2VP4A

Structural studies of nucleoside analog and feedback inhibitor binding to drosophila melanogaster multisubstrate deoxyribonucleoside kinase
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
198
structure length
198
Chain Sequence
TKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQRRPQSCKVLVLDADL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Studies of Nucleoside Analog and Feedback Inhibitor Binding to Drosophila Melanogaster Multisubstrate Deoxyribonucleoside Kinase.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase
molecule keywords DEOXYNUCLEOSIDE KINASE
total genus 75
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.145: Deoxynucleoside kinase.
pdb deposition date 2008-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2vp4A00
2JDIA 1Z8FA 1ZCAA 1CJMA 1G16A 4IEIA 4NE2A 1NLFA 2J9RA 2EWWA 2ZITA 3I62A 5CDFE 3K0CC 1FX0A 2KJQA 4B74A 4BE7B 1NVUQ 1PUJA 4Q7JB 3RNLA 3WHKA 2VRWA 3DOEA 1E1RD 3ZD7A 1JEDA 1NY6A 3H0KA 3O8BA 4R98A 2NIPA 521PA 2V6JA 3IGFA 2O8CB 1NVXQ 4AIIA 4EFLA 1H8HA 3KJHA 4LHVA 5JZVA 2GBLA 4XVQA 2H8KA 3LX8A 3K9NA 2JASA 2NOAA 2ERYA 4UNPA 2OV2A 5KUTA 1BH2A 2NO7A 2GKSA 3SJAA 2F1RA 2NZ8A 4Z8XA 3GD7A 4LJ9A 1NVVQ 3KX2A 5GVRA 4UXIA 4JSYA 1DEKA 2C96A 1RRCA 1E9SA 3B60A 4MDFA 1WMSA 1T3LA 2FN4A 2FSFA 2IWRA 3U3RA 3WP1B 3T1QA 2ZRKA 3CF6R 1QZXA 3U7EB 1AGPA 1RJ9B 4TT3D 5DE3A 4O3MA 3RWMB 4PO8A 1GP2A 2W0SA 1AQYA 1I4TD 2PT7A 4GMDA 5KDDA 2GCOA 5D3MA 1Q0UA 1M7GA 3RABA 2IEYA 2WOJA 1JQLB 1XXHB 3JVUA 4KFTA 2FGJA 1SVSA 2PX0A 1UBCA 2OBNA 3ZYCA 3UWKA 4MYHA 1P60A 2O0HA 3CRMA 4F7WA 1E2PA 1G5PA 1E3MA 2XOKA 1CP2A 1S4QA 5JJIA 1Z0IA 1WXQA 2DFTA 4DWJA 1IN6A 1AZSC 2C99A 2QTHA 1E2EA 1FNNA 4NYMQ 3UMFA 2ZYWX 1Q44A 1R0XA 4NZYA 1KJWA 5AK0A 2VHTA 1KI8A 1RYHA 3L0OA 4ILEA 1E0SA 4ACAA 1UKEA 4XVUA 4U5XA 2QTVB 5FOUA 2NPFA 1KK3A 3TW8B 3UMSA 1TNDA 1RPZA 1U8AA 2AHOA 1M8PA 2CVFA 3SHWA 2RGDA 3EARA 1YR8A 4YXWA 4JLOA 4LJ4A 1UKYA 4NYMR 3CZQA 5JHHB 5HR5A 4QRHA 3ZVNA 1E9BA 1SGWA 1RRGA 2RB4A 3W34A 1KGDA 2QPTA 5G3YA 2AKAB 3W8RA 5AUOB 5F3WB 4EPTA 3C5CA 4DBLC 2NO6A 2B8TA 2DY1A 1NY5A 2CCJA 1OIXA 3A1UA 2VP0A 4FXPA 1SHZA 4V03A 4CYMA 1QDEA 2OM2A 2JLQA 3B7GA 1EK0A 4NPHA 4NCIA 2ZS9A 4KO8A 3BFKA 4NH0A 1G5TA 4I1UA 4OQFA 5CITA 2CL7X 1EXMA 2K5UA 2EU8A 3U3OA 3GEEA 3B85A 2QP3A 2FFBA 1N6PA 2OCYC 3MGCA 1U90A 5DI3A 2IW3A 2J0VA 1FTSA 4HAVA 1ZU4A 4FCTA 2BMJA 2IYXA 2FPMA 2WOOA 2WWHA 3GMTA 1OT3A 2W2TA 3AF0A 4LYAA 4NKRA 4NTZA 2GRJA 3QKSB 4WVFA 4RFVA 2WPDD 2B8WA 3NEYA 2ZR7A 5AUQA 2ZR9A 3CH4B 3PEWA 3A37A 1KI9A 5KPDA 1E9EA 2P0EA 1YR9A 2IC5A 5CYOA 1E9DA 4YMSA 2AK3A 3QEOA 4RJLA 4B71A 3I92A 4M21A 1KIMA 3OF5A 1XWIA 2FDCA 1CJKC 2YINC 2VF7A 3SYNA 1HURA 5CM9C 5KU1A 5F9FA 4CRWB 4MRSA 1BMFD 3LDAA 4Q18A 1FPMA 3OHMA 1TPZA 5J4KA 3ASYA 1NIPA 1KTVA 4KBGA 5IK2D 4D4MA 1II8B 2PZFA 1XD8A 2F3RA 3K9LA 2QRZA 4LPSA 3R7WA 2GVZC 4D2IA 1KSHA 1PZNA 1W4RA 4CZ2A 5JFGA 2QM7A 2XTMA 821PA 1XD2B 4B3GA 2LKDA 5DNYB 3OEHD 3H86A 1MR3F 4URYR 1LV7A 1XD2A 1XMJA 3LNCA 1A4RA 5HZHA 1H8EA 1ZC4A 5LD2B 2JJ1A 2PLRA 2VF8A 3EC1A 1TQ2A 3GJXC 3SJZA 2GETA 3VX3A 1XMIA 2GILA 2ZE5A 4KLZA 5DIFA 2ZRFA 1ZM4A 4PR0A 4Q19A 5D3QA 4U00A 1NBMD 3GJ7A 4FMDF 4LX0A 3VKWA 3T61A 1SHKA 4TLEA 2PJRA 3UKDA 2P3SA 3QXCA 2F9MA 1Z3IX 3DKPA 2IHBA 3LWNA 2YKGA 1Q22A 2ZRLA 2BKUA 4E5UA 2V1XA 2KI5A 5AJZA 5HE8A 3U3MA 4DIDA 1NBMA 2WKQA 4D81A 4UKDA 4LWZA 2VP2A 1PLJA 1KI6B 3SN6A 3FKQA 3NH6A 3I1FA 3C41J 3MMPA 5C4MA 3QI2A 1J99A 4DCUA 5H68A 4RSGA 3SJBA 3FMIA 1XPOA 3R20A 1IJEA 4OJKA 3KB1A 1OE0A 1G4AE 2P2LA 3AF1A 1KY3A 3K09C 4M22A 1MRSA 3DVLA 4MGZR 1NMZA 3THYB 1Z6GA 2ZYVX 1UEIA 4RZXA 4FI3C 3QBVA 2WWXA 4PPNA 1YHNA 1KZ7B 3IHWA 2QMHA 1VG8A 2FF7A 3CNNA 4KVAA 3WNBA 3X1ZA 5FI0B 3QF4A 1F5NA 4TLAA 3RRMA 5F98A 4MRVA 1XMSA 4YMUA 2ZI6A 4PHGA 5ANRB 3VU9B 2NPIA 2ZRHA 3QQ5A 4TTRA 4M8NE 1QRAA 4A2PA 1N0WA 1F6BA 2XXAB 3NVAA 4GNKA 1KK0A 4E07A 1RYFA 3EG5A 4GI7A 3TIFA 2P65A 1GZSA 5L3RA 2FZLA 3HYRA 4AYTA 4HI0E 1YR7A 1M34E 5E7MA 2P5SA 5FR2A 1N0VC 4DLSA 4C4PA 2ONJA 1X1RA 3AP3A 3IPXA 4MUBA 4HUTA 4FWIB 4KSCA 1CBUA 4DLTA 5GJVC 2F43B 4M1KA 4PC3A 5JJLA 4Q9KA 2R8RA 3O8CA 3IILA 3CPJB 3KQUA 4PANA 2PMDA 3OEHA 3EWSA 3QKRA 4K46A 1E2KA 1KO5A 4PSVA 5FOVA 1GM5A 2Q6TA 2VH5R 1E1QA 4LSGA 2JJ1D 4DEYA 1P73A 3A4MA 2DFKB 2GXAA 4BASA 2O0JA 2J7PA 3B8HA 4F4CA 2ORWA 3NG1A 4LV5B 4BFUA 3PUVA 3NH9A 4UQOA 4ASUD 2QAGC 1Z6YA 4LBYA 3KXIA 4C0JA 3I5XA 4KI0A 3KL4A 4MH0R 1O87A 4JLPA 1ZNWA 3L8YA 2PCJA 5CYPA 1YZTA 3DHWC 1ZP6A 1QHNA 3WYFA 3FFAA 1CKEA 2G6BA 1IBRA 1YQTA 5B30A 1Z0JA 4DJTA 2IXGA 5FTJA 3L2OB 1KDPA 2C2HA 2GZHA 2W0MA 3IPYA 1TADA 5DN6A 4PQFA 1T5LA 4B76A 4ESHA 3PG5A 1W49A 1I4DD 3LQQA 4S35A 2PH1A 1WP9A 3ZQJA 3AVOA 3D8BA 4DLXA 4LBVA 1YRAA 1LTQA 1QHHB 4QOSA 1R10A 4MKIA 1KDOA 2EFGA 3KJIA 2ZTSA 4QGHA 3B9PA 1U0LA 3Q8XB 1IONA 5KOYA 3B1ZA 3THYA 4Z1MA 2VBCA 2QQEA 4CEHB 1G7RA 4Z54A 3BWDD 4CGZA 4NDZA 4CEJB 1AZTA 1S3GA 3R9IA 1RW4A 3OESA 1E32A 3GLIA 3DDCA 5TVKA 2O8FA 2BBOA 4M9QA 4Q66C 3PXGA 5H8WA 1A1VA 1UEJA 1W2GA 4M0LA 5L3SB 1W0JD 2RGNA 5EE0A 3VAAA 1KYIA 3FVQA 4C0AC 4ZCIA 2N1BA 4NONA 3LA6A 1L4UA 4I1VA 3TVTA 5GJBA 2A5JA 1X1SA 5SZJA 2CCGA 1E2FA 1Z63A 3P27A 