4AJKA

Rat ldha in complex with n-(2-(methylamino)-1,3-benzothiazol-6-yl) acetamide
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
331
structure length
330
Chain Sequence
AALKDQLIVNLLKEQVPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLKTPKIVSSKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPQCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPQLGTDADKEQWKDVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCILGQNGISDVVKVTLTPDEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/inhibitor
molecule keywords L-LACTATE DEHYDROGENASE A CHAIN
publication title The Design and Synthesis of Novel Lactate Dehydrogenase a Inhibitors by Fragment-Based Lead Generation
pubmed doi rcsb
source organism Rattus norvegicus
total genus 115
structure length 330
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ajkA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4ajkA02
3AWDA 4OSOA 2DVMA 1ADFA 4CMIA 1MB4A 3MJCA 1N8KA 1GY8A 5FI3A 1JWBB 1KVTA 3GGOA 3WGZA 2QQ5A 3BMNA 5JDIC 3K2BA 1AE1A 4RDHA 4AICA 1DJQA 3KSZO 1D7OA 3KUXA 3ULKA 3FHLA 1Q2XA 4E12A 1B8PA 2UAGA 1SAYA 4YTEA 5BNTA 2H9IA 1DIGA 4CMEC 2ZTUA 1YL5A 4J2OA 1EBUA 3E8XA 4IZHA 3V2UA 3QVWA 1UZLA 3N74A 4ITUA 4L73A 1PQUA 3C1TA 1ZJZA 1LA2A 2ZB8A 4FJ2A 1PGJA 2JHFA 4RPKA 1DRVA 3U4CA 3EC7A 4RO0A 5C3MA 2O4CA 2PGDA 3WQSB 3WX0A 1FXSA 4CLRA 1YONA 2ZTLA 1WZEA 2X0RA 3RUFA 3WTBA 3OETA 2I3AA 4U8GA 1QKIA 1VSVA 1RWBA 2I3GA 3ABIA 1X1EA 3WNVA 5TJHA 3E03A 4IDAA 5C7IO 4DC1A 1DC4A 1U2DA 1ISMA 4R9SA 3I9LA 1W6UA 2D5AA 4MOWA 1E1NA 4DPKA 4LMRA 3H5AA 3F47A 4II3A 4QO7A 1PJBA 2FR8A 3DZIA 3OICA 2UYYA 4FFLA 1YGYA 3K6JA 4A5OA 1LDGA 2I66A 2FMUA 5L4NA 3TZ6A 3BZUA 5JNLA 4JJGA 2A92A 2Q3EA 2DTEA 1C1XA 5A5FA 2OP1A 4BNHA 1GQ2A 4XYEA 1BVRA 2PTGA 5DCYA 4BMVA 2YZ7A 4GAEA 1WNTA 1P1HA 1CQJA 4AG3A 1U3UA 4J1SA 4CJXA 1P3DA 3L4BA 4R1SA 2AHRA 3ZHBA 4PG4A 5I7FA 1XLTA 3UN1A 1YQXA 1PTJA 3ANLA 4WLVA 3OQBA 3R6DA 2FSSA 4EEZA 4ILKA 4YA6A 1LSSA 3EMKA 2G0TA 1I3NA 3H4VA 2BI7A 2EXXA 3WWYA 4YRAA 3VVBA 1H0KA 5TJ9A 2ZQYA 3VH2A 1E5LA 1S7CA 3ORFA 4J9VA 2BGKA 4PLFA 4E6PA 4HFMA 2PZJA 1D3AA 1KVUA 1YH3A 2QG4A 3PHHA 3WGIA 5T8KC 3O38A 1E3SA 1BXGB 1VLLA 4B4UA 1P1RA 5JE8A 2Y67A 2Q2WA 3E5RA 4B79A 2DUWA 1LLDA 4BS9A 3AUSA 1U2GA 1Y8RB 4K6FA 2DBZA 1WLYA 4J91A 2I5PO 1ADCA 5I9LA 4I5DA 3E82A 3FR8A 4AJ1A 3U0BA 2RH8A 4DREA 4L75A 1ZEMA 3GG9A 3EUWA 4M87A 5BSEA 2EERA 4O63O 3D4PA 1E3LA 1Y5RA 3QQPA 2E82A 3QE3A 5IDXA 3WBBA 2HMWA 1NPYA 1DIBA 1TVEA 2GZ1A 2WD8A 1A4UA 2VRBA 3HB5X 4KWIA 3CSDA 3Q0EA 5AVOA 1U8FO 3ZWWA 3AW9A 4Z9XA 3KXDA 2DPHA 5GZ3A 3WMXA 1JKFA 2B0JA 1PJSA 3IC5A 1T4DA 4JX8A 1A9ZA 2AE1A 4CLXA 4OXYA 4F6CA 3UKOA 1KEWA 3RUIA 4CUKA 2XXJA 3RAJA 3PWSA 5TGDA 2HK7A 2CY0A 3ZWNA 4NBWA 4KQWA 4W7IA 2IYOA 3QA9A 2BGLA 1HE5A 1O8CA 1YDEA 4XYLA 4WJZA 4IJKA 3DZHA 5HBRA 4HFJA 1PR9A 9LDBA 4BNXA 1WW8A 1MLDA 1NQ5A 3QWFA 4HBGA 5DBGA 3W1VA 3ZV6A 4D42A 4YT8A 5IAAA 4P4LA 1PJTA 1MP0A 1E3EA 2X5KO 2ZJ0A 3FWNA 1ONOA 4JCOA 3WIDA 4R3WA 1B15A 2P5UA 3M2PA 2GASA 2AEFA 3WFIA 1XU7A 1TT5A 4E13A 1LDEA 3V2HA 2VRCD 3F9IA 3GT0A 5HM8A 3H9QA 3FWZA 4GBJA 4IY1A 4BNTA 1XGKA 2GCGA 2JD2A 2X58A 3SVTA 2HJSA 2PKQP 3ZN2A 3HZZA 2YV3A 4IJUA 4I9NA 1U8XX 1T25A 3UXYA 1ZBQA 4XB2A 2CFCA 3G1UA 1HTBA 3NDJA 4KTTE 3UICA 1GEEA 1KBZA 2CDBA 4GVXA 1OAAA 3JYPA 4MVJA 4AJHA 3VTZA 4WK6A 5JDCC 3IL2A 1QYDA 1GCUA 3BMCA 4CLOB 3KTDA 3C7AA 3AM4A 4BO4A 4ND2A 3ANNA 1Z6ZA 1ZK4A 1EDZA 3L9WA 4ALKA 1P77A 1QYWA 2PV7A 4NBVA 4S1VA 4XCVA 3EDMA 1LC0A 2WSBA 4R1UA 1VPDA 3RROA 1NASA 1D1TA 3B20A 5LDHA 4OJNA 2FZWA 2IODA 3EK2A 5JMPA 2G1UA 3D4OA 5TF4A 3V1TC 1PGOA 4CQMB 3DZBA 2Y1DA 1NYTA 4ZGWA 3LF1A 2FY8A 4CR8A 1UXKA 1UXHA 1Y5MA 4Q3EA 1F06A 1E92A 1YXMA 5LC1A 4D44A 2GZ2A 4BUCA 1ISJA 3COSA 4KP7A 4NJOA 2B4QA 4AJ2A 2Q99A 2H63A 3JQBC 1K0UA 1Y8QA 4CM8B 3GVIA 3NDRA 1JW9B 5ITVA 3F3SA 2PY6A 1ZK3A 3RSHA 1I2CA 4D45A 4R5MA 1SNYA 3NAQA 5ADHA 4L4RA 3I4CA 2VQ3A 2O3SA 4J43A 3TZQA 5JSFA 4IS3A 4JQCA 3VTFA 1EZ4A 3PEFA 1W4ZA 3KB6A 3CZMA 2IZ1A 3H3JA 4EUFA 1DRWA 1HETA 4XQGA 4DC0A 3E48A 5A9SA 9LDTA 3FCOA 1LSJA 2W8ZA 3AJRA 3ASVA 4BVAA 2RCYA 5H83A 4E2YA 1N7HA 3UGKA 3WGGA 5A5EA 1JN0A 1G0OA 2BLLA 5BT9A 4M55A 4WKGA 2NTVA 1I10A 1GUFA 2P2SA 3B70A 4DTIA 1UH5A 4ZJUA 3OEWA 4PLZA 4DYVA 4ALMA 3MTGA 3PQDA 1K89A 1O5IA 1QXSA 3RI3A 2AQ8A 1DC5A 3F4LA 3HHPA 3UVEA 4BGVA 4JBIA 4RVGA 2W2LD 2P91A 3ZV3A 4OMUA 2HAEA 2ZCVA 3BMOB 3JD1A 4AJJA 2X22A 1NWHA 1EVYA 4CQLA 3FI9A 3PLRA 5JCJD 4IJVA 4NH4A 2YUTA 5CDUA 2P9GA 3DDNA 4CMHA 2PR2A 4ZVVA 1QMGA 1KOLA 1KERA 2O3JA 5A04A 2J5RA 3H9UA 3UH1A 1DOHA 1IULA 3HDYA 1GV0A 4W9NC 4XB1A 3HG7A 2X5OA 4OKNA 1XWFA 3GZNA 4DYDA 1I2BA 1T24A 3ONFA 1MC5A 3RC9A 5A9RA 2IZZA 1O94A 3PFWO 3V1UA 3CMCO 1HDOA 3ADOA 4I5FA 4YJHA 4R9RA 4XX0A 3BTUA 2VHWA 5GMOA 2C5AA 1NP3A 4BV8A 1PL8A 3OFSA 4E2XA 1PGPA 3KO8A 1C3VA 3QWAA 3U5TA 4CM4A 4AJNA 1Y7TA 4CPDA 3GA0A 3RFVA 4URFA 1NX6A 3ICPA 2HO5A 3ZV4A 4E32A 3NRCA 1FDVA 1PWXA 4D0RA 3I83A 3LT2A 2X0NA 5AQ1A 4ZRNA 4JBHA 3JQAD 4E33A 5C7OO 1IB6A 5HS4A 2VHYA 3IUSA 5KIAA 3JQ8A 3KZVA 2OUIA 1ZMTA 3HDHA 1YKFA 4BL5A 3RUDA 3WIEA 3BTSA 1Z45A 2NVUA 3DONA 3GN2A 4TMFA 8LDHA 5TNXA 5T6BA 1ZEJA 3RKUA 