2VP4A

Structural studies of nucleoside analog and feedback inhibitor binding to drosophila melanogaster multisubstrate deoxyribonucleoside kinase
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
198
structure length
198
Chain Sequence
TKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQRRPQSCKVLVLDADL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DEOXYNUCLEOSIDE KINASE
publication title Structural Studies of Nucleoside Analog and Feedback Inhibitor Binding to Drosophila Melanogaster Multisubstrate Deoxyribonucleoside Kinase.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 75
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.145: Deoxynucleoside kinase.
pdb deposition date 2008-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2vp4A00
2QT1A 1GOTA 4XIGS 1YU9A 2NOAA 1XD9A 1HYQA 1T0JB 1GDDA 5AWFC 1G20E 4L16A 3RVBA 5B57C 2PJZA 4NYMR 2ZRBA 2GTPA 2VQSA 2IS2A 4KI0A 4NDZA 1T6NA 4L4UA 3T61A 1OB5A 1NN1A 2MSEB 4B3DA 3H84A 5KO2A 1VG8A 1OHHA 2C99A 4ITRC 2RGGA 3D8BA 2IYWA 5KPJA 1LF0A 1VPLA 1KMHB 4RVCA 2VP2A 4PPNA 2GEUA 2X2FA 5L3VA 3A1VA 1DADA 4XSGA 4LGMA 4MGIR 3R8CA 3TBKA 1HE1C 4V0LA 2FSFA 3NC0C 5J4KA 4WZAE 2QBYA 4IHQA 3QVVA 1XD8A 4AYWA 2IBMA 4FCWA 2MMGA 2JJ1D 3CPJB 3PENA 1XXHA 5FL7A 1OW3B 5L3SB 3DPUA 2IC5A 3THWB 2P6NA 3U3JA 1SZPA 2BMEA 2Z5FA 4AI6A 4C0JA 5D3QA 1CLUA 2FWRA 3FMOB 1IN7A 3I32A 3FMPB 4RD3A 2QNRA 3T1QA 4FIDA 4M9XA 2ERYA 4DCVA 3GLGA 4C0LA 5JRJA 4G3XA 2UKDA 3ZH9B 3U44B 1G4UR 4NCHA 3HYRA 5KDLA 3N2EA 1XRJA 4QKQA 1OPXA 5IF9A 3LW7A 3GJ6A 3QXHA 3SEAA 3TRFA 4ESVA 1FNMA 5KPDA 2J0SA 5FUYA 2EYQA 4HLCA 2O5VA 3B13B 5DNYB 2XSZA 5JBQA 3LRPA 5B64A 1GKUB 3ZGXA 5AR1A 1OF1A 2CJWA 2YKGA 2IF2A 1C4OA 1HQCA 1G64A 1V5WA 2OE2A 1W2GA 3NVAA 1X8LA 4IOLA 2IUSA 4LCBA 4A0HA 3GJ0A 5G53C 2R6CA 1PV4A 4DLVA 4IVPA 2BBTA 5K8IA 3T34A 4A2WA 3AF4A 3NDBB 2V1UA 4FXPA 1Q1ZA 1XDBA 3REGA 3ICQB 2CLSA 1VIYA 2C98A 3L0SA 4ZDWA 4D4LA 2FF7A 1XD2A 2G6BA 1II0A 5EUQB 2E1RA 4JZKA 1G7TA 1O3YA 2PBRA 1A2BA 5DHFA 3X1ZA 1OSNA 2QP4A 1R10A 2JASA 2CVHA 4AKIA 1OKKD 1R6BX 4IXNA 4QFMA 4DKXA 1TPZA 4BZPA 4BZQA 2ZUBA 4D0LB 1FTSA 2WWIA 2G3YA 3VQTA 3AUXA 1E0AA 1F2TB 5DI9A 3B1VA 3AH8A 4PHGA 2WWWA 2HEIA 2IYRA 2GXAA 3LVRE 2WZQA 3UMFA 4Q03A 3OEHA 1OXSC 4PXAA 2EFEB 1J8MF 4MRSA 4OHWA 1UADA 1U99A 2A30A 3SJBA 2X2EA 1SVWA 2YC4C 2R6GA 2YOFA 4QGGA 1LW7A 4NH0A 5F98A 2G77B 1FQKA 1AZTA 2RGEA 3DHWC 3TJZA 4DLUA 5SZJA 2WTUA 1DVRA 1UBCA 4JLAA 1DAHA 1LF5A 1N6KA 4LHVA 3TSOA 5TY0A 2ZJZA 1L8QA 3QKSA 2QN6A 2VP9A 1K5GA 1KZ7B 2JLWA 1W0JA 5K8UA 1COWA 4YDHB 4OJKA 5F2EA 1KMQA 2IXEA 1LTQA 4MQBA 4NYMQ 1GM5A 3EWSA 4JS0A 1TUEA 3MGCA 1YZTA 3VKWA 3MD0A 1LV7A 1SXJE 4DLZA 1CTQA 2ZRIA 1SXJD 3SQWA 4BPBA 3PVSA 3TUJC 4MKGA 4XH9B 3RS2A 1CJTC 1G8HA 1HT2E 3GLFA 4DCUA 4EPTA 4GSYA 1TF2A 4UNNA 1XJQA 3CRVA 5A0FA 2WV9A 4TSFA 3IO5A 3FWYA 1Y3AA 3LQQA 2XXAA 1D9ZA 2ZRGA 2DB3A 4DB4A 1NG1A 2FPLA 1F6BA 1IN5A 4M9QA 2IS1A 3K0CC 1ZNYA 2FA9A 3TUIC 2GRJA 2FPMA 2J59A 4TMWA 2FG5A 2J0UB 1DE0A 1W36C 4HZUA 3G0HA 1ZJ6A 2ZQ5A 3ASZA 4OK6A 4PSVA 3W3AA 4DSTA 3DEFA 4ZPXA 3AUYA 1GAJA 2OZEA 2V6JA 5GJWC 3OFND 1SKYB 1XP8A 2GF9A 1F2UA 2XITA 4RFVA 3WMFA 4N1AA 4KVGA 4B6FA 2QE7D 3B78A 3ADCA 5J4VA 1YRAA 1YR7A 1AGPA 3CRMA 3AKYA 2JLSA 6Q21A 4EUNA 1QHIA 2PT5A 1G21E 2NO9A 1XCMA 1DG1G 3CUEF 3PFIA 2XTMA 3VMFA 1QHXA 821PA 2HT6A 2SHKA 3CKLA 2VSFA 3M1IA 3SU8A 4D82A 3K9GA 4DCSA 4DUGA 3FMIA 4DLYA 1E2JA 4TTQA 3RABA 3WHKA 3IDQA 4AKHA 1G8FA 4IOMA 3IGFA 1Z0AA 4EPVA 1RKBA 2Q21A 4L9SA 2W0MA 1E0JA 3C7KA 2HYDA 3FKSA 1XTSA 2JLXA 2BEJA 4AWXA 1XBTA 3N5CA 3KQKA 1P9WA 3KDSE 2YWEA 3DDCA 3KKPA 1N3BA 2PCLA 3U7EB 2IX3A 4LBWA 2GILA 4M1OA 2WAXA 1E2PA 4P0TA 2VPPA 3EC1A 4LPSA 4C7OB 2XX3A 2RKOA 5AJZA 5FPSA 4V02A 2V6IA 1FP6A 1T4GA 4M0LA 2OCAA 3Q7PA 4OBEA 4QC2A 3OIVA 5EXXA 5C46F 4RZXA 2JCSA 4JLPA 5EXTA 4Q1AA 4LC1A 1ZBDA 2BJWA 5CIQA 4POAA 1QHHB 2KSQA 2YYZA 1II8B 1NKTA 2IT1A 3CO5A 3CZQA 2VF8A 3TNFA 2CVFA 3FPAA 5AJVB 3EWAA 1W36B 3LO5A 1XTRA 3TIFA 2BOVA 4XVUA 2I3BA 3WMEA 2Z4SA 5E95A 5J5CA 4V0KA 1X3SA 4XWKA 2ZETA 3W6NA 1E79D 1MRSA 3CH4B 3L0PA 5BXQC 1HTWA 5D3MB 4MDFA 1OFIA 2HF9A 3MCAA 2XTNA 2A5DA 3RS3A 3ZVNA 4TYWA 1KO4A 3R7WB 1ODFA 5JSZB 3R9XA 1XZPA 2OLJA 2QQ0A 1UDWA 2OBLA 1P75A 3RHFA 5KUTA 3DKVA 1IN6A 1GSIA 2P2LA 1TQDA 2CL0X 1M8PA 3E70C 3QEJA 2FE4A 3RS7A 5TMPA 4O3MA 3A37A 4AD8A 5FTJA 3A4LA 4OHVA 1JXOA 5G3ZA 4F4JA 4GP6A 1MO5A 2A78A 2AX4A 2OLKA 1QZXA 4B32A 1GVNB 2QQEA 621PA 4QM7A 1G291 4HAXA 1N6OA 4TL9A 5EP3A 3BB4A 2E87A 2FEOA 4BRWA 2OILA 2HJVA 4FINA 1TNDA 2V7QA 5TB5A 3UIEA 1IBRA 3RYTC 1KI2A 4D81A 2VEDA 3P26A 4RZ2A 2ZU0C 3GFPA 3GPLA 1OFUX 2REBA 3SHWA 4LOAA 2AK2A 8OHMA 3NH6A 4MRVA 3THXB 1FFHA 1N0WA 2OBMA 1TTTA 1Q12A 3T5DA 4YQFA 4BASA 4UJ3A 5C1BA 5KNDA 3B85A 3OZXA 1U9IC 2OHFA 3JZMA 1IM2A 1DELA 2PLRA 4JT4A 3GLIA 3ZLJA 4YMWA 1QHNA 3OEEA 1GRNA 1MOZA 4OI4A 4FWTA 2NZ8A 2BIFA 2XOKD 1DOAA 4JLBA 3PIRA 5JI3E 5FBRB 4R71A 3T35A 1MH1A 1KNXA 3EA0A 4TL6A 3EZFA 1G7CA 1CBUA 1A4RA 4QHSA 3RWMB 1XCPA 1OXVA 1QRAA 5KNBA 1Z0FA 2FGJA 4D4JA 2OM2A 5E7IA 1KZGB 3CR8A 3D6TB 2CHQA 3ZVLA 5LD2C 3VKHA 1Z8FA 1G18A 3JZAA 1E2LA 5F9FA 3TQFA 2AFHE 3AGPA 5DYGA 