5EE9A 3SE0A 4IVQA 3KKNA 3MJRA 2W58A 3KZ1E 5CLLA 3LQRA 1FOEB 1YZKA 3KQHA 5C46F 2OLKA 5KTYA 2E9SA 5KO2A 1N25A 2IYZA 2ZJ2A 3WRYC 2LWIA 4YQFA 4O0MA 3HPRA 3W6NA 3A4LA 2ZRBA 3B1YA 1NIJA 1JAIA 4XWAA 3K0FB 5SZKB 2ZI9A 4ZDIA 5JCZA 4TT3A 1MV5A 1KSJA 2XZOA 5FOXA 3EPKA 4GDFA 1KMHB 2WMOB 4HB2A 4CVNA 4AK9A 4DUGA 1G7CA 4FMCB 3BFXA 4PPGA 1YR6A 3HJNA 2QN6A 4UNSA 2ODNA 4QHYA 4HLCA 4NL4H 2YWGA 3OE7A 3SBEA 1R6BX 2V55B 1VKJA 2F1JA 5LPNA 2HYIC 3AGQA 3QE0A 2BBTA 2Q9CA 1OIWA 1ZIOA 3CB4A 3GJ8A 4NBSA 4NYIQ 5IT5A 2HF8A 1OSNA 4A82A 2IYWA 2ZAMA 2OLJA 3BRWD 1XTQA 3RS7A 4QHTA 4ABYA 3LLUA 3ZQ6A 3M0EA 4WW0A 1TQ4A 3TQCA 3C8UA 1XX6A 2ZE6A 2VP6A 3QG5A 4TQAA 4AKIA 3RS2A 2QZ4A 2ZU6A 3AGPA 1E9AA 3E5HA 3NKVA 5HZKA 1MO5A 2OEPA 1WQ1R 3PEUA 4OQLA 1LY1A 5KNCA 3AVUA 2CJWA 4CDGA 4Q9HA 3K09A 2OILA 1AGRA 2A5YB 4ZDKA 4A0HA 2FA9A 1Z22A 2ZIAA 1AQUA 4Z1MD 1CULC 2BHRA 3AVYA 1HT2E 2WHXA 2DWQA 1AS0A 3BB4A 4LJ5A 1MO4A 1DADA 4RKFA 4GZMA 4TQ9A 4Q9IA 3BB3A 3GEHA 4IOLA 3RRNA 2GJAA 3KTAB 3CPHA 2G77B 4BLOA 4X8OA 3ZH9B 3VHXA 1XEFA 3X1WA 2GK6A 1DAEA 5KDLA 1N0UA 1E9RA 2CEAA 1V5WA 1C4OA 2DCUA 2J59A 2W83A 4RFSB 5EUMA 4CIDA 2OCAA 2ZRMA 4HZUB 2BDTA 4PC6A 5EZ6B 4PHFA 2GZDA 5SZIA 1ZD9A 2VSOA 3HP1A 1XTJA 3FOZA 2JJ2A 1UFQA 2R9VA 2I3BA 3THWB 3WYAA 3NBFA 4WZAE 2Q9AA 3KTAA 1AK2A 3L82B 5AUNB 3TK1A 3HU1A 4ACBA 3ZZTA 3VNUA 1G6OA 4ZI2A 2VO1A 1P2VA 4DSTA 1Q1BA 2ZYUX 4UXHA 4A8JB 3OZXA 3ONWA 1CU1A 3B1WA 3GJ5A 4LK2A 3WYGA 1NRJB 3AUYA 3TH5A 3CRQA 4B32A 5CB6A 1TL7C 2CMKA 5CK4A 2BJVA 4RCYA 5JEEA 2JJ8A 3AVTA 2VQSA 4Q7LA 4BQSA 3WBKA 5J40A 3EWAA 3SJCA 4II7A 3AM1A 1XCPA 4IDHA 1GOTA 2O8BB 4DRZA 1S1MA 3IEVA 1E9FA 1MABB 3NHBA 1DAGA 4BEJA 3I8SA 1JPNA 2CLDX 2IS1A 3AF4A 3IBYA 1DAHA 2PX3A 5J4LA 5JRZA 1N5IA 4BLPA 1G20E 1GWNA 1U99A 4P3YA 3RSLA 1RIFA 3TRFA 2QROA 2WJGA 2ZI3A 3WBJA 1ZCBA 2QBYB 2ZJOA 3MWKA 4HSEA 1G8FA 3GJ3A 4BLTA 2YWHA 3HYTA 3QIAA 2FV8A 5BYJA 1T0HB 2FG5A 5SZHB 4L9WA 2ZRAA 3PVSA 2YC4C 1CRQA 1HV8A 4XOIA 4ZDJA 4A36A 2ZE8A 1KAGA 1KNXA 3ND8A 2HUPA 1VIYA 3Q85A 4V0NA 2C04A 4XJXA 4B3DA 4TL7A 2ODBA 5TB5A 3UK6A 1II0A 1CJTC 2GVDC 1FUUA 5HE9A 3NEJA 2C95A 2OBLA 3DM9B 4LC0A 5EP1A 2O8CA 1T3SA 4Y0AA 2H16A 2MMCA 3L0IB 2RHDA 2FH5B 1OV4A 3Q7PA 3QOFA 4BGDA 3PFIA 1XP8A 1GRRA 5FBVB 3S1AB 3V4FA 2F6RA 2CBZA 3T34A 1E69A 1YKSA 3ICQB 4F91B 2BC9A 1B0UA 1J90A 1A5TA 4MGYR 1GFIA 3TQFA 2WZQA 2XEXA 3GJ6A 3QPUA 2OSBA 3X1XA 3WRXC 4OHYA 1EFRA 2JLXA 5FTMA 1SVIA 1Q21A 2A5GA 3ZVMA 1NVWQ 4D82A 4ZIRA 2OESA 1GL7A 2IK8A 1XJ0A 2IYRA 1S9DA 3ASZA 3EIHA 3F0TA 3OFNA 4V02A 3GLFB 1OPXA 1ESNA 1FQKA 3K70B 3CR8A 4C2TA 1DTSA 4URWR 1OXXK 4B73A 1I2DA 3VR3A 1CJVC 4FMCF 4DLRA 1Z6XA 5JSZA 4URVR 5M04A 1BOFA 1II9A 3V00A 3GLIB 2QE7A 2WVJA 4AC9A 3CLVA 3NBXX 1L4YA 3QF4B 1ZD1A 4ZIRB 4JKIA 2XTNA 2OFXA 3UIEA 5GJCA 1DAKA 3KKMA 1DAFA 3OAAA 1IAQA 3HR7A 2YOFA 4M1SA 2VA8A 3GLFE 2F55A 3I4LA 2HT6A 5A4JA 4GOJA 1WB9A 2IF2A 2RGGA 2WAXA 4C7OB 5AUPB 3MUFA 2IUUA 4JT2A 3UATA 8OHMA 2QT0A 1T5IA 4O2LA 1N5LA 2DHRA 4MGIR 1KZGB 4PZYA 1NG9A 3B82A 4JLVA 2O8BA 4TYWA 1C9KA 2DYKA 5GJWC 4G0NA 2JGNA 1R2QA 3SEAA 3FWYA 4TTQA 3GLGB 1BMFA 4OI2A 1QBKC 2FMXA 5J47A 1P61B 1SZPA 4LHZA 3BC1A 4TMWA 4E03A 2ZSEA 4Q01A 2GJ9A 3VMFA 3CX6A 1D9XA 1ZJ6A 3A1SA 2MSDB 3EAQA 1W4AA 4YLGA 1YZQA 4HUQA 2JLRA 2R6DA 1Q3TA 3T5DA 1A7JA 2Y8EA 1P5ZB 2IT1A 3BFVA 1GL9B 4FMBB 2XTZA 2J0SA 1JR6A 1H8ED 3GLGE 1XZPA 1N6NA 4QG7A 3AVPA 4TL8A 1T6NA 5FUVA 2LCFA 5LBIA 2ANCA 2HDNB 2JIZA 4MRPA 5CIWA 1Q12A 2FSGA 2IYTA 3HDTA 3K70D 1VCIA 2LKCA 3BH6A 3HU3A 5E4FA 2IS4A 1Z47A 4EJSC 3QKTA 2ATVA 1DE0A 4OK5A 2VP5A 5DN6D 1RRPA 3EASA 3ADBA 1W2HA 4Q9JA 1D5CA 2ZUBA 3EZ2A 3LVRE 1VYUA 5A5GA 2N42A 4X8HA 1G3IA 4ASUA 4JLDA 2J0UA 4WAUA 3L8ZA 4LBWA 4R2IA 2JCSA 1VCMA 2OFWA 2QPAA 2GNOA 4Q1EA 2C98A 1OF1A 1R0WA 2HLDA 3CR7A 1E9CA 4HLUC 4ZKDA 3VX4A 3AUXA 2NGRA 5L3VA 2H17A 4DCVA 1LNZA 2A5FA 3QF7A 1UADA 1G17A 2IUTA 2G9NA 4LHYA 3ZIAD 3W6PA 3VU9A 1TUEA 3HU2A 4MKHA 2CHQA 5BWMA 4DB4A 1R5OA 4ZPXA 3IIJA 3P20A 121PA 2OZEA 1G64A 2R62A 3RS0A 1DG1G 2Z4RA 3SBDA 1IY2A 1OXUA 2YJTD 2OCPA 2FGKA 4B2LA 1P72A 3KKPA 2P6RA 4UXJA 5FBRB 2FEMA 1U98A 3AVWA 1T8UA 1AA9A 3WXMA 4GT1A 4A2WA 4F4JA 4NU0A 3ADDA 1P75A 1V43A 3M6AA 4V0ME 4WBSA 1WBBA 3NHAA 2WICA 1QHGA 1FMJA 2HJVA 4BFTA 3T15A 3GLGA 2C9YA 3N2EA 3PCRB 4O25A 1P3JA 4NYJQ 4DC9A 3PV0A 4GPTA 4F93B 2GEDA 3PUYA 1P9RA 2AX4A 4YMWA 1Y3AA 1G1MA 1GUAA 1P62B 1VCOA 3D6TB 5BN3A 1OFIA 2WM9B 4JT4A 1HUQA 1DBSA 3K70C 1VG9B 4JMPA 3U2QA 1G5RA 1ZNXA 2RMKA 2V1UA 2D7CA 2WKRA 2E87A 1KI1A 3QEJA 1P2UA 3Q5DA 1DO2A 1G8PA 1OH6A 4D0GA 5CJ2A 1GNRA 2ZSBA 2AWNA 4B75A 3AV0B 1N6OA 2EFDB 3BORA 3JVVA 1IXSB 1A82A 3A36A 4AURA 4RY2A 4MKGA 1NG1A 1AKYA 4JJKA 4UJ5A 2WJIA 4RD2A 3PENA 4XD7A 1W4BA 1ZIPA 1AN0A 1Z2CA 4I1SA 3ETLA 5FPTA 4TYYA 3VNVA 1NF3A 4Q4HA 1JXMA 1SVWA 3K0FA 1TTTA 4KLNA 2J41A 3B2EA 2GHIA 2CHVA 1OHHA 3THOA 3W3AA 4KFRA 2RGBA 1EWQA 4OQMA 1EG7A 2CXXA 2Q21A 1VG0B 2GCNA 1G6HA 3MWJA 4QGAA 4XH9B 1VIAA 3FE2A 3NC1C 1HH4A 2EW1A 4Q4AA 5FFMA 1F2TB 3TNFA 4AD8A 2OUKA 3LW7A 5JWOA 3KQLA 1ONBA 3THXA 1IXRC 5TDHA 4S2EA 2GF0A 4FMDB 4W5HA 4IFBA 1TX4B 4QGFA 1IY1A 2ZRIA 2IYUA 2YOHA 4MYUA 1E2MA 1G3QA 1GILA 5F2EA 1N5JA 1U81A 2HXYA 2C9OA 