3Q40A

Sulphur sad structure solution of proteinase k grown in so4-less solution.
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Proteinase K
publication title Crystallization of Macromolecules in Selenate to Solve the Phase Problem
rcsb
source organism Engyodontium album
total genus 106
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2010-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3q40A00
1Y9ZA 3BX1A 1SCJA 1WMEA 3DVRX 4WOBA 1PFGA 1PTKA 4H6XA 1GTG1 3GCWA 3DE2X 4RYDA 3TI9A 2V8BA 2IY9A 1IC6A 1Y3CE 2HD4A 1Y33E 2DP4E 4NE7A 4AKTA 3GT4A 1HT3A 2W2NA 1TO1E 3LPDA 1SCBA 4Z2AA 1A2QA 2B6NA 3TI7A 1P7VA 2XTJA 5AMXA 5ARCA 1CSEE 2TECE 1TMGE 3QFHA 4OMCA 4FONA 3I37X 1Y3BE 1OYVA 2W2PA 2PQ2A 3WIVA 3EIFA 3DW3X 3A3OA 1S02A 5SICE 1SUCA 1AVTA 5I9SA 5AVKA 4BWGA 4ZARA 5ARDA 3OSZA 1SN7A 3GT3A 1Y1KE 1TM4E 5FFNA 1BFUA 3VYVA 1SBTA 1S01A 1PEKE 3I34X 2SICE 2QTWB 1AK9A 4M1ZA 3T41A 4LVNA 3P5BA 1KDZA 1SUBA 1OT5A 1C3LA 1TK2A 4DJ5X 2IXTA 2ZWOA 1Y4DE 3DE0X 3HJRA 4GI3A 1TM3E 1BH6A 3SQOA 3F49S 1DBIA 1YU6A 3D43A 1ST3A 5JXGA 3I2YX 1V5IA 4H6WA 3BGOS 1SIOA 3DE1X 1KDVA 1SPBS 1SBIA 1Y34E 1ZVJA 5FBZA 2ST1A 1ST2A 3DYBA 2Z30A 3AFGA 3SICE 3VTAA 1C9JA 3PTLA 3AJ9A 1GNVA 2HPZA 4LVOA 2DQKA 3I30X 4I0WB 1MPTA 1LW6E 4AKSA 1XF1A 4MZDA 1T1GA 1JEAA 3EDYA 1GA4A 1TM7E 3LPAA 4K8RB 1GNSA 1C9NA 2WUWE 2X8JB 1DUIA 3DVQX 5AVJA 3Q40A 3LXUX 1TECE 1WVMA 1IAVA 1SH7A 1R6VA 5JXJA 1GCIA 1YJAA 1MEEA 2SBTA 2W2QA 1TM5E 1YJCA 3VSBA 1NDUA 4HX2A 1UBNA 1OYOA 3Q5GA 1T1IA 1SUEA 5JMOA 2Z56A 3BPSA 1P7WA 1SBNE 5ARBA 1SUAA 1CNMA 1NDQA 3ZXYA 4C3UA 3VHQA 3PRKE 3A3NA 4DZTA 3VV2A 1SELA 2Z2YA 4JP8A 1SVNA 1SCDA 1KDYA 1V6CA 2ID4A 3TECE 1GTL1 1EA7A 4OV6B 4OMDA 2PMWB 1R0RE 3L1KA 2SECE 2Z58A 3DDZX 1WSDA 4ZOQI 2PWBA 4CFYA 3F7OA 1GA6A 3H42B 3DE5X 1Y48E 3A3PA 5FAXA 2DUJA 1GTJ1 5AQEA 2PYZA 4B5LA 1GT91 5B1DA 1SBCA 1C9MA 3QMPA 2X8JA 2XRMA 3GCXA 2Z57A 2W2MA 1ZVKA 1EGQA 1R64A 2WV7A 5JXHA 2PWAA 2E1PA 3D9QX 2ZWPA 3ZXXA 4DWWA 1PJ8A 3DE6X 1BE8A 4J94A 4CFZA 1BE6A 1Y3DE 4YN3A 2W2OA 5JXIA 3LPCA 2WWTA 1SCNE 4HVLA 5CW1A 1NLUA 1KE2A 3QTLA 2G4VA 3CNQS 3F7MA 2SNIE 4KPGA 3WQBA 1AH2A 2Z2ZA 1VSBA 1P8JA 1YJBA 3DE3X 1SUDA 1TO2E 3VV3A 3DE7X 1Y3FE 1SCAA 3EE6A 3DVSX 1BFKA 3DW1X 1TM1E 2P4EA 3UNXA 2PRKA 4KG7A 4C3VA 2PKCA 4NMXB 1AV7A 5K7SA 5B1EA 1AQNA 1Q5PA 4NE9A 1AF4A 3DWEX 1GA1A 4WOCA 3CO0S 1SBHA 1SIBE 2ID8A 4H6VA 1THMA 1SIUA 1KE1A 4KB5A 3AJ8A 1BJRE 4CG0A 3DE4X 1WMFA 2Z2XA 1Y4AE 3WHIA 3WIUA 2WUVA 1S2NA 2ZRQA 1WMDA 1T1EA 1SUPA 1AU9A 2GKOA
chains in the Genus database with same CATH superfamily
4U7WA 1IQRA 4P92A 1QSGA 3RLFA 3VTZA 2QD3A 1ZCFA 4PRKA 1Q7CA 5EE9A 3VC2A 3JAMA 2W98A 4QOIA 3QFFA 5T8KC 1ITZA 1PTKA 3Q7RA 4XGQA 4YNBA 2HN9A 4ZI5A 1X7HA 4LN1A 4A3SA 1N6IA 1Y9EA 3NHBA 5JRDS 3JSXA 2G5PA 1Z17A 2Q29A 3MYRA 1W48A 1QHHA 1Y8AA 2WDPA 3GCWA 1RC8A 4U7JA 1FX0A 1ZXXA 1NKTA 1T9GS 3H1BA 1XMSA 3IT2A 4V0LA 1YMUA 1ZJYA 3TJMA 4A2PA 3NIFB 2O5RA 4X6LA 3WICA 5HEKA 1RC1A 1T0BA 1L7VC 1USUA 3DT8A 4UZSA 5K4GA 1U6IA 2AF4C 3C15C 3FNIA 3FOFC 3BIOA 4L50A 2DP4E 3BDAA 1DQYA 4LJKA 2HT1A 2CB0A 1VPWA 3TLBA 4L95C 1V1MB 3LM8A 1U9IC 1YE3A 3I2IA 4JL5A 4OCZA 3T5GA 1IBSA 2DVMA 4MV8A 3O8BA 2WAXA 2ES4A 1HNZB 2HGZA 4M98A 5KVQA 3UICA 2BN4A 2ZJBA 2GSDA 3IJ5A 4NFYA 3ROEA 1VPLA 2Y4OA 5BN5B 5EZ6B 4UBOA 1G8YA 1BNCA 4BCDA 1P73A 3IMEA 4B3RB 1JDTA 1JLMA 3LDUA 3Q5EA 4Q34A 2W4IA 3PDWA 2H2GA 2YN0A 2FUG1 5CLGA 3TH5A 1N2JA 2ZTUA 4K7JA 4UCWA 3W5DA 1T8WA 4Y2TA 2ZG6A 2R7KA 3CNBA 1XRNA 2J6BA 1IK6A 1XHLA 1JTVA 3KOWA 3VZDA 4CF3A 5JDIA 3KE9A 3BKWA 2A0FA 1ZGHA 2PQ2A 4HQ6A 1U11A 1YAHA 2GEDA 1JKMA 1MW9X 3TKLA 1WHSA 5KWEA 1BKSB 1XJCA 4UE2A 4BWVA 3CR3C 5ELMA 3M4XA 3VR5D 1L4HA 2QNBA 1NBMA 2G9QA 4FFPA 5G0SA 4Q4JA 3P0FA 2HPHA 1NV8A 4HAXA 3GLIE 2B3TA 4KQKA 1X74A 2AD1A 2WMOB 1NVUQ 3AU9A 3QSGA 3PQ2A 4AP6A 4DE5A 1Z2DA 1DXOA 1OLXA 2QRVA 3E53A 2F3UA 3NJ8A 1NOIA 2VKQA 2XYGA 1Z2NX 2CHFA 1U3FA 2LKCA 3O6VA 4QBGB 1QQAA 1PS0A 4I3HA 2VLIA 2ECKA 3W8EA 3SQLA 1E1DA 1TM4E 2EW8A 3JQBA 1F2VA 4I99A 5FFNA 1XVVA 4Q4DA 1PK8A 1PNOA 3RWMB 3SC3A 3VYVA 3DZGA 5THXA 1PEKE 3I9FA 1KEEB 1VSTA 1R4AA 1FP7A 2G09A 1DIOB 2IVFA 4NF2A 4RA6A 4BEWA 3TE6A 3P9CA 3DCIA 4I6EA 1MX3A 1X1EA 3H9BA 2PA3A 3IURA 2ZVJA 4OGLA 4C88A 3EY9A 5B6JA 2JFZA 4HN2A 5FO1A 4BFSA 1HLDA 3AM3A 3ZE0B 3LBIA 2D5BA 1YCHA 3PHBE 5BSVA 3AEYA 4M8SA 3G0HA 2LV8A 3CGGA 4UOZA 3BTVA 4US2R 1R16A 2OXEA 1QH1A 3ANYB 3E7PA 3GJQA 4ZHSA 2HUPA 3LZ6A 4WKBA 5KQRA 2O54A 3HRIA 4FR0A 4GW3A 3I53A 3L06A 1T3TA 3OQIA 4X9XA 2IBSA 1N77A 3SE0A 4GRDA 4HKTA 5EA2A 1O03A 5CLHA 4FZVA 1MC4A 2V6FA 3ICOA 2R62A 3VI4B 1IN7A 4GI3A 1XKXA 2AFRA 4HAUA 4YQEA 1TFUA 2XB4A 1SUWA 2GF2A 3IBTA 5M5BA 5EUMA 1XQXA 1USIA 2J3HA 2XLCA 2XQVA 3ZOZA 3ZD7A 5CG2A 3WB2A 4DT1A 4ZZIA 4A16A 4F93B 3M83A 1XEXA 4GPAA 1YFLA 2GEFA 4KAAA 4WV3A 3B9RA 2WFMA 4R1TA 3QF7A 3B70A 3KJHA 1YRLA 2PRIA 1A82A 2DQYA 3NBKA 2QUAA 2Q49A 3KJQA 2QVCA 4FKBA 1N25A 1HY3A 3UXHA 3V3TA 5LZ8A 1MB2A 1EK1A 1N75A 1V16B 2G08A 3BXHA 3EIOA 4A0QA 5D01A 2XJ9A 2YNMA 3KLBA 3EG9B 2HA7A 4FBLA 1T29A 2NUTA 3BGOS 1ZONA 1ZNQO 1BE0A 4IIDA 1UL1X 2H5JA 3CWQA 3WLPA 3CX8A 