4MA4A 3QBTA 2F3TA 3ND8A 1T3LA 1W1WA 3QKTA 1WP9A 1AIPA 1N6HA 4CEHB 4IXMA 5G3YA 4NKRA 1T8UA 3VHLB 4CEJB 1KY2A 1XEXB 5CYOA 1KI8A 1KSGA 4DSOA 2NPIA 1BIFA 4BEBA 4LHYA 4LUCA 2XTZA 1JNYA 5FPYA 4ZIRB 3DOFA 4IDHA 1KI7A 4ZV4A 2ASEA 1ZNXA 4RSGA 4V0MA 4EQ6B 4QL3A 4XVRA 1VHTA 5EP1A 2O8CB 5FI1B 2QPOA 3ICEA 4FI3C 1GRRA 5EUMA 3C16C 1ZD9A 4DJTA 5J40A 3SQXA 4PPQA 1JBKA 2HCJB 2RGNA 2QL6A 4FD2A 4ZO4A 2KB0A 3BBPA 4B3FX 4US1R 3U4QA 2YZ2A 3SJAA 2PT7A 3TW4A 4DRZA 2QI9C 1XMJA 3NXSA 1QG4A 4HAUA 4TT3A 3B2EA 3IUYA 1EFHA 1M6NA 5H70A 3WNDA 2ZYTX 3I8XA 3EA5A 4C2UA 3H1TA 3K8YA 4PX9A 1FQJA 3A4NA 1UEIA 1FNNA 3EPLA 2QORA 1RJ9A 3K0EA 4FMCB 2CMKA 2ORIA 4DLSA 2GKSA 2D3WA 2LKCA 3NC1C 4FCVA 3FTQA 1NLFA 1OXTA 2JAQA 2QP9X 2Q3FA 3K0FA 3L0IB 2JLYA 3A1TA 4V0OA 1CJMA 2VHCA 4PC3A 1RRGA 2FEMA 4Z1MA 2O0HA 5IK2A 4ZI2A 1IOZA 3BE4A 1KSHA 1WB9A 3BRWD 5KSPA 1T3SA 3F8TA 3PR1A 2QA5A 2ZE8A 4IDOA 4AYTA 5JJKA 4Q00A 1VTKA 1Z29A 2OXCA 3FVQA 3QEOA 4YXWA 3GFTA 4KFUA 2RAPA 5LD2B 4Q18A 1BS1A 1C1YA 2C8VA 2RGCA 2O8FB 2NPFA 4C0AC 3BH7A 2MSCB 3C8UA 4HEJA 1E9SA 4BEJA 3MMPA 2RGAA 4BRUA 1A5TA 2ZRAA 1YQTA 1BOFA 1GTVA 5EP4A 4L5BA 2CCJA 1MRNA 3ZS8A 3PV0A 4JBWA 5EE0A 1W4RA 2IEYA 2WJIA 3SJZA 5HCNA 1KO5A 4PO9A 4EPRA 1E94E 1WBBA 4BE7B 4R9UC 3KFXA 2YC2C 3RANA 5GADl 3KQNA 5JFGA 4PANA 4XTRA 2ZI7A 3U3MA 1ETUA 3BJIC 4LWZA 1UKYA 3ZIAA 5JWRA 1D9XA 5F9HA 3FYHA 3BGWA 1GZSA 2BHRA 5JCZA 5FOXA 2OSBA 2BCJQ 2V8OA 4LJ4A 2FJUA 3HWSA 4PC7A 1JALA 1M2OB 4M1KA 3SOPA 1NLYA 4RJLA 4ASUD 4GL2A 2ZJ5A 2VP6A 1D2EA 5AK0A 2QGZA 4WXRA 3B60A 1Z2CA 2JLUA 4RZ3A 1GFIA 2CK3A 4MYUA 4YLGA 3BC1A 3L8YA 4RD2A 1AK2A 2JATA 2FSHA 1R0XA 4DWJA 1VHLA 2QEQA 1JR3E 3G5UA 1W0KA 1WA5A 1DARA 1JR3D 2D2FA 4MRNA 3GCGA 4Q1CA 3UANA 2PX0A 1S96A 4B2LA 3EXAA 4U7DA 1F60A 4UKDA 1E4YA 2WHXA 4GDFA 4Z51A 2EFHB 1WBDA 4CGZA 3UK6A 2WMNB 5EE3A 3RWOA 2F3RA 3VKGA 1UBEA 3RS5A 5BW8A 1KMHA 3H0KA 4MRRA 4DLWA 1E1RD 4B6EA 1QHGA 3IBYA 3RS0A 4M1SA 1AZSC 1XCGB 2YV5A 3QKUA 1UKEA 3AP3A 3BFKA 1S9DA 4Y0VA 2L0XA 1H8EA 1NJFA 3MWKA 5FUXA 3VR2A 2O8BB 2XGJA 5L3SA 2YINC 1MR3F 1XZQA 2BWJA 3L2OB 4FMBB 3SNHA 4I1UA 4OQLA 1UM8A 4TTPA 4X8OA 3THWA 3KUDA 1OHHD 2W2TA 3OAAA 3Q5EA 1VECA 2YWHA 1GL6A 5DN6A 4CT4B 3QXSA 2GXSA 1EK0A 2R6AA 3QE0A 2AXNA 3IBGA 4TMKA 5J4LA 1GKIA 3O8DA 1Z47A 1G8PA 3RSOA 1DAGA 1EX7A 2D62A 3WYFA 1NP6A 2FGKA 4Q4AB 5HE8A 3U44A 1P7CA 1SVIA 1XMIA 2GBLC 2FFQA 3LLMA 4GOJA 4ZCLA 4JL8A 3T15A 2G0NA 1II9A 4US2R 3SC3A 2DWOA 4KYUA 2XJ9A 3I62A 1GWNA 2J7PA 2PLFA 1HY3A 1E2QA 4ZDKA 3GLGE 2Y8EA 3SFZA 4BLSA 4QGFA 4DLTA 4ZDIA 4IOKA 2J0QA 2QUZA 5JS8A 3EPKA 4OI0A 2QAGC 3K70D 3A4MA 5CLQA 3KQHA 2ZAMA 2P0EA 2G0TA 2H5EA 2VP4A 4IEIA 4H1VA 3LFUA 5FTMA 4EKDA 5IT5A 4KSCA 3WRXC 3QY0A 4LBYA 1NLZA 4JYCA 1XPRA 1UKZA 1GNPA 4JIMA 4O2LA 4QJ5A 1LY1A 2ZE6A 2XNDA 1YVDA 3HU2A 2XSZD 2PX3A 4M1YA 2QP3A 4IKEA 3CW2A 1EFRA 2ODBA 2OO7A 4FMDB 4NCIA 3CB4A 1IAQA 2ONJA 4D2IA 1XPUA 3PUVA 4IDPA 1DEKA 4UXJA 2YOGA 4C0KA 3TSZA 5AUNB 1NVWQ 4MH0R 1CR2A 2BBWA 2ONKA 4R2IA 2ZR0A 3LXXA 3SBDA 5KSYA 1KAGA 3DM5A 3C15C 4QM6A 2ZRPA 1T0HB 3W90A 4ILEA 1IXZA 1T91A 1Z2AA 1FMJA 2XEXA 1G1MA 3SJCA 3VFDA 1U8YA 1F2TA 3DMNA 4B2IA 5ELXA 2UZ3A 4YDSA 2J46A 2Z43A 5K8LA 1MV5A 1AN0A 1G6HA 4BUJA 1IY0A 4NTZA 2J3EA 5P21A 3CNLA 4DEYA 2BM0A 4BGDA 5EE9A 4BLTA 3B8HA 3H86A 4YC7A 5A4JA 3MG9A 1JJVA 4CF7A 3OIWA 1ZUHA 2DY1A 1SGWA 1Z0IA 2B6HA 3DL0A 3UG7A 3FHOA 3BH6A 4B73A 4NE2A 3HP1A 1ANKA 2ZRFA 2D7CA 1HE8B 1N6LA 3PXGA 1TX4B 3ZZTA 1BYIA 3TUZC 1ZM7A 3FGNA 2R65A 3U7GA 1L4YA 4LHXA 3OEHD 3SDZA 4M53A 4R2HA 4BLPA 1UDXA 4NPHA 2CCKA 2QAGB 5FPHA 3BB1A 4XWAA 4PO1A 4IFBA 4W5WA 4ZKDA 1LNZA 4DSNA 5DO9A 2A7QA 3QOFA 3PITA 3HYTA 2XZPA 2R62A 2FSIA 4M9ZA 4A1FA 2QTVB 2BKEA 2ZRNA 4A2PA 4PZYA 5JLJA 4DT1B 4DXAA 2J0VA 1H65A 2AKYA 3U60B 2AKAB 2ZRLA 1TQ6A 5CK4A 1FL9A 2CHVA 2IHYA 5FTNA 1PZNA 1W0JD 4TMZA 3AVUA 1COWD 4NYIR 3MJRA 2OEPA 2D2EA 4NHOA 1GIAA 2ATXA 2FPKA 2NO0A 3WNBA 2XZOA 2XZLA 3EW9A 3Q7QA 3VHXA 3AVXA 4AIIA 3FKQA 3KJGA 1E9EA 1P4SA 2BDTA 3TGPA 2IYTA 2QSYA 4KFSA 3HU3A 4C0BA 5DH9A 2GK6A 5DIFA 4PSAA 2J0UA 4Q1EA 4A6PA 2FZ4A 1CRQA 2GJKA 3CWQA 3LD9A 3ADKA 1Z08A 2C95A 2CCGA 1M7BA 5DGXA 3CX7A 3N70A 5E4FA 3QPUA 3EAQA 3WBJA 4P4TA 3LBHA 4HB4A 4PHFA 4G5SA 4NCNA 1E0SA 1NIJA 1NI3A 1HH4A 5BN5A 1E96A 2BC9A 3UXMA 5LB2A 4O0MA 1OXXK 3PG5A 3QI2A 3EZ6A 4B43A 1NRJB 4RD1A 1P2UA 5FR1A 4LRWA 1YZUA 1JAIA 3EC2A 1UEJA 1E98A 1AJEA 3DKPA 4C0HA 1S2MA 2HF8A 4LHZA 4P4UA 1CU1A 1SKQA 2ZYUX 3AVTA 1NKSA 4IDQA 1N2CE 4JL5A 3EG5A 5AJWA 2A2ZA 5FBWB 1VG0B 4QGAA 1AS3A 3GJXC 2LWIA 1W4AA 2QAJA 3CF6R 4HLDA 3SFVA 2H1LA 1S1MA 1KI1A 2J41A 4C7OA 3X2SA 1CJKC 3K09C 3QNUA 2UVQA 3BH0A 5H68A 5DI3B 3K0AB 4Q4LA 3NBYC 2N1BA 4QG7A 2GHIA 5JMTA 1Z6TA 2AK3A 1TQ4A 5FUWA 2ZSEA 4A9AA 3C14C 2W00A 3FKSD 4IOJA 5EZ6B 1WXQA 3NHBA 4QRHA 2QROA 1QHHA 1MO6A 2I1QA 4Q19A 3SI7A 1T5LA 3PEWA 1XEFA 1II8A 2HDNB 2GEDA 2GDJA 3ZZUA 4QBIA 5FOVA 521PA 2G9NA 4Q9HA 1KK1A 2VIIA 1W46A 4V03A 2QSZA 3AKDA 4I1SA 4OHZA 1BH2A 1E2NA 3OE7A 5SZHB 4Q01A 5D3MA 3OESA 4G1UC 1I4DD 1NVXQ 1J7KA 4URZR 2ZIAA 1U0LA 2HLDA 2V9PA 4LSGA 2ZR9A 4TLBA 4H9GA 3R7WA 5BN3A 4F7WA 2ZJ8A 3IEUA 1FP7A 4TZ6A 3DOEA 5JSZA 2PH1A 1XWIA 4S2EA 4TL7A 3U61B 