3Q40A

Sulphur sad structure solution of proteinase k grown in so4-less solution.
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
279
structure length
279
Chain Sequence
b'AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title Crystallization of Macromolecules in Selenate to Solve the Phase Problem
rcsb
source organism Engyodontium album
molecule tags Hydrolase
total genus 106
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2010-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3q40A00
2W2OA 1Y3DE 2DP4E 3WIUA 3SQOA 3A3NA 2WUVA 2PWBA 3DYBA 1WMDA 1WMEA 1TM7E 1MEEA 1MPTA 3DVRX 2TECE 1Q5PA 3VSBA 1P8JA 5FBZA 1JEAA 2SICE 4HVLA 1IC6A 1YJBA 1BFUA 4B5LA 2ZWOA 4CFYA 4AKTA 3I34X 3F7MA 1CNMA 4WOBA 3GCWA 2PYZA 1CSEE 3OSZA 1V5IA 2PRKA 4J94A 1S01A 1SELA 3TI7A 3I2YX 3SICE 1SBTA 2W2NA 3F7OA 3GCXA 4WOCA 4RYDA 5I9SA 2X8JB 1GA1A 3AJ8A 3HJRA 4GI3A 1GTG1 5ARCA 4HX2A 2DQKA 1HT3A 3DE0X 2GKOA 1SCJA 3DE6X 1SCAA 3VHQA 2W2MA 1AU9A 1T1EA 3UNXA 1SVNA 1PFGA 4NE7A 1SCDA 3QTLA 3ZXYA 5JXGA 2W2QA 4BWGA 3WQBA 4MZDA 4CFZA 1V6CA 1R6VA 3VTAA 3VYVA 5JXIA 2SECE 1GNVA 1AF4A 1R0RE 1SBIA 1PTKA 2ID4A 1Y4AE 1C3LA 1NDUA 3LPDA 1SBNE 4K8RB 2ST1A 1LW6E 4H6WA 1KDVA 5AVJA 1YJAA 1Y1KE 3QMPA 4JP8A 2IY9A 4ZOQI 1Y34E 1BJRE 3PRKE 1SN7A 1DBIA 1ST3A 1GA4A 3LXUX 1AQNA 2PWAA 3DDZX 3BPSA 3DE7X 1YU6A 1AVTA 1SUDA 1SIBE 1SUBA 4AKSA 1T1GA 1Y3CE 1KE2A 1TECE 2IXTA 4OV6B 2PMWB 2Z2ZA 1SUPA 4LVOA 1PEKE 1T1IA 1AV7A 3LPAA 1NDQA 1TO2E 2ZRQA 1P7VA 1AK9A 1GTL1 4C3VA 1VSBA 3ZXXA 4NMXB 1TM1E 4OMDA 3CO0S 2V8BA 3WHIA 1UBNA 4Z2AA 1Y9ZA 3DE2X 5B1EA 1S2NA 1Y3BE 3BX1A 1BFKA 5JXJA 1Y33E 1R64A 1YJCA 4DWWA 2QTWB 5FAXA 2E1PA 5JXHA 3D43A 3WIVA 2SBTA 3EDYA 1GNSA 4ZARA 2XTJA 2DUJA 2X8JA 2Z2XA 3GT3A 1NLUA 1DUIA 1OT5A 2HD4A 3F49S 3I37X 1GCIA 3VV3A 5AQEA 3DE4X 5SICE 2SNIE 4KB5A 5K7SA 3Q5GA 1Y3FE 4H6VA 3D9QX 5CW1A 1Y4DE 2B6NA 1BH6A 1AH2A 5AMXA 1SH7A 1A2QA 3DVSX 1ZVKA 2Z58A 2Z56A 2ZWPA 3TI9A 4NE9A 3DE3X 1C9NA 3Q40A 1SIOA 1OYVA 3AJ9A 1WVMA 1KDYA 3DW3X 3EE6A 1KDZA 1TM5E 3T41A 1SUCA 2P4EA 4DZTA 4LVNA 2PQ2A 4I0WB 4YN3A 4KPGA 1EA7A 3QFHA 5AVKA 1SCBA 2WUWE 4H6XA 1EGQA 2PKCA 3DE1X 4DJ5X 3EIFA 3H42B 3A3OA 3DW1X 3L1KA 2WWTA 1PJ8A 4C3UA 3LPCA 1S02A 5ARBA 1GTJ1 1OYOA 1SPBS 3TECE 2ID8A 1SCNE 3DVQX 3PTLA 3GT4A 1C9JA 2HPZA 1P7WA 3VV2A 3AFGA 1BE6A 2WV7A 4OMCA 5ARDA 1TO1E 3A3PA 4FONA 4KG7A 1TM4E 1Y48E 5JMOA 1BE8A 4M1ZA 1SUAA 5FFNA 1SBHA 1TK2A 1THMA 1WSDA 1GT91 1TMGE 3CNQS 1SBCA 1IAVA 1WMFA 1KE1A 3DE5X 3P5BA 1GA6A 2Z30A 1C9MA 3I30X 3BGOS 1XF1A 1ZVJA 2XRMA 2Z2YA 5B1DA 3DWEX 1ST2A 1TM3E 4CG0A 2G4VA 1SIUA 1SUEA 2W2PA 2Z57A
chains in the Genus database with same CATH superfamily
2J85A 5MHTA 3D3QA 2ZBUA 5CD9A 3KZOA 4I5IA 3ELYA 3NOXA 2Q3BA 3B82A 1ZGZA 5ANRB 1P2GA 2IHTA 2OG1A 5L53A 3PF9A 2HSZA 2VRWA 2YWDA 1Z4MA 3ZE0B 3DYBA 1WMDA 4QO8A 1CUIA 1HE3A 3NGXA 1DV1A 2J08A 4NG5A 1CF4A 3UFXA 9LDTA 2APJA 1FXUA 1B3BA 4ZVUA 5BQ5A 5I7WA 3DGFC 1F6DA 3WZ2A 1U7XA 3L8EA 4A0QA 1Q6YA 2QRZA 3FYUA 2XXAA 2NTVA 4L28A 4ZGGA 2JL1A 3HEBA 4PZ0A 4G0MA 3RUPA 4I9UA 5BWNA 4UNIA 3GEIA 4KH1A 1OC2A 2CY0A 3MGCA 1Z5UA 4OHXA 1IC6A 2GQ0A 2XHEA 4MV3A 4LXGA 5BOSB 1SVMA 4YRSA 4TL6A 2QRHA 2Z6UA 2X0NA 1RD4A 2PUJA 2MINB 4HNAA 5HZHA 4IIXA 3U0BA 3IPRA 1KDYA 2JIDA 3HGTA 1BX3A 1XP5A 2A9FA 1S96A 4L8FA 4LDZA 4G4IA 2FK8A 1MB3A 1OI3A 1UKEA 4L3OA 3RS2A 2QMOA 2P7HA 4LY9A 4RQUA 2P3SA 4WXEA 3DZBA 4HH3C 1ZHFA 1YB4A 2ZQZA 4QX6A 4QGSA 1T13A 1XA4A 1G21A 5ENDA 5JD4A 2AJ8A 2OAEA 4B43A 4JEUA 1PR5A 4WADA 1UM8A 1RRVA 4KYIB 4NMHA 4I4NA 4LBZA 3E2MA 4JSTA 4KFCA 5EMHA 2Q9UA 1Z8DA 2XB9A 3U1BA 1E0AA 2XJ9A 2J3LA 1YFZA 2C78A 4PO3X 4QXOA 5EQJB 3TGPA 5C7IO 4KITB 3FJYA 5EZYF 3VNVA 5J3JA 2ZZNA 5LP6C 2PKRA 3SG0A 3O31A 3OICA 1U28C 3ZY5A 5FTWA 4IAOA 2VJDA 1Q1NA 1ZSYA 4PANA 4EYSA 7REQB 3K16A 4NZ9A 3F7OA 1KY2A 3PE3A 4A8HA 1LF5A 1L7BA 3RU2A 3E22A 3HDVA 4I50A 4AJ4A 5K6AC 2WUEA 4IGIA 5C8YB 2A84A 2P2SA 1JYSA 1S7CA 4AK9A 3U39A 4QLBA 3NIGB 2QJRA 2EC5A 3CVXA 2CLLB 1GZ6A 2OCXA 2X5OA 3LU1A 4DCNA 4RKWA 2CL7X 2UUOA 3HR4A 3CG0A 3AKEA 1II9A 1CQZA 5C3MA 4HLNA 4W5RA 1YZUA 2F2TA 4J8PA 2TMDA 2X8JB 2ZRBA 2F8SA 2VT6A 5CVEA 3ZCQA 2R8OA 3CH5A 2HYDA 4HX2A 4JR2A 3WLLA 1A97A 1ZUHA 3IL2A 2HYIC 1KQNA 2P9YA 2PS9A 3HHEA 4JELA 3HRHA 4DANA 5IUJC 2A86A 3DE0X 4LNUA 1LK7A 2IS1A 1ZOIA 3ED5A 1GUYA 4EJ6A 1UJBA 2PE5A 4KWIA 3PD1A 4BNGA 5TPZD 4ISBA 1FFSA 3ZWKA 3DWGA 1H93A 2JFBA 4K40A 1SCDA 3DV0B 4LGVA 3V33A 3VC7A 4DIOA 1E2IA 2V7PA 3BGWA 2QQ5A 3BGDA 4UM8B 3A4NA 4CCSA 1TVCA 1TJPB 1T5TA 4WCFB 4ALMA 4BNIA 3GA7A 1P29A 4L5AA 4Q4CA 4LFAB 3CPHA 1YBAA 1FVXA 1N8NA 2Q28A 4LZNA 2II6A 3PQ7A 5EHGA 1Q1ZA 2PY6A 2RKBA 1PFYA 1IZ8A 4IVPA 4ZA2A 4DWJA 2I5PO 3DOCA 2W83A 4YUZA 1EFRD 4R8SA 3ENKA 3FY4A 4AJ2A 2OYRA 5HP4A 1UZUA 2YOFA 4RK1A 2ZRHA 3F4LA 4B3BA 1J09A 1QGOA 4LXTA 5D3KA 3RAGA 3A2NA 1MC5A 3NXKA 1XQXA 5CFMA 2FRDA 5G2OA 1Z39A 1R16A 4B8WA 5DNVA 1N6KA 2UZ1B 3H2GA 4ZYWA 1AUVA 1NDUA 4JZYA 4QL3A 1E63A 1EFUA 4JUIA 1LW6E 1SZJG 3A9TA 2ZJ1A 1OZ0A 1Y1KE 2N0SA 6REQA 1YNOA 4UFPA 1QGAA 4LGCA 5FWNA 1ZIPA 3PFNA 1ZAKA 4N3NA 3BE8A 4B82A 4PPNA 5AXBA 5LA6B 1ADFA 2DKNA 3DFMA 4ZOQI 