1EUDB 5IK2A 2ZRJA 1QZZA 2IDZA 3C8MA 4XH9B 2OO5A 4D44A 1CIJA 1FY2A 4RY8A 3CX6A 4QEKA 5TR9A 2IHJA 2F1JA 2J45A 2WP8J 4N6OA 3L8YA 5EP1A 3PDHA 4PAGA 1ADGA 2ST1A 3BK7A 4HX9A 1KZHA 3PWKA 3WNQA 2BGKA 4OQXA 1ACJA 2CFOA 1TLLA 1GPYA 2Z09A 621PA 2O2IA 4PCVA 5EE5B 5HBGA 3NALA 2VEOA 4IOLA 5MN5A 1U8CB 3AIMA 2IHTA 4L28A 3VNAA 1C4XA 1ZOIA 1XVTA 4FYWA 3TB6A 4F3RA 4TV8A 1UBUS 1DNPA 3D31A 1EB8A 2JHCA 4AG3A 1QGUB 5ISMA 3ELUA 1NXXA 4RQAA 5K6TA 1G20E 1DC8A 3AJAA 4BBJA 4DUPA 3LC0A 3CR7A 3M6UA 2YFKA 3H0CA 1GZSA 1SO8A 2WYOA 4EUSA 4HFRA 4IPTA 1K7XB 2Q1SA 3OHPA 3MS4A 4CT4B 5J4VA 1B2RA 4AO8A 4DGQA 1Q19A 4Y8VA 1TT5A 1K98A 1SVWA 2RMKA 3EZ7A 3O93A 1GAQA 5EESA 1KY3A 4ZDWA 1TU4A 3VAZA 2UXBB 4RC9A 4HATA 3WK4A 4K0KB 4LHXA 4LXUA 3SWWA 2LDXA 3ICPA 5AVJA 4URXR 4BVLA 4P5EA 2WYUA 1NF2A 4G41A 3BE4A 5JARA 5IABA 1U8XX 4G5XA 1NN0A 2ZIAA 1ECLA 2GD1O 4P08A 3S55A 2LGJA 1BJTA 2BGRA 3GFQA 4QGBA 2WHPA 5EKUA 4OBEA 3V42A 4BKOA 3A6ZA 3KR0A 4CG2A 1BN6A 3VI3B 3HYNA 5JXJA 5ALQA 5BXYA 4B6GA 4BKMA 3OLWA 1WR8A 1YAJA 1Z47A 2ATCA 4N65A 4MQFB 3TE7A 1IONA 1XYVA 4FPXA 1UK6A 5CDFA 2Z1MA 4BP3A 4Y6SA 2DF8A 5K5EA 3S1SA 5JS6A 3OECA 2C5FA 4J03A 3G6KA 1E2MA 4EMUA 1AUPA 1DRVA 2I3AA 1EFRA 2QB5A 2X0RA 4HX2A 5T7BA 2QLJA 1C3OA 2ERYA 3BFKA 3USES 2OYSA 1QRAA 2WWGA 4LV5B 2FQYA 1DDGA 2XNKA 4OFZA 2NADA 3VNBA 5K0TA 1TCAA 3IQGX 4I6GA 1NF9A 2DHRA 3ZLVA 5F33A 1H2AS 3R3SA 4S0XA 3TVYA 5CB4A 4K81B 4RLSA 3BPSA 3R5TA 3QGMA 3WHKA 3E9DA 1I4TD 4FEYA 5E9JA 6LDHA 4ZI7A 1OUMA 1QONA 2JFXA 1U0HC 1XKQA 5SZHB 2V5AA 1QIIA 4ZMSA 1N57A 2ZJ1A 4MTCA 4OUDA 1XPUA 2QGZA 4KFSA 2C3MA 2JFQA 3WGUA 2H11A 1PBNA 2RGAA 1E5XA 2V03A 3O38A 3V32A 4OHKA 5F9MA 3V46A 3PRKE 3G82C 5JC8A 5EIAA 5TXGA 1G6Q1 4HXGA 2B7BA 4JWTA 1WIWA 2EHDA 5JECA 3ZNPA 4NU5A 3KS9A 1GAJA 2AFHA 3S5UA 3O9VA 5EVCA 2VHCA 4MPPA 5IDVA 1CX9B 1EDDA 1ZESA 1UM9B 3HKDB 3N59A 1T6ZA 2BHRA 1XTTA 5AH0A 2RD2A 4MVCA 5DGDA 5KQPA 4DXDA 3O7WA 4PN3A 1BHSA 1KKLA 3HUDA 4OMDA 1SXPA 2F1KA 1NP6A 2YN4A 4REQB 1MRNA 4C01A 1M0WA 5EE0A 4ARSA 1VE7A 4DV1B 2EX0A 1ZISA 1YVPA 4KXUA 5F7OA 1VSQA 4BQEA 1UEJA 4G5OA 1XEFA 4EBBA 4P86A 5EWJB 3CKLA 3DDZX 4FR2A 4JNKA 1U81A 4LJSA 4XCQA 4IQ8A 5KO2A 1K75A 5TQVA 3EF3A 1J8DA 2QM0A 3SBXA 5IH7A 2A88A 3IBSA 1FMJA 5DI9A 2E21A 2BUBA 1ULHA 5AVWA 3M70A 3KR9A 2FNAA 1LBQA 4BP8A 3HB0A 4LZWA 1PD1A 4P34A 5C81A 3SBOA 1UK8A 2HQBA 5B7GA 5AESA 2X5NA 2O8FB 2GLXA 1Y48E 3R3HA 1SOMA 4O4LB 3TSAA 3CRMA 3MPUA 4N48A 1CNFA 4YYZA 2AG1A 1A8HA 3L6BA 4PYJA 1X7YB 1LLFA 4J4BA 1K7FB 5JPIA 1PR3A 4TQAA 4HLCA 4DQUA 4WLFA 4LHZA 1C9MA 2K87A 2X8JA 3CINA 1JHDA 3CQ9A 5IXSA 4AUKA 1GRVA 3FGOA 3NO4A 5CRIA 3WRVA 3C98A 1CFZA 3MRXA 2HRQA 5SZKB 4KMRA 5EC8A 1HDYA 5F5LA 4BLSA 1UDXA 2ZR9A 3P20A 1R9JA 5DTIA 4IHQA 3RPEA 5C8XA 4Y2UA 1GPWB 1EVYA 4HJRA 4TMKA 5ALSA 3FOWA 3V1TC 2Q1YA 2V3VA 5F5NA 1L5YA 2W6OA 2HIMA 1XNJA 2RHMA 3ZXXA 3OPNA 1PJ8A 4GOND 2IXEA 3F8SA 1E92A 2HL6A 1UC8A 4OYYA 3SF0A 4MWBA 4Y98A 5EWMB 3AZQA 1ECGA 3L04A 4CEJB 3U4CA 4J94A 3H97A 1Z8HA 4MH0R 3IC5A 4UBMA 4CU2A 3LL4A 4TV9A 1ECCA 2ACEA 3UCEA 5GJBA 3IPYA 2PZLA 1IUOA 1FFBA 1NWCA 3QVJA 1H2EA 4Q4LA 1RYMA 5J5AA 5TY0A 1D6JA 3UYKA 4A2QA 3L6OO 3WYAA 2PBLA 2EF1A 4G25A 4ZU3A 4U2CA 3F6PA 2YIVX 1W4CA 1UBHS 3BB1A 2FDCA 2WA2A 3ESAA 4I8DA 4ZREA 4JNCA 2WWXA 3V8BA 1Y0BA 5HKOA 4W9NC 4CKCA 4AP9A 3OT5A 4XAQA 5KNDA 1GUBA 1KQNA 3FFWA 3ZV5A 5AVXA 2BMAA 3GUZA 2IP2A 2QX8A 4PYMA 2IPMA 1BWSA 1JFTA 2P3SA 1CJKC 3WQBA 1PAUA 3QX8A 2NP6A 2VH1A 2WT4A 2GD0A 5L7WA 3Q87B 2WVJA 4NCAA 4GZMA 4REOA 2YMQA 4H35A 3SF8A 2OGZA 4BX0A 5AVTA 1F2UB 1M2GA 1XQ6A 3PD7A 4H15A 3PC3A 4N9QA 1JIJA 1FLAA 1SVSA 1VXRA 3WBKA 2PQ6A 1I1OA 4RKYA 2XX3A 2XMZA 3W3AA 5ECWA 4E32A 3FSJX 2CD9A 1X1SA 4EHAA 1BE1A 4UUQA 1E63A 1DRJA 1FBTA 1WNTA 2P2SA 2WSSA 5CA0A 2IS2A 1ICIA 3TQCA 1K5PA 2HF8A 2OV3A 3CUUA 1W6RA 4PRYA 4DCGA 5BQFA 2R6CA 3H5AA 4QXOA 4OFXA 3ZNNA 5B12A 1RW4A 5E8RA 3KHKA 5CB6A 2YJ6A 2P9HA 2PO7A 4YUYA 3X0DA 2BJHA 1P0PA 1N0HA 2J6CA 3OH8A 1CJTC 2P9ZA 4Z49A 1IXSB 4EJSA 2VH5R 1O0SA 1KYIA 2RAPA 4LZLA 2QJTA 5DGHA 3HCRA 5SYMA 4BZPA 4EGJA 4L6AA 1XV5A 2OBBA 3ENVA 1MGOA 2VK4A 3LY5A 4P5PA 5CR9A 1NRXA 4DSZA 1DQRA 4Y1RA 3MBIA 4PGFA 4DBLE 3D2BA 1M1YB 2ZXUA 3L5OA 4UHKA 1TAQA 3QNWA 1WLSA 4ZO9A 5FB3A 3BT7A 4H0FA 3BUSA 4FGWA 4Q6BA 1YB6A 2W5UA 3M6LA 3ZHUA 2KX7A 1L3CA 1B14A 4OHMA 2XYQA 4I55A 4R2JA 4TTSA 1KE1A 4DA7A 4K9OA 1E6LA 2JFGA 1C9YA 5FF9A 2GF9A 1ZG3A 2PUHA 1J1ZA 2FSHA 1BH2A 4RDIA 2PE5A 4B4VA 2XXAB 2BSXA 4ZVNA 1RBZA 1ZH4A 1USKA 4R41A 3KJGA 4WJKB 2YV4A 3BC1A 1WP9A 4NV1A 4ZRDA 5JW6A 2QZJA 1IHOA 5LQNA 2NZVG 1A2BA 3GRUA 3DE4X 4XGRA 4KQHA 4M89A 5EYPB 1BIFA 2ODWA 3BMQB 5FUYA 5YASA 5A04A 3A36A 1SKBA 2C9CA 2ORIA 4IXDA 3VR2A 1JLLA 1T3GA 3ELBA 4IIHA 4X1KA 1SKQA 3UWKA 1YRQA 2PMEA 1Y5LA 1ZUNB 4IDAA 4RCYA 5I9BA 3LOPA 5IVDA 2QTBA 3A4IA 3CUSA 4D6PA 3VBCA 3AVYA 1RVDA 2P2NA 1LTQA 3EARA 1XP8A 4JVNA 3O8RA 2J41A 1I4LD 1ZD2P 2ZAGA 1GZ6A 4LYGA 4F85A 1CF4A 1JHXA 3PC8A 2R1VB 3Q9LA 1WMEA 4GNRA 3JYLA 4KMOA 1Z6PA 1Z29A 1K1EA 2JNWA 3O9ZA 1MOZA 1QIEA 3GRPA 3SJCA 1FBNA 2FEMA 1PRYA 2J5QA 1VL1A 2Y93A 3EDCA 1YNOA 3ILXA 4INOA 3RRXA 4H31A 3V6LA 4CMHA 5E1MA 4EMSA 1RWBA 