1E3WA 3DHYA 1MG5A 3NT4A 3O9ZA 1F14A 3OQ6A 3ZW8A 4LN1A 3DBLA 3VPXA 4AJIA 3DZKA 6ADHA 1H2BA 3ZWPA 3ZV5A 3L4BC 2V7PA 1X0XA 3FNFA 1FF9A 3R1IA 1EBFA 2GN9A 4YWJA 3QVOA 1JKJA 4YQZA 1X14A 3OJEA 1FJHA 4IDEA 3KHUA 2HK9A 3G3EA 2DTXA 3KRTA 1WPQA 3GVXA 1X0VA 1V0JA 2GR9A 2GF2A 1P44A 2NADA 3L0DA 1PJ4A 5A05A 1IE3A 2O23A 3INGA 5A3JA 3MZ0A 2ZB7A 3JYQA 3TOZA 1B2LA 1X7DA 2PD6A 4N5LA 2X5JO 4J90A 2F1KA 4XA8A 5G0UA 1BW9A 1NTOA 1HKUA 1YQDA 2HUNA 3U4IA 3VKUA 2VZ0A 3Q3CA 3W6ZA 3PHGA 2YFQA 5GY7A 2GO1A 3ZU3A 2EWMA 4OIMA 4BB5A 3LC1O 1ZK0A 3F4BA 5G4KA 3WNQA 2C59A 2EGGA 3OIGA 2QYTA 4PIVA 1TI7A 5JS6A 3AOEA 5JO9A 3L9XA 4NU6A 3LDHA 4AL4A 1WP4A 5CEFA 2VHVA 3AI1A 4GWKA 4IZIA 2C20A 5CFZA 1N1EA 3MJTA 3KLMX 1P0CA 1V3TA 5T64A 1PZFA 2P4QA 3RIHA 3IS3A 3GY0A 4TVBA 3QY9A 2E6UX 2B35A 4YEDA 1HF3A 1BTOA 2YV1A 4JNKA 2ILTA 4J4HA 3UAGA 4MDHA 4XGKA 4BKQA 1IZ9A 1RJWA 2PD4A 3D4NA 4CM9A 2OL4A 3TZCA 1Z74A 2WMDA 1UP7A 1NHGA 5IFLA 1AN9A 4E2WA 4EEXA 4GQAA 1GQQA 5AOVA 3NJ4A 3L07A 4UVEA 3PGJA 4CMAA 1XU9A 2YV2A 1JA9A 1XIVA 1VKNA 3KVOA 4R1TA 3IOYA 2VTEA 4MVJG 5KKAA 1ARZA 3OQ1A 4PN3A 4XDZA 1RYDA 1HXHA 2XPCA 1NVTA 4N54A 5AXBA 3D3WB 2QIOA 4FPXA 5DNAA 3FF4A 5L7WA 5KTKA 5JAIA 1H6DA 1MV8A 3H65A 3ZNPA 4E5PA 4CMIB 5G4LA 3JQDA 1YJQA 1ZVMA 2FRDA 3Q11A 3WB9A 4KDEA 4WNCA 4UVDA 3BMNB 2EKQA 5L40A 1I2ZA 5KKCA 1CF2O 3D0OA 4TRNA 5JAZA 1H93A 5F3RA 1UUFA 4OQYA 3DBHA 2O50A 4IMRA 1EUCA 3ONEA 1O95A 2DPGA 3E9MA 3LYLA 1E5QA 8ADHA 3OJ0A 5JC8A 1EUZA 3DOJA 1NWCA 1N1GA 1QP8A 1Q7GA 1YB5A 2RH4A 1ZZEA 4ZRMA 3RASA 1VE9A 4GX0A 5T57A 4E2ZA 5L4LA 1LC3A 3E18A 3F1KA 4QEDA 2GGSA 2CSUA 5CP8A 4JLWA 2I76A 3CMMA 3OBBA 1PZHA 2WEKA 4WECA 5EPOA 3T7CA 4E4YA 1R0LA 1DFHA 1XA0A 2B69A 1ONPA 1YB1A 4OL9A 1U28A 4GGPA 1ZIDA 3QRWA 1R4NA 4UEJA 4DQXA 2I65A 4CLRB 5F5NA 2EW8A 5B4TA 4RVFA 1E6WA 1KYQA 3A4VA 3RWBA 1EVZA 2LDBA 2HLPA 4HXYA 4IDFA 4L8VA 3DMTA 4ESOA 4PRLA 3VZSA 1R15A 1SB9A 2NUAA 4Z0HO 1XQ1A 1YBAA 2GN4A 4P38A 2IE0A 2X9VA 4NHEA 3FNGA 1UP6A 2ZB3A 4PVDA 4F45A 2EV9A 3ZGYA 3BTVA 2J3JA 1O89A 3M1LA 2JAHA 4PVCA 4U0JA 3CIFA 3FTNA 1LDBA 1GPDG 4CM6A 4WEQA 1AHHA 2C5EA 4NPCA 2Q1UA 4A73A 4I8XA 1YRLA 1BG6A 2AMFA 3JQBA 2BFMA 2NLOA 3MEQA 3RBZA 4NFHA 1P1FA 1J6UA 1MGOA 1NAIA 5F1KA 5K0ZA 2IXBA 1C1XB 5KJ6A 3ZI0A 1MUUA 4J7UA 4WLFA 4YJGA 3U49A 1WMAA 4LVUA 1VL0A 3RJ9A 3O26A 2I6TA 4PGFA 4PLPA 2HMTA 4RZIA 6LDHA 1LQUA 2Z95A 1CYDA 1C0PA 4R54A 4CM3A 4GWGA 5KJEA 1Q0HA 3KEQA 1HSOA 3BHMA 3HN7A 4RL6A 4ALLA 4FR5A 1PJCA 1R12A 4RZHA 3ZWBA 3EW7A 1M2WA 3NUGA 4OXKA 4UUOA 3FN4A 3S1LA 2OGUA 4B3JA 5EINA 4BGEA 4K26A 4EITA 2PGLA 3KBOA 5ITWA 2X1HA 1LDNA 3STHA 3ADPA 3NKLA 4NBUA 4CODB 2Q1SA 3D5TA 4YACA 4R5HA 4BNFA 5FWNA 4KMSA 3PFFA 3ONDA 5ICMA 4MKXA 3NT5A 1E6UA 4R16A 1WVGA 3TNLA 2B37A 4XQCA 2DLDA 1E7RA 4QT0A 2DC1A 3JYLA 1LLQA 3MJSA 4RGBA 1NXQA 4J3FA 4OHUA 2OO5A 4RPHA 3UUWA 3PHIA 1JDJA 3MWDB 2X0JA 2YHIA 3DC2A 4ND3A 4R1NA 3RKRA 1GTMA 3VZRA 3OA0A 4UVHA 1PQWA 3RD5A 4W9NA 2RAFA 1Q0LA 4HUJA 1KEPA 2LDXA 4YAKA 2Y0EA 1U7TA 1P1IA 4XDYA 1ORRA 4Y6SA 4NIMA 1Y9AA 2R2GA 3ZH2A 2VYVD 1KEUA 4UVIA 5ENVA 3NX4A 4DMLA 4C7JA 3HDQA 3GHHA 4RPLA 1IPFA 1SOVA 1MX3A 1CEQA 2VWHA 2VZ8A 4RLHA 4XYMA 1EEHA 1ISFA 3KLPX 4E31A 3BYZA 1J4AA 2HQ1A 1NFRA 3IQDB 1M75A 1R4MA 2FN7A 3FTPA 1O6ZA 1ADGA 1DIRA 1B14A 3OSUA 4ND1A 5B12A 4JP3A 2J5QA 4RVUA 3EZLA 4F46A 4TRJA 3ZWMA 1HDRA 3L77A 3WS7A 3GPDG 1BGVA 4TZTA 3GUCA 4BGUA 3TF5A 5CPBA 1DIHA 3OJLA 1XCBA 1E3JA 4WLUA 4WLOA 2Q50A 4FOSA 4O1MA 3S2IA 1I24A 5L53A 2QYSA 1PSDA 2BH9A 4Q3DA 1CIVA 4ZQEA 1ENPA 2OOSA 3T4XA 3JCZA 1X13A 4HV4A 1N92A 1OI7A 2VYND 1R6DA 1TT5B 3AK4A 4U6SA 1DO8A 3H9JA 1NAHA 3VOSA 3LF2A 1ISHA 5FEUA 3WFJA 4FD3A 5G2OA 5I9MA 3JQ9A 3AU9A 4CMBA 3I4FA 3GEGA 4MINA 4YT2A 2EF1A 1PS0A 4NU5A 1K2WA 4JN6B 4FCCA 3DFUA 3PWKA 3HN2A 5LCXA 4B7UA 3GNTA 1Z73A 4BNLA 2PZKA 3ZWOA 4LMPA 4CQMD 4D3SA 3WQRA 5KOIA 3X2FA 4FN4A 4PLVA 2BF7A 2EKPA 2ZK7A 3BMCB 3ZU5A 2PKQO 4WOJA 1T2FA 1ADBA 2JKVA 3K5PA 3PXXA 4OSPA 4XYBA 5CDTA 3C1AA 1A71A 3SC6A 4BKRA 2OBYA 3AFNA 1BXZA 3K2EA 5IZCA 3ZWAA 3MWEB 4PZEA 4B3IA 1PEDA 3NDIA 2Q2VA 4MVJH 3PQEA 4XGIA 5EJ2A 3ZDFA 1ONNA 4W99A 3DMYA 1F12A 4O0LA 3RC7A 2FPPA 5JMWA 2C2XA 4YT5A 2HMSA 1U1IA 1DLIA 3VAZA 1UP4A 2VN8A 1E7WA 1FMCA 4UUPA 4AJEA 3AOEC 3CTMA 5DBIA 3OIDA 4BMSA 1BDMA 4TKMA 2HKIA 2B5WA 4GPD1 4Q3BA 1MXHA 3JQ7A 1H6AA 3RU9A 3RU7A 2BFPA 1Y8QB 2GD1O 1B7GO 3IAHA 4EW6A 1MC4A 4FFPA 3L4SO 4IMPA 2YHUA 3NV9A 4M1QA 5JW6A 1ISIA 2NV6A 3GC6A 3OM9A 4BB6A 4BNYA 2EIHA 5DCWA 3G17A 3WICA 1XG5A 2OBNA 3H6KA 3I3OA 1XR3A 3AU8A 2NSDA 1YJ8A 2J6IA 2VUTA 4PG6A 4D46A 2BRUA 5JC1A 1WWKA 5A9SB 2NQ8A 1UXGA 5L7YA 1O9BA 3O4RA 3QHAA 3L6OO 1KIFA 2X4GA 1MXFA 4RV9A 4Z3KA 2DKNA 5JPIA 3SJ7A 3ICCA 3TZKA 3HUDA 1WDLA 3I6IA 3P2YA 1P45A 3MCVA 3CEAA 1VL8A 2GZ3A 3GOHA 3UCEA 2DFVA 5EIOA 3EYWA 3K31A 2CD9A 1IPEA 3E5MA 4IDBA 1N5DA 4J1NA 2H1SA 4RVSA 4IXWA 1ISGA 4H16A 2O2SA 2X6TA 4CQLB 2Y68A 1K3TA 1LTHR 3QWIA 2Q46A 1VM6A 4QFDA 5COAA 2RHCA 5TRTA 1XKQA 3WQQA 4P4GA 1T26A 4QFCA 3FSRA 1BVUA 3MOIA 1K5HA 4BO8A 3IIEA 2BFOA 5H82A 4DBVO 2YY7A 3FD8A 1D4FA 1GZ6A 3CH6A 3GZNB 3RQSA 4CLHA 2R00C 4OH1A 3TOXA 2X7HA 4AJ4A 5EESA 1H2HA 2B5VA 4YJHB 5L9AA 5K6AA 1BWSA 1M6WA 3DAFA 2UV8A 