4AJKA

Rat ldha in complex with n-(2-(methylamino)-1,3-benzothiazol-6-yl) acetamide
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
331
structure length
330
Chain Sequence
b'AALKDQLIVNLLKEQVPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLKTPKIVSSKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPQCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPQLGTDADKEQWKDVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCILGQNGISDVVKVTLTPDEEARLKKSADTLWGIQKELQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-LACTATE DEHYDROGENASE A CHAIN
molecule tags Oxidoreductase/inhibitor
source organism Rattus norvegicus
publication title The Design and Synthesis of Novel Lactate Dehydrogenase a Inhibitors by Fragment-Based Lead Generation
pubmed doi rcsb
total genus 115
structure length 330
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ajkA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4ajkA02
1J5PA 1P1JA 4I5FA 1EUZA 4BMVA 1BXKA 2CD9A 3AU8A 4XGKA 1VE9A 3CTMA 3WFIA 1EBFA 3EMKA 1RM4A 3RSHA 3L6OO 2WYUA 3H9JA 3LC2O 1PGNA 3FTNA 5ILOA 3DR3A 2OZPA 5TS3A 2B35A 4IDAA 1LDEA 1TI7A 3TZCA 1YDWA 2IRWA 3ZWPA 4BNVA 3ZHZA 3R1IA 4Q3AA 2GLXA 3I52A 1PR3A 2ZQZA 1EUCA 3AWDA 1L1FA 2Q4EA 1LXCA 1QXSA 3H8VA 3PQFA 1E1MA 4RLSA 4J91A 1UZNA 1TT7A 4UEKA 2Y1OA 3LT2A 3I9KA 4NK4A 5IZ4A 3KOUA 3EDMA 2VUSA 4CUJA 2ZJ1A 4AICA 3OM9A 1EQUA 2OOSA 2ZJ0A 1NAHA 3OJLA 4N5MA 4FFMA 3RJ5A 2UDPA 2BD0A 4Z0PA 3HB4X 5CAEA 2IEDA 3UGKA 2WD7B 3FCOA 4PLYA 4UULA 1LI4A 3VPGA 4EUEA 1FDTA 3LDHA 1QMGA 1I3MA 4MVJE 4YJFB 1KERA 3QIVA 4JBHA 3VVBA 2ZTUA 1DLIA 3ZHBA 2Q49A 4CMBA 4CV3A 1N9GB 4S1VA 4M8SA 2JHFA 2DM6A 2BGMA 3ITKA 3F4BA 1E5LA 4JBGA 3LT1A 1P9LA 1QKIA 1EDOA 4PRKA 3HJAA 1NXQA 2ZATA 4K6FA 1MX3A 3PEFA 4JP3A 4PZDA 5H82A 5K6AA 1BTOA 3PI7A 5IFLA 2OGUA 3D4NA 1BVRA 3RUAA 3TDKA 2POQX 4E13A 1DC6A 2HAEA 2VHYA 1KVSA 3D1LA 2GYYA 4ID9A 1Y9EA 3GOHA 3ORFA 1U7TA 1S7CA 3E1KA 4XA8A 2VHWA 2GZ3A 2PZMA 4E2WA 1XKQA 1QR6A 2FHSA 2I3GA 5F5LA 4BO1A 2I66A 4P22A 1FK8A 2BMAA 3CINA 1CYDA 3NAQA 4AL4A 4MKRA 3H5AA 1SB9A 4CL8A 3KYCA 5IF3A 5G4KB 3SX2A 3PDUA 3JQBC 5JY1A 3GN1A 1OZAA 1BW9A 3QSGA 3VPSA 2PV7A 2Q2VA 3BA1A 3U4IA 1R66A 2BFAA 1ZJZA 3QWAA 1LLDA 4DMMA 1DFHA 4BQRA 3VPHA 5L7TA 4YAEA 5T57A 4OMUA 4M86A 2WM3A 1ZXBA 2NVWA 1GUFA 3DMTC 3D5QA 2RAFA 2PFGA 1GTMA 2X7HA 3GNTA 3PQDA 4PLGA 5BQFA 1DFIA 3JV7A 2BFPA 5THKA 3JQ6A 4CMEC 2B4RO 1EEHA 2EEZA 8LDHA 1AHIA 3DB2A 2VHXA 3PXXA 3OSUA 5KOIA 2PR2A 4DWVA 5LDHA 2P9CA 3GAFA 2BI7A 3GEGA 2HRBA 4O5OA 4BHTA 4R4JA 2DLDA 5T8KA 1NWCA 1VSVA 1YDEA 2AG5A 3I9JA 2EERA 5KVQA 4FBGA 3TJRA 3V2GA 2J3JA 4YACA 3VZRA 1HLDA 1ZEMA 5CEJA 3TFOA 4EI2A 2G76A 1O95A 2C07A 3WBFA 1DO8A 1JKJA 2IXBA 3LZ6A 4CM8B 3Q3CA 4OOFA 4IJKA 3ZCXA 1QYVA 2J6IA 4A0SA 4CMHA 4O6VA 4MVJP 4II2A 5AXDA 4EJMA 4A27A 4D79A 2IYOA 2X5OA 1K5HA 3IUPA 4ALMA 1WDMA 2AE2A 4LK3A 3OA2A 4UUNA 3ZU2A 4NJMB 2HMWA 1B8PA 4BKPA 3T4EA 4IINA 3GY0A 4NPCA 3CH6A 4WCDA 3ETDA 4QUKA 4YT2A 4BQPA 3AK4A 5BNTA 4LSWA 1HDOA 5A06A 3IOYA 4R5HA 2GD1O 4W99A 2VUUA 4HUJA 4J7CA 1KIFA 5GZ6A 5K9ZA 5U9CA 4CLEA 1ULSA 2P68A 2ZTLA 2EKLA 3MEQA 4IUYA 4YJDA 4NNJA 1LLUA 2P2SA 3AUTA 3F6YA 3QY9A 4ZU3A 3ONEA 3FN4A 4UEOA 4E5PA 5JC8A 1FF9A 1EDZA 2JAHA 1LJ8A 4HKTA 5DCUA 4AJNA 4NBUA 2AXQA 3KLPX 4GVXA 4ALLA 2QZ9A 4NK5A 1HYHA 4FR5A 2VZ0A 4KTTE 1U3WA 2NTVA 1GYPA 3JQAB 3GDFA 4BV8A 1CJCA 5JAQA 3AM4A 2V65A 2IODA 1HSZA 1KYQA 1GU7A 4Q3BA 1PU2A 4RVDA 3ZV5A 4L76A 2EW2A 4TRRA 4W6ZA 4D46A 3RUEA 4D42A 3WICA 1EE2A 2DBQA 3U4CA 1TT5B 5A3VA 3UOGA 2XAAA 1LNQA 1P33A 4TSKA 4I5DA 4KUHA 4JBIA 5DZSA 4DMLA 4A03A 1B8VA 2E48A 4UVEA 2H6EA 4D3DA 1KC3A 1P1HA 3B1JA 4IIVA 1XU9A 1LDYA 2DTEA 4MO2A 4TZKA 4ZQGA 3RUFA 4BGUA 5LC1A 1NFRA 4L4XA 3ZWYA 2JKVA 2DPGA 3LT4A 4IY1A 2EP7A 1GQQA 4I8XA 2PLAA 5A9TA 3BHJA 4RF5A 1SPXA 2FOIA 1P1KA 2HK7A 3ZWAA 2O3TA 4J1QA 3SLGA 2FSSA 3QE3A 5F5NA 3G1UA 1ZUD1 3DAFA 3GNQA 3GZNB 2PKQO 5TLSA 4LVUA 3WFJA 1U4SA 3C7AA 2J5KA 3H2SA 1ADGA 3DOOA 1MGOA 4D41A 2Q2QA 2I99A 2CFCA 4PCVA 5B4VA 1HDXA 3GHHA 4XKJA 2RIRA 3SC4A 3HQ4O 3BYZA 5AXAA 3GVIA 3UICA 4YAJA 1FDWA 1T2CA 4IJWA 4XGNA 4UUMA 3RFVA 4R41A 4CLOB 4JXKA 1F12A 2ZK7A 3GZ4A 2NSDA 5CDYA 4GSLA 1A5ZA 1ZSYA 1E3LA 1O9BA 2AQKA 3GZNA 1QG6A 1LDGA 1DBVO 1M75A 2PD3A 3C1TA 1F17A 2GZ2A 2VHVA 3MJCA 4GWKA 4O63O 1T24A 1D7OA 1YL5A 3JYPA 5KJ6A 2O4CA 1MUUA 2UV8A 3GRPA 4FN4A 1A7AA 4E2YA 1QV7A 4II3A 1QLJA 1YGYA 1EK6A 4WKGA 4HX5A 1SC6A 4Z0HO 2EJWA 1LRJA 1CRWG 1I32A 4BL5A 3AW9A 1HDCA 2RHCA 5TT0A 4ALNA 1BXGB 5L51A 3UN1A 5L9AA 3QJ5A 4XYGA 4BGVA 2D1YA 3R6DA 4UVIA 1Y7TA 3OQBA 3QWFA 1DXYA 4TKLA 2VNSA 4J4HA 4K9DA 5I9LA 3IC5A 4QQRA 2O48X 2C7VA 2OHXA 4G81A 1FXSA 1V0JA 4RVUA 1IZ9A 1CDOA 4GX5A 3L4BC 4Z6KA 1HDGO 3B70A 4MVJM 1A72A 5T5QA 3EY4A 5B1YA 4YRBA 2EXXA 4AJ2A 4U6QA 1T2FA 3L6EA 2B83A 4R3NA 1I10A 4LW8A 3IUSA 5H83A 3ZWBA 4XRGA 3DC2A 1Z7BA 3H9QA 4OOEA 3QHAA 1GPJA 3TWOA 3ZV3A 4EGFA 3UCFA 4YT8A 4CQMB 4OAQA 1DJQA 3BZUA 1E6UA 2VOEA 4CL3A 4LCJA 4PG8A 1OAAA 5JO0A 5JC1A 1I3KA 4MIYA 3FTPA 1ZMTA 4D3FA 3W8EA 1F8GA 4GX0A 4KWIA 5C3MA 1E7RA 2YDXA 3N74A 1DLJA 4JGBA 3OJ0A 1IUKA 4O59O 1T25A 4WCFA 3RUIA 1X7DA 4L73A 4DGSA 3KYCB 1ENOA 