3N6VA 3PLRA 4TKLA 1OW3B 3G9ZA 3FLMA 1WTAA 4H7JA 4FGKA 4BMVA 4ZI2A 1IHDA 3PRKE 1JBQA 4PLZA 2JATA 5DBGA 1BJTA 3CW8X 4EB6B 4EPYA 1DAHA 4FR5A 3KQMA 1E2FA 3VISA 1IEQA 1E99A 3INGA 3QF4A 2OKCA 4FYWA 5AI5A 4IIYA 2QRUA 4C4RA 5K0TA 2ONCA 2C2GA 4BLVA 3EDQA 1M2WA 3N7AA 4RH0A 1LSJA 4BQFA 3TR5A 3GFRA 2R1ZA 2QYTA 2J9ZB 1EINA 4X0EA 2WHPA 4GOKA 2WJGA 1DL5A 3GLTA 4P4SA 1OV6A 1Y3CE 3CJQA 2B1RA 4XR4A 2J48A 3WR5A 1LBIA 4R2IA 3NBFA 3B8HA 2RK4A 3A1TA 4FJ1A 4D8YA 2C5EA 2G17A 3AKDA 3G8CA 3P9YA 4FB4A 3KVYA 2Z2ZA 2R1VB 3FUXA 2DE0X 2FNAA 3SVZA 3GFSA 1DAKA 2NNLD 1RW4A 1MO3A 2YRWA 3GNQA 7ADHA 1VJTA 4BE7B 4EKEA 5BQ3A 2IT1A 4TKMA 3HL0A 3T5BA 3HZOA 2Q5EA 2R87A 4ZEMA 3OF2A 2ZRQA 5JQGA 3MT9A 1TF2A 2P77A 3HJUA 3KHSA 3FWNA 1NV9A 1ZD1A 4HXYA 1ZD2P 4JASB 3NVKI 3IOBA 4KI0A 3QRWA 4I3HA 5IDQA 1L7OA 1XQ1A 1ZU5A 3E7XA 2O5VA 3Q3GE 7MHTA 4FNMA 1RQGA 1IVSA 4YTEA 1GPMA 2PU7A 3DKRA 3EWIA 1UBMS 4FCWA 3SM3A 1GR0A 4KUEA 1T8SA 1KC3A 3QMMA 4Y1GA 3WHIA 1RKUA 1N9KA 3KOXA 1Y6GA 3QXSA 1A04A 3FVVA 3OZ7A 4CM9A 4I50F 1DPGA 1ILEA 1NVUQ 3CH6A 3UICA 1W73A 3VSDA 1W2GA 2FZKA 5J5CA 5DN6A 4DW8A 2AE2A 3QNMA 2FV8A 1JHZA 2HWUA 1GGKA 3KZ1E 1BE0A 3NJ8A 4ILEA 2CN1A 3H5RA 2QAGC 2VJOA 1QK4A 1SQ6A 3GDFA 4C9BA 1G5FA 2NM0A 1PEDA 1J0CA 1WDMA 1Z0SA 2CMKA 3IUQA 4XSGA 5D00A 5DLDA 2QZJA 6Q21A 1DS6A 2C2BA 2GVNA 5JNVA 3C5WP 3RV3A 5JU6A 5CCDA 4CL0A 1Q0ZA 5ES4B 3AKYA 4RPGA 2F3TA 2V9PA 1BDBA 5M04A 1QK3A 1ZDMA 2Y67A 4YBZA 1UPAA 1XCJA 3JTMA 1W1WA 5DRTA 6YASA 4Z4CA 5BQOA 3J80A 1I7LA 4JODA 1GYQA 4HEJA 3VMFA 3R76A 3LO8A 2XVZA 2HV9A 4HJRA 2X5JO 3KEMA 1UBJS 3MTDA 1BRTA 1H2FA 2FE1A 2EKPA 2FJ0A 2LR0A 3QWIA 5FTMA 4QKQA 3WAGA 3KVVA 3PC8C 3KKNA 3KV1A 9LDBA 1Y8CA 5ECGC 4QDXA 3WOVA 5CDUA 4P35A 1YB7A 4XQEA 3H8VA 1IH8A 1KI6A 3MGBA 4GPIB 1MAAA 1SFRA 2I4IA 3BCRA 3R7WA 4JUFA 3ROGA 4UE3S 3D6VA 1II8A 1O1YA 1SOMA 1I1QB 4G84A 5HPYB 3I1FA 1S2LA 3TYXA 3P2EA 4FZRA 2C4WA 2O7VA 2HD4A 2C04A 1HURA 3ETNA 3IHTA 2B99A 2C20A 4MMZB 4OL0A 1GAXA 1J9ZA 2NO5A 4K9LA 3IVXA 4FGLA 2AR9A 10MHA 1ZG3A 2AI3A 3TD9A 4DVGA 4IJ6A 3AF5A 4KR3A 5CNMA 1LVHA 2H63A 3MWLA 1CRWG 3B38A 4AS1A 4QEDA 1AY0A 1GU1A 3QITA 3CN7A 3ZHUA 4HEQA 2P75A 3OIVA 1TXGA 4QYTA 4BFCA 2DHEA 1Z3IX 1ZN7A 5D3MA 5GJCA 2M2IA 1KHHA 4XYMA 3UQYS 1L4HA 4PN3A 4WXRA 1M2VA 5IM5A 2YIVX 2PGLA 3B6KA 5CRIA 1M7HA 1EP1B 4WEQA 1WWKA 4LAFA 4YAEA 3KALA 2PL5A 4G1FA 3UFXB 3N39C 3NKLA 4TM7A 3WNCA 2R84A 3DL7A 4XLLA 4CKWB 1G63A 1NVEA 1NKSA 1FY2A 1DDGA 3SJAA 3KSMA 4QBFA 5CVJA 4HTFA 4YMIA 2G71A 4JR1A 1L7QA 2R6HA 2BRUA 4MVJG 5IBRA 3TQSA 4QWMA 3AHGA 1ZYUA 3L4KA 1OUMA 3FUCA 2O8BB 2VSQA 3GA5A 1OIVA 4F12A 1GRQA 1EFAA 3KYBA 3ZDAA 1PRYA 1O94D 4I8DA 2CCJA 3RVOA 2GRUA 3R9XA 1HZZC 1JGTA 1TA0A 3OCXA 2HNKA 4KSCA 1YCHA 1C8VB 1GUZA 5B36A 5DN9A 2BFEA 4QEKA 2UUCB 1N4DA 4ZJYA 4QARA 2V4UA 3WNVA 2JIQA 4Y2XA 2PQ2A 4B83A 1YU9A 3NHYA 3SQLA 3W04A 1CQIB 2BFFA 3JQ7B 5LIRA 4NBTA 5EERA 4TLEA 1MHTA 5KKNB 2OILA 4KQJA 4S1WA 3V4ZA 1QE5A 4H18A 4IHKA 3FB4A 4N03A 4WLVA 4UXHA 4BCBA 4EW2A 4F1KA 5IZCA 5JQGF 4BFTA 4WINA 4DQDA 4P7BA 4RZSA 3RC9A 1N5KA 1ECLA 1TT7A 1AMNA 3R09A 2F1IA 4AJNA 2VWQA 3V8QA 2JFNA 2A58A 1VMDA 3BJIC 4TMVA 4I4IA 4EEZA 3K7EA 1O5IA 1KAQA 1DO8A 3S28A 1NUAA 3WK6A 1E9CA 3H5TA 1CF2O 4NAHA 3SHWA 1Y9EA 4LOJA 4KQXA 1J1ZA 4UHJA 5THXA 3KQLA 3UBTA 2QE7D 4WX2B 3A9RA 3HVHA 1Z06A 4F4DA 1BQ3A 1SUIA 1UFKA 4UE2A 4WQMA 3TRHA 1XNGA 5EOVA 4BLPA 3CLRD 4XYBA 3WISA 4ARVA 1DTSA 3MFYA 2IW3A 1S02A 3G1TA 3OJWA 1Z83A 2OKGA 2PGJA 2GD6A 3C87A 2QL5A 4QYIA 3VR2D 2R00A 2AYXA 4IOLA 3PNBA 4KV9A 3TPCA 2QX4A 2ZJBA 4R0MA 1J0EA 1XDSA 4GKAA 3VU9A 1UZAA 4ITRC 2HDNB 2VCHA 3L79A 3NHMA 4PLTA 2Q5HA 4U3JB 5EIOA 3TVDA 3WK5A 2M98A 2JCGA 2XOKA 1B16A 4UUBA 3T8YA 1KO4A 2PTHA 4PO9A 3A2MA 3FH0A 1MX9A 1DRUA 1NBOA 2AFHB 4LJSA 5HFAA 3GJ5A 4LNUB 3IO5A 2F3PA 4ZJZA 1WZNA 3IVGA 2OMKA 2VIIA 1BE6A 3NAMA 4TSFD 4AS3A 3SC2A 5LMNB 1XG5A 3RWOA 5B7PA 1LFAA 1DO2A 2AF3C 4C4XA 4PCVA 2HTEA 1K66A 4KWHA 3IOMA 3RF7A 4Q3AA 4NENA 2BFNA 3K20A 2DJIA 4DGQA 1TKRA 5AK4A 1ZJ5A 4TMTA 4D3SA 3EZXA 4KFTA 5D85A 1Z5PA 3BSFA 1TU4A 4IJ5A 4MS1A 3UJ8A 4CEIA 4U7WA 1GYRA 4DM4A 5CCXA 4WGFA 1U4NA 3WDMA 1Y48E 3NP9A 4AJJA 2RGWA 3ZHRA 4AQYB 4O3MA 1IEVA 3OIFA 4RHUA 1T3GA 3UB3A 2GBLA 1W5BA 3DULA 1MO6A 1DDOA 2R6FA 2HQOA 3DJFA 1DNPA 2XEDA 1HDOA 1GUAA 3B1YA 4O8ZA 1XTIA 4X3PA 4E5PA 1W0KD 1FNSA 4QDOA 4W1PA 4Z4QA 3AHEA 4JVLA 5CLLA 1XRJA 1VC2A 4FQ5A 5KHAA 5BNZA 1NYTA 4B4DA 1L4EA 1UH5A 3NWPA 4HGRA 1Y5LA 4WNAB 2QL7A 5CXUA 1SXIA 3PXGA 5CDTA 2VG8A 3KUCA 4H1UA 3AHCA 3VJLA 2G9VA 2O2SA 2VJBA 4GG1A 1VHTA 2R68A 4KKVA 4BX0A 4QT4A 1YGYA 1EJ0A 3CLSD 3AG6A 3GFPA 3G5TA 2J33A 5LLTA 5KYYB 3K70C 1ZLXA 2WC1A 1OH5A 3LYAA 4DEVA 1W1UA 1Z37A 2Q5IA 1K9VF 1O89A 2H07A 1W9MA 2Q2OA 5EXEA 2CZCA 2GJ8A 2QORA 2DH5A 3EJ6A 3THWB 3M49A 4MWSA 4GX1A 3UAXA 4I9HA 4J6FA 4LRSB 1GTVA 1NWHA 4LF6B 1WUTA 3GRFA 3I5XA 2CUTA 2J7PD 1ZNQO 3N1UA 2H4WA 3TR6A 5E1MA 3J81k 3NR2A 5B55A 2FI1A 1N5OX 4S1PA 4FHZA 1C9YA 3IMEA 1OLSA 3U09A 1M6WA 1NW3A 1PLJA 4B0PA 1NJGA 1TKBA 2KB0A 2TS1A 2Z57A 3S29A 3UBMA 4E51A 2Q0SA 4X45A 1JE0A 2WHPB 3HDJA 1U8XX 3L18A 3QVLA 1RXCA 2P40A 1X1DA 3C5HA 4P4SB 3ZY2A 4ED9A 4EMTA 1NI3A 