MU0A 4C87A 4AN1A 5EIAA 1MX9A 4MEAA 5BOVA 2WQZA 4G9EA 1YB6A 3WJ2A 3I1IA 1A8UA 2OCIA 4P9NA 4PW0A 1QIFA 4DM7A 3BJRA 4YPVA 4LYDA 1U65A 5T4EA 1WB5A 4G8CA 3WWDA 2BFNA 4B83A 3ZPXA 3EQ8A 3WKAA 4BYMA 2YXPX 3STWA 3H2HA 3IDAA 1KEZA 2WFMA 2J4FA 5AKXA 3D7RA 2H1IA 5AKKA 1A8QA 2CEKA 5LZ7A 2XQJA 3GUUA 3F97A 3CCCA 1ZD3A 3ZWQA 2XUAA 4LHEA 5HKBA 4J0HA 2AJCA 3HLKA 5DNUA 5HCUA 1HKHA 2WJ6A 4UHCA 5HK8A 4EY7A 5AKHA 3H1BA 4BDSA 1SFRA 3DJYA 2CKMA 2VAXA 3RM3A 1J07A 4F0JA 5BV7A 3GFFA 1AQLA 1XQXA 4XX1A 1XLVA 5LYYA 2WUFA 2AJLI 4B6GA 2O7VA 4K5QA 5K3BA 5AM5A 4DMHA 1UOOA 5AO9A 3NGMA 2YYSA 1X2EA 4AMZA 3H2KA 2XT0A 4GI1A 4U2DA 3KXPA 3H2JA 1GGVA 3IBTA 1CR6A 3BDVA 4A5SA 1ODCA 2J3DA 4UHEA 2FX5A 1Z68A 1CUHA 1XKLA 3QVMA 2QXTA 3AZOA 1HDEA 3PDCA 4KE8A 2IIVA 1C7JA 2VEOA 1YB7A 4KE9A 4QEKA 4UUQA 2QVBA 2OGZA 4JYPA 3ZV7A 5J3JA 2ES4A 2BKLA 2QT9A 2HL6A 3BXPA 2XUOA 1ZGCA 1N5MA 1AGYA 5F4ZA 3MUNA 5JASA 5E4JA 2WKWA 4F5ZA 4AO7A 3UMJA 2D5LA 1ZOIA 3BIXA 5SYMA 3LLCA 4Y7DA 1CRLA 1I6WA 5JYCA 1VZ2A 2QS9A 4J0IA 2HRQA 1TRHA 1ACJA 1YASA 1LPSA 3E0XA 4MQMA 1XRPA 1FFEA 1RWQA 5AOCA 5JZSA 1HLGA 3ED1A 4ZREA 4AO8A 2H7XA 3G9TA 3V1MA 2I3ZA 1ZI9A 4BVLA 2ORYA 2XLCA 2CUTA 5CT5A 4M0EA 5C8ZA 3QM1A 4OU4A 1QZ3A 3AINA 1PFQA 4IH4A 2OAEA 4G8BA 4MWSA 5EFZA 1LNSA 1GPKA 3WKCA 1WB6A 3WIOA 1TCBA 5HF6A 4DMFA 1CV2A 1L7QA 1P0MA 2C58A 3JYHA 4C4YA 2BUAA 4G9GA 4H7FA 4MEBA 3T4UA 1Y7IA 1EDDA 5K3FB 3I1YA 2QR5A 5D3ZA 5AHXA 4G4JA 1YA8A 2WJ4A 3B3QA 4EY8A 4UBJA 5AOBA 5K3DA 4QNNA 4KR0A 3V48A 4FMPA 3FYUC 1R4ZA 4M0FA 2JEYA 2HU7A 1HPLA 4Y2TA 2PPLA 4UHBA 2ZYSA 1TIBA 1QLWA 2WJ3A 4HRYA 5AK6A 2ZSIA 1XQVA 5AK5A 2PSEA 5BWCA 5JD5A 3ZLTA 1AMNA 5I7UA 5KREA 4CI9A 2ECFA 3PICA 1MAAA 4N8EA 1VZ3A 2C7BA 1GQRA 3OM8A 4N5IX 3WMRA 4GDMA 1Y7HA 4B0OA 4OB6A 4F21A 3JWEA 2O2GA 3FSGD 1CQZA 4KEAA 1C7IA 1SC9A 2BAGA 4E46A 1P0IA 3STYA 4DNOA 3A6ZA 1QIGA 1T2NA 3PUIA 5C81A 3BF7A 4EY5A 4FBMA 5FPQA 3TEJA 5EIHA 4DMKA 4INZA 4CCWA 4MYSA 4DNPA 3AIKA 2QJRA 4KRYA 3F8SA 3STVA 4BE4A 1NX9A 5ALUA 4CG3A 4H18A 5JD6A 2H7YA 5ALOA 5CW2A 2WTNA 2VJCA 4AQDA 3WK4A 3UUEA 4X90A 2OGSA 3DKKA 4P92A 1CUSA 3SWWA 3RK4A 5IVKA 4GW3A 1MX5A 1VJ5A 1OCEA 1ZI6A 4GXNA 1TCCA 4WFKA 5IVHA 4AX4A 4PF1A 2P8SA 4L9AA 1CUUA 4H7JA 4Y2QA 4FBLA 5KWJA 1QTIA 4UHDA 4KE6A 1E89A 3LIPA 5CMLA 1JJIA 1XRQA 4DNQA 5CURA 4O08A 1UK6A 1J2EA 3A2NA 1G42A 1C4XA 5LZ8A 5LZ5A 3HC7A 5ALQA 5DTJA 2BUBA 3HACA 3PFBA 3A2LA 4Y2PA 4YASA 2FJ0A 1XRNA 1WHSA 2QZPA 3FNBA 1F6WA 1WCYA 2QTBA 3D3NA 3WL5A 2C5GA 3IULA 5A2GA 4BCBA 2ZVDA 3AUKA 1EX9A 1QIDA 4M0MA 1CUIA 4N8SA 2J4CA 5HKAA 1TKRA 4OYYA 4J03A 1T4MA 4BRSA 5ISMA 3WZLA 4PSDA 1RP1A 2JGMA 2JGIA 1E66A 1ZGBA 3B5EA 1QIKA 3DL4A 2CMFA 3I6YA 1CUEA 3JW8A 1BN6A 2OAGA 4N5HX 2EEPA 2XMBA 3WK5A 3FWHA 3GA7A 4FTWA 3H2IA 1VXRA 4QDXA 5C7YA 2AJBA 1G5FA 5AM3A 1R50A 4JYMA 1XZEA 3I2GA 2JEZA 1BCSA 3M83A 4Y2SA 4Y2UA 3RKSA 3ESDA 3DDUA 1X2BA 5HF8A 2WU3A 2Y6UA 2HA2A 1UK9A 2GYUA 3B12A 3WKEA 3W05A 1QIHA 4Q1VA 1GKKA 4OCZA 2C5FA 5E4TA 1XROA 2DSNA 5AKGA 2G63A 2PU7A 4KAAA 3G0CA 3O4JA 1S8OA 2G4LA 1F0PA 4W9RA 3ESBA 5JALA 2VATA 3FYTA 1XLUA 4X97A 2Y2UA 3TGLA 3K6KA 4DSZA 1CUWA 4YX9A 5DYWA 1H2XA 2I78A 4UBOA 4NS4A 5K3AA 1QE3A 1QONA 3QMMA 3PF8A 4FDMA 4G4GA 4EY6A 4B9AA 1YA4A 3H04A 2XB6A 1LZLA 4QA9A 4XWGA 3U1TA 3BL8A 3F98A 4QZVA 2WIGA 1XZJA 4U2FA 5AI0A 2W6CX 2WLSA 2JGFA 1LGYA 2HA6A 3HZOA 2DCMA 2PU5A 3EQ7A 3ANSA 1A88A 4X00A 5ALXA 3BDIA 3H0CA 1U2EA 1UXOA 2HRRA 1LPPA 2WM2A 5AIBA 5JANA 2OG1A 4OPMA 4UBLA 2I03A 3IUNA 5AM0A 4DMCA 5FDFA 4EA6A 3FSGA 1AUOA 2Z3WA 1OILA 1ZIXA 3IVMA 1QTRA 3D2BA 3MVEA 3WK7A 3BE8A 3I2JA 5IVIA 5E4YA 2RAUA 2Q0XA 4UBNA 2DHCA 4KYVA 2R8BA 3M3DA 2QJWA 5K3FA 1XLWA 1THGA 4CIAA 1R9MA 1XRRA 2WUEA 3RARA 1NU6A 1JU4A 4RGYA 3L1JA 2O2HA 2EDAA 4BRZA 2ACKA 5ALZA 4HXFB 3FVRA 1JI3A 1A8SA 3WIBA 4BAGA 1JJBA 1DQYA 2VT6A 3FOBA 4DTCA 2HA4A 4X7BA 1K6EA 4J0KA 2WUDA 5AKYA 3P2MA 2XUHA 1EDBA 2Y6VA 1WPRA 1UK8A 2O7RA 3C5VA 5ALYA 2Z3ZA 5ALKA 2OXEA 4E14A 1IZ8A 5A7HA 1H23A 2OPHA 4BAZA 4C01A 5FOQA 3C6XA 2QUAA 1XKTA 4UBKA 3H2GA 1N5RA 3G0IA 3W9UA 1XZDA 5FUMA 2CZQA 2UZ0A 4TGLA 3DLTA 2I3DA 2V96A 1U4NA 2ZSHA 2ZYHA 3HABA 1GPNA 2XQKA 4IH1A 5DYTA 5D3KA 4Q3OA 1UOQA 5A71A 1P0PA 2WFZA 3DYIA 1R9NA 2JGJA 3D5EA 4QDOA 5AI8A 1PJAA 2O2IA 4Y9SA 1CUFA 2JF0A 1BN7A 3N2ZB 1QJ4A 2XMZA 3W2TA 2Y2VA 3E4DA 3H18A 1USWA 2GYVA 3DCNA 1FFAA 5A62A 4Y2XA 4GBGA 4BB0A 3FAKA 2WTMA 4BCCA 5JAHA 2BCEA 3ZI7A 5ALNA 1EK1A 4LXGA 1EI9A 1N8SA 4ZV9A 3C87A 4H7HA 4EUSA 2HU5A 4N8DA 1MO2A 1K63A 1OXMA 1QIEA 4QWMA 3SK0A 3IURA 4BCDA 1CLEA 4BTLA 4J0DA 1MNAA 4LXHA 4QDTA 7YASA 3HEAA 4FFVA 1DWOA 3QBJA 2CJPA 5CH8A 5KBYA 5AP9A 3I2FA 5K3EA 5DNVA 4B84A 3Q0TA 3M82A 1WB4A 3D2AA 3G0BA 4UFOA 5HK9A 1X70A 1W4LA 3LP5A 5ESRA 1FSSA 5JZBA 5LZ9A 2VSQA 4L72A 3DOIA 3OC0A 1TAHA 5AI4A 4ETWA 4H77A 3GROA 1YAJA 3I2KA 3DKRA 4WJLA 3A70A 1LPBB 2Z5GA 3A2MA 3WI7A 1L7AA 1VLQA 4CCYB 4IO0A 2GYWA 1K8QA 2XQIA 1F0NA 4H35A 2PKYX 4GEGA 1EINA 1Q84A 4E15A 2BJHA 4Y2RA 2V97A 4AXBA 4MWTA 1M33A