2QMUA 2GA8A 4KO8A 1P9RA 5FBQB 1ELOA 2IHBA 2EFGA 1Z06A 2DYKA 2F1IA 1ZM9A 2P6UA 2QPAA 1E9DA 2QRZA 1LS6A 1Y63A 3KX2A 3R9WA 1G3MA 1E32A 1M7GA 4EFMA 1NNEA 3JVUA 1N5IA 1DAMA 1KJWA 2WKPA 4KVAA 4DC9A 4YMSA 4E22A 3IEVA 1ZAKA 4LJ5A 2ZS8A 4EDHA 4QHTA 4MKIA 4DBLC 2J9RA 4J0QA 4ZCMA 2J5XA 3V9PA 4FWIB 3BS4A 2NZJA 3GJ7A 5EZ5A 2IYUA 1F3OA 2ECKA 4JBYA 1XMSA 2HXSA 1Q22A 3RAPR 1RVDA 2ZJAA 3W5IA 4HUTA 4ESHA 4OQXA 3I92A 2J45A 1NG9A 3QPWA 4E03A 3M6AA 1E9CA 4NONA 1N6PA 1PUIA 1DAIA 4HAWA 2GF0A 1W47A 4NYIQ 5HPYB 1NMXA 4B74A 3GLHB 3THXA 4DCNA 1ZRHA 2QG6A 3O8BA 4M21A 1K6MA 2AWOA 4IDNA 4IEEA 5LB4A 4MRPA 3ZDQA 4NU0A 4XD7A 2DFKB 4N3NA 3VAAA 1N25A 1XNJA 3IIMA 3BORA 3D7MA 2UZIR 4CYMA 4EPXA 3GJ3A 2B8WA 2QY9A 2V7QD 2ZRCA 5AJXA 3PQCA 2XB4A 1ZD8A 2H57A 4BFSA 4UQOA 4A0RA 1EESA 3HR8A 4URUR 1K5DA 1R4AA 3LAWA 2IWHA 3H2YA 1E4VA 3GMTA 4JJZA 4JSYA 1BO6A 2IS6A 4HYYA 1KDTA 1R7RA 2OCYC 1Z28A 4MKFA 4B47A 5HCIA 3ADDA 3AVOA 3GLIE 5B2ZA 4AC9A 4DHEA 2Q6TA 3NTUA 1R5OA 2KBEA 2ZROA 1DPFA 4JJKA 5BWMA 3OEED 3VNVA 4F91B 3BFXA 1VCMA 2CDNA 2OXRA 4M1MA 4CEHA 1YZKA 4L8GA 4GMDA 1IY1A 4HZIA 4CW7A 4CEJA 1XEXA 4JVNA 2VHQA 2O0JA 4PQYA 4UNSA 5L8VA 3MWJA 2R6FA 3CH5A 1U98A 4ZIRA 3CRQA 4RCZA 1Z3IX 4M22A 4EQ6A 2O8CA 3ETLA 4QGHA 1Z0DA 3RC3A 1Z6GA 1S8FA 1YE8A 3B9PA 1GL9B 1WQ1R 3J81k 1RZ3A 4L9WA 2HJGA 4TLEA 2AR7A 4BFUA 2B7BA 4TWZA 3CPHA 3KXLA 2I4IA 4URXR 3FMFA 4FMCF 3AF3A 3RS4A 5C18A 2F1RA 3EPJA 3AKCA 4D80A 2IF0A 3QG1A 4V0ME 2W83A 1XTQA 4CZ2A 4PR0A 5JCPA 4JLKA 1F48A 1U9IA 4F38A 2ZAOA 5CJPA 4ZDJA 2CNWA 1GITA 1ZNZA 2FOLA 4OYHA 3R9IA 3P27A 3SBEA 5JEEA 1P60A 3BK7A 3ZQJA 3DO6A 1R8SA 3KTAB 3WY9A 3VR1A 4TT3D 1E2GA 3D31A 3KUCA 4D25A 4JYBA 4XOIA 1EG7A 2IYQA 4D0NA 4UNRA 4Q66C 1W2HA 1G6OA 5HKKA 1OH7A 2OESA 2MMCA 4B3CA 3CBQA 4Q4JB 3X1YA 4B75A 5EE5B 3VR6A 2QTFA 1SULA 2OAP1 3GJ4A 4M1WA 1QHSA 3TR0A 2O8FA 4BWYA 1UKVY 3T1TA 2N42A 3IQWA 4Z1MD 2ZM5A 2DR3A 2VP0A 4TLDA 2BMDA 2JIZA 4KITB 2WPDD 4DIEA 3UPUA 2REOA 3OFNA 3OIYA 5TARA 4UXHA 3I3SR 2QE7A 3AB3A 2ZRDA 1TF7A 4IW3B 1G3QA 4B2PA 3I5XA 1EXMA 4EAQA 2WVJA 2HUPA 2HT1A 3THYB 1Q0UA 4W9MC 2G83A 2Z6VA 3QPVA 1RIFA 3U7FB 3DZDA 2VLIA 3GEHA 1SXJC 3P4YA 4LDJA 2FH5B 4Q7KA 2Q9AA 3LDAA 2F9LA 1OYWA 1IJFA 1W44A 1CIPA 2ZPTX 3QXXA 4WA7A 4ABYA 2ZSFA 2KI5A 3NHAA 5FPKA 5SZIA 1JEDA 3IO3A 5JECA 5KYKA 4OK5A 2ZRHA 1G9XA 1JI0A 4P32A 4C2TA 1VCOA 4E5UA 1HQYE 3ZIAD 1E69A 2C77A 1PLKA 4Q7MB 3Q5DA 4RCYA 1IXRC 1XFAA 4JLDA 2VYFA 5E7MA 3MAAC 2W6IA 5GJCA 2ZI4A 2WJYA 2W58A 2ZUDA 1TF5A 4FN5A 3ASYA 1DS6A 4I99A 2DWPA 4QJ4A 3SR0A 3IPXA 3MWYW 1DO2A 2ZSDA 2ZU6A 221PA 3AGQA 4LBVA 4OI1A 1P3JA 3WRYC 2G1JA 2NO7A 1IY2A 2AD5A 3MRSA 4JKIA 1Z0JA 2IS4A 1U2RA 3LV8A 4AKEA 2C9YA 4A8JC 2V3CC 2WWXA 4JLNA 3VX3A 2IW3A 3LY5A 3WYAA 1W0KD 4QBHA 2XB2A 3I5YA 1TUIA 3FHCB 4Q9LA 1AA9A 3LVQE 3L43A 5AUOB 4TYYA 3K0SA 2O8BA 1OH6A 1H8HA 2KWIA 2ODEA 3CRRA 3HPRA 5FPTA 4JKYA 4WBSA 3FHTA 1VKJA 2GZDA 4WVFA 1JXMA 1RYFA 4JLOA 3SS8A 2VH5R 3B1YA 3CZPA 4CEIB 4F4CA 5FH9A 3EX7C 2ZJYA 3CRW1 1SXJB 2GK7A 1W7AA 1XTKA 5FFMA 1WCV1 3F5FA 3VNUA 1ZM4A 1GRQA 4QNRA 3W3ZB 1IXSB 4N0DA 1ZCAA 1OH5A 1LFDB 1FMLA 1H8ED 1TL7C 4Q4AA 3CLVA 4BFVA 5JWOA 1E2KA 2VHJA 4IVRA 4JL6A 5AUQA 1KOFA 1DTSA 4NP6A 1KO7A 1YZQA 2JDIA 4FCTA 1KJYA 1PUJA 2C04A 1P61B 4F93B 4JLJA 2ZRJA 1ZCBA 4R98A 2B21A 5DN6D 1ZW6A 4AG6A 3AEZA 1T9HA 4JSTA 3NWJA 1OIVA 3QKRB 4NZYA 2CEAA 2DPXA 5JHGB 2JJ2A 1T3HA 4S35A 3Q9LA 3UATA 4JVSB 1E1QA 3I73A 3ZZ0A 5G40A 1B0UA 1KSJA 3ECCA 2BEKA 2FSGA 4TMVA 3HU1A 3PJRA 5J47A 2O8DB 5H1YA 1P73A 4FMDF 1KDPA 4OQNA 1L4UA 1KI3A 4PQRA 2OBNA 3AKEA 4A8JB 3LBNA 5KTYA 2QU8A 1NVVR 1J90A 1TU4A 2J7PD 3UG6A 4C3ZA 5J4YA 3U6KA 2PZFA 3TH5A 4EPYA 1DAFA 1JB1A 4URWR 3RRYA 3FE2A 3CPEA 4K81B 4A0FA 4W5JA 2DFTA 5B58C 2EFCB 2RGNC 4XTCS 1NN3A 1N6RA 4LPKA 4C0SA 4TQAA 3RDPA 3A6PC 1UPTA 1CULC 1NJGA 2ERXA 5FOWA 1IONA 2A5GA 2FFHA 4KU4A 1WE2A 2LCFA 5GJVC 1QF9A 1TEXA 1NBMA 2BVNA 2GXQA 3KJHA 2XNDD 3S1AB 1IQPA 4PSKA 1E6CA 2P65A 4ARZB 5DLQC 1EWRA 2GBLA 1Z6YA 3AVQA 5ANRB 3UMSA 1DG3A 5CB8A 1EFUA 2JJ8A 3LWNA 3LX5A 2X77A 4I81A 2PCJA 1G19A 4GMXA 2IYXA 4NYJQ 4HB2A 2WSSA 1FX0B 4RD4A 1U81A 4KBGA 2JEOA 1WRBA 2H7VA 3MSXA 4MYTA 4TQ9A 3RRZA 2YWFA 3A58B 3W6OA 4G5QA 3OF5A 1ESMA 1TQ2A 1NMZA 4PFSA 1W4CA 2QAGA 1SQ5A 2Z4RA 3IKJA 4D0GA 4DDVA 1J70A 2CXXA 4LYFA 1OLOA 2TMKA 2F55A 1AM4D 1O87A 2DHRA 5LBIA 2OT3B 2PZGA 4Q7JB 3WBKA 3ZQ6A 2AN9A 4OK3A 3M4YA 4DT1A 3K53A 3X1DA 3QVUA 3RLFA 4OHXA 4A2QA 3P4XA 1PLLA 2G88A 4Y0AA 3TSWA 2YJTD 1EWQA 1D5CA 1E2IA 4D26A 1UBGA 1HEIA 4D4KA 4BLQA 1GNQA 4HLUC 3LQRA 4EJSC 1XXHE 2NO1A 1I4LD 1XF9A 4KAXA 4P4SB 2R9VA 4A15A 1Q57A 5FL7D 3B1ZA 3FB4A 3T5GA 4X8LA 4G5OA 2O0KA 4RFSB 4D6PA 1W48A 3AV0B 5CDFA 1N5KA 5AJYA 5GVRA 3EZ7A 5L3RA 4PQFA 3A36A 4YMUA 3DZ8A 2IUTA 4TZ0A 2C96A 2ANCA 4GNKA 1KK2A 2EYUA 5JI2E 1ZYUA 4OQMA 2IEZA 2A5FA 3KKQA 2NMVA 4EFNA 3U5ZB 3RSLA 2FV8A 4GZMA 2KBFA 3GD7A 1U8ZA 2W6JA 3W8RA 3C41J 4KBFA 4NMMA 3VR4A 4F92B 3OIUA 1E2MA 4RKEA 2GEVA 4HLQB 5BQ5A 3I1FA 4MGYR 2ZEJA 3KB2A 3PUYA 2CL6X 2GCOB 2YVUA 5L3QB 5G41A 4YMTA 1S4QA 4RD6A 3NH9A 1KYIA 2F7SA 2RGDA 4AY2A 1WDTA 1OFTA 1JJ7A 2F6RA 1VYVA 2ZYVX 4XVQA 5DSZA 2BBSA 4UXIA 3QIAA 4RY2A 1JEEA 1KDOA 