3MJHA 3AQ4A 4B48A 4DEXA 1OYWA 1GKYA 2GAAA 4NHOA 2RGXA 4LJAA 3C7KA 4IFEA 5B57C 2FE4A 4LYHA 2GESA 1K8RA 1SXJA 1NNEA 2FU5C 2PEZA 1OFTA 4L9SA 5D3MB 3R8CA 3Q72A 2J0UB 3WY9A 4DSNA 2JDID 3T1VA 3S1AA 4A2QA 1TF7A 3KUCA 1ZD8A 3MLEA 4TMTA 1M6NA 4H1UA 4P4SA 2GCPA 3EZ9A 4BPBA 5JECA 1Z08A 4D25A 1UKZA 4D4KA 1IN5A 4PC7A 4HAXA 1JJVA 4HLDA 3QXXA 1MABA 1ZMXA 4N1AA 4L16A 1E4VA 3AP1A 2V8OA 3VR1A 4BFXA 1VDZA 4M1OA 4B2PA 1ZM2A 2V9PA 4P4SB 4DB2A 2F43A 1DS6A 2R65A 4IXNA 1WCV1 2NMVA 2EFEB 4WXPA 3EPHA 3IKJA 1RE0A 2H92A 1E2DA 1OH7A 4L15A 1MKYA 1KOFA 3MRSA 5AJYA 1KY2A 3LX5A 4TLCA 1NLZA 1GITA 2I1VB 3CF2A 1LVGA 4WXRA 3QSYA 2ASEA 1IQPA 1LS6A 3F3YA 1NSTA 1R7RA 3K0AA 1M74A 3EZ7A 4ZCMA 1LF0A 1Q57A 3SR0A 4IW3B 4XD7D 4TYQA 2BEKA 1R4AA 2WJYA 1UPTA 2XJ4A 3SYLA 3V9PA 1DOAA 2WSSA 3LBNA 2FPLA 2NO1A 3GQBA 3LW8A 3WMEA 5H70A 3PEYA 1ZM7A 4RD0A 3U7HB 1E2IA 4G01B 4LDJA 4DZZA 1DG3A 1II8A 1CJUC 3I72A 5E3HA 2ZJAA 2XX3A 4UNRA 4D4LA 1JXOA 3H84A 4JYCA 2BM0A 1NSFA 2ZEJA 4P4TA 2BM1A 2Q3MA 4TYNA 2WWYA 4GOXA 1Z0DA 2YWFA 2O52A 2YNMA 2G83A 4JIMA 4JBWA 3CZPA 2FFHA 3FB4A 3K9HA 2ZREA 4YDSA 5AJVB 4HDQB 2P6NA 4FWTA 1HEIA 4DXAA 4EQ6A 5JS7A 3UMRA 5C4GB 1RC8A 3TUIC 1E4YA 3WNCA 4DSUA 3I73A 4IVRA 2OBMA 1CR4A 1Z29A 4RZ3A 1E0AA 4BECA 1G7SA 1PUIA 1RKBA 2CLCX 3T12A 4D4JA 5DI3B 4ZO4A 1G8YA 4BRWA 1VYTA 1RVDA 2AFHE 4LJ7A 3V4RA 4G5SA 4MGKR 4XIGS 2VHJA 5H1YA 1QVAA 3IHLA 5GVSA 1Q20A 1G19A 2QE7D 1QHSA 1NL3A 4LYFA 3B78A 2D2EA 4RD1A 3SZRA 4M1WA 5B58C 2CJWB 3LBHA 1NN5A 4GFDA 1JNYA 2IXFA 4PC1A 5AWFC 2VHUA 2NZJA 1D8TA 1VHLA 4PQRA 5G41A 2QM8A 4TQUS 4LJ6A 1NJFA 4M2LA 3LLMA 2HYDA 3FPAA 4LY6A 1FMLA 1T0JB 3GFTA 1BS1A 4PSAA 2IS6A 1N5KA 1I4LD 4LPKA 2IYYA 2AD1A 1E0JA 3PR1A 4PPFA 2EYQA 4B43A 2YV5A 2V7QA 3RSOA 4NP6A 1P9WA 1F2TA 3THXB 2WBLC 5KPJA 5L3QB 4XTRA 1GL6A 1W7AA 4PAOA 2FFAA 1XJCA 2KBEA 2OG2A 4M4SA 3IEUA 2RH5A 1K5DA 1W4CA 1J70A 5G53C 2CK3A 4DDWA 3KKQA 1G21E 1ANKA 3IUYA 1P9NA 2B21A 4L5BA 1E0KA 3ECCA 5FTKA 2ZXUA 1P7CA 4M1TA 4D0NA 1N3BA 2PZEA 2C8VA 5FOTA 5TV2A 1SKYE 1COWA 1XEXB 1FFHA 3X1DA 3BE4A 1L8QA 2WSSD 1OFHA 5J5CA 3B9QA 3TJZA 4OI0A 4HDOB 4AWXA 221PA 4QC2A 2JLYA 4YMVA 2ZI5A 4JYBA 4C7OA 1XXHA 4KCGA 3W5JA 4KITB 3GLIE 4HUQB 2VPPA 4AG6A 2GJKA 4KJZA 4FW9A 5HKKD 4NCNA 3GLHE 1VYVA 4RZUA 1D2NA 3ZLJA 5C18A 4GP6A 1KI2A 4IKEA 4Q5IA 1MO6A 2Z6VA 4HZIA 4QBHA 2ZRPA 3A4NA 3MSXA 4A8JC 4HATA 3EPLA 4URZR 4A6XA 2Q3HA 2OO7A 4I81A 1FTNA 5DGXA 3FHOA 4TMKA 4B34A 2G3YA 3CM0A 4IRUB 1XJQA 2ZRJA 5AR1A 4QBGB 5KDOA 4BFWA 3NDPA 3LBIA 4Q9LA 4PZZA 4BFVA 1GKUB 1UJ2A 3FTQA 4NCHA 4TL9A 1OYYA 4JLAA 5JRJA 1TEXA 4M1MA 4CW7A 2QQ0A 2KE5A 3C14C 3AKYA 2V6IA 5FUYA 5EP2A 2G0TA 5G40A 1G8HA 2WTUA 1U9IA 1SXJC 6Q21A 4CEHA 2F3TA 2IX3A 5EE1A 4W7SA 5JBQA 3UPUA 3RC3A 2QSZA 4HLQB 5KNDA 3QXHA 1TF5A 1TQ6A 4IXMA 4YMTA 2XZPA 3DMDA 1QHHA 2BMFA 2QG6A 4L8GA 4TN1A 2REBA 5KYKA 2I1QA 1SVLA 3LV8A 2AR7A 2HJGA 1ETUA 3FKSA 3L43A 4BZPA 4GSYA 3IIMA 4BEBA 2HLDD 3RYTC 1CR1A 1XMVA 4Q1CA 4Z8YA 2Q0HA 1E2GA 4UJ3A 4HB3A 1NN3A 2ZU0C 2BMDA 4LGMA 1T8TA 2V7QD 4LOAA 4OHWA 5TY0A 3TLXA 4BFSA 3ADCA 2QRNA 3U7GA 3PUZA 3A1VA 2PLFA 1KO8A 4BZQA 1XF9A 2Z83A 4R2HA 3SNHA 4C3ZA 1NKSA 2Z5FA 1KO1A 1KJYA 4G5RA 3NC0C 2JA1A 2G1JA 4G3XA 4OKSA 3CF0A 1OB2A 1QF9A 2YOGA 1U9IC 3BS4A 2WWGA 1FX0B 2A7QA 1W1WA 4DIEA 3H4MA 3CNLA 1E6CA 4I99A 2D4HA 2XNDD 3I32A 2BMEA 2BOVA 1CTQA 3LXXA 3MD0A 2AKYA 4EPXA 4B35A 4V0KA 5BYKA 4GL2A 4HDCA 1E2JA 2ZS8A 4OQNA 3RDPA 3Q7QA 3U4QB 5IHPA 3DMNA 3LVQE 1OJLA 4DCNA 4JZKA 3G82C 2VHCA 3TSOA 4QJ3A 1QG4A 1X86B 2W6ID 3BH7A 2ONKA 2YVUA 3FMFA 4US0R 1HY3A 5HKKA 3ADKA 5KSYA 5EE3A 4C0SA 4LRWA 2NO0A 2YWEA 3CNOA 3K0CA 1QHXA 4ZKEA 2WSMA 2P67A 3FHCB 1JB1A 2ZSFA 2H7VA 2HCBA 3VR4A 4DLYA 4DT1A 1R0ZA 2QA5A 4B47A 1YRBA 4PQYA 5EP4A 1ZRHA 3QG1A 3VR5A 1NLYA 3CPEA 1W0KD 2QORA 4IDQA 1FZQA 1M7BA 4CT5A 4JL6A 4JL5A 2G88A 3P1JA 3QKUA 3X2SA 2VSXA 1KK1A 2VIIA 1EFTA 1N6LA 2GXUA 2QAJA 1WE2A 2VYFA 3RC8A 1NMYA 1SVKA 1B23P 1E2QA 4XWKA 1TF2A 1YJ5A 2GZAA 2MSEB 4BLSA 4C0LA 2GCOB 3EC2A 3CBQA 4IVPA 3RANA 5FH9A 3CWQA 4JBXA 4EDHA 2AXPA 5TARA 3PITA 1US8B 1G3MA 2O8EA 2WJVA 1X6VA 5EP3A 4QNMA 4LHXA 1ZUNB 3PIRA 1TEVA 2DBYA 2ZYTX 3I8XA 3FMOB 4LUCA 1G4UR 3VR6A 4RFSA 1R5NA 4WOPA 3FDIA 1NJGA 1KI6A 4A6PA 4DHEA 5ELXA 3T1OA 1SQ5A 4A1FA 4Q1BA 4XWOA 5KHOC 4C9BA 3REFA 4NYJR 3C16C 2XZLA 3BIFA 4G5OA 4TYPA 2WWIA 5UKDA 4URXR 1E2NA 3NIBA 3ZS8A 2JJ2D 3GCGA 1W0JA 3K8YA 2XNSA 1Q1EA 1XPRA 2CL0X 2DB3A 4GRAA 2XNDA 2NO9A 4MRRA 4EJSB 1Y63A 3Q3JB 4RD4A 4PTLA 1GAJA 1LB1B 1SXJB 2NTYC 3KJEA 1SVOA 1N6HA 3RLFA 3D7MA 1MOZA 3CKLA 3F5FA 1Q3HA 5BXQC 4LYJA 2QT1A 3N5CA 4PAQA 2DWPA 2IWHA 1H8HD 1Z06A 5J4VA 3KQKA 3RAPR 4KV9A 4H1VA 5LD2C 3Q5EA 5AJXA 3JZMA 4DDTA 3GJ0A 5JMTA 1BIFA 4UNNA 4OQXA 1G7TA 5C2JB 5GADl 1U2RA 4EPWA 2GJSA 1EWRA 4TMXA 1SXJE 4WZ6A 1DVRA 4IEEA 4QHSA 1GTVA 1G41A 3LO5A 4A8JA 1UM8A 4DLUA 3GJ4A 2ZS7A 4JLKA 2WJJA 1EX6A 4XTCS 1U0HC 1VPLA 1F2UB 1JR3E 4B3FX 3RHFA 3CX8A 5BN5A 5EZ5A 1PVOA 2ZPTX 1YU9A 4DDUA 3D31A 1KMHA 3SQWA 4JVNA 1HE1C 3WHLA 4V0OA 3TBKA 2AN9A 4QNRA 3CRRA 1IXZA 2X77A 1VHTA 1UF9A 4EQ6B 1HT1E 2FEOA 1JJ7A 3OIWA 4H9GA 2GJ8A 5DISB 1YVDA 4AKGA 3CONA 1FNMA 2R6GA 2NQ2C 2QTFA 1Z07A 1JAHA 1U0JA 