4R3WA 1GTG1 3AI1A 2C3UA 4MB6A 1FL9A 2DPMA 3ICCA 4YECA 3TTTA 1ODLA 3LZCA 4DSNA 2JIBA 4QZVA 5JV5A 5TMPA 5CLFA 4MWDA 3DO5A 4WESB 4MCJA 4C0LA 2PYIA 4Y6GB 4LDPA 3FYHA 4K46A 1QP7A 2OZLB 2IHKA 3W05A 2INGX 1N6HA 1FMLA 3WYDA 2Q0SA 4LY3A 1MAUA 2DR2A 1H2YA 3JPWA 5FX2A 1XA4A 2EJTA 1FOEB 1C1HA 1Q57A 3O8LA 5BQ5A 3MT0A 3UCFA 5JY6A 4PGAA 3DBLB 3V8NA 4NK4A 4HWTA 4AO7A 4RHTA 5DHTA 5CA1A 2Z6UA 4ND4A 2AH5A 5FWXB 4IP0A 1ORVA 3T8YA 1DAMA 4HEHA 4MCAA 4M99A 1GCGA 1LXCA 1TO1E 3GVIA 1NVBA 5LU9A 1BX0A 3VJRA 1ZH6A 4GLLA 2WVHA 1L5SA 3DS8A 1PJLA 4HG2A 1N4DA 3L0SA 2HK6A 1X80B 2JIOA 3KT0A 2IHNA 4HEA1 2H0AA 3ZGNA 4FGJA 3UOAB 4BNFA 1L5LA 2JH9A 5EJ2A 4BJ6A 2IPOA 3AYZB 3SQMA 1O8CA 1JQKA 1MJ5A 2FSFA 4IF6A 5KC8A 1VJ1A 2BEWB 4K9MA 4DJEC 4E2ZA 3R0VA 3EXFB 3OIDA 3U3JA 2V6IA 2QIOA 3A9CA 1R12A 2R11A 4NDZA 1Z63A 5IBRA 4QNMA 3KOZA 4J7AA 2W2PA 3K0HA 4FOPA 4KPUB 1N6LA 2ZTMA 1CDOA 4Q4AB 4XFDA 4IX1A 1UZNA 4QGAA 1KJJA 1EHYA 5AD1A 3HGQA 3BKXA 4FC6A 4CCYB 3SD7A 2XUHA 3NU1A 2X0FA 2EIHA 3PQ5A 1ZVVA 3PFGA 2H0QA 3JVEA 1M8GA 2VTBB 1PBTA 1U9ZA 3KFXA 1X1QA 2NSLA 3FRHA 3MXTA 2C7BA 2XQGA 2DECA 4NPHA 6REQB 1R5OA 3I9OA 3KTAB 1FK8A 1WOYA 1KMQA 1QUFA 2O8VA 3CUKA 3O90A 1QNFA 2G7MC 4N18A 3VKVA 2Q0XA 2C7GA 3QLVC 3CZAA 2IEGA 3FNHA 1Y1KE 1JXMA 2ZRNA 2WIFA 1S2IA 3ND8A 2BSAA 1QP8A 2NPIA 4M0DA 1F4PA 1SG9A 4RTSA 1MAAA 1U3DA 2VG8A 3R6WA 2OD2A 1UBLS 3N2KB 1FTGA 1EUQA 2O0KA 3GZJA 4FI3F 5IS2A 3LPNA 3DBHB 2CYCA 3GP3A 1V7PC 4E94A 3TD9A 1Z5ZA 3BDIA 4RYLA 3PJRA 3MINA 4J7XA 5EI5A 1U9YA 2QTWB 4JFAA 3N53A 2OTCA 3RYFB 3TKYA 3ZWPA 2C7OA 1ZWLA 2NXCA 1RDFA 4K87A 4AAYA 2D7DA 3AM1A 1GG5A 3RSZA 2PV7A 2XPCA 3C3EA 3OZCA 1VGQA 2AXPA 1I3KA 2E0IA 3EX7C 5CLJA 4ZYZA 4URWR 4IF4A 3TPCA 4UFPA 1NY5A 1PFYA 3DV2A 5LA6A 3SCZA 4F5YA 4Z0NA 2VJOA 5EUCA 4TMYA 4X20B 1Q0LA 4FOSA 4PTLA 4MIYA 4NAUA 1KYYA 3HJNA 4RIEA 5LM3A 4U0KA 3AF0A 3HXMA 2YINC 5IT5A 3DOFA 1HSZA 2VPIA 5KX5F 3F49S 3KLOA 5BSFA 3KQNA 1UCFA 2WU4A 3ERCA 1KRXA 3TQRA 1UP6A 1E2GA 1JU9A 1L4UA 1YC2A 3PHIA 5EXEA 3SM3A 3SY8A 4BAZA 4Q3EA 2QRZA 1O5IA 1GDDA 2IOFA 4CF7A 2OCKA 2QAGA 3PNOA 2Q6OA 4FN4A 1VG0B 1U2PA 1CJMA 3FOCA 3D4NA 1PZMA 3ZHXA 5DM4A 5JUWA 3O03A 1KERA 3HZRA 4ZP1A 1J70A 2PX8A 1AQ6A 4TTJA 2NXJA 4N7RA 1ACLA 4Q3OA 3E9YA 3A4TA 5A5FA 1AGRA 2FN3A 5ETJA 3TZ6A 3VO2A 2CNNA 2IITA 1JEYB 1J06A 2FRVA 5H3LA 2IS6A 5EMMA 4MVJH 2AK3A 1T2VA 2VQDA 5AVZA 5GZ3A 3PUYA 5DYYA 5HHTA 3CZMA 3HABA 2VHUA 2AOVA 5FUWA 1N34B 1H6CA 1VM6A 2OV8A 1FLNA 1RXEA 2PAAA 1L9KA 3A1UA 4M46A 2ZYUX 2B2CA 4Z4IA 4LDQA 3RRNA 1MV5A 2GYWA 4XJXA 4BMOB 2WVGA 2Q3CA 1YQDA 1KYWA 2C4WA 2FZWA 3PV0A 5AVYA 1A98A 1V1RB 3L0CA 4CZ2A 1VDZA 4IVQA 2WK1A 3CT6A 5ALGA 1ADFA 4GOMD 4BMXA 4YA6A 3GDOA 4N47A 3SS9X 5KI6A 2VYNA 4NNPA 4TMZA 5ALNA 4HWOA 1UMBA 2NO6A 4CKEA 2BH2A 1QFJA 1N2HA 2O4UX 3MGCA 5COBA 4HPXB 4RY9A 3TVDA 1RXCA 2EQ5A 3GFTA 1JE0A 3HXKA 3ML1A 1XK7A 1JKJB 4MZDA 3TCXB 1MA0A 3A1FA 2I6SA 3NYQA 3CSSA 4OB8A 4LWZA 4EG8A 3UGQA 1MR3F 2RGUA 4A6DA 4B31A 3HSSA 4M9ZA 1NUTA 1M33A 4Y0AA 2NZXA 1RPJA 1T91A 2AXEA 4PCAA 3LUJA 3KB8A 4R05A 4XVCA 3O3MB 1ZM3A 1ULTA 2Z5LA 1NI3A 3F96A 2QSUA 4V1CI 5FA8A 1JT2A 5FV7A 3KOUA 5LYYA 2QLTA 1EP2B 3C3JA 1Y80A 5CJJA 4E31A 4NL4H 5KSZA 4QVIA 2VSYA 1CULC 3WC4A 4BY9E 1LSJA 5BMVB 3OOEA 2IF0A 1R0LA 1S2DA 1AKYA 3KE8A 5BNTA 5D2CA 1LZLA 1CP3A 4UAVA 3VQTA 3QVWA 1R18A 4FYMA 4QXMA 1FVOA 1DAEA 4QNNA 3SYTA 4X54A 3VR3A 1H4VB 1FNBA 4F5EA 4MRVA 3WISA 4CLHA 2ZIXA 4IGKA 4GC9A 5FOWA 3FKSD 3LKBA 3KQVA 3DMNA 4H3HB 3HXLA 2JB9A 3PQ4A 1IBLB 2ZBRA 1TTTA 4DIMA 2SBTA 2X0IA 1AUVA 3IHLA 1TL7C 5F23A 6NULA 4LJYA 3DGEC 4BMCA 3OCCA 1UADA 3OTOB 3IDSA 2EBUA 3NH9A 4F9GA 2QTHA 3JW8A 3H8JA 2C31A 4G3XA 1J2RA 3C8HA 4HUJA 4NFSA 4I50F 1UBNA 5D3QA 2RB4A 2ZJFA 1B42A 5JRJA 2O2ZA 1B8UA 4RFSA 2CJYA 4PHTA 1Q0TA 2BRUC 1CVIA 3GLQA 4AXBA 1HRDA 4LECA 1CY0A 2VHTA 1EAYA 5AM3A 4HTFB 2EKQA 5DEOA 4Y2GA 3ZTWA 5GJWC 1KJIA 1XTKA 3IBCA 4R8RA 1BHJA 3ROKA 3ZWOA 4ER6A 1F06A 3RVDA 2QA5A 2OYRA 2BDEA 1ZVQA 5LZ7A 2BZSA 3IODA 4AL4A 4EG0A 1E2JA 3LYLA 1K88A 2DFPA 3UT6A 1U02A 4RTQA 3DL2A 2H92A 5ICMA 4ZIRB 1VCMA 1LBEA 1PQYA 1X2BA 3KAKA 4ETNA 2VTEA 3NBYC 3T1HB 1R8JA 2E5FA 4I4TF 1JHQA 1UJ4A 3K0AA 4ZQIA 3K0FA 4QLAA 4RORA 3FI9A 4P7JA 4DZTA 4JL6A 2C5SA 2ANBA 1OIVA 2CVZA 2GCOB 5FHQA 1U1DA 1U4SA 2AQIA 1OXTA 3SNKA 1LBTA 4H60A 1QHSA 3AETB 3TLKA 4CM3A 4X97A 1GFZA 5E1BA 5CBKA 4DG8A 4DXHA 4P3YA 4KBGA 1DG1G 3G9QA 3EYAA 3V8EA 2BI4A 1Q0SA 3DKKA 1Y6QA 2DHCA 3GGGA 4IH9A 1GTL1 2GRUA 1UBMS 2ZUUA 2NO5A 2EDAA 4LYAA 4OV6B 5BUZA 1A5AB 1P39A 3L0OA 3CZQA 3R3WA 4XJSA 4PM4A 5K0GA 1GZ5A 4CRWB 2NG1A 4PXYA 5BR7A 3G8CA 5CEEA 3KV1A 3TRIA 1PG5A 2JI8A 1QS0A 2TMYA 1YHZA 3R8XA 4ZICA 2D0DA 4NBVA 4QPJC 3TCNA 4E13A 2MOKA 3CM0A 5AJZA 1C0LA 3MLBA 4U9IS 1JBKA 1NIPA 4ND8B 3GZ4A 2A5DA 1SC6A 4IJ5A 2IIVA 4GMKA 1E99A 3FZGA 4UOQA 5HTOA 3E9CA 3ORSA 1J33A 3TQSA 3HN2A 3ZHVA 4I5GA 1WZ2A 1TCVA 3WL3A 2HXGA 3QVVA 3WGQA 4XOUA 1IEVA 1Q12A 4DLSA 4JI2B 4UUPA 1ZK1A 3U4IA 3OOWA 2B99A 2VTDA 4PR3A 5KVSA 1YRWA 1AXEA 3PLNA 5LKRA 2PX5A 4UTNA 2I1WA 2C88A 2YWRA 2W6QA 1GKLA 2IU6A 4FYYA 4B85A 4JU9A 3TLGA 2VTVA 2VCYA 3JV7A 2BT4A 1P7ZA 1M34E 1X9HA 3EULA 