1BDBA 5FF9A 4XQ9A 4J2OA 1DB3A 3WGYA 1V8BA 1BXGA 1DJNA 1JKIA 3KZVA 3NEPX 1MP0A 4DXHA 1DRVA 2I5PO 1EUDA 2ZTVA 3LC7O 4DYVA 1ENPA 3S2EA 3VHRA 3BHMA 2NU7A 2XXBA 4I5EA 4CLXA 5CFZA 1ZKMA 3H9UA 2W2LD 5EMHA 2HO5A 1CQJA 1ZH8A 1SAYA 2I65A 3KUXA 2X0IA 3H9GA 4RPKA 3TN7A 4B7UA 1R4NB 1UDBA 1MV8A 2PKRA 1QYWA 3IDSA 1Z75A 1EQ2A 2QRKA 1T2EA 2IE0A 2NQTA 4A2CA 3D3WB 3DHNA 5L3ZA 3RQSA 5HRUA 4UAGA 1D1SA 1LSSA 4Z9XA 3K92A 5ITWA 2X22A 4L4RA 3NRCA 4K26A 2GR9A 3MTJA 1C3VA 1EFLA 3PZBA 2OXIA 5G4KA 4HFRA 4Q3NA 4GMGA 4JLWA 3WLEA 1YQGA 3ZNOA 4I5GA 4Y6PA 1ISGA 1P44A 3RCBA 3DTYA 4WLNA 2PH5A 4BB5A 4YWJA 3PWSA 4YPOA 2X86A 3BTUA 2DKNA 3B1KA 3DONA 2VTDA 3AFNA 1O6ZA 1Y5MA 3BMQB 2FWMX 5IZCC 3COSA 3EK2A 4WCFC 2P91A 3VDRA 4DLAA 3R0IA 3Q2IA 5ICSA 1ZNQO 1ADBA 1ZK2A 4L74A 1RWBA 4XR4A 4IQGA 2Y0EA 1NQAO 4E3ZA 3S2FA 5DP2A 1H6CA 3AJRA 1YBAA 3DZHA 3L9WA 1B8UA 2RHRA 2UYYA 3ANMA 2FZEA 3QV1A 4CM4A 3VH2A 3H5RA 4QX6A 1GV0A 3E5RA 2EWMA 2GNAA 1U3UA 2UUOA 3TSCA 8ADHA 5TRTA 4QSMA 2OFPA 1HE3A 2DTXA 4CPDA 4UVHA 5TIIA 4BMSA 5KCZA 4RQTA 4UVGA 2O2SA 2B69A 3OBBA 1Y5RA 5JDIC 1E92A 3MJVA 3GVXA 5FYDA 1LLQA 3C8MA 3OETA 1R12A 3K31A 1K6JA 2YQ4A 3SJ7A 1V9LA 3OA0A 3WSVA 4HFJA 2JD0A 4JIGA 3QVXA 2H9IA 1V3TA 1ZEJA 4NFYA 3DBLB 3HWRA 4OKIA 1YJQA 5DBFA 4DIFA 4W9NA 2UUPA 3TFQA 3GK3A 4IGFA 1KY5A 4KOAA 1AHHA 3JD4A 2J5QA 1FMCA 1M66A 5BNFA 5A9SA 4UREA 2YFHA 2HQ1A 3H3FA 5IN4A 1R0KA 2DBZA 3CUKA 2A35A 3H3JA 1WXDA 1YJ8A 3UVEA 3H9EO 2NTJA 3GMDA 2YYYA 4CLDA 1A9ZA 3HN2A 1XLTA 2QRJA 1MC5A 2D3TA 5CP8A 1M6WA 4B4WA 1Z7EA 1A4UA 3W8FA 3GNSA 3MOIA 3T7CA 4GKVA 1ZVMA 4WOKA 4AJJA 5BSFA 4J16A 2AW5A 3JQ9C 5EERA 2VYNA 1P3DA 4M49A 5DBIA 3SXPA 2JFFA 3DAPA 3AOEC 1ONOA 4GLLA 5ES3A 1ZK0A 3G3EA 4DL9A 5TSDA 4KQXA 4YJHA 1ZCJA 5JYEA 3NT4A 3PJDA 5A3JA 4D43A 2NV6A 4B4OA 2DAPA 3T4XA 1V6AA 3ZW8A 3GAZA 4J43A 2Q46A 4AJ1A 1PL8A 4HWKA 1Y1PA 5JDIA 3AUAA 3NV9A 3HHPA 5A03A 3RC1A 1E77A 5A05A 2QX7A 3NDIA 4WNCA 4EJ0A 1PQPA 4R01A 4XYBA 1HE5A 4LISA 3AUSA 4PG7A 4YJGA 2IZ1A 3ZNPA 2DUWA 1X1EA 3JQEA 1HSOA 1U8FO 3EHEA 4R9RA 4NQZA 2X5KO 4GX2A 4S3MA 3U62A 4MP6A 4AFNA 2AHRA 1B14A 4FGSA 1DPGA 1WDKA 1Q7GA 3I83A 3FRJA 5TNXA 7ADHA 3CMCO 3NDRA 5ENDA 4W82A 2ZKLA 3PGXA 1PJSA 4FFNA 4IBOA 2I9PA 4DPLA 2G17A 4R68A 4CMEA 4CM4B 4B3IA 2X8LA 3C1AA 4KUGA 9LDBA 3OEYA 3WWYA 4AJ4A 5COQA 5AQ1A 1MA0A 4B3HA 2ZTMA 1R4MB 3MWEB 4B79A 3QP9A 4IMRA 1T1SA 3CEAA 4OQYA 3K2EA 4PZCA 4E4YA 1PJ4A 1QV6A 3GC6A 4IDEA 1NBOA 1DIGA 2PH3A 3JCZA 1PGPA 2EHDA 2I6TA 3LQFA 2NU8A 3VH4A 4H7PA 3OJEA 3OIFA 4TVBA 5G2OA 2GSDA 4L0QA 3BIOA 4ND3A 1JVSA 1UDAA 5EQDA 5A02A 5EPOA 3RKRA 2QZZA 1QYDA 4U6SA 4IDGA 2ILTA 1E3JA 4RVSA 2QIOA 2NWQA 4XDYA 1YWGO 3DL2A 3TOZA 2Y1FA 3M1AA 4BNMA 1B15A 1M67A 1IL0A 4QO7A 3KO8A 1PJ2A 5ICMA 2PD6A 5T64A 2GCGA 1I2ZA 3JQ8B 1DRWA 3KSDO 3RBVA 1B0AA 2IEBA 4WLUA 3C7DB 3RWBA 3NGLA 3WQSB 3F46A 4ZVVA 3CPSA 4M87A 1NFFA 3WQQA 4CM1A 1EVZA 5EINA 1XWFA 3DBRA 3RBZA 6LDHA 1ONNA 1O89A 1UR5A 4PLFA 2XXJA 4ZRMA 1P74A 2D5CA 2Q3EA 4TZTA 4DIOA 5FEUA 2JL1A 3R3JA 3HUDA 1SB8A 3VOSA 2TMDA 5JSFA 4B8ZA 4U0KA 5JPIA 1C0IA 1GYRA 3VTZA 4BNJA 1MLDA 4RVHA 4HY3A 2Q1UA 2HMTA 1IULA 2OO5A 1PWXA 3INTA 3JD1A 5H81A 3PLNA 4RZIA 4QT0A 5ER9A 4IXWA 4WUVA 1NVGA 2HMSA 4UEJA 2WYVA 1XYGA 3ROQA 2GDZA 1ZZEA 4NJOA 4CM3A 1VJ0A 3O8QA 3BAZA 3PYLA 4KQWA 4YTEA 4IIUA 4DC1A 2AQ8A 3OQ1A 1AE1A 1E7WA 3ENKA 4B3JA 2DPHA 3TZQA 1HL3A 1JWBB 1UXJA 4HXYA 4XB2A 4OM8A 5GZ3A 1S6YA 4JN6B 3AI1A 5KIAA 4FD3A 3ZU4A 1BHSA 4CLHA 3RFXA 2P5YA 5G0VA 3H6KA 2GASA 1RM0A 3FWNA 4CUZA 3P2OA 4D0RA 1PS0A 1HETA 3BMCA 1XU7A 3PHJA 3AOGA 3NJ8A 1T2DA 1Y8QB 4ONEA 5G4LA 3KBOA 1GQ2A 4NMHA 4CJXA 3JYLA 4XRRA 3A06A 4E2ZA 2HU2A 4IDBA 1B3RA 4RGBA 4H15A 1NNUA 4J0EA 3PK0A 2RH8A 5TJHA 2Q99A 2NVUB 1NPTO 1NAIA 1M2WA 2E49A 3Q11A 4JX8A 4DYDA 4IZHA 1U5AA 1PJ3A 5T6BA 3HN7A 2YHIA 4C4OA 1XQ1A 1FDSA 3W8DA 1NPYA 2JFGA 4P4NA 1LBEA 1U2DA 1VSUA 5IXYA 2ZCVA 2EW8A 2Q4BA 4E5KA 1M76A 2DFDA 4XDZA 1GFSA 4IDDA 3JD2A 3WGTA 2V6GA 2DT5A 5BSGA 3FNHA 2GGSA 1VI2A 1JN0A 1C1DA 2ZYAA 3GHYA 3SEFA 3KYDA 1PGQA 3P5SA 4P4GA 2WEKA 4AVYA 1NVMB 2FZWA 4MVJF 5G0WA 4MVJA 4N5NA 1RJWA 4PZEA 3IJPA 2HSDA 1A7KA 1D1TA 5KVSA 1C14A 1ARZA 4Y67A 4KMSA 1NHGA 3JQCA 5IDQA 1DIAA 3G49A 2ZYGA 5L95A 1N1GA 1GEEA 2PTGA 4ND5A 1JWAB 2X0NA 2WE7A 2NUAA 4AJOA 1XA0A 2QQ5A 4B8WA 1AN9A 1GAEO 3MJSA 5CPFA 2VCYA 3U4DA 1A71A 5CDUA 4Q3CA 1G6KA 2D2IA 3KYDB 3PWZA 3QW2A 1GZ3A 4BO5A 5L4SA 2J3KA 1BRMA 1I8TA 1K2WA 4E12A 2C54A 2B0JA 3O9ZA 4CMKA 1GQYA 2YFQA 1B2LA 3QLJA 2QHXA 4NBTA 4GMFA 1IE3A 4Q39A 4J1NA 3RC9A 2X9VA 4R69A 1HE2A 1LU9A 1NR1A 3KM0A 5L4LA 3GEMA 4FJ1A 1N7HA 2DBRA 1H5QA 4IDCA 1CIVA 3ZHXA 3QWBA 3DO5A 1WMAA 3WMWA 1E3WA 3D0OA 4BKRA 2XOXA 1I2BA 4LRTB 4BB6A 2CNBA 4MPDA 2AQIA 4YRDA 5F1KA 4J6FA 2BLLA 4FFRA 1RKXA 3GLQA 3LLVA 3HB5X 1NX6A 4MKZA 1YBMA 1E7MA 2OP1A 1TLTA 4FOSA 2X1HA 4FW8A 4W9NC 3UFXA 4WPGA 4NJMA 3ZI0A 4FC6A 3PYMA 5AYVA 1LQTA 3DBHA 5JCJD 2YV1A 3W1VA 2R00A 2FR8A 3DFUA 4RPJA 2AMFA 3MJTA 4OXNA 1QLHA 3ROMA 5KKCA 1UUFA 3U49A 4GL4A 4WLVA 1U1IA 4CM6A 1GL3A 2Q1TA 3C1OA 1O5IA 4G5HA 3RROA 1SCUA 1T26A 4XJTA 5KNLA 1LA2A 3BMCB 3F3SA 4RF4A 2NU9A 1HYGA 3MTGA 3E9NA 3PHGA 2YHUA 4DTIA 4EJ6A 3ANNA 1DRUA 4RCVA 2DC1A 