1ZCJA 1I36A 4KWHA 1XELA 2EJWA 3ZCXA 4QTZA 2WYVA 2QX7A 1T2EA 4LISA 2Z5LA 3JD4A 5JBIA 4CM4B 1B16A 1TXGA 3DMTC 4J1TA 4E5MA 4BNIA 2WE7A 1KETA 4IQGA 3ROQA 1C0LA 1EE2A 3VHRA 2OHXA 1P9LA 3SX2A 1ZJYA 2PZLA 1Y1PA 2OP0A 1Y9EA 5HWSA 4BNVA 4ZHSA 3ZWVA 3IKTA 2EGHA 3JQ8B 5FI5A 4PG7A 3S2FA 4R3NA 4FQ8A 2EEZA 1EVIA 1GR0A 3I6QA 1NPDA 4NNJA 3C8MA 3V1YA 5TQVA 3VPSA 2XAAA 2NVUB 3TPCA 3DTYA 4TKLA 5I7SA 4WPGA 1OMOA 2GERA 4AFNA 1ULSA 1E3WB 2QW8A 4DPLA 3IUPA 4IGFA 2RBEA 4E21A 5MDHA 5ENDA 3BTOA 1FDTA 3KOUA 1DHRA 3KYDA 1V35A 2PH5A 3KYBA 1DAOA 4FFOA 4Z9YA 3QVTA 3DBLB 1HDZA 4PZDA 1EFLA 2Q49A 1DPGA 1I30A 2FR0A 3GDOA 4EUHA 5KNLA 4JXKA 4DUPA 2O3RA 1YBMA 1EK5A 2J3IA 7ADHA 4KUHA 3GMSA 2C07A 1UZMA 4IIUA 3S55A 4MO2A 5A06A 3S2GA 3INTA 4MKZA 1E3IA 3C3XA 4F6LA 2UVDA 2X86A 3GGPA 2EG9A 1R16A 1U4OA 2O48X 3H8VA 4I9UA 3KYCA 1NPTO 2I9PA 1NQAO 4FC7A 2VTDA 3HADA 4O5OA 1UDAA 2PFGA 4N7RA 5ICSA 2BI8A 3PVZA 3ZWXA 1HT0A 1BW9B 3P2OA 2AEMA 2NU7A 1LLUA 3BAZA 1P74A 1A7KA 1EK6A 4KTVE 1EDOA 4M8SA 1VRWA 2HRBA 4GGOA 4EJ0A 5B1YA 1UAGA 3B6ZA 2P9EA 4RVDA 5HS6A 3KSDO 5THKA 4UULA 4U5QA 3HJAA 3PZRA 4W4TA 5G4KB 4LCJA 2O3UA 3ITDA 3LK7A 3F5QA 1PQPA 3AOGA 3Q6IA 3WBFA 5MGBA 1U5AA 2NVBA 4KDFA 4NR0A 1ZKMA 3VH3A 1EFKA 3Q2IA 3ZNOA 4D43A 2Y1CA 4CMKA 4RORA 4A27A 3K73O 4Z6KA 2YDXA 3VC7A 1LXCA 3L6EA 4B7XA 4U6QA 1PZGA 3H3FA 2Y66A 1I8TA 5IDQA 3DTTA 4TZKA 4HNGA 4YJFA 1LRLA 1HZZA 4IM7A 2DM6A 3D1LA 3OJOA 4LSMA 1GU7A 3GRPA 2WD7A 4P4NA 1QYVA 1LBEA 3GRKA 2BD0A 3JTMA 2EW2A 1H6BA 3PIIA 4RF2A 3ITKA 5CAEA 4W6ZA 3QV1A 2EP5A 4GKBA 4ZQHA 4RCVA 4J7CA 5JCXA 3RVDA 2ZQZA 2Y0DA 4GLOA 5L51A 4DMMA 5I8WA 4FGWA 2V6MA 4MPDA 5TC4A 3GLQA 4OYRA 4UUMA 2J3KA 4DQVA 4DPMA 2NWQA 1GAEO 2AQIA 4FJ0A 4AJPA 1SCUA 5F5LA 4CR6A 4EI2A 4AJKA 2GDZA 5TIIA 1ZSYA 3P7MA 4R4JA 4FFMA 3RC1A 1ZSVA 4I08A 5IJZA 2D8AA 3JQ9C 1DEHA 2C0CA 2O7SA 4HX5A 3WGQA 2PH3A 4LSWA 1ENOA 2GN6A 2YW9A 3DBHB 4JBGA 1T2DA 1DHTA 1ZXLA 2QRKA 3Q1LA 3VKVA 3TFQA 5U4QA 4A7PA 4XD2A 2CDCA 4BHTA 3O03A 4YQYA 4DGSA 1Z7EA 3C7CB 3FRJA 3RFTA 3ENKA 1C0KA 1J5PA 2FPGA 2DBQA 3BHIA 4RF5A 2IRWA 5BNFA 3BA1A 1KS9A 3GNSA 2CVOA 3BIOA 2OORA 2WWRA 1L7EA 4BNKA 3DBRA 5DZSA 4AJOA 5IXYA 4MIEA 1R4NB 4FJ1A 3PYMA 4PLWA 4YDRA 2DTDA 5IZCC 2I99A 4OGWA 2NVWA 4LCEA 5ER6A 1E0DA 2C54A 4P22A 2JFFA 4BNMA 1NFFA 3ZWCA 2D5CA 3KM0A 1JU9A 4EBFA 3BMQA 3PWZA 3UOGA 4DIOA 4W7HA 2VUSA 5BSGA 2X9GA 4M54A 2A35A 4IGEA 3GF4A 4A0SA 2PZMA 5ER9A 5B4UA 2VHXA 1GYRA 4II2A 4KZPA 5BSFA 4J6FA 5H81A 4WUVA 2HMVA 4HNHA 5JO0A 1SB8A 1I32A 3JD0A 4BKPA 3MJEA 4YT4A 3PRJA 4DBZA 3VH4A 3QVSA 2HU2A 1SEVA 3JD2A 4J4TA 3INRA 3CUKA 3WYBA 2POQX 1PIWA 3VDRA 4M86A 4FSHA 1YOVA 1Q1NA 2JD0A 4YJGB 1Q7CA 2D3TA 2PK3A 1GUZA 3EHEA 2IYPA 4CV2A 1NBOA 2EKLA 1P1KA 4BO2A 5KCZA 1JVSA 2W2KA 4LW8A 3UF0A 3HNPA 1F17A 2O3TA 2C7GA 1VC2A 2G76A 2PLAA 1X7GA 2OMEA 4ZQGA 3WJ7A 5C5IA 1C1DA 4BO3A 3F5SA 1QR6A 1XYGA 5G0SA 3ZNNA 1LU9A 4JROA 5G0WA 1A7AA 4ZU3A 1LI4A 4EJMA 1UDBA 2VRCA 4CV3A 2UUPA 3ZU2A 4RDIA 3W4JA 3PHLA 4QQRA 5CPFA 2FZEA 5U9CA 5CHEA 2VCYA 4YJDA 1HWYA 4BGIA 3A14A 3U62A 4B8ZA 5JXWA 2PA3A 4DQUA 1IHXA 1TT7A 1UXJA 5KVVA 4B7CA 4L4XA 4H7PA 1LRJA 3HE3A 1D1SA 4G2NA 3I1JA 4IBOA 4OQZA 4ALJA 3WMWA 2NU8A 2YHIB 3QIVA 4TQGA 4B4OA 2HK8A 2HCTA 1Y81A 1I5RA 2DFDA 5EQDA 3DFZA 3EVNA 4HFNA 2HDHA 4KOAA 3H5NA 1JVBA 1P0FA 2NU9A 1NNUA 3OH8A 5EERA 1VJ0A 4BO1A 2R00A 2ZIZA 4PLHA 4RQUA 4EGFA 1M67A 2J5KA 4O59O 4DVJA 1T2CA 2AEJA 2FR1A 3JYOA 5JAQA 3IJRA 5K6AC 5F1PA 1NVGA 4XKJA 1F8FA 5TSDA 3DB2A 1I0ZA 1WXDA 1GCOA 1V8BA 4D0SA 4UAGA 3H5RA 1R4MB 2VUUA 1GL3A 5DOVA 3PJGA 3Q9UA 5G0VA 4P8RA 4EZBA 4OOEA 3ZHXA 3HB4X 1MG0A 1AGNA 3H2ZA 4YRBA 1HLDA 4RLSA 1I01A 5ILGA 4FFRA 2CZCA 3EAGA 1VJTA 4ZQFA 4R69A 3VH1A 1GV1A 3TQHA 1JAYA 4KUGA 5TS3A 3NTOA 3PPIA 4GSKA 4OAQA 1HYGA 3H2SA 1P33A 3DOOA 1J0XO 3GHYA 3PLNA 4MVJD 1G0NA 3W8FA 1KC3A 2PD3A 3EZYA 1HEUA 4CV0A 2PGJA 5IG2A 2NACA 5IZ4A 2F00A 3LVFO 4FC6A 4XZ3A 2QZZA 5L7TA 1SC6A 1J49A 2GRAA 4Q9NA 1SZJG 4LGVA 3VZPA 3ASUA 1Q7BA 4YVFA 3O8QA 3RUAA 1T2AA 4ND4A 1R0KA 2YQ4A 2WJPA 4BO5A 4MP8A 5GZ6A 3HWRA 4F3YA 3HDJA 5DT9A 1AXGA 3IMFA 2B36A 2ZYAA 5BSHA 2ZJ1A 1N9GA 1LEHA 4IDGA 1B3RA 2HRZA 1RM3A 1GFSA 2W2LA 2E49A 3WG9A 3IP1A 5JCJA 3R0IA 1KY4A 3D3EA 3EVTA 2D2IA 2ZATA 3TRIA 4A10A 1UJMA 1I3KA 4RQTA 3PHJA 3D64A 3QW2A 5IXSA 4RVHA 3PYXA 3UCFA 1IUKA 4B3HA 1LDYA 4YYZA 2GN8A 5AYVA 1T4BA 3DWFA 4B4WA 2NU6A 4GX1A 4M89A 3GN1A 1E7MA 2IZ0A 2WYWA 1ENZA 2CVZA 4JP2A 5TX7A 1DAPA 3QWHA 4LRSB 3GAFA 3KV3O 4DRYA 2Y0CA 5I7EA 1ML3A 4PLGA 5ILOA 4BV9A 2VNAA 4J1QA 3T4EA 2BGMA 3A9WA 4RF3A 5A3VA 4E5KA 3JQ7B 5L3ZA 4J9UE 7MDHA 2BFAA 3A1NA 4MVJI 2X0IA 1CETA 1V9LA 4HKTA 4R41A 4ZD6A 1JAXA 2ZCUA 1IZ0A 3JQAA 4Y9DA 1Y6JA 2PKRA 5EMHA 5L95A 3ROPA 1U7HA 1DC3A 4HY3A 3QP9A 3PDJA 3DOCA 4XYGA 2AQKA 1QV7A 2FWMX 2NM0A 2W4QA 3OHSX 4BQPA 5KVCA 4I5GA 5HRUA 4RPGA 3MJ4A 1QSGA 3W6UA 3HFGA 4HFRA 5CG2A 4NJMA 3TDKA 1RYEA 1HYEA 3HQ4O 4JGBA 1IOLA 1R37A 3GUYA 2JHGA 3RJ5A 1IYZA 3VPFA 1PJ2A 1W73A 1Z75A 1MA0A 2GLXA 4XJTA 4XR4A 1MFZA 4BNUA 4NK4A 3TWOA 4ZN6A 1OZAA 2Y1GA 3SBOA 1KY5A 1EMDA 3IP3A 4FDAA 4Y6RA 3AY3A 3BXXA 4L74A 5L45A 4WCFA 4G81A 1JLLA 1CERA 1U3TA 2YDYA 2ZYGA 2Y1FA 4GL4A 3VZQA 4RF4A 1CJCA 