5KHOC 4RD0A 2FFBA 4G0NA 5E7JA 4PHTA 4W7SA 2ZR7A 2GNOA 2ZI5A 3CNNA 5JHHB 4PPFA 3TLXA 5HE9A 3E5HA 3ZD6A 4ERNA 1KNQA 3R20A 4KYIB 1V43A 2ZRMA 3NBZC 2ZS7A 3LA6A 2AD1A 5DHAA 1NVVQ 2OG2A 4LC0A 3TVDA 1YHNA 4DIDA 1ONBA 1XMVA 4ZCIA 1QVRA 3GQBA 5DI3A 2H16A 2VHTA 2GZHA 3K0AA 4PHHA 4QBGB 2BM1A 2GCPA 3TW8B 4HDOB 2RB4A 4EJSB 3E1SA 1XEWX 1JR3A 2IA5A 3VTKA 3TQCA 3ONWA 4L15A 3REFA 3B6EA 3QF4B 2RGXA 2W2XA 1NY5A 1G5PA 4HAYA 1G3UA 3C5CA 2RH5A 2WJJA 1ZINA 2CE2X 4G5GA 2OAQ1 4K46A 4TLAA 2NGRA 3BAFA 2O52A 2AL7A 2F43B 1E2DA 5LDDC 2QM8A 1U0JA 1UFQA 2GCNA 3N2IA 4QXAA 2ANBA 1QDEA 2QPTA 4DDUA 5EXPA 1W4BA 2OV2A 4G5RA 4CIDA 2D4HA 2Q3MA 1I4TD 4OJQA 3KJEA 2ODNA 3IHLA 1W36D 4PAOA 1U8AA 2QGNA 1MKYA 1LS1A 2C2HA 2VHUA 2ZI9A 2AFIE 1CJUC 3NEJA 2OFXA 3QUSA 4N0EA 1NN5A 5IDVA 4C9BA 4Z54A 3OE7D 1VYUA 4UNPA 1Q20A 1HT1E 4X8MA 2G1KA 1T5IA 2OUKA 2VF7A 3K9NA 5IHPA 2B7CA 2HLDD 1TAGA 2QTHA 4Q7LA 3AF0A 1DAEA 4Q4HB 4GRAA 4EPWA 1ZIOA 1YR9A 1UBFA 4K8OA 1KI6B 2V4ZA 4HUQB 1IJEA 1L7VC 4E07A 4A0GA 3K09A 4DSUA 3GLFE 3K1JA 2WJHA 2PL3A 1SVLA 3GJ8A 1E9BA 1LVGA 1XJCA 3IHWA 1RE0A 4TSFD 1D2NA 1GG2A 4QBFA 4EIWA 3ZS9A 4HAZA 3FFBA 3GLHA 3UWKA 1NY6A 1Q1EA 3QXJA 2ZITA 4GP7A 1JR6A 1J8YF 1E9FA 2QZ4A 2EWVA 1BMFA 4TYPA 3X1XA 3TKLA 4BZXA 2VSXA 5KNCA 2ZSAA 1R2QA 1S0UA 4NBSA 1P2TA 2AXPA 3KKOA 4Q48A 2HYIC 2GAOA 1S3GA 1TEVA 4PTLA 2JLRA 1Q1BA 3CM0A 1XTIA 4WZBE 2ZS9A 4LJYA 4PZLA 5CIWA 1NF3A 1X86B 2EU8A 3EIHA 1RW4A 1US8B 3PUWA 4WZ6A 1A2KC 1GNRA 3CONA 4XD7D 4TQUS 3VU9B 3P1JA 2GJ9A 1KY3A 3Q72A 2YWGA 2E9SA 4Q9IA 2IXGA 4DUGD 2DWQA 1C9KA 4OKSA 4Q21A 4IRUB 2VA8A 3W6PA 3BFVA 2EWWA 1OV4A 2WWGA 3BOSA 3FDIA 3NBXX 5CYPA 1KIMA 4TMTA 2NTYC 3P20A 2FN4A 4P33A 2CHGA 3AVWA 3K0CA 3TAHA 2QMEA 1DAKA 3NDPA 3LLUA 3NKVA 3K70C 4B71A 1OIXA 1WF3A 1OIWA 1Q44A 4BFXA 5KU1A 1MABB 3QQ5A 1G8GA 4MYHA 2BMFA 4WW0A 4IJMA 1R0WA 2C9CA 3KZ1E 3BXZA 4KODA 4KJZA 2O8EB 3LX8A 3AVVA 2VP5A 3B7GA 3BD9A 3NEYA 5BN4A 5FOUA 2PZEA 1L2TA 2YOHA 3RC8A 2BKUA 2J7KA 2JJ1A 4PC1A 1VCNA 2HCBA 4I1OA 3NG1A 4U02A 2X1VA 4B33A 4XSHA 3AP2A 4GOXA 3QJYA 1X8KA 3UWOA 1A82A 1P9NA 1FW6A 4BECA 3GP8A 2QT0A 3SYKA 1NVUQ 2IYYA 1ZC4A 2ZJOA 1UF9A 5DISB 3MWLA 1Z63A 2X8AA 3IIJA 2A5JA 1JPNA 2PEYA 3KTAA 2GJSA 1FOEB 2P67A 4Z8XA 3ZVRA 1FUUA 4JVLA 4YMVA 1YR8A 3U2QA 2QBYB 5JEDA 4QNMA 5EE1A 2QMHA 1R0ZA 2GWHA 4MYCA 4B76A 4BLOA 1Z6AA 1XXHB 3HPQA 5JJLA 2AWNA 2CNWD 121PA 4Q4JA 3B1WA 5FOSA 2GETA 1Q3HA 4B3XA 4B35A 4DB2A 1EGAA 1B23P 2DBYA 1E3MA 1HA3A 5HZKA 3B1XA 5H8WA 1X1SA 1Z22A 4ZKEA 3WXMA 2X19A 3IILA 1M1YE 3MFYA 4LZZA 4HDQB 1G7SA 1AQYA 3M0EA 2FX3A 3GLGB 1OXUA 1AS2A 4A92A 5KOYA 1ZC3A 1ZP6A 3AQ4A 2AHOA 3K70B 1YZGA 2XJ4A 3U7HB 5HTKA 2ZJ2A 2GVDC 4URYR 5HKKD 1T8TA 4LJAA 3THYA 4KFTA 4AKGA 3RRMA 3Q85A 1VIAA 2N46A 5E3HA 2PJRA 3BERA 4TN1A 4GZLA 4LBZA 2JIZD 5JZVA 1RYHA 1G3RA 4BQSA 1KAOA 4BFYA 4IVQA 1ZD1A 2CJWB 1MO4A 4B34A 4LV8B 3TAUA 1VYTA 4KCGA 1VCIA 1PLJA 1R8QA 1OKKA 4AYXA 3VR3A 4PPGA 1U90A 1CKEA 2MSDB 2D74A 2EW1A 1DBSA 2ATVA 4P3YA 4R7ZA 4B44A 5IRCD 4MGKR 1OE0A 1UJ2A 4GFDA 4MUBA 5KDOA 1KHTA 3GJ5A 3ADBA 3PEYA 1GP2A 1XD2B 4OI2A 3F0TA 3PEUA 1G8YA 1JECA 3U6BA 4DDTA 3EIQA 3Q8XB 3PCRB 1N5LA 5JRZA 4WIAA 1NSTA 1M7HA 421PA 5UKDA 4DEXA 2F9MA 1P6XA 3B5JA 4HB3A 2ZVPX 1W49A 2WSMA 4P31A 4Q9KA 1TMKA 2W6ID 3K9HA 4DZZA 2H18A 3W8NA 1X8JA 1G41A 1WMSA 2REXB 2VL7A 3IIKA 1RRFA 4M8NE 2R44A 2ZI3A 4GBMA 2HV8A 5F3WB 3KFVA 3CR7A 3MJHA 2WOOA 2F1JA 4LJ7A 2P3SA 4CEIA 2QM7A 3O8CA 1Z07A 1D2MA 3DVLA 2WIBA 1SXJA 3I8SA 2ZXUA 2IUUA 3V4RA 4ZI3A 5C4GB 3WP0A 1YJ5A 2P6RA 2ZE7A 2WJGA 3QKSB 1OB2A 1SVOA 2WWYA 4LJ6A 4I4LA 2GJAA 4O2RA 1H8HD 1AKEA 1YZNA 2GESA 3AF2A 3E2IA 2ZYWX 3I4LA 3SE0A 3FFAA 2KJQA 5HZHA 1S3SA 2IYZA 1D6JA 3KL4A 5CJ2A 4PAQA 3AF1A 2OFOA 1N5JA 2V1XA 3BIFA 1G17A 3QKRA 4NCJA 4US0R 3G82C 2Q9BA 3KKNA 2RHMA 3CF2A 3DM9B 4HAVA 2FMXA 3CX8A 5CK5A 1HV8A 1QVAA 4WAUA 4Q1DA 3GLFB 2D7DA 1CP2A 3I61A 2ZTSA 5IK2D 4JBXA 1JQJC 3KXKA 5DYIA 1M34E 3SYLA 2NQ2C 3CF0A 2XXAB 2A3RA 2JDID 3TVTA 4U5XA 4KXFB 2JLZA 1VMAA 2O8DA 5TDHA 5GJBA 3ND9A 3RNLA 4YXWD 4A8JA 1A7JA 1SVKA 3HJNA 1NN0A 1XX6A 4G01B 1S1CA 5AUPB 1XEWY 2H8KA 2Q0HA 2CL7X 2JJ2D 4WOPA 4HZUB 4IFEA 4GT1A 5CLLA 1AS0A 3O47A 3QG5A 1E1QD 2BCGY 4JLVA 1XPOA 4C0QC 4TYNA 2IYSA 2C9OA 2NG1A 2PMDA 5JS7A 2IYLD 4LK2A 4CVNA 1F2UB 2ODWA 4FW9A 1CJVC 2ZVQX 1J2JA 2DFLA 4Z8YA 3GFOA 4M1TA 4NYJR 4ACAA 1XB2A 3AP1A 3T1OA 1I2MA 4XWOA 5FUVA 3H4MA 5CITA 4ACBA 3S1AA 3O8RA 3NIBA 4Q1FA 1ZNWA 1KDRA 3WP1B 2ORWA 3ZVMA 5SZKB 1RRPA 4I1VA 2WKQA 1FZQA 4NL4H 2V54A 4LJ8A 4A82A 3V00A 4ARZA 4HDCA 2F1HA 3QSYA 3KQUA 1OH8A 3HDTA 1CS4C 2CLCX 4Q47A 3A1UA 3WMGA 4HATA 1FTNA 4DLXA 4KSBA 1I2DA 1PVOA 2HXYA 1NBME 2CK3D 3AVPA 1E0KA 1FX0A 4QHYA 3D3QA 5CM9C 1NBMD 4X8HA 1U0HC 1ESNA 1ZUNB 1KK0A 2QENA 4TL8A 1CRPA 4XJXA 4CDGA 3CIOA 4M4SA 3CX6A 3SZRA 3WHLA 1RRCA 2EVWX 1E79A 3QF7A 1G5TA 1HUQA 4YONB 2W0SA 1M74A 2XNSA 5LPNA 4MDEA 5J4HA 3SN6A 3SHFA 1Z6XA 4KLZA 3TK1A 3U3KA 1X6VA 2RCNA 3LXRA 2WSSD 4CT5A 1KGDA 1SHZA 1YR6A 3W9YA 1OJLA 1D8TA 4HB0A 1G16A 1Q1QA 2BMJA 2ZRKA 1YZLA 5GVSA 4BLRA 5M04A 1OFHA 4WXPA 2WOJA 5KSOA 4TLCA 1KI4A 2WWFA 1VDZA 4P4SA 4H1UA 1R5BA 4A36A 1J99A 3U3OA 4ON9A 2JLVA 3L0OA 1ZIPA 3TE6A 