2Y1CA 3WNQA 4PLTA 1ML3A 4WNIA 1G1AA 3DBRB 4HFNA 3JQAA 4MKXA 3TL2A 1SEPA 1U3VA 2PZJA 3IAHA 2IYPA 2BFOA 3F5SA 3SJUA 3ZNQA 5T67A 3CE6A 3RFTA 2PY6A 5FFFA 3UHAA 2YJZA 1SOWA 2PGJA 4KP7A 1NM5A 2VT3A 4N7RA 5G0TA 4CMJA 1EE9A 1JVBA 3BTSA 1U3TA 4CLOA 1N92A 1B26A 3O26A 3R3SA 5IG2A 4GH5A 3WQRA 4DQXA 5L45A 1F8FA 2P9GA 3ZZNA 5CPBA 1IPFA 3KLMX 1UJMA 4D0SA 2HMVA 3U0BA 1GYQA 5AOVA 2VYVA 1JLLA 4ALIA 1Q1NA 3QVWA 1HRDA 4J1TA 3CMMA 3DQPA 1DEHA 3P7MA 1Q7BA 4KZPA 3DDNA 4XYMA 5U1PA 3ST7A 1I30A 4JQCA 3K2BA 3VKUA 2DVMA 2G5CA 2DBVO 3I23A 2F00A 3LC1O 1QP8A 4WLOA 4E21A 2EGGA 4B4VA 3I5MA 2O3SA 3KXDA 4RZHA 1DSSG 1VLLA 2C29D 3ONDA 3TZKA 3ADOA 4ND4A 5C37A 4NHEA 3OF2A 1BXZA 4IQ8A 1EMDA 3RKUA 1NTOA 3RU9A 2NADA 3NTRA 1GCUA 3QVOA 4J2HA 1CEQA 3DZJA 4GLOA 4OYRA 4CR8A 2CDBA 3AI2A 3JQGB 1ZK3A 1ID1A 1PSDA 3ZU3A 3B1FA 4BKOA 3MCVA 4J0FA 2PZLA 2HK9A 5DT9A 2AEJA 4NG5A 2AG8A 2OORA 5ER6A 2CZCA 4BNHA 2WJPA 4ZA2A 4BS9A 5B37A 2G0TA 3AY7A 5HBRA 2BELA 2B5WA 2R00C 3FBGA 3I3OA 1I24A 1UAGA 3DWFA 3WJ7A 4CMIB 1PZFA 3DBLA 3VTFA 2EJVA 4U0JA 1KY4A 4YJGB 1P45A 1NASA 3E6AA 3M2TA 5I8WA 2W90A 4GGOA 1H9BA 3INGA 2YV3A 1I3LA 1P0CA 1IZ0A 1Y8RB 1J0XO 2DU8A 3FR7A 3ZV4A 4ZHSA 3I9LA 3JQFC 1BG6A 1GPDG 2C2XA 3WGOA 5JLAA 1BW9B 3LYLA 4YT4A 3AM3A 1WZEA 4P4LA 1CQIA 1QSGA 3OECA 3UXYA 5KVCA 1H2HA 2QRLA 3A4VA 4JNKA 4RQUA 3KETA 5KTKA 3VH1A 1LSOA 3D7LA 3EYWA 1E0DA 5TQVA 4BMNA 3WGGA 3H2ZA 2Y0CA 2QG4A 3ETEA 1ISMA 2WD7A 3LU1A 4YCAA 4RJTA 4GAEA 4RO0A 3RD5A 4TQGA 1I01A 2Q45A 1UP7A 4R1SA 3FNFA 4J9VA 1PWZA 2RBEA 3ZWWA 1WPQA 3P19A 4BGEA 3C3XA 4K1LA 4R54A 5COBA 4ITUA 3ASVA 1UXGA 4PRLA 4E0BA 2Z5LA 5I9NA 2AA3A 2YW9A 3IIEA 4XD2A 2YUTA 4XX0A 3SC6A 5A4DA 1K6IA 2BGLA 5F21A 4NZ9A 3F1KA 4ZQHA 1MG0A 3RIHA 3ETGA 3AM5A 3KB6A 3GFBA 1IYZA 1UDCA 3DMTA 1CWUA 3EZLA 3FD8A 3JTMA 4PLPA 4X54A 4R51A 4Y98A 3V1UA 4Q3EA 3K9QO 2WYWA 1JA9A 3WMXA 4ALJA 2I76A 2CVQA 4NH4A 3ITDA 3GVHA 3V5NA 3VVCA 1NHWA 3HADA 4BNUA 1NWHA 5LDGA 1N7GA 2P5UA 4WCFB 3W4JA 3JYQA 2EP5A 1PJTA 3FHLA 3KVOA 1QORA 4XB1A 4LN1A 3QVTA 4A26A 3T7EA 4BV9A 5T8KC 1HDYA 4XGIA 1P1RA 1Y8RA 2GRAA 2X9NA 2C2YA 1PQWA 3LT0A 2Y99A 3JQ7B 5G0UA 1Q0HA 3F4LA 1B7GO 2Y67A 3OIDA 3RI3A 3BMNA 4JCOA 2ZQYA 3UF0A 4CMCA 3U09A 4IM7A 2QYTA 3DTTA 3DZBA 2D4AA 2JD2A 4Z3DA 3C24A 1EVJA 3W4KA 1EK5A 1HF3A 2X0RA 1D8AA 4LRSB 3HE3A 3GGPA 2VHZA 4JJIA 1BDMA 1GADO 4Z9YA 4R3WA 2FN7A 1YO6A 1R15A 4YR9A 4YJHB 2JFHA 1FDUA 3DZFA 1LUAA 1OOEA 2ZIZA 2PGLA 4U7WA 1E3WB 4CM9D 1DC3A 3K6JA 1FDVA 1SNYA 3FPLA 3PGJA 3PVZA 5DOVA 4DPKA 1Z6ZA 4E2XA 1ADFA 1L7EA 2VUTA 3DZGA 4RDHA 2XF8A 3BMOA 4XYLA 1Z45A 4P8RA 2PZKA 4AJPA 3JQAD 4IS3A 4ZJUA 5JYDA 5ADHA 2IZZA 2CDAA 2A92A 4ZQFA 2JCVA 2CDCA 2PGDA 4DVJA 3WLFA 1E6WA 1HTBA 3HDJA 2AE1A 4BNXA 3KSZO 1IOLA 1DFGA 2CF5A 3WYEA 3PHLA 2VT2A 1HT0A 4J90A 2YV2A 2X9GA 5BNIA 2WWRA 5C5IA 1MB4A 4MP3A 4EUFA 3VAZA 1KC1A 3JSAA 2FMUA 3WWZA 1KETA 1XQ6A 1CF2O 1I3NA 3CZRA 2XPCA 5AXBA 2E6UX 2C82A 4D7AA 1LEHA 3I1JA 5CG2A 5GY7A 2VWGA 5I9MA 3TQHA 1R37A 1NQ5A 2EV9A 3AI3A 5THQA 4OXYA 2D5AA 2BRUA 1Q0LA 4FSHA 1YB1A 1MFPA 3GUYA 4RF3A 2VOJA 4CQMD 5F3RA 1PJCA 1KVTA 4I9HA 4Y9DA 3ICPA 3WXBA 3DHYA 1A27A 2VYVD 3B6ZA 4BO0A 4RL6A 4FS3A 4YRAA 4GBJA 2W8ZA 2FY8A 5CDTA 4UVDA 1DAOA 4ND1A 1PS8A 1RYDA 3FR8A 2B37A 3ASUA 1NR7A 3E9QA 4UUPA 1GEGA 3ADPA 4Z0TA 4D3SA 4HBGA 4BNFA 4FC7A 4ND2A 3HDYA 4ZQBA 2BH9A 4YAIA 3MOGA 1ISFA 3EW7A 2YHIB 4J3FA 3OH8A 3Q0EA 4YEDA 4R9SA 2Z1MA 5I8ZA 4A7PA 5JW6A 5HWSA 2WTBA 3EC7A 3HSKA 1WNTA 2NVUA 5JMWA 1H6BA 3WGQA 3K73O 3NX4A 1PL7A 1N1EA 4K28A 2P4QA 2Q50A 5DCWA 3F5QA 1FJHA 3WNVA 1PL6A 4DQUA 3GGGA 3P2YA 3ZWNA 1YH3A 4BNWA 4B7CA 1LDNA 1ZMOA 2B4QA 2HDHA 5JXWA 5G0SA 3OJFA 1SBYA 3ENNA 2W2LA 5I7VA 1YB5A 4LMRA 4RDIA 4BO3A 1YONA 3OFSA 2VQ3A 3WR5A 1YB4A 1OC4A 1P0FA 1TEHA 3WYBA 4J4BA 4F6CA 2BHLA 1PTJA 2CSUA 5C7LO 5L7YA 1KEWA 4JK3A 4PG4A 1PZHA 3Q6IA 3WS7A 1UZLA 2GERA 2NLOA 1HE4A 2FR0A 2V6FA 3L0DA 4PLCA 1D3AA 1K0UA 2EGHA 2B36A 1E5QA 3VH3A 4TVOA 2Y66A 3FI9A 1TXGA 2C0CA 3GR6A 3EVTA 1O0SA 5EIOA 3BMQA 5BSHA 2CVZA 4PLZA 1CETA 4DRYA 1HKUA 5KJFA 3QQPA 1WZIA 3GDOA 1DIBA 1IPEA 2Y1DA 3HFGA 4D45A 2NQ8A 3NGXA 4MVJH 3K5PA 4M54A 4BKUA 3OHSX 3AUUA 3PZRA 2V6MA 1WAMA 3D3EA 4EEXA 1ZXLA 2HK8A 4F6LA 1UAYA 1DHTA 4XEHA 5IAAA 5JAZA 1TB4A 3PTZA 3F1LA 1VL8A 2VZ9A 2O3RA 2VWPA 3GQVA 1PR9A 3S2GA 2FSVA 1G0OA 3IS3A 3O8QB 4NI5A 1BSVA 1WMBA 5I7SA 2C5EA 2EF1A 4YBZA 2OL4A 4CM9A 4NU5A 3PPIA 5EQFA 4OO3A 1ENZA 2Z95A 4BO6A 2IXAA 4AJIA 5JAIA 3MJ4A 5L40A 1YQXA 1GY8A 5HTOA 4YXFA 1IHYA 2ZB4A 5DCYA 4KWHA 1H6DA 3GFGA 3ZWMA 1UXHA 1C1DB 1H9AA 4CQLB 4G2NA 4AJHA 3V1YA 2EG9A 3NTOA 4BNYA 2ZB8A 1AXEA 3ULKA 1H6AA 3CZMA 1YL6A 3Q9NA 2FPIA 3NYWA 4BGIA 4BKQA 4BO4A 1MC4A 4YAGA 2JAPA 4BNLA 5A5FA 5TT1A 3H4VA 3W6UA 2JJYA 1WLYA 3VZQA 3DOCA 2Y68A 1NYTA 3A14A 1R16A 2EIHA 3ZGYA 2O3UA 3PRJA 1TT5A 3FSRA 1X13A 1KEVA 1DIRA 3X2FA 1RPNA 4YQZA 4EEZA 1PGOA 1AUPA 5EESA 1QYXA 2X0JA 1YS4A 4FFLA 3DZIA 4PG5A 2HRZA 5GZ1A 4XWYA 1HWYA 2NM0A 3C85A 3PFWO 6ADHA 3ON5A 4IJUA 4EZBA 4GPD1 4RF2A 5TJ9A 1H2BA 1ISIA 2YZ7A 4OKNA 4WEOA 1WW8A 5KJEA 2LDBA 3TPCA 1ZFNA 3IJRA 2F1KA 1X7HA 5A5EA 4URFA 3WIEA 1PQUA 1WP4A 4TROA 3RVDA 4F46A 1SOVA 4AG3A 2EKPA 3RC7A 4FDAA 3N7UA 4ILKA 