4BKUA 1LDMA 4L76A 1M66A 3PGXA 3IKVA 4FW8A 4J7XA 1GUYA 4D7AA 2JCYA 3JQGA 4QO8A 1RM5A 3ETGA 4NG5A 2GPTA 1FDUA 3GDFA 1DXYA 1OC4A 3RUHA 2XF8A 3NTRA 3WLEA 5IDWA 1YWGO 5F21A 1YQGA 5JAMA 5JYDA 1PJ3A 1CDOA 2R6JA 3OP4A 4NI5A 5CDYA 1AXEA 4XQ9A 2O4UX 3WYEA 3KSUA 1EE9A 4YRDA 1DFIA 2Q1WA 5CDGA 2NTNA 5T67A 1NM5A 1PGQA 4XRGA 2H6EA 1HDYA 3CE6A 3QLJA 1OBFO 3ENNA 4ID9A 1H9AA 1QG6A 4Z0TA 4E3ZA 1AHIA 4GMGA 4WEOA 3VDQA 4BO0A 3RUEA 4YBZA 5JYEA 1E7SA 2AE2A 1LQTA 3WTCA 2DBRA 1SEPA 2Z1MA 3OIFA 2P4HX 3GAZA 1K6IA 3OF2A 2B83A 1ZK1A 3GGGA 5TT0A 1PS8A 3TL3A 3PJFA 3WYCA 2NTJA 4D3FA 2DAPA 3ZHYA 4B8WA 5A03A 4IIVA 3IDSA 3JQCA 3QWBA 3T7EA 2B4RO 2AA3A 5CEEA 4N5MA 4Y8VA 5A4DA 2CUKA 2EHDA 3ZW9A 3ZNQA 4EJ6A 3DXFA 3CZRA 2CF6A 1RKXA 4CLDA 1YVEI 2P9CA 4PG8A 4FGSA 3DL2A 2Y1EA 3KYDB 5TLSA 4I9HA 4NZ9A 2VWGA 1AUPA 1GZ3A 3H9GA 4TWRA 3K92A 1N7GA 4MVJP 2C82A 3M1AA 1N2SA 2WM3A 1ZFNA 3U9LA 4Q3NA 4E5YA 1C0IA 3N58A 4Z0PA 1U5CA 3U4HA 3PZBA 1PU2A 3AM5A 1H9BA 3JD3A 3KEOA 4BO6A 1P31A 3UCXA 1ULUA 4J0EA 1HYHA 3LT1A 1K6XA 2Z1NA 4TSKA 2BHLA 1GYQA 3K96A 3LC2O 2OXIA 5CDSA 4EYEA 4K28A 3RC2A 4ZICA 3ON5A 4I5EA 3LSYA 3KETA 1IL0A 1ZO8A 3AY7A 3FBGA 3KYCB 3WOHA 3AFMA 4FOOA 1V3VA 3VPHA 4IDCA 5THQA 4S3MA 1QRRA 5BQFA 4MP3A 2WDZA 5IN5A 1E77A 4BO9A 2RHRA 2H5LA 4CM9D 4GVLA 2DBVO 1DB3A 4Z3DA 5KJ1A 3WGOA 1NVMB 3I9MA 4BOYA 3DHNA 4K9DA 2J3HA 3UHAA 5BR7A 2Q4BA 5DF1A 5CEJA 3HFSA 1SOWA 3F6YA 4KQXA 4R01A 3DAGA 4K6CA 2AG8A 1M76A 4OOFA 2C29D 4D41A 1NFQA 4BKOA 1DBVO 1ZK2A 3PK0A 4BO7A 2FSVA 3ZHZA 2D1YA 2FOIA 1NQTA 3G0OA 5HA5A 5B37A 5IF3A 1A4IA 4CUJA 4I1IA 3K8ZA 1JTVA 1SPXA 1TLTA 2BKAA 2W90A 3CXRA 2Q1TA 4Q39A 4O6VA 1LRKA 4YJFB 2Y99A 1VI2A 1Z82A 1ZW1A 4FS3A 3ZZNA 5LDGA 1VJ1A 5KJCA 2JFGA 1DC6A 3W4KA 5FFFA 2WD7B 2WTBA 1PL7A 3B1FA 1YL6A 2CVQA 4JIGA 5TT1A 4INAA 4M49A 2XXBA 2TMGA 3P19A 1V3UA 4FBGA 1EQ2A 4HADA 2C7VA 2GNAA 4ROSA 4BMNA 1H94A 1SMKA 1YL7A 1BXGA 1ENYA 1LX6A 3B1KA 3GEMA 1UXIA 1XEAA 2VOJA 2W98A 1KVRA 1QYXA 3TSCA 3OECA 4G65A 3UFXA 2TMDA 1TB4A 4IQ0A 1I3MA 1Y8RA 2JAPA 3NGLA 4YAGA 2J8ZA 5DULA 3PP8A 5JLAA 3U3XA 2VWPA 1VSUA 1YBVA 5C37A 2ZKLA 4DLBA 2DU8A 4L0QA 2X23A 1HE4A 3PQFA 4WASA 1X7HA 4DLLA 4WLEA 1XQ6A 1LUAA 1CWUA 4JJIA 1BSVA 2QHXA 1HE3A 4FIZA 4NFSA 3G1TA 3HSKA 5ES3A 3V2GA 4FB5A 4YAJA 4IQ8A 1LLCA 4ONEA 5DP1A 3GZ4A 5DDIP 3PJDA 5JY1A 5DP2A 2P68A 3JQFA 4D79A 4XWYA 5DOZA 2P5YA 5AXCA 4TRMA 1H6CA 3AI3A 4IJWA 3NJ8A 4XEHA 1HDCA 1U3VA 1A27A 1HE2A 1DIAA 3C24A 3C85A 3DBRB 3DEYX 3K9QO 4MVJF 2HJRA 5AXAA 3F1LA 4YPOA 5FF9A 3UW3A 3LLVA 5I9NA 1E1MA 4GLLA 2G5CA 2X8LA 4AJLA 1T1SA 2WE8A 2DUUA 4Y98A 1LSOA 2FHSA 3GQVA 4C7KA 1WDKA 2GUGA 5COBA 3LT4A 3L6DA 3BMQB 4EUEA 4BIIA 3GVPA 2OZPA 4CM1A 4J4BA 2VYVA 1F8GA 1TEHA 2V65A 4N18A 4OM8A 4A26A 2E4AA 4GX5A 3GR6A 4J49A 1X15A 4BNGA 1JQBA 2JFHA 1E6EA 1QLJA 1S6YA 1PX0A 1UR5A 3PTZA 4WLNA 3M2TA 5G0TA 5U1PA 5BNIA 1YO6A 4CM5A 1NQOA 3LT0A 1B8VA 1JWAB 4DL9A 4D3DA 5JDIA 1IHYA 2PWZA 4MKRA 3I9KA 3SLKA 2O7QA 4BNWA 4NQZA 4ALNA 5JFOA 1JKIA 4DWVA 1W8DA 2D59A 3NTQA 1YOVB 4GKVA 3LU1A 2ZTVA 4XRRA 1ZSNA 1PL6A 4YXFA 4HP8A 4RPJA 4QSMA 1FK8A 4GH5A 4CMEA 3FBTA 3NYWA 2EP7A 2G82A 2JCXA 2W2KB 3E1KA 4YB8A 4BNNA 1I3LA 4QXMA 3E6AA 4LVCA 3TN7A 2AXQA 3ROKA 4MIOA 3W4IA 4MVJE 3CINA 3S8MA 1NHWA 2AQHA 1C1DB 3FNHA 3RBVA 4GMFA 3WSWA 1E7QA 4L9RA 4CLOA 5KVSA 2ET6A 2YFHA 1PWZA 2EJVA 2UDPA 2VYNA 3W8EA 1HZJA 2BMAA 4MVJM 4DLAA 3QVXA 2NNLD 2VNSA 5C7LO 1BXKA 2YJZA 2Y93A 2JL1A 2NQTA 1K6JA 3ETEA 4CV1A 3E9NA 2SCUA 3SXPA 4DXHA 3H9EO 4OXNA 1BRMA 4PLCA 3R3JA 3SC4A 3Q9NA 2JCVA 2D4AA 3E9QA 3ZWYA 4BQRA 4J0FA 4XQEA 1QV6A 3TFOA 4PZCA 5EL0A 3DZGA 1YE3A 2FPIA 3C7DB 4DA9A 1GYPA 1FDWA 1I33A 4CQMA 3EY4A 3RCBA 1WAMA 4MP6A 2GYYA 3G49A 4NDNE 2Y05A 4WCFC 3G79A 2AW5A 1B8UA 2Q2QA 1C14A 4IXTA 3WJAA 2JD1A 4H3VA 5I7VA 4CMCA 2HMUA 3DBVO 3JYNA 4PLTA 5CG1A 1DFGA 4TRRA 1PJLA 3RFXA 4CM8A 1U3WA 4NMHA 1DRUA 1BMDA 1OFGA 1HDGO 4Y6PA 3LC7O 4XJSA 3MTJA 1YS4A 2V6GA 5A9TA 5J23A 4NBTA 4G5HA 1WZIA 1ZUD1 3LLSA 3GFGA 3SLGA 4OKIA 4DIBA 1YDWA 3QJ5A 4BNJA 4Z9FA 3CPSA 4XIJA 3GMDA 3OEYA 2CMDA 1HLPA 1F0YA 1PGNA 3OMLA 3C1OA 4R68A 1W0CA 4NBRA 2YQ5A 3JQEA 3M6IA 1UZNA 3GEDA 4J2HA 4PFJA 4GI2A 1WDMA 2IEDA 3MOGA 4FFNA 3GNQA 3FNEA 4QECA 1MFPA 4UVGA 1GD1O 3A28A 3A06A 2C2YA 1E7YA 3I52A 5T8KA 3VPGA 1SO8A 3GDGA 3DHEA 3LZ6A 3JSAA 2VT2A 1R0SA 3ROMA 4A03A 1KVSA 2CNBA 3PDUA 2CDAA 3I9JA 4QUKA 1HDXA 3GFBA 1TA4A 3FR7A 5DBFA 3BMOA 3W8DA 3WGYA 3D5QA 3PIDA 4HWKA 3H7AA 2A94A 4GX2A 1B26A 2Q4EA 1HRDA 3IJPA 1L7DA 2QRJA 3RUCA 4CR7A 1QYCA 1XDWA 1PS9A 3VVCA 1RM4A 1G6KA 4Y67A 4LK3A 4C4OA 1EUDA 1SBYA 4IDDA 3V5NA 4J16A 4CM7A 1Q0QA 1KEVA 3AUAA 3DQPA 3I9OA 1U9JA 3O8QB 5HTOA 2AG5A 5L4SA 5COQA 1R66A 3PYLA 1PZEA 2VWQA 5F1OA 1OOEA 4UREA 1KC1A 1IY8A 5KWEA 1DSSG 4IPTA 4YCAA 1A5ZA 1N9GB 3ANMA 2IDZA 3GH3A 1CQIA 3K30A 1QLHA 2FP4A 4WGGA 4AVYA 5K9ZA 1A9YA 4KUEA 1BHSA 4NK5A 3GPIA 1HL3A 2O3QA 2VZ9A 3FPLA 4XIYA 4YAIA 4R51A 3WXBA 3TL2A 3DZJA 2OFPA 4IS2A 2JJYA 3TZHA 4YR9A 5A1TA 4UUNA 4CLEA 1DDOA 4IUYA 2V6FA 1GADO 2E48A 3AUUA 1V6AA 5KVQA 4CL8A 3AI2A 4OO3A 3EGOA 2E37A 3NT2A 5DCUA 3NEPX 1UDCA 4ND5A 2DQ4A 2QRLA 4MIYA 2B4TO 2A9FA 4TROA 1ID1A 1G1AA 4N5NA 3OA2A 2A4KA 4UEKA 1ZH8A 