2OO5C 1P73A 2PV7A 2B25A 2JLYA 2GHTA 4JVMA 4M1EA 4B3IA 4X54A 5AK3A 4F4HA 1KEPA 1YS1X 2PWBA 2W9XA 5K0LA 4R2KA 2EYQA 2I22A 3U4HA 5ICGA 1C2TA 4OSOA 4S1VA 5K3FA 5A9TA 4RAOA 1MEEA 2PH1A 4H15A 3EAGA 4NDZA 4ZO4A 1ND5A 3E9DA 1P2VA 4EA7A 2TECE 3HB9A 3O9MA 1Q5PA 4OKSA 1FYDA 3CQ9A 1DQRA 5KDDA 1ZGGA 2EDAA 3WWPA 1K7SN 1JEAA 2QVBA 2W93A 2BEVA 5BV1A 2ODBA 4EA9A 1PL6A 2V59A 4LV6A 3QGMA 5JD3A 1LD3A 2GEKA 2IUSA 1GPDG 1K7XB 4K3VA 1Z9BA 2H1VA 1N0VC 2I8CA 2H0AA 2NU6A 1XAIA 3FYUC 3I2IA 3KKLA 3MRTA 4I1SA 4PNPA 3FCCA 4UMDA 1GKYA 4NBKA 2XTZA 4BLOA 1CNMA 3ABSB 1EGAA 3RU7A 2YZ2A 3N07A 2G70A 2ZK7A 3QENA 4PC6A 3JARA 3AM5A 3SJ7A 1N5LA 4CNBA 4C6TA 4JJEA 3UUEA 1TJ5A 2NU7B 5F3DA 5K8VA 4P80A 5IJ9B 4DLNA 1Q6ZA 1AMUA 3HP4A 4OQ4A 4ZAGA 1W59A 4LF5B 1PGPA 2R85A 4FMCB 1BW9A 1V5IA 2PGOA 3CN9A 1N1GA 1A2BA 2G07A 4JB0A 2EKZA 4X3OA 1SELA 4HEA6 2OG2A 4KU4A 4ZO7A 4US1R 3PNLA 4HWKA 3W78A 3AU9A 4F7WA 1WLSA 3QKSA 3FLBA 3R4CA 4ZVTA 1QCYA 4URXR 4CQMA 3KQTA 4JU8A 3V7UA 3TJRA 4N5LA 5I7AA 2Q1WA 2Q6OA 1YRYE 3ONWA 3ZWMA 1Y9AA 2ZJ3A 3A4TA 2W2NA 3Q3VA 4M7PA 2VKTA 1LBHA 4QFBA 1C81A 1CY4A 2XVYA 4R9RA 1YRLA 4URUR 5BVGA 1FFXA 2AH5A 1ODLA 2B2NA 4HS4A 2BV3A 3CX8A 3H8JA 1C0KA 2B8JA 4M22A 3TOVA 4URVR 5CDHA 2VKQA 3C0KA 3EVFA 3PD7A 3PNSA 2F17A 4Q7LA 3L6DA 5AOVA 1EP2B 3OQPA 4MH0R 2OFFA 3RJ9A 4Q1AA 3DTVD 5BN3A 3IP1A 1YVDA 1GGFA 5F35A 2ZQ5A 1KK1A 2HCJB 1WB5A 1VE5A 1J7KA 1X6VA 4DCCA 1KI6B 2BCEA 2AEMA 4FFNA 3M5CA 5AKLA 2H65A 3R7WB 4AW9A 1E8NA 1II8B 2GKSA 4HDMB 5E0KB 5FADA 4F5ZA 1UBCA 4M86A 2YWRA 1FNCA 3MUFA 5ALXA 5AVSA 1ZRMA 1A9OA 2FE4A 3INTA 1KPGA 4LHZA 4MUIA 2P2YA 1TF5A 2F00A 1SZPA 1NVWQ 2JLXA 4JOSA 3E3LA 1KZHA 1Q16A 2QLMA 1A2OA 1OASA 3KWJA 2YFYA 5CUQA 3S1SA 3WBFA 2R6CA 4M98A 1TMKA 4E1BA 4FIDA 5LQJA 3ZKWA 5A05A 1ODIA 1Y4UA 1O95D 4JDPA 3U31A 1ZISA 3QFCA 4ZT3A 3CVUA 1BRMA 1EE2A 4Z3DA 3PENA 2EQ5A 4RZIA 5A5EA 4M36A 5KU7A 1P0PA 2MMCA 3KWMA 1CP2A 4MINA 3UGKA 4P4LA 3NVDA 4D4KA 2OBMA 1C7IA 5CT9A 4V0NA 3TLXA 4D92A 1AHIA 1W5FA 2KQUA 4TQUS 2C97A 5LKRA 1M1YA 3EARA 3FZQA 1CJMA 2ZW9A 4WN9B 5AVRA 4PYMA 3KCNA 4YXFA 3THYA 3R8FA 2F43A 4RZUA 5B4TA 4MCHA 4UMEA 1GM5A 2PR7A 3KZKA 4PNEA 1RC0A 2X86A 4MI1A 2GRJA 4GGOA 4TTVA 1V45E 3H87A 2GVZC 3AGQA 1IONA 3C6ZA 5BO5A 3BOSA 4EF6A 1V71A 7GPBA 1Y4AE 5FFMA 3PQDA 1EK6A 1UWLA 1C3LA 1NI4A 2O14A 2XSZD 4NRDA 1B8UA 1MVOA 5FHRA 5F2NA 3KKKA 3GBSA 1DBVO 3UMYA 1BCSB 1LJ8A 1VKHA 3PWKA 5LZ8A 1HA3A 5D3ZA 2DPGA 3GN1A 4GP6A 2BZSA 2FRDC 2IIVA 5SY6A 3R9XB 2AOUB 4HWTA 3ORYA 2XDQA 4H7HA 1GITA 2VP6A 2EGHA 1IM5A 2WMYA 3OZSA 4IG4A 4BNDB 4E11A 1KMIY 2IYPA 2BKXA 3CRW1 1EWTA 5SZHB 5TGTA 1H22A 3WFIA 3U4QA 3EIOA 4FR2A 2C5GA 2BFFB 4MB0A 4D42A 4S1OA 2ZJ8A 1CERA 1CUWA 2I34A 3KKOA 2CBXA 2IXAA 1CIJA 3A25A 4UEQA 4W8GA 1XROA 1NVDA 2XB8A 4Y9UA 2ZR8A 4YNBA 5EUQB 4YRZA 3HNOA 1E6CA 5ITSA 2HK8A 1YU6A 3R3SA 4MYRA 5HKOA 2QD5A 1DHRA 1PX2A 1B1AA 3H9CA 3M3DA 1GQSA 1Z7YA 4KAFA 5JZSA 3COWA 1F2UA 4KHPB 3DL4A 3FDIA 2ZYWX 3WFJA 2Z2IA 3I01M 2YIMA 1ZUD1 2OM6A 2V45A 2VP4A 2H3HA 2I87A 1RU3A 1WY7A 1A7UA 2X76A 4HR7A 1CF9A 3BHIA 4MMYB 4X8HA 5HMMA 3ZJ5A 4KVAA 2A4MA 4W7HA 2PMWB 4G5OA 4WW0A 1QIKA 4RELA 3MC1A 4LBWA 1NE2A 3G1WA 3C1OA 4Y6LA 7MDHA 4M89A 2X0KA 3QSYA 3DAYA 3I9LA 1CQWA 3FNIA 4KKXB 4BVKA 3OM1A 5EEHA 4R2JA 5KNLA 3HS3A 5IAOA 1JEQB 2EHDA 2YCLA 4PSVA 3DMHA 4QYIB 4EL5A 3U3MA 1ZCFA 1XF9A 4UQLA 5FOUA 2E4UA 1MB9A 1PBNA 4HRVA 4ZMBA 2XYQA 4BQOA 2XDYA 2ONJA 3H84A 3OPQA 2XNDD 3Q6MA 1VMEA 3WLTA 4NCKA 2CLEB 4JB8A 4JUCA 4EUNA 2G0TA 5KOYA 1HQDA 1GEEA 2AXEA 4FSHA 5CLFA 3A3YA 4GL2A 3A8TA 2GTHA 1UKAA 5LYYA 3FIUA 3HVUA 3OZVA 4YCNA 2PSFA 3AHJA 3BGIA 1SQFA 3EX7C 4K9SA 3CKLA 4NONA 3W3AD 2WTAA 3ZHCA 4EUSA 3DVAB 1WA5A 1U3CA 1X0XA 2W4IA 4MVWA 4BECA 3PXAA 4QM7A 1CUBA 2GCNA 2PMKA 1MGPA 4C2UA 1WOYA 4YIKA 2QZZA 5A06A 5AKIA 4C22A 4LW8A 1ENZA 1Y33E 4JU9A 2PSJA 2ZI5A 3GRVA 3GZNA 5MFZA 4G4SO 2GBCA 2O7NA 4D25A 1JL3A 3MHPA 3S70A 3MRVA 2CNBA 3CWCA 5H02A 3C5EA 3U80A 1E1KA 2HKIA 2GOYA 4I9NA 4DMFA 2M6RA 4HZGA 2R4QA 4LOAA 5HS4A 4BY9E 1P6UA 4QFDA 4D4HA 4EARA 4LJ5A 1ZUNA 2HA5A 1THGA 2IKSA 4DCPA 2P9GA 4GXNA 2POCA 1TZKA 4DPKA 1B41A 4IYRA 4EUEA 1RI2A 4XYEA 5KBYA 2OLKA 3SZOA 1G4UR 2EV9A 3FLAA 3HYSA 1GNSA 1ZD3A 2H4FA 3E9RA 4BWVA 2PUCA 3DDSA 1U3DA 1EDEA 5AOBA 5IT9A 4H0FA 2R25B 1J2UA 4H27A 4ESOA 4F86A 2V7BA 4ATNA 2ONZA 1GPUA 4FX5A 5KUTA 1CJKC 4AJIA 1OHHA 1Y7IA 2Q5JA 4QSHA 3WLKX 1JLMA 5KCZA 1NJ2A 1T3ZA 3B7PA 1X9GA 5KOJA 2BFDB 3TLYA 5I4CA 1P5FA 4Y1FA 2NZJA 2Z1MA 2IEIA 2AN4A 1OLSB 2DPMA 1G7CA 5MFPA 2H3EA 1YR8A 3QEMA 1P19A 1UOEA 4X65B 1YT5A 3EQ8A 2QLBA 1QORA 2P6PA 1AC5A 1J5XA 3HCBA 3P32A 3VPCA 3D31A 1WVGA 1DOHA 1YBVA 3DQZA 2E4ZA 4IIDA 3TKYA 2WHYA 2X0RA 3DMFA 3IAHA 1MTZA 2VT2A 2B6NA 2VPXA 4Y1EA 1BWPA 4PE5B 1XI2A 1AH2A 3V9PA 4UEJA 4FPXA 5HKKD 2XOEA 4XFJA 1QZ3A 1QZZA 3GF4A 4DRYA 4N6NA 4AZWA 1KFEB 4QBGB 4B0OA 3KSAC 4XM2A 4GOMD 1QIIA 3G0IA 4D4MA 3BDAA 3G5MA 2JAUA 1HYQA 2FVXA 1D0SA 3NORA 4MMXB 3VHRA 1N78A 1EQAA 3KB6A 1ECGA 1JIVA 4DNXA 3JD0A 1XEXB 2BEVB 4WT7A 4WHMA 2HT1A 4G6ZA 3BFPA 4U2KA 3H9JA 5KNCD 1B14A 4EHDA 4XGRA 1BS2A 1F3LA 1VKRA 1W52X 1SEPA 1YFKA 3EXG1 3HYRA 4RTOA 3CU5A 1X92A 1RLTA 