1DOHA 1I2CA 5HS4A 4LSMA 4QECA 1UXKA 5A04A 3GA0A 3PJEA 1E3IA 4WK6A 2HJSA 1I33A 5EJ2A 3U4HA 2G1UA 3M1LA 2OP0A 3RU7A 3PQEA 4ALKA 1XEAA 3INRA 2HMUA 1HYEA 1T4BA 1IHXA 1L7DA 4YJFA 4DLLA 1YOVA 2Q1SA 4GQAA 2WDZA 2JD1A 2HKIA 2ET6A 2OUIA 4CR6A 2O50A 3GPIA 4RORA 1E7QA 2HCTA 2Y93A 3C7CB 4IZIA 4CQLA 5IN5A 1Q0QA 5JDCA 4BO8A 3BTVA 3FNEA 2D59A 1DC4A 2H63A 4KDFA 4PGFA 5L7WA 1UZMA 2D8AA 3GVCA 3RAJA 4MVJD 1U9JA 4NR0A 1EVYA 3VPXA 2GN6A 4UUOA 1YE3A 1LX6A 1W6UA 1R6DA 3PHHA 5HS6A 3D64A 3JQ7A 1B16A 1ZK1A 3A9WA 3ZWOA 3KEOA 4HADA 4WLEA 4NDNE 1ZIDA 4BO2A 4HV4A 2O23A 5JY6A 2QYSA 2VTEA 3E03A 1V35A 3SBOA 3AY6A 2VN8A 5K6AC 3LSYA 2CUKA 3IQDB 1ORRA 4GX1A 4R16A 3EVNA 4PG6A 5F1OA 4PLWA 4A5OA 2Y1GA 3ZH2A 3VC7A 4PN3A 4L8VA 1QYCA 2O2YA 1YRLA 1JQBA 3IMFA 4MIOA 3U9LA 3DEYX 4TKMA 5F1PA 3A1NA 3DAGA 4DBZA 5ENVA 2E82A 4HNHA 2X5JO 4NBVA 3PIDA 2AQHA 4DLBA 2OBNA 3WSWA 1GCOA 2DUUA 1LDMA 2JCXA 5IDYA 3E8XA 4Q3DA 3H65A 3S1LA 1U7HA 4L4SA 3ROKA 3VDQA 3FWZA 4K6CA 1PIWA 4Y6RA 1NP3A 3E5MA 1ZK4A 4BIIA 4E6PA 5A9SB 1K6XA 1ENYA 2JCYA 5TX7A 3JQFA 4HNGA 4M89A 3MJEA 3HFSA 2GPTA 4NBRA 3F47A 3ANLA 1E7YA 3B20A 1X7GA 3ROPA 1D4FA 1X0VA 4ESOA 1VKOA 3I4FA 3UAGA 3NUGA 1VM6A 2PA3A 4I1IA 4L9RA 5EL0A 3KHUA 4A73A 3IKTA 4FIZA 1C0LA 1WVGA 4ROSA 2VWHA 3WIDA 4INAA 5IJZA 5KJ1A 4EITA 3WJAA 4MDHA 4E31A 2R6JA 4FGWA 4B7XA 1MXFA 1LSUA 3M6IA 2DQ4A 1LC0A 3NT2A 4I08A 4TRNA 1X1TA 3ZNNA 1N2SA 1N5DA 3Q9UA 4BNIA 4TRJA 4DREA 1OI7A 3NKLA 5B12A 3KEQA 4OIMA 2ZYDA 3UH1A 3IL2A 3EGOA 1C1XA 4AJKA 4CM5A 4EYEA 2DFVA 2NNLD 2VRBA 1G0NA 5CEFA 3GUCA 2W2KA 5JBIA 1RM3A 2P4HX 2Z1NA 1P1IA 2O3JA 3O4RA 2O7QA 4WJZA 3ZDFA 5ITVA 4D44A 2O4UX 1AXGA 3DMYA 1U4OA 3DXFA 2RCYA 3GPDG 3E48A 3ZU5A 4TMFA 2J5RA 1P77A 3WX0A 4EW6A 1EVIA 3GMSA 3OICA 5DOZA 3VZSA 3BMNB 3D5TA 2C59A 3Q1LA 1M6HA 3PP8A 4JP2A 3WOHA 3AFMA 3JYOA 5CDGA 2NACA 3I9OA 3TF5A 3KYBA 2QW8A 4BVAA 1GV1A 3E18A 1I0ZA 5DDIP 3ZWXA 3VZPA 4WASA 4IXTA 3ZW9A 1JTVA 1PX0A 2HJRA 4WOJA 4IDFA 1NVTA 1PJBA 4BOYA 3W6ZA 4PLVA 1VKNA 2V6BA 1E1NA 1VRWA 4LCEA 4M55A 5EN4A 5JCXA 1JW9B 4P38A 3L9XA 5L53A 4CODB 5FI3A 1GZ4A 4CUKA 1CERA 2B5VA 3LF1A 1R0SA 3GEDA 5A9RA 3KV3O 5CHEA 5CEEA 2BFMA 2UVDA 1EBUA 1YXMA 3LLSA 4GVLA 1B3BA 4MOWA 3U5TA 1LRKA 3WGHA 5KKAA 3Q2KA 4F3YA 1PZEA 3CXRA 1OC2A 2C7GA 5DBGA 1W4ZA 3TNLA 4QFCA 5GMOA 1SZJG 1XR3A 5LCXA 4OSOA 4RVGA 3RUDA 1R4MA 1RYEA 2Q1WA 4OH1A 3X2EA 3QVSA 4OSPA 5MDHA 3M2PA 1QRRA 4OHUA 3ABIA 4YA6A 3I6IA 3I6QA 4E5YA 4KTVE 1NQTA 4JJGA 5JCJA 2H5LA 2W2KB 4OQZA 4DIBA 4WLFA 3EAGA 3NJ4A 2X58A 5AXCA 3S8MA 4CV1A 3FNGA 2H1SA 4JJFA 4O1MA 5JAMA 3H5NA 2VRCA 1C1XB 1EFKA 1HZJA 1XELA 2AEFA 1AGNA 1XIVA 1Z74A 1LQUA 3PWKA 2PK3A 5KJCA 2GN4A 1SEVA 1H93A 1VC2A 2OMEA 4LGVA 4BNZA 5JS6A 4IPTA 4BNKA 5A1TA 3D3WA 4Q9NA 1OBFO 2WMDA 3GGOA 1MG5A 1DHRA 3WDSA 2CMDA 5C7IO 2J3IA 2TMGA 5CG1A 1R4NA 3ZHYA 1LTHR 4LVCA 4A10A 2A94A 2GZ1A 5JO9A 1E3EA 4FCCA 3V2HA 3BTOA 4J49A 1PS9A 1TVEA 1VL6A 3MZ0A 3V8BA 1JAYA 4YAKA 3JQBA 1H94A 4GSKA 3PLRA 1VL0A 2W98A 5JMPA 2NVBA 4DUPA 4MVJG 3WB9A 3G79A 4ZN6A 2P9EA 3KSUA 1NQOA 2BGKA 4GWGA 4OXKA 4M1QA 3K96A 2HUNA 2PNFA 2JHGA 1I5RA 4IJVA 3GDGA 3JQ9A 3NDJA 4FJ0A 3GG9A 1X15A 3PJGA 1KBZA 2X23A 4FOOA 5DNAA 1XGKA 3V1TC 5CDSA 4NFSA 3JYNA 3GRKA 3AY3A 1GZ6A 5TC4A 3WGIA 3OJOA 1J6UA 5L4NA 5KVVA 1MFZA 1GUZA 4XIYA 3DZKA 3S2IA 4CMIA 2LDXA 5HA5A 1LDBA 3VPFA 4J9UE 5I7FA 4N18A 1YBVA 3G1TA 3DOJA 1ONPA 1C0PA 4G65A 2X4GA 2RH4A 2ZCUA 1E3SA 3G0OA 1JU9A 1ZJYA 2FP4A 2FR1A 2V7PA 4AJEA 4RVFA 3W4IA 1Q2XA 4MIEA 3NTQA 1YQDA 4I9NA 3TZ6A 5BR7A 4CQMA 5B4UA 3AU9A 3WYCA 3I9NA 4DA9A 2ZB3A 4J4TA 3WG9A 3GH3A 4XJSA 3HDQA 4WGGA 4CM7A 3H7AA 4PVDA 4OL9A 3ZWVA 3JQDA 2NU6A 1VJ1A 3EZYA 4FPXA 1PEDA 3DBHB 1I36A 1F0YA 3OMLA 1MXHA 4YT5A 4CV2A 4CLRB 3OIGA 1WWKA 3OP4A 5AVOA 1YOVB 1NFQA 3UKOA 1E1LA 1F06A 2W4QA 4QTZA 3VKVA 3IP3A 4WEQA 1N8KA 1RM5A 5JFOA 3PYXA 3QRWA 4ZRNA 3V2UA 1U2GA 2ZB7A 3HDHA 4PIVA 4EDFA 4FFPA 2SCUA 3WTCA 1BGVA 4E33A 4B4UA 2GUGA 4ZD6A 4E5NA 4EUHA 4XQCA 4IMPA 4BO9A 2CVOA 4R1UA 2BI8A 3SVTA 4J7XA 2X6TA 3JQGA 4ZICA 1U8XX 1UP4A 1KVRA 2NTNA 4YB8A 2O7SA 2DTDA 1GR0A 3E82A 3RASA 3A28A 5JNLA 2Y0DA 4LMPA 2B4TO 1XSEA 4E32A 4DC0A 1J49A 2A4KA 4U5QA 1XDWA 1E1KA 4NU6A 3HNPA 1O8CA 4WECA 3QWHA 2IZ0A 3FPCA 1KOLA 5TGDA 4NBWA 3TRIA 4FJ2A 4U8GA 3WGZA 1KEPA 4HP8A 1C0KA 1O94A 4W4TA 3PJFA 4XIJA 3PDJA 2O3QA 3CKYA 1OMOA 1T1RA 1GD1O 2WD8A 5U4QA 2J3HA 5ILGA 4PVCA 3RUCA 1W73A 1PJQA 1Q7CA 3PHIA 1SO8A 1P31A 3DFZA 3K30A 3GF4A 4QXMA 1PJLA 4YQYA 3L07A 4DQVA 2BKAA 1IY8A 2AEMA 3ZN2A 1UXIA 3PIIA 5K0ZA 3BHIA 3ICCA 2YQ5A 3L4BA 1T4DA 1A4IA 1HXHA 4BUCA 1T2AA 1E7SA 1YL7A 1BMDA 1VJTA 1UP6A 1DAPA 3TOXA 4IGEA 4WE3A 2OBYA 1SMKA 1HEUA 4N5LA 4XQGA 1IB6A 1Y9AA 1ADCA 3LK7A 4BNGA 2PWZA 4XCVA 5KWEA 1XHLA 4MP8A 5IDWA 1JKFA 2GF2A 3SLKA 3QWIA 4Z9FA 4XR9A 1KS9A 2EKQA 1Z73A 3G17A 4R1TA 5DN9A 1VPDA 1Y8QA 1YKFA 4Y8VA 1GUYA 4F45A 1LSJA 3TZHA 1F14A 3RBXA 1K89A 4QO8A 5B4TA 5BSEA 3GN2A 2FPPA 2HLPA 3RC2A 1BWSA 4XZ3A 2VWQA 3D4OA 2Q2WA 4MINA 3O03A 3HZZA 4Y6SA 2CY0A 2I3AA 3DBVO 4ZGWA 4N54A 1HDZA 1Z82A 4XYEA 3CIFA 1ZSVA 3U3XA 1NPDA 3L6DA 4GI2A 4KUEA 3GVPA 2WE8A 2A9FA 4JROA 3KTDA 1Y6JA 4IS2A 1R0LA 4BNTA 1HLPA 2Y05A 2GN9A 3UW3A 1ZO8A 1W8DA 