chains in the Genus database with same CATH superfamily
1V9LA 3AL2A 1XCJA 1PZMA 2J9XB 1YR7A 5AKZA 3ZH9B 4AC9A 4DUGD 3LX8A 4NTZA 5BWBA 2FE1A 4WK4B 1KR2A 4KNWA 3N2GB 4QM7A 4XIJA 4BGEA 4ER6A 3J80A 3L8FA 3G8CA 5A4IS 2DR2A 3IB3A 4H7DA 3RS4A 2YHIA 3GCXA 3INGA 4DLNA 4ERNA 1AY0A 1XPRA 5DULA 4C4XA 3KV3O 2QTAA 2WB4A 3F6EX 2Y4NA 5JYDA 2L82A 1XJCA 1KP9A 3QHQA 1GPAA 3WWYA 3ZCXA 2CXHA 4KOEC 1UDRA 1C3EA 5KHLB 2ZYAA 3I2IA 2CLKB 1XCBA 3T9BA 1QC5A 2H85A 2HHLA 1B2LA 3DBLA 7MDHA 3RGGA 3FDJA 5KOHB 5FJIA 3K8ZA 3UK6A 3VHQA 3R24A 3DM9B 2INGX 1UAGA 3KZOA 5DWDA 3MAAC 5HKKD 3QQ5A 1UQTA 3AIOA 4YAIA 1O5OA 2ZE5A 4P86A 3ZC3A 1NXTA 2A1IA 1XWIA 2VPTA 5FT9A 4F38A 3L1VA 3RRMA 1PSWA 1UC4B 5A0VA 2G7MC 2CHUA 4IIEA 2Q6VA 5E9AA 3PKZA 3EGXB 1VL1A 3AIMA 5EXTA 4F84A 4RD4A 1WKCA 4OAQA 4WRRA 3GFOA 2PUHA 3AY3A 3HWRA 3IR5A 4ZO9A 5B2ZA 3T3IA 1U1EA 3G2OA 3VR5A 2R48A 3C8ZA 4RJTA 4I50A 1PK8A 1WSBA 4RK1A 2W6IA 1TLLA 4BASA 3K4PA 2QMHA 1QH8A 1P4JA 4Y2VA 4NULA 1ZUIA 1C80A 1R8QA 4FT2A 4DBLE 4F4CA 1MC8A 4URZR 1KE2A 3N86A 3K96A 4OLFA 4DLPA 4HB3A 2PYDA 2Y0EA 5LBIA 4KKVA 1XL0A 1Z22A 2IZOA 1I32A 2VYVA 3WA6A 2WSYB 1N1MA 4ZARA 1QIJA 2WUGA 4P32A 1A95A 4B0PA 1W581 3I3SR 3IUQA 4TLDA 4TTVA 2NU6A 4K6GA 4IIGA 4PPGA 1QO9A 3TAUA 3KAKA 4YCMA 2PO7A 5LP6B 3HWSA 3IEMA 4MAMA 4W82A 3WWCA 1ESDA 3TZCA 2YXBA 4JVOA 2DFTA 2F8MA 2G9VA 2WG0A 3JARB 1ZQ9A 1E9DA 1DKUA 4R7GA 4RMGA 3GNSA 5IJ0A 4MW2A 5FRDA 2QD1A 4F3KA 5CVDA 3ZV4A 4XSVA 1G19A 3ZWAA 4OH7A 4RLFA 1MG5A 3ZHSA 1SXGA 4E2FA 1A9ZA 1IXKA 3A1EA 4KWTA 4ZVNA 1JPUA 3VJRA 3NZEA 1CIJA 2BN4A 5M34A 2FWNA 1FJ2A 3OIUA 3HI6A 3VI4B 3LUPA 4QBKA 3IUMA 4OHUA 4TSRA 1XZHA 2FW0A 2XMSA 3C8HA 3CWQA 2HH9A 2QUHA 3GUZA 4JJEA 4P98A 5LFAA 2BEWA 3CLSD 1J8FA 1QVWA 5FEMA 5K2OA 3N2EA 3EPJA 3JQ8B 1U7HA 1W6UA 4BNTA 3MMXA 3JRNA 3G49A 5JCJD 1OAOC 1W1IA 2J48A 3CLTC 3A0RB 5A0TA 4UTRA 2ZJZA 3VKGA 1B41A 4A9AA 3MXOA 5LC1A 5AW6A 1R5OA 2WF5A 3TCKA 4CCSA 3FBWA 1YZUA 4P3KA 4AP5A 4LJAA 4I9FA 4O02B 2GFHA 1ZA1A 5EL0A 4RPJA 4BWVA 3RHFA 3CUYA 3OU7A 5KKAA 4RJ2A 3KVNA 5LA6A 4YJ3B 1ESCA 4D8WA 5FWDA 4MUIA 4L8VA 1DELA 3C45A 4C7KA 1GVNB 3UUGA 1V8OA 1YRHA 4GUAA 4REQB 4BMSA 2VDMB 4ENUA 4GI5A 1IY8A 5CX4A 5F7XA 3C4JA 3CB2A 4TV8F 4A8TA 1T9KA 2RK3A 2UUBB 1Y3HA 3R3WA 4QG7A 5KNBH 3EEBA 5AVTA 2WIDA 4Q7QA 1GCUA 2XWBF 4MROA 3UV6A 2IS4A 1L4MA 2Q3BA 1QFZA 2HSJA 3CRNA 1POWA 1WL8A 1ZP6A 3C14C 3WLTA 3I9LA 4CG2A 1E69A 2VXBA 3A14A 3QRWA 2FMXA 4O2BF 2A4KA 4LPKA 4EB6B 4EG5A 4NF2A 2PT5A 3TPZA 1NM5C 4M87A 3MMZA 1N2IA 2JIDA 4BFYA 1VI2A 5BT8A 3Q7IA 4JXJA 1JKMA 4EATA 4X92A 1UEJA 2OCKA 3EG9A 3BJZA 2Q4RA 5ALWA 3IVCA 5TGZA 1G55A 2X0FA 1UOPA 5AJUA 5BSMA 3V7YA 4B82A 2C61A 4D5EA 1TK9A 2C2HA 5E6RA 3ROMA 2QVCA 5A05A 2YV4A 2GPWA 4WZBB 1ZVVA 1UKBA 5DHTA 1DNPA 4Q3CA 3AYZB 4Q4CA 3JR3A 4GLBA 3BN3A 3HSSA 3QG5A 1G2QA 4GI7A 5IKXA 4HAUA 2IITA 3I30X 5AR1A 1NQOA 4KWHA 1EWKA 3AUXA 1RYHA 1ZCAA 2AJ8A 4Z99A 1EDEA 3CO0S 3GIDA 3AJEA 4ZTZB 4WOJA 3AQIA 3S2ZA 3H2YA 4GHWA 3PYMA 1TTPB 1OREA 4HI0E 4NV0A 5EWJA 3IHWA 5GY7A 4KB5A 5M5BA 3X44A 4MS4B 3FYCA 4RU1A 3PV0A 1W52X 3PNLA 1G8PA 2A5YB 4NU5A 1BKSB 5I6DA 1X86B 2ORED 3QFRA 2WHXA 5JZ9A 1DCMA 3DV0B 5FV7A 3HXPA 5L7TA 4J3NA 4MB0A 5EJ6A 2ZRMA 3LBFA 2AMFA 5IKOA 4O4HA 5KVCA 2WD9A 4HDNA 2HV9A 1YQDA 2FPIA 3JR7A 3K9NA 3PQ6A 3BGDA 5COBA 2RI6A 4BX9A 3HZHA 4FNGA 2Z43A 5JAUA 5ARCA 4X45A 4F7WA 3QNMA 4HDKB 3RVNA 3MWKA 2IV2X 2VP2A 4KQJA 5BMVF 2B83A 1QQ6A 3NO4A 1JWAB 2PGDA 3BIWA 1MPTA 3QELB 4WECA 3JQBA 2B78A 3FUTA 1JE1A 3I05A 1QG2A 3ISJA 5GONF 3PIDA 4ZHQB 4QGGA 5ITSA 4OQPA 1I9CA 4R3NA 4LK2A 1TVKB 2OV2A 5KYWB 3E8XA 3BFPA 4ICIA 3DT9A 3NALA 3SHFA 1E6WA 1A9XA 4CKBB 3KHTA 3I34X 4V0KA 5JBQA 5ITWA 3B3FA 5JY1A 4JFRA 1WSWA 5BO5A 4U00A 1ZJJA 1IL0A 3NJ4A 1QBGA 2CB9A 4F5EA 