1A72A 3ZU4A 3WGTA 4A2CA 1OC2A 3U09A 1LSUA 4Q3CA 2ZTMA 4X54A 3DO5A 3FPCA 3N7UA 4U7WA 1XSEA 1BDBA 3P5SA 4WCDA 4ZA2A 4NFYA 2RIRA 5I8ZA 3JQAB 1CRWG 2G17A 1GDHA 1U4SA 1UAYA 2Y1OA 4ALIA 4CMGA 3S2EA 3DZFA 4K1LA 1Z7BA 3WDSA 3AY6A 4WOKA 2CF5A 3SEFA 2GSDA 4UEOA 1GQYA 4JK3A 4QX6A 5JY6A 2YYYA 1E1KA 1VKOA 3TJRA 5AXDA 3DR3A 4JJFA 5JDCA 5FYDA 1QORA 1ZNQO 5KJFA 5A02A 4ZQBA 1HSZA 1ZMOA 4Q3AA 4NJMB 3OJFA 3JV7A 1GZ4A 2VT3A 1DLJA 3AM3A 4RJTA 4PLYA 1FDSA 3PJEA 2PNFA 3D7LA 3QSGA 1ZXBA 5IN4A 4L4SA 1NR7A 4BNZA 4W82A 4YAEA 1XHLA 3GVCA 1D8AA 5DN9A 3WSVA 3U4DA 5EQFA 5IDYA 3RBXA 2VHZA 2O2YA 2QZ9A 4CMJA 2Q45A 3Q2KA 3GK3A 3ST7A 3R3SA 3X2EA 4WCFB 4PRKA 1O0SA 1RPNA 1DJNA 3NGXA 2HSDA 3MJVA 2ZYDA 1LNQA 2UUOA 1GPJA 4E0BA 1PJQA 1EQUA 2IXAA 1P1JA 3WGHA 4E30A 3I9NA 1EVJA 3F46A 3JQGB 5T5QA 1T1RA 3ETDA 4PCVA 3SJUA 1E1LA 2D0IA 1X1TA 1KVQA 4B4VA 3JQFC 4U0KA 4EDFA 2IEBA 3WR5A 4TVOA 3AUTA 4PG5A 4WNIA 4MJLA 1B0AA 2WYUA 3JQ6A 1NR1A 5EN4A 3V8BA 2DT5A 3CKYA 3GG2A 2I67A 3WWZA 5GZ1A 1GEGA 3I23A 5B4VA 2XOXA 1RM0A 3DAPA 4LRTB 4CL3A 4GSLA 1WMBA 3BHJA 4CUZA 2BELA 4WE3A 4XGNA 4DIFA 3PI7A 4IINA 2ZB4A 2VOEA 1VL6A 1L1FA 4XR9A 4H15A 1YB4A 4E5NA 1H5QA 3B1JA 3GVHA 1PR3A 1M6HA 3I5MA 3D3WA 2V6BA 1B3BA 1LJ8A 2X9NA 3WLFA 3LQFA
chains in the Genus database with same CATH superfamily
3O75A 3UO8B 6REQA 2ECPA 2Z8YM 2PZGA 1YASA 2OQRA 4X5OA 5C8YF 1GY8A 1KVTA 7GPBA 1E18A 3ZJVA 2BTOA 3S7ZA 1YACA 2HUPA 1S89A 1AE1A 3CRRA 3W78A 1C80A 8ABPA 1DJQA 4DV0B 4BLSA 3QE4A 1ZGGA 1Q2XA 3X1XA 3PTAA 5TMDA 4OA5A 2R751 3E3NA 1PUXA 3NW9A 4O02B 1B8PA 1D8TA 1J8QA 4NS4A 5KCMA 4TXJA 1RKVA 2J48A 3MRXA 2HDWA 4UNSA 1P4JA 4F1KA 1EBUA 3E8XA 5DJ5A 2Y1WA 1CNFA 3AESA 4L73A 4EVSA 2ZWIA 2KQUA 1LA2A 1ESNA 1PGJA 4EECA 2FWJA 4HZUA 2JHFA 4TWIA 1DRVA 3H1AA 4X63A 1NL3A 4RO0A 3EPLA 2O4CA 2PGDA 3R3UA 4A8JA 4UXIA 4YQEA 3SX4A 1ZJ5A 2ZTLA 3U56A 3A0RB 4PQYA 3ZKAA 1BCSA 3QF4B 4U8GA 2R79A 2FW8A 5L6MB 1S3FA 1ZNZA 1U7UA 3OTOB 2I3GA 3ABIA 2XZTA 3NIWA 4FN5A 2FVXA 4IDAA 3PHBE 3WNVA 3N8NA 4RD0A 4D6XA 1DC4A 4E70A 1ISMA 2VEOA 4R9SA 1T5HX 4ZDJA 1QFZA 1W6UA 2D5AA 3IQHX 1D6NA 3GEHA 2P2GA 2J33A 2VVTA 3K0CA 3L7IA 1FPMA 2OXEA 1SCBA 1Z62A 2GLUA 1T43A 3WDSA 1FS5A 2G77B 3C3AA 3F6EX 3JR3A 4ZAXA 3QPBA 4B7ZA 2FR8A 1IDOA 4WMLA 4DM4A 3OICA 1A82A 1P0PA 2ENWA 2I2BA 2UYYA 3QFCA 4LVNA 4ER0A 5H4GA 4N01A 4KR0A 4L72A 2FMUA 4Q24A 5L4NA 1TF5A 3HVIA 3BZUA 1FE8A 2LWIA 1YTUA 4JJGA 1C3XA 3F4KA 3P0FA 4C7XA 3PGLA 3DPIA 5A5FA 4J75A 4TUYA 1V26A 3SFTA 1XJQA 1KSJA 1NF3A 3F0TA 1Q6ZA 2GYWA 3ZZUA 4Y2XA 5B1SA 4AG3A 3W6OA 1U3UA 3FUWA 3W5HA 1ZMXA 5AI8A 5MN5A 2C1ZA 1P3DA 2L82A 4LXXA 1ETUA 5FLKA 4JR2A 4KGZA 3UFBA 5C5CA 4GP7A 1XLTA 3IERA 1YQXA 1G5QA 1ZMBA 2EZTA 2TS1A 1GARA 1DEKA 3OQBA 4PZZA 4WLVA 4C0WA 3RDPA 3EMKA 1RVV1 4K6OA 3KPWA 1ZU4A 3DCYA 3UJNA 3CRVA 1FUUA 1XZBA 2BI7A 3KFLA 2BMJA 3GI1A 3T7RA 3VVBA 4N7BA 4M36A 1RJDA 2P3LA 2RIPA 2PXXA 2RGCA 1BJRE 3QGMA 2ZQYA 4TS4A 3T06B 3ASZA 3BQNB 3ZXXA 2W48A 1S7CA 1I1QB 2IK8A 3IPYA 3ORFA 4MTLA 2BGKA 2MCFA 3HRHA 5JNUA 1K75A 3EWIA 3DBOB 1D3AA 1YH3A 3ANSA 1VLLA 2QW0X 1SA0A 1TD9A 3TNDA 1DJLA 4BVJA 1RVDA 3KB2A 5IVHA 2JZOA 2A33A 1B8OA 3KKZA 2VJBA 1J9GA 1G8HA 1RPTA 2CLOB 2QRVA 1SXJC 5J43A 2IYXA 5ALHA 4J7AA 1L5KA 3WOVA 3AUSA 4D5EA 2ACKA 1RMQA 3QVMA 2VAVA 3CNNA 2Y4OA 4CFZA 1X7WB 3MWDA 3HKDB 4L8YA 5G41A 5DM70 3OBIA 4J91A 1M2KA 1ADCA 2X8JB 3OZIA 3I58A 5C1PA 4ZZ0A 4EAQA 1V11B 2RH8A 4U7PB 2FF5A 5KC8A 4Y3UA 1XTJA 1B4DA 4TL9A 3G6KA 3WMRA 3WGMA 1IMJA 3EUWA 3HXQA 1E3LA 2EJUA 1EM6A 3VR6H 3WB1A 2OV6A 5IBPA 4AUKA 5IDXA 4B4KA 3BWCA 2J41A 4EGAA 4TWBA 3OT5A 1FDRA 3DD5A 3IESA 4QVGA 3HZOA 2VRBA 1ODKA 3F98A 4UPVA 4FEGA 2ZREA 3A1UA 4Z9XA 3HNRA 7REQA 4HMQA 1CUFA 5JLJA 2I8LA 3A6PC 3NHYA 4Z0NA 3IC5A 2FFQA 4EIWA 3GPCA 2E3JA 5L6LB 3H8WA 3EMDA 1EVKA 4HAOA 1Z56C 2VF7A 4EY8A 5LUAA 5LZ2A 1YFLA 3R4CA 4PC1A 1TVKB 5IANA 1R0CA 1LF0A 2X9LA 1A9OA 3Q3HA 4E46A 4KH0A 1OBVA 4NESA 3T7AA 1G17A 4MDEA 3IKLA 1DKLA 3BL6A 1CJSA 4US2R 1Y7IA 5ADVA 1GZ7A 3OLCX 3AVXA 4H6PA 4IWYA 1HE5A 1CVLA 1O8CA 1YDEA 4WJZA 1XFAA 2EKDA 3B7WA 4HFJA 2WILA 2AGVA 4M0LA 2PXHA 4BNXA 1NQ5A 4X1IB 3W1VA 4B2PA 4DA7A 4D3YA 3L79A 2PDAA 4P4LA 5B30A 1E3EA 3J81k 1MAWA 1Y0BA 3ED1A 3EDOA 3S29A 4G5QA 2P5UA 4AYXA 4WXYB 4UM9B 5JHHB 1JJAA 4DXAA 1C3LA 3UZUA 5FLYA 1TQDA 2FRXA 2VRCD 1L3IA 4YMSA 4K9LA 3U7FB 1KYYA 1Q6YA 3OU2A 1KJZA 3O3CA 3THOA 3GLGE 4KIJA 1OXVA 4X6XA 1YVPA 1NE7A 4KE7A 1AMOA 4E1VA 4Z1OA 3AF0A 3SVTA 3H7IA 4C4YA 3CQ9A 4ILEA 3AJEA 1XJCA 3HXTA 5JQWA 1K08A 1FX1A 5HMMA 1ZBQA 3G1UA 2R60A 1GEEA 2PX3A 3N2LA 2GEJA 4OLBA 3ND9A 4LC0A 4RIGA 2IHBA 4YXWA 1E32A 2BZ1A 1SULA 3ZHQA 4KN8A 4WK6A 4GR9A 3BF8A 3L8ZA 2FEOA 1JHXA 2KWIA 2A9QA 3D1VA 4HQLA 4QPZA 4CLOB 1OZ0A 3TLAA 4ND2A 2W8BA 3U1VA 1ZK4A 1EDZA 1VBFA 4MB6A 4FIDA 5JANA 2QPLA 5IJ9B 3VR5H 3MRSA 5B7PA 5ALLA 1SD2A 4JOBA 1OKKD 1UKVY 4NBVA 1QR2A 2CKMA 3A37A 1LC0A 4RFLA 1FVFA 1D1TA 1R8QA 2AFHE 2BCGY 2G9UA 4GOXA 5LDHA 3DTVD 2B8JA 3MD9A 2G71A 4QKQA 4IV5A 5JMPA 5KNBA 2G1UA 1CF4A 3AILA 4KVAA 4S2UA 1BOOA 4DMUB 1KMIY 1ULBA 4KLAA 4X62B 1ZGAA 3DZBA 4LNHA 3TCXB 4RGQA 6Q21A 2FY8A 2O8NA 1WXIA 1Z4NA 4CR8A 1UXKA 1TZCA 4YJ2B 1W9HA 1YULA 4DSNA 3T5PA 3AHJA 4O3MA 