3PUKA 4XYMA 3WYNA 1O5OA 1R9GA 4O5AA 6PFKA 4DWJA 4ZKDA 4IIJB 5JCOA 1BVUA 2CNOA 1KAOA 1VB3A 4MP3A 1NP3A 3EQZA 3KQYA 5FEMA 4JA2A 4R1NA 4X0EA 5C52B 1UUFA 2ZRFA 3JYNA 4CXMA 4P54A 5EEGA 3LI2A 1H5UA 2OZVA 3H5RA 3JAKB 4E6PA 4UPDA 5AOBA 1KY4A 1PHPA 1HNXB 3A14A 1KYTA 4ENSA 4F9FA 1H0KA 4LQCA 3VPHA 1SCUA 3HCOA 5EJGA 3PYLA 1S89A 4D92A 5EMLA 3I9MA 2OESA 5BQ3A 1W4ZA 7GPBA 5HJEA 2BIFA 1HURA 3AR3A 3L07A 1H69A 4OHPA 3ROFA 1JNYA 4JYCA 4BVKA 5L40A 5AI6A 2YMLA 5KOHA 5AKGA 3N2YA 3EVGA 1UMDB 3UAZA 3VR4H 3U4QB 2YIDA 1J9ZA 221PA 1QG2A 4KOAA 3C2QA 5CIQA 5JXIA 5MN6A 1KFJB 3CLTC 3TLCA 2D7JA 4G9EA 3O2JA 4RPIA 1BTOA 1DB3A 3AEXA 1RJ9B 3U44A 3QE9Y 3HK2A 1R3DA 3JASA 1KC3A 3U7QB 3GLHB 2GHIA 4H18A 4P7BA 3NCTA 1XTUA 4DDKA 1HNWB 4OQQA 1S0UA 1GTVA 1XD8A 2Z3WA 3FF4A 5KTTA 3DTNA 3U7IA 1JECA 1G5PA 4HNUA 1OYYA 3KQKA 3P0JA 1CZRA 3AILA 1SHTX 1RWOA 2E2WA 3FFXA 1T36B 2QF7A 3PF8A 4IS3A 2BE7A 2VDMB 4TT8A 3NJ4A 4XR9A 4NFLA 3G5MA 1I6MA 5ESXA 3ZWQA 4CNBA 3AXSA 3UPUA 1PQPA 3Q5DA 3EPRA 1JHPA 1WABA 4CEIB 3JARA 2LTAA 1V5GA 1RZ3A 3QEMA 5FLEX 5KKCA 2C42A 4NICA 4HY3A 2HU2A 3RH0A 4DB2A 4MPJA 4ZEXA 5HF6A 3PS9A 1DJQA 3OOSA 2BSQA 4KG7A 3SFZA 3J7TA 2VPXA 4WPGA 3MLAA 3TD6A 3WFZA 2V9ZA 4PNPA 3PE4A 2V7XA 3U3RA 5KNCA 2A1TR 2EX4A 2CNBA 2HTFA 5A06A 3ZVMA 4GBGA 3WG9A 3OQHA 3CW8X 4C14A 3W9UA 1ESDA 4PFQA 1WW8A 2H1SA 4MW1A 3T3DA 4PYNA 2FR1A 1ECJA 1PZHA 2AOUB 2W6JA 3DF7A 4MR7A 4OLHA 4XCVA 1JHZA 4MB0A 2EG5A 3RD5A 1EWVA 2BPOA 3Q9SA 1C7JA 2NGRA 2WAYA 3TLJA 1RPNA 3R41A 3QLUC 4H4CA 4BAUA 1EWTA 2C1XA 2IEZA 4XWTA 3PFNA 4YUZA 1ND6A 2PKRA 3I2KA 2WE8A 1ZVMA 1VFNA 3BE6A 3JWPA 2F55A 5T6MA 2GLUA 5K0BA 5KTSA 2UUAB 5JCJD 2PKWA 3C3DA 3JWJA 1YT5A 2NTVA 5ALJA 5ES3A 2Y99A 2FFQA 5G0UA 4C78A 3HJTA 3C97A 3FDFA 4CG1A 1XK6A 3L40A 4KB5A 3ID6C 1XLTC 2ZBVA 3Q9UA 3Q8KA 4YY3B 1EX6A 4BNVA 3IH5A 1TDJA 3PDCA 1KYXA 4HLQB 4JOQA 1EXVA 3TNLA 1FP2A 3RS4A 4J3JA 3HY6A 4IRMA 4JGGA 1L7RA 1W59A 3FB4A 3BJIC 5H16A 2RHCA 2O2CA 2HK7A 2FMUA 4O0LA 2XMCA 4FLEA 1SCKA 2BEJA 4JT9A 1UF9A 3A3YA 3PC4A 1O95D 4ZHQF 5ESWA 1RMYA 2NQTA 2GZDA 2R47A 2XE8A 3BZWA 3CNEA 4IZIA 2GZRA 3SZGA 3KR2A 3GN1A 2AF3C 4ZTUB 4AVYA 2ONZA 4YP0A 3CN9A 3QVXA 1SCJA 2A0WA 3CWCA 3NVKI 3P1JA 3S6JA 1JAYA 3V2IA 3AVXA 5KNBA 3OAAD 2FTKE 1KJ9A 4IHJA 4WQMA 1QO7A 3QLJA 3UJPA 3E9MA 3ZX5A 1OBFO 3IQWA 2FLKA 3FAZA 4KVGA 1K4MA 4MVXA 4WADA 1E1RD 4HH3C 1JQDA 1O8BA 2O2GA 1ENOA 2RJOA 3DAYA 3E58A 3QLVA 3R9KA 2EXXA 1J0DA 5CT4A 2P30A 2ZJAA 2VYFA 2G28A 2CXPA 4GR9A 5H3CA 3TS1A 1VOTA 4WECA 1U28A 3SC6A 2DCUA 5I5GA 4IMJB 1L5QA 1NU6A 3L9XA 1JKIA 1RHUA 1YGYA 1Z34A 2ZAYA 4OQYA 3PVSA 4RGQA 4UQOA 5HILA 1VJCA 5JFTA 4F72A 4HXYA 2OR3A 2LKDA 5EUQB 2GDJA 1A77A 3SG0A 5KDDA 1OAKA 1VBNA 4J1SA 1AS3A 1DC4A 4RJIA 3ZW8A 1XD2A 4DLXA 5BV7A 1C3JA 3NDBB 5F2KA 3FNEA 1G21B 3ENKA 4FN5A 4BNDA 3WMGA 5I48A 4TYYA 1RAIA 3RYIB 1D2GA 2UZ0A 3GFVA 1EFHA 1ZD5A 3QKTA 2ZU6A 4MGYR 1T3ZA 5EKXA 3IDQA 2IYOA 3H8SA 5E7JA 3AVWA 1AF7A 2CE7A 4IG9A 2PUTA 2DFVA 4JI5B 1SBYA 5CLQA 3EWIA 2VR1A 3G7UA 3LQ4A 4G9BA 4B6SA 4FFBB 1F12A 1VJGA 2XQJA 3HSYA 1RPAA 4X6XA 5BVGB 4UTOA 1CPYA 3IKTA 4Z9YA 4MKIA 5LVAA 1QIFA 2JFFA 3FPLA 2XT6A 5EKTA 3BORA 4KODA 5EOVA 5LNK1 1XAHA 4CYMA 2OFFA 1CRLA 3ZGVA 1KHTA 3H84A 2VWQA 4G1UC 3A0RB 1ONPA 2HHAA 2YJ5A 3AEUA 4OBWA 1TZBA 2A4KA 2QLNA 4HC4A 3RK0A 3PLAE 2WKPA 3KBBA 4Q24A 3B51X 4PYRA 2OCYC 3AL0C 4B80A 3M5CA 3OUZA 4P38A 1AUXA 3KYIB 2BV3A 2FZGA 4WWHA 4RVOA 1Y8RB 2LCQA 5HP4A 1S02A 4OJTA 1D9XA 1RAAA 2XB2A 3JQFC 4O08A 2OGWA 2FG5A 2YVQA 2GBCA 3QE3A 3KJEA 4IYJA 4AMBA 1E79A 4DC1A 4L73A 3K73O 4ZARA 3DBVO 3ZKWB 2IPAB 2QN6A 4F9EA 1W52X 2E89A 1V8PA 2Q9UA 3ANXA 4OKSA 1A2OA 4LK3A 3OX4A 5BYKA 1JHVA 1EVKA 4QATA 1R27A 3Q7PA 4KO4S 3HLTA 1ZH0A 1SD1A 1DC6A 1ZX1A 4GSLA 4LPSA 4OA5A 3VPGA 1JG7A 3I34X 2EFJA 2RAFA 2RGBA 4M9XA 3UWSA 2HX1A 2DAPA 4TRNA 8MHTA 1NONA 2PL5A 5LDDC 1L5KA 4MZXA 2PN1A 1E7MA 3Q1LA 3T61A 4D3SA 3HVHA 3K8QA 3HBLA 4GYWA 4R2MA 5IAKA 2X6QA 1U0SY 1NE2A 1OTXA 2AOWA 2KSQA 3PXUA 4F4UA 1Y6JA 4D45A 3PT5A 1P45A 2L82A 4FGUA 3IIJA 1RJEA 2V6GA 1GPAA 4MMZB 1NBHA 2I1LA 2QL7A 3CRNA 3FVWA 5CYPA 4DMHA 5K0JA 2RONA 3KQSA 5KAPA 1ZD9A 2BELA 2FOIA 5A6SB 3T4UA 2V7TA 2JBWA 3CLRD 1RRPA 1KDZA 1SUBA 2C9YA 4L3WA 4LDAA 2E4UA 2OD7A 1QOPB 1E59A 1M0EA 3FHTA 4NDNE 4IR7A 4TLBA 3WNDA 4FFWA 4IHKA 9GPBA 3RS7A 4D0LB 4ZGBA 4FKZA 4H2DA 1WKCA 1QX4A 3BWBA 2BHTA 5K20A 4TL9A 1IBRA 3K1AB 2OKCA 3RREA 3T94A 4ARAA 4YROA 4G2NA 5C7LO 1XTIA 4O8ZA 5K6RA 1NTRA 1PJSA 4U4AA 4AYXA 4BO8A 1EVIA 4KIGA 2JCVA 1CLEA 1A0OA 1K7YA 4QBTA 1FFHA 1YJXA 2G6BA 3O74A 2VNIA 3UVEA 3GELA 4MUEA 1Z6ZA 3O0TA 4E7PA 5L3RA 2W83A 3D6UA 4YAEA 1V1MA 3W8DA 4QNRA 3TQTA 4EB8A 1BCRB 5LPNA 3VNVA 1WXWA 3C0KA 4G5GA 1SIOA 3U80A 1S8FA 5HFAA 2XCLA 1TUIA 2ZYGA 4NH4A 3PXGA 5C31A 4O4JF 3EOZA 1JSLA 2C03A 3L77A 1JHUA 4R40A 1UDBA 1J25A 5AK3A 1U0OC 5BN5A 2P91A 3FYUB 5KVCA 1W7AA 2X5XA 4H3VA 3RYHA 3GLFE 2AFIE 4YXWA 1C7ZA 5FOVA 4FYXA 2FN9A 3RRBA 5AOVA 1W581 2H5LA 5DGXA 2DY1A 3E03A 4H27A 3R6LA 3PNPA 3UJ7A 4B4UA 5HK9A 5GIOE 3WV4A 1YB5A 2UXDB 1JILA 3W2FA 2VL7A 3IIEA 3ITKA 5BYJA 2Z4RA 2ZBGA 4D0GA 1IHUA 5A9TA 4G8BA 2JZOA 1KRWA 2BRUA 