1UP6A 4AI6A 5CA0B 1CXZA 2GEJA 5UKDA 5FWXA 3GLVA 1R37A 1ZP6A 2YIJA 3D7MA 2OOSA 2BRUC 3T5CA 1CUHA 4PTZA 5BOSA 4TMWA 5JY6A 5DWVA 1PU2A 2EQBA 2FRXA 3Q87B 4JB3A 4XQ0A 1VLLA 3JARB 3L0DA 3R7SA 3USES 3AT1A 4XUDA 4C6TB 1HQCA 1AZLA 1KKLA 2X5KO 3GVHA 3P9CA 2RHWA 2WIAA 4KXLA 5EJIA 4ZCLA 1Z0DA 4JLNA 1H8HA 4X20A 1RTKA 1Y1LA 3M34A 3QU7A 5GWXA 1ADCA 2W6ID 1J06A 3DZHA 3IDQA 3PYXA 2R5WA 1RI5A 1EA7A 2EL9A 4IEFB 2HJRA 4KPGA 3RUAA 3ZXSA 4D3YA 1R8YA 4NU5A 4EMBA 4OI1A 3WB9A 1PJZA 2C7OA 2Z3VA 1E0KA 1SA0A 2XA9A 4KDCA 1DQPA 1I9GA 4PBRA 3UIEA 5KZMB 4GSKA 3RSQA 3FFBA 1VGQA 1Z07A 4D97A 1R6DA 2XRYA 3O4VA 4TQAA 3RGWS 1X19A 1Z2AA 3PPIA 4QOJA 4CQMB 1RM5A 3CUEF 2P1ZA 3MCVA 2RH9B 4IH4A 5IZCC 3VKGA 1EK5A 5IC4A 3MQ4A 1W30A 5KYWA 5LUAA 4EW1A 4G9GA 3S55A 2ABWA 2J07A 5BVGB 2YWCA 1NY5A 3U62A 4BB6A 3H2HA 1GNQA 3H97A 3I9NA 5CX1A 1I0IA 3KFXA 5INTA 4PC3A 4BEWA 2XQIA 4LRXA 5LZ2A 1LWOA 4KXWA 1OPRA 2AOTB 3KNZA 2FP3A 2VDUE 1QO7A 1X7YA 4WLFA 5F1OA 5JD5A 1L4BA 1SB9A 1QKIA 1SPBS 5CHEA 5E3IA 5B1SA 3E48A 4ZJUA 3IMGA 1KGSA 3DVQX 4QYWA 3ZYZA 4G81A 3BRWA 5J2TB 2HB6A 1OC4A 3HBAA 2CL6X 1TDJA 1NQAO 5G4LA 1NPTO 2ZB3A 4HNRA 4CEJA 3S2SA 2BOVA 3DHEA 5AW9A 1DC5A 2FDRA 3UAZA 4P3NA 2QUZA 4GICA 4K6OA 2YFKA 4Y1RA 5CX4A 4DR1B 1U8ZA 5JUWA 1G9SA 1UBGA 2OXCA 2QVYX 1MJNA 3GG2A 1KYTA 4TN1A 4B3DA 3UJHA 2WJZB 3CM0A 1K0FA 5B6IA 4BGDA 3WLEA 2OV2A 2ZYRA 2NP6A 3M7IA 2OV3A 4CM3A 2AJDA 3EA0A 2FPOA 1QWSA 3WS7A 1JDUA 4C7BA 4ZKEA 4F3RA 1NG9A 4ZCRA 1VL0A 3ELBA 9GPBA 3CONA 4R2LA 1YR6A 2SKEA 2RI6A 4DY4A 2JG3A 4Z53A 1A50B 4NMLA 5JAZA 2C5FA 3YASA 1QKJA 1ZUIA 3DR3A 1C7FA 2GHQA 4NU0A 1M1YB 3THYB 4CHTA 2F8LA 4LUCA 2F43B 2WWGA 1M1YE 1SC9A 5IJAA 2W70A 2JD1A 2VTDA 5IAEA 4MW7A 2ENWA 1W4ZA 1XZAA 2CFTA 3NTLA 1U0FA 1GFZA 4B1FA 2XRFA 2LCIA 2GBLC 3E9MA 4AICA 4GKBA 4MVJD 4PQEA 2CXOA 5DTMA 2QN1A 1NI4B 2X7HA 4P2BA 2I6TA 1OPXA 1WETA 5JJLA 4I1UA 4RORA 2HQSA 4NV3A 1G8MA 4K9PA 1E7MA 4I46A 2ZRFA 3O1IC 1S3IA 2UXDB 1M8KA 5CIQA 1TAGA 1CR1A 3A11A 1Z2NX 3ABQB 3LC0A 4HDSA 3JAWA 1U0EA 3RIXA 4F1JA 4RD4A 2P9BA 5F1KA 2I2XB 1T3TA 2Q29A 3MYYA 3KD2A 5ADWA 3OZUA 3TQQA 1XF1A 3CF4A 2QTGA 2ZTHA 3OQNA 1UOQA 1G3IA 5B1DA 3U4QB 1FFDA 1GTZA 4UTVA 2H2WA 2VHWA 3DZCA 2ZCJA 4FNGA 2Y1KA 3ELUA 2V55B 4REQA 1CB0A 3GEHA 4C5BA 1U8YA 1KI8A 1SUFA 1D6SA 1KVSA 3DQQA 1P9LA 4MKXA 2IELA 2GD2A 2PD4A 4RC9A 5DSXA 2EP8A 2Q3HA 1HYGA 1T3LA 2VSFA 3W2IA 4GH5A 1ZWKA 1HLFA 2H51A 1F2UB 2DP4E 1W29A 2QY6A 2VHJA 5HK8A 1WZCA 2FK7A 2YQZA 3KOZA 5DXJA 1PR9A 4EHFA 1ECPA 3HQ4O 1YJ5A 2JKZA 1UJ6A 3EVBA 3HU3A 2WIGA 1HYEA 1HY3A 1U1IA 3PPXA 1JA0A 5JVDF 3J81A 3H13A 5A1TA 1I3LA 1RIIA 2HK9A 4BKUA 3ORRA 5FBKA 1QM5A 2EDCA 2EJWA 5EJ6A 3JQ6A 3MAGA 3K8OE 1A82A 1EVQA 4DE5A 3J7AC 1K7EB 1I7DA 4V1CI 2VH2A 5EKUA 1EXWA 1NXXA 5AJTA 4GMFA 3RFXA 3JVUA 4BVEA 5H4GA 1IB0A 2IYUA 4XB6B 2EEZA 3LI2A 4U2BA 2COUA 2ZS7A 4XD7A 3ZWVA 4FWTA 4E07A 4IG9A 2HLDA 4HDNB 1RAAA 4V0RA 5IKOA 4QOIA 5T7BA 2EKDA 3SSNA 1C7ZA 2ZWOA 5ALHA 3C3PA 3CLUC 1M1ZA 2WU8A 5FNVB 1JAXA 1KQOA 3NHZA 3W4JA 3WP1B 6PFKA 1G7RA 5JYBA 3O26A 1V3QE 2EGGA 1NJ6A 2YWEA 3IJ5A 4GRDA 2XCIA 5D2CA 4WK4B 4WCVA 2I99A 5AKEA 1IPFA 1K3TA 2UYCA 5CXSA 4UD2A 2PIAA 4UFNA 1GPYA 1UJNA 4JXJA 5JNTA 1NONA 3KU1A 4QQFA 1N0HA 4I1RA 2XMGA 2YVKA 3KTAA 3UVEA 1VJ0A 3I9V1 2V5VA 1NBWB 2ERXA 2FPGA 4KVGA 4UPVA 4RTQA 5HJ7A 4C2TA 2YDYA 2AVNA 4UC0A 1OE0A 3B9PA 3GZNB 4V02A 1DWOA 2J6BA 4WECA 3IUEA 4I81A 2H1WA 3TX6A 1Y8QA 2OVBA 4IIFA 4MRAA 1PWYE 3UXEA 3E35A 1SBTA 1RACA 3ESAA 3QPDA 4Q0MA 1USIA 1B15A 1VCOA 3BMOA 1GZDA 1RIFA 1S3FA 1RE0A 4FX2A 1USGA 1ZUNB 1BX1A 1P1FA 4UDOA 3WVNA 4YCDA 2ZBGA 3DZ8A 3E4CA 4MYUA 4OSEA 1IXZA 5CCEA 3FR8A 4TXHA 4UDXX 3CNLA 4BKMA 2R96A 1LLDA 3CNEA 4JL6A 3B1XA 2DG2A 4WOCA 1WUYA 4ZAZA 4RTNA 1M76A 2V3WA 4V03A 5EMMA 5CH5A 2H4YA 4LJ7A 3INNA 1XJWA 4IGEA 4MGYR 4PVCA 1M75A 3TW0A 4EFLA 4M6WA 4NICA 3FZGA 3O91A 2BD0A 5T67A 2AR7A 3Q85A 4TXMA 4DOMA 4E32A 3UEOA 3KAJA 5COBA 5IDWA 4ZOBA 1SQ5A 4AX4A 2FGJA 2C2KA 1G6KA 4G63A 2R8YA 1J22A 3BCSA 3DAPA 4XEUA 4B34A 3GJ4A 3U6KA 4DJAA 4AWAA 2EL7A 3ND8A 5B2FA 4ZVMA 3R5FA 4E2ZA 4LMPA 4IXMA 4WASA 3ZE9A 4EHHA 1MEJA 1I8TA 1ZONA 1W5EA 4PIMA 1XP8A 4W8HA 1XDDA 1XQVA 4LSGA 2IA5A 4OGGA 1KAHA 5L3SA 1HEIA 1Q0LA 3EZNA 3MTBA 1M8FA 3D7NA 5KAMA 4XDYA 1DOZA 2VAWA 1OBOA 4MLPA 3SU8A 1U04A 1Q95A 1U99A 4XGIA 2D1FA 2JZOA 3JQ9A 3DEKA 3RRJA 3V5NA 5I7FA 3FB1A 1FDUA 5K8JB 3EH1A 4BWGA 1NP7A 3ANTA 3DOJA 4ZOLA 4AG3A 4O4HA 1Z38A 4Q16A 3AP1A 4R54A 3R4VA 4B6RA 3V46A 4U2GA 3VYVA 4MJ7A 3T4XA 3PLAE 4YT4A 2XGOA 3RD5A 1ZIXA 3EEQA 5E6SA 1IXKA 4TVBA 1VI2A 3JR7A 1R8QA 2QP9X 3IULA 4JJZA 5DNCA 2XT9A 2FMKA 2ZR0A 4JOBA 5BVHA 2O59A 1NOKA 3M4NA 3PDUA 1HOXA 2A7QA 1R4MA 4KIUA 4DLAA 1N8TA 2EVWX 1DRKA 4IIJB 4LDQA 3UGQA 3HJCA 3V48A 1LTKA 1NRWA 4F8YA 1IJEA 3KEGA 1C14A 1E61A 2HC9A 3BS4A 3WDLA 3RBAA 4HB3A 3OQ1A 1JRLA 4FBLA 3RJZA 1JZSA 2VDKB 3F3YA 4CWAA 1P45A 5A9SB 2P41A 2O7RA 3DKVA 3Q5EA 2X77A 4NCHA 3I42A 3BYZA 1RPJA 1G8SA 5EXSA 2Q7DA 2AMYA 3TD2A 2PKWA 4DIEA 2PLWA 2P2NA 2Q1XA 2QIOA 4DZZA 2CZQA 4Q9IA 3D6NB 3HY4A 1UJ5A 1WU7A 4RDCA 5CT8A 4G37A 5IMSA 4B4VA 1B42A 4DCVA 1H3FA 4AJPA 3PWTA 4TQ9A 3EPHA 1JW9B 1J00A 