3W5IA 1Y9JA 2IHKA 3M4YA 5DHRA 3RB8A 4BNHA 3BEOA 4L1KA 2XKBA 4GI2A 2QORA 4E11A 1SC1A 1D7AA 2K7FA 5G0SA 4X1IA 1W85A 3AHEA 3HGQA 3DQZA 1FSGA 4E2YA 7REQB 5KVVA 2O48X 3DEKA 3ELDA 3W9BA 2DM6A 1DQPA 2GZ2A 4ZWNA 1SK9A 4FYMA 3ODGA 3L43A 1CJBA 4EYQA 2G06A 3KLNA 3PJGA 1J0CA 1A69A 1OJ7A 4JCOA 5D8DA 5ALRA 5GPBA 1O0BA 5LQMA 3Q7TA 4XWTA 1C9JA 5ALIA 1CUCA 4K03A 3ASZA 5E0OA 4KXVA 5CEEA 3NEJA 3EFOB 2ZUWA 1KIAA 2B8EA 3B6EA 4Q37A 1TT5A 4H7EA 3OJOA 1BOOA 1J0BA 3EBPA 5L3SB 4DV5B 4CRWB 3HO1A 3K0SA 3KE9A 3JVVA 3WJAA 4EQ6A 4GD3Q 5EIEA 1WW2A 2I66A 2RGAA 3T7KA 2XOKA 3PLAE 2QTHA 1F06A 3HA2A 3QLTA 4FLFA 3P26A 1U3UA 2P5YA 2P2NA 3S2IA 4LVNA 1II8A 3PCXA 5H0IA 1BMQA 4HNAB 1OUMA 2XE8A 3LNTA 4URUR 3WLJA 3CBQA 3LHSA 3CIOA 4Q1DA 2OR3A 3Q6IA 1FW6A 1U90A 4J1TC 4C5AA 1P44A 1X7GA 2HPVA 2WG1A 4I1SA 1AZTA 3TR5A 4BX8A 2HIHA 4GT1A 5B5SA 1HE3A 4Q9IA 2BBTA 4D4LA 1PW5A 5H82A 3TN7A 3N9IA 4JENA 1XQWA 4UAGA 1W6RA 3FDZA 2AOXA 2IDJA 2Q9UA 4ITVA 4RENA 2C99A 2WWIA 3L7CA 3PR1A 2NO5A 4BFUA 1Y5MA 4AAYA 1Q7CA 4EARA 3RFXA 1NULA 1RQ7A 1MGPA 5J1TB 3TIVA 2ZUEA 2AJTA 5LJLA 3PNOA 1U1DA 1U2TA 4HP8A 4NQZA 4GU5A 16PKA 4V0SA 2QN2A 1UXIA 3UF0A 1LK5A 1I3KA 1L5YA 4HDSB 5DSTA 5TVGA 1SD1A 3DZGA 2L2QA 3PQ4A 4NMWA 1AU9A 4C7XA 5J58A 3K70C 1DX6A 3GLGA 1GTSA 3LX6A 2CLLB 3MPUA 4IGAA 3ZWPA 5BRAA 3ZLJA 4FSXA 2GLUA 5GV8A 3AM5A 4ZZ2A 1K2VN 1U0JA 4NBLA 4GM4A 2ZJ6A 3CKKA 5A6SA 5BQXA 1J4AA 1E2FA 1MNQA 1RQXA 1S3IA 2WKPA 5LBUA 4ZGGA 4PO3X 4WIAA 2XD9A 4GO1A 5AUPB 4ETWA 3T5PA 4FMDF 4MZXA 3QK7A 2FSIA 5AI9A 4NCAA 1QIIA 3W77A 2DAPA 4MUGA 2W43A 4GVLA 5KMGA 4ARZB 3RK1A 1W75A 2VHTA 1V8BA 4TTIA 3GGOA 2ECOA 4G63A 3WBFA 2NVBA 3ZQJA 5HWSA 2UXDB 1KAQA 4ER5A 2ZGVA 2SNIE 4UTNA 4MDEA 3RREA 2O9JA 1D5CA 1UKVY 3R5FA 1NW8A 3O4GA 4ML3A 2M1ZA 2HMAA 1F2DA 3HBAA 4OL0A 1ID1A 3I58A 1BHJA 4NJMA 4EA9A 4LNUB 2GN2A 5HIAA 3TZEA 1UEIA 1XJWA 5CBPA 1CF2O 5K8LA 3HRHA 4EA8A 4CM9D 4JJ6A 4MWBA 1NUTA 1E58A 2XMCA 4IDOA 4JXZA 5JSKA 3UYKA 5AK3A 4LBWA 4AY3A 1ZR2A 1GQYA 3V6MA 2EKBA 2XVXA 4EW3A 1I7PA 1QAOA 3BWEA 3DS8A 3NI2A 1FDOA 2H4XA 4OUDA 1V8PA 1KQNA 1OFHA 1PLJA 1VIYA 3O91A 1P3DA 1S9DA 1KDRA 2XZPA 1VCHA 4Z86A 1T43A 1KL7A 2C4TA 4ZT5A 4CKEA 2PRSA 1MA3A 4IV0A 2YYAA 3CA8A 4M9ZA 4MS1B 4RESA 5FWNA 3MIZA 3ICOA 5BUCA 2GDJA 3PUJA 4IMJB 1RC0A 4RABA 4QLOA 5FO0A 3OLYA 5JECA 1QFJA 1OFUX 2FEOA 2R66A 1KVQA 1GSOA 3U4GA 2OXRA 4GECA 1G9XA 2JFXA 1RHRA 1VMEA 4CM6A 4DJ5X 2OXIA 1F48A 3MJEA 1FX0B 5CXUA 4JI7B 3GMDA 1P9LA 4TYMA 1OF1A 4GGMX 1JL3A 4NZZA 3WO1A 5CDFE 1LV7A 5LYJA 5IF9A 5JAMA 1HWYA 1PSDA 5J5VA 3D59A 1MTOA 2HB6A 2XVZA 2RGXA 4TLLB 1QOZA 3IDFA 3RANA 2RFLA 2BGNA 3T99A 5AKIA 3W1EA 4YMVA 2I7DA 3KD3A 4N6NA 2EG9A 3C8DA 3JYQA 1AUXA 1E1QD 3LS2A 3TEMA 1G5TA 3O4IA 2R6FA 3EXHC 3GELA 1NNUA 1ZK2A 1A4IA 2X7XA 4NDAA 4BLPA 4C0KA 2QSZA 4KRFA 1RPJA 3JQBC 2ZRCA 1RWXA 1C30B 2G0AA 2CB0A 2HLHA 1I2DA 3CONA 1S1MA 5BNZA 1GN8A 1II0A 4PG8A 1Y5IA 2DPLA 2REXB 2MHCA 4B45A 2IUYA 5AK0A 4UATA 5A9SB 3ZD7A 4BE9A 3F7TA 1OXUA 4Y0VA 3T4XA 4F4FA 3LO8A 3DWIA 4FKBA 4QJ4A 4K9NA 3TNDA 1GKUB 3P9PA 4H7KA 2CDRA 5TPWA 1DTEA 3G85A 4E2ZA 4PG4A 3KVVA 3QOFA 4XQ9A 5AVWA 3H8WA 4XX0A 4B6FA 2X40A 4H1UA 2TMDA 5IP5A 3G02A 3FHLA 3K09A 1T8SA 5CA1B 2IHNA 5JFTA 3DV2A 3EEQA 1UKAA 3IIJA 4LY3A 4YJ2B 4RK5A 5DU2A 3UB4A 3WK9A 5C7LO 2V3VA 4IMRA 4QUIA 1L7EA 1OE0A 2BCJQ 2EJBA 2W9XA 3EGOA 4RFSB 4AJPA 3KTAB 4YJ3F 1DKOA 3GDWA 5DGTA 4EIWA 4IINA 4ZT4A 4OHYA 3VKWA 4QEDA 4QQKA 1C5KA 4IPTA 3C7TA 1HDYA 5DCUA 1GGNA 2JGEA 5TIIA 1FDWA 1US8A 5KTYA 1PQYA 2WKQA 1SB9A 1XA0A 3IUSA 1HSOA 4K9OA 4HGRA 3WMGA 4EPXA 3CX3A 2NX2A 3FHOA 4L15A 1EIZA 3SYKA 4BL5A 5BSVA 3OPNA 4QXOA 4RWZA 2VDUE 2ZAIA 4QUAA 1UMCA 1V8ZA 1GTVA 1Z35A 2SKCA 3OZGA 4F9FA 2REBA 2CSXA 2CCJA 1ZR4A 2RSLA 4NJEA 1IM8A 1QP7A 1YR8A 4EYGA 3KZKA 4Q7LA 5AUOB 2VRNA 4K88A 1JAYA 3A3PA 1NPDA 1YJBA 1R4AA 2J5RA 1DC4A 2H08A 3EF3A 1PT5A 4MIYA 3MUOA 1WR8A 2BI8A 1H2ZA 2PUCA 1QLHA 1IUPA 1E3WB 1EHYA 1C0LA 3KLOA 5DT9A 5KYYB 2R8RA 3CISA 2EFGA 1F8UA 4L75A 2QQFA 3VGPA 4YMHA 1Q21A 3N05A 3LI2A 4TM7A 3Q9SA 1VM6A 1QYRA 3EIEA 1ZN8A 5IMSA 3NBZC 3BD9A 2HIAA 3PT5A 4JLAA 1Z25A 2JK1A 1USIA 2JATA 1D1TA 4F45A 3REOA 2JLVA 1O77A 4B6RA 2B37A 4C78A 3R9IA 2Z2JA 1FLVA 4MYHA 3W8NA 4RGBA 3ZW9A 5HQ3A 1A27A 4YT2A 4C0HA 2QQEA 4BC0A 3MRSA 3WJ7A 3O0DA 4AS1A 5CYGA 2Q5LA 4J3JA 1MJ5A 1YMVA 2ZIFA 3ANLA 3FPHA 3NWBA 4FNOA 4TWBA 3MTBA 