2A9KA 1IN8A 4U00A 1GL7A 1Z83A 2A5YB 3OAAD 2RGBA 4RFSA 2K5UA 2C03A 1ZM2A 1ZVQA 4BFTA 1P62B 1E9AA 4M2LA 2CE7A 2XAUA 2B8TA 4PAMA 1FUKA 2FNAA 1R5NA 4O25A 4GI7A 4CRWB 3KQLA 3LW8A 5TVKA 2ZJBA 1ZMXA 2RHDA 4MKHA 5FTKA 2ZE5A 3A8TA 2ZSBA 721PA 1IN4A 1N0UA 1ZM3A 2ZUCA 3CNOA 3GEIA 2WPDA 3B9QA 3IQXA 2VRWA 1P5ZB 3A1WA 2GVZC 3NBFA 2OCPA 4UNQA 2GXUA 2DFNA 5DE3A 5A5GA 5CDFE 3W5JA 4LHWA 1NMYA 2C78A 2GCOA 3ZJYA 3I72A 1E2FA 2WIAA 2WJVA 5L3QA 2IK8A 5CM8B 1VG9B 3T06B 4AURA 5HR5A 1KTVA 5TV2A 3UKDA 1XJ0A 1GILA 4JT2A 2QRNA 1N6NA 3VR5A 1NIPA 2YHSA 4MGZR 4Q02A 3MUFA 4AG5A 4DDWA 2XOKA 4OQFA 1YRBA 1AGRA 1Z0KA 3ZYCA 4W5HA 4OL0A 5EQTA 3WNCA 2W6JD 3V4FA 3AVYA 3C5HA 3FOZA 2B92A 1LB1B 5JJIA 4MUAA 3EZ9A 1JPJA 4A4DA 4A6XA 3EIEA 4JLMA 2WKRA 1UAAA 3QENA 2FFAA 2YNMA 1EFTA 1G7RA 4LJ9A 3F3YA 1N6IA 3GLIB 1A1VA 1W5TA 3MLEA 1P2VA 4GPTA 1EFRD 2BBOA 2D06A 1PJRA 4LYHA 1RC8A 2H92A 1XU4A 4HLUA 2J1LA 3KB1A 4EJSA 2FU5C 3JVVA 3U3RA 4DCTA 5FTLA 1CEEA 2GAAA 1S9HA 2ZI6A 2J87A 3BB3A 2JLQA 3OHMA 3PUXA 2NO6A 1QHYA 4F4IA 2JA1A 3QF4A 1KKLA 1G4AE 1Q21A 1EX6A 4C30A 2IXFA 4BFWA 4AK9A 3BWDD 1GKYA 5FBVB 3X1WA 3Q3JB 2FZLA 1MT0A 5FI0B 2EFDB 3PUZA 5CB6A 2I1VB 2C5LA 4TTRA 1X1RA 4Q9JA 2WMOB 3KKMA 1KK3A 4RKFA 5FR2A 1BYUA 1EFCA 1G5RA 1W5SA 3VX4A 2F43A 3LBIA 2V55B 4KV9A 1AKYA 2PEZA 5BYKA 1AQUA 3EASA 3SYNA 4DLRA 2BJVA 4KHZA 2VBCA 2Q9CA 4V0NA 5EXSA 5TXGA 1DO0A 2Q3HA 2NIPA 3IPYA 4TYQA 1KO8A 1SHKA 4EFLA 4QJ3A 5KDDA 1JAHA 1QG2A 1U94A 3GEEA 3KJIA 1ZU5A 5FL3A 4MITA 2RMKA 1NL3A 2Z83A 1ZU4A 2R2AA 4LI0A 2P5SA 1KSFX 1VG1A 2P5TB 3KXIA 3U4QB 1RPZA 4Q4HA 2W2VA 4E09A 3UMRA 1CR1A 1SVSA 1KI6A 4HUQA 1IHUA 4UJ5A 3TMKA 4LV6A 1KI9A 5FBLB 5KSZA 3ZD7A 1XTJA 3EPHA 2JGNA 1RJ9B 5C2JB 1YKSA 4JVMA 3C4JA 5JWHA 2OFWA 1HURA 2R8RA 3DMDA 1CF4A 2DCUA 1E2EA 3K0FB 2PMKA 4BFZA 2CLDX 5C4MA 2FDCA 2GZAA 5EP2A 3W34A 3K9LA 1JQLB 4PZZA 2OCBA 2Z0MA 4Q5IA 5K8TA 3TR5A 3RRNA 3L82B 4PC2A 2ORVA 1MO3A 1Z5ZA 4M9SA 1P2SA 2LKDA 3HR7A 4C4PA 4B48A 2IL1A 4JMPA 4KFRA 4KLNA 2GJ8A 4II7A 1GUAA 4LV5B 3T12A 3B82A 3AM1A 5FOTA 1NSFA 1SKYE 1ZUIA 1KKMA 1N0VC 4PO8A 3GLHE 3EARA 4LYAA 4B3GA 1G3IA 1TU3A 3THOA 3WYGA 2QMOA 1Q3TA 5B30A 4ASUA 1CR0A 4DVGA 1US8A 1KJZA 3QBVA 2VSOA 3P32A 1RFLA 2H17A 1BMFD 1R0YA 4LY6A 4Q1BA 3R8FA 3VU9A 3T1VA 4PC6A 1E9RA 3LNCA 1OT3A 3A1SA 3CWZA 5EJEA 2KE5A 2WM9B 3QXCA 1KO1A 2WBLC 2WICA 2WWHA 1TADA 2ZANA 4LX0A 2IYVA 1F5NA 1SVMA 1BKDR 1CR4A 4OHYA 1K8RA 3PEVA 4B3BA 4GOKA 2VTKA 2ZREA 2EQBA 4HI0E 1QBKC 4TMXA 2R6DA 4URVR 3L8ZA 2WAYA 4QOSA 5BYJA 2BV3A 4LYJA 1MABA 1P72A 1E2HA 2VO1A 4HSEA 4D4MA 4RZUA 2IWRA 2CBZA 1FPMA 1OYYA 3EZ2A 3LH5A 1E1RA 4NCKA 1E99A 2O8EA 1CXZA
chains in the Genus database with same CATH superfamily
3AHGA 1ZXXA 3PFKA 1GOTA 1S3IA 4X7MA 1Q83A 2E21A 1HYQA 4EK9A 5AYVA 3RU9A 3RVBA 3C1UA 3SHVA 2ZRBA 2GTPA 2VQSA 3FNBA 2AR9A 2A0XA 4NDZA 4MWEA 4L4UA 4C07A 1AH2A 1OB5A 4A10A 1JNXX 2MSEB 4EKNB 4M0UA 4F3KA 2HC9A 3I2KA 5KO2A 5I7OA 4ND3A 2RGGA 2IYWA 2J31A 4QUIA 1WHTA 2VP2A 4HNQA 2GEUA 1D2AA 1R1DA 2X5JO 4LGMA 4MQ5A 4MYDA 3O92A 5F7OA 3EOBI 3JTMA 2WUFA 3NC0C 5C5CA 3FMVA 4XFDA 4D0RA 2XBMA 4FLFA 1MFPA 1OI3A 4AYWA 4U2KA 3OTOB 3OCUA 4GVXA 3INRA 4NEQA 5J2TF 5DBHX 2MMGA 2DWUA 2JJ1D 2VAMA 1SM4A 3LXMA 4JENA 3U4AA 1EIWA 5FL7A 2TMYA 3T3DA 5L3SB 3DPUA 1TU0A 3WYEA 4KP7A 3FCAA 5THXA 5F7ZA 1QGUA 4C21A 3AR7A 5EJGA 2BMEA 3CVOA 4E6PA 5BN1A 3PI6A 4FLEA 4X94A 5D3QA 3CA8A 2QQ5A 1J25A 1DKUA 2PYDA 2Z09A 3HJHA 5LL6P 1O4VA 3JD4A 4EJ0A 1IN7A 1TK3A 3I32A 4IQ4A 2AS0A 4BE4A 3FMPB 4DARA 4MQFA 3FH0A 4EO7A 2QNRA 4QT4A 2FRDA 4DCVA 1WD5A 3CZ9A 1RWMA 4C0LA 2QLJA 3M5DA 3I9V6 3PQ2A 2Z1MA 2JBAA 3LUDA 5J2UF 4HPXB 2DC1A 2YZNA 1XRJA 1ZLXA 2VSQA 3B5IA 5KDLA 3UAZA 3I2YX 3GJ6A 1QZTA 4XVHA 1CJBA 3TRFA 5LP6F 3H3XA 1PJBA 1Y3CE 1TFUA 4KGVA 3M4NA 4RL6A 5ALYA 3CN9A 1F3LA 3GFVA 5FUYA 2JNWA 5IBQA 1GN9A 1PV2A 3UBTA 3B13B 4BX8A 1C5KA 2XUJA 4B84A 5JBQA 2IH5A 4LZPA 4YJGB 3FETA 3RYIB 3UH1A 2CJWA 2LR0A 4GPBA 5LUAA 2JLBA 1HQCA 1G64A 1V5WA 2L17A 2H2DA 5K05A 4GKVA 4GSKA 1HETA 1E7QA 4H1HA 2G5GX 3UCXA 3O1JC 4ANFA 5G53C 3FSGD 1TA4A 2CJPA 4ND8B 4GQIA 3AF4A 3WQQA 4E4TA 4CCWA 5BVHA 2V1UA 4FXPA 3NDBB 1XDBA 2COKA 2QTLA 3IAHA 2NTEA 4PYKA 3ICQB 2WLSA 3HJRA 4KN6A 3FZQA 2CJYA 3IDZA 3E0XA 3IP1A 4TRMA 4XDYA 4ZDWA 1XD2A 5KOJA 5F23A 3HBLA 3W05A 2PBRA 2C7QA 1R10A 4XIYA 4IEFB 3GAAA 4AKSA 2B69A 1I6MA 4MCHA 4ZODA 1NBEA 4PYNA 2BLLA 2YXBA 4DKXA 2GUGA 4IMPA 1KZHA 2FDXA 2BEVB 1N5RA 4F3TA 2XOEA 1D6NA 2C5AA 5B6PA 3ANYB 2WWIA 3KEMA 1QC5A 4Y3UA 3V8PA 3VQTA 4B5LA 4D96A 1CB0A 4RJ2A 3T5AA 2M6RA 3B1VA 3UAVA 1QIFA 3R3XA 4PHGA 2IYRA 3G3EA 1KORA 1YJQA 1NONA 3OEHA 3ZDDA 1OXSC 4RSMA 2I67A 1J8MF 3RSFA 1E3DA 2A30A 1O6FA 1RJWA 2X2EA 4UUQA 5TQ0B 2VUHB 3ILVA 5SY9A 3W1WA 5F98A 4FK8A 2ID9A 2G77B 1FQKA 1MTOA 3L4JA 2XQIA 2RGEA 3L7NA 4AF6A 3HXOA 2P78A 4WDQA 3L93A 2EX1A 1EZ4A 5LC1A 3NPMA 4DMFA 4ARAA 4NJEB 2W4IA 3UOGA 5ALEA 4LHVA 2EX0A 3TSOA 4YUZA 3LYLA 1F6WA 4DIOA 2QN6A 3TLKA 1K5GA 2HUNA 4YEDA 2RHBA 1W0JA 3RBVA 1SUCA 1OYVA 2ZWVA 1COWA 4XB1A 2DUWA 4ZD6A 1VP9A 1G42A 3TEMA 3V1UA 5K7SA 5L95A 4MHOA 4IV8A 5FWNA 4MQBA 3L1JA 1GM5A 1I6KA 3ZI7A 4EVQA 3OOSA 3RI3A 3M1AA 3KALA 1LV7A 2JFFA 5AW2A 1CTQA 