4V3BA 1WB4A 4L5YA 4PLCA 4KDFA 4ASUD 1HLGA 5BNWA 5GV8A 2AG1A 4X62B 1L4MA 3AI1A 2QVLA 2HRRA 4C4ZA 1AHHA 2HIHA 3IE0A 4AUNA 4QOFA 3K6KA 2R4UA 1NT4A 3H3XA 1OH8A 5DU2A 4BE4A 1NQVA 4KYTA 3RG8A 2AMLA 5C7YA 3BQNB 1PEKE 2AMFA 1T1IA 3MLEA 2P65A 4IZOA 4TWRA 3U37A 2DPYA 3PFGA 2PL3A 1CDZA 1Y6JA 1GFSA 5J2UB 1N2JA 4C7XA 3K9NA 5AWFC 2EFHB 4AS2A 3SR4A 4MW4A 3DD5A 3P1JA 1R66A 4EK9A 1OKKA 3F6PA 2R6R1 4RMNA 1QIFA 3VR6D 1P7YA 2ADFA 2QJTA 2VT3A 3DVLA 5FPSA 3R0JA 1RQNA 2IHZA 4U2EA 5F5NA 3AR7A 3AEZA 4X1YA 3RSZA 3QSGA 3U44B 2CNWD 4LVUA 5FORA 2WWHA 1V16A 3EGWA 4QEZA 1LRLA 4IDFA 4NZYA 4QOHA 5BYBA 3LVBA 2X3YA 2CXSA 2NG1A 1RWOA 4K6HA 4RQBA 2CCKA 5DSTA 3NYRA 5TXGA 3VZCA 3WGVA 2H29A 5CDYA 4QJ5A 5DNUA 4B80A 2OD7A 2PUEA 4M3NA 2X8LA 2HWXA 1DFIA 3GPIA 1AGRA 2ZRPA 4MNTA 4ZQIA 4YI3A 2QXYA 1MD9A 2PHZA 2GLUA 2W48A 1WUHS 5AKJA 4RJTA 2CCGA 1TUIA 4YLGA 3OTGA 4YRKA 1RI3A 3FAKA 5FBHA 3UT5A 4RSGA 2BKEA 2C03A 2JBAB 4MXDA 3IJRA 4RE6A 3EPKA 3Q1KA 4BNTA 3F8SA 3QUQA 5U9CA 1I7SB 2O0LA 1GZHB 4WRRA 4HRAA 5CW2A 5IHXA 2JCXA 1Z0KA 3LDHA 3VKUA 2JANA 4YUYA 2B4YA 2GERA 4CKCB 3MG9A 1P60A 5LQAA 1E7SA 3OIYA 4IVNA 4OHZA 3VSCA 3PE4A 3GYBA 3QTTA 4BUZA 5ULLA 4HBZA 3KBBA 4JLAA 4C0WA 3SYKA 2VP9A 2BEWA 4GSLA 3D43A 4JITA 2O2JA 3GHYA 6ADHA 2NO4A 1X3LA 5ICSA 2PA0A 4E08A 2L82A 2QE6A 4WDRA 1QMPA 3U81A 3ZU5A 4NFYA 3UF0A 3HCPA 3NBZC 1GGMA 3DTVA 2SBTA 3P7MA 4PV7A 2V5UA 4X24A 1IPHA 3WIVA 4YRQA 1EP3B 2KPOA 2WYUA 3E5HA 4KIJA 3SQDA 3OM9A 1JR6A 3NOVA 2OAGA 1U7WA 3JAWB 4O2BF 1XQ6A 2P9EA 3I05A 4GPBA 4R1UA 1K5GA 5TQJA 2HRZA 5FRDA 2O2ZA 4ZOLF 1M1XB 4H60A 4CJXA 3OEHD 2BLLA 2OBXA 4JB2A 4O4HF 4KZKA 3SF0A 5JISA 1CEXA 3BAZA 3NDPA 5CEFA 1VL6A 3GT3A 2HCRA 1C4OA 2NO7A 1O6GA 3OG9A 5E6RA 5GP1A 2FWRA 1AQJA 3IE1A 1PCXA 2BH9A 3HCWA 1KZ1A 3AEYA 2MSWA 1RXUA 2NLOA 3PS9A 3ZCUA 5AI6A 3AEUA 2X6QA 2XZDA 1PEYA 3DHNA 3NRJA 4AP6A 2OLEA 4GFDA 5SYAA 1FTNA 3OM8A 1Y5MA 4OUDB 4ALNA 1U1EA 4L95C 5AOAA 1ISMA 3BFXA 1IMJA 1BH6A 1QFSA 1WX1A 3DEIA 4F06A 3PEUA 2YYAA 3EZYA 4M76B 4MR8B 1FS4A 3VNBA 4EOGA 4ZXFA 3D64A 3V8EA 4OY3A 1CP3A 2YUTA 1KZYC 1QHIA 1SR8A 2O2CA 4CUZA 4G97A 2HMVA 2C9CA 4BC0A 3QM1A 5FTJA 2GPJA 2HH9A 1A69A 2VDNB 2ZE6A 4Y9SA 5AVYA 5KTNA 3DMDA 2XT6A 1T6NA 5AT1A 5FBVB 1YS4A 2JLUA 3JQAD 3PXXA 4PG4A 1TYDE 3Q8LA 1CR0A 5KVQA 3ZCTA 1OYVA 2R8ZA 1JG7A 1I7QB 2JF0A 5F64A 1WVMA 3MZ0A 2V7GA 1TF7A 4WZBB 2PT9A 4FHCA 2HBQA 4WZBE 1KDZA 3TRIA 3NDJA 4KRXA 3K92A 3QX7A 3W77A 5FULA 4AY3A 2GPNA 5BMOA 3WGZA 4BIIA 3HKEA 4TSRA 1V8DA 1RWWA 3INRA 4C43A 3A1UA 2XF2A 4O8CA 5BMVA 5IK2D 5CYPA 2C84A 4KAAA 3IP3A 3L7JA 2PUTA 3QHPA 2WU3A 3L0YA 4K46A 4QGFA 4I0WB 1EWQA 5FOWA 3TRDA 5B6PA 4D9FA 3VPHA 4I5DA 1I5RA 4UW9A 5GGYA 4YRAA 4BLSA 3TJMA 2MSLA 2VHQA 3O4IA 2IPLA 5AW5A 1WY5A 4XVQA 3HUTA 2VAXA 3QFHA 5ERGB 4TL7A 1X9IA 3EIHA 4P53A 3Q8KA 4PLGA 3LP6A 1PZFA 1EGQA 1AK2A 1W49A 1Y8QB 3PC2A 4OJMX 4EG3A 2QMYA 1KKMA 4UVDA 4MR9A 3EIFA 5H82A 3WJAA 2O3RA 2YINC 2EYUA 3DW1X 2IS6A 2QN6A 2QUBA 1NNEA 1XWWA 1CRZA 2R48A 4DV2B 5EQFA 2AIRA 1AZSC 3CINA 4FE4A 3TTWA 4ZHQA 4X6XA 4N3GA 1N8SA 4NCBA 4XPIA 1HDIA 3N2IA 4L08A 2WJ4A 5IAJA 3GELA 3RYCA 2O2GA 1RR6A 2GM9A 4KC0A 1I4LD 4KQEA 4L4RA 1TEHA 1EBBA 4ZVRA 3L7MA 4XQGA 1FMTA 4IL5A 4F4JA 1PAUA 3ZEIA 2PKEA 3DLAA 3UK2A 2I0FA 5K8UA 4LC0A 1CQXA 1E7WA 1IEWA 3Q3HA 3LGXA 4P5PA 3SPXA 4J0JA 4YRPA 2ZZMA 1J39A 1DBQA 4KLAA 3NTRA 1VIMA 2IU6A 3IQDB 1RRCA 4UNQA 2J87A 3UKOA 3TIGA 3IAS6 3NUQA 2JGMA 3M33A 1V5GA 4X63A 3PGKA 1ZN2A 1FFWA 1A9YA 4B32A 1D1TA 1T5IA 3EQ2A 3R0VA 3G79A 2WWFA 4JNCA 4PX2A 4W1QA 4EGQA 5L95A 4DSZA 1THZA 2GJ4A 1U8FO 3JWEA 5FPPA 3B8EA 2P0YA 3L7YA 4QOEA 4ZDKA 1CHNA 4NK4A 1W5TA 1YIDA 4RFSB 4DAOA 3Q15C 4C4YA 4RTKA 3N0TA 4W9RA 4ETMA 3O74A 4GBMA 3ME5A 4C03A 1I7PA 2LV8A 3ZE2B 5A0TA 4QDJA 2WPDD 5JADA 4O4HB 4YDHB 3OIGA 3P27A 5JFGA 1SBHA 1Z0JA 4UU8A 4PGHA 1QYIA 4G0OA 1RCUA 3O93A 2QENA 2X9LA 1VCIA 2J0SA 4JBNA 4FB5A 2C8JA 2NV6A 4O4IF 4QVKA 5BVHB 2VSNA 2HNBA 1THMA 1BD3A 2QW8A 3DOIA 4KXUA 4EA6A 3W5JA 2P6MA 3K05A 1GSIA 3DAOA 5AQ1A 4YP9A 1XMSA 1O4WA 1E2EA 5TY0A 2NADA 4Y2JA 2QTMA 3PQ3A 3RK4A 3TR0A 1WMFA 3KXKA 1E2HA 3EMVA 4AY6A 2RGGA 1JEYA 1R9GA 2OXRA 5HE9A 3HU1A 2XF8A 5AUQA 2FTKE 4IDGA 4RVCA 2KSQA 3I30X 3TGWA 5LD2B 2CLSA 2NZUG 3BDIA 3BGOS 4H77A 4BMZA 3IKTA 1TGVA 3SVTA 5IT4A 4MHTA 1L5YA 1Z47A 2HF9A 3T7TA 1N2HA 2HRBA 4PHTA 521PA 3VBCA 1IULA 1Z6QA 4XVHA 4BGVA 4DGSA 2WAOA 2D62A 4W8OA 4ZQFA 2V4MA 3SIRA 1E6WA 1KS2A 3WQHA 4KXXA 1IOZA 1OA1A 2Z5VA 3AEXA 2J6HA 1U63A 3BICA 3JQBA 4MIEA 4ZEOA 3BTOA 1X13A 1Z28A 2W2PA 4H3HB 3W5VA 2WT9A 1E6MA 3B3FA 3WBBA 2GJ9A 3COZA 3FSGD 3H2SA 1Q77A 4PIPA 1DXOA 3BB3A 3N86A 1DIHA 1CJVC 1FBNA 1LSOA 1MN6A 1J0BA 1JI3A 1FXWA 3V3TA 4BRZA 5JNSA 5DHQA 1D2HA 3O84A 2OK8A 4IFBA 2VN8A 4UUNA 2DZDA 4XXHA 1G6OA 3N6XA 5AVZA 2C54A 5DYIA 1Z5GA 3OIDA 1J1UA 3AMVA 2J45A 2O07A 3VOSA 4DDMA 4BMCA 1JIUA 1VHLA 4DIUA 3SE0A 5F9HA 4HAUA 3LKBA 1R5NA 1KI9A 3G2IA 3QH4A 1JFFA 3B85A 4K7JA 1EWKA 2VWPA 4R6XA 2CW5A 4TN5A 3T1NA 1WXDA 1QO0A 4ZZ1A 5E1BA 1M0EA 1M1NB 1ZIDA 2MSKA 2QUKA 3ZU6A 2Q8NA 3C7AA 2AFVA 1C0EA 2V7UA 1IU9A 1DKUA 1SHZA 2VYQA 2C98A 1Y37A 2X5NA 3QUTA 4DJEC 5BWBA 5LOVA 5JJIA 1BSVA 