2W37A 2WHPA 3NNSA 4PTLA 4BV2A 1J21A 3WQBA 3PF9A 5HGXA 1YB1A 1OH5A 1HT1E 3MWLA 1BWSA 5AJHA 3WV5A 1BQ3A 1GFWA 1LUAA 3G9UA 1VKRA 2LPMA 3CJQA 3WK8A 1I0IA 2WHEA 4O5OA 4UFNA 1KDTA 5E7IA 2H4ZA 5JV5A 4L3OA 4DY6A 5LKAA 1OLUA 1B23P 1N8KA 3IE1A 2QRLA 4ENTA 4G09A 4HK4A 2QUJA 1M0SA 1YZKA 2J0UB 2M9MA 3BSSA 1JILA 3KFXA 4HLDA 4LHVA 4R7ZA 3JQFA 5FQNA 5J2TF 4C1BA 1L9KA 2RCYA 1OB5A 3VR1A 3IVGA 2B2NA 4CLRB 5TARA 1UBGA 3I23A 5ALMA 1CG6A 2UKDA 1X42A 2V7GA 1OC4A 1ZLXA 4LOAA 2G9ZA 4EEXA 3OQIB 3D0OA 2ZB8A 1M6HA 1XU7A 5TR9A 5JEEA 4B8YA 1L7XA 1ZC4A 3N8NA 2FWPA 1YZQA 3ETCA 3RIMA 4E5VA 2GWRA 3NBMA 2HI0A 2IUTA 1ZJ5A 4B8ZA 4R1QA 4RPCA 5FORA 3SBOA 3VU9A 1XTIA 4DBLC 1YQQA 4PO9A 4RTOA 1VBMA 3PHCA 3GPDG 3ISTA 4GMHA 4ZAVA 3UJ3X 4C1NA 4R5HA 3N87A 5DTQA 5IPFA 1GL7A 1LW6E 1XE3A 1YE5A 3CM0A 3GH3A 1W19A 1AZLA 2CXOA 3B53X 3LY5A 3QE2A 3Q5GA 1E1CB 2BMVA 3NFYA 4HS9A 3VC2A 4GLFA 3ZV6A 1PNRA 4DIEA 1RXUA 1W4RA 3D8SA 1P1IA 2PZLA 7MHTA 4BNNA 1QRDA 4K9PA 3OIFA 4PGGA 4JAVC 1HFEL 2QN9A 5BR1A 3LRXA 4P22A 2CBGA 3HB1A 4ROTA 3NVKI 1RR6A 2UZ4A 1Z38A 2ZSUA 2PANA 3NDPA 3CF0A 2C82A 4UNQA 9ATCA 1JLLB 1UBKS 1S2DA 2GBLA 4MVJD 5EXXA 3T1VA 4QBIA 4NXMB 1UZLA 2PS1A 1DXOA 1MAHA 1TQHA 1DT5A 4DDKA 3D6NB 2BGRA 4UUNA 2W6NA 2W00A 1WZEA 2R0QC 2WJPA 1P5ZB 1Y4DE 2QGNA 4KREA 5IW8A 1SU8A 2XI4A 3RAFC 2AB0A 1AQIA 1NJ8A 1TK2A 2P1RA 3BK2A 1W36C 2GNAA 5IWAB 4ZU3A 2Y1OA 5EN4A 2I1QA 2A3RA 4DC1A 4Z5XA 2K4MA 3H6KA 2P68A 4DA4A 1XZKA 4MWCA 5K0CA 3AQ4A 5TT1A 5AI6A 3N3AC 1VP9A 2QOEA 3H7IA 4UHKA 4C7OB 5DTEA 2YCLA 3JS5A 1OTYA 5AQEA 1ECLA 3R0IA 3R7BA 1TO2E 4JLNA 2ZWMA 1I1NA 1CZHA 1SU7A 1R0SA 1JBEA 2JKVA 3EXEA 4FCVA 2EKLA 1ACLA 3B6ZA 3HN2A 4H0CA 4J7AA 4EF4A 4Q5IA 1JT2A 1ONPA 3MLBA 2NZVG 2YWBA 2H1SA 1P1FA 3LHKA 4HN2A 2DXIA 1PFUA 3NYWA 3FRHA 1PZEA 3H17A 1FY2A 2YDYA 1HDOA 1W5TA 1YJ8A 3PUZA 2GB4A 4KXFB 1Z6AA 1W4ZA 4FGZA 1Z4NA 1YUBA 1EX7A 3HV0A 4ZQGA 4PEVA 4DEYA 2Q1XA 1Z2OX 2IE8A 4ID9A 3JQAB 5C4GB 1U11A 5ILOA 1X1CA 2BRUA 2OENG 3LL4A 2NO6A 1RI1A 4MR8A 2VPPA 1QHEA 5DYNA 4QJ3A 1D6MA 3UO8B 4BP8A 3U56A 1XZIA 3IAM1 2E4XA 4QDZA 3ZW8A 4GE0A 4DDHA 1QO0A 3OQMA 3QKRA 2YC2C 1P73A 2FWAA 2FSFA 1CUYA 1JMVA 2OFFA 4BX0A 4PQGA 4TXJA 4C14A 4YFVA 2GK4A 2VWHA 3SJUA 4ZYVA 5T67A 2J3QA 3D43A 3CEMA 3JXEA 1HYHA 2X5OA 5EP4A 1GARA 2X8JA 3K0KA 4DAOA 1VMDA 1GGHA 4YAOA 3V3KA 3ABIA 3VC3A 7AT1A 2FE4A 4DT1A 2B34A 5G0WA 1EYZA 1PRYA 1MC5A 3HZZA 3TD6A 3VRHA 2YWEA 3EIOA 1U8FO 3RC3A 4F6RB 4MOWA 5JH7A 1DVRA 2WP0A 1AB6A 5HW0A 3ORSA 5AOAA 5C4MA 5I7EA 3U61B 2FW9A 4LRWA 4DXHA 4PLZA 4LC0A 4WLNA 5E7QA 4BZWA 1L4UA 1T9ZA 2WD7A 1NN3A 5DSXA 4F12A 1AH2A 1B26A 2GZRA 1BEZA 1GKIA 4OBBA 4ZN6A 4S1WA 2F43A 1BXGB 1QYVA 2TSYB 1ZW6A 3MSXA 2V4MA 2V5VA 2XNCA 1KJNA 1ISRA 1RAGA 2Y1FA 1DIBA 1EQAA 4NAHA 5TPZD 6PFKA 4FYPA 4I5DA 3ZYZA 1DOHA 1GO2A 2PVSA 1IN4A 3C74A 4O4LA 2I33A 2PZEA 1WCIA 2BFWA 4A0QA 4C6TA 1N3IA 3VUFA 4MB6A 1ZIPA 1T8TA 2YH2A 1KZ7B 3ZDYB 3KE8A 4AZSA 1VIAA 2CJXA 5J4YA 3G0HA 2BJVA 1K8YB 3HA5A 3P9YA 4IKOA 3SIXA 4EHHA 1ESMA 1O95C 4EK9A 3COWA 5KUTA 1BW9B 2ON6A 3GP3A 2WE7A 3ICWA 4X20B 4B7XA 2HAEA 4YREA 4EM6A 3GVCA 1TCUA 1AN0A 2EFCB 2QUIA 1CS0B 2BFBA 4QYMA 4ALLA 5KTNA 2AKAB 1H2WA 2DMRA 3WYAA 5KO2A 3E70C 2OHIA 3ZDCA 3LGAA 2HFKA 1U9JA 1Q1EA 3FPEA 1GFZA 4O2AF 4D42A 2RHHA 2ZM6B 4FFPA 3V32A 3S2YA 1SKYE 3PUWA 1N75A 1L0BA 3BAFA 1K8RA 4P4TA 1I1QB 4QTUB 3G3EA 4QXQA 3D2LA 3K9BA 5EKTA 1YTUA 1GUDA 4YALA 3SJ7A 3TRKA 1OGYA 3P52A 3BGSA 4J49A 2WAYA 4MQEB 1JEYA 3NJRA 1NYLA 4ZZ3A 2P5TB 2QVLA 4DCJA 1T3ZA 2ECPA 1ZRHA 2B61A 2ZAYA 5FXMA 3ZOZA 4WY2A 1DXHA 4IKEA 2JHFA 4MR9B 1QHXA 4X95A 3TYXA 2WKSA 5C51B 3R3JA 1FSFA 2CLMB 1GGMA 3PNYA 4DR2B 3IP6A 3OBBA 1TYBE 3DBHB 3EQ6A 1BYIA 2I55A 3GMSA 3H99A 3ZH2A 2PK3A 2R1TB 4U6NA 3AZQA 4G5RA 4IEFB 4UU8A 3TIGA 2VK1A 3WYEA 1WB9A 4Z0HO 1VKOA 2DG2A 4WFJA 5KX5A 4RHCA 5LXTA 1VJDA 4JJ4A 4KXXA 3TSWA 2HQSA 3TZ6A 1VOTA 4NICA 4NBSA 4G5QA 5BVGA 4YP0A 2GBIA 3PRYA 1SWWA 3HRKA 4OGLA 1D4OA 4ZCPA 4IX9A 4CLHA 1GEEA 1O6ZA 4JGIA 3EXFB 4XCVA 5GAJA 2DU8A 3FTPA 1QKJA 2VP3A 2NO7A 5FLKA 4UFPA 4O3MA 1KOJA 2VP5A 2YUIA 3H1EA 4I99A 1J06A 2VPWA 1NW3A 1LPAB 1PG0A 2AFRA 4B09A 5FUYA 3NOVA 1VLMA 3HJTA 4GOLD 1NR7A 1SG9A 2Q6LA 3LFUA 5EHNA 3RTDA 5B7PA 1AOXA 2WWXA 5B4TA 1OXXK 1P7CA 2R11A 2GRJA 2A78A 2W2KA 3H3XA 5JCOC 2W2TA 4ARAA 2XWSA 3VI3B 8LDHA 3C0KA 4AJJA 4PVCA 2G17A 1SK8A 2WIJA 2GBCA 2WV7A 