4BV3A 4IP0A 2Q1YA 3NMUF 2O2ZA 5F73A 2A0WA 1CZOA 5FPYA 3CUVA 1RZ3A 5IAJA 1IWBB 1T3GA 3IUEA 3HU3A 1ZP6A 3BKWA 1Y8QA 3SSOA 3GVIA 3NDRA 1JW9B 4JQYA 4WKCA 3F3SA 1ZK3A 2G1JA 2PLWA 1OIWA 1I2CA 3VNUA 3CRNA 1SNYA 3LXRA 3NAQA 2EWWA 5LZ7A 4L4RA 1BWPA 1WCV1 2BEVB 4J43A 4X3CA 4P53A 4IS3A 5FI0B 3RK4A 2FLVA 3GO4A 16PKA 1KYXA 1JYEA 3FGPA 3LY5A 2COUA 1YZQA 4JYPA 1S4MA 3PEFA 5AVKA 3EEFA 1ILEA 3CZMA 2AYXA 3T1NA 1NC1A 4FNOA 4DC0A 1D2RA 1VJCA 3GB9A 5E3IA 3FCOA 3B36A 1IQUA 3BQ9A 1U7ZA 3OZBA 2A0FA 4P92A 4ZI7B 4C01A 4E2YA 3UGKA 3LCUA 2IBMA 2O7VA 2Q7DA 1UFVA 3I62A 4X1OA 3ZBTA 4M55A 3LO5A 2ZRCA 2PX5A 2I1VB 1TCVA 4QGSA 3B70A 4DTIA 1UH5A 3GJYA 1QF7A 2IEAA 3PNPA 2XRFA 4YREA 1NQUA 3WSTA 1D2AA 1NUPA 1K68A 1QAMA 1G8AA 2XA2A 1DKRA 3RI3A 3UJ9A 1CB0A 1YQTA 2ZETA 1ND6A 3HHPA 2PT9A 1NRIA 4M0KA 1F0NA 4BGVA 3U7HB 1DELA 1JFFA 2R6HA 3ZI4A 1OFTA 3BMOB 1KQFA 2FZKA 4L22A 4MQFA 5J4YA 3W7BA 1QWOA 3HB9A 4CQJA 1E4EA 1RBQA 5PGMA 2NNWB 2PZEA 3PLRA 3RNOA 3TI7A 4ENRA 1G8JA 2P9GA 4XPIB 3HLTA 1NONA 2PR2A 1G20B 5LD2B 3G8YA 3MWKA 2H18A 2K2WA 5A04A 1E2NA 3T15A 2J5RA 1RXSA 3HB1A 2GS9A 3JVVA 1PFYA 3HDYA 3I04A 4EARA 1A0OA 3ZG6A 3GUHA 4BZWA 2VSQA 4RQAA 2ETXA 1VSTA 3KZ1E 2QRNA 4HUQA 1I2BA 1TPZA 1YJXA 4L5CA 2FZ4A 4Q9IA 1A1VA 1YRAA 5B57C 1EA5A 3V1UA 1IN4A 3CMCO 3ADOA 4E11A 2ZYUX 4R9RA 4WN9B 1YQUA 1QBGA 3D59A 4PBSA 1PGPA 1C3VA 1JH8A 4QFMA 3KHTA 5LOVF 1NY5A 3ESRA 1EJBA 3A9CA 3PT5A 4XH9B 4R7GA 4AJNA 3U5TA 1G3UA 2ZPAA 3I2JA 3KE8A 1IHOA 1XYYA 3ESQA 1TFRA 5HCIA 3CEMA 3ICPA 4XLZA 3HJUA 4C0XA 1FDVA 4RKFA 4D0RA 3D3KA 1XZFA 821PA 1DBQA 3LT2A 2VUIB 3AVYA 2YV4A 4JB8A 3EUFA 3JQAD 2M6KA 5BMVF 1L8XA 4BU0A 4X9XA 1BHJA 3HKBA 3JQ8A 1BYIA 3QEKA 1FNDA 2OUIA 1FTNA 1MO4A 2ZXUA 2O7RA 1IIRA 2NO9A 3FLEA 4BL5A 2SBTA 5I47A 1Z45A 2NVUA 2JLRA 3DONA 4JOQA 4TMFA 4UMDA 5B6PA 2DHEA 3RABA 5DLEA 1AD2A 4Q37A 4BE7B 2QAIA 4B09A 1QE0A 4QRIA 4MS4A 3COPA 3DHYA 3NT4A 3O9ZA 4LY9A 4EHFA 3RADC 2VZLA 2Q7OE 2QTMA 1RLMA 3DD1A 4ZXPA 1MEOA 3PG5A 5HG0A 5K0FA 3RIXA 4X60A 4N6NA 1SBNE 2XRYA 3A1TA 8OHMA 1G7CA 1RSZA 2ID7A 4MLZA 3DBLA 2IW1A 3PR2B 4AJIA 3SS8A 2XD9A 3K0AA 3QVGB 3IE0A 3NBXX 3KWJA 1RWWA 5LZ9A 4CEJB 4LZPA 4ID3A 1X0XA 4CKCA 3EIQA 3HS3A 1FL9A 4M9ZA 3UAWA 1CV2A 4YWJA 1PTJC 4KNVA 2CJPA 1LB1B 3RFCA 4CT4B 5K99A 3ETJA 3T95A 3C3MA 3DKVA 3ZE0B 3UWOA 2H16A 4OFZA 3VU3A 4P86A 1H2AS 5LP6B 4C3UA 4R7TA 1Z5WA 2Z43A 1V5EA 2WVHA 3NPMA 3IEPA 1WPQA 3UT0A 3F2IA 4UM7A 4UU0A 1X0VA 4Y6QA 2GR9A 2GF2A 2BTQB 3IIKA 4C2AA 1V1MB 2GHQA 5JQGF 1ID8A 3OT4A 4IOJA 1UOPA 3DZ8A 2ZB7A 4YPFA 5SZHB 5BSUA 2VK4A 3JYQA 5A0TA 5B58C 1AKVA 2PD6A 1YKGA 1PX2A 4QTXA 2F1KA 1JR3E 3D0RA 1NKVA 1BW9A 2JFWA 3OEHA 4FI3C 4WY8A 3QE0A 1NTOA 2RHOA 1HKUA 1CQXA 4AF7A 5CA1A 1K8XB 3VKUA 2GK3A 3WRXA 4L2IA 2YNMC 3CTPA 3Q3CA 3MWJA 4Q4JA 2R6GA 4KO3S 1L5FA 4DNFA 2FZLA 4NE2A 1VYVA 1VP3A 4KV7A 2C2MA 4C0SA 2EWMA 3AF4A 4IIBA 3LC1O 4OHRA 3TAXA 3WB2A 1NUAA 2PO5A 2C59A 4TL7A 2H59A 4B48A 4L0CA 4PIVA 4YHBA 5JS6A 4B84A 3EDQA 1JIXA 4OKSA 3V7NA 3KAKA 2AC4A 4IDOA 1WP4A 3OE7D 4MZDA 2FMFA 2XQKA 3OX2A 3RVKA 2C20A 1EYZA 5CFZA 2FCAA 3DE1X 4RY2A 3PV0A 4HTFB 1KPGA 3FGZA 1OIVA 4MMXB 4MVWA 1SUCA 2P4QA 2FHPA 2FZVA 3GY0A 1TX4B 3IS3A 3QENA 4LECA 5I5GA 5JCPA 3IAXA 2E6UX 2P35A 2B35A 3KE9A 4YEDA 2J32A 1BTOA 3B1YA 2NO6A 2TRSB 3NONA 4J4HA 5EMKA 3WL7A 1C7EA 4MDHA 4XGKA 2ZAIA 2VDRB 2ZE5A 3D4NA 3F74A 4CM9A 4NENA 5JNWA 1W36D 1Z74A 2WMDA 4A0HA 4BLRA 3CIOA 4X44A 2VBGA 2GM4A 3BX1A 2WUDA 2XB8A 1DS6A 2VLIA 3MM4A 4GQAA 4JL5A 4E2WA 2VJCA 3R3HA 2ADMA 3NVAA 4U9HS 4CYMA 4UVEA 2WAYA 4LJSA 3H1PA 5D8DA 2ZRHA 1MC8A 1XIVA 4KACA 4DMGA 4ZAYA 1N5LA 4MUGA 1YDFA 4Y1RB 3UA4A 3ICQB 4QOFA 1MB3A 3DAHA 3H04A 3MCTA 2AG1A 4LRQA 4P36A 3NALA 2FAXA 3TTUA 2XPCA 1BROA 3D02A 3TQIA 4ARSA 4BUJA 2OR3A 2IZ5A 1K63A 2QIOA 2W6JA 3E9YA 3NHMA 4FPXA 2JATA 4NU8X 3PQ8A 5BN1A 5CFPA 2QPOA 3ES9A 1VJGA 1PHPA 3HJNA 3QKRB 5BOSB 1A8SA 5MHTA 1GVNB 2GLTA 1GFZA 3JQDA 1Z2PX 3E2MA 4GW3A 4DE5A 4B5KA 1YJQA 1JJFA 2FRDA 4H0CA 3NB0A 3Q3JB 4MR8A 4BDTA 1I7PA 1RE0A 1ZH6A 4G8CA 1CTQA 4WNCA 2WFZA 4AY5A 1I2ZA 1T8SA 2DPYA 2PL5A 3EVFA 4MI3A 4PX3A 5K8UA 4QJBA 4TRNA 3GFSA 1H93A 1OZHA 4YLEA 4B9AA 4MQEB 1Z0UA 3DBHA 4IMRA 4RA6A 1EUCA 1GKLA 2R4TA 4NEGA 5IKPA 5JS8A 2DPGA 4XLTA 3A2NA 4QJ4A 3LYLA 2GCOA 5E6RB 8ADHA 1DZ3A 3F3YA 1W19A 2RAPA 5IJAA 3JVDA 2G67A 3HXOA 1QP8A 3RT1A 1M6NA 5C4GB 1JEYB 2OFOA 2BISA 3JWJA 3O83A 1AV6A 1NNLA 5FFMA 2J0UA 2BJWA 4JC0A 1KEEA 1FMLA 3QLTA 2I76A 2C8KA 4OLAA 2WEKA 5C32A 3T7CA 1J8YF 2QRQA 1R0LA 1XEXA 5KINB 5DE3A 3EIHA 1DFHA 1XA0A 4URHA 1JVNA 1KH2A 2JJ2D 3BRWA 3Q15C 4B3RB 1YB1A 2IGBA 3MINB 2H52A 3N2GB 4OL9A 1ZIDA 4PYOA 3C6YA 4GBED 5F78A 2PX6A 3U3RA 2O8EA 3EVGA 4RKEA 3OZUA 2IIVA 4RVFA 1E6WA 4RPCA 1D6JA 2AL7A 3A4VA 3M6LA 4M4SA 4TQUS 4HXYA 2HLPA 4KEAA 4L8VA 1HBJA 1JA0A 1U8YA 2H9AA 2WZCA 3DMTA 1KWKA 1AKYA 5LLTA 5J2TA 1XK6A 1JBQA 1R15A 1QH1B 1IUOA 1SBHA 3CPHA 5DHAA 5K05A 3SCZA 2X9VA 1E2BA 4QQNA 3B5IA 1MJHA 5BRNA 2GYUA 4ZTUB 2M9MA 4EY7A 2EV9A 3EVZA 3RVSA 4YX9A 1XTQA 1A7UA 2KBEA 4QL3A 3ZGYA 1O89A 3M1LA 1C0EA 5KPJA 4PVCA 3KJZA 3NJRA 4J0CA 1BMFA 1GPDG 4CM6A 3KQQA 4YCLA 3HO6A 3BK7A 4C0JA 1CUVA 2C5FA 3T3OA 4PSVA 5HK9A 5BQ3A 5CRIA 1T9BA 