4DLLA 1PWEA 2Z8YM 3D0KA 1Z26A 2ARKA 3AWDA 3H1GA 1YWGO 2XA1A 1XHLA 2ZR9A 3P26A 4HB4A 4Q1VA 4DRXA 2FCRA 2ZBRA 3EUFA 4Z1MD 3HTXA 1I13A 3I73A 4ZHQF 1BCRA 1CUXA 4G5GA 5L9AA 2PA3A 4HGNA 4BNMA 2CDBA 1R8SA 1PT5A 1AUOA 2FEXA 2ORVA 3G17A 2P9TA 2PYZA 3E82A 5PGMA 8ABPA 2CLHB 5HA5A 3A0RB 2QSUA 3WADA 4DQUA 3NWJA 1PR2A 3L1UA 1RQXA 3IUBA 3ZJYA 5GV7A 4G41A 2QTVA 5BNTA 3RUFA 3IBTA 2J3JA 3G9QA 2RKOA 1B3RA 1VPVA 2Z5FA 4TTRA 2QJOA 4QQRA 3GMSA 2L69A 1GCOA 3HN6A 1R6BX 3DYVA 2GAJA 5FOXA 5H83A 4LHVA 3CLTD 2XNKA 3OWXA 1JB1A 1ODFA 2BP7B 4EBFA 5KSZA 1KYQA 2CXTA 2Q3LA 1VYTA 3PITA 2GA9A 3QU5A 1FC0A 2IUFA 2P2ZA 2BEWB 3DHWC 3S8EA 1JQ5A 4K86A 1QTQA 1H5UA 3EVNA 3Q6IA 5DK4A 1DIRA 2GR9A 4PO8A 3TMYA 2ZJ6A 3WWZA 3LFTA 1Z8FA 4YJ2A 1WV0A 4IGFA 1Z73A 2XAAA 3THXA 3DFZA 3ZDFA 5CVTA 4LF7B 3DTVB 2YBDA 3LQ2A 3CBQA 4JYPA 1YA4A 2VAVA 1RP7A 1OIXA 1YQEA 1WCWA 3MWYW 1L5ZA 3THOA 2ZIVB 1FSZA 3FHJA 4LDPA 1I51A 4FC6A 5E9JA 4EO9A 1Z6YA 4W5OA 4DPMA 1IJBA 5F98A 1WHTA 3TZCA 1GA1A 1IEXA 3W1EA 3VVLA 5FB3A 3TRKA 3WV4A 4GI3A 4N41A 1F8FA 3BJRA 3UUWA 1U9YA 2H4ZA 1GY8A 1LKZA 5JY1A 5E6RB 5B58T 3ZJUA 1VA4A 1Z4IA 3MCAA 4MW2A 2PXAA 2V7VA 3UMGA 2AI2A 1XMOB 2GN1A 1A9TA 3URMA 3V8MA 3K15A 1BNCA 5EJEA 3O8CA 3ML1A 3L4EA 1YVPA 4POOA 2ZM6B 4DM3A 4DNOA 4IWNA 3OA0A 1ZI9A 3I6BA 5T57A 3HM9A 3AEUB 1S2IA 2CMHA 4RNCA 2F9MA 4CT5A 1PJ3A 2X9NA 3W9YA 3BHJA 3NHWA 4WJKB 2BZ0A 4KXYA 5SYNA 1R88A 3Q0IA 1DKNA 4H4EA 4QTZA 4V0QA 5FUMA 5TT1A 2QSYA 3I76A 4JX8A 2VUSA 4F2HA 5A62A 5F52A 1N34B 4XCQA 4Z4GA 3HZHA 3TQTA 2YW9A 3VTAA 1JHVA 2A9OA 3E05A 2P9ZA 1UMBA 3JQ9C 3RSOA 2WVJA 4M1OA 3H19A 3L8ZA 2XYVA 1H2EA 1M67A 3TSYA 1DJOA 2WIDA 3OCVA 4CM5A 5J4HA 4JUDX 1SO8A 2Y1XA 1M7GA 2JS7A 2R6ZA 3PI6A 2I76A 3WYGA 4AFNA 1E5QA 4Z4FA 2B20A 4CUKA 1BVUA 3PXEA 2HJSA 1YZ3A 2C7PA 3AHIA 1SQ0A 1NQXA 1X9HA 4B31A 4KMOA 4M37A 4DIKA 3N53A 2H54A 4OLAA 4XEHA 5BSFA 4MJXA 4ENRA 5JSHA 5KVSA 1LTHR 3HG7A 3ETGA 4ARUA 2EZ4A 2ZREA 1NTOA 1LDNA 3N70A 2GAIA 3ZDEA 3H5OA 4KIFA 5BMVB 2R86A 4JP2A 3O7MA 3A4VA 1CC1S 3MTIA 1BQ4A 4ER0A 1NC1A 4NOMA 2I3GA 3MUEA 4GUAA 4Z9BA 3TE6A 2Q3DA 4E5KA 2FSHA 1CBUA 1OX4A 2NO1A 4CQNA 2VCYA 4YXWD 3I9FA 1LX7A 4YP0A 2W2KB 4C78A 3M5DA 4CCWA 2VJKA 3GARA 1QCCA 2IUYA 5JH7A 4MA5A 5K3SA 2O48X 4O3FA 1ORDA 1WZIA 2CLKB 3TIVA 3BD7A 4JBYA 1K6IA 4O63O 2IC5A 4U5XA 3PCTA 4RA6A 5LOVF 2CXPA 3LHIA 3SHVA 1IZ0A 1D6MA 2BGLA 2IP2A 5LN1A 2A9VA 1G59A 3HCRA 3QI2A 4ME6A 1OWPA 2QLTA 3DTNA 4MR9B 4YV1A 5JQWA 1E4OA 3VR5D 5DYGA 2XE7A 4L5JA 4BO6A 3QUCA 3D8RA 2NTNA 3OKAA 4ZT6A 3PHJA 1UKYA 2C1EA 2E89A 3LBAA 3LP8A 4PAWA 4ZI7A 1F7UA 3BH0A 4X84A 1JG2A 2OCAA 3F7NA 3HR8A 5IJ0A 3OQVA 4XPIB 4JX9A 4FUQA 2SKCA 4F92B 2QIPA 4JBGA 2A0YA 1NY6A 2HU2A 2DJ5A 2ERCA 2YXLA 2EWWA 3AHHA 3WGKA 5HKBA 1TAHA 4PS1A 1RP1A 1IZ7A 2KM1A 3FA2A 3I6QA 1T2CA 2ZYSA 3MWJA 4IMIB 4JSRA 4KO8A 4C0XA 2O8NA 5KU1A 2QNIA 4Q7KA 4QQNA 1WCXA 3E9ZA 2FP4B 3LG2A 4CTNA 4DV4B 1NYRA 3GDOA 4Q03A 3IHLA 2DUUA 4NZOA 4LF9B 1DP4A 2QD1A 2FHPA 1B74A 4R4JA 2C99A 2Z9DA 3SLGA 5FAKA 4G25A 2KI5A 4N9WA 1K92A 1ZCAA 1T2NA 2QA5A 3VYRB 2ZR7A 3LCRA 3K0FA 3R5SA 3SK0A 1EB9A 2Q62A 1Y9ZA 2PX3A 4YJ2F 2K87A 1V4VA 1H9AA 5TLSA 5DHTA 5TR9A 2CF5A 1OXBB 4H16A 4R69A 3KJEA 5AO9A 2UZIR 2BSXA 4K6MA 5C5EA 1XEFA 2D5CA 1YQUA 3EAQA 5L4SA 4P33A 4JK3A 2QP4A 5HX7A 4Y2RA 1B8PA 1KTIA 1TUGA 1Z4KA 5KHLB 1JIQA 4G07A 4IHJB 4L51A 3PUZA 4NIMA 4OD0A 4UBLA 4UTPA 2F3SA 1KMNA 3BHMA 3EEYA 3S6JA 2AX3A 3VX3A 3UMJA 2I7XA 2E6KA 1ZD9A 3K0HA 4KE8A 4DDUA 1YI8A 3KG2A 3CNOA 2NPOA 5J58A 3HWX1 3SLKA 3VDQA 3K5IA 5JHGB 3C74A 1WDTA 3QIVA 3G2OA 2B0CA 5DNWA 3WBJA 3GX1A 721PA 4MW5A 3OE7D 3NBYC 2GCIA 4KLNA 2TMYA 2D00A 2DMRA 3FROA 3ORQA 4PZYA 3A9UA 4CODB 4EDFA 1AV6A 3O2JA 5K9ZA 1SHJA 2E1RA 5JOQA 3MERA 4K9MA 4DV5B 4RVFA 1QIGA 1P1HA 5E0OA 2WZDA 4MVXA 3IKVA 3BK7A 2XTJA 3ZIAD 1RYYA 2ZI4A 5C80A 4HAXA 3EZFA 1RZ3A 1GO2A 3ZWDA 2IHVA 5DX1A 2W0MA 4UTRA 4LFBB 2Q3JA 1QDEA 1F8GA 4FKMA 4AO7A 4DMUB 1PNRA 2E5WA 5C9ZA 1VE9A 3D5QA 4XYGA 2IYWA 1TYAE 1Z5VA 1RE1A 3DL2A 5CFNA 3U7GA 4WXPA 1BXRA 3H5VA 4RUKA 1KRXA 4GPEA 4MVJI 3PEWA 3PNQA 2OCBA 5TS3A 4L72A 3BFVA 4LZAA 4C30A 3ROPA 2WRZA 2WYHA 2UYQA 4BWYA 1EEHA 5C53B 3DXZA 2VQ3A 4PSUA 3RW9A 1R5JA 3IX7A 1FQOA 1M2EA 3NHJA 2VSXA 1PF7E 1SH7A 1E1YA 1A2QA 2HLPA 4QDZA 5E7JA 1Z74A 3RHZA 5LDHA 3HEMA 1VL5A 4WI1A 1RHMA 3LHFA 4LXQA 2C7GA 3OPYA 3F6CA 3AOGA 2XNJA 1D0VA 4CEHA 4A0HA 1P2DA 1V2HE 4M9XA 2CT8A 1QHGA 3H05A 3VR0A 5JH7F 5G1NA 2IOYA 1MJFA 1JVNA 1HDEA 1WF3A 2CBZA 2FFJA 1AGYA 2Q6IA 3MPOA 1QF7A 2XZLA 4G26A 1MOQA 4MSUA 2NNWB 2A8YA 2DUWA 2GZRA 3K94A 4NC9A 1OXSC 4A5SA 3G2KA 3MPUA 3C3AA 1E2JA 1QPGA 1VKOA 4FFWA 4OXKA 3EE6A 4UAVA 4M60A 2UUBB 2JJ1D 3U6BA 3AJAA 4R3NA 5BYAA 1RRKA 3CCCA 2VPQA 3IT1A 2D4HA 4PINA 4QT0A 3WWDA 4YMVA 3FG9A 1Q1QA 3KSUA 4ZI7F 5KQLA 2WNSA 4CLDA 4IUDS 4DZTA 3CUKA 4R81A 2WZQA 1FRQA 2W2XA 3EWNA 1E9EA 2FOIA 3W5UA 1EG2A 2B3TA 1ZMBA 3HYTA 5DLQC 1E3IA 1KK3A 2E18A 4JHXA 2P78A 2V58A 3SEAA 1A98A 1FF9A 2Y1FA 3F71A 4ZOCA 2FLWA 3U1TA 1DQSA 2RBKA 4E3ZA 2UU9B 5AFSA 1QVWA 4FK8A 4TWAA 2EBUA 2I2BA 3AFIA 3NKVA 4KTTE 2EX1A 1Q20A 5AICA 3AZQA 3VNAA 5CFZA 1YA6A 3QXCA 3RRYA 4HYTA 1TO6A 3MHTA 1ELOA 