1M2VA 4B4OA 1LSOA 3BMCB 1S8NA 1CZRA 4OK5A 1JU3A 5KDDA 3BFXA 4EEKA 1HT0A 3AY0A 2QG6A 4NPCA 2C4MA 4M53A 2P2ZA 1EWTA 1CVRA 2AR9A 1RWPA 1C1DA 3K8QA 4LDRA 1WMSA 2NNLD 2VJMB 3DE1X 2RHCA 2CXRA 2BP7B 1F2TA 2H9AA 2Q5IA 4WNYA 1JDVA 3RCBA 5C7IO 1XZQA 3G8AA 1X8KA 4XUGB 1HNNA 1P1RA 1U5CA 1WZNA 2ZR7A 1G64A 2ZYUX 2GCNA 4L4RA 4M99A 3P96A 4ZOLF 4EJ6A 4OMUA 3FVTA 4UBIA 5CT6A 1JDUA 1WMEA 4P08A 4EKGA 2YASA 1BXKA 1MB2A 5GIPE 2R8PA 2QZ9A 3IUYA 4UUOA 4YP1A 1XAIA 1PQ4A 3PE3A 3RG8A 3GJ0A 1J42A 2IXDA 2Y4OA 5DJ5A 1CUJA 2OA0A 3GVIA 3UAGA 1FJXA 3SLRA 2EJWA 2VWPA 1AF7A 5CTAA 2ERXA 3U4AA 4DTIA 2X58A 1I36A 1TB4A 2GKOA 3O2QB 3R5TA 3NOQA 1OT3A 4BO0A 4RPLA 2GARA 2Q5JA 1FTQA 2SICE 2IZ7A 4IUYA 4PHFA 3SGLA 4HWRA 4HQNA 2GZSA 4CQJA 1D9ZA 2HF7A 5DOZA 5BN4B 1XMQB 1ZNWA 4H3HB 3AHCA 2J4DA 2PS3A 3D8BA 4RE6A 4AX8A 3WLFA 1YCGA 1DJNA 1L9XA 4UPVA 1XCGB 5DTIA 3L4KA 2VVTA 3C85A 1TU4A 1AURA 3T9DA 3TSCA 1SKAA 5HIIA 1C41A 4NZMA 4TL9A 4ZQHA 3QH4A 5KNBA 4GKJB 1JECA 2XLBA 1FS4A 2DGDA 4LVOA 3C4VA 3OQHA 4YUZA 3PX2A 3BGOS 5GTDA 1GA6A 2ZE7A 4DCTA 4X71A 5KKCA 3PX7A 4LX8A 2ZJ1A 3E8SA 1NV8A 5A4DA 3L9XA 4MUFA 2ZP1A 3OCJA 2B1RA 4PS0A 2WNIA 2CYCA 1RYEA 4XM1A 4PYRA 4YAFA 1RAAA 3LQ1A 1B15A 3R5XA 4UVHA 1BWPA 3OQ6A 4WE3A 3W3AD 4HBGA 3BRWA 4BLSA 3OQ1A 2IYEA 2ET6A 1JIVA 2BZSA 2OSBA 3GPIA 3VVCA 1NUPA 4BKMA 5FP0A 3LYHA 3ZNOA 5DYYA 4GL2A 2CYBA 1WNTA 3KOXA 4H31A 1Q0HA 2EX1A 121PA 1M1NB 2ZT8A 3IMKA 5JAQA 3WTCA 2PMBA 3C2QA 1ZK3A 3L5KA 2HREA 5ALEA 3IDQA 4D74A 3QFTA 2QW8A 4C08A 4MGYR 3PZBA 621PA 2Y1GA 5K6AC 3AF0A 3GT0A 4PHGA 3E9CA 3LO5A 4OA8A 2PMFA 5K01A 1B43A 1W2GA 3LH5A 4NPHA 13PKA 1TUEA 2PBFA 5G1OA 1S2LA 2VP4A 2E18A 3PD0A 2QGFA 2C3OA 4L9RA 2EKPA 2EOAA 4YJFB 5KQPA 4I8XA 4BQSA 4D97A 1YL7A 4DSAA 3HYSA 4WESA 1D0IA 4ZKDA 4RKWA 4EX7A 5B3JC 1PV4A 3GJ5A 3I64A 3VSCA 4HDRA 1T2UA 2WZQA 3DPSA 4R3UC 3OU2A 4FT4A 4EYKA 4F6LA 3Q0IA 4HATA 2YHAA 4E4YA 1CLUA 1P6XA 2WU1A 5I4BA 3LQFA 1MJHA 1TNDA 3USES 2PYZA 4IYJA 1RI5A 1YQTA 3SJCA 5AQ1A 4BLRA 2YXNA 2OZPA 3FZNA 2XUJA 4N0PA 4C21A 1R2QA 1SXIA 3MGAA 2Q28A 2YYYA 3OOEA 4G36A 1FMCA 5CFNA 4YH1A 3K73O 4ILEA 5CJJA 3MJTA 1P0CA 4Q02A 4MGHA 1H3FA 3CZPA 4JJIA 2MR6A 3WRYA 2GFIA 2YNMA 5T7BA 2O3RA 1GV1A 1Z2AA 3WLIA 4AN0A 1JNYA 4RGQA 1CB7A 1ORWA 1MVLA 2CVPA 2QG9A 2YVKA 4MITA 1RQGA 2I2DA 1Z2EA 2C95A 1GXSA 2OGTA 3N75A 3Q7SA 3R0ZA 4Q4HA 4Y67A 1YOVA 3L0DA 4H9GA 4RUKA 2B9VA 2XE4A 3KQPA 4DF3A 4L27A 3TE7A 2NP6A 1TTHA 5JWHA 1G6Q1 3P0FA 2WVJA 3T8YA 4NK5A 3HFSA 1PCXA 1VYVA 4LVUA 4QDJA 1BDMA 1M5TA 2PHZA 2FPGA 2QV0A 2X5XA 4LVCA 1V37A 1YS2X 1BWRA 1GTL1 4P54A 4TN1A 3ZIUA 1BS9A 1PJTA 4ASUA 3IEPA 4N54A 4C89A 2C92A 3RVKA 3DHVA 2R00A 1JSXA 4BWYA 4NR0A 2JIPA 2A0FA 2NAFA 2J3EA 2D0PB 4TXNA 1FMFA 3OFJA 5DLQC 4FW9A 3U1VA 5A5DA 3OQNA 4X65B 2F1IA 4DYDA 2DFLA 3OLWA 4CNBA 3F6RA 1ZXBA 1TJ4A 2XHZA 3OPYB 1J6UA 1GGFA 1YKFA 5H9WA 1V7CA 4NECA 4NQRA 3NH6A 2P9GA 1Y1TA 4GZMA 1XVVA 3G5TA 4N82A 4OQYA 2C3PA 2B0CA 4ZCSA 1TFRA 3KQKA 3ND9A 4PSCA 4AURA 1UBJS 3FF1A 3EZYA 3H3JA 4HGOA 4UTXA 4EHFA 1N9KA 3PDWA 1U3VA 3DVSX 1QFMA 2FR1A 2JIOA 4X94A 3O1JC 3TIFA 2FB9A 5JSHA 1RAEA 3ZNNA 4OBWA 1PNVA 2REQA 1DS6A 5L9AA 3L4EA 3PVSA 4A23A 1M34B 4HC4A 5DI3A 4E4RA 2XAAA 3EGWA 1SZDA 4HGPA 2E5WA 1VBNA 4F4JA 2FLVA 5KQRA 2P6NA 2AUMA 1L4YA 1NONA 1OLXA 1O8CA 1NW6A 1EWRA 1XJQA 2OKGA 4AJ9A 1HG0A 1Q20A 4TVOA 2XGGA 4MH0R 4D4MA 1DGQA 1E6EA 4KH1A 1R8JA 2EF0A 3PKJA 4X1YA 2YJ6A 4E5UA 4WVLA 3ZY6A 5BVHA 2ZTMA 4Q18A 1Z0SA 1X1TA 3RYFA 3VR5D 4AYWA 1Y8RA 3SFZA 2AW5A 2XWQA 3O0TA 3IDSA 3RU7A 2W6ID 4RVSA 5LP1A 2PSJA 3KKLA 3R09A 1U80A 1YMQA 3CU5A 3IE0A 1R8SA 3ZHZA 3WQHA 4YAWA 2PE5A 2QL9A 1YR2A 2LIPA 2YJ3A 4KVFA 2QN1A 3ZDAA 1A7AA 3BK7A 1ODSA 1SBQA 2PMEA 4LWQA 1WHSB 2BFDA 2FSGA 2K7ZA 3GO4A 5KKNB 4R1OA 1XU4A 2WYVA 4KYTA 4KXLA 5EMNA 1RXSA 1D2CA 4PC3A 1RT9A 1BFKA 3DOHA 5AM2A 1E79A 3WDLA 3FTEA 4EO4A 1BHSA 3GL9A 3ZXXA 4C87A 4OI2A 1H8ED 2G6BA 3M0EA 4R9SA 1O4WA 3NRBA 1LQ2A 4BQPA 1J8YF 1Z0IA 4G9EA 4X24A 5IXJA 2YJGA 3IP3A 4TRRA 4NG5A 5I7RA 5BR7A 3GLIA 3ZWVA 4AJNA 4ZXPA 3M6FA 3F5DA 3W4IA 2ZT6A 2WJVA 3L6CA 3ZYCA 3ESQA 4Y8VA 3UEOA 1QIFA 5BN3A 2FOXA 3OM1A 5CHYA 3BJRA 3E22B 2JIBA 1CNFA 3F49S 1XMPA 3L0BA 1Y6RA 1H3EA 3PFNA 2WDZA 3C7CB 4Y0AA 3VSDA 2FUEA 1WB5A 4CM8A 2P67A 4QNMA 1XU9A 3V5NA 3FAZA 3QWHA 3RYHB 4B83A 1CQPA 1NKSA 1CQIA 1NQVA 3OWOA 4MS3B 4I1IA 4G24A 1LC0A 3EQ8A 3HU1A 1E3EA 