2W6IA 3LHKA 3U39A 4K0KB 3RBZA 1ZCBA 3FYHA 3K7EA 1J6UA 1IK6A 1ZQ1A 3OUTA 4JLUA 3ZVLA 4EOGA 5K8TA 4KXFB 5K0ZA 3QFFA 2VPTA 4P98A 4IIXA 3E05A 3SDBA 1QONA 1DOZA 1EIWA 4JASB 4Q12A 4O3FA 1JB9A 1VL0A 1YHYA 3SKYA 1E3TA 3TPZA 2HMTA 4JNCA 3ANYB 1ZRMA 2GNOA 3Q8KA 1WMDA 3FYCA 2G4VA 4EATA 5LMNB 3DMGA 4YRMA 1M5UA 3ZHOA 4BZXA 4L4UA 3WZ2A 1JE1A 4RK1A 4W5QA 3W5JA 4UEQA 4IEFB 4EYGA 2AW3A 3KYIB 1HSOA 3R0JA 3R7NA 1R6TA 5LYJB 1T9GR 1KOJA 2HRCA 3GYBA 4RL6A 4EB3A 4F3RA 4KX5A 4XM0A 1R12A 2H48A 4M1YA 4A2PA 3KAPA 2IX9A 1M2WA 4OXKA 3IAS6 4UUOA 3SI7A 2FQXA 3VAYA 1I7SB 2W2NA 2OGUA 3QUTA 1LKZA 4IHAA 4BGEA 4K26A 5HNKA 3P27A 2IIQA 3OOHA 2CFIA 5ITWA 4LNAA 1EM8B 1LDNA 3STHA 4NBUA 3NKLA 1UMDA 3KOXA 4PHCA 4A16A 5JXGA 5JZSA 4BNFA 4MV5A 4WKOA 4X45A 2QNRA 4MKXA 3FSJX 3NT5A 4G2TA 1E6UA 1SM4A 2ZJ8A 1MQ8B 1WVGA 1GPH1 1OYOA 2B37A 4XQCA 4QT0A 3O21A 4RGBA 3MJSA 2UZ4A 4OHUA 4J3FA 1X8XA 4EJSC 3DMNA 2ETVA 1XUOA 3DFFA 3QXJA 3TIFA 1JDJA 4OBWA 5EJ4A 1XTRA 2X0JA 2QN1A 1O96A 4K40A 4P31A 5D3QA 3SJBA 4F4FA 3ZE8A 1TIPA 2W71A 2YVUA 3GL9A 3SR0A 1PQWA 1SHTX 2EZUA 2H4HA 1KYWA 2XKBA 2PN1A 4B7CA 1KEPA 4QNNA 4G5OA 4EG7A 3EXHB 3MMSA 5AVXA 1CIJA 2R2GA 3Q1KA 2W00A 4MKIA 1L5ZA 1PG5A 3QNUA 4ZCRA 2VYVD 1NQVA 3OX4A 4HH4A 3ONVA 1OYYA 5HJ5A 1PLLA 2PUVA 4U7TB 5DNYB 5AKGA 2PHZA 5BV7A 2PMCA 3IT3A 5KUTA 3TW4A 1QQ7A 1IBCA 2WLSA 5DRTA 4FLMA 1EEHA 3KLPX 1KA9H 3W2TA 3ONWA 1MIHA 3RRBA 2HA7A 1W2HA 2JJ8A 2XBUA 2B30A 4L6AA 2WJGA 5E4YA 5H70A 1J4AA 1UM8A 3DF9A 3RVMA 4F84A 1PSWA 4A2QA 3BEDA 3R6LA 1WDTA 4L0MA 3TFWA 3GJTA 4C06A 1YRHA 4V1CI 4JP3A 5GM1A 4F46A 3EZ7A 2XYGA 3BFPA 3G13A 2NSLA 4TV8B 4HAYA 3SF8A 3CR7A 4LYFA 3ZWMA 4XSGA 5JZOA 2ES4A 2TYSB 4YGXB 4WJKB 3R3XA 3QKSA 1Z29A 5DXJA 2AT1A 3O8NA 4JEUA 1XCBA 2QV0A 4NCJA 1GSIA 1E3JA 1LQ2A 2OT3B 4NYJR 4CF5A 4FOSA 4LJLA 3GUUA 3IUJA 4O1MA 4XCQA 3S2IA 1UT8A 1I24A 4N8DA 3VR2D 5KTRA 5L53A 1PSDA 2BH9A 1BXRA 4Q3DA 4KSYA 4E22A 3LDAA 1JDUA 4II7A 5CX4A 3TM5A 4QICA 1NDUA 3AW8A 4HLQB 2Q3LA 4NMXB 4QUAA 5CLHA 3T4XA 2GXSA 1U9IA 5BXYA 3KSMA 1N92A 3RT9A 2DPMA 1Q2UA 1QOQB 1D6MA 1NAHA 1YOBA 2GB4A 2RK3A 1P7PA 3CB4A 3LUBA 4QDJA 3T9AA 4W5WA 3WFJA 4CEIB 2R0QC 3DAOA 3NOXA 3U81A 1ZNYA 1N32B 1UJ6A 3LLCA 3SAJA 1KBOA 1ZGHA 1ZM3A 4KQ2A 4UUBA 3AHHA 3SHVA 5FLEX 5HSGA 4MINA 1RI3A 1PS0A 3PQ4A 4LWZA 5GVRA 4NU5A 4ZAWA 1K2WA 3M3PA 2C78A 5C8DA 3K72B 3QE9Y 1MPTA 3DFUA 1HFJA 3HN2A 1YS6A 1UXOA 4TV9B 1VIMA 4HRYA 3ZWOA 2EBHX 1T36B 4OBEA 3X2FA 4C03A 4MCHA 2JK0A 1FB5A 5AOAA 3V1KA 4QYIA 4CCYB 5JAHA 4AZ0B 1QFXA 3UBTA 4OK3A 2UZ1A 4NEHB 3L7NA 4QDOA 1ADBA 1U81A 4OSPA 3B48A 3WWCA 5LLDA 2IPOA 3FMGA 1TKRA 4LK2A 3AFNA 2ZE8A 1FTQA 1L4MA 3K2EA 3AHEA 3VV2A 4D74A 1G64A 5IK2A 4PY2A 3A11A 3NHFA 4R0MA 4FBMA 4CIWA 3DOFA 3C8ZA 1GPAA 4FKBA 1SVKA 3SYTA 1OH7A 2Y1LA 2J08A 2C3PA 1Z36A 3ELYA 3DMYA 1QVRA 3RC7A 5CH8A 2CUTA 2QL9A 3N2IA 2RGXA 3PXUA 2X15A 4M7PA 1GA1A 2HHHB 1GGKA 1DLIA 3OWOA 1XF9A 1RQNA 2OO7A 3X43A 4MUEA 4A8TA 1EQAA 3D7SA 2HSWA 4GPIB 3PGA1 4ZKDA 5JXIA 3DE6X 3AOEC 4LPKA 2EW1A 4YFYA 4FONA 1BDMA 1VLJA 4TKMA 4YCBA 2R9VA 3E1GA 4RH1A 2B5WA 5IYZF 3RKSA 2ZWMA 2QN3A 2BFNA 1R2QA 2BWJA 1Y3CE 2AJTA 2B78A 2YHSA 3EUEA 1GNVA 3EQ8A 4KQ9A 4GT1A 2SHKA 3RU9A 3RU7A 2GD1O 4F3CA 1SUPA 4J0DA 4NJEB 1B7GO 3SC3A 5GP1A 4JI4B 5LIRA 3RYIB 3ZGLA 3NBYC 3ORRA 5DM0A 4EW6A 3CZ5A 4IMPA 3KJHA 5I8PA 4PPNA 4L3WA 3OM9A 4BNYA 3DOIA 3LZCA 2OBBA 3U3JA 4XWKA 2PUJA 5CBKA 5JFGA 1Z17A 3EC2A 3WICA 2WSSD 3PEVA 1E1QA 3PITA 3HYNA 2E4ZA 3H6KA 2CWWA 1SXJD 1XR3A 1P2UA 2VUTA 3AU8A 3I3OA 3QTLA 4PG6A 5G1NA 3RS0A 1XDDA 2DECA 2HPAA 1NF9A 4WZBA 1WB4A 4O1IA 5A9SB 2VJYA 4UOZA 1Y1RA 1T2UA 2AUNA 1I5OA 4RJ2A 5KYVA 3KU1A 3R5FA 1O9HA 3FJYA 5I9TA 5KNCD 4RV9A 3QX8A 2WJWA 5FBLB 2H0RA 4KR2A 3DQQA 5BPHA 5DTRA 3EXFA 2O2XA 3FMVA 3P9CA 5JTTA 1WDLA 1E5DA 1WY5A 3D8SA 2P8SA 3I6IA 3QVVA 1DQNA 2QJWA 5AUNB 4ZFNA 3L93A 1JF8A 4DUGA 3O2QB 3LTEA 1L5GB 3UTDA 5JVDA 3BN3A 3UCEA 4UAJA 5AW4A 4PPYA 2ZJ7A 3E5MA 2JHAA 4FILA 3PVCA 6AT1A 5LQKA 4QXQA 4MW6A 3ZCTA 4R71A 1BIFA 5F7ZA 3U60B 3MS7A 1L9KA 4LGMA 1GITA 3P9SA 4NXNB 4FYKA 4IXWA 4E6EA 4DR5B 2FMXA 2O2SA 3ZQ4A 5K3FA 2X6TA 2YFKA 3BULA 4QPJC 3TMAA 1K3TA 3GLUA 3BJRA 5JNTA 4QFDA 3DM9B 4PXYA 1XKQA 4NL4H 4ZALA 1FRVA 4MV0A 1W76A 2A88A 2FWIA 3KR9A 2ODNA 2X8BA 3NI2A 3PX2A 5CT9A 3MOIA 2H7XA 4D25A 3T5CA 2R7MA 2V9PA 2HTEA 2G06A 3IIEA 4U7FA 4BO8A 4PR3A 4DDKA 2YY7A 5FBRB 3K4PA 4U5XA 3NFRA 1H2ZA 4RFSB 2R00C 4OH1A 3P0JA 1IY0A 2FPMA 3VYVA 1QG4A 3ZY4A 4AWBA 3ZDAA 3S99A 3VJLA 5L9AA 3EA0A 3FNBA 1D5WA 3E3OA 3RV3A 4ASUA 2QYOA 5J5VA 5K6AA 1M6WA 1MO3A 1N2GA 3D54D 1I36A 3DAFA 2UV8A 3ZCXA 3G02A 3ML1A 4C4SA 4QTZA 1OXMA 2NSJA 5BWLA 2LCIA 5FOVA 5ALVA 2QX7A 2WMOB 3I9V6 5BSRA 2NPFA 1TM3E 3L1HA 3JD4A 5JWOA 4B82A 3B1WA 3UPUA 2WP0A 3MPOA 4F1JA 1OPRA 1EXWA 3VHRA 1EHIA 5LKRA 2IGTA 2DR3A 4MUNA 2X4IA 4KXXA 2J9FA 3MTAA 1XA3A 3QLUC 2OP0A 5EEHA 1ZESA 3SM9A 3V4LA 4AP9A 1NN3A 4BNVA 2B6NA 1NVUQ 2BSAA 2O1SA 3SZRA 1ST3A 4TXMA 1A5AB 2XOKA 4FR2A 6CHYA 1BS1A 4MW7A 1NNI1 4P34A 5IMBA 4PG7A 1G2OA 3EGDB 3L0YA 2V0GA 4ZT3A 5K0EA 4BLTA 1DINA 3B3AA 3PNLA 1GTJ1 4DKXA 4DDUA 4XASA 5EJIA 5FL3A 2PBLA 3TPCA 1U0LA 2Q62A 3DTYA 3T4PA 5I7SA 3OZRA 4UAUA 3TGWA 5H3CA 1E3WB 