1GG8A 2WU4A 2MIIA 2B0JA 3F2VA 4KWHA 2OGWA 4BE9A 4BVEA 3GNTA 1YQXA 1EKXA 2G1AA 3EZXA 2X0JA 5F4ZA 2QB5A 1F0KA 2XMRA 2DPHA 2I8LA 1ZGAA 4PNPA 5LZ7A 3SLGA 3FG9A 1G8HA 4JZYA 3MJCA 3FYTA 1JSCA 4CG0A 2EQ5A 1U8UA 1K6EA 3KOWA 4ATNA 1TF2A 2R5FA 4IJKA 2X4LA 1XJQA 4NAHA 5A0FA 4TSFA 5DNWA 1I2CA 5KJCA 2FHSA 2ZRGA 3TSAA 4DA7A 4DV3B 1N8SA 1NG1A 2RJNA 3PE4A 4RY0A 4TOIA 1BE1A 1F6BA 1G6KA 1T8PA 2R6R1 3BEOA 2R4UA 3L0BA 4UZEA 1F14A 2X9GA 3LA8A 3LC0A 3TUIC 3AZPA 2PG3A 1JUDA 1Y6FA 5JVDF 3PNOA 1MAVA 3QEMB 4GU5A 4L5AA 4TMWA 3FNQA 5LQSA 2GYYA 4PXSA 2J0UB 3M1LA 5DXJA 4ZICA 3FF4A 4YNBA 2WU0A 3CVXA 3AG6A 2BUCA 1RLIA 2H11A 2WUVA 2IFTA 2ZW9A 4O2BA 4ZPXA 1KVQA 5I7HA 1SKYB 2IIPA 3DBRB 3F1LA 3GH3A 1U0SY 3ON5A 2Y92A 3EQ6A 4MAAA 4KVGA 3B78A 3RJTA 3LRTA 3QVOA 2AV6A 3D3KA 1YK1A 3MELA 3ADCA 1OGIA 2P2SA 2EV9A 4E2YA 4OBWA 1FLVA 3OLQA 2IZOA 1QHIA 5ITZA 4CN9A 1UODA 3EZLA 1ISHA 3HI6A 1DG1G 3CUEF 3HP7A 3QVMA 4P8RA 1U9YA 2AX3A 4K26A 3K6SB 1LJ8A 4EGQA 3FMIA 1E2JA 2B4QA 4Y9TA 4BGEA 3IDQA 5DHPA 1HE5A 3PB3A 4EPVA 3BK2A 3RF7A 4MVYA 4Y1FA 4ZAWA 2HCFA 3QIVA 1S2NA 3NWOA 3O0TA 2YWEA 5HQ3A 2XUDA 2EZ4A 5EUCA 4D3XA 1N3BA 3OZAA 3U7EB 3WL7A 2D0IA 3LT1A 3BXHA 1CYEA 1ZUNA 3G0OA 3ZD9A 2FOIA 4M1OA 2HSZA 3RYFB 4P0TA 4L28A 2Q3EA 1ADJA 3M2TA 3AHJA 4M0LA 1FP6A 4R4JA 5DLEA 3TB4A 4EHDA 1H0SA 2PUHA 2OCAA 3Q7PA 3GJTA 4E5MA 3K1TA 1CQIB 3WAGA 4FDAA 1G59A 3IUQA 3PTZA 4ZCSA 4PVDA 5U4XA 3RKUA 4JLPA 1YRLA 4ZCTA 3L7AA 3GHYA 4O4JB 4GMHA 3R5XA 1WCWA 2YYZA 3G23A 4RQAA 2FPPA 5EG5A 5ALFA 3CO5A 3CZQA 3ZW9A 1ENOA 4EQZA 4TUYF 4QLOA 5AJVB 3EWAA 5CFPA 1YK0A 3PDWA 3ZGNA 1XTRA 4XVUA 5KMGA 1HNXB 2HQ1A 5E95A 2DU8A 4M99A 5TGTA 2XGGA 4V0KA 2JI7A 2R8XA 4XWKA 3W6NA 2AFIB 1E79D 3CH4B 4H60A 1Y5MA 3KWFA 4JT9A 1HTWA 1RDFA 2IDKA 4F5DA 3LU1A 4PYQA 1ZI8A 2VJAA 1VLQA 4H4DA 2A5DA 1C3XA 4Z99A 2FP4A 3SU8A 1Q15A 3ZVNA 5EFOA 2QW1A 5CA0B 1UFRA 1ECGA 3R7WB 3SFTA 2F17A 1M2EA 4BO7A 3TXYA 2XMGA 2VT6A 3WQBA 2OHVA 1OLUB 3DHYA 3K5HA 3RHFA 4D4IA 2CZGA 2VPTA 3NOVA 5KUTA 3BIOA 4WGGA 1TQDA 1Y89A 2W90A 2JGRA 3PQ6A 2FE4A 4ER6A 3UGJA 3FNRA 1PJCA 4FBMA 4AD8A 2PRZA 3ZHTA 5JNTA 4OHVA 1JXOA 1RCFA 2Z8ZA 3UENA 4GP6A 2O0LA 3OFJA 3PRJA 1MO5A 2A78A 3CZRA 2WHQA 4RKRA 2AX4A 1JLKA 4IGEA 1IU9A 5H5JA 1WZNA 2E55A 1V26A 4X65B 4NNPA 1JX6A 4AZ3A 1L3BA 2AF3C 4FFRA 5EP3A 3OOYA 3DLTA 2JVJA 3LBFA 2E87A 2FEOA 1LQ2A 2QNBA 3RIGA 4H3SA 1TNDA 2FUG1 1SK9A 2V7QA 5B53A 2D8AA 1IBRA 2YHIA 4H3KB 4MV9A 5G0UA 5TB5A 4UTNA 4ZVQA 2QZPA 2B2CA 3ZE1B 3ZWCA 2REBA 2HJHA 1U7WA 1WDWB 2AK2A 4LOAA 3NHZA 4QOEA 2J9FA 3F78A 8OHMA 3RAFC 4IMJB 4PIMA 3EGEA 3THXB 4RSRA 3K2EA 3SE7A 1WZUA 1Q12A 4N5NA 4BVBA 5LR6A 2WMYA 1DP4A 4WGFA 3HBNA 2BI4A 2NV0A 3W5BA 1AQ6A 1DIBA 3JZMA 1IM2A 2PLRA 5KC8A 4JT4A 1T2UA 2R97A 3K6JA 3KT3A 5SY6A 1QHNA 3GRKA 3KR0A 1GAXA 3OU6A 4XARA 3AHCA 3S2GA 2NZ8A 3D7RA 3VYWA 5BSGA 1KAQA 3T8YA 4JLBA 1JVNA 2XGOA 3HKEB 1JDBB 1XDSA 5JI3E 3BGOS 5BSHA 2XWBF 1W52X 2BFOA 1MH1A 3EA0A 5EIHA 3CZCA 4DNOA 1XGKA 5B58T 2B99A 3JQGA 1CBUA 1J7JA 4PYMA 1SBNE 3FGOA 4ZEXA 4LC9A 3ZHOA 2VCHA 4ARCA 2AUNA 5KNBA 2I8AA 4GOMD 3E05A 2I99A 1N75A 3A9VA 1JJAA 4NQRA 4WKBA 3IAAA 4ME6A 3ZK7A 2GN2A 1ISPA 1T5SA 3CVJA 5LD2C 5KWIA 1U0FA 2QR2A 2F3TA 1ES9A 3JZIA 2POQX 4GLOA 2CLIB 4IXMA 5G3YA 1T8UA 4CEJB 2WF5A 5CYOA 1KSGA 2NPIA 3I0MA 4LUCA 4U0KA 5FPYA 1SG9A 1SC4A 4LZNA 3ZBQA 4E15A 3DOFA 4IDHA 5AKYA 3LQ2A 2ASEA 1ZNXA 2C4TA 4NRDA 2JCYA 4FZJA 3NASA 3F8WA 3Q7EA 3FVTA 4FI3C 1RM4A 4X6YA 1GRRA 2ZJ6A 4AJLA 4WNIA 4UM9B 1PS9A 4X71A 3ZI0A 4HJXA 5EWJB 1H0RA 5B3AA 5J40A 3SJUA 1JBKA 2Q6LA 3H5LA 4EX7A 3LHFA 3OKPA 4FD2A 4II2A 3E6AA 2KB0A 1FEZA 5I7AA 3U4QA 4Q7QA 2EP8A 2PT7A 3TW4A 1XMJA 1TM2A 4CIVA 1KWKA 2QLLA 2ADOA 4F85A 2OMKA 3B2EA 1EFHA 3IUYA 4EI8A 3DFKA 4YJ3F 2HSEA 3UKJA 3EA5A 3DUWA 4PX9A 3EXFB 4J16C 4E1AA 1UEIA 2AC4A 2YVQA 4JBHA 2PFSA 1RJ9A 3K0EA 5FX2A 4YHBA 2QHXA 4DLSA 2Z1DA 4ARVA 4B7AA 2D3WA 4D8XA 5KTRA 3WWZA 4BB5A 2GMWA 4L27A 1NLFA 1OXTA 2QP9X 3DQZA 1XVIA 4JUAA 3F9CA 5K1ZA 4YYZA 3A1TA 1CJMA 2VHCA 1ODTC 3L9XA 1TTHA 2VK8A 2VZLA 3LBYA 4DLAA 3QE9Y 4EZBA 2VBFA 4AMVA 3BHNA 4R1OA 3WWDA 2PTHA 3BRWD 5TQ2A 3F8TA 4IDOA 1D03A 1M34A 2V65A 5J1SB 3T3IA 1VTKA 2JAXA 2OXCA 2OGUA 2VC2B 3QEOA 4HWSA 4R8MA 4X64B 1U0BB 2VDQB 2HLHA 3L0YA 3AINA 3B6IA 3ILXA 1YONA 4JWTA 4UPVA 1L5HB 5LD2B 2Y4OA 4M0EA 5DNVA 1WY5A 4V1CI 1BS1A 1GADO 3DL7A 3IH5A 1JG6A 1LPMA 1OY1A 5CVDA 1DJPA 1V1RB 3R9KA 1A3CA 1KIFA 1XMXA 2QTWB 1P3DA 2PXCA 5CDUA 2PGAA 4HEJA 2J9YB 4BEJA 2W42A 5KWSA 4UZSA 1A5TA 4W7HA 1YQTA 3ERCA 1MGOA 1U3VA 1YCHA 1BA3A 3WGNA 1QU2A 4RBNA 1MRNA 1NPYA 3EQ7A 2W2NA 1YL5A 1OWNA 2XPCA 4X1IA 4K9RA 2WJIA 4WOKA 1VB5A 1ISRA 5HCNA 1EQ2A 4PO9A 3EN0A 1ZEJA 1E94E 3Q3IA 4N6OA 3GOQA 4M54A 1YGYA 4CDMA 5J58A 3VVBA 1P17A 5GADl 2Q6VA 4XR4A 3FNHA 1DX6A 4PANA 4Y7DA 1O9HA 2A58A 1J06A 3OPYA 1I3OA 1VL5A 1EZ1A 2B35A 4CNBA 7REQB 5ITSA 4L0DA 3L7CA 2NUAA 1Z4PX 4AF8A 1D2GA 4DR6B 4MMXB 5DWDA 1SCAA 4NJMB 4X84A 3RFVA 4QVGA 3HWSA 2QL9A 3F49S 4DCJA 1JALA 1M2OB 4MVJM 4DQLA 1ZH0A 5LA6B 4Z3OA 2A5LA 4I9FA 4IO0A 4KV7A 5AK0A 1FDSA 4UMDA 4WXRA 3V1KA 1VJ1A 5C35A 1C9YA 5F78A 3FOWA 1WTAA 4YLGA 2H9IA 4JJGA 4PLFA 1BU8A 2OAGA 4ZZ1A 1AK2A 1JG3A 3I6BA 5EIBD 