1ZSNA 1BVUA 5COAA 3ZV6A 4KDEA 4TWRA 4CMGA 4Z3KA 5IDXA 3IP1A 3EUWA 4C7JA 5TF4A 2C5AA 1KVQA 3QA9A 4BO7A 3ONFA 3GT0A 2VZ8A 5DULA 4J1SA 3MWDB 2BF7A 5I7EA 4W7IA 4O0LA 1LRLA 3UCXA 4DBVO 3JD0A 4EBFA 3PFFA 1HZZA 4RPLA 4BNNA 1X14A 3O38A 1Y81A 1X0XA 3NT5A 4RV9A 1YVEI 2YDYA 4R5MA 2UAGA 3AOEA 3RUHA 3HG7A 4HFMA 1ZW1A 3GG2A 4QEDA 3TL3A 4CM8A 2D0IA 1P1FA 1XCBA 4IQ0A 3UUWA 1LLCA 3RJ9A 2PD4A 1W0CA 4DPMA 3L4SO 4MJLA 3F9IA 9LDTA 3I4CA 3JD3A 3WBBA 3OEWA 5IZCA 4I9UA 4NFHA 3N58A 4RPHA 5J23A 4MVJI 4TRMA 2C20A 2R2GA 4NIMA 4L75A 4YVFA 5BT9A 5C7OO 4FB5A 3I9MA 4E30A 5HM8A 2VYND 5JDCC 1K3TA 4PLHA 5DF1A 1V3VA 1PZGA 3LVFO 2VRCD 2J8ZA 5FWNA 2E37A 2IDZA 4H16A 2GN8A 3FF4A 3E9MA 3D4PA 5DP1A 5FI5A 1J4AA 1OFGA 1PGJA 1UH5A 3KRTA 4OJNA 4J7UA 4C7KA 3STHA 2YY7A 1ULUA 2FPGA 3BMOB 4YYZA 1GDHA 3JQ8A 5IXSA 4E5MA 3IKVA 4GKBA 1ISHA 1V3UA 2I67A 4FFOA 2CF6A 1JAXA 1H0KA 4RPGA 1XG5A 1E6EA 2GO1A 1LC3A 3BXXA 3L77A 4FQ8A 3DHEA 4GGPA 4YDRA 1DDOA 3FBTA 3UCEA 1KVUA 4CMAA 2E4AA 4W7HA 1U28A 2FRDA 5JE8A 7MDHA 1EZ4A 1N9GA 4RLHA 4OGWA 2G82A 1HDRA 3CSDA 5MGBA 1WDLA 1DC5A 1JDJA 1ZBQA 4PFJA 2VNAA 4CR7A 2Y1EA 2PKQP 2WSBA 4ZQEA 4CLRA 3K8ZA 1U5CA 3LF2A 4XQEA 3OQ6A 1ISJA 1TA4A 4R1NA 1DIHA 1KEUA 3S55A 4CV0A 4QFDA 3WTBA 3ZWCA 4H3VA 4AJLA 1A9YA
chains in the Genus database with same CATH superfamily
1SIBE 1N5OX 3C6XA 2HPHA 3C4QA 2OQ2A 2VHCA 3WP1B 1H4VB 3FMPB 4HATA 2WYOA 5HJ2A 4DA0A 4MWBA 2WYUA 5HR5A 2MWMA 1PGNA 3LY9A 4M0KA 5KC9A 2ZWIA 2QT9A 3EXEA 3M3DA 1N6RA 4BEJA 3UUEA 2X3UA 1N2ZA 4IDAA 1TRKA 2C9OA 2WIKA 4LWZA 1E4EB 1TI7A 1KAHA 4XD7A 3LCRA 2HU7A 4LQCA 4Q4HA 2YV4A 3OWXA 2XYQA 3ZWKA 1ZMBA 1KRXA 2PGXA 4Q3AA 16PKA 3RVRA 4TLBA 4TKVB 2Q3BA 5L3SA 2UYHA 3R8CA 4N41A 3CUVA 1TOAA 2QMQA 3FX2A 4B6EA 5EUMA 2GETA 2JKZA 5FPPA 2G63A 3V7WA 2GD6A 3Q7QA 2CXPA 2WJGA 4ZXFA 4C4ZA 2P3LA 1T0BA 3LT2A 3I9KA 3O3MB 4NK4A 5BN4B 4TSFD 4TTIA 1R5BA 1EFRD 4CUJA 5DNEA 2E4VA 2QENA 2DE0X 1ESNA 2IBMA 1TGYA 1BH2A 2ZKIA 3DEJA 1ZNWA 1SXQA 4HC4A 3O83A 1WABA 2IEDA 4AULA 1MC8A 1LI4A 2NUPA 3VPGA 2Z30A 3R0QA 3MGAA 2J7KA 1CUJA 4UMVA 4JJ6A 3LDHA 1QMGA 4MVJE 2B94A 1PV2A 4P5EA 1KERA 1QNLA 1SHUX 2P7HA 4IG9A 4UBNA 2F9LA 5DTJA 5FHQA 3VVBA 1VDMA 3BZWA 2LR0A 2FNAA 2ZM5A 4CMBA 1EBBA 1N9GB 2A3NA 2OK7A 3L7NA 3QX9A 4R05A 2DM6A 4ZODA 3AESB 4BLPA 4JHLA 3T3GA 3PGA1 1Z26A 1EX9A 2Z3WA 3K1YA 3ZZTA 4HVCA 3RSOA 1Z7GA 3HJAA 5G53C 3H9CA 3NALA 2ZATA 4E3WA 4JP3A 4PZDA 5H82A 1HG1A 5KYUA 1PR5A 1BTOA 2XQIA 3PHCA 4UHBA 3UK1A 4BXOA 1QJCA 3PB3A 1NSYA 4MUIA 5JS7A 1J22A 3N3AC 5DLPA 4CNBA 3KOYA 1DC6A 5KQMA 5MN4A 1HKHA 2ZE8A 3CR3C 3D1LA 5K6RA 2GYYA 1B23P 1BN6A 2F2TA 1MNAA 2J33A 4DILA 2ATIA 5A1JA 3IQIX 1NNEA 4BLWA 4GVPA 2VHWA 3O0DA 2GX6A 4QYIB 1XKQA 4MPRA 1IWPB 1H8ED 2FHSA 1B8OA 1WW3A 2YJNA 3HU5A 1S1CA 2UVPB 1E2BA 2OG1A 4BO1A 3AVUA 2IIQA 4KN9S 2I66A 3ZGZA 2BMAA 2QTHA 5MN6A 2ONYA 4CL8A 3KYCA 3RSLA 3SX2A 4UDYX 4X0EA 5KAMA 1MCZA 1EUYA 4LJYA 3VPSA 1LJUA 3B13B 2O52A 5CTAA 3BA1A 4M6WA 5JSKA 3U4IA 2BFAA 1C30A 1ZJZA 2LKCA 3K72B 2C4TA 4XTRA 4BQRA 2CCKA 4QREA 5AHXA 1VKZA 3U4AA 3Q8MA 2W4MA 4K8RB 4M86A 2JAOA 2GWHA 2KS6A 2HA3A 2JZOA 1E2UA 2NVWA 3D5QA 3I05A 3PV0A 3V8RA 1J8VA 4B76A 2HNKA 1Q83A 3UZUA 1RE0A 2ODEA 3RTBA 3WZLA 3GNTA 2QMUA 4PLGA 1WB4A 3GI1A 5BQFA 2BFPA 5DWQA 3SXUB 3ACCA 2CK3A 2X8JB 4HDMA 4TYNA 3YASA 1CS0B 2B4RO 2RJOA 4GBED 4YRRA 1SVMA 4Z7QB 5KU7A 2EEZA 8LDHA 4Z9BA 1GT6A 3VC2A 2E4XA 3DB2A 1M6NA 2FWPA 3FTFA 1L5WA 2AOTA 2PR2A 4GR9A 3F7TA 3GAFA 4ZI3A 2NVUB 2GA8A 4MV9A 2DLDA 3GA7A 4YCDA 1GPNA 4BRSA 1YVPA 3LUKA 4J2TA 1YDEA 2X8BA 3MAAC 3I2KA 2OV1A 1WXHA 4HZUA 3L6UA 2QL5A 3OOYA 3STTA 2REOA 3V2GA 3IUJA 5FUYA 3VZRA 2XBMA 4EI2A 2G76A 2H2AA 5FTJA 4NCKA 3ODGA 3Q3CA 4HX2A 3SHOA 3WYDA 3MXTA 3ZCXA 1MB2A 3QE4A 4CMHA 3OE4A 4OFWA 4WY2A 3U40A 4L02A 4D02A 2DZDA 1PDVA 4EJMA 1QRSA 3Q41A 1DOZA 4G1CA 2IYOA 1RR6A 4FYYA 5C1DA 1Y1SA 1I94B 1DUVG 1WDMA 1OV6A 2AE2A 4UUNA 4CDRA 1SZCA 3ZU2A 2B30A 4NJMB 1IJKA 4F7WA 2VUIB 1H23A 4MCHA 3RS7A 3RYFA 2CL7X 1Z4MA 3L0OA 1VLJA 3I92A 4QUKA 1TTPB 2KWIA 2I2XB 2Z8ZA 1RKUA 1HDOA 4LSWA 1DBWA 2IYWA 4QU8A 5AKKA 1OASA 1VFNA 3CA8A 4B7ZA 2C04A 2GD1O 4W99A 4J7CA 2E87A 3UJNA 3A1TA 5DNDA 2H54A 5K9ZA 2HBYA 2QLJA 2GZSA 2H4WA 2K7FA 4CLEA 5HUJA 1U99A 2YTZA 3PNMA 3MEQA 3IOMA 1G3MA 2HDNB 3BT7A 1YZNA 1URPA 2GHQA 4YJDA 2BR4A 3ZZ0A 3VISA 1LLUA 3LX5A 1WA5A 4UOEA 4ZU3A 2VBGA 2Q3LA 4JGGA 1XF9A 3CRZA 4G23A 1E6CA 1SA0B 1NXPA 4EZIA 1HTTA 1RYYA 1LJ8A 5CFMA 1CD5A 4B1FA 6CHYA 3MOSA 5CYPA 1I7QB 2QZ9A 5I9IA 4RZXA 1SXJE 1DAMA 1P5HA 5DYTA 4QG7A 4C6TB 4F85A 5DLDA 4EJ2A 5K3CA 3HSSA 4RK1A 3X1MA 4F3TA 2Y2UA 3JQAB 1QCZA 1U0RA 1OXSC 3TCNA 4R9UC 3S2YA 3HK2A 5BURA 1NBMA 3V34A 1WSBA 1KYWA 2IOFA 2IODA 1TQ2A 1HSZA 3GJRA 1KYQA 2KHZA 3ZV5A 1OH7A 1GCIA 1KSJA 2HJGA 2PKXA 4HZGA 3BGSA 2GZMA 1GIAA 3E27A 1OGJA 5FTNA 1AHPA 2Q5JA 2BBWA 3KDSE 4JLJA 3RUEA 1ZM4A 1D2GA 4R81A 4D42A 2XIQA 2Q3JA 2O9JA 2HYIC 4L8YA 4I55B 2IUEA 3ADCA 5JD4A 5HUHA 1WVIA 1P33A 1K92A 1EXWA 1EDEA 2AH5A 2GOYA 3SE7A 4I5DA 4C2BA 1D6NA 3DPUA 5TY0A 3MWFA 3OT5A 3PNKA 4DMLA 1B8VA 4WXRA 4UVEA 3TNJA 4DMGA 4D3DA 1KC3A 1UMDB 1JZTA 4IYRA 3M5CA 3UKDA 3LUFA 5DN6A 2NTEA 2WICA 3OE1A 2HA5A 4MO2A 4P7BA 5F77A 2FW8A 