2OHGA 3REQB 3SVTA 4QXRA 2AWOA 3GG2A 2LP4Y 2LUOA 3PNQA 3UTCA 3OA0A 1Z4NA 2C5EA 1G6OA 1X7DA 1J6UA 2WZBA 5T67A 1L6IA 4DY6A 4NBUA 1JNXX 3Q1KA 3G9UA 2H4XA 5ALEA 4C6HA 2CT8A 5EHGA 3O73A 1O96B 1JJVA 2G3YA 2CUNA 2OEPA 2CYBA 2XOKD 3O9MA 1B0PA 2WU3A 3P9YA 1XQ1A 4BVJA 2BKXA 5DNUA 1TAGA 3AGQA 3A28A 2PXAA 1CB7A 2CD7A 1NW4A 4EOGA 3HJUA 4V0ME 5HKKD 1VB5A 4K8RB 2IYYA 3H1FA 1CUJA 4II7A 5FKJA 1SC9A 4K3VA 1LVGA 1HC7A 1TTPB 1V5FA 4U7PB 1N8SA 3L7NA 5THKA 1KEEA 1XCLA 4YRAA 3VVBA 4U8GA 2FX5A 3P9XA 4WZAE 2FXVA 1WVGA 1GSAA 2X5JO 3DBIA 1NSFA 3UJ9A 3C7TA 1IUKA 3KALA 1E9CA 4KFRA 1Q20A 4DCVA 4ZVMA 2QTTA 4I1VA 3UB2A 2XF2A 3WFJA 4UXJA 3UHAA 4AYTA 3HMKA 1ENPA 4LVUA 5BWNA 1TO6A 2NTEA 2QRUA 3DC2A 3PCXA 4C0KA 2Y2VA 5JSZB 4YIKA 3KKKA 1N8TA 1Q16A 4MRPA 1VYHA 2A33A 2ZBEA 5ICSA 4CEHB 3I9KA 2H16A 4F7DA 4BKQA 3D3WB 1Q84A 4HNRA 1W0CA 3V6MA 4TGLA 2WRZA 4AY3A 2OA0A 5BPFA 2D2VA 1KVTA 1ZL0A 2N1BA 4BB5A 3TIFA 5FPHA 3ZI4A 1E3JA 4IFTA 4LRUA 4Y6RA 2I66A 4JJZA 4LFAB 2WOOA 3PXCX 1TF2A 3GMDA 3W2HA 3TG8A 1K8ZB 4NFHA 3ZU2A 1NFQA 3MM4A 4G5RA 4MIOA 3IUEA 5JO9A 1XLWA 2R8OA 4FEEA 1RLOA 1SUEA 2A59A 1IB0A 1SMKA 4OXQA 4PAMA 1Y63A 4TQUS 5JSKA 1LPAB 4B3SB 5CITA 1OAOA 4KGDA 4RAOA 3H6HA 2Q4DA 3NATA 1SG6A 1ZN2A 4U0JA 4UOEA 1E6EA 3H9JA 5JS8A 1XZEA 3LLCA 1RM3A 2VZ0A 3PXBA 2FZKA 1DO0A 1V16A 1QZ3A 2B78A 2H2IA 2O3JA 2WJZB 1H9AA 4BMDA 3S27A 2JLZA 1F5SA 4KYVA 3WADA 3EG9A 3B6ZA 1W0JA 3DOHA 1DQZA 1M8JA 1D5WA 3BZBA 3TW0A 2PLWA 2ONYA 2P2LA 1JJAA 4EA6A 1AY0A 1WXIA 5AOCA 1YKGA 5ALMA 5F7ZA 1EUDA 2E4YA 3BFPA 3GP8A 4R7TA 4CMBA 1D1SA 2DWQA 4H77A 3KU1A 4HXEB 3VUEA 1IFXA 1XU9A 2WAAA 1BYIA 1QIJA 4RIFA 1RRFA 2H7CA 1Y9DA 1GGHA 4RANA 1GZ7A 1NRWA 3GQBB 4M87A 2YJZA 4TWZA 4FM9A 1GQYA 1PHRA 1I8TA 3FBWA 1E2NA 1MG0A 5HVNA 1BGVA 4D46A 4PC7A 1E1MA 3TXYA 4KDFA 2PUVA 2ZUDA 2DM6A 2NOAA 1NBMD 3LT5A 3TRDA 1V39A 3KEOA 1WSDA 2ZS8A 4W8OA 3T7JA 2A9QA 1GSHA 4D4KA 1HUQA 1KYVA 2B1RA 1ZA2A 2ZTLA 4KNVA 4PZ9A 3SZOA 1OXKB 2NO1A 4DMRA 1LF0A 2Y1XA 3W5UA 4LOIA 2ZYVX 4WBSA 4KR9A 1QGUA 1Y7PA 4ALNA 3R7LA 4YP9A 1NVVR 1HSOA 1VIDA 2CLIB 2ODNA 2IUEA 3M8KA 1JFLA 1L7NA 3DDOA 2FWMX 2QOEA 4V24A 2OXRA 3JR3A 3ODPA 3STUA 1GT91 3TQFA 4A8JC 3N2GB 4BU0A 2R1UA 1QIDA 4GXQA 5EQDA 1LSSA 1Z62A 3THYB 5CT5A 2GAFA 2XZPA 4GMDA 1FS5A 4HF7A 4MS1A 3P2KA 2F62A 5D6OA 2H18A 1KTIA 1OC2A 2PL1A 3RV3A 1QQTA 3K05A 4M1TA 1YJ5A 2YV5A 2JZCA 1FYXA 5CNIA 4DNFA 1DU4A 1Z5UA 5KSOA 2HF9A 4UEJA 3M9WA 1ECFA 1PT7A 2YV1A 2O8BB 1XEWX 4ZVSA 5EIXA 2GXAA 1N5DA 5JH7F 4FNAA 2NXWA 4LJRA 1FYWA 5JXHA 3GLHE 4MQFA 1JYFA 2E1PA 3WFIA 3ZWAA 4LOJA 4LV8B 1L7EA 1VGVA 4CTKA 1KARA 1D3AA 1EZ4A 1RYHA 1WWKA 1YSCA 1YZ3A 2A57A 4KXLA 5AKZA 5L6LB 2Q5IA 3UMYA 2QMEA 4JT4A 3HCDA 3TX6A 4CPDA 1I7LA 4ARZB 3OU7A 3R24A 1ZD1A 4BKRA 1BE6A 4KMSA 3LHSA 3L4JA 3WSVA 1GL3A 3QLUA 1Q1AA 3EASA 4QVGA 4YN3A 3GJ8A 4GWGA 1Q1BA 2QP4A 4Q5IA 3GJ4A 3EMVA 1AHHA 2VYQA 3C74A 1U8ZA 2GOYA 2YCBA 1U98A 5C8YF 3OJ0A 1A5TA 1CUGA 4QU0A 4X7RA 3TAHA 3N76A 4CR8A 1U7WA 2YNMD 2Q5EA 4B6PA 4JVLA 1ZIPA 5CP8A 3ZC3A 4NBTA 4DQLA 1U7OA 3PDUA 1JLKA 2F1OA 2FZCA 3DEJA 1XZAA 2DQZA 1RXSA 1H66A 3D0OA 3EC7A 3GEIA 4KQ6A 4WCVA 3MUEA 1UWKA 1GR1A 5IK2D 5FHRA 1T0IA 1IBKB 4FD2A 3LTEA 4GEGA 1UXJA 5AK4A 1VL0A 5AVVA 4OGKA 1NQOA 1UM9A 1KP2A 3HKDA 4Z54A 2CEAA 1NR1A 3AOGA 8OHMA 4PQEA 2J5KA 4AJ1A 4AKEA 4P4SB 4Q82A 4YMHA 3KXLA 2AG6A 1OLSB 1KO1A 2ECFA 3I45A 3PHJA 2VF7A 4GVXA 4O3FA 4REQA 3WDMA 1UC5B 3WL5A 2B4QA 3RSCA 5AK6A 1W1WA 2ZDGA 1PYDA 4OD0A 2P3OA 4RSGA 5FWDA 5EIFA 3T7TA 4WBNB 4DHWA 3I0ZA 1BKYA 4K6MA 5EWJA 1PFWA 4LFBB 3ABZA 3JTMA 5JHGB 3OP4A 1NNUA 2JASA 1QHEA 3IESA 3R0QA 4FW8A 5FV4A 2UYCA 1H93A 3IQDB 2J5RA 2GM3A 5JBIA 1VA5A 1NDHA 2Y92A 2YN2A 4P8RA 4NE9A 3IVRA 1TA9A 1VLVA 3OJXA 4M9QA 3VYUB 3TOCA 2O8FA 2GT1A 2PZ8A 4K40A 4DIFA 1EX1A 1R66A 2P1RA 2Q5FA 4O4LA 4QAQA 4D81A 4F4HA 3IL2A 1ODKA 4MYTA 1I6WA 2ET6A 2PTHA 4I6JA 5DMXA 1BFDA 1JWLA 1EFKA 3E18A 2F8LA 3IGFA 1X7YA 1N7HA 4GP9A 4RXUA 3QV2A 3F98A 1UBRS 5DOZA 1Z0AA 5IC6A 2OGSA 3RSFA 4GQIA 4IILA 5CTAA 4B9EA 1EFTA 5EP2A 1U2GC 3QOFA 4PU0A 4DHEA 3RADC 1EK6A 5GTDA 1HDEA 4RW0A 4KQXA 1O97C 3VZSA 3QSYA 2BEVB 3MS2A 1OI4A 1XLVA 4PLPA 3GQVA 4ZOCA 2VF5X 3KOOA 3H7IA 3HCAA 5E38A 2GN8A 3CO5A 4RJJA 4ME6A 1U1FA 3A6HA 5DM1A 1NUPA 4BRSA 4ZRNA 1DC5A 4K9RA 3I23A 2L19A 3SIPA 5FOQA 5K01A 4NZNA 3E82A 4X66B 2JH8A 1F7UA 2ZSIA 2WUVA 3F7TA 3THWB 1XCOA 4AW9A 2W9XA 4JUBA 2C2YA 5DBHX 4MYSA 2OQVA 1I2DA 1JEJA 3DMDA 3FSRA 4JELA 5A03A 1EFRD 2YJ3A 1Z26A 4J6FA 2I6GA 1VG1A 1Y8CA 1E5TA 3EXG1 5EWMA 4I8IA 1YVEI 5FTKA 1URPA 3OZIA 4HZGA 4TUYF 4CEJA 3GJ3A 4JL8A 3ZHZA 1GWNA 5ALRA 4HGQA 4ZAXA 2MSWA 5IXJA 3L0YA 3GROA 3B78A 4FSHA 2D2XA 4IX9A 3JQFA 2QV0A 4XGIA 4HMQA 2VF4X 3DO8A 4H6XA 5DXFA 5AFSA 2VP3A 3NFRA 4YWHA 3WLLA 1KWGA 2RI0A 5JAOA 4KDCA 2EBWA 1UXHA 4N54A 1D1PA 2R6GA 4BE9A 2OORC 3DZKA 1P1IA 2JA2A 4IXTA 3MJTA 1LUAA 5IYZB 4LYDA 2IOYA 1E9VA 4Q01A 1QHXA 3ZXUB 3COWA 1AB5A 4ZV9A 2O2SA 3VMMA 3OHSX 4V3BA 2GLTA 5TQ0B 2Y2UA 1XRQA 1N0UA 3KB6A 4DDTA 2WTXA 3O94A 3RTAA 4HDOB 5IT9A 1YDWA 4BFUA 3M9XA 4RJLA 1YKFA 1BVRA 1PZNA 3QWBA 2BGTA 3TUJC 1F2UA 3ASUA 2BOVA 4UNQA 4EVQA 4G6ZA 4DR2B 4LBYA 