1LNSA 1VPWA 2DTXA 2BBWA 3JX9A 4P3KA 4FVTA 5LLDA 2PKCA 1CB7A 2Q5QA 1EZ4A 4CMBA 3MS7A 4P2GA 4CIYA 5FV4A 2IYFA 3CZRA 3VO1A 3K4PA 2JFOA 4TQGA 5JAQA 3PE6A 3ZHZA 2C83A 2G9RA 3REQA 3FZEA 4Q3NA 2H0QA 4J3FA 4MYCA 1VJDA 2O23A 2JARA 3IELA 4KQKA 3RI3A 3NYIA 3T54A 2J0QA 1VIYA 3NYWA 3MNFA 5BSEA 2C4TA 4KBYA 1FDTA 3N0WA 2NVOA 3AL0C 4AKGA 1PZNA 1T5LA 1AO0A 4JWTA 3KQVA 2ZSAA 1B8OA 1EK0A 1KPIA 3DDCA 3HSSA 3T15A 3VI3B 3ZI7A 1DAMA 3QVSA 2V54A 4AMZA 4HBGA 1WHTB 1Q1GA 5DOVA 3HKBA 3N2GB 3UCXA 4ZHSA 5C7LO 1SM4A 2MJLA 2HIGA 2WE7A 1TVKA 3QPWA 2B35A 2HPZA 2YWBA 1JEOA 4IDHA 4X00A 4ZCMA 3EZ7A 3AWIA 2BUBA 1NVXQ 2PL9A 5DIFA 4E5SA 1RTTA 1HDXA 2X2FA 3DO5A 3OCJA 3ILHA 4W5TA 3ORFA 3O1JC 2WV7A 2FU5C 3ZVLA 1NE7A 5LPNA 2O05A 1SG0A 2OBFA 1N77A 3GY0A 4MQEA 2XPCA 4OMFG 3TO5A 4L76A 1DEHA 2V9CA 1E4VA 1T9GR 3GG9A 3RFCA 2ZIXA 3C4QA 4N82A 4MQFA 3B13B 5REQB 3GD7A 4DBLE 2FPRA 1P2UA 2CVOA 4DB2A 2XTMA 4XD2A 1UT5A 2OL4A 3SWWA 4OYLA 1P9NA 2CXHA 1VYUA 5F21A 3G0CA 3L8FA 4KQHA 1GUBA 1EUCB 1U8CB 2NWQA 1VSTA 2ZJOA 3F2VA 1G8PA 3KTDA 2IJGX 3IP9A 3GMDA 2XGSA 2EFGA 4I9FA 2VYND 1NW7A 3MRXA 4U9UA 4BZXA 2JGRA 2C77A 2NO6A 1KL7A 2O6LA 4FWIB 4Q21A 4F3NA 2J7KA 2W6JA 3H9EO 4B44A 4LQ4A 3HKDA 1U0LA 1FB5A 2A67A 4LOKA 2D2XA 1WSWA 4N3BA 1GT91 1T9ZA 3JD2A 4X92A 3BTSA 1TMGE 3N75A 5LU9A 1R8XA 3D2LA 1Q0HA 4AF7A 1DG3A 4ACBA 4QRIA 1J2EA 2QRKA 2JGKA 3LQKA 3DFUA 1VJCA 5A1JA 2GLXA 1ZOOA 5AM2A 5L6LB 3OEHA 2Y0BA 2Y1EA 5TMBA 3UXMA 3BFJA 3P0EA 1Y5RA 1JA1A 5BQXA 4PICA 2Y4OA 3UY4A 1U0BB 4OIMA 5JJKA 1E9DA 1YZFA 2HO5A 2JAWA 1ZIOA 3WYBA 1G1MA 3L5KA 2X4GA 4Q1DA 5DM4A 4NNJA 2JDIA 4BNXA 2A30A 3ZLVA 1NN1A 1YZHA 4TGLA 5CLIA 4YS6A 4XWOA 5AKXA 3OMXA 2QLJA 1DKRA 4HYQA 1PGQA 4K6FA 2UXCB 3NV9A 3QUSA 3RSSA 1VKZA 4FYXA 3E53A 1AKMA 5DM1A 4BPRA 3HADA 5EP3A 2YS6A 3NRCA 3P0RA 4HDAA 3RVRA 3TTTA 4MUBA 1WHSA 2RCYA 2W7TA 2YV1A 3PHHA 2MDTA 4RGVA 4X9XA 2WUVA 1V1JA 3K9BA 1DO0A 2R9VA 2YX1A 3JQBC 4JV5B 1WB9A 1H9BA 3FGNA 1QVRA 1T9DA 1KBQA 1YD7A 1V7PC 3EVGA 2NSLA 1I9CA 3UOWA 4F85A 5A4JA 2F3UA 3N9IA 1XEAA 1KIFA 4RPKA 3KEQA 4Y6RA 5DP2A 4IIVA 4BRUA 3RK0A 3I28A 5IJ0B 1Q84A 3R0ZA 2CVFA 3KUKA 3NQ41 5IH7A 1TEXA 4CIBA 4RDIA 3SM9A 5FH9A 3JQAA 2VJMA 2VJLA 3E18A 2NP7A 4AF6A 1FNMA 3H86A 4INPA 1O0CA 1NSTA 2O5EA 2KMLA 1KI2A 2ONYA 3PIDA 5HOEA 5BYKA 4Y30A 1JXMA 1IBKB 1L6IA 4R1OA 1T6YA 3UN1A 3KQUA 3O90A 2DQ4A 4I7EA 5EN4A 1DCKA 3FKJA 4DMCA 3M9WA 3UJAA 1DZ3A 2CK3D 2JVIA 3QXGA 3N0RA 5AKZA 3CRRA 5IK2A 1YDFA 1QHNA 4GX2A 2NACA 4GZ3A 1IHUA 5KSYA 2O20A 3NRBA 1P5RA 2JLAA 3JAMA 5KQSA 4KWCA 5F1YA 2YOGA 4OQMA 2OLJA 1E18A 3A6FA 1QFYA 3FYHA 4I4LA 5JG7A 2Z04A 4ZK2A 2LGJA 9ATCA 4MWTA 1EGHA 3K09A 4Q3LA 1FFCA 1U1DA 3UYLA 4O2AA 1CE8B 1QG2A 4QBIA 2WDZA 3EHEA 4I4CA 1WLYA 1XCBA 5L7YA 1EEXB 1KZ9A 1SRQA 1UBOS 2PRKA 5IDVA 4ZV9A 5LQKA 1GGVA 2B7BA 4J94A 4K88A 1JAIA 1I4TD 2YHSA 1JLKA 1SXGA 2Y27A 4LMRA 4RF2A 4YCJA 3WGHA 3K1JA 3WIEA 13PKA 3LUPA 4NYJQ 2DFVA 1QH9A 2GSWA 1B4DA 2OC9A 3MCZA 3G2HA 3UGTA 5D3QA 2PFSA 1O9GA 5EGNA 4B4WA 4D3XA 1W94A 1ZRHA 4R2WA 4RJIA 2CFSA 2ZWVA 5ITWA 5ALUA 4F4CA 1DARA 1Z63A 3TIXB 1I01A 1QG0A 2BFAA 4Z7NB 2QTNA 1J4AA 4ERNA 1ACMA 1Z13A 5COQA 3RAJA 3ESQA 2ZE7A 4QPJC 2WSSD 1KZGB 3GUUA 1BMTA 1RKQA 1ZW1A 3VOBA 1ZXBA 2X42A 3D7SA 5DHUA 1JJAA 4DMKA 3LUHA 1T2DA 3WTBA 4HEA1 3H2BA 4MO9A 1TE2A 4A92A 1S8OA 3OQOA 2E49A 3IIMA 3NWBA 4TS3A 5ARCA 3LM8A 4J1TA 2H2FA 1Y7PA 1MX3A 4B9EA 1E2GA 5HGJA 3K9WA 4U2CA 3UC5A 4CF7A 1UXKA 4FFBA 2JFXA 3PI7A 4V3CA 4CKEA 4E1AA 2QG9A 3WMWA 1BXRB 3L9WA 2YN2A 5SZJA 3VR3D 3SE7A 4TT3D 1F0NA 4C1BA 2L2QA 1G2PA 1ZAYA 3ELWA 4XVRA 1TVEA 1FNDA 1JQBA 3QTLA 4PAGA 4QG3A 4DR7B 4E1VA 1FLNA 3B9RA 5JZMA 1HXHA 3AX6A 4RIEA 4BQQA 1GN8A 1E94E 1CR4A 1Z2PX 3OJLA 2RD2A 4PPFA 1XZGA 5ALMA 4CMJA 4EFKA 2ORIA 3H1BA 3IC5A 4LYJA 3U3JA 1TZCA 2ATCA 3T3GA 1IMOA 1E3JA 2G72A 2PRSA 2ZAIA 1N2XA 2A9KA 3OPYB 4Y2YA 3WWOA 4DQKA 2D74A 4C08A 3CR7A 4GR4A 1H1LA 3MJRA 4DY6A 4DA4A 3FGOA 4HNVA 4B3HA 4ADSG 3GT0A 1E1RA 1I10A 1R8JA 4XIYA 3T99A 2OYCA 3ZD8A 1ENYA 4L9WA 4Y0NA 1I0ZA 1RLMA 4JQOA 1DXQA 4MB6A 3W2HA 3HCDA 2BMVA 1U5CA 4KGXA 3HCFA 4J16C 4K8RB 1EAMA 1KEVA 3OLVA 4EENA 4ZV4A 4MLCA 1N0WA 2C3OA 1YCDA 5AVJA 1TLLA 1AQYA 4O1IA 2COEA 3OE5A 2IZOA 3QMVA 2JGEA 3F5QA 5T5QA 1WO8A 4D9KA 5EINA 3C3EA 3LGSA 1ZGBA 3KWLA 2B6HA 1T6BY 2J6CA 4BP1A 4IDEA 3Q2OA 2OXIA 1DHTA 3JY6A 4AZ0B 2ZUFA 5TMPA 3C3DA 2ZYGA 4V1CA 3R7BA 1FZTA 3SIWA 2WG2A 1PS9A 1SKAA 1RJDA 4AIIA 3QVGA 4G0YA 1WDWB 3P8ZA 3VR5H 3VO8A 2RHTA 2AQ8A 1OYWA 1F8UA 5A71A 4OK6A 2C2ZA 3H17A 1QHSA 3QY9A 2JVJA 4KPUA 3KKMA 4QNRA 3TZKA 3ISVA 1Q3HA 1KE2A 3FDFA 1CZHA 3EBOA 4KRFA 1ML4A 1EGVB 4RKRA 3JQFA 3ZWXA 3DBIA 3PL1A 2XH8A 5IWCA 4WZAA 3RPEA 3VNQA 1DG9A 3JQCA 1G3MA 2C9BA 1GPNA 5EE1A 4P8RA 2FN9A 2BELA 4O2AF 1G66A 4ZC8A 4JI1B 2C9ZA 2X0FA 4B81A 2A5YB 3NATA 1CDDA 2XMBA 1ZVVA 1GKKA 1MHPA 3P0IA 1WXFA 2LNDA 4CMGA 2X6TA 3B48A 1AD2A 4LY3A 4L8WB 1NDQA 2WKPA 3T34A 4EY3A 4UDYX 4YYZA 4B4OA 4Y6SA 1UBTS 4FHDA 3PKJA 5CB4B 2L0XA 4N65A 4D74A 4DN6A 3FOCA 4J0DA 3JZMA 4ZDJA 1T0IA 3DMRA 4C3VA 5K8IA 2I6FA 5G41A 5C34B 3WQSB 5B12A 2QRLA 5EYPB 3ZXXA 1U0OC 5DLYA 2CSXA 4MIYA 5DYTA 2GYWA 1ESEA 4MHOA 