3HCAA 4DPLA 3BM5A 4R2XA 2R4QA 4MUBA 5JS2A 1CY0A 4URYR 2V7QD 4G9BA 4E21A 3NHKA 1VHWA 4AROA 5LMUB 4RTMA 4KR7A 1DHRA 2K6GA 3FETA 1FUIA 3KZOA 4C2TA 4FFOA 1DAOA 3FVWA 1RC0A 2TMKA 4DLVA 2DFLA 3QVTA 5CLLA 4INJA 1RAGA 1JR2A 1HDZA 4PZDA 4RHXA 1EFLA 2HIAA 3PNOA 3BB1A 2Q49A 3OTIA 2G9QA 4OXIA 2FR0A 3GDOA 3TOSA 2BP7B 4EUHA 3EVEA 1SBTA 4O2AF 3I5XA 2HA6A 1NZFA 2AR9A 2Z0MA 4OJTA 2VHUA 5CB8A 2C07A 4IIUA 3H18A 4X84A 2FX5A 3ZLUA 4PQEA 3S2GA 3DWEX 3L06A 2UVPA 1C2YA 2IZ6A 4RULA 2J0QA 1AXRA 2DFTA 2V7UA 2AJBA 3HY4A 4F6LA 3A9TA 3IOEA 1NJ6A 1IXKA 1VYUA 2C3YA 3GGPA 4UHEA 4EKYA 5FWYA 1AUXA 2O48X 1GNSA 2VSOA 3BH0A 2P2NA 3H8VA 1NPTO 4H7DA 3TAHA 1MHTA 5JSZB 2I2CA 5CD1A 5JJIA 2GPBA 1SG6A 1NSTA 2VTDA 1HURA 2FNAA 4FC7A 4KN6A 4O5OA 3ZJUA 2PFGA 3CT6A 3KJGA 4ZT4A 1F2TA 2FK8A 3C43A 3Q2OA 1E9DA 2FSPA 1RCFA 2FWAA 2B7BA 1P74A 1XEWX 2WTEA 3CLTC 3UAXA 4KTVE 2IJGX 2HRBA 2WIGA 4GGOA 4EJSA 1EU1A 1U7XA 1TECE 1DE0A 2JFZA 4KO8A 1UAGA 4KU4A 4RVDA 4X3PA 3KSDO 1UKZA 2Q3HA 1K7XB 1AKUA 4R81A 3UT6A 4ES6A 4CFYA 4Q3KA 2BEWB 2CLLB 2YQZA 3F5QA 3I6MA 3ITDA 3LK7A 5H68A 1J8FA 4ZU6X 4FNMA 1CZRA 1ODLA 1GQRA 1U5AA 1U5BB 3FYDA 2WIJA 4TN1A 5BWNA 4QRDA 1DVRA 2VLBA 3OC0A 1ZKMA 4DWJA 3VH3A 4JHXA 2BONA 1EFKA 4F4IA 3QVKA 2Y1CA 3DNMA 1D9ZA 5J47A 5DGDA 1I5EA 3T5MA 3EJ6A 1TMOA 5JYBA 2PE5A 1KP3A 4H9GA 3NG1A 1IQPA 4XQ0A 3VR3D 4AY6A 1LXCA 4KGDA 2XZPA 1ZRHA 2D0OB 4IIGA 1PZGA 3ID6C 4U6QA 5DTJA 3OM1A 3ETCA 5JWHA 4OHMA 3DTTA 4RHEA 4HNGA 3SZMA 4H6VA 4A5SA 3UNXA 2WU8A 3UANA 3AR8A 4IM7A 2DM6A 3H97A 2VSFA 1PKXA 2LD4A 3FM9A 2GAJA 3GRPA 3SQXA 4ZARA 2BD0A 2P6OA 3PIIA 1JIIA 2XWBF 2O06A 3B7PA 4RL4A 4PNPA 2W70A 3KKOA 1R00A 4YAUA 2AKYA 5CAEA 4W6ZA 3QV1A 2JEZA 4F71A 2WKWA 2EP5A 4KMMA 1O08A 4GZLA 4RCVA 4ZQHA 3FMIA 1KI6B 3M4NA 3PEEA 4GMXA 4J7CA 5DWDA 4WBNA 3EMBA 3IEXA 2UZIR 2Y0BA 2HU5A 5L51A 1NNSA 5DTEA 1QS0A 2DSNA 4PR0A 4FGWA 5I8WA 4IV0A 3P8ZA 2V6MA 3ZC3A 4MPDA 1DL5A 1YA8A 4G07A 4OYRA 1NW9B 3DPUA 4GHWA 1NMSA 3PUJA 1GPMA 2AQIA 2VBFA 3BBPA 2CFOA 3ACBA 2F90A 2GRJA 2M32A 3KL2A 3LBHA 3N39C 2P9YA 4O4LB 1X8LA 3P7MA 4R4JA 3RC1A 1UAAA 3EBPA 3ZS8A 2JAOA 4JSRA 1TEZA 2D8AA 3JQ9C 1DEHA 4B4DA 3KDAA 2Z3VA 3GOQA 3KCQA 5D51S 1Z4IA 1OB2A 1GTL1 2PH3A 4LSWA 4F85A 4JBGA 4MXDA 3IAAA 1GG8A 1XAIA 1HDEA 3E58A 1Y1TA 2HIHA 3Q1LA 1I2AA 2JDID 4PX5A 2QTWB 1C30A 3DOEA 5U4QA 3CE9A 4L8WB 1PW7A 3TB4A 4M0PA 2ZYRA 1W7AA 3BIJA 3EYAA 1Z7EA 3L7JA 3FRJA 1H2YA 3IVXA 4JYBA 2J59A 1N36B 1W4RA 5BNFA 4F4HA 3KFVA 1KS9A 1D09A 4KWCA 4C14A 5L3QA 1M8KA 2ZLBA 2GPSA 1WVMA 3DBRA 1QGDA 1PKEA 1R4NB 3PYMA 4FJ1A 1G4UR 1A9PA 1DTSA 2VJPA 2DTDA 3IQXA 1OCEA 3D7MA 4OGFA 4YDRA 3G88A 3G0HA 5CLFA 2I99A 3JRWA 5ER6A 4JYAB 2B8NA 1PDVA 2V3VA 1O7JA 4ZREA 2CXOA 1QHSA 5IFKA 2R47A 5KOHA 1JDNA 3N76A 1R7RA 1JU9A 2ZRGA 5HKAA 4R0VA 3PWZA 4MEBA 3RHFA 3DMPA 4DIOA 2VUSA 3O4FA 3MGBA 2VDMB 2EZ9A 1GU1A 4IGEA 3GF4A 4MJ7A 4FYIA 4JI5B 3N9IA 5B4UA 3OLWA 1SKYE 2C3UA 2B20A 1I14A 3FKSD 2VBCA 1GA6A 2ARKA 4TMZA 3M4YA 3NHLA 1E2MA 4G63A 2XX3A 4DCNA 3CVYA 4LFAB 1CQWA 1M0TA 1R5JA 1U0HC 2ONKA 2ODPA 2HWWA 1TMGE 1V8PA 5EFOA 1SB8A 4B3BA 4G0PA 2HK6A 4EY4A 3NDBB 3IUBA 4BVHA 2WKSA 2QMOA 3LCVB 1SEVA 4ATNA 2WMYA 3CNLA 3INRA 3R9WA 3WYBA 1G8MA 3DYIA 3OIVA 5EIBC 3QFTA 4B3DA 4FSHA 3VSEA 2CL7X 2FJUA 2PU5A 4WFQA 2IHYA 4QODA 1Q7CA 3S81A 1WHSA 2HXSA 4FEYA 3B78A 1R3DA 2DH6A 2XVYA 4KJZA 2IPNA 4CCSA 4TX1A 5AKXA 1PR0A 1GPUA 5EKSA 2VQFB 1LBIA 4JELA 4K9RA 5KCZA 3AVOA 1U9ZA 1F4LA 3HNPA 1F17A 1N8SA 2I71A 3FSGD 3OCJA 2C7GA 3QMMA 5E95A 3UMFA 2H54A 3QLVC 2YNMD 2PLAA 5CU7A 2VXBA 3V97A 3WJ7A 1P6XA 2CD7A 2V0NA 3TTSA 1JHMA 3WLRA 4F04A 4F9TA 3F5SA 4KHPB 1LU9A 5G0WA 1E2FA 5AM4A 1ZM4A 1LI4A 4RY9A 5ICEA 4BY9E 4QPNA 5DYTA 1RP1A 2H1VA 3JR7A 2WM2A 3ZE2B 4CV3A 3SZGA 5IC4A 4QQRA 4TXHA 1UBCA 3Q8WA 4H35A 5FDFA 5J59A 3P0IA 1Z7YA 2QV7A 2JAQA 1Q44A 3K6RA 3RC3A 10MHA 3FCAA 4EI7A 5EHXA 4JL8A 2I1WA 4BGIA 1NKSA 2TECE 3U62A 2OUKA 1ZIXA 1ATZA 1RE1A 1XXHA 1COWD 1IHXA 3HO8A 3O7WA 2YINC 4UPEA 1UXJA 3T4UA 2G1KA 4TYMA 3G9UA 2AI1A 1G2PA 2A5DA 3K2QA 4LAFA 2H3EA 4LV5B 4CL0A 2ZUBA 4S35A 3WYDA 4ISBA 4FFVA 4OQZA 2QVYX 3ZY6A 4CIDA 5CA1F 1L5YA 4TQGA 2MU1A 3K05A 4B4OA 1RD4A 3FFWA 2HK8A 2HCTA 2G6TA 1Y81A 3IEIA 4QUJA 5IF9A 2OCDA 3V8NA 3OLYA 2DFDA 1XD8A 2ZI4A 2EDAA 1ABEA 3EVNA 3OURA 2H8KA 4HFNA 2LCFA 3H5NA 4C2BA 5C4MA 2X0DA 2HJ9A 1AMUA 3EDRA 1FQWA 4NYIQ 4CKWA 5ED0A 1YIDA 3C45A 4DQLA 1NT4A 4TTIA 1SUDA 1UIRA 1VIYA 4G4GA 1AUVA 1SBZA 1XD9A 2R00A 4CN8A 2UZAA 4B6FA 1T2CA 3VNAA 2AEJA 2CJFA 2RHTA 3JYOA 1SU4A 2JKZA 3IJRA 1NVGA 1XTUA 3DVAA 2RC5A 2DHRA 4K5QA 5TSDA 1OHHD 3UA3A 1I0ZA 3N70A 1DXHA 1WXDA 4QD3A 4JT9A 3KZMA 5AVTA 3ZD9A 4FTWA 2O57A 2F7SA 3L84A 3A3NA 2VUUA 3PA8A 5ALNA 1PBNA 3DLPX 5G0VA 5BN3B 4Y18A 2ZZNA 1AGNA 3PD7A 2R44A 3X44A 1HLDA 1UFKA 4K9NA 4GYYA 4RLSA 3D5EA 3EAGA 5ILGA 1BWRA 3VH1A 4QTYA 2FX2A 1VKJA 2QAGA 4Z7NB 1JEOA 1P8AA 3A4LA 5TS3A 1RQPA 4ZK2A 1BEZA 3RS2A 3GV0A 2V3CC 3H2SA 1F6WA 5AK5A 1VRCA 3UJ6A 2CXTA 1NVAA 2ZJ2A 3GDHA 4FYYA 3WP1B 3VKGA 5J9FA 2I7CA 2XQFA 1IEQA 1SBQA 1GO2A 2EJBA 1KC3A 2PD3A 3EZYA 1VMIA 1KSGA 3RVJA 1AO0A 3HVJA 5IG2A 4OQEA 1Z39A 2F00A 4B87A 1S2OA 2P11A 5EUQB 1OBOA 4FC6A 2X2OA 4HC4A 5ALEA 3GLIB 2XTAA 3BG