2BBWA 2KBFA 5IK2A 3IDQA 2JAQA 1W36C 2B7CA 4KSBA 2ZROA 3ZJYA 3F8TA 1XEWY 3ZZ0A 5JLJA 5EXSA 2CCKA 1OIVA 2GA8A 4HAUA 4FN5A 4A0RA 3KKOA 4FCVA 2HT1A 1HYQA 4FD2A 2X1VA 1O3YA 1ZYUA 1E79A 1DPFA 3MFYA 4JLNA 4OK3A 4PXAA 1OKKA 3KJGA 2G1KA 4JVMA 1XDBA 3BAFA 4Q1DA 5JS8A 1XD9A 3ZDQA 3AKDA 2CL6X 2GTPA 5EQTA 2RKOA 4DDVA 3SU8A 4LV8B 1R0YA 1KK2A 4EPVA 2N46A 4YONB 3JZAA 3O8DA 1GSIA 2HXSA 1TMKA 1FQJA 3KB2A 3NXSA 2FX3A 1KSGA 1OKKD 4A0GA 1LFDB 5FUWA 4WIAA 2X19A 5JWRA 4QFMA 2QNRA 3IIKA 1GVNB 1W46A 2OAQ1 5FPKA 3R9XA 1ZNYA 5JI2E 3HWSA 3DOFA 2O0KA 3QUSA 3IO3A 2OCBA 1RZ3A 3KXLA 4CF7A 1AJEA 3OAAD 4RCZA 1M1YE 3WMFA 1JR3A 4A0FA 1FP6A 2A2ZA 4EAQA 3H1TA 4Q03A 3QNUA 4WA7A 2JLZA 2VP9A 2J1LA 1F3OA 3DPUA 1XZQA 5KSPA 3T35A 2PT5A 2YZ2A 2Q9BA 3LY5A 1HQYE 1E96A 1K6MA 3QKSA 4A92A 1M7HA 3K0AB 1ODFA 1NKTA 4LZZA 4DSOA 2PJZA 2FNAA 2PEYA 3NWJA 4LCBA 1S2MA 2R6FA 2QU8A 1KO7A 1IN4A 2KWIA 4KU4A 4OK6A 4AKHA 4A9AA 2QUZA 3A58B 3KDSE 4QM6A 1F2UA 3A8TA 3W5IA 1AKEA 2FZ4A 1E94E 5FBQB 4DCTA 3BB1A 4L4UA 2WWWA 1QG2A 4EJSA 1UBFA 3TKLA 1S9HA 4HLUA 1MT0A 2J3EA 1ZM3A 4ERNA 2FSIA 4B3BA 2OXRA 4NCKA 5FTNA 4JJZA 1OH5A 1AS3A 5G3ZA 1W47A 1E2LA 2QP4A 5BQ5A 1PLLA 2D2FA 3WP0A 3CO5A 2IA5A 3SYKA 2P6UA 2WPDA 4OJQA 4PFSA 4TL6A 1JQJC 5DO9A 2R6CA 2ODWA 4IOKA 2WIBA 4JLJA 4EIWA 4F92B 4TTPA 3RRZA 2QMEA 3RVBA 3N70A 1J8MF 2V4ZA 3AF3A 4LJYA 5CDFA 4YC7A 1SULA 1XTRA 2XB4A 2Z43A 3W3ZB 3U6BA 1GRNA 2BBSA 3QY0A 4G5QA 4IJMA 1VCNA 2D06A 3MWYW 4GP7A 4JBYA 1E79D 4OHZA 5EXPA 3L0SA 1N6RA 3UANA 2OXCA 5FL3A 4ZV4A 1ESMA 4HB4A 2VTKA 2JIZD 2OT3B 3Q9LA 2X2FA 3I3SR 3U44B 4XSGA 1SKYB 1XTKA 3GP8A 2A3RA 5K8UA 1S3SA 4E09A 4RD3A 2OFOA 4EPYA 1TU4A 1CR2A 3SI7A 5DI9A 3QXJA 4B3CA 3FKSD 4IDPA 2QSYA 3H2YA 2G0NA 2HF9A 1X8KA 4TLDA 3ZVLA 4IDOA 3PEVA 5BN4A 5DHAA 3OIVA 4GZLA 2B7BA 4E22A 3CW2A 3GLHB 4EKDA 4B6EA 1XFAA 1CIPA 3I5YA 1RJ9A 2H1LA 2IXEA 1D6JA 3RWOA 2RGAA 3IQXA 2RHMA 4W5WA 3NTUA 1QHYA 4HYYA 3CWZA 3NBYC 1HE8B 2Q3FA 2WJHA 621PA 3HPQA 3KFXA 2D7DA 1GRQA 3SOPA 2F9LA 3VHLB 1YZGA 3TAUA 1UDXA 4HZUA 2ZETA 3ZIAA 4JKYA 1KI3A 4ZDWA 3ZZUA 3BD9A 5IF9A 1NI3A 4P4UA 2A5DA 2ZJ8A 1G9XA 4P32A 1D9ZA 2F1HA 2CLSA 1UAAA 1JBKA 4M9XA 4Q48A 5DSZA 2ZQ5A 4TSFA 5P21A 3K9GA 2CK3D 3GFOA 3TR0A 3U61B 2ECKA 1ZNZA 2XAUA 2OE2A 1LS1A 2H18A 4ESVA 3REGA 5AJWA 1XEWX 3QVUA 4TSFD 5A0FA 2W6IA 2WMNB 4HAWA 3U3JA 3U5ZB 3R9WA 3VKHA 4TMVA 2BKEA 4TZ0A 2REOA 2QBYA 1Z6TA 1EGAA 1EFUA 1P2SA 2R6AA 3EA0A 2V54A 1TQDA 2ZRGA 3A1WA 1PLKA 3DM5A 3P26A 1TAGA 2QGNA 2UZIR 4P0TA 5FPHA 2YYZA 1ZU5A 4MITA 2YHSA 5EUQB 5FBWB 1CF4A 3PQCA 1XEXA 1R8QA 5K8TA 2J7KA 1C1YA 1D2EA 1GG2A 2RGNC 4AYXA 4IDNA 4EPRA 1ZUHA 3TSWA 4C0KA 4W5JA 3K0SA 1W0KA 1NBME 4Q02A 5CJPA 2X8AA 2IBMA 3HR8A 2JLVA 1OXSC 2CNWA 1X8LA 2ANBA 2ZE7A 2W6JA 3EW9A 2CHGA 1CRPA 2H57A 4Q00A 4W9MC 3IBGA 1NP6A 4DCSA 3DZ8A 2GXSA 3C15C 5HCIA 5B64A 4MDEA 3AKEA 1NVVR 1TUIA 3RS5A 4C30A 2ZRCA 4KFUA 3TW4A 2IS2A 2PL3A 2C77A 1E2HA 4JSTA 2CNWD 1H65A 2FJUA 5HTKA 2W6JD 4G1UC 3AH8A 1E1QD 1M2OB 4LJ8A 5DHFA 2QGZA 5K8IA 3BJIC 5CB8A 1N6KA 3VTKA 4P33A 4BWYA 4OI1A 1HA3A 4KYIB 1YZLA 4JLMA 4JVSB 1XNJA 4Q1AA 5KSZA 4POAA 2OHFA 4K81B 1I2MA 2CE7A 4Q4JB 4F38A 3BOSA 1ZUIA 4Q4AB 2MSCB 3O47A 2W2VA 4QJ4A 4OHVA 1KAOA 2QAGA 5JHGB 3TMKA 2AFIE 5J4HA 1FW6A 2QMOA 5FTLA 1IN8A 1T3HA 1FP7A 1G8GA 4KODA 3PUXA 1F48A 2TMKA 1WF3A 4IOMA 4DLWA 1XRJA 4KFSA 5FI1B 1DELA 1ZBDA 3DZDA 3QENA 1IJFA 4TLBA 1VECA 1G291 4BFYA 1KJZA 4CT4B 5FPYA 2AD5A 4QJ5A 4HEJA 1XCMA 4HB0A 1Q1ZA 3FMPB 3EIEA 3FGNA 5FL7A 3EA5A 1W5TA 3OEEA 1Z2AA 1MO3A 3L0PA 3X1YA 5DYIA 5JCPA 1KI7A 4X8MA 1SXJD 3DEFA 2O5VA 2GF9A 2GEVA 5FOWA 3B1VA 5HCNA 1S8FA 2BEJA 2VEDA 3GPLA 1WRBA 3N2IA 2V3CC 1OFUX 1UBEA 3SFZA 2C78A 2YC2C 5EJEA 4Z51A 1S96A 2ZI4A 4AG5A 4DVGA 4YDHB 2OAP1 1CR0A 1ZM9A 2UZ3A 4PAMA 2F1IA 4Y0VA 3OIYA 2DFNA 4K8OA 1BKDR 5E7JA 4US2R 1IN7A 2BIFA 2ZANA 5JSZB 1K5GA 1ZC3A 2BCJQ 3UWOA 4A4DA 2C03A 2FSHA 1GIAA 4XSHA 1P4SA 1NMXA 2IYVA 4HAZA 3AKCA 3AP2A 4MRNA 4BRUA 1BO6A 1J2JA 1N6IA 4C0HA 4G5GA 2D3WA 3B6EA 2ODEA 2O8EB 1KO4A 3K0EA 5EXTA 2CDNA 3P32A 4QKQA 2C9CA 1P2TA 2A30A 2NG1A 4RVCA 4D0LB 3CUEF 3J81k 1XCGB 3LD9A 1EX7A 3MWLA 3TE6A 1G18A 3E1SA 3B13B 1ELOA 2ZAOA 3KFVA 2BV3A 2UVQA 1OHHD 2XOKD 3MG9A 3C5HA 3VQTA 2J87A 4DUGD 2ZJZA 1A2BA 4EFMA 4PHTA 4PZLA 1KKMA 1D2MA 2B6HA 4N3NA 3IO5A 3RS3A 1OLOA 4PHHA 1MRNA 1R8SA 3M4YA 4KVGA 2O8FB 3KUDA 2AWOA 1U8YA 5CIQA 3CH5A 4KYUA 1PV4A 2W00A 2GDJA 2PBRA 4D80A 1VG1A 4JLBA 1XU4A 1US8A 3LFUA 2ERXA 3FHTA 2JLSA 4JS0A 1XXHE 3P4XA 3AVQA 5TMPA 1G3UA 3QPWA 1J8YF 1UDWA 3TSZA 4Q7MB 3WMGA 4MUAA 3U4QA 2XSZA 3U44A 2JLUA 2PMKA 4GMXA 1XTIA 3MAAC 3QKRB 2UKDA 4LC1A 5FL7D 3CIOA 2WWFA 3OEED 4OBEA 5L3SA 2R44A 4HAYA 3CRW1 2KSQA 3FYHA 4QBIA 2XJ9A 2VHQA 1EFCA 3TVDA 3O8RA 1OXVA 2EFCB 3TUZC 1UBGA 4YXWD 4MYTA 4C0QC 1ZVQA 3KXKA 4FIDA 3FFBA 4U02A 1Z83A 5IRCD 2R2AA 4CEJA 1RFLA 4NYIR 1R5BA 2BVNA 3BERA 3DKVA 3BXZA 5K8LA 1QHIA 3R8FA 4D26A 1KSFX 3SS8A 1Z28A 4R71A 3QVVA 3LRPA 4MQBA 2GK7A 4KXFB 4EUNA 3ICEA 1DAIA 3IQWA 4B44A 3C4JA 1AIPA 2ZRDA 3VKGA 5KSOA 1ZAKA 2SHKA 2W2XA 2WKPA 2QP9X 5FR1A 4KAXA 4LV6A 4Q21A 1X8JA 4Q7KA 3KQNA 2QI9C 2XXAA 5E95A 1W36B 4AKEA 5LB4A 3U7FB 5CLQA 1YZUA 2MMGA 1QVRA 