5AIAA 4XB1A 2IXGA 3F97A 1R9JA 4KAXA 1GL7A 2AFRA 2IP1A 3L1JA 1RC8A 1LC3A 2HV8A 4ZQGA 4H7KA 1QCDA 1T0HB 5ENVA 4HZIA 1IM8A 1CY8A 1ZH4A 4MQEB 5AYVA 3WKCA 3M9LA 4G36A 3RM3A 5A3QA 1H2BA 3FIJA 3I9OA 2A78A 1R0YA 3LLMA 3GQBB 3H83A 2CL0X 4HDOB 4AWBA 5KQGA 4KMSA 1G60A 4JP5A 5CHYA 2XB2A 3PNMA 2JD0A 3PQEA 3VPXA 1XZBA 2GO7A 2ZI3A 2FR8A 3FE2A 2YW2A 3V34A 4F7DA 4B2YA 1AN0A 2YV4A 3OECA 4L6IA 3RUDA 2R7MA 3ZE8A 4R5HA 4AJLA 4B85A 4D1YA 3JATB 5KSOA 1CFJA 3V7NA 4Y2QA 2ILVA 4BP3A 4KNYA 2P2LA 4D0SA 1MXHA 3V6MA 4R1PA 4P98A 3V2HA 3FOFC 1DELA 3B51X 1COWD 3ROEA 3RSFA 3CEJA 1HE4A 1H2XA 1KEZA 2VXOA 3PQCA 4TMYA 5I9MA 1E3TA 1XBTA 2IPOA 4AULA 3L6RA 1ZVMA 4EFMA 2MSEB 1JHQA 2IBTA 1YIAA 2QRVB 1G5TA 5HZGA 4AN0A 1R6TA 5CTJA 3RS3A 2IYXA 1Z2OX 4TUYB 4EAQA 1ORIA 3RUIA 2HGZA 2JK0A 4G9BA 1XGKA 4JT8A 5HYVA 1XYVA 1O87A 1ZEJA 2IPNA 4C4OA 4CMEA 4LKRA 3I8SA 4FMDB 2DUJA 3ZHQA 1Z4OA 2GPAA 2EX4A 3RHTA 4JKIA 4DLPA 2Y3IA 4MVCA 1PBTA 4ENQA 1ATIA 3K9GA 4N0PA 4Y67A 4NFLA 3MS4A 1XD2A 1E2DA 1CD5A 3X2FA 1C3OB 1BFDA 1EU1A 2CWDA 3DS8A 4YRTA 2FG6C 3CTMA 5JPIA 4MUMA 1P17A 2CLFB 3JASA 4XQCA 5GAJA 5TMEA 4FYYA 3FHOA 3JZAA 4BS9A 4D26A 1DT3A 4YASA 1Y1RA 2J4CA 1G3QA 4RA9A 2XCQA 4WLNA 3B20A 1MG0A 4S35A 1GPAA 1NVMB 4G0NA 2FMHA 3FPCA 1NMZA 2P0AA 1X77A 1YBFA 4HN9A 1UCFA 4LHEA 3GD5A 3LBFA 5B53A 1N36B 3VHXB 1UK6A 2QD4A 2Z56A 1IN5A 3T5MA 1SXJC 2ECOA 4UNRA 1JX6A 2FYTA 4KK4A 3RVQA 4FFMA 3U4AA 1MAVA 2FY8A 4XCVA 3I32A 3JQAB 5LMZA 2VJMB 2W58A 5TS2A 1U6KA 4CFSA 3EUWA 4PSKA 5AK6A 2PZJA 1RT9A 1N9GA 2ETVA 2FG7C 3O3NB 3GJQA 4KOAA 4FYPA 2V65A 1K4KA 1T1SA 2K6GA 3AJ9A 3EXFA 4KQMA 3JU3A 2CMFA 4PPGA 5AM1A 1X7WB 1L4NA 3II6X 3G5UA 3G6WA 1DWPA 2Z6AA 4OJQA 3QOXA 1QRUA 1V39A 1DUVG 3ABIA 2QBYA 3F8TA 5JNRA 3ZS8A 2P4EA 3BQ9A 3NBXX 3I83A 3TM5A 1FMFA 3R5JA 3MGGA 1ESCA 5K6TA 1XVLA 3SBOA 1B76A 1HKHA 1M34A 1JAZA 1T5BA 1GL9B 1V96A 3CZ4A 3G0DA 5FOSA 2JI6A 4FEAA 3U56A 4ES6A 2Q5FA 3O73A 1VE6A 3HXTA 4E2FA 3T3NA 2POQX 1I4WA 3WC4A 2WTUA 3F6RA 4KZPA 3QIAA 3TAUA 3IRVA 1QLHA 2WFLA 3FDZA 5CMLA 4Q7QA 1QV6A 5DISB 4QXRA 2MR5A 1RJEA 2YZMA 4PTYA 4F3TA 5IANA 3JQDA 4JROA 2YHBA 4LMBA 5EUCA 3ETCA 4V0LA 5H4HA 1VGVA 4MS3A 2O8EB 1CPYA 2DUNA 2HHCA 2Q41A 2RK3A 3AEKA 3IBSA 5EJGA 5JSKA 1QIEA 4GR9A 3VR5A 1C1DB 2OQIA 4ZT2A 1KEEA 1AA9A 4GI1A 1WBDA 1J9GA 3LY9A 5KWIA 3NC4A 4CM7A 4AX8A 1UK7A 1L4LA 4REMA 3GOQA 1XVUA 5K0NA 4BX3A 1AKVA 1CTQA 4RJLA 4XX0A 1M10A 2LUOA 5KVVA 2HADA 2VEOA 5MDHA 1OZHA 3DC7A 3WK7A 5JS8A 3OF3A 4UUQA 2N42A 3GK3A 621PA 2H9IA 4JFRA 1NG1A 5CFRA 4EAAA 2C5BA 4L7QA 4PZUA 4I1VA 2HMWA 3E5MA 1SCNE 2P2GA 3D6JA 3KJZA 3ONFA 4LXXA 4N7MA 1UADA 4CLOA 1XPRA 2YMMA 3ZCXA 1JHOA 2Y1LA 2ZUEA 3RLIA 2BFMA 2NSDA 3FOAA 3GT4A 1D1QA 5CNIA 5KSWB 4NHEA 4L8YA 2HGSA 5FOVA 1E1QA 1LPMA 2FEPA 3EXHA 1AQUA 2VF5X 3TLCA 4YCLA 4H0NA 4XLTA 4Q01A 1KETA 2DHQA 1HE5A 2LTAA 3LFUA 4FFBB 4HXEB 1HUQA 4ZEXA 2Z2JA 4CKEB 4C0HA 1J56A 4EP1A 3EC7A 1XDBA 4B75A 3DBHA 2ODNA 4QD3A 4AMYA 3DNMA 5IH3A 1KZ7B 3H2JA 4WKOA 4D9CA 4BMDA 1HE1C 4B7AA 5LB2A 1ZI8A 1FMLA 4MB2A 3RTBA 4H35A 3EMBA 5U4XA 2JAHA 5HFJA 4J7XA 3QJ5A 2GPBA 4UUOA 5WRFA 2D0OB 3WLNA 3GLUA 2GZ1A 2BFPA 1XZDA 4J4TA 2QM8A 4NBSA 2IVZA 1QQBA 1PVOA 3JD3A 2GHIA 4YCCA 1IK6A 2OCIA 2OZVA 3CE6A 3NTVA 3RYIA 1UPBA 1TADA 3AV0B 1FTSA 3EGXB 1G5RA 3FSJX 3GMTA 5F4BA 3E7FA 3ZGXA 3AFMA 5JNWA 3PKZA 1F14A 3R8CA 5CITA 3ASVA 4V0MA 3T3EA 3EXG2 4K05A 4TVKA 2VNSA 1K89A 4EJ2A 4EGSA 3ECCA 1YACA 2ZDHA 4GC5A 4AP5A 821PA 3Q8MA 4J0GA 4BASA 1Q0TA 2IXFA 2AXPA 4HPJB 1D1SA 3SYMA 4TKUA 4Y9TA 5BSRA 2X2PA 1TFRA 4YH1A 2QG6A 5E95A 1L1FA 3SQMA 5AXDA 5E6UA 1RWBA 4PPQA 3R41A 1NLYA 1WUJS 1R3UA 1VRWA 3K9CA 4N39A 5CVCA 3GFVA 4LOHA 4TTQA 3LYLA 5CFPA 1NZJA 2QX6A 5H9WA 2QTCA 2NUTB 4QO7A 3QVGB 2WWVD 3WYAA 1T0PA 3DZKA 3ZI0A 2WFMA 4MVJM 5D86A 4R6WA 3VPFA 1ZX1A 4Q4JB 5LLSA 1M6NA 1OLXA 4B9AA 4F04A 1LK5A 2FSVA 4KPUB 5BURA 5KOIA 2OAP1 4H6PA 3PPWA 4PRKA 4CNQA 4F6LA 2P9JA 2G04A 4NS4A 3IA2A 3SFZA 4DBZA 5EPEA 1PG5A 5ITZB 1MG5A 2Q0QA 5LIPA 1OTYA 5F7OA 3EIQA 1BXGA 1QQTA 2HEGA 3FGPA 3LAWA 4WV3A 1L5GB 3UHFA 2QDKA 2JFZA 5FPQA 2VWGA 4WZAE 4H1TA 2EQAA 4JOCA 4B45A 4KNVA 1M0TA 3R6GA 2GDJA 3KIPA 5TGZA 3M3PA 3DVRX 3IUNA 1V7ZA 1F20A 3D2BA 2FGKA 2DFNA 4MGZR 4F2DA 3OA2A 1IJKA 1IHPA 1UDCA 3U3RA 1NXPA 2I8LA 4LYDA 1VLVA 4RVSA 3A4MA 5TQVA 3GAFA 3ZLJA 1EVEA 1Q74A 4CMAA 1Z35A 4MQMA 4OGKA 2EZ8A 1LLUA 3UMBA 2J9FA 4CIDA 3K9QO 2FWBA 1E4EA 3PX3A 4AZ3B 3K9FC 2XKBA 4CFYA 1DJMA 1Y6RA 2VYVD 3QPVA 4ZQHA 1Z6ZA 1ZWLA 3KYIB 1JQ3A 2P9HA 3C1UA 1XTQA 1Z6PA 2JKVA 2GGSA 5FYQA 4LZOA 3B89A 2GAAA 4KX5A 1MV5A 4KWTA 1QFZA 4EB8A 4JYCA 1KORA 2E85A 1E7QA 3WA6A 4U4AA 3LY8A 1RPTA 3RSGA 1P1IA 3A6LA 4R68A 1UMDB 1SVUA 3OY2A 4ZEVA 3OO0A 4U9HS 3HCNA 5L4NA 2P1RA 3OHSX 3ZW7A 3UTCA 2R8BA 2QDXA 4HFRA 1Z6AA 4PPYA 3MMSA 1P39A 3RIGA 1QUFA 1V4NA 3QKRA 1CZNA 2ZJ2A 4PLVA 4Z2YA 1NVAA 3FCYA 3CE9A 3K09C 2HLNA 3I2YX 2J4FA 2OHVA 4JY7A 4S2UA 4D8UA 3IVMA 4UPEA 2EZ9A 2TYSB 3SICE 3MIZA 4Y6PA 1Y63A 3O03A 2IHJA 4Y6GB 4B3SB 3KBOA 3EG9A 5ADVA 5FO1A 1YMUA 3H9BA 2EHJA 3CZ5A 3AHDA 3B5EA 2YVAA 4TRMA 1DG1G 1V5FA 1YQXA 4DWVA 4ZVVA 1Y98A 1NNUA 4WA7A 5TEWA 4ZGBA 3A37A 5DT2A 1CZLA 2DOKA