5EHIA 4F45A 2FPSA 1E77A 1D6MA 1RI3A 2O52A 3N8NA 4G8JA 4II2A 2RHHA 3F67A 1QZTA 1RQGA 1NBWB 2DT8A 2QXTA 4U7HA 5AUQA 5DNDA 2PUGA 3F6RA 1MB4A 3H2GA 3VPBA 2PUDA 3IS3A 2XQKA 2GGSA 1H3NA 2O2DA 2W2VA 1UKEA 2H2WA 3DEFA 2EW2A 3O92A 2CHGA 3ZCXA 1Y3BE 1XDGA 4YMIA 3PI6A 4D6XA 4G0VA 5LFAA 5C4IA 4TTQA 4OREX 3TGWA 1M2OB 4URHA 2JLWA 4XLTA 4ACBA 5JJKA 2VP2A 1Q17A 3CXUA 1Y9AA 2IE8A 4L02A 1NU8A 2OYCA 3STTA 3ZDYB 2WSLA 3OJOA 3EVDA 4EHDA 1WY5A 2XRFA 4JUDX 4O63O 2BCJQ 1GN9A 1L9XA 2REOA 3ZQ6A 3FDZB 5HCIA 1AZWA 1WXGA 4F4JA 3B3QA 3F3YA 1MU0A 1GFWA 4DVGA 1M1YA 5AW4A 2CZQA 2Q45A 3RRMA 3RIEA 4LYHA 1QDLB 5BRJA 1T5DX 1VCIA 1YFZA 4HZUB 3HEMA 1LWOA 3LLVA 2ZYIA 5HMLA 3VH1A 3GT3A 2XGMA 3O4JA 3EG5A 4JLDA 5JAUA 2VPPA 2X13A 3ORHA 2OXTA 2XXAA 1QF7A 3M5PA 2D5LA 3O8NA 4U2KA 1I10A 3CX3A 1RZVA 4H0CA 1XAJA 4JHXA 2XCQA 1WJGA 4V0RA 3VC7A 5KNDH 3H11B 4OI2A 4F06A 3IUYA 1DIHA 3FKQA 1VHJA 4RH0A 4WACA 1N2OA 4X94A 5EYPA 3BMQA 4B09A 1BX3A 4JI7B 3SJ7A 3B1VA 1NMEA 3C3BA 2OCPA 2Z2JA 3DKVA 1WV1A 3UC9A 2ADFA 5JAHA 1ZUNA 1V3UA 3EPPA 3GNSA 5CT6A 1EVJA 1VRVA 1AK9A 3B1YA 5CFRA 1B41A 2AJDA 4O8CA 3H1GA 4A8TA 2BFOA 3KVNA 3LCMA 1E6MA 2A5JA 1C3LA 1XCGB 1H6AA 2R1VA 4DJ5X 1YZQA 2IXTA 5EXDA 4YCAA 1EBUA 7AT1A 3THXB 1V11B 3WRXC 4LRSB 1NAIA 1N3YA 1L7OA 3KQWA 2I76A 4IWNA 4X3PA 3B48A 4IJ6A 2I4NA 3QU9A 1B16A 1SKYE 3QPUA 1BU8A 2GHRA 2Q3LA 4LZOA 1F51E 3TJZA 4D0RA 4WESA 2F3SA 3AUUA 4QWWA 4WOPA 4NULA 3VDXA 3DHEA 5KNDD 2OZLA 1KWKA 5GM2A 2VH2A 1UMCB 4QLOA 3V97A 3GN2A 4EGAA 2BM9A 1AX9A 1NR5A 5IKMA 2ZUFA 1DKNA 1YQUA 3NHFA 2JJ2A 1N7JA 2CUTA 2P4SA 3V00A 3GYGA 5A4KA 3IBYA 4Z5XA 3AIKA 3M6IA 2PH1A 5I9IA 5FWXA 4G4SO 2BI8A 1JWAB 3A4LA 1IVYA 4EYOA 1E5DA 2YDYA 1ACMA 3IALA 1UFRA 1TCCA 4EG4A 4WE3A 1TZ2A 1KDVA 3W3AD 1GGMA 3KUUA 1D0IA 2W4MA 2ZYSA 3K96A 4F1JA 3WA7A 1TX4B 1KGDA 3QEOA 5P8WA 2J3MA 1X80A 2H7VA 2WSSD 5CPBA 2C9MA 3E23A 3HJHA 2WKWA 4IINA 3ZIAA 3FCEA 3THRA 1UBTS 2DYKA 4J43A 2OWDA 3C14C 3OVMA 3MD0A 4R9SA 3RUIA 1E9SA 4DF3A 3LW8A 1HLPA 4FLMA 2BEWA 2I6UA 2ZDQA 1UFOA 2IYXA 3QLTA 1RACA 3EXFA 4F84A 4NEHB 3OFSA 4G4SP 2XUJA 4YJ3B 2D00A 4CF4A 2Z30A 5ECDA 3EUFA 4KPUA 4Q4AA 2XCSB 3PNSA 3VNRA 2I7CA 4EI9A 2ZJZA 3W5SA 3S99A 5ALKA 1QK4A 4D57A 1M3SA 3VTKA 5HRAA 5HW0A 3VA7A 1A9TA 4D3FA 3QWHA 2YZGA 4GX5A 3K94A 2UUBB 2GEUA 2RH9B 4WNAB 5BWLA 4UUBA 2VTBA 2JEOA 5DGTA 1MPTA 3KDAA 3T7IA 1CUXA 1B8VA 1YR6A 2BFPA 2DC1A 1DCFA 3GZNB 3HJAA 2P6PA 6REQA 1L6RA 4YAFA 4DVJA 3KTAA 3WGVA 1K5GA 2I3DA 4IOJA 3ANNA 1MDFA 3TUZC 2P27A 1P1BA 5DCYA 2PANA 1JJBA 4KTTE 2BW0A 3O4VA 1PV4A 2XCUA 5IT0A 2QP9X 4MLPA 3RRJA 1DZ3A 4ENWA 5BSMA 1W8IA 4TV8F 4MHTA 3K30A 4WXMA 4X7PA 4JP2A 2FZEA 1DUIA 2QTZA 3KXIA 3N2KA 3T54A 4F2HA 3DBHA 1PR5A 3VR2D 3NBQA 1AKWA 4J1TA 5FYDA 1N9KA 4UM9D 1CY7A 1WUIS 2V1UA 1N33B 1J49A 1PIWA 1FPMA 1MAHA 2CL7X 2PGDA 3IJPA 3WNVA 3RYFA 5I8PA 4MV0A 3WTCA 9ABPA 4C2TA 5C37A 5L7TA 4ATNA 3SP1A 4B43A 3IPAA 2NQ2C 3QVSA 3OTQA 2IV2X 4F91B 1GL6A 2YUIA 5EZSA 4YAKA 2PX0A 3OPXA 4R8LA 1GUDA 2ATIA 3EZ9A 1Q21A 3L82B 3ONWA 5DSZA 3ZR4B 2R65A 2Q50A 1YJCA 3AERA 4EUHA 1DEAA 2IYZA 3LO5A 3ENZA 4IGFA 5IBQA 3RT7A 2W0MA 3I28A 1QHGA 3N7UA 4JGBA 4X20A 5C3MA 5IH3A 1NSTA 1JVBA 1K27A 2C2WA 2QRHA 4IM7A 3WRYC 4EYQA 3FCXA 3ACBA 2V9CA 5J1SB 3LUDA 2GARA 4Q1VA 1GV0A 1AURA 3G17A 2BKUA 2D3TA 2VLBA 2I3ZA 2RH5A 4LHEA 5LJLA 2PT6A 3T5PA 2O7NA 2XITA 4R98A 1QTQA 1SBNE 3S2ZA 5JLAA 1AV6A 1IMJA 1C0IA 1FRNA 4UHBA 1XP5A 3NRCA 5SV2A 1GQSA 3RU7A 4PLCA 1DFGA 5IF9A 2DERA 4QPZA 5BUCA 1U0LA 3URMA 3T5BA 3G2MA 5HX7A 4EO4A 4J0JA 1CXZA 4RMHA 3RHTA 1GY8A 3A9WA 1H9CA 3AG6A 2NNLD 5CVJA 5TGDA 1FJXA 4DA9A 3MYYA 2ZQYA 4NEGA 4OQNA 2Q0QA 5A5DA 2XUDA 3OOYA 4BVHA 1JEYA 5CB4F 3A7DA 3AOEC 3GOHA 4JQZA 1YIAA 1FXWA 4N41A 1KDYA 1JG2A 4ZI7F 3EWSA 4ZO4A 2X2EA 4DDUA 3CIFA 2QL6A 1R00A 2Y1FA 2GWRA 2WHXA 5ALOA 1VJ5A 4JCCA 4ID3A 3T4EA 1YI1A 2YZKA 5KBYA 3L6RA 2C8LA 2JAQA 2RBGA 3LRTA 5DGCA 3A1TA 5H02A 2ZWAA 1FFGA 5C0OE 1YNSA 1F2DA 1R15A 4YAOA 1V1RA 3P9PA 1UDRA 2G4LA 1ZPDA 3L1KA 2EARA 1WF6A 4RWEA 5J2UB 2SECE 1DAPA 1Z7GA 4F8JA 1QGED 2VK1A 4RHCA 4B73A 3BMCB 4BO4A 2JEZA 1U4NA 3EXHC 3BMNB 2V55B 4ARIA 3ZWYA 2HMWA 5KYGA 1K63A 1R5BA 1WPQA 3GJRA 4JLSA 5DVZA 1KY5A 5IKOA 3ZGZA 3RGWS 5IDWA 1IQUA 1JKJA 4U7TB 4EUKA 4GDFA 4DR4B 1O6CA 4N7MA 3EISA 5DHFA 2QMOA 1T4GA 3M89A 1SVUA 5JS2A 4J3NA 4C7KA 5HIMA 1GZDA 4QUHA 3RK4A 2KWIA 4BEVA 3HR8A 2PKQO 4IZHA 4JI6B 3HKBA 1V48A 2AI2A 4QARA 3NGMA 4DEXA 4LX8A 4QDUA 3ZCVA 1JBQA 4RQTA 3LYAA 5E2AA 4I4CA 3T9EA 1IN5A 1OLUB 1T25A 1YOVA 4AX8A 3QYPA 1PLKA 3SC2B 1N2XA 1T3SA 2RHOA 1ZMOA 3A25A 3OM9A 2HRZA 4FCTA 3ADKA 4P2GA 3EVNA 4P6VF 2J46A 3AVOA 4R7ZA 4XSGA 3RGGA 5KOIA 3B6EA 3NRBA 4PSUA 4F3YA 2BD0A 2DPLA 4C4RA 3DLPX 3FJ1A 3UYLA 4Y0VA 3WL6A 4E2FA 1ONNA 3IP7A 2Q3HA 3WKAA 5CDGA 2JZNA 2A1UB 2QLMA 3B3AA 4FNOA 1L8QA 3RFTA 2WY2D 4V0KA 4DGSA 5DIFA 1JQ3A 1W49A 2PWAA 4JJ4A 3PYXA 2VRWA 5ANRB 2ZWPA 4NARA 4OK3A 2PCLA 2ZANA 3V7NA 2A9OA 1Z15A 3FZQA 1NQAO 4KFCA 5CEFA 3NAQA 1GDTA 5JQGA 3CH5A 2P2DA 4MVJG 3T9CA 3PFIA 1VHTA 3RBVA 1J39A 2HFJA 5C1DA 2X5KO 1UOOA 1U2ZA 5HYVA 3KC2A 3D59A 4HTFA 1AG9A 2OY0A 3ETGA 4H6PA 4RPJA 4OL9A 1R8XA 2QYTA 