4R8VA 1NBIA 2FY8A 1K7YA 3D8UA 2QRPA 1CUZA 1CUUA 1JR3E 4JEHA 1W0KA 1SC6A 2ZIVB 4MW7A 2P2YA 1SCKA 2HSDA 3A0UA 4MRNA 2HIHA 3O2JA 4ZEWA 1H9CA 4DAOA 4ZQHA 4NS1A 1IB6A 2NVWA 1F60A 1FU8A 1P4GA 4AAYA 1M1XB 4X45A 4OSEA 1TYZA 3KHSA 2WMNB 2ZK7A 3G13A 1YH3A 5EE3A 2WZBA 4PSCA 4Z4HA 3G2QA 5K0FA 5A71A 4AWBA 4RTQA 1IAVA 2WD7A 3P9RA 4Q12A 4QPJC 3WI7A 3VZBA 4QUEA 2DUMA 2HHHB 3JD3A 1UBOS 4B6EA 2ZQZA 1NXVA 1QHGA 1ZK2A 3HGTA 3PFBA 4CMJA 1V16B 3TTYA 1R6XA 3RS0A 4ALNA 4IIXA 1XCGB 3S27A 3DDUA 3FDZA 1NQVA 3AP3A 1T5TA 5JATA 5C0OE 3PGXA 4HRAA 2V5VA 2RHCA 4D97A 1H8EA 1P6QA 3P0RA 2AEJA 3OY7A 4F4DA 3D6MA 1IXKA 3RU3A 2XGJA 1GN8A 2BWJA 4FMBB 5KVQA 2XTJA 3SF0A 3TFQA 4XWWA 1UM8A 1BEUB 1SUDA 2I22A 1Y7PA 2W2TA 5B4UA 3T0GA 4JIGA 1VECA 2PJDA 2YWHA 4NZZA 4ZV9A 1N5MA 4PYIA 1GL6A 1YA8A 4W1PA 5LU8A 2V5UA 2FK8A 3H0CA 3R6DA 3E9DA 1A8QA 3D0KA 2R6AA 3QXSA 5J4LA 2G1PA 5JXJA 3ZNQA 1QH8A 3O8DA 2XEDA 1Z47A 3LHIA 1D5WA 3SHQA 4C1NA 3BEDA 4F2GA 4Z1OA 1REQA 4JJ4A 4KMSA 3RSOA 3UBMA 1EX7A 1VIVA 2AG6A 2D62A 1NP6A 3O26A 3LXUX 4J43A 1K8YB 3B89A 1VYHA 3N8IA 2BZSA 3QFHA 4YK7A 3S2SA 1L5VA 1P7CA 1SVIA 4FJ2A 4EVSA 4ZOQI 2HV9A 2FFQA 2YS7A 3IOYA 5CEEA 5DBFA 4CM4B 4BV8A 1QMPA 1X9HA 5BOSB 5AVXA 1LBHA 3SXPA 1BVYF 1KIAA 3OEYA 4Y2UA 3HVJA 3O82A 2LTAA 2V6BA 3JQ9C 4HWTA 4RVNA 1EFPA 1M1ZA 2J7PA 1A2OA 1FJXA 4CQNA 1S5PA 2QVBA 3S1LA 2ON6A 3E3LA 4IHJB 3TLCA 3GLGE 1EE9A 1PGOA 2G06A 3D4OA 3PHBE 4DLTA 4C7JA 4ZDIA 4IOKA 1MAHA 1G6Q1 2ETVA 4O8ZA 4BNXA 2GERA 2ZGVA 2QUZA 2J0QA 4RK1A 3V6MA 3EPKA 1CUBA 2QAGC 5EJMA 3A4MA 1EVEA 5CLQA 1VJCA 5I45A 2OGTA 4M8IA 2XCTB 4GWLA 4QYIA 4X1KB 3TSYA 4M76B 4FUTA 2VJBA 3OF3A 5KINB 1D6SA 1LDGA 1KL7A 4KSCA 4BYMA 1USIA 4LBYA 5K3FA 1E5QA 3IPRA 3OQVA 4HPJB 1W25A 4G0PA 1FUYB 3TFOA 4O2LA 2PYZA 4BGUA 2ZE6A 2PGJA 1YVDA 4FC6A 4EKYA 1TAHA 2PX3A 4IKEA 3FFTA 3CW2A 1EFRA 1VSVA 1SQGA 2G6TA 1SHLA 2OO7A 3OD1A 4J0FA 4X61A 3LYHA 5SV2A 4GG1A 1KJQA 1NJ1A 2VZ9A 1EPUA 3PUVA 2C3MA 4LE0A 4L02A 4UXJA 5AVKA 2J3IA 5TS3A 2JGDA 2AN3A 1A8HA 1TZMA 1CR2A 1RADA 1IIRA 2BBWA 2IOQA 2ZIFA 3LXXA 2YIMA 2A88A 4MULA 3SBDA 1QYIA 5LQKA 3EK2A 3C15C 3HYLA 4HXYA 4OGWA 3UHOA 2I1LA 1D07A 1MX5A 4TKUA 1XZEA 2HK9A 4J7CA 4PG6A 4C6SA 4B31A 2AG0A 1G1MA 3SJCA 4GYYA 5LYJA 1UBTS 1R5JA 1O8BA 3GRPA 2PR7A 3JV7A 3ZV4A 3RHZA 3ZWVA 2UZ3A 2PZBA 4B83A 4ZZ3A 1G5QA 2I6SA 1NHGA 8ADHA 4QU0A 1PS8A 1GNSA 4F11A 3QHAA 4J2OA 4QREA 2TS1A 3JTEA 4H7FA 1IY0A 3BXXA 4CKEB 4JWKA 1I14A 4PLGA 4J4HA 3W9BA 5P21A 2J3EA 3S4YA 3TQIA 3CNLA 4DEYA 2IYOA 4BLTA 5A4JA 3HXQA 1O4WA 3WKEA 3MG9A 1TGYA 4YAIA 4CF7A 2QTCA 3OIWA 3GJRA 3TRDA 4Z9FA 1KMNA 1ANKA 2OYRA 1HE8B 3GRUA 1N6LA 2ZKIA 5JRDS 3PQ4A 3CISA 3KLPX 5DNAA 1CRZA 1VC2A 2ALJA 3H3JA 1CUJA 1K8XB 1T9AA 3VKVA 1EM8A 4EG5A 1LW6E 1RWBA 2VG8A 3OEHD 4LHXA 3SDZA 4BLPA 1ZS9A 1V7PC 4NPHA 1BWSA 4OGGA 4RGYA 3GRZA 1DC5A 4QRIA 5CXSA 2CF5A 3PLRA 2C0PA 1YFLA 1MVOA 3PA6A 1TVKB 3ROXA 2R62A 2FSVC 4G2NA 1N4AA 2ZRNA 4PZYA 3T9BA 2GKGA 1B16A 2F3QA 1RBZA 2HA3A 4O3FA 1ORIA 1MTZA 3DFUA 1FL9A 5A5VA 1E3EA 1B6SA 3N86A 4RFLA 1JJBA 1T4CA 3DDNA 1W0JD 2YYAA 3MS2A 4TMZA 4C22A 1COWD 1FDWA 3LFTA 4XR9A 3H7AA 2GQ0A 2HPVA 4G4GA 3RUPA 2XZOA 3CKKA 4P84A 4RESA 3LMKA 1LDMA 3VHXA 1W2WB 4MV5A 1TRKA 3C6QA 3E53A 4DPMA 1P4SA 3ZEAA 2OB2A 1F0NA 2IDMA 4OEHA 1U2GA 3HS3A 4XGKA 4KFSA 4LG1A 3HU3A 5JNLA 2GK6A 2ZT7A 5DGIA 4WQMA 1SCUA 3ZQ4A 3GLTA 4Q1EA 2FZ4A 2GJKA 4C3OB 1ISGA 2AOUA 1D2CA 1M7BA 3GGOA 4I6EA 4IIHA 2GRAA 4REMA 4R81A 1USKA 2WFZA 4FYKA 4P08A 4YT2A 3PFNA 4L85A 5C8VA 4ZOEA 3Q87B 2JIPA 3EFBA 5CJJA 3K8QA 4A73A 4AWAA 1VHJA 2PJUA 5ECGC 2E5WA 4YLEA 5HYVA 4L6AA 5BN5A 2BC9A 3Q6MA 5CXUA 1XLTC 3D3WB 3H2HA 3I01M 3BG5A 4GIBA 3PG5A 1L5FA 3CIFA 5C8YF 2PQ2A 1ZK0A 4CLRA 1NRJB 1V45E 1ODLA 4RD1A 1SBZA 1SMKA 2CSXA 4W82A 2E49A 5DVZA 2G7ZA 3V7YA 5KQSA 5K3CA 3Q2IA 5H9WA 1S2MA 1ZISA 2GF2A 4LHZA 1U63A 4BB6A 4L5YA 1O03A 1SHJA 2M1ZA 4WH0A 1N2EA 1CPYA 1WL8A 1EFVB 1I1OA 1K08A 3PCTA 4HNAA 4TWAA 4X00A 4G86A 4QOJA 2J0EA 1FFSA 2Q07A 2V6GA 4W1QA 4FZ3A 4JR0A 4N49A 4BYGA 4C20A 2F8LA 2QU7A 1QQ5A 2LWIA 2QAJA 2W22A 2WIKA 1ZZGA 2D3TA 2H1LA 1NT4A 1CUGA 3CF6R 3GFSA 4HLDA 4PBSA 3AEKA 4ZU6X 2ZYGA 1QG0A 1Z75A 3HA5A 1GPWB 4EGCB 1IZYA 3CEHA 4PLCA 3K0AB 5DI3B 2RAUA 1E4EA 2N1BA 2GHIA 2YWRA 3AHDA 1NF9A 3E3MA 4QG7A 5CT4A 1TQ4A 4O4IF 4A9AA 3C14C 4QECA 1AX9A 1RXCA 1WXQA 1NX9A 4QRHA 1NDUA 1G20A 4Q19A 5ALGA 1K98A 1XEFA 3OA0A 1II8A 2XRFA 1ETHA 1UFOA 1EUDB 1J0EA 2HDNB 4N4AA 5DT9A 2BW0A 3GZTB 1EGVB 4IJQA 5G2OA 1J24A 4JEIA 2I4LA 2G9NA 3OX4A 2GBFA 5H4GA 1P18A 2W93A 1W46A 3MTAA 3OI7A 4V03A 2ZFUA 1N8NA 2O6HA 3RYCB 3AZOA 5EKSA 4BO5A 1NUUA 1Z35A 8LDHA 3OE7A 1C50A 1E3QA 1C3OA 1VI6A 3LWBA 3OESA 4A0SA 1UMCB 2CL5A 1ULSA 4LSGA 1FFDA 1COZA 1DFIA 3EXG1 4F4FA 3RJMA 1FSPA 1Q6ZA 1YB2A 2ZJ8A 4YV0A 3QWAA 4YECA 2BH9A 2PH1A 4GC5A 3FX2A 4TL7A 4WD3A 3UC5A 3UHJA 4Y67A 5BMVB 3ABRB 5KHAA 1KXJA 5EHNA 3DTNA 4CEIB 1T9CA 4RA6A 4B17A 4S1PA 2D13A 1IOVA 1ZM9A 2QPAA 4KR0A 2JFWA 3R9WA 1Y63A 2FEPA 3IKVA 3Q41A 1Q19A 5CNIA 3ZHUA 1MLDA 2ZBEA 3QYFA 4EFMA 4HBGA 1NNEA 2AE1A 1AZWA 3AKZA 4GKJB 3UFBA 4DV2B 1SBCA 1QUFA 4GPAA 1KJWA 2CSUA 1VE7A 2WKPA 3EGDB 4E22A 1EU1A 3O4JA 1Z34A 4C05A 3BF7A 1CNMA 4FEYA 1NQOA 4H27A 3DFMA 4QHTA 1XAJA 2VLBA 1KOLA 4DBLC 2JRCA 5INTA 4J0QA 2QRUA 2YJGA 3DULA 3JQAB 3MUOA 3BMCB 4OFWA 1ZWKA 4CKZA 1JIKA 3BS4A 1GPH1 3GJ7A 5EZ5A 1BOOA 2ECKA 4CM1A 4CCSA 1E62A 4EEXA 4QTYA 5KC9A 2C3PA 4DXDA 1QQAA 2YMQA 3DYVA 3HB5X 3HDYA 4GH5A 1UPXA 4MVCA 5A6VA 3QSGA 4J1SA 3FY4A 2C2WA 3ILSA 3QPWA 4E03A 4ZK6A 1YTUA 4KREA 3KKKA 4M86A 2EL9A 4M37A 4OU5A 5HPYB 2W98A 3PTAA 1NMXA 1D1PA 1Y5IA 2W4MA 1OTYA 4DDMA 5HM8A 3WDKA 5T57A 1QBGA 1ZRHA 2P4EA 1GLGA 2QG6A 2V7UA 4M21A 4NCAA 1XNQB 1YA4A 4IEEA 5LB4A 2PO7A 1V7QA 3DWEX 3VZCA 4JB2A 4FHEA 4BX3A 4XD7A 4MVJF 5C5EA 1LCIA 3DEIA 1EUYA 2DFKB 3MGKA 3VAAA 2XA1A 3V7WA 4UCXA 2A35A 3ER6A 3MOIA 4OUDB 2QX8A 4H15A 4EPXA 5BSFA 5K6TA 2F00A 2QY9A 1P4JA 2V7QD 2ZRCA 5AJXA 1F0YA 4ZGGA 3PQCA 2XB4A 2ID4A 4PYOA 4PCUA 1RXEA 3NGLA 3O0DA 4Y2GA 4YJ2B 2BHLA 2YUTA 2HMSA 3K1AB 3OE4A 1O1YA 3QX3A 1U8EA 1R4AA 3R8XA 5L4SA 2R8PA 1E4VA 3GMTA 4DRXB 4DVJA 4LZLA 1YF3A 1ZQ1A 3I76A 4FJ1A 4KGZA 3WK4A 5BVGB 5K0SA 4I14A 3GLIE 2P9HA 3KBOA 3ZHRA 1ZO8A 1H1DA 2BFFB 2C5SA 3AM4A 2WHPA 3FPEA 4TTJA 3USCS 5LMNB 2DJIA 5JY6A 1ONOA 1E8DA 1QTIA 3JU3A 4TV8B 1LFAA 4E70A 2NO4A 3B51X 2OV1A 1RXIA 4M1MA 1YZKA 4F2WA 4GMDA 4OHKA 3ZGZA 4RLQA 5GMOA 4CW7A 5HVNA 4QTTB 2JFNA 3OFKA 1PFVA 3FJOA 3DR3A 4DIUA 2CUTA 1L4FA 3CH5A 4ZIRA 3A2LA 4HNHA 3CRQA 4RCZA 4ZP1A 4EQ6A 3BTSA 4RMHA 4YAGA 1V3TA 3U31A 3UZUA 1DMRA 5FULA 5K9ZA 3T7TA 3KQMA 1S8FA 1YE8A 4WMLA 3M3DA 2O6LA 3GP5A 4WJLA 2K4MA 4FT4A 1J0DA 4L9WA 3DE1X 1UMBB 4ZYYA 3Q3CA 4FYXA 1N0IA 3AIIA 3RS4A 5C18A 3EPJA 1Z16A 4BP9A 1PEDA 2FFRA 4G0VA 3T3PB 2W83A 3RYHA 4C5BA 3OM0A 1X3LA 4CZ2A 5JCPA 1QV6A 2H1HA 2VH2A 5E6RA 1JFLA 5JAQA 2RHTA 4JLKA 5IHXA 1F48A 1U9IA 2KLHA 4X0EA 4GYKA 5CJPA 3M33A 2CNWA 1C4XA 1ZNZA 1QJCA 5DRTA 1NQXA 4QXQA 4I46A 1N77A 1Y5LA 2VUIB 1TCCA 3SBEA 1QX3A 3PWZA 3QU7A 5JEEA 1ZPDA 2O2XA 4LZAA 5DGHA 4LVNA 1OFUA 4QYXA 1TLTA 2VJDA 3TI7A 2V58A 4ED9A 5KOHB 3VR1A 1AKNA 2NXWA 5AXDA 1UOOA 3UJNA 2PZ8A 4F6CA 2L42A 3ZJ5A 5F52A 1EG7A 2IYQA 4OHRA 5DV9A 4RNCA 5HKKA 2WT9A 3F3MA 4B81A 4Q4JB 3X1YA 5ENVA 5EE5B 4BQEA 4P0PB 4B3RB 1XMOB 1M76A 1DIOB 3DGFC 4MW1A 1L5MA 2ZIUB 1ZN7A 3TR0A 3HKBA 1D09A 3JALA 4FGUA 1TMOA 2AOWA 1SQ6A 2YCLA 4L5IA 4BMNA 5GINE 3GLIB 3RVKA 4IUBS 1UKVY 3T6KA 3IPLA 4MV6A 3OWOA 2EDAA 4GRDA 4NK5A 5FOQA 2WPDD 3GVIA 3MRXA 2G28A 2V4MA 4ALJA 4BBJA 4H3VA 3NOQA 3U49A 1NFFA 1E5LA 1EX1A 3OIYA 4HEA1 4WK6A 1L1FA 2QE7A 1TW3A 3AB3A 3ZCVA 4C3VA 1TB4A 1G3QA 3I5XA 4Q05A 1KMMA 2HT1A 2ZSIA 1HZZC 1Q0UA 1QK4A 3H4IA 3IDSA 4W9MC 2G83A 4M7WA 5J5AA 5TGZA 4J4TA 4YPFA 3R0ZA 1K0FA 4B8WA 4EJFA 1J97A 4R16A 2VLIA 5JSQA 3ND6A 5B7PA 1OTHA 1KE2A 1Z8NA 4LDJA 3V4LA 2XI4A 1WNFA 5G4KA 4Q7KA 2XQGA 2Q9AA 3W06A 4U7PB 3LPNA 1CW2B 4HC4A 1SA0B 1K4MA 4PQGA 1E1MA 4BJHB 1IJFA 5LFAA 1T2VA 1Q5PA 3C43A 1W44A 3T3HA 4V2IA 1Z62A 4W5RA 3QXXA 4YQYA 4IFTA 3A1DA 1KXZA 3NHAA 2VUTA 4X7BA 2ZDGA 5BV2P 1OBFO 5KYKA 3C8DA 2QYHA 3G2MA 1G9XA 1ATZA 2NYAA 1VCOA 1NMEA 2CMHA 2VJLA 3RUIA 4E5UA 1XJWA 1E69A 2XLBA 4RDXA 4Q7MB 4BNMA 1K2VN 3IAM6 3K5WA 1QG6A 4H1TA 5K0NA 4GRIA 1TJNA 4Q16A 1OLXB 5E7MA 3G2HA 3V34A 2O2ZA 1FLDA 1KYXA 5KX5B 4KE9A 4LXUA 2WJZB 4BV3A 2C2MA 3MJEA 2DWPA 4QJ4A 4B7UA 3M3PA 1AN9A 3AEQB 2H54A 2C2YA 1E6UA 5JS2A 3AGQA 1JE1A 6YASA 2Q5QA 4V1CA 2AD5A 3DYIA 2NACA 1Z0JA 3KZKA 3LV8A 5B3JA 3R4VA 3M9XA 3SLKA 4P9NA 5M7EA 4FR0A 2IW3A 4CBVA 3LY5A 3TRJA 4J1QA 4MO2A 1W0KD 5SY4A 1TUIA 3LWDA 2Q4DA 4Q9LA 1FXSA 1LBIA 3BE5A 1OXMA 4JDPA 4MEJA 3PPWA 4ALMA 1VLHA 1A9TA 3HE3A 1V8ZA 4WLOA 1KEVA 3Q8MA 5BR8B 3A3KA 4MPRA 1AV7A 1BCSB 1JI3A 1GPMA 3BSSA 3EH1A 3FCXA 3K94A 4C5AA 4WERA 4Z2YA 1WXXA 1VKJA 2GZDA 3CJTA 4K0RA 3L06A 3CLSC 4JJAA 3DBLA 5JXWA 4ABTA 2VK2A 2E85A 4OFXA 2BEUB 2ZVDA 3NDIA 5EZYB 3MGGA 2OKCA 3COVA 4EFKA 1W7AA 2RSLA 1YMQA 1XTKA 5FFMA 4ZVVA 4HUJA 3SQLA 3T7JA 3U48A 1TEZA 4K9MA 4QNRA 4CF5A 1IXSB 2XMCA 4GLJA 5DXAA 1JILA 1LFDB 1H8ED 1TL7C 2GEBA 3CLVA 3RU2A 3S44A 4QYSA 4BFVA 1E2KA 2VHJA 1XELA 4QD3A 3SX2A 1KOFA 5BSMA 2AC7A 1NRWA 3P19A 5EMJA 5J5VA 2CBXA 4FNAA 4NP6A 1X7XB 4EJ2A 1QH1B 3HFJA 1TECE 2D1QA 2C04A 3IQHX 3PDIA 1T0IA 2BDEA 8ATCA 3KS9A 4UARA 4F93B 3I1YA 3QWBA 4PZ0A 1HLGA 1ZCBA 1ODIA 2B21A 2CNKA 3C7AA 3P0EA 3USZA 1P7ZA 2VCYA 2H7YA 4N7RA 1J5PA 5JHGB 2DPXA 4MIYA 2PX8A 3T9DA 1NZDA 4F06A 2QJFA 3C98A 3PHCA 1MBZA 3EIWA 1OFGA 1BFKA 3JQBA 3Q9LA 1I0ZA 1R0RE 1A88A 3LP5A 4FP9A 1E1QA 3STVA 4P4NA 3UATA 2OZLA 2VAWA 3QHPA 3GVXA 4DQVA 2BEKA 3V8EA 1I3NA 4JD5A 4TMVA 1O5TA 4LEIA 3H5IA 5J47A 4DV5B 4ITUA 5H1YA 1HI9A 1Q74A 1KDPA 1E59A 3DLIA 3JPWA 4P1ZA 4RLHA 5IAAA 1XK6A 3IAFA 3DDHA 4ZYXA 1CUCA 1A7KA 2ABWA 3DZIA 1RD4A 4FU0A 2R1UA 1W94A 2QU8A 1NVVR 1KAEA 3RUDA 1LU9A 5KTYA 5IASA 4D1YA 2J7PD 2W5UA 1ONSA 2I03A 3MB5A 4TS1A 1P4RA 1UXIA 3LIIA 5DTJA 5ALUA 3TNJA 3U6KA 1DAFA 2JJYA 3RRYA 3FE2A 2PA3A 5IJZA 1EGQA 4W5JA 4IIEA 3M9WA 2NU7B 1JFTA 3UWDA 1CUSA 1NN3A 3F98A 1N6RA 3IALA 4YJFB 1QVVA 1I7DA 3VYUB 5DXFA 3A6PC 1X80A 1ZR4A 1U7PA 2I76A 1GL3A 4PX2A 2A9PA 3KG2A 2H4YA 3ASVA 3Q8LA 2A5GA 2OTCA 2H51A 2LCFA 1QF9A 5FWYA 2QPLA 4AT1A 1RI1A 2PMWB 5BYAA 2BVNA 4OP1A 1RVV1 2PWAA 4ENWA 4YAFA 1NR7A 3WLRA 4J03A 5JAZA 1JSRA 4TV9B 3DOCA 1I3KA 1QHFA 1LLCA 2C29D 3JAWA 4QGBA