5LC1A 1NI4A 1XYYA 2C88A 5HKAA 4IIXA 3I37X 3IT0A 4Q7QA 2Z83A 1OLUA 2QM7A 3G8BA 3P8ZA 1IK4A 4RZSA 2JATA 3ROXA 3WWDA 3BFVA 4D8UA 1UBNA 1RCUA 4XVQA 2O3TA 3D2CA 4RD2A 4HNAB 3QE3A 2JBAB 2R7AA 1ZM3A 3LQQA 5A0VA 1YC5A 1U4SA 1CUUA 2J5KA 2WJ3A 3GT4A 1ADGA 3DOOA 3IDFA 2JLAA 2XUPA 3IXMA 5JXGA 1MGOA 4D41A 4J1TC 5IYZF 4L0CA 3FHTA 221PA 4TL9A 1Z0FA 1PFQA 2JLYA 1R0YA 4K6GA 1KGDA 4RM2A 4GP6A 1V5EA 2XA9A 4KIFA 5K3DA 1L0BA 4DUGD 4HT3B 3IESA 3E84A 3HQ4O 4OLFA 5FI1B 3GVIA 1T2CA 4IJWA 1XYVA 4UUMA 2BT4A 5CK4A 4R41A 4C3UA 4CIYA 1XN1A 2WMNB 4IP0A 2PRZA 3LOPA 4J0KA 2ZK7A 2NSDA 4R71A 2RGNA 4HQ0A 1E3LA 4LZAA 1DBVO 1U8UA 1F17A 2GZ2A 1VLHA 3HB9A 4J76A 2O59A 4JP5A 4BU0A 1XQXA 3HJNA 4E2YA 2V7BA 5CB0A 4NL4H 1Z6XA 4W5QA 1YQWA 2A9RA 2VPXA 4AYTA 1OA0A 4AF6A 1C9KA 1R2QA 1SC6A 3G23A 2EJWA 4G9EA 1SOUA 4LYEA 1E5TA 1I32A 3WA6A 4EGQA 3GLGA 2P27A 2B82A 4DCMA 3WXMA 4OGLA 3E0XA 2BIFA 2J4FA 2WF8A 2YN0A 4GYKA 4ALNA 1BXGB 5L51A 3IOEA 5L9AA 4XYGA 3R6DA 1OD6A 1UIRA 4YRGA 3W77A 1Y7TA 3LUDA 4TKLA 2R6AA 4MB2A 2G04A 4XUDA 3ZC3A 4A0QA 3Q88A 4LX0A 1M6YA 3IC5A 4M3NA 2QD5A 2D4HA 3OEHD 3S1SA 3L7LA 1Y8ZA 1P2FA 4G81A 2O0KA 3QYPA 5CCXA 1H1LB 5JCOC 4MGHA 2OY0A 4BQQA 4Z6KA 2K2WA 1TD9A 3GZJA 2B9VA 2HX1A 1GLVA 2O1WA 3CURA 3EY4A 4YP7A 3VBCA 2IYTA 1J8MF 1ZC4A 2FMFA 4LW8A 5HDBB 3ZCUA 4QATA 1DV1A 3BDAA 4YC7A 5B6PA 1V4NA 2AUMA 1IJBA 1SWVA 3N2GA 5ICEA 2G9RA 4MHTA 3JWPA 2W11A 1GPJA 3QHAA 1JA0A 5CVUA 2BH2A 3EFHA 4C01A 4DSAA 1POWA 1YKGA 4O4LF 5MF6A 2P9BA 4E4RA 1MD9A 4A16A 4BRZA 3AG5A 4CQMB 3WYNA 4AP9A 2G1PA 1T6BY 1L7NA 1E6UA 4RHTA 3LLCA 3MTQA 4LCJA 3CVUA 1EK1A 5DYNA 5IAKA 5K1ZA 5LQUA 1VGVA 1L5GB 1I3KA 2VCEA 4PXAA 1QTIA 3O3CA 5DYGA 4EK9A 4XI9A 3W8EA 3N7TA 4ZYZA 3FETA 8AT1A 1E7RA 1WCIB 1VBMA 2YDXA 3NR2A 1WU8A 2YNMC 3N74A 4N8DA 4Q5IA 3VOTA 4O59O 4AMGA 1L7MA 1T5DX 4J29A 1X7DA 1Z0DA 4FX2A 3RUIA 4MS3B 4L78A 4P0PB 4DGSA 1G9XA 5JG7A 3OI7A 4LECA 2DFLA 2WMOB 5FF9A 3ZJVA 4MR9A 1R6XA 4UMDA 1EVEA 1E2PA 1PF7E 1G5FA 2SNIE 3EZXA 4J2OA 1JKIA 4KO4S 3NEPX 1JDBB 4NS4A 2GXQA 1MP0A 4FUTA 2I5PO 2IIPA 2OM2A 1EUDA 1U3CA 1YR3A 4G0OA 4RJ2A 1ENPA 2FSVC 4LZZA 4KLCA 3ZZ1A 3HVHA 3AKEA 4NEGA 4DEVA 4EI8A 7ABPA 1EWKA 2O8BA 5FB3A 3K1AB 3HTXA 2WKQA 4RS3A 1ECLA 2WSSA 1CS0A 2IHBA 2R11A 3TGPA 1LS1A 3B6MA 3EQ2A 2X7JA 4LTNA 5AJZA 4OF4A 1KE1A 3HVJA 1RU3A 2HMYB 3TMYA 1JJ7A 3ABSB 3TLXA 4B6SA 2X0IA 3MB8A 5JBQA 4BPRA 1JR6A 2AFHA 1UDBA 1MV8A 3HUTA 1G3UA 3EUFA 3A6HA 3OJWA 3IDSA 3PCTA 4ZYVA 3P20A 4Z99A 3ENZA 1FP1D 3KAKA 5EIEA 4LFAB 4YCMA 1RMTA 3IVCA 2CLHB 5L3ZA 5DW3A 1QIEA 1AZLA 2YMLA 3TTVA 5FLKA 1N32B 3EWSA 2ZETA 5EJ6A 1XZMA 1D1SA 1LSSA 4Z9XA 5D7BA 1JPUA 1RPJA 2RKOA 2V8OA 2YWJA 4YPFA 5JSYA 3WL4A 1AUQA 1UINA 3O21A 3K70D 3MTJA 3RVKA 1CUDA 2NYRA 4QULA 4EX7A 2IYUA 3VJMA 2JLWA 3FHOA 3VSEA 5F9HA 2JBWA 2PMCA 3FSEA 2R1TB 4PXYA 3U3JA 4AN0A 1XRRA 3HCRA 5LMNB 2G6TA 1AUVA 2H92A 3PKJA 1GZVA 2UVPA 3VVLA 4GXQA 4Y6PA 1TEZA 2XR1A 2VSYA 4B75A 1F60A 4L5IA 1YB7A 4WLNA 2PH5A 2JFZA 4RY9A 3H2BA 2YS7A 4DM4A 4YPOA 1WBJB 3R74A 4KR3A 3BH0A 1KI9A 3M3PA 4EO4A 4LHVA 3QXHA 4BP1A 3SXUA 4G89A 3K8OE 4IMJB 3PQ4A 2J9ZB 2Q07A 3V8NA 2GZAA 3SIRA 1VZ2A 3ZTYA 3IP7A 4RK7A 3Q8XB 3PUHA 4IF4A 1NIJA 1N3IA 2HNAA 3DKKA 4PC7A 2WB2A 3EK2A 4UNPA 4HNUA 4WDQA 2C95A 3OJCA 1GWNA 3L0YA 3K9LA 3LHIA 4D5GA 4OQFA 3LQYA 1ZK2A 2CE7A 3B48A 3IRVA 1U7DA 4IQGA 4I3GA 1FTSA 4KMMA 1NQAO 5JRDS 4WERA 3ESBA 4K81B 1T9ZA 2FPWA 3IPCA 4NKRA 2O7NA 2E89A 3DZHA 1GU1A 3L9WA 2QM8A 1KMHA 1HBJA 4HYEA 1Z62A 4LY6A 4CTOA 2UYYA 1XK6A 4M0MA 2HJ9A 4ZHQF 4EX6A 3DZ8A 3VH2A 3OLZA 2R1ZA 3H5RA 4QX6A 2H2GA 4FFWA 1PNVA 4DLUA 2NW6A 4C3ZA 8ADHA 1N5KA 5TRTA 3H4MA 3R9KA 1HE3A 4CKWB 2V5UA 2VYQA 1GKIA 3NBUA 1EX1A 4A8JA 4BLTA 1TMYA 2ATXA 2R5FA 4ASUA 4BMSA 4OH7A 4D8XA 1YULA 4QODA 5KCZA 1EM8B 4MYDA 3U7EB 3T54A 2F43A 2Q6IA 3DTVD 4LKRA 3U56A 2B69A 3MJVA 3GVXA 5HIIA 4DWJA 3C8MA 1SIOA 4L3OA 3K31A 1U81A 4B31A 1ODLA 4LX8A 3SJ7A 3OA0A 2LE0A 4TYWA 3VYSB 4DDWA 1YA4A 3QBEA 1L7XA 4LIPD 4XIIA 3JATA 4E46A 3NASA 3KLBA 4GSYA 4OKIA 5AW9A 4G86A 1EWRA 5B1HA 5HSGA 3LUAA 3T9CA 1SRRA 1DUIA 1KY5A 1RC0A 1KMMA 3KXKA 4LYDA 3ZLUA 3B7WA 2OBBA 3EMBA 3AJDA 1NLZA 3JPWA 3DXXA 2J5QA 2I4RA 2A4MA 1OWOA 1XP8A 4MI6A 3U9SA 1VIYA 1VTKA 2I71A 2Q1YA 3FVQA 4KAJA 5JHGB 3O5AA 2REXB 2YFHA 4EA9A 3FOBA 5K03A 3DVQX 1R0KA 2DBZA 2Q8NA 3ACBA 1V3QE 1WBDA 3H3JA 3NBMA 1YJ8A 3GJYA 3HKDB 4Z86A 3GMDA 4XM0A 4E88A 4IL5A 2FFAA 4KGXA 1Y80A 2IYYA 3QUQA 1XCGB 2QRJA 2D3TA 3SYMA 3BUSA 4EL0A 4KXWA 5D3ZA 2FF5A 1PD0A 1WY7A 1Z7EA 2M9MA 3L8YA 3U7RA 5F23A 3MOIA 4TGLA 1CY8A 1Y6RA 1CR1A 4FILA 4GKVA 3TTWA 4AJJA 5BSFA 3L49A 1K8ZB 5EERA 1UOOA 4FGJA 5KKNB 3A9SA 4MS3A 1KBQA 1ZK0A 1KO4A 3G3EA 4XLZA 4YJHA 1T91A 1ZCJA 1JV2B 3D43A 3N07A 5TE9A 1XMIA 2ZPTX 5JYEA 2F4VB 2VI5A 3ECAA 2B9EA 4OHMA 4D43A 4B4OA 4OCZA 3QHPA 4EH1A 4MR8B 3ZW8A 5PNTA 2Q46A 3C3BA 2W7TA 1Z6QA 3K6RA 4OB8A 4X60A 4HF7A 1AQUA 1PL8A 2AHOA 5JDIA 3NWPA 5KNBH 2QWXA 3EXEB 4Q01A 3ZCPA 2RAUA 1AKRA 1P6XA 3P9XA 3QELB 1E77A 4GWLA 1YRQA 1ZOIA 4EJ0A 3I5YA 4R01A 1HE5A 1Q15A 1EINA 4J6EA 2IZ1A 4OQPA 1X77A 3I32A 4KRYA 2GZHA 3DV2A 1HSOA 1U8FO 3JQEA 4R9RA 4X8LA 4MW5A 1ZMRA 4MP6A 1QH9A 1K98A 2AFVA 3HKCA 3LY8A 3FRJA 3RB8A 4BFXA 