1FYFA 4LUCA 3U48A 4XH9B 4NBTA 4BYMA 2YXEA 4EELA 3D7LA 3BD8A 2ZTHA 3H8SA 1D8AA 5IJ9A 3E1SA 1ZWKA 4CM1A 2WFMA 5D6NA 1GFIA 3GPLA 2BTEA 2QYOA 4K6MA 1BSVA 3D3WA 3ELBA 3NVMB 3I92A 4C6RA 1OAKA 2HT6A 2QLMA 1YDWA 3GGJA 2ABWA 4RIHA 3COSA 2D0IA 2VRCA 3G59A 3GUUA 2JJ2A 4C3OB 4C4RA 1Q15A 2C7GA 1VPVA 2VHJA 5EERA 1T9DA 2GERA 1SBHA 4URFA 2NP7A 1T4CB 1D0VA 4KVGA 1DARA 2FPWA 5FA5A 2Q3FA 4ZD6A 3OIYA 5A9TA 1QHIA 2QTGA 3PHBE 2YFYA 3EAQA 4F2WA 1HE1C 3MWJA 3HJGA 3AEUA 4DSNA 2UYHA 5HKBA 2GN1A 2BFMA 5JS1A 3NV9A 1QP8A 3IR6A 4RZHA 1TJ5A 3FTNA 2M6LA 1JLMA 3UMBA 2CF6A 5DSZA 3E82A 2W6MA 4CMHA 4FXPA 3WFZA 5HCUA 1RTKA 1ZY2A 4RANA 1CE8B 1HKHA 3FFAA 5HK8A 4CKWA 3N2LA 4ZTUB 1G291 5JWOA 4L8FA 3EYAA 3H1BA 4BDSA 4WX2B 3I42A 4Y2HA 1SFRA 2BW0A 2NV0A 2FCRA 4CFYA 2VAXA 3NHWA 1EXNA 1OWNA 2EKDA 4GX5A 5H9VA 1OYWA 2QZ4A 2VUIB 3F8TA 1C29B 1J07A 3RM3A 3TZQA 2PEZA 4I2VA 3WAKA 5KTMA 3R8XA 4XIGS 2V1XA 3X1YA 4C3UA 1NF3A 4I5EA 5B1HA 3SQMA 2VCEA 4HZUA 3R8CA 3A9TA 1KZ4A 1NPTO 2WUFA 4QUBA 5LYYA 1NBMA 5DV9A 2R00C 4GP6A 5AM5A 3F71A 2Y8EA 2YYSA 3LQ2A 1X2EA 3OAAD 1L8QA 2LTAA 1NBAA 3AG5A 2C2KA 5FTLA 2OCPA 4JVSB 3NC4A 1ARZA 4GPTA 4FSHA 4IIJA 4JP2A 3VBEA 4DMUB 4MRMA 2GXAA 3F4BA 2CYAA 2YS7A 5K0BA 1GGVA 5KYXB 1K97A 5JTUA 1R5JA 1WUIS 3JASA 3UJNA 3QXHA 4B46A 2A9QA 2CLFB 2Y71A 4CDRA 1IBMB 2HJSA 1C9KA 3AF5A 3AWDA 2IXGA 3HN6A 4JUFA 4HPJB 4U4AA 1Q7EA 5D87A 4A5SA 3ZS9A 3U1BA 1NVGA 1ESNA 1FYWA 3F1LA 2C7OA 1MO5A 1Z68A 2PH3A 1CUHA 1TD1A 2JLUA 3QVMA 1THMA 3VSBA 2QXTA 5IASA 4RL4A 4DV6B 4AU1A 5D00A 3UXEA 1YB7A 2FN3A 1UBOS 3QWIA 2QVBA 4LQ4A 4JLSA 3EEIA 4CZ2A 2C8JA 1J7KA 5J3JA 1PE0A 4A2PA 4FDTA 5EXSA 2N75A 1XL1A 5IU6A 3B9RA 2ZB2A 6GPBA 3A6EA 2QT9A 4QGFA 3V55A 2HL6A 4JP5A 4QKQA 1N77A 1N5MA 4NBUA 2Z4TA 4KWIA 2WMDA 1LS6A 3R4VA 2A3NA 2ONYA 1S8AA 1NGSA 1YQGA 2WTEA 1ZN2A 3UMJA 4KQFA 4MIEA 5SYMA 1XELA 1Y4AE 3M9XA 3DTTA 1CRLA 3IXMA 1I6WA 2P41A 4MW0A 2E5LB 1T8RA 5JYCA 1YZGA 3ZHXA 1M3SA 1NI4A 3HTXA 1DJPA 1K6XA 2PZAA 3L8DA 1GPBA 1VZ2A 4QFMA 2XGJA 3F6CA 4FJ2A 2GM3A 3NHFA 2FK8A 2XYHA 1Y3CE 4ID3A 1EVZA 1MC1A 2OAQ1 3DMGA 3BCHA 3OTIA 4M0PA 4NFHA 4NOKA 5TQ2B 3SDBA 4C2BA 3RVMA 6NULA 1ZJ6A 1WXDA 4UARA 1K7EB 4D0LB 5KNDH 2OCBA 2R7AA 1Y1KE 2W2NA 1R8XA 2R6AA 2ZRKA 3TL6A 3IL2A 3BMXA 1FFEA 2GX6A 5AOCA 1HRDA 4XEHA 3GUYA 5JSFA 2QYTA 1KZ6A 3ELUA 2OEPA 5B3LA 4AO8A 3OWHA 1EPUA 4TV9F 2P77A 4Q48A 3CT4A 2R97A 5I01A 4QXMA 1NVVQ 2QYHA 1U7TA 2DPMA 3FNGA 1CJKC 4LHSA 3K6JA 3SD7A 5U1PA 3U49A 1Z2CA 1C1XB 2B8NA 3LBYA 2XLCA 4IHJB 4U9IS 5FPHA 4PQFA 2O1EA 2NACA 2Z57A 5CT5A 1UWKA 5KI6A 4XA8A 1RI3A 1IZ9A 3BH0A 2Q4EA 4QUKA 4OU4A 4UTZA 3LDFA 1PFQA 2YIMA 3TQCA 5IJXA 1XCOA 4FR5A 4MUYA 4H60A 3EGIA 4G8BA 2GWHA 1Z82A 2O2EA 5HJEA 2JFOA 1U3WA 2FXVA 4URHA 4ZHSA 5IFKA 3KPJA 3O6VA 1WB6A 2ZSFA 3WKCA 4AMUA 5JFOA 3DLBA 2PKQO 3QENA 3N7UA 3OOYA 5HF6A 4NNPA 4ZFNA 4QOFA 2P7IA 5M04A 2ZIXB 1P0MA 2WM3A 3UV7A 4I1YA 4HY3A 1RPTA 4NCKA 3VR4H 2B8WA 4G9GA 1A5AB 4JLUA 4MEBA 4ODIA 2PIDA 3C1OA 3I1YA 5EWLA 1XDGA 5JNRA 1KFKB 3DZ8A 5D3ZA 2XZLA 1YIDA 4LOHA 3X1MA 5AHXA 1NVEA 2XOKD 2H4HA 4JU9A 5BMOA 1NVTA 2JANA 1ST3A 3T35A 3DUWA 3WOVA 3B1XA 2I4LA 2CL6X 1R16A 4UBJA 3ZX5A 5AOBA 3RV3A 3ZZTA 3Q1KA 4EJSC 1C7FA 5FFMA 5K3DA 4CMEC 2PVCA 3ZWBA 1V6SA 2GHRA 4D8XA 3GVPA 3V48A 4FMPA 5GM1A 3ZE2B 3NAZA 5A4AA 5E7JA 4M0FA 4MVWA 2BCGY 4L78A 3ZWYA 4BUCA 1I1HA 3T5CA 2FFRA 4PZ0A 2EV9A 2ZXFA 1Z88A 4Y2TA 3TECE 1JLHA 3MCZA 1M1ZA 4WXPA 1SKYB 2V7XA 3Q9LA 3QEMB 4INJA 1Z39A 4LOIA 2ZSIA 3ZQ4A 1ECJA 1XQVA 3NB0A 4RTRA 3II6X 2Q7DA 5B37A 2ANBA 2QX8A 3GAZA 4F4DA 2W6ZA 4BB5A 3DL2A 1AMNA 2R6GA 3WIUA 3R7LA 1X94A 1D2HA 3GLUA 3GNTA 1YH3A 2H57A 5LR6A 4GQAA 2EFEB 2F1HA 2HQOA 1OYYA 1B76A 4CE6A 5IM5A 3BX1A 4CI9A 4Z4CA 1HG1A 2XYVA 4LJLA 1R6DA 2V6GA 3JAKB 1HFJA 4UMVA 3ZE9A 2JFPA 2ECFA 1JVSA 3DVAB 3OQJA 1E7WA 1I5OA 2CKDA 1MAAA 4C4SA 2OQ2A 1LNQA 4MHTA 2P0EA 4ITUA 2RG1A 4B75A 1TQ2A 4W7SA 5JRDS 1C4WA 2Q50A 4GDMA 3PU6A 3OWXA 4N5MA 5AVRA 1W0CA 2BYTA 1MA0A 1RHJA 2BISA 3DZFA 4BFTA 3U6KA 4CN8A 5CNJA 1MXHA 4W9NA 1P6QA 4EA7A 1C7IA 1LY1A 1SXPA 2HU2A 3E9DA 2AT1A 4A3SA 2BAGA 3RYIB 3GIWA 4MRPA 5FNVA 1NWHA 3HFJA 2PKEA 5DN9A 4I81A 3KQQA 1PR6A 3TF5A 3QX3A 3OHPA 3EVBA 4OG2A 3U9TA 4ECAA 3P9CA 2X22A 3F5FA 3DVQX 2H5IA 1T2NA 2QNIA 4HDMA 2QRZA 1W5FA 3PUIA 5DBEX 1VL5A 4QAQA 2FUG6 4GE3A 4EY5A 1F7UA 2VDWB 1ZSNA 2YDXA 3LCCA 3REGA 3EFEA 3IGFA 