1LLUA 2I7TA 3QUAA 4XDGA 4WCDA 3IKMB 3WAJA 1KSFX 3NM5A 1ESZA 2CVHA 4OP3A 2DWPA 5L4SA 3LPCA 3CB2A 3UJAA 2O9JA 4EUNA 3FLMA 2IU4A 3EFBA 2IYWA 3CJQA 3KG2A 4EA8A 5BNZA 4K9LA 2G4VA 3PCRB 4TV9F 4WLNA 1J23A 1X0XA 3FCUB 3KJNA 2GCOA 1JN0A 3B6JA 4LGYA 1H1TA 1U4OA 3UGKA 4DA4A 3IP6A 3RWBA 1Y3AA 3NHKA 2OL4A 1R0CA 1AKUA 1IG0A 3AETA 1XRRA 2MHCA 5ER6A 2HYDA 1AZSC 1QFZA 2B5VA 1IB6A 2C5LA 2VYCA 3IT0A 121PA 1TO2E 3M4NA 3VR6D 3VV3A 2PGAA 3PFBA 5K0NA 3QJ5A 3UM9A 2QTAA 3OLZA 1AKEA 3FDIA 3B13B 1SCAA 2PGXA 3KB2A 3DVSX 4O2AB 5PGMA 3INGA 3PE6A 3RLIA 3F7NA 5DHUA 5EPUA 7ABPA 4B3JA 1ZSVA 4BLVA 3C6BA 1SY7A 1V96A 2P4EA 3DMRA 4F71A 5KTOA 5CD1A 3KOXA 3QJYA 3ZDBA 4NCBA 2FPUA 1JW9B 3EGDB 3FLAA 5DSXA 1UXGA 1TEXA 1E7QA 1G5IA 2VYND 16PKA 3OJWA 3D4IA 1HE8B 4UXHA 2YOGA 5NLLA 4N4AA 4XIFA 1IDN1 3N8IA 1I5OA 2AN9A 3PNBA 3C4JA 4ND8A 2OZKA 2J9GA 3G0CA 4W7SA 4Z9BA 4TPKA 1KDPA 4MQMA 2FSIA 4X7BA 1XU7A 2XWPA 5EWLB 1ZCBA 1D1QA 1E32A 2OORA 2ODPA 3GPDG 3I3OA 3K2IA 3KU4A 4UVIA 1W4RA 2ECQA 2AUNA 3SZMA 5CA0F 5I51A 1D07A 2A6PA 3AF4A 3FTNA 3FWNA 3E48A 3OIFA 5FTMA 1GA1A 1NWHA 1USGA 2Z4TA 3ECCA 2IIBA 3MTGA 4WFJA 4U8HA 1OE0A 3UMGA 3ZWKA 4CW7A 2CLSA 1NQVA 3KPVA 1G41A 2ZROA 2C9ZA 2OQ2A 1I2AA 5HS6A 5IULC 4C6RA 2AJTA 3RARA 1U5BB 1PR9A 1N2ZA 5ALIA 4B6RA 1JR2A 4GE3A 3HV0A 3NXKA 5EKSA 1BDHA 2R6HA 3IQIX 1LPBB 4IIJA 4TWAA 3T34A 4X24A 3VR3D 4CV0A 4KYIB 4NCNA 3USZA 4C5AA 1OT3A 1OX6A 1CJUC 3GFSA 3K4PA 1AE1A 4NAVA 4TYPA 3LX8A 4MP6A 3CONA 1HRKA 2F1RA 3MCUA 4L4RA 1WXQA 3MT7A 2B94A 1G2OA 4N3CA 4YONB 4F60A 4X3CA 2ZRGA 4UJ5A 2YFYA 4OQLA 2PR7A 2GS9A 3JAKA 4N5MA 4I55F 1YQXA 4OHRA 2B8EA 2OENG 4PNEA 1SXQA 4PZEA 4LF9B 2DH6A 4GPTA 3HVJA 2C99A 2CHUA 3VBEA 4G01B 4J0EA 4DJFC 3D1LA 5EIEA 1AA9A 1X94A 3AI2A 4KGZA 5A3RA 5DP1A 3C7KA 4DG5A 5TX7A 2A5LA 4JLNA 4KSBA 1RFLA 1HOTA 3NB0A 3DV9A 4WCFB 1F1JA 4WKOA 1CEEA 3LT4A 4S35A 1A7KA 2DETA 4CKWB 1TJNA 1AQLA 1LK5A 3ZCQA 1QAMA 1PJ4A 2CMFA 1SOVA 3IHKA 5BV8A 4DBLC 1E3LA 1P0QA 3Q11A 1GJRA 3U4QA 3IEPA 1N5IA 3ORYA 4MS3B 3ZGYA 1ATIA 4GO1A 5HM6A 4YMUA 1MJFA 3BXZA 3RVNA 3TFWA 3K70C 1E1CB 3H9GA 1F6WA 1P5HA 3NXSA 3MAJA 1JB1A 3DZJA 4JLOA 3UJBA 4ZQGA 3LFTA 1R6UA 1RKQA 1RJ9A 4UMEA 3DV0B 3ZDXB 4BPBA 2ZIZA 4C0JA 3U7QA 3RAEC 2B20A 1NYLA 4M9SA 4KR0A 1H5QA 2JVIA 2W6IA 1CZNA 4NSNA 4UBIA 2QN2A 5DYNA 4X3OA 3NHZA 4LZAA 3WLAA 4QBIA 4TQ9A 3HYCA 3AFIA 3X1XA 4ZZ3A 3DR5A 4KLZA 1T36A 1ZK2A 2Q2NA 3EAFA 2FGKA 3HCEA 3EVEA 3V8MA 2N9UA 1JX6A 5F2NA 1CV2A 1HV8A 4GWKA 4NECA 1P0CA 1KK0A 4CEIA 1A2QA 3NR2A 2EP8A 4A8HA 4EIWA 3FROA 4FBGA 2RI6A 2C3OA 1NGSA 4L3OA 5K8TA 1OXUA 3QVKA 3X1WA 1XMOB 4URVR 5F5XA 3B7WA 5AJWA 1PS9A 3W90A 5CA1F 3W6UA 4RGYA 4ZGWA 3A06A 1E96A 2MDTA 1FDUA 4JH0A 1P7CA 1P9WA 2LE0A 1WO8A 4IGAA 2BGNA 4E51A 3BQNB 2IC5A 3F6YA 4KQIA 3GF4A 4QPCA 4N0DA 3UXYA 2D74A 1XRLA 4ZYYA 1OZGA 2E6UX 5CUQA 1VG9B 4RFVA 5CVVA 1KS2A 1A97A 3M6XA 4XPIB 3IAUA 1SA0B 1XA3A 2CFRA 2VOEA 2XR1A 2AOUA 1XZCA 1WF3A 3II6X 3GWGA 3QA9A 1IUPA 4NV3A 1K6IA 4TYWA 2GESA 5COAA 1VKJA 3N3BC 2B92A 1OBCA 3EH1A 4OXXA 3HWX1 1AVTA 2OBNA 1SQ5A 1V3VA 3WIBA 4BIIA 3F2IA 2XT9A 1MOQA 3FJOA 3EK2A 2G9VA 2PX4A 3N0XA 1KI7A 3OJFA 4NYMQ 4PYLA 5EJAA 3WNZA 2FW6A 3HRHA 5JI3E 2AIRA 1N6KA 2L17A 4MDYA 1PR6A 4UEQA 1X7WB 4A0HA 4E5YA 1LDBA 1J0AA 3KVOA 3Q3HA 3RV4A 2OMKA 4MWEA 4Q7QA 1B4DA 1CUFA 1DWOA 4DCNA 5JQWA 3A10A 2P6MA 1I4DD 3F90A 4DDMA 2FZ5A 1MV8A 3FMIA 4PC3A 2M6LA 3PNMA 4A5OA 4QPPA 4GICA 4FIZA 5I01A 2NACA 4NCJA 2GDZA 4CI9A 1VYTA 1WX1A 3D4BA 3X1ZA 4LJ5A 5A62A 2XZLA 4K9KA 3EJWA 2V1XA 4UFNA 2EWMA 4X7MA 5ELXA 3ZJVA 4TKUB 4B79A 3LSYA 3D3EA 2EAUA 4YAGA 3ETDA 4JJEA 1GCAA 4ZOBA 4D79A 4JLAA 3I83A 3SHWA 3E9NA 4KLNA 2HRRA 2XDAA 1QX3A 3ON5A 1GU1A 2QYOA 2O23A 2QVBA 4C0WA 4L7VA 1Z5VA 1S2GA 1NW7A 2X22A 3R6GA 1OWMA 3JD0A 3MIIA 4MJXA 4E6EA 2CJFA 1TQ8A 1G19A 2B1IA 3W34A 5KQMA 4KI7A 5HDBB 4Z4QA 3I1IA 2NP7A 1JL3A 2QG9A 1BHQ1 1DLIA 4S2UA 4GLJA 1U1GA 4ZQBA 4DNPA 4GSYA 2GAIA 2A3NA 1V7ZA 4UUOA 4UU0A 2BJWA 4KIJA 4ZO6A 3W4IA 2I1VB 3CS3A 1RQNA 4KK3A 3WI7A 4AZ0B 5CFOA 1AO0A 5DH9A 5TS2A 3ZV3A 4P5DA 1ZP6A 3LCUA 4QDOA 1AHNA 3OIGA 3Q7IA 1TYBE 4R8MA 2X4IA 4BFVA 5LA6F 4KUGA 4YUXA 1UXOA 3K71B 3K5WA 3RNLA 2RG1A 1PK7A 4Y9TA 2R79A 4UNNA 3UN1A 3RHSA 1RXIA 2QXYA 4RPGA 4D8WA 4Z7JA 6GPBA 5LN1A 1PVVA 5FUQA 1G21A 3H2JA 1NZDA 3ONEA 3C5HA 3KSUA 3O4GA 4YCJA 5DTJA 3RYIA 3KZOA 1SC3A 2WMDA 1HQYE 2ZJ4A 3LH5A 4NBLA 4NS1A 3GHYA 1VE1A 4TTIA 1KK2A 4ITVA 2COKA 2CVOA 3SYMA 4KRFA 4Z8YA 4YRLA 1GV1A 4YVFA 5K0ZA 2GEKA 2ZITA 1HOXA 1QRRA 2WTAA 5BMOA 1IPFA 1X42A 1Z07A 1H2XA 2D2EA 1PJCA 3C1AA 4FFBA 4G26A 5JSFA 5KNCD 3UMCA 5BVGA 2IZ6A 4TRMA 3AGPA 5FBZA 2ZJ7A 4BQIA 2P5YA 4G9GA 3ILYA 1UJMA 4DLNA 4M0FA 5BSWA 2BFDB 2AW3A 4YJHB 3TB4A 4KOEC 3INRA 4CHTA 5EQJB 4M21A 1ZM9A 2YHBA 1HT0A 3BD7A 3IELA 4GU5A 3WP0A 3RVOA 2W6JD 3VSDA 3T35A 2DUMA 2OK8A 5CFZA 2E4WA 4PFJA 4UQPA 1QOZA 1UBOS 4XJTA 4XE5A 3AKDA 2CXRA 3Q7QA 4KQEA 4MR8B 1KIMA 3ROQA 1C14A 2POCA 1GYPA 1ZJ4A 5IVIA 4MV7A 1Y8RA 4QLBA 4OB6A 1DKLA 2QSYA 1QGZA 5TEVA 2H9YA 1ZU4A 4EW3A 1XF1A 1G38A 2D1QA 1XNRB 3KYCB 1X14A 3MK31 1G63A 4Z7NB 4ZAWA 1GVHA 3ZKWA 1JDSA 2AOTB 2GBFA 2O2XA 4S0ZA 