4AJKA

Rat ldha in complex with n-(2-(methylamino)-1,3-benzothiazol-6-yl) acetamide
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
331
structure length
330
Chain Sequence
AALKDQLIVNLLKEQVPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLKTPKIVSSKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPQCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPQLGTDADKEQWKDVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCILGQNGISDVVKVTLTPDEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-LACTATE DEHYDROGENASE A CHAIN
publication title The Design and Synthesis of Novel Lactate Dehydrogenase a Inhibitors by Fragment-Based Lead Generation
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase/inhibitor
total genus 115
structure length 330
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ajkA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4ajkA02
1MFZA 4NG5A 4GLOA 2PNFA 5CPFA 3S2GA 2HK8A 3WXBA 2YYYA 2E82A 1WDLA 3SVTA 2ZIZA 4Y6SA 1XU9A 3JYQA 4GL4A 1RWBA 3AM4A 4K6CA 5EESA 5JXWA 3ASVA 1R0LA 2QRJA 4GX5A 4IDFA 2DM6A 3RD5A 3ZH2A 4FFLA 1LSUA 3I4FA 4RVGA 1U4OA 2RCYA 1YXMA 1ONNA 3QWAA 3GT0A 3MJEA 1BRMA 3CXRA 3ADOA 3DL2A 3KHUA 1ISIA 3RUCA 2FY8A 3Q3CA 1HWYA 4JNKA 5A02A 4E5NA 2YZ7A 2GN8A 4AJEA 5IZ4A 2CDAA 3F3SA 1H6DA 5K6AA 2HMVA 2D2IA 3RROA 4CL8A 2QQ5A 3HWRA 3LU1A 2Q2WA 4J2HA 4YQZA 2AG8A 2PA3A 3FWNA 4BNGA 2JFFA 1QMGA 4OHUA 1NR1A 1EE2A 1C3VA 3OHSX 4NZ9A 3ZWXA 4ALMA 4CLRA 2CF5A 4ZRNA 4GWGA 2P68A 4FFMA 5JY6A 1RYDA 4IDGA 3DONA 4DYVA 4GWKA 4PLFA 5HS6A 4YAJA 2CZCA 1PQUA 3PTZA 4JGBA 4XGNA 3P19A 4G81A 2A35A 4RLHA 3ASUA 3LT0A 4BIIA 1V0JA 4JP3A 2EWMA 1E5QA 4UEJA 3DZFA 2NVWA 1E6