1P45A 4C0SA 2QE6A 1ZS9A 1TZJA 1RC1A 2XKAA 2O57A 3QVWA 2D1FA 1KI9A 2CD7A 1GR1A 2I80A 2VQ3A 4MCHA 3RVOA 4CW7A 4D9NA 1LSUA 3STVA 2Q7OE 1PJ3A 2IEIA 1KS9A 3CF4G 3WBBA 3G2LA 4QTYA 3GNQA 1V96A 1JBKA 2WNSA 5T5QA 4PCVA 4RKRA 3VMMA 5CG2A 3U3DA 3VKHA 4IJQA 4P3OA 5ALUA 1HDXA 4ND3A 4RZUA 4HKTA 3I83A 5SZIA 5JD6A 2H7YA 1J2UA 1QHHA 2RH8A 1TC2A 4LDNA 3RF7A 5CB4B 2GXQA 3U3RA 5CW2A 2WTNA 5JXJA 1Y98A 3QFCA 4OHKA 4JLWA 2H48A 3CPJB 4ZOQI 4AJKA 1G60A 1P9RA 1NYTA 2X0KA 2FPSA 4S05A 1IM5A 4AQDA 4ZIRA 3DAPA 1SUIA 2RI0A 5K8UA 3DLAA 1I01A 4BP1A 2OGSA 1KMNA 5DBHX 1U28C 3ND7A 3URMA 3SWWA 4Q1FA 1E5LA 3NH9A 4RULA 6AT1A 5IVKA 2BMJA 3ROFA 1WU8A 4MVYA 2BM9A 1Y5LA 4LCBA 4NU6A 4GXNA 1DFHA 1W34A 4HNRA 5G1PA 3T15A 3IKTA 3QY9A 4OXKA 4AX4A 3HQ4O 4CETA 4R1PA 4CDNA 2P8SA 2Y3IA 1AG9A 2GESA 3KM0A 2OXTA 1FSPA 1EE2A 3OAAA 4US0R 3NNDA 2AOVA 3FXAA 2CSUA 3Q9UA 5CB8A 1CUUA 4HJRA 1FK8A 1B42A 1SQFA 3PD7A 4H7JA 4IMIB 4KTVE 5CPFA 5CIYA 4NU8X 1RIFA 2NTYC 4MYUA 4QGHA 5FI0B 1OXVA 1ZUNA 2WU8A 3G88A 2AS0A 4FBLA 4QOSA 3V3TA 2Z6AA 3NEYA 2X5JO 4TLAA 1QTIA 2YWDA 1DJLA 4UHDA 2ZZNA 1IHOA 4YQFA 2FETA 3UMCA 2UAGA 1SKUA 1LDBA 3K31A 4DNQA 5CURA 3ICQB 1MVOA 1KFCB 4O08A 4DMRA 2PX4A 1AXEA 1PZFA 5IC5A 2ZLBA 5NULA 2IY7A 3D8HA 4KITB 2EJVA 2BUBA 2WF6A 3HACA 4J2HA 3C3PA 2ZYVX 3N6RA 5IC6A 1ZGGA 5BSEA 3WHIA 4X1KB 1Z4LA 3F4KA 3AVWA 1XRNA 3K9GA 1Z8NA 1DBPA 3QKWA 4O0MA 2G9NA 3ZCSA 3FNBA 3K71B 1Q6YA 3FF4A 3IP7A 3L4BC 2HJVA 3UXHA 2WTAA 4WKNA 1QGDA 1W47A 2J46A 3FVWA 4NNOA 4DVJA 3G2KA 3U5TA 2C5GA 5BOSB 4EFMA 2C9BA 2XRYA 3N58A 1DQRA 3D31A 2ZIVB 1NBEA 3MMSA 4TRNA 2OILA 1LFAA 3KYDB 4OXRA 4RF3A 1FFXA 1QOQB 2WIAA 4FC7A 4MVJF 4OX9B 4MQBA 3CKLA 1TYCA 5DNYB 1EK0A 2BFAA 3F6SA 2I29A 4TOIA 3RNOA 3M6XA 3ZCRA 1PFWA 4M38A 4UEJA 5K4GA 1YBAA 4RA6A 5LOVF 1OA0A 1T36A 2N0SA 3AUKA 4QU8A 1ILWA 1DB3A 3RFUA 1QIDA 4FZ3A 4E5MA 4BKOA 5IG2A 3UG7A 1ORRA 1EWQA 3KDSE 2GKSA 3GRRA 4ETMA 2GNOA 1SD2A 3KJZA 2OB2A 1JSCA 1I3CA 1TKRA 1VYHA 1DKRA 2PG3A 3AUSA 3NT2A 4I4TA 5TMEA 4KGDA 3ZBTA 1N5OX 2BSAA 5JVDA 1OW3B 1T2FA 3F5MA 3O83A 2JIZD 3TXAA 3HJBA 3MYRA 1UEXC 4UU1A 5GIOE 1ODLA 1Z7EA 4Q47A 3HNOA 3ZY5A 4MQUA 3SLGA 2VNHA 1AE1A 1KI6B 2C3UA 3QV2A 2L17A 1ZNZA 4X6LA 4IUBS 3PX3A 4RK0A 1XFAA 2ZSJA 2C7PA 2Q5QA 1PJLA 1WXGA 4M1TA 4EECA 4EVIA 2ZROA 1E5QA 3HDHA 2OAGA 5EIOA 1KDOA 4RYDA 4E2XA 4DLYA 1M76A 1UBMS 3CVXA 1O95D 1M83A 1RLUA 3UQYS 1I7SB 5EWMB 2IYAA 1NRIA 1RWOA 2GSDA 4B4KA 2O8DA 1T29A 5IDYA 1CY0A 3C1TA 4ARSA 1RRCA 3S2UA 3BXFA 3U7RA 4EMSA 4UMFA 4TV8A 4BVJA 2QI9C 3KUUA 3ONFA 1IVSA 1VXRA 1EX1A 1KMIY 1DTWA 2P2DA 3SC4A 2WZBA 3TL2A 4BGVA 4BNUA 5A2QA 5KYGA 1XN4A 2R68A 4GUDA 5JW6A 5AM3A 3BJEA 4Y6GB 3G17A 3LAWA 1KFJB 1XV5A 4WCFC 3PFIA 4XLTA 4ZJPA 3L0SA 5DCWA 2NUTA 3Q12A 1GGJA 3Q41A 4R1SA 3SX0A 1X3SA 4O2BA 4CEHB 1D1PA 4CEJA 3EARA 5AW8A 2B6HA 5EE3A 3MW8A 1IHDA 4HGYA 5IKPA 4CJXA 1FXSA 3DDUA 2VH1A 3O5AA 5TT0A 3T3DA 3Q3EA 4QJ5A 1QNFA 5HF8A 4AMVA 5L7WA 2O8FA 1SAYA 2WU3A 4PR3A 4R98A 5A02A 4MGEA 2BTQA 2WT9A 1BE6A 4OK3A 2YHIB 5HTOA 3ROEA 2GYUA 2WWGA 1QP0A 1U9IC 2RGNA 4G8JA 5ESDA 4DRXA 5L51A 4P84A 2AN1A 2BJWA 3WB0A 4QOEA 2ZREA 3L6BA 3N0VA 1EM8A 1GKKA 1QC5B 1GUFA 2B7CA 5E4TA 2H31A 3DBLB 5TQVA 4D9BA 2PQ2A 1XNRB 5BV2P 3QBVA 3TCXB 5DDIP 4ISBA 3ZHOA 2XNDD 4KAAA 4RO0A 3W5HA 4R2IA 4RH3A 2WTXA 3N8KA 3SHTA 1JW9B 3G0CA 2VK8A 1HORA 1NI3A 3P4XA 4FYVA 3CO5A 4WNAA 5HFJA 5JMOA 3HBJA 5ED0A 4IHJF 5IEJA 4CL3A 3MD9A 2PWAA 1VGRA 4BRWA 2EYQA 2VATA 2CNLA 3FYTA 4WBNB 3SR3A 3E0QA 1O94A 4TMYA 2PUDA 1SURA 4JUBA 1CUWA 2GF9A 1K5DA 1PK7A 3SM9A 5DYWA 2IYRA 1NTRA 4F06A 3RAJA 4IGIA 4TL6A 3VZSA 5CFQA 3PNMA 1Y8AA 1KK2A 3EZFA 5HGJA 1O0CA 1HXHA 4ME6A 1QV9A 3TQHA 3K30A 4B2IA 1MQ9A 2X42A 3F47A 4C9BA 1NNI1 1QONA 3C15C 3IOCA 4RVCA 1Z4MA 1YQ9A 3N2KA 2X8LA 4MPDA 4Q7MB 4QYXA 4B9AA 2AFIA 1RRPA 4U5QA 2QLBA 3SEQA 1ODJA 3AR8A 3IHKA 4WCFB 3U1TA 5EMJA 5BMVA 4KC0A 1LXCA 3BL8A 4GOKA 1U4SA 2HV8A 3MMPA 1QBKC 5GONA 4OJKA 5TSDA 3T0FA 2NU6B 4G3XA 1JB9A 2W58A 2XYQA 2G28A 2Z95A 5FOTA 3RTCA 4CKCA 1SU4A 4M76B 3MGKA 2QTWB 2P35A 2WIGA 1SKQA 3RO7A 2IS6A 4OI4A 3O8OA 1G8SA 3K05A 1P5JA 1DCKA 3B2EA 4U2FA 4M1OA 1JHOA 2DB3A 2L42A 3DVLA 2YKGA 2W6CX 3BWVA 5ELLA 5IJ0B 5J2UF 5HNKA 2HBRA 1XEXA 1SUFA 2PT7A 3L0OA 3R5SA 5F33A 1IAVA 4JL6A 1QZXA 4Z4QA 1WCV1 3ZY3A 3WB2A 2PU5A 3EQ7A 5KWSA 3ANSA 5I45A 1KI8A 1L5OA 1XQ1A 5AMXA 4UTPA 1JDZA 1MAWA 