1D2RA 2ES4A 3M9WA 4EW1A 4X7BA 4UU0A 4XUGB 1F8XA 4QHSA 4CM4B 4NHOA 3ZHTA 3WK4A 3L0CA 9LDBA 3OEYA 4A0GA 2W48A 3MBIA 3MUEA 5TQ2A 2Z6AA 2AJTA 4Q16A 1E2IA 5IDQA 2AZTA 5KTTA 4OAOA 3MWEB 1F48A 3NBXX 4P82A 5CB4F 3IE2A 4Y7DA 3F6SA 1S2MA 3CEAA 4RH0A 3SKVA 1B4DA 4H31A 4C07A 5TQJA 3IODA 3P9SA 1E1QD 2FN9A 2HL6A 1QV6A 2BPOA 2VTKA 4NZYA 1DIGA 3IVRA 1TADA 3EXG2 3JCZA 3NATA 4IIYA 4PGAA 4AS2A 2E3JA 2A2ZA 3C6ZA 2IDMA 2NU8A 1B0PA 2LVBA 3CBQA 1G2IA 3EXG1 2HBQA 2OAP1 3OIFA 4M7OA 5G2OA 1CY0A 4MYSA 3SIWA 1XMSA 4L0QA 3BIOA 4ESVA 3BRWD 1BX1A 1Y63A 2NNWB 1KDOA 5CLGA 1DTWB 4CVNA 4P1ZA 4Y2JA 4DJ5X 5EQDA 4JI5B 4IX1A 3TLAA 1CNFA 3ILVA 1EFVB 3RKRA 5TPZA 2UZ0A 5I4IA 1GA6A 3MB5A 2KMLA 1E6LA 2ILTA 3ORRA 3Q15C 4MKGA 4MUFA 1JPNA 4LKOA 4RVSA 1Y0BA 1KH1A 4XDYA 1X8JA 1FFHA 1A2KC 2MR5A 2XWJI 1J23A 4KQGA 4PC6A 4Z2YA 1EWTA 2R751 3M1AA 1WHTB 1M67A 2VHTA 4BNMA 3WA7A 1EGMB 1PJ2A 3DV9A 2ZR7A 3K7EA 1BKSB 1TKAA 3L79A 2VSQA 2PD6A 5T64A 2GCGA 2QSZA 1EXNA 1TYZA 3A6GA 3C43A 4DNQA 4WLUA 3AHJA 1LS6A 1LV7A 5TQ0A 2WSIA 3H11A 3NGLA 4C89A 2A1TS 4A0RA 4GR4A 1OROA 1NF2A 4JT9A 4CM1A 3DJFA 2A5GA 2J9GA 3T1YB 1GO2A 3LXXA 6LDHA 1ZGJA 2QSYA 1O89A 4GQIA 4MS1B 4GOLD 2C7RA 2IKQA 3IULA 3QOXA 1Y4ZA 4TZTA 4XVUA 3BXPA 5FUMA 3HCCA 1EIWA 1SQGA 3UT5B 1X7XB 4OSEA 1G4AE 5D2CA 1QG0A 3TOCA 4U0KA 1EFPB 2WVAA 1G8SA 1MLDA 1JLLB 4RVHA 5A4FS 5F7ZA 2I8LA 4KJXA 1O4WA 5HQ3B 3LE8A 3HCEA 1IULA 1W8IA 4DDKA 3BRQA 3ZIUA 1C7IA 3HDTA 4LGYA 3JQRA 2TSYB 1WNFA 4IXWA 5ER9A 2WWVD 3V9PA 1GVHA 5A4AA 2QB5A 3FPEA 4G0WA 4HNSA 1Y48E 1KSFX 1JKMA 2XH8A 3KHTA 1WB9A 2WYVA 3ROQA 3S8EA 3O8OA 3MCWA 1LI7A 4G5QA 3S29A 2J3QA 4EF5A 4ECAA 1NQXA 1FJGB 4NOMA 4HGZA 5BQ3A 2NO6A 1NUQA 1ODSA 1DKPA 1RLUA 3BIXA 3KOWA 3OLWA 2WK1A 2J6CA 4MUNA 4N8SA 1QU2A 4ZC8A 5FBRB 3PDWA 4AECA 1TCVA 2E9SA 3ENKA 2Q28A 1Y6ZA 3TLKA 2C0PA 1RQ2A 2ZSFA 3OFVA 3URKA 2ZU6A 1JWBB 1W0KA 2JIOA 3GO4A 4M60A 4HXYA 4OM7A 4XB2A 4KGDA 1JEQA 4OM8A 3VU8A 2REQA 3F98A 4JN6B 4PSDA 5CGZA 4FD3A 2MYPA 4C0QC 2VYCA 4NYJR 3MRTA 4WFIA 1Z2DA 5G0VA 3D6AA 3H6KA 5B2FA 4I9FA 3PQCA 1Y3AA 1KHTA 2SKEA 4D0RA 5A7HA 3MQ4A 1FP6A 1TD1A 1EG2A 1HETA 5CUQA 3B7PA 4X8HA 2ZE7A 5EPEA 1RI5A 2D62A 1LQ2A 1MEOA 2C5FA 5UKDA 4F97A 4ONEA 5G4LA 3B60A 2DY1A 4G36A 4ITVA 4EHFA 4XRRA 1SY7A 4RS4A 1CRPA 3K16A 3IT3A 1JGTA 2VHUA 1MAVA 1U7PA 4XM2A 3SZUA 1NUTA 1YZUA 2A14A 2QI9C 4I1RA 1NPTO 2VC2B 2SKDA 3PVCA 1FFYA 1M2WA 2FFQA 1FP4B 5C8YA 2APJA 1JR4A 1PJ3A 1U0JA 3O2JA 5T6BA 3KD3A 3TLGB 4B87A 5A7FA 1OB5A 2DOKA 1NUSA 3GV0A 2G8LA 3N05A 4AF7A 5K8VA 1KO7A 1NPYA 1U2ZA 1BJTA 1YUNA 1ZYUA 1HV8A 4OHOA 1UJ4A 1VSUA 2OZVA 3PGVA 2EW8A 3QU9A 5G02A 1ULBA 5E3HA 4E5KA 1M76A 4LXUA 2CKMA 3I9V6 1T8SA 4KQFA 4BCDA 2MINA 2V6GA 2NUAB 2DT5A 3HR7A 1NDHA 5HUQA 3VC1A 1OX6A 2I4OA 4DZRA 1SKMA 2WSYB 3FNHA 4TV9B 2ZYAA 1C1DA 3GHYA 4IOJA 4JU9A 5JANA 3KYDA 4BNDB 4HH1A 4Z2AA 5IYZA 2CMHA 4JYPA 4MVJA 1RJWA 2CCJA 3BDVA 3GLHA 4L28A 3CT4A 4PZEA 5CT4A 2HSDA 1T4MA 2J87A 2X8AA 3RODA 3DC7A 4TVKA 5KVSA 1ARZA 4Y67A 4LJ6A 3I2JA 2MR6A 5LNK1 2ZQ5A 3D0KA 1ODCA 1ZD4A 5L95A 2I29A 1ODKA 1AS0A 4EY4A 2PTGA 2A9KA 4L9AA 4JT2A 4C88A 4CQNA 1JWAB 1TZ2A 2QROA 2RBGA 4LOKA 3SC2A 4FMCB 2F3UA 3G9TA 1ZS9A 4OK3A 1QHGA 3QZUA 1XX6A 3NCTA 1GAEO 5CPFA 2D13A 1K97A 1VCMA 2I6GA 4UTOA 5IU6A 4Q3CA 1G6KA 4EMBA 2FDRA 5JH7B 4UHFA 1V4VA 1Y3IA 4PQYA 2J3KA 1BRMA 2WSMA 1I8TA 3CUWA 4MUAA 5AJVB 1F8YA 5D6NA 1K2WA 3UMGA 2BEVB 3FTDA 3K0FA 3T34A 4CMKA 1BS9A 1UANA 4DMKA 3AVVA 3KWJA 1MAUA 2R4UA 1BJKA 1P8JA 2DR3A 3BXEA 3CS3A 1JEQB 3DE2X 3M4NA 3ZK7A 1KI7A 4LOIA 4IDQA 4LMBA 2UZ3A 4BAZA 3ND7A 4S0ZA 2Y2VA 4P83A 3V6LA 2FRXA 1CY4A 4G25A 3T1VA 1NR1A 1BEEA 1JVNA 1MQ9A 3GEMA 1G18A 3LQ1A 1EFUA 3GUVA 5KTOA 3H0EA 4LJLA 3SFTA 1EPUA 1UDRA 1G8AA 1SURA 1W0KD 2XBLA 3MMPA 3NM4A 2COKA 1WMAA 2B21A 1E3WA 1GAQA 3FJOA 2WPDA 4FFVA 3RYIA 4B0OA 1WJGA 4BKRA 1C3OA 5G1PA 4EMSA 2YFYA 4MLDA 3JS5A 4MUGA 5HFJA 3RV4A 4YRDA 3HU2A 3RVPA 2XVZA 4UBIA 2BLLA 4YP9A 5CLJA 3EPHA 4BNZA 1QB8A 4HH0A 1MPTA 3GLQA 5EHIA 3A1WA 1O5OA 5K8CA 1YRHA 2CB9A 4FOSA 3EEOA 1TLTA 2HA2A 3EBOA 4FW8A 5PGMA 2OZKA 4OQLA 4PN7A 3U61B 1QIJA 1UK7A 4GPBA 3PYMA 5F51A 2PMEA 3WJ1A 1FVXA 4IHJA 5JCJD 1DMRA 1Z6YA 4C0XA 2OXEA 2VLBA 5HZGA 1THGA 1YCGA 1XRSB 1L5QA 3DFUA 4ZO7A 1L8OA 3S7TA 4ZOBA 1H8HD 4GPTA 3VJKA 2QDKA 4HYYA 1QLHA 1ZG3A 3EZGA 1UUFA 1A69A 3U49A 1GNQA 3EJWA 4GL4A 1PZXA 4WLVA 5DYWA 5EWLB 3DNMA 4YO7A 2RGRA 2H4JA 1FX0B 4WA7A 2VJNA 2WF9A 2CLIB 1EHCA 2GJ4A 3U13A 3BMCB 2ZRFA 3EGIA 1OGYA 2NU9A 3MTGA 3E9NA 4DTIA 1KO5A 4ZT3A 1DRUA 4RCVA 4KIJA 3ZGLA 1N7JA 2Y1CA 2QQGA 3LWNA 4QTTB 1ML3A 3WNQA 4WNIA 5JECA 1G1AA 3DBRB 4F11A 5AJUA 2COEA 1DINA 5SZJA 4HFNA 3JQAA 4YLEA 3STXA 1SEPA 2PZJA 3IAHA 3MGBA 5FPQA 2X0EA 4ON9A 3OP1A 1JHZA 3CE6A 4RAOA 2BTEA 1PLLA 4B74A 1CB7A 2XJ4A 3UHAA 3EW9A 4Q1BA 2QVZX 2C1EA 2VT3A 3WLIA 4ZVLA 4MS1A 1CC1S 3BTSA 4ZEOA 2JGEA 2PQMA 5FOVA 2V6IA 1Q0PA 5BV7A 3GFTA 5A71A 3W5CA 5IG2A 1XTZA 4XCXA 3WQRA 4DQXA 3NJRA 4RTNA 5JZOA 1JSCA 1KXZA 1CFZA 5K8LA 2K4MA 5EHQA 1E9DA 1IVYA 1WXQA 3OC0A 3VMMA 2XB9A 3AP1A 4NZNA 5TQ2B 3UPUA 1MT3A 1TK3A 4Z4EA 3DOEA 1GYQA 1NBEA 1SCDA 3OOJA 1Q1NA 4A0FA 4UNRA 1DMSA 2IL1A 3R4CA 2C5BA 2H1FA 3JASA 1DEHA 1IEXA 1R0RE 5GGXA 