4JBWA 1CRZA 3RIXA 1K7SN 1G5HA 1NM5C 5B58T 1U7UA 1YZVA 1B43A 5FPSA 4TXJA 4LMBA 2H9AA 3D2AA 1CIPA 3IVAA 3NOVA 4CMEC 1C9NA 3HDGA 4BLOA 2NYRA 2JIMA 1RCTE 3B1XA 3OZXA 4O4HF 4RETA 2W6PA 4TTPA 4A5SA 1KIFA 5I4CA 2GMWA 3QWFA 5KTPA 1NRIA 4M76B 4U7DA 1U31A 3OCVA 2JVKA 3Q40A 4KITB 2CXUA 1OGYA 4MARA 4TKZA 4IRXA 3TSYA 1WM1A 3HBAA 1P1KA 4R1LA 3P7MA 5FQNA 1N6NA 4KXYA 1V4BA 1QQ6A 1KMIY 4K86A 4Q9HA 4QOGA 4BLUA 1ECBA 1GCIA 3L49A 4W1SA 4JV5B 3G5TA 2C0QA 2TMGA 3HPRA 1MEEA 2JD0A 4KDEA 1SB9A 4FMCF 5A6SA 4P7FA 3NONA 4I2NA 3EXHA 3W0LB 1O0CA 4Q7MB 1LW7A 2QAJA 2D8MA 2O3UA 5KNBD 3LP5A 3V4RA 4CM5A 4JDUA 4E2XA 3PX3A 1IUNA 5I7AA 3JQDA 4KX3A 4X71A 2ZJ2A 3MNFA 3T5TA 3GH3A 2QW1A 3STXA 4YRQA 1SHUX 4M1SA 3K1AA 3HFSA 4G0WA 3ZQ4A 2XB6A 3OZDA 3P9NA 2FQXA 3V1YA 2A0KA 2XOEA 1A9YA 2GPNA 1TQ6A 3GOQA 2Z56A 2HXYA 1ZC4A 2GN9A 3KOYA 4QOSA 5CM2Z 2G8LA 1OU0A 3PKIA 2PLAA 1Q0QA 2CB9A 3AINA 4TLAA 4U63A 4CMKA 2FMKA 2LZ0A 4E12A 1T5IA 1Q1GA 1BCRA 1QKKA 2BMFA 5F7JA 5C1BA 3JQQA 3X1YA 3UGJA 4HGRA 4PE5B 1S2OA 3OPYI 4ZT5A 3HXOA 4MRRA 1XTZA 2VDWB 4QTZA 5DX8A 3IVXA 3KYDB 3PPVA 4PLHA 1YONA 3QTTA 3JYPA 2R85A 3FYUA 2XWQA 5BY2A 4OLJA 3ZDCA 5KPJA 5IZCA 4CTNA 2EZ8A 1HDOA 4RSRA 3RC7A 3U0BA 1E61A 2ID4A 1EA7A 1C4OA 1E2HA 3SHOA 4F5DA 5CM8B 3WBFA 3PGVA 2QD4A 2Y0EA 3LE8A 1P2VA 3EQ6A 1MQSA 2GD2A 4IZOA 2B30A 4BTVA 4PQGA 1TKRA 2W6ZA 4R1QA 4TTAA 5E1DA 1L5HB 2BCEA 4GKBA 1KEKA 2XKJE 4OM7A 2RKWA 5EINA 3RE1A 3DH0A 3Q7SA 3L0BA 4C5CA 5C4MA 4YB8A 5J58A 5JS1A 2WB2A 2GF0A 4DABA 1EE2A 2IZOA 4UPVA 5EJ8A 1Y1RA 4IL5A 5HDQA 1K66A 2ZYDA 1PT5A 3OTHA 2Q41A 1QFXA 4RAQA 3F5QA 1E79D 1X8KA 2CLOB 2OV4A 3LQQA 1O96A 2IQ5A 1MXHA 3QG5A 1OX4B 3DE5X 4UCXA 3H4VA 2FHSA 3V48A 5FPTA 1ZN9A 5A2QA 4WSOA 1IATA 4EW1A 3SDSA 1Y7LA 3QUCA 4FDMA 1CZHA 1LV8A 3HWWA 3MOSA 2V7PA 1IQPA 2IY8A 3GWZA 2AEMA 4MYHA 4PBTA 1P2TA 3BS4A 4W7HA 1XUOA 2EX1A 4LRXA 4S24A 4URFA 5D5HA 4DC9A 2QWXA 3RT9A 3GA0A 3R9XA 1JEQB 3STVA 1MHTA 1XZPA 3LV8A 4ZT2A 5DN6A 3AR6A 2RDMA 1ZNYA 4G1VA 4AUNA 3E7FA 3C1TA 1LA2A 3KZMA 4I4LA 3G0GA 3O7MA 4ZGGA 1N1GA 3TL6A 4O2LA 2J4CA 5BSKA 2IS1A 4GAEA 4F04A 3K0CC 1OU4A 4B2LA 2EZTA 3WZLA 1G8GA 2V4ZA 3O4FA 2NU8B 1RLUA 5JSZA 1OR8A 1T34A 1AMUA 1E2FA 1AT1A 1VA4A 2CDAA 2IBMA 4U5QA 4RADA 3UHJA 1P1RA 3X1JA 5BOSB 2OCGA 1G4AE 3LCCA 3D3WA 4HSGA 4M0CA 5FYQA 2H59A 1XTSA 1H22A 3ABOB 3P2YA 1MJGA 1KY2A 2AEJA 2JJQA 3IO5A 1EA5A 1BE8A 3PUZA 3B1KA 3TMKA 2EP7A 3X1DA 4BQFA 2ASEA 3EGXB 1IJBA 4CN8A 4MDEA 1COWA 2W00A 1RBMA 2YBDA 1SVKA 2PU7A 2YIJA 3QVTA 1NASA 4HAWA 4I1UA 4UBJA 3QEAZ 4AN1A 1AH2A 3DXXA 3DEZA 3P0IA 3RFXA 3R9WA 3TOZA 1UKZA 3RI3A 1FU4A 5EQFA 3TK1A 4CTJA 2V5VA 2RBKA 3E5RA 5DU2A 2AMJA 2Q8PA 3D7LA 3H2SA 3MFYA 1VSVA 4NCHA 4WLOA 3SIWA 3QEBZ 1CUYA 4TVOA 3FNQA 4DDHA 2RGXA 2W4QA 2Q4OA 3H19A 4HRXA 3VKGA 4EKNB 2QP3A 1ULUA 3B9PA 4AJNA 1UM8A 5CFPA 4J29A 2PHZA 3PYMA 2JARA 2VDLB 4LY9A 3U48A 1PDVA 1TVMA 2PZMA 4MIEA 5B6IA 1XVLA 3NPAA 3RTDA 2RK6A 2FPPB 4TL8A 3UBMA 2Z2ZA 5A5GA 3T7AA 5LMNB 1KVUA 4YXWD 3RVPA 1KP9A 1Z0DA 4UHHA 2EKBA 3NX4A 4IIVA 3T7RA 3DE3X 1F8UA 1CG6A 1PEDA 4BB0A 2JGJA 3L41A 3S81A 1PE0A 3D6VA 4GXTA 1MOSA 1Z3IX 3M3DA 2OBXA 1A4RA 4NG5A 5TE9A 1JDNA 3GQBA 5LZ2A 1N0IA 4BFTA 2J9YB 3A1DA 3NIWA 3NAZA 2UVDA 1II8B 4OHYA 2R97A 1HO3A 3UEOA 5CPFA 2XA2A 2PRJA 1SEVA 3TNDA 3ZX4A 3KAPA 4P82A 2R4TA 2YVKA 5AXAA 4UTVA 2BFAA 1CW2B 3FPJA 1OFTA 1Z08A 3F5MA 4LJ9A 5CCEA 3QNMA 2O0LA 2X7XA 4I8XA 2BJVA 3CCBA 4MEBA 1ZOSA 4BB9A 2J0SA 2QJOA 3PQCA 3E1KA 5JC1A 4KNYA 3LBNA 2NW6A 2WAOA 3VNSA 2F48A 3PGA1 2DWUA 5K3FA 1CK4A 3RAJA 3RVLA 1HDXA 3UFBA 4FMDB 3LP6A 3PSAA 4NCKA 5JVDB 4OATA 4CL2A 3VAYA 3OWOA 3ER9A 4ALLA 2IA5A 2O1EA 4JLVA 5BN4B 3N2GA 4DM7A 3I9JA 3MCAA 1II9A 3U13A 1XDUA 1JS1X 4YAUA 2EP5A 1LWNA 3THYA 1ZI9A 3CSDA 1AS0A 2GCNA 3FPHA 3H8VA 1XTJA 1TAHA 3P9SA 4QASA 4DRYA 2GNOA 1VBMA 3AZOA 3AONB 5JTUA 4MP8A 1TJ4A 1YJ8A 1N0VC 4TMXA 3K8ZA 3NM6B 4MKXA 3TIIA 1A76A 3KFVA 1JFVA 4MVJA 5JANA 1NJ8A 4TS9A 1WETA 2O8BA 4LBZA 2V0CA 2IYEA 1WB9A 1CUCA 2GETA 2VSNA 2R8EA 2ZRCA 2W2LD 1GGVA 1RT9A 3IIMA 5AXBA 3WDLA 2A2ZA 3L2OB 3HMQA 2IH2A 1QB7A 3R7SA 1OX5A 2DKNA 1KZ6A 3OFJA 1F0KA 2R2AA 2GBPA 3UK7A 1SUPA 2VATA 1U1EA 2WJVA 5KWVA 1T4MA 3LPLA 2ZJ5A 3H3FA 2EGGA 4PZ0A 1ORDA 1PVDA 1XZNA 2NU6B 3MCTA 2LW7A 3FUUA 2PNFA 3N2IA 4MCHA 4WLUA 5CURA 1P3Y1 2C20A 4ARZA 4AG6A 2UYHA 1K86A 1PT9A 4KH0A 5DLDA 4Y18A 2OB2A 1M2HA 3SOPA 4UW9A 2FUG6 1Y7IA 1ZM4A 4YJGB 4XCXA 3V1MA 4DXAA 3C3WA 3I4FA 1YU9A 2VUSA 2NT3A 1NL3A 2QU7A 3H8WA 3QBTA 3QE4A 3GFBA 3R6DA 4IBOA 4MA4A 4OIMA 5FORA 4WKNA 3RIMA 3HVKA 1WPRA 3LBYA 1YS9A 4PAOA 1F6DA 5EJFA 4AT1A 4KR2A 2YOFA 3GGSA 1WD5A 1XVAA 2CL6X 2GBIA 2HF7A 4RYDA 3FOEC 1PYOA 2DE0X 1NW9B 3B8EA 4D4LA 3ZK9A 3LXXA 3EA5A 4IWXA 1W0JD 3UWPA 2PVSA 4PO3X 4CE6A 1PGNA 1X39A 1DIGA 2GYYA 5IJ9B 3B7PA 4TLEA 4QOHA 3ELYA 2DFKB 3KZCA 1JEDA 2X1LA 3BN3A 3IDAA 1ZC3A 1DRWA 3KUKA 3SEQA 4U3JB 2ZI9A 4PSKA 4KSYA 2ORED 2AQ8A 2VWPA 4X8LA 4LMPA 1II0A 2C5HA 4IHJF 5ADUS 1XEAA 5G0VA 1ATZA 1J07A 4ZC8A 4D3XA 2P41A 4AK9A 4IVNA 1YQTA 4G1BA 5ENDA 1KSGA 4F8EA 5JY1A 1X2EA 1Y8ZA 3PGLA 4QFBA 2L18A 1VBFA 4YEDA 3V4FA 3IVMA 5KUTA 2QRNA 4O33A 4UU1A 1WBDA