3H0CA 4F2DA 4QQRA 1QO0D 3WZ2A 4RK7A 2JH3A 3KZMA 2HRRA 4YR7A 2A58A 1IWBB 1M9NA 2E7ZA 2MYNA 2QJOA 4JYZA 3HDVA 4IDPA 2R5WA 3UKJA 2DWOA 4D4KA 2HT1A 5D3MA 1MXFA 5DBOA 4CL0A 1YE3A 3WYGA 2ASEA 2XXJA 2FSPA 2D2XA 3FRIA 1P1KA 2G88A 2G9RA 2BEWB 5TE9A 2CXTA 3G2NA 3L07A 3TLGA 3WISA 2PMDA 4ZANA 2ZUBA 1F7VA 4BNVA 3EDYA 1NXSA 3TQSA 2YFQA 4PXSA 4EABA 2C4UA 3SF8A 4NYJR 2YJTD 1S02A 2XVAA 3WHPA 2M98A 3LV8A 3PTLA 3ETGA 3FSGA 4EA6A 2BBOA 4RC9A 3RS7A 2HRCA 3HCFA 2ACVA 2X1HA 5A0FA 1V5FA 1QVVA 1SCAA 5AVJA 3RTAA 3D2BA 4EYEA 5LU8A 4MKFA 1DJQA 3MWGA 3UOAB 4NWIA 4OFBA 1SUWA 3V8BA 5LA6B 2ZJAA 5TJ9A 2HWKA 1R9JA 4PR0A 1D4FA 4D3YA 1RWVA 2GVDC 4YCDA 3P0EA 3VZRA 5CDHA 1OWPA 1SHZA 1RWKA 3LKZA 2FW8A 4URXR 1U3FA 3AM1A 2O52A 3NHMA 3IJ5A 3CHYA 3U17A 4HQOA 4PLYA 4CF3A 3CXRA 4CIAA 4AULA 1NU6A 1RLJA 3UXYA 3DH0A 5KWVA 3L1JA 1TUGA 4H6WA 2KSQA 3RF6A 5KNCA 4QARA 3LCJA 3NTUA 1XCLA 1UT5A 3Q7PA 4WW0A 4YCJA 4QRIA 5CNIA 3HR4A 4I1PA 3M1AA 1PNQA 1HEUA 1JXMA 1RAFA 2ODPA 3DWEX 2FDCA 1DQYA 2PX5A 2QU7A 5LMZA 3JVUA 1UM9A 3MWEB 2IUEA 2HDNB 2FDXA 2QSUA 4IP0A 4PG6A 1ACMA 3LVBA 4JGBA 4X7BA 1AS2A 2IYYA 5CTJA 3T7SA 3TRJA 3EG9B 1C3LA 4EUKA 1TEHA 4ZVKA 1P77A 1P8AA 5I7HA 3CB4A 1PUJA 2D2FA 3D4PA 1RWMA 4LA4A 2JFWA 2QROA 3PYLA 2E85A 4C0BA 2PS0A 2DC1A 5LWHA 1CY7A 3ZN2A 1KSGA 1I4EB 2IPXA 3S40A 2O7RA 1SVOA 2H0AA 1N6LA 1J70A 2Z3ZA 3SVTA 1A4UA 1N0HA 3QEKA 3GA0A 5J4HA 5JT1A 2DHQA 2YR0A 1WZCA 3OKAA 3LW8A 3TR0A 4F2PA 2R8OA 3A3OA 3EIWA 3DR3A 1QZUA 2HNAA 4JI1B 1OH6A 4BBAA 3CH5A 1JQ3A 1IJFA 2QV7A 5EWJB 1JNXX 4WKBA 1E6MA 3D8UA 1D9XA 4ZDIA 1E0DA 4YDRA 2V3CC 3DMFA 1P4SA 3C6XA 2JG3A 2Q9CA 2HK9A 2JDIA 5CLIA 4D4JA 1QVZA 1N5RA 1SEPA 3OJEA 1AKMA 1H6BA 4PHCA 4QSHA 2FPRA 1FRVA 4PU0A 4ZEOA 5K4HA 5KS2A 4PFKA 2ZJYA 5TVKA 2Z9CA 2PZKA 1Z6PA 1PL0A 2B4QA 2QRHA 4O4HB 4J4HA 5E1OA 4IXDA 4HDNB 1GCIA 3R9XA 1U4NA 2FPIB 1KIMA 2H1VA 2CE7A 2I54A 3K15A 3KS9A 2AN5A 4IZHA 4KQ2A 1NATA 2IP1A 4N5LA 4QXAA 5DP2A 3PEFA 1V5IA 5D3KA 1V11A 1W4AA 1EFAA 2X1MA 3FSRA 4RJKA 4PRZA 1R6BX 4ND8A 4L50A 4GOXA 4M2LA 4AJLA 4YTEA 1YS7A 2CMDA 4DZZA 1I51A 2IJGX 2HOQA 3HDTA 2JGJA 2PWYA 3HNPA 1UAYA 4G56A 3EIUA 1RYNA 2EP7A 3HS3A 3KSZO 5AI8A 1A9XB 4NK4A 3KB6A 3QU7A 1CR4A 2PA0A 3VQTA 1YRLA 4OREX 4ZJUA 3F6BX 2JGNA 1RPZA 3FIUA 1CB0A 2IP2A 3JYLA 5F9HA 2J9GA 1K92A 4IAOA 1QU2A 2VSXA 1JLKA 4OH1A 2FQWA 1QH1A 3GWGA 2AEJA 3IEIA 4BFZA 1HH4A 3WQQA 4KU4A 2AWNA 3EULA 3QBDA 4MVJI 1WD7A 3IKVA 7ADHA 2NADA 3AVYA 1T25A 4X1IB 3UHJA 4RLQA 2NO4A 2PKWA 5DTMA 3W2TA 4V1CI 1ICEA 2JJ8A 1XQ9A 3R20A 2KX7A 3EVZA 3CLUD 2VAMA 5B58T 3WAJA 1DMRA 3CZ4A 3DCNA 3EPHA 2HCJB 1BD4A 3IAXA 4FEGA 4W5JA 2Q1UA 3L01A 1NIJA 1T2DA 4JVNA 3PQEA 1F8YA 4HSGA 1P91A 5HQTA 1TT5B 5LU9A 5TLSA 2H2AA 3KHUA 2Q6TA 2A1UB 5JAHA 4GX0A 3GP8A 1MP0A 4FMBB 3KV1A 4GMGA 4GQIA 4EQ6B 1CBUA 1DBVO 4R40A 3IEUA 3EISA 1COZA 3EY4A 5F64A 1E0JA 4MYRA 1PD0A 1FVHA 4LXGA 3INRA 4RADA 1EI9A 1FZTA 4CIDA 3TGPA 1KK0A 1VRCA 4A4DA 3RBVA 5EIWA 4M8KA 5IAOA 1Z74A 2IXAA 3VO8A 3LT2A 1DEXA 1FFSA 2GTPA 2G25A 4MCJA 3PGKA 5I3CA 1T4DA 3FSEA 2G40A 2JFHA 4K7JA 3OMLA 5K8IA 1WBJB 1E7RA 1PZXA 2NXNA 5KNBD 1Y8ZA 1T0IA 4P3PA 4QWMA 1LD3A 1T0PA 1L7PA 2ZBDA 4B44A 3IURA 2CLSA 4R1NA 4XB2A 1QMGA 4UD6A 2SKEA 4YAJA 1NWCA 1V1RA 3FDZB 1JTEA 221PA 1PFVA 4XWAA 4Z0TA 2V0NA 4TTJA 3UH1A 1HA3A 1FYVA 3EJ6A 3JD1A 4U63A 4GDFA 1O6CA 2R1ZA 1FXUA 4S0ZA 3WRXC 7YASA 2ADOA 1SEVA 3UT5A 2BMWA 3HCCA 4OFWA 2BPOA 3CWZA 4FFVA 4MO2A 3BRWD 1GNQA 4YEDA 3WLQA 3FWZA 5CH8A 4PN3A 3TSOA 1EG2A 2WWRA 3OE4A 1YVDA 3M6IA 1ZBDA 3ETHA 1RPNA 3FNIA 1M2WA 4BJ1A 3G2MA 3HRIA 5JYBA 5LNK6 1XG5A 2RHMA 4KX3A 4JUDX 3GLGB 5MGNA 2HLPA 1ICIA 1T1SA 3QU9A 1S2IA 1WB4A 4E7OA 3SSMA 4RFLA 1YWGO 2DT8A 1GUZA 5BUQA 1AKVA 1C7RA 2CV2A 1X70A 5DBIA 1W4LA 1E2DA 3LDGA 4EDFA 4Q66C 2VRWA 4WZAA 4C05A 4NCNA 4QVIA 2VSQA 3NWPA 3UJHA 1SHKA 3PSHA 4CF7A 2O5VA 2YBDA 3FHCB 1UBUS 3OC0A 2BM0A 4C0JA 5EJ5A 5KMGB 1TAHA 1DBRA 1U7OA 1ISSA 5AI4A 4H77A 1JEOA 1L7DA 3I2KA 4XLZA 1TDJA 3KCNA 5U4XA 3W2IA 5FH9A 8MHTA 1GTG1 4YP7A 4WJLA 1L7MA 2C4WA 2H5LA 1T1JA 2LR0A 1LPBB 2P6OA 3A2MA 3A70A 3OZ7A 5FB3A 1K7XB 4ZOAA 3I0ZA 1XZNA 4S1VA 3F7OA 1ZSYA 5LDHA 2GZHA 2HPAA 3L93A 4NJMB 2WA2A 1VLQA 5D86A 4I50F 3GRUA 3OQOA 5J2TA 1T5DX 1X8LA 3W2GA 1S7CA 5G40A 4PPNA 5JS8A 1B3RA 4GP7A 3ITDA 1DAGA 3EIFA 2GYWA 3BGIA 4IO0A 2XQIA 1F0NA 4L6IA 5EZ5A 3N6VA 2X9GA 5KAPA 2ENWA 4HDOB 2VUTA