4N6OA 1R0XA 1S0UA 3SJAA 1CQIB 3FSJX 1I4DD 2I3BA 3LC1O 4BWFB 1QP8A 4AIRA 2EGGA 3GEHA 5ALZA 2C5GA 3F49S 3N0RA 3KXDA 4G3XA 5AKZA 5EOVA 1DSSG 1VLLA 4DCPA 4LBZA 4AQ7A 1KNQA 2AFIA 3OZIA 1Z5PA 3C3MA 3QVKA 3F6PA 1TJ4A 1BXZA 3H7IA 3NB0A 4IQ8A 1NTOA 2BM9A 4YLGA 5CYGA 1GCUA 5IULC 1CEQA 3DZJA 1GNTA 3IB3A 5I9TA 5C3UA 1IBKB 10MHA 2GD0A 3JQGB 2QR2A 3CLVA 3SZOA 1ID1A 1BU8A 1NVKA 1SA0A 3B1FA 4IV0A 5ELLA 3KG2A 4BZXA 2O1XA 5LXTA 1F7VA 4QTXA 3TNDA 4J0FA 2XXAB 2G70A 2B92A 1UODA 2YZKA 3M82A 5TGZA 4PZLA 1XDBA 2VYFA 4MR8A 4U9UA 3IO3A 2ZXEA 4OJQA 2HK9A 1CE8A 1SK9A 2ZRIA 1PDWA 4NG5A 3ZEIA 1G7RA 2CZCA 3C3JA 3E23A 4I6GA 1US8A 4BS9A 5B37A 1CNMA 1VI5A 3AY7A 4LJ8A 2BELA 5HBRA 3HRHA 5REQA 3LCUA 4B81A 2J9FA 7AT1A 3LAWA 1CJBA 2XTZA 3P97A 4HN9A 1PZFA 3C7KA 2YWDA 5TMDA 1FFAA 2V59A 3FMIA 2CL6X 3HFRA 2BDUA 4IGKA 1FU8A 3CNOA 4UPDA 2W0SA 3M2TA 3LBNA 4NESA 5C7YA 1TUBA 1MO4A 1W5AA 1FL9A 4FNMA 4G0MA 1IXSB 1KBOA 1A82A 1XDZA 1RRKA 4DLZA 3ZCTA 2J0SA 4IIJB 3MJFA 1I3LA 3HA3A 1C1YA 1WV0A 1PFYA 2XUOA 4R0NA 4RMIA 4TMZA 4KW7A 4AROA 4BQNA 5J2UA 4ZHSA 2K6GA 2YFKA 1BG6A 1GPDG 5LQJA 2CEAA 3WGOA 3WZ2A 4HSGA 1WTAA 3WWPA 5HNKA 4UD2A 2Z2YA 1XZAA 4OMCA 1FUUA 3LYAA 4RU1A 3A1EA 2QRLA 4LJ9A 1OI4A 1NN5A 1OU4A 3UTCA 4B3GA 3OZXA 1JT2A 1QGUA 3VH1A 3I0ZA 4OYLA 4PAOA 1N5IA 4RKWA 4QNNA 4JUAA 1I7LA 3GCDA 2IHKA 4ZTBA 3DYIA 2H1IA 2ZRNA 1ISMA 2HT6A 3LU1A 4YCAA 5JSUA 1RQLA 2Q45A 1KOJA 2IIBA 4HAIA 4Z3OA 1FX1A 2X8JA 4HDMB 4WESB 1WPQA 3C3XA 3JALB 1BKYA 2CHEA 3DV0A 3PWTA 4G01B 3G2HA 3QITA 4ITUA 4PNEA 4YLYA 2ILVA 4A6PA 2QPTA 3USES 1XDGA 5I9NA 3A7EA 1NE2A 4KQCA 3PSHA 1MB0A 1P2BA 2H08A 4R98A 2JI9A 4Y1RB 1K6IA 5JJBA 1N5JA 3IIIA 3W3ZB 4ZQHA 2GFHA 4QZVA 3KB6A 4FQ7A 1VPEA 2EF0A 2GXUA 1UDCA 2UYGA 3EZLA 4AKEA 3FFAA 1T4CB 4KXYA 2WYWA 2HA6A 1FBTA 2BONA 3M6MD 5D84A 4CG3A 4AZSA 5IC5A 3EWNA 4TMYA 1FFSA 1MDBA 2O07A 1NWHA 3BKXA 3BWBA 3HADA 3K05A 2GEJA 1JEEA 2PZBA 4JCCA 4Q3KA 1OB2A 3E3AA 3W4JA 4IUBS 4U9IS 3MELA 3LW7A 3ZDDA 3FHLA 1QORA 1YQEA 4BV9A 4YROA 4S1NA 1U0LA 2DKOA 3T7EA 5AW0A 4JXJA 1WPRA 5FWDA 2XNJA 4AUMA 3UMMA 3H5IA 1ZIPA 3PGMA 2X9NA 3ZHCA 4XWKA 3LT0A 2Y99A 2ZPAA 4FMDB 2VBFA 3DMDA 3GLTA 1Q12A 1P3Y1 1GLNA 2QTBA 3I4LA 3S28A 3BMNA 4JCOA 2ZQYA 3U09A 2OCYC 4DA8A 2V7VA 2D4AA 3OZUA 2OAEA 3SEQA 3A4NA 3E7FA 1Q14A 2C8VA 1P0MA 1H5UA 3ONVA 1TEXA 4LRSB 2VHZA 1HH4A 1FZTA 1GADO 2FZVA 4PZ9A 2N47A 5F12A 2HT1A 1GHTA 1KARA 2QN2A 2CYCA 3GRFA 4TUYB 5ALWA 1N2XA 4KXLA 4URXR 4Q4HB 4ZTZB 3QKIA 2WIJA 5HOEA 3KAQA 3SHTA 4CM9D 3H8WA 1CUIA 1R88A 1ORWA 4Q24A 3RAEC 1JP7A 3FPLA 3PGJA 2WU0A 1Z6ZA 4GEKA 4A1FA 1VE3A 2BWJA 4FFBB 1ETUA 1K3UB 1L7EA 2HCFA 2NUPB 2VATA 1A98A 1YACA 2FPGB 2ODTX 3I9FA 3R4VA 2OCDA 4Y3UA 3JARB 4ZAVA 1OH5A 2PZKA 4ZJUA 5JYDA 3TSWA 3UV6A 5EUBA 3M49A 1MIOA 2GEFA 2CDAA 1CDEA 3GLFB 5CIQA 1UCFA 1IBLB 3UT0A 1MKYA 1OUMA 1E32A 2VJCA 5DX8A 1KEZA 2CDCA 2HB6A 1GTJ1 3UG7A 3F8WA 1PHRA 1E6WA 1HTBA 3E2IA 1H42A 1NT4A 1DFGA 4GNRA 4N7JA 1NJ5A 4RD1A 3A1CA 3CZCA 4YMLA 4MP3A 4EUFA 4DY4A 2D1RA 4F2PA 3O2SB 1H9CA 1KC1A 1MABA 2E1PA 4NCBA 1QP7A 2A5YB 2EBUA 5REQB 2AF3C 4INOA 5AXBA 2ODNA 3FZQA 3P9ZA 4G5SA 4RGQA 1ULZA 5CG2A 2I1QA 5GY7A 1YJCA 2ZAOA 4PSAA 1AMUA 3NC0C 2D5AA 4GF5A 4K3VA 5HMMA 2Q0HA 1E0JA 3DKIA 1PYOA 2Y8EA 1W9MA 2MSEB 3KEFA 4KFCA 3DMPA 3TXAA 3LBHA 3QUAA 3ZD6A 3VBEA 1Z0ZA 2X3FA 2PRJA 2WUEA 4OIFA 1PJCA 1KVTA 1XA4A 1T5IA 2I03A 2J5XA 2JFYA 2NZ8A 3DOFA 2KW5A 1A27A 1O9GA 2VYVD 3ICPA 4FEGA 5JXIA 1IHOA 3ICVA 1X1AA 4F4JA 4H6XA 2VXBA 2WWGA 1P0PA 1T0JB 5DLEA 4M53A 1FYEA 1AQJA 3BH6A 4LRWA 1PT5A 5D51S 4AU1A 1EEXB 2C98A 4UHHA 3T7DA 5DV9A 3DP7A 1E6KA 3E9QA 4UUPA 3ADPA 3T1HB 5FAXA 3QUCA 2F3TA 1UWVA 4YJ2A 4FZJA 1THMA 4LJAA 3UV3A 1C50A 4ZQBA 2BH9A 3FIJA 1V43A 1NUHA 3OIVA 4S2UA 3MS4A 4C4SA 3G6KA 1WZCA 4ZDIA 1YR6A 3RVBA 5L3SB 1RLTA 4R9SA 3R7AA 4U2EA 1M6VB 4PHTA 2DSNA 3EVCA 5TVGA 3EC7A 4GW3A 2FG5A 1PJAA 3JVUA 4R8SA 1LV8A 5KSPA 3WGQA 2WY2D 2AN3A 3UBTA 2I91A 1IEQA 1JA1A 1XLTC 3K0KA 2HV8A 2Q5LA 4L6AA 1JKXA 1PL6A 1GRNA 1MRNA 4AB1A 4R2XA 1JG4A 1BA3A 1VLZA 3IBCA 4L5YA 4CTNA 5B58C 1BMTA 1SXGA 2A0XA 1HORA 4B7CA 2O8DA 3ZXXA 1N75A 5ES4B 1ZMOA 4D57A 5ECDA 3NU1A 1W5FA 2B4QA 2HDHA 3GJ3A 4P3YA 4MMYB 4GBMA 1XNJA 3WIBA 3X1KA 3U7HB 3KPVA 2W2LA 1W4BA 5I7VA 4FYHA 1VKHA 3HBLA 4I8IA 1IQPA 1NGSA 3NS7A 4LMRA 3I72A 2H7VA 4BO3A 3WR5A 1A9SA 1NBME 1S2DA 2FPOA 2FDXA 4JVSB 2HQSA 3DWGA 2IDJA 3Q5DA 4ASUD 3BB3A 1TYAE 1NRWA 2JRCA 5EKDA 1N3YA 4XD7D 4V0LA 5CMLA 5DM0A 1U1EA 3S1AB 3RYHB 4X61A 2CSUA 4F4UA 5C7LO 2IXDA 3IP5A 1ATIA 2AOUA 4WMLA 3RS8A 3FZGA 2ZUTA 4S2EA 4MLCA 4JR1A 1AGXA 2FPPB 4M1WA 3HVIA 4EKYA 1OH6A 4UAVA 3PNSA 3GPLA 2B61A 2EGHA 1MR3F 3EFOB 1G3QA 3EH2A 4IZOA 1ZOPA 1T1GA 4KV9A 2XB2A 1VPWA 3CJTA 4LF9B 4HEQA 4A15A 3PEVA 3R0VA 3DWIA 3EVTA 1M72A 2GTIA 3ENVA 2JFVA 3BMQA 5AVVA 4H18A 2AMVA 4M0FA 2G9VA 2AC4A 1G17A 1EGAA 1GPYA 4NOLA 1X1DA 3INYA 4ZCPA 1OXVA 3BGOS 3SPXA 2M6SA 3M1YA 1CETA 4C0BA 1L5YA 4DRYA 3LUHA 2XE8A 1QP4A 2GBIA 2PZEA 3KXLA 1DIBA 2Y1DA 4R3UC 3HFGA 4K9OA 3ZCVA 4EKIA 4EGCB 5AW1A 1W4CA 2IX9A 1QIDA 3C41J 5DJ5A 2QTNA 3A1FA 4M54A 2D5LA 4BKUA 2V6MA 4JL6A 1Q50A 3D3EA 1Z5ZA 3SLRA 4FGKA 3TFWA 2ZUWA 5FTMA 4DHEA 3PTZA 1RYZA 4IDOA 2FWBA 2KM1