1W44A 1KI4A 2IUSA 3D3QA 1E98A 1COWD 3M1IA 2RGCA 4US1R 4QM7A 4PPQA 2EYUA 4RZ2A 2O8DB 5FPSA 1J7KA 2Z0MA 4DT1B 2IEZA 4R7ZA 2IL1A 2ZRNA 2B92A 2CE2X 4MA4A 2WAYA 2J46A 3TGPA 4EFNA 4AI6A 3SFVA 3SHFA 3ZD6A 4DKXA 4QL3A 4R9UC 1KNQA 3W6OA 1L2TA 1BYUA 1P6XA 5DYGA 3B1XA 4Q4HB 3TR5A 2O8DA 1XTSA 4TZ6A 1OXTA 2HV8A 1VMAA 1VTKA 2PZGA 4U7DA 3CX7A 3VR2A 3T5GA 2IYLD 4ARZB 3GEIA 1KMQA 2JLWA 1IY0A 4IOJA 1L7VC 3GLFA 4OL0A 1JALA 4JVLA 3R7WB 1OB5A 3I61A 2DR3A 4PO9A 5CM8B 3AEZA 5KNBA 3SQXA 4LBZA 3EXAA 4OYHA 3E2IA 1T9HA 1F60A 2HEIA 3W90A 4AYWA 4BZXA 4JL8A 3G5UA 1Z6AA 2VSFA 3BGWA 5DH9A 3CRVA 1YZNA 3ZGXA 2GWHA 2AL7A 2J7PD 4MYCA 5FOSA 5JEDA 3AVVA 2J45A 2ZSAA 1Z5ZA 2RGEA 2XSZD 5LDDC 4I4LA 3QXSA 2WIAA 2EVWX 3LH5A 3QPVA 2BCGY 3QBTA 4GBMA 4M53A 3AB3A 2IF0A 2VP4A 5CK5A 5JI3E 2D62A 2ZJBA 4A15A 2RAPA 4BFZA 4TMZA 3SDZA 1OW3B 5E7IA 5L8VA 1W36D 3UXMA 2XITA 1Z0AA 1HQCA 5JWHA 2A78A 5J4YA 4FCWA 2BWJA 3A6PC 4ITRC 1JR3D 1S1CA 1DAMA 2D74A 3PUWA 3W9YA 2C5LA 3U60B 4M9ZA 2QAGB 1DARA 4NMMA 3BK7A 1JECA 4QGGA 2DPXA 1WA5A 1EFRD 2IYQA 5L3QA 1X3SA 2FWRA 3OIUA 4FINA 4TWZA 2GXQA 4LHWA 1UKVY 2F7SA 3ND9A 2QPOA 4OI4A 2L0XA 4MKFA 2XGJA 1GNQA 3OFND 2KB0A 2PCLA 2FOLA 4M9SA 1GKIA 4J0QA 1YE8A 1JI0A 2ZJ5A 4Q47A 2DFLA 2J5XA 3K1JA 5IDVA 1FL9A 421PA 4BLRA 4Q4LA 1W5SA 2ORIA 2ZVQX 4B3XA 1RRFA 4NCJA 4QBFA 5C1BA 2ZUDA 3DL0A 3T06B 2ZM5A 4CEIA 1AM4D 1DO0A 4O2RA 5EXXA 3SC3A 1WBDA 1T4GA 4XVRA 4B6FA 3NBZC 4DLVA 1EESA 1GNPA 4BLQA 1E1RA 4LI0A 1GDDA 2ORVA 4PX9A 2EQBA 1PJRA 3THWA 2WV9A 3LXRA 1KKLA 1XB2A 1KDRA 4CEIB 2FFQA 2JATA 2IHYA 2QEQA 4Q1FA 1CEEA 3WNDA 5B2ZA 1U94A 4RKEA 1Z0FA 5EE5B 4B2IA 1OH8A 2ZVPX 5F9HA 2QMUA 3AVXA 3TAHA 4B33A 1W48A 1NN0A 2ZR0A 4ON9A 2IYSA 4V0MA 4URUR 2X2EA 2DWOA 3DO6A 3TUJC 2QENA 3E70C 2ZI7A 4N0DA 3UG6A 3U6KA 4C0BA 3T1TA 1IOZA 2GAOA 5JJKA 1A2KC 4IHQA 1FUKA 2GBLC 2FPKA 3EX7C 1AS2A 2CVHA 4C2UA 1CLUA 1HTWA 3OE7D 4PC2A 1LW7A 2JEOA 3B5JA 4P31A 4RD6A 2AK2A 4OHXA 1LF5A 1SVMA 2I4IA 2ZSDA 2E1RA 3VFDA 4Q4JA 5FUXA 2QL6A 1S0UA 2QY9A 4ZCLA 4ZI3A 1JEEA 3RS4A 3ZS9A 5HPYB 1IM2A 1MH1A 2VLIA 3EIQA 1N2CE 4PO1A 1ZINA 2VL7A 1NN1A 2ZJYA 3GFPA 3MCAA 4DLZA 1G3RA 1IHUA 1SKQA 1T91A 2A9KA 2ZUCA 3K53A 2P5TB 3U3KA 1ZW6A 2J0QA 5LB2A 3AF2A 1CS4C 2EWVA 3BBPA 3P4YA 2REXB 2XB2A 4PSKA 2EFHB 3W8NA 2GEUA 3EZ6A 3PJRA 3GLHA 1Q1QA 3RRYA 721PA 1CXZA 1BYIA 3LAWA 1KHTA 2ATXA 3BH0A 1Z0KA 1E99A 1XBTA 5TXGA 2HCJB 3A1TA 1EFHA 3EZFA 4BUJA 4M1YA 1JPJA 4KHZA 1TU3A 2AXNA 2RCNA 5DLQC 5FBLB 4D6PA 4WZBE 4F4IA 2H5EA 1KDTA 4N0EA 4V0LA 4X8LA 3UG7A 4KBFA 1XPUA 3EPJA 3NDBB 1U8ZA 3G0HA 4AY2A 4I1OA 1WDTA 4GOKA 3ZVRA 4UNQA 5BW8A 3QJYA 2Z4SA 4ARZA 4QXAA 2BJWA
chains in the Genus database with same CATH superfamily
1MJHA 2C3MA 3EULA 1Z8FA 1ZCAA 4CFYA 3U19A 5JO0A 5IF3A 1SURA 4Q3LA 3F6EX 4IEIA 4K0RA 4HDSB 1T8PA 1FJ2A 1PQPA 3BZWA 2YUIA 3FUVA 2B3DA 3RFVA 2OHHA 1SFRA 3E3OA 4BE7B 1NVUQ 1P2BA 4ED9A 1X7XB 3WGIA 1CJBA 2FPUA 1YA4A 4JYAB 4M9CA 2VRWA 3DOEA 1E1RD 3H2GA 4TM7A 5H9WA 3ZD7A 2J6BA 3OLQA 1QV7A 4K9KA 1AC5A 4XYLA 1SBNE 5KOJA 3EBOA 1H2HA 3IGFA 4UHJA 2Z1NA 4RJIA 4MPJA 5EQFA 2O8CB 2H07A 4F2GA 4YBRA 3WS7A 3KJHA 5CPBA 3H8SA 4LHVA 4BO2A 2GBLA 4XVQA 5JZVA 3MJDA 3ABIA 2FRDC 3LX8A 4HRXA 2ERYA 5FA8A 3ZDCA 5KUTA 4X3OA 2NO7A 5DX0A 2VJMA 4PLWA 4EY7A 5JPDA 2NN3C 3AJ9A 4J2HA 4WI1A 1L4BA 1NVVQ 2C2GA 2ZK7A 2ZYIA 5GVRA 5K8JB 2IH2A 1I5EA 3RNOA 3C6YA 3JSAA 4K7JA 5GONB 2FSFA 1T3LA 4F6RB 1L4MA 2IWRA 3WP1B 2JBWA 3FCOA 3BSYA 4RTMA 1EBBA 2E7ZA 2XHEA 2XZTA 3AI7A 2O3JA 1AGPA 1RJ9B 3N0TA 1XZCA 1CEYA 2CXQA 3IUPA 5ALTA 2VPIA 4KGXA 3ZCXA 1I4TD 1MUUA 2PT7A 5KDDA 1ENZA 2C42A 4DWOA 3RABA 4J1SA 1E5VA 1RI4A 1Z0UA 2IEYA 1JQLB 3BMCB 3N87A 4X6YA 4MULA 4TTTS 3ODGA 4RENA 3L7MA 2OBNA 3ZYCA 3T7EA 5BVHB 1QQ7A 4HRYA 2V0NA 1S4QA 1Z0IA 2ZBVA 3L7OA 1WXQA 5FKJA 4G81A 1VKZA 1AZSC 2PU7A 2QTHA 1E2EA 1JDVA 1FNNA 2ZB2A 3E7XA 3FZYA 1P5JA 1O6FA 1E7WA 1OLXA 1ZJ5A 3GT7A 1Q44A 1YQUA 2YYYA 1DWUA 3LIPA 4Z9XA 4U0KA 3ROFA 2RHJA 4Q0MA 2Z2XA 3H3JA 1Y98A 5E9JA 2OGWA 2ZFUA 4CNBA 3OZFA 3CUUA 4ACAA 4GYKA 5HTOA 5FOUA 2GLTA 4J1TA 2UYHA 3TW8B 5CXUA 1OC2A 3H04A 1M6YA 2P4QA 3GR6A 3KEGA 4MQ5A 1YONA 4FOLA 4F96A 1KIAA 1GCAA 1M8PA 2HAEA 1HQKA 3DEKA 4YAGA 5CFOA 3W4KA 2PLWA 1DJLA 3EARA 4D9EA 4CLOA 2HHLA 4LJ4A 1QFMA 2JRLA 3ZVNA 3ZDAA 1E9BA 4G36A 4INOA 5CVJA 1AUPA 1Z37A 5TPWB 3V4OA 3W34A 4DQ0A 2CV0A 4LOKA 2QPTA 3TLMA 5B2EA 3JD0A 1EJ0A 3TZCA 3M4ZA 2WFMA 4XR4A 4A73A 4DBLC 1PWHA 2B8TA 4P36A 2CCJA 3CC8A 3DLIA 5FI5A 3BMOA 4REQB 3GD5A 1L7AA 4IGAA 1BDHA 1SHZA 3BGOS 2R5NA 4EFKA 1LSJA 2PD4A 1BG6A 4V03A 3B7GA 3D4PA 4ND4A 3RYHA 3QMWA 4GE0A 2V7XA 3AY0A 5JW6A 4IFIA 3WWPA 4UTRA 5JD4A 4MP8A 2QK4A 4YRSA 2AX3A 5EJIA 1TT5B 2WQ7A 2WJ3A 1L5VA 3EK2A 3IMKA 4I6GA 2CL7X 4OQFA 3STWA 1EXMA 2JG3A 4I5FA 1T9GR 1ZD4A 3ZLBA 5HFAA 3C2QA 5H4HA 2IXTA 1KZ6A 2OD9A 1RKUA 1GXSA 1S5PA 1DT5A 2HA4A 4F71A 2RDMA 3MRVA 4HLNA 4C7VA 1FTSA 4QYXA 2BFWA 2XY4A 1ZU4A 3K2BA 2DF8A 2FPMA 4LYAA 1TYCA 4MUEA 1IZ7A 5IYZB 4E14A 2D2IA 3EMKA 3LHKA 3QKSB 3R6TA 4WVFA 3UT5A 2XMPA 3T7CA 2RH4A 3DEYX 2DLCX 3O94A 4RFVA 4CM4A 5DCUA 1HNXB 3QEAZ 2ILTA 3CH4B 2X8JB 1V11A 3A37A 4Z49A 1E9EA 3R0QA 5HDQA 3K6RA 1ORDA 4FEEA 4YMSA 1E9DA 3GCZA 3QEOA 1ISJA 4B7CA 4B71A 1O89A 2X41A 4NZNA 4M21A 1KIMA 5AM1A 3OCZA 2BTOA 1PX0A 4W6ZA 3D8UA 4H1WA 2H2AA 2VDVE 2VF7A 5CM9C 5T4HA 2XB9A 5KU1A 2UUPA 2AFIA 1QRUA 1BMFD 1FPMA 3OHMA 5FORA 2EX0A 3ASYA 1NIPA 4KBGA 4DNPA 4YQYA 1KMCA 3OLCX 1A5SB 2AN1A 1HTTA 5IKXA 3FDZA 2X6TA 3GBSA 3IJPA 3NIFB 2QRZA 3L0DA 3NAGA 1WP4A 4AZ0B 3UJBA 4ND2A 1BMDA 1PZNA 3OM1A 3A6ZA 3JD1A 5B1EA 4B8YA 4WFQA 5IUKC 5DNYB 5LMNB 1U0EA 4FZ3A 5AHOA 4XUEA 5ALVA 1Z5GA 1UP4A 3OZBA 3RSQA 3W5SA 3RVLA 3RBAA 2C97A 2VF8A 1TQ2A 3SJZA 2GETA 1RDFA 1TCVA 1XDDA 4LYEA 2PFGA 1QP0A 3GJ7A 4YJFB 3CCBA 3VKWA 2QJFA 1C3LA 1V48A 3AY7A 2PGXA 3D5QA 3T61A 2PJRA 4UAJA 2OP1A 1D03A 5AKKA 4KQKA 2Y99A 2GTHA 5DXFA 1QJ4A 4PV7A 3R9XB 2PKQO 2QF7A 5C0OE 3E05A 3MWEB 1TB4A 3OP1A 3Q9NA 3GI1A 3G0CA 1CQPA 2KI5A 4GPBA 1FSGA 5HE8A 1NBMA 2WKQA 1RXSA 4R9RA 2VF2A 1YJBA 4ALMA 2VP2A 4CG2A 3QJGA 3X0DA 2QL9A 3I1FA 3ZY4A 3AFHA 1Y0BA 3MMPA 3O91A 5C4MA 2IDZA 3JZFA 4YMLA 1J99A 1UWKA 1NRXA 1Z0SA 3SSNA 3AK4A 4MPDA 1ENOA 4RSGA 1J07A 1W4LA 1IJEA 2H0AA 1HWYA 1GUZA 2IW1A 4F8YA 2PS0A 1B3RA 2XQVA 1FXWF 3LDFA 3R5HA 3MS4A 2P75A 3V8PA 1NMZA 1UEIA 4KQ6A 4TVBA 4G0XA 2WWXA 4PPNA 3Q8LA 3EY4A 3O1IC 1VG8A 2PBLA 4OOFA 3V34A 3E7WA 5JCOC 4KVAA 3WNBA 2XCOA 4QE3A 3ZHCA 1Z82A 3QF4A 4I8DA 3RUCA 3M9WA 3SR4A 4BV2A 5F98A 3LDGA 4JP3A 3LPLA 1JQAA 4BQEA 4QYWA 4IXWA 4PHGA 5K7SA 1LKZA 3CN7A 5ANRB 2JVKA 4U0JA 2UZ4A 1VLZA 3H17A 5IYZF 3D3NA 1QRAA 5HSGA 5EZSA 3NHYA 2X9QA 1V6SA 1FRFS 3AEKB 1KQNA 4ZYZA 5BYBA 4FGSA 3AUAA 3ZEIA 4B4KA 4CU5A 4DIKA 4TV8A 5C4IA 1WHSB 4TTSA 3RO7A 2ZUEA 3AIKA 4XA8A 2BEWB 1KK0A 3BXHA 4E07A 1BWRA 2GSWA 3BXFA 4GI7A 1N3YA 3D1LA 2I67A 1TKRA 1OZFA 2GH1A 2FEPA 1TTHA 3VYRB 2C61A 3JD3A 2VCEA 2RAUA 2VPYA 3TKYA 2PMEA 4B6RA 5BUCA 1J06A 2P5SA 3A6EA 1ZK3A 3ZI4A 3GPIA 1X1RA 1LVUA 2KS6A 3G2NA 5A4AA 5D3KA 1P2DA 1L5OA 5TMBA 2V03A 1PI3A 3KWLA 4MJLA 4R9SA 5D87A 3K2QA 4IDEA 3ASUA 2J33A 2VUSA 4PC3A 3NASA 2K7FA 5KQSA 3ZWDA 3KEFA 4Q9KA 5AW3A 3KNZA 3FCYA 3O8CA 2C07A 1PEDA 3ETEA 4L8FA 3AUKA 2HCRA 1SB9A 3EWSA 4K46A 2AB0A 5EKSA 4Q7QA 2J3HA 3ZPXA 4D4IA 5K3EA 1A72A 1CVIA 2II6A 2N75A 1GM5A 3HO8A 5CFZA 3P2EA 1E3TA 1MB9A 1P73A 1YBFA 1ZZEA 3BTVA 3JS5A 2ISCA 2QN9A 4P7GA 1R3UA 3I9FA 4BASA 4ADSG 3T94A 4RSRA 3AEXA 2J7PA 4O2BB 5EHQA 1SCUA 3NG1A 1FK8A 2YV1A 4A8PA 3NH9A 1KOGA 1NAHA 1Z6YA 5CT4A 3E58A 3KSZO 4LBYA 2J3IA 4C0JA 2HV9A 4KI0A 4MA0A 4LWQA 2PH3A 1U11A 4H0NA 4MH0R 4YRFA 2IHTA 1P0PA 4O4HF 3G9QA 3T3NA 3VSBA 1QHNA 1TOAA 1V8BA 2VWPA 3FFAA 5JALA 4MB2A 1THMA 2WTAA 1PX2A 3ETDA 2IXGA 4ZO6A 5FTJA 3BSWA 1ADCA 1TVKB 3C6QA 1ZR4A 3RD5A 3HKCA 4YPOA 2P3LA 3IQEA 2Q2NA 4JJEA 5E8RA 5J1TB 2GZ2A 5JXHA 2ONCA 1TD1A 2Y67A 3MK31 5F4ZA 5I8PA 1Z3CA 3VYUB 3C8DA 4E88A 2HMAA 2H0QA 1W49A 3TF5A 1WP9A 2B0JA 4YXFA 4URHA 1LFAA 2DBZA 1MAVA 3CCCA 1AXRA 4DUPA 4HKTA 5EHZA 1SXPA 4MSUA 2L69A 1QGUB 4UVDA 1N2IA 5AOBA 4QT0A 1UT6A 1ZQ9A 2Q5QA 2E4ZA 4BEWA 1FZTA 1W6UA 4WY8A 4CKZA 4XWTA 2FG6C 3B1ZA 3WGJA 2EP7A 4EB6A 5C1PA 3MBKA 2QQEA 2EL7A 4EUKA 5IKEA 3THYA 1ZRMA 4TUYB 4CEHB 4OXYA 2BI7A 3PDHA 1BROA 4CQMB 1VXOA 2ZSHA 3ZU4A 4QUIA 3VNAA 2P9GA 3MS7A 3FRIA 4Y9TA 3WLNA 1DKPA 3RYFA 1H4TA 2Q50A 1B3BA 2BBOA 1T8YA 4Q66C 5H8WA 2OWEA 2H06A 1FA9A 1FB5A 1M2VA 3EGCA 1QB7A 3NBUA 5L3SB 3U62A 2WIGA 1O96A 1KYIA 3D6FA 3CLTD 1RXYA 2R8ZA 4N6NA 2I2FA 5JAMA 4YUVA 2CLMB 5K3FA 3LA6A 2Y1FA 2O19A 4I1VA 4XPIB 4B17A 2CNBA 5SZJA 4JLSA 4QPPA 2V8BA 4B85A 1E3DA 1Z63A 3O3CA 4IVQA 2Q3EA 3BRSA 3EXIA 3DOOA 1YZKA 2WUDA 3F6SA 2P5YA 3TIGA 3LP5A 5EJ6A 1BMQA 1FRVA 2QX7A 2IYZA 1H05A 3WRYC 4K3UA 1U2EA 3EMVA 3W6NA 1Z25A 2OBXA 2ZRBA 3L3BA 2PUDA 4WX2B 1Y6RA 3L1VA 4FNGA 2SKEA 4Z3KA 2DUUA 3K0FB 3LP8A 5C34B 1XQ9A 2ZI9A 4ZDIA 3UGQA 4TT3A 2CFIA 2VDOB 3W2FA 4F9FA 2CLFB 4F3CA 4DIMA 1S2GA 1BHO1 3WWZA 1UWVA 2R7KA 3DL7A 3RASA 3RVDA 1Y48E 1HYBA 2V9ZA 1YR6A 3ICVA 4RVNA 5B7GA 2YIMA 1FU7A 2QN6A 2W90A 3AILA 4N8EA 4LECA 1HXHA 4QHYA 4C22A 5BW5A 2W2LD 4B3IA 3I28A 2RSLA 2V55B 4I2NA 1C50A 4HDKB 2F1JA 5BV2P 3F49S 4X1OA 3SXJA 3WGLA 4EG3A 2I6UA 4UVIA 1GY8A 4NBSA 1OIWA 3WIUA 4G1MB 2PX2A 2NSDA 2HJ9A 2OLJA 3NVDA 4BNVA 3PQ8A 3AEUA 3AUJB 2O0MA 5CPFA 1FRNA 4ABYA 1QMGA 1BVHA 2OV6A 3LLUA 1MU0A 1UFOA 3E9EA 3TQCA 2ZAGA 1X9GA 3ZE9A 5AVKA 5LLDA 2VP6A 2XMZA 1OX6A 1EIZA 2SCUB 3N2GB 4JOQA 2GN9A 5T6MA 5KTRA 4UMVA 2O9JA 3F3SA 3PC8A 4EVRA 3PQ5A 4YT4A 5BT8A 3I64A 3MJ4A 2O2XA 3OHSX 4JEMA 3KLPX 3ZJVA 3ZU3A 4K0KB 5FBHA 5KNCA 1E5QA 2CJWA 1YKFA 3Q8KA 3V5NA 4Q9HA 1U63A 5IXSA 1C7IA 4PYNA 4ENTA 3N6XA 1LWOA 4FHFA 4F4HA 1Q7GA 4AUEA 3V32A 1L8OA 2GOYA 3AVYA 5EC8A 4TWIA 1QRRA 3P2OA 5G1PA 1W4ZA 1XCLA 4TS1A 3DPIA 1D4OA 4LJ5A 1DADA 5IC4A 3LPDA 2DH5A 4OQ4A 1EGHA 4ETNA 1V96A 2PGDA 2C57A 4QDJA 1A9RA 3HA7A 3KTAB 4WCDA 1WV0A 4EYQA 4BLOA 4LDZA 1VLHA 3PL5A 4M37A 5K20A 1T1GA 3GDFA 2E4YA 1UQRA 2XBUA 3TZHA 5KDLA 1FNDA 1N0UA 2DCUA 2EP5A 1V5WA 2CD9A 2ZBQA 3EISA 3N9IA 1XZMA 4IJQA 2FZVA 3VKUA 3FFWA 5L7WA 4HZUB 3D5EA 4CTJA 1FFWA 2XRZA 2BE7A 2GAFA 2H2FA 4GNRA 4IV8A 3Q2IA 1UFQA 1AMUA 1WX1A 2I3BA 3THWB 3OA2A 3N2YA 4XGQA 1AK2A 5ECWA 1JLLA 1VP3A 1PIWA 3TK1A 1F4LA 3UPDA 4DCMA 1OX4A 4OKIA 1G6OA 4P84A 4WKGA 4C6HA 1XVVA 4ZI2A 2VO1A 3CA8A 4BO0A 5J23A 1VGRA 4A8JB 1EQ2A 4IIFA 4EHFA 2X5JO 4D3XA 2VRCA 3WK9A 1RJEA 4RLFA 4MLZA 2BJVA 2Q1SA 4OUDB 1GNLA 1I2BA 4RCYA 2JJ8A 2WU4A 3VSCA 3AVTA 2H2HA 1JLMA 4MVJE 2PMBA 3WBKA 5DNCA 4HQ6A 4PGAA 4II7A 1XP5A 1GOTA 2O8BB 2YXBA 2X0FA 1S1MA 2ZWPA 4UEJA 1E9FA 2BHTA 3EIXA 1DAGA 1UBMS 4BEJA 3KG2A 3CUVA 2JHFA 2CLDX 2PG3A 1DV1A 4JNCA 3IBYA 5G0VA 2B4TO 1LC0A 4XI9A 1BQ3A 4JVOA 2EW8A 3VYTB 4RY0A 4QOEA 4A0QA 2IE0A 1GWNA 1TK3A 3WQBA 1RIFA 2QW1A 2DHDA 2QROA 2WJGA 2QBYB 2EBFX 3I53A 2DAPA 4HSEA 4UFPA 1R0BA 5DCLA 4BLTA 4GQAA 3X1JA 3B38A 3EGXA 2FV8A 5BYJA 2VXYA 1MC8A 3N2KA 4CQJA 1T0HB 1XYYA 2A9PA 2FG5A 1N0IA 3VHRA 1YGPA 1GA6A 1CRQA 3PVSA 4DR1B 2QUJA 2YUTA 1KAGA 3ZCVA 4G8BA 3Q85A 3D8TA 4HDKA 4XJXA 4OLFA 1G2IA 1PL7A 5FOQA 4B3DA 2XWJI 1H2EA 5TB5A 5IJAA 1DBVO 4M0EA 1J9GA 3O8LA 4Q4CA 1XQ6A 4MVJI 1II0A 5ICEA 4KW7A 5CX4A 2JBHA 2GVDC 4COKA 1PJAA 1HORA 5D7NA 3CZRA 3CGWA 1KIFA 1TA4A 4G63A 3DEHA 5KNCD 4YCMA 1WSDA 1Y1QA 3HY6A 1T3SA 4Y0AA 5HBGA 4E5VA 2O8CA 3L0IB 1OT5A 2GYYA 2VBGA 2FH5B 4N5NA 4Y6RA 1JKJA 3UHAA 4Z3OA 3PFIA 1EM6A 2EF0A 4KR9A 1GRRA 3WZMA 3GA5A 4KLAA 2D0PB 4KO3S 4YRIA 2F3SA 2IY7A 3OTIA 2Q3DA 4DJ5X 3QVWA 4D9NA 2BC9A 1K4KA 1CB0A 1XVIA 2VPTA 3EF1A 2D8MA 4MWBA 5CGQB 1GFIA 4TXNA 3CJRA 3EXIB 2B4YA 2XEXA 3GJ6A 1EVEA 3KR9A 2MSNA 1GPUA 1IY8A 2FWBA 4AZWA 3NUGA 1HETA 4KFCA 4TWRA 1KARA 3PKZA 4ZT7A 4JDUA 3LCMA 4D82A 1VL8A 2OM6A 3ADPA 5THXA 2X4DA 5FLKA 1OD6A 4BP1A 2IK8A 1NI4A 2XE7A 3DEIA 2BZSA 2IYRA 2A33A 1RPJA 3F0TA 3IR5A 3PP8A 4RQTA 3GLFB 1ESNA 4R16A 2DCMA 3JTEA 1O08A 4ZT4A 4G9EA 1DTSA 4JJ7A 2VCYA 4D3ZA 7YASA 1I2DA 5BW4A 1MXFA 1XEAA 3H19A 1Y1PA 1Y4ZA 1TD9A 4IIJA 4QQNA 5CVDA 5JSZA 3HJFA 3QV1A 1H0SA 3IP5A 2WVJA 2Q4DA 2WI8A 3G5MA 4TYMA 5DHRA 5A3SA 1EEXB 4AC9A 4ZCTA 1ZD1A 4WL0A 1B8UA 1G0NA 3BX1A 1C1DA 5YASA 2XTNA 2OFXA 1ETHA 4LVNA 4MQMA 5KOJB 4HVAA 2F62A 3I9LA 1VRVA 1Q19A 2AI2A 3OAAA 3ANTA 2G67A 4RPJA 3QOXA 4A9AA 3WRYA 2YOFA 3KKZA 3WZLA 3B7PA 3UYLA 1N5DA 5A4JA 2D2XA 1NV8A 2IF2A 2RGGA 3ESCA 4HJXA 3S81A 2GPBA 4XW2A 3HUDA 3UB2A 3T3DA 2AFHA 2IUUA 4JUIA 3ZNPA 4HGPA 1QF7A 4JT2A 4CIVA 1T5IA 2HO4A 4O2LA 2YY5A 4MUMA 5BQOA 3ZNNA 4EB3A 1KZGB 1NG9A 2PTHA 4JLVA 1OZHA 4RF4A 2OHXA 2DYKA 5EL0A 1BKSB 5GJWC 4G0NA 3DXYA 3GUVA 3FWYA 4TTQA 1GKLA 1SUCA 2CVPA 2FMXA 2VK2A 5J47A 1P61B 1SZPA 1JL3A 4LHZA 4KDCA 3FCUB 7MDHA 2XQGA 3GJRA 5KVSA 3GOHA 4TMWA 2JGDB 4E03A 4BX9A 1GSOA 4TZKA 5GOZA 2L82A 1QO0A 2ZULA 2E4AA 3JSXA 2HLHA 4AY5A 3BZUA 3AC0A 2MSDB 3E27A 1CUJA 2C59A 1YZQA 2D5IA 4MUIA 5J9FA 3ZOZA 2H8GA 3W5BA 3T5DA 1P1BA 1A7JA 1UOEA 2I8LA 2Y8EA 1QVZA 4OCZA 3EDRA 4UPDA 4CQMD 3DUFA 2NUPB 3W1EA 5LNK6 1H8ED 3GLGE 5LDHA 1NHWA 1UCFA 4XYMA 3U1TA 1MQ9A 3G8BA 4WXEA 1T6NA 2GAJA 2XODA 4KZKA 2BM9A 2CB9A 2FHPA 2JIZA 3AUUA 1Y9AA 4M60A 1Q12A 4MRPA 3T7AA 4AU1A 3MXTA 1DCKA 1ZGHA 5ALXA 2LKCA 3BH6A 1T9DA 3HU3A 1O95C 5E4FA 2CXPA 2IS4A 1OILA 3M9LA 4R1MA 2CV1A 4OK5A 1WTAA 2VP5A 5DN6D 1D5CA 1VXRA 5A5GA 1ZOPA 3UB3A 1G3IA 2GASA 3PTLA 4GZ5A 5EYPA 1JG6A 3D59A 3SZLA 1DKMA 2H0RA 5JROA 1VL6A 1XALA 2OFWA 4BKQA 4DWWA 1FBTA 1L7QA 2A1IA 3WL7A 3CUYA 3QBJA 4M9UA 3HKEB 1KTIA 1F9EA 2JFOA 1C3OA 1PG2A 2BFFA 2Q3LA 4JB0A 3WSTA 3T5PA 4KGDA 3RVNA 2CWWA 3H7IA 3M8KA 4DCVA 5IXJA 2A5FA 4E2ZA 3F73A 3HKBA 2OSVA 3WIEA 1UADA 2NU6A 4Z5XA 5AM2A 4WN9A 4P7FA 3ZIAD 4DNFA 1AD2A 2CHQA 1TZ2A 3MGGA 5B1HA 3OP4A 1J8QA 1R5OA 3PDCA 4ZPXA 3IUEA 1EX1A 4C6RA 1YZYA 2OZEA 4RGYA 3RS0A 4D57A 3O9ZA 2OXFA 1OYVA 3ESAA 4NBTA 4R54A 4IBOA 4WFJA 5DVZA 1EUCA 2BP7B 2AGVA 4UXJA 4I9FA 4ITUA 4BZZA 1D09A 1T1SA 1SG9A 4F4FA 5B4TA 2D0IA 5MN4A 2V3VA 3DVSX 3UTCA 4O4LF 2CNDA 3M6AA 3G6WA 4WBSA 5EZYF 1UFVA 1DC5A 2WFLA 2KPOA 2WICA 3DH0A 1LDEA 4HY3A 1JAZA 2PGJA 3B2QA 4YJGA 3UJ8A 3NO4A 3PCRB 5KJ1A 2EJCA 4MW4A 3I2FA 3PV0A 1Z36A 4RJJA 4BTVA 2C1XA 2GEDA 5ALYA 5J63A 4G0WA 2ZP1A 1P9RA 3L0ZA 3ADOA 4U7FA 3HWX1 3MC1A 1G1MA 3LQ1A 4DPLA 4GR9A 3H99A 3BHJA 4LDPA 1O6ZA 5BN3A 4MVWA 1IOLA 1YOBA 2C2OA 1DEHA 2XVAA 5AJHA 2WFLB 1ECBA 1JG1A 3NETA 4NZZA 2FEAA 3L7BA 1E64A 4BP8A 3LTNC 2RMKA 2WWTA 2I65A 4I5EA 2D7CA 1XN4A 4EABA 3WIVA 3FZGA 1QRTA 1SAYA 1KI1A 1MP0A 3QEJA 2DTXA 4E2FA 2OGTA 3ZGLA 3USZA 1GNRA 2G09A 2AWNA 3UN1A 3AV0B 2EFDB 3BORA 3JVVA 1PS0A 1SRQA 1WCIA 1IXSB 1RJDA 4PBSA 2HLNA 4UCQA 3A9UA 3ORYA 1ENYA 1L5QA 3IVRA 4TMFA 1FU8A 1JN0A 1NW6A 1IN1A 2FEXA 3LCVB 2GPSA 5C32A 2Q6IA 1T2NA 4GPIB 3PENA 3PQEA 4TS9A 2AMJA 4XD7A 4C7JA 4DMGA 4EI7A 4P5DA 2EGUA 5HHTA 2G9QA 4LRXA 1KPIA 3S2YA 1ZGAA 1NF3A 2QYSA 3NOOA 2UXBB 3LPNA 5HQ3A 3K0FA 1SVWA 3H11B 3C6KA 9LDBA 5F3DA 1A8HA 1O58A 4RWEA 4GL4A 2J41A 2XT0A 1GUFA 3KEOA 4GKVA 4L6AA 3CKYA 4PTZA 1V7CA 4W1QA 5FF9A 3U9SA 5KWEA 1OHHA 2PWYA 3V7WA 1LTKA 2RGBA 2VAVA 5LQRA 5K0FA 1CZLA 4DFDA 2GCNA 1EG7A 1HQDA 2Z56A 3HCAA 5ERYA 1V9LA 4XH9B 1VZ3A 1PS9A 2W8BA 1OXMA 1Z5WA 3FE2A 1QCZA 3GIWA 4MW9A 4Q4AA 3TNFA 3PPVA 3UJCA 5JWOA 2HJWA 4GW3A 5AW1A 1ONBA 2YZNA 3ILXA 2AIRA 1IXRC 2BKVA 5LCXA 4BNNA 1ND5A 3D6JA 2GD1O 3OQ6A 5EMNA 4WEOA 4FMDB 4IFBA 3EQ8A 4RS3A 4QGFA 5MDHA 1AKTA 1QO7A 2JZCA 3MW8A 4YAIA 2IYUA 4MYUA 1CHDA 1CUBA 3H1FA 1GILA 4PLTA 1U81A 2HXYA 1YVRA 2C9OA 4UARA 3MJHA 3AQ4A 4MKZA 3HN2A 3RYIB 1GKYA 2J4DA 1ABEA 2V7EA 3O8NA 1PKXA 4IXDA 5K03A 1WQ3A 4MHTA 1Y37A 2QVBA 4BQIA 3H5WA 4PWZA 3TBFA 3FF4A 3ICEA 2QGFA 1F8YA 1IUPA 1VFPA 4GI3A 2PEZA 1AXEA 5D3MB 4ZVOA 1TVEA 5IPFA 1OWMA 3TW8A 3HVRA 3NI2A 1UK6A 4PZ9A 1EIWA 2X0IA 3AINA 3DMTC 3PK0A 4HDMA 4TMTA 3RAEC 3PRJA 4ISCA 1GTJ1 1DIBA 3L02A 1I94B 4BPBA 3EGIA 3OU6A 3QVLA 1XHLA 5DSXA 3V42A 4D25A 1ZN9A 4TV8B 1CRPA 1IN5A 1VBNA 2EZTA 4AIRA 3PJDA 4E11A 1RTTA 3A26A 2QVYX 4EF5A 5E2AA 1QIFA 5EKDA 1E4VA 3AP1A 3GHYA 1QXSA 2V8OA 3CEMA 3WGKA 4BNXA 3E22A 3DT6A 1NF8A 3ZCQA 4M1OA 4BFXA 1ZM2A 2XMSA 2EGGA 3O7WA 4CR6A 4DB2A 3CUTA 1CQXA 1DS6A 1EX9A 3ET4A 2R65A 5JYDA 2V59A 3K1YA 4HAIA 1T6BY 5HIAA 3S2ZA 2YH2A 4M99A 2AEJA 3RU9A 5HK8A 1D6NA 4RTKA 3P94A 4JC5A 2XUOA 1KFJB 4DR4B 3VOTA 4CV1A 2OVBA 4UDOA 4EYSA 1L4GA 5DCWA 5A9RA 1RWMA 3EWNA 2WYOA 1KY2A 2V58A 5AI4A 1NLZA 5TPZA 1DBQA 2E4XA 2BHLA 4WXRA 3ZHBA 3PUIA 4N0PA 1T0IA 5FQOA 1NSTA 1E6WA 3L4BA 4R01A 1XDWA 4ZCMA 1Q57A 2YZ7A 2ZJ4A 4RM3A 2Q99A 4XD7D 2DPYA 4OVKA 2YCBA 3NCTA 3RFFA 4IH1A 2Y05A 3GT4A 3PHJA 1UPTA 4MS3A 4ARAA 3IPAA 5I7UA 5LMUB 2WSSA 3LBNA 4QUDA 3M2PA 5LBTA 3AW9A 3T5TA 3T7TA 3PEYA 3TMAA 3FX2A 1CSEE 3OECA 3U7HB 3P9SA 3T7KA 3FETA 1DG3A 1II8A 1CJUC 1DLJA 1GCIA 3I72A 1H2XA 2GNAA 2ZJAA 3C6ZA 3FCEA 5E3HA 4D4LA 4DDMA 4J43A 4EGQA 8MHTA 3NS7A 4ZAWA 4UAGA 1ABFA 5ALZA 1ZH0A 2BM1A 5CNMA 4C89A 4GOXA 3A05A 2XV1A 4F46A 1SU4A 1NC3A 1Z0DA 2YWFA 4AY3A 2X0DA 2X4GA 1POWA 3KJZA 2XQIA 2FFHA 4P38A 4WHMA 1H94A 2ZREA 5D00A 3O1LA 2W98A 4WRRA 5AJVB 5B3LA 3U1BA 3H5OA 1HYGA 1T5DX 3LX6A 1XKLA 3H4IA 4BFCA 5C4GB 4RGQA 4X3PA 3B6ZA 3Q15C 1JX6A 3I73A 4GOND 1LJLA 1A8SA 2CBGA 3DC7A 1CR4A 1Z29A 1VCHA 1U8FO 5DT9A 2RBEA 4CMKA 2MYUA 1PUIA 2JAHA 1YFZA 3MTEA 2DHEA 1QH9A 4L22A 4Q24A 5FUMA 1I4EB 4TN5A 1LBSA 2ZIVB 4UVHA 1XZBA 5IC5A 2A14A 5FFFA 4G0OA 2B78A 5DW3A 3RRFA 4XX0B 5LZ2A 1QVAA 3IHLA 5GVSA 1F12A 5LZ7A 2DH6A 3E03A 4ID3A 4EW2A 4BJ5A 4RPHA 1QHSA 4RD1A 3AFOA 2D2EA 5B58C 4M1WA 2OECA 1CHNA 2OY0A 4LY0A 3DV0A 4PC1A 4E12A 4NFYA 1DJNA 4B4DA 5AWFC 1N33B 5J2TF 4PQRA 1U1GA 2FDXA 1J20A 4M9RA 4KXLA 3WFJA 3N6RA 3WKCA 1T0JB 1UJ4A 3HLKA 4CG0A 4PSAA 4PVCA 3AT1A 1FTGA 1N5KA 4ID9A 3PR1A 3LHSA 2A86A 3SZ3A 2YV5A 1G8JA 1YWGO 2GI4A 3T5BA 5A3RA 4NULA 3LA8A 3BZBA 4MHSA 2M98A 2Z5GA 4ZI7A 2Y0CA 3LFTA 5KPJA 4XTRA 4FU0A 4LZOA 3OKAA 4NZPA 4L1KA 4DYDA 4IIYA 5I3CA 1GL6A 2ENWA 3RUHA 4FYVA 2Q2OA 5JMOA 2FZCA 4GQIA 1BFUA 4ENWA 2RH5A 3C8ZA 3FPJA 1UPCA 1W4CA 1ZGBA 2PRYA 3PC3A 4RMNA 4O8ZA 2MCFA 4GYYA 4DDWA 2BDUA 3JCZA 1DHRA 4GM0A 4JT9A 4WKBA 4OB7A 2QNBA 4Y67A 4JI1B 3ULKA 2YJ5A 3FIJA 1A7KA 2C8VA 1RWXA 4RPIA 1XEXB 5FOTA 5TV2A 4ETWA 2PZ8A 2CFOA 5JC1A 3G8DA 2WSSD 5J5CA 5C51B 4ZTZB 4HDOB 4HN9A 3WMWA 4OQQA 1U3FA 1OTXA 4FE7A 3H9UA 4MCAA 4Y2UA 1CZHA 3CJTA 3ZIDA 1DZ3A 3H05A 3WQQA 4BWFB 4YMVA 1P0CA 3A14A 4YMIA 3PGKA 1Y3IA 1XXHA 4X20A 2GMWA 2OZVA 3AJEA 3JARA 3JWEA 3W5JA 4HUQB 2YVKA 4B4OA 2GJKA 4EK9A 4KJZA 2F90A 1EP3B 1W73A 3SC2B 2WE8A 2Z08A 3AI2A 3L7NA 3QKIA 3L40A 5DW0A 4HNAA 4ZCQA 3ZLJA 3PNVA 1H22A 3UWSA 5IZ4A 2XVMA 3OU2A 4Q5IA 1MO6A 2Z6VA 1VE6A 3I3OA 3G89A 3A4NA 4A8JC 5I5EA 5AT1A 5A4DA 1XLTC 1HSOA 1HRKA 1B8OA 1K7XB 1RWBA 1UR5A 4X6XA 1ATZA 3FTFA 2D5LA 2G3YA 3MTGA 3JARB 2Z30A 3CZCA 2J6HA 4R3WA 1C3XA 2ZRJA 5AR1A 5BRAA 3QZUA 2YQ5A 5SY9A 4HVCA 3NDPA 1KEKA 2TS1A 3DB1A 1PZGA 4FNAA 2FKNA 3GUUA 3MUEA 4PZZA 2OYRA 4BFVA 2QD3A 5ITVA 2VJQA 4TL9A 3AERA 4JLAA 4W6QA 2AZ4A 1R6AA 1ZOIA 1K5HA 1V1RB 1TEXA 3O3NB 4M1MA 4OBWA 1ECGA 1N3LA 3FHJA 3FPGA 4MAMA 4KYTA 3WLIA 3HE3A 3T9DA 2A59A 2KE5A 2BH9A 5KJFA 1HI9A 4W8HA 4D26A 5FUYA 5TGDA 1PFVA 2H3HA 2G0TA 1G8HA 1TAHA 3G8CA 4KXNA 5EZQA 5FWAA 1U9IA 4ENVA 1MHPA 2BLLA 4G4GA 3RVMA 1J0CA 3K6JA 3DVAB 2XI4A 4EEZA 3GAMA 3LCRA 5E1DA 4JV5B 1F8GA 1PUXA 3USCS 2OMKA 1TF5A 3HCCA 2QZSA 4ZJZA 1JJBA 4YMTA 1B14A 2VYVA 2ACVA 3JQEA 3BDIA 4QO8A 4QPZA 3L4JA 1W76A 3TCNA 3LSYA 2QV7A 1GTRA 1SVLA 3FLEA 3VC1A 1X80B 2PUEA 1O1YA 2H85A 1DIGA 2HJGA 1QV9A 2PZLA 1H85A 4GSYA 3U0BA 2AZMA 1K89A 1U0TA 3PX2A 3V7YA 1I30A 1M6EX 3RYTC 4Y9UA 4BO9A 4YJHB 1W75A 4AB1A 3TRDA 5AVWA 4HB3A 4RYDA 1QAOA 4R8VA 2M6KA 4ARVA 4WLNA 4BO3A 4EKYA 1WNTA 4BFSA 2QRNA 3OD1A 4FEYA 3S27A 5JBIA 4I14A 4NOMA 2JEYA 3IKLA 4R2HA 1NKSA 1KJYA 2PZBA 5C8ZA 4G5RA 2RKWA 1TJPB 2JA1A 4I9UA 1NR5A 2IPOA 3LF2A 3KD2A 4CLOB 4OKSA 3CXRA 1MQ8B 4E6EA 3A9RA 4WACA 1QF9A 2AEMA 1LGYA 5KI6A 1U9IC 4YRZA 3BCRA 1OB2A 3IVCA 1SHLA 2DFPA 2ZBUA 3H4MA 4IZOA 4I99A 4IEFB 2VF4X 4LMAA 3I32A 3R5XA 1ISSA 5LNK1 3IVXA 1CNEA 4GQBA 1D2AA 2AKYA 3GFFA 3TZEA 3V1LA 5IJ0B 4EPXA 5DNEA 2H1VA 2ZDHA 1E2JA 2C84A 2WSLA 2ZS8A 4OQNA 4GL2A 1OVMA 3ZGYA 5HGJA 3Q7QA 2ZCJA 3O9MA 4L50A 1O96B 1H2FA 3UOWA 2J3DA 2Q27A 4DM4A 1ZHHA 4EW6A 1TT7A 5IHPA 2I87A 2CSUA 2A9RA 2FUKA 1JSLA 1CEQA 1L1EA 1T3GA 2VHCA 3FNFA 4IHKA 4O29A 3TSOA 3OJLA 1QG4A 1E4EB 1UMDA 4QQRA 2H52A 1E0DA 1SCIA 2YVUA 2ZTUA 4S1WA 4UM7A 2MU1A 4QREA 1U6KA 4G07A 3I58A 1VE9A 4QBKA 3UJHA 4A3SA 1BD4A 3P9YA 4B09A 5KCZA 4MWOA 5FWNA 4C0SA 4ML3A 4IMRA 2GZ3A 1IRIA 3CNOA 1ZISA 2ZUUA 5EMKA 1DSSG 5ALJA 5FHQA 4BO5A 4Z4GA 1YB5A 1E7SA 1V5GA 1XZDA 2FSPA 2GCEA 2W6OA 1WMEA 3DV9A 4B44A 4RZIA 3WMRA 4KOAA 1PJ4A 2HCBA 5I51A 1Y3DE 4PQYA 4Y8VA 5EP4A 3QG1A 3NOVA 4YIKA 3PDIA 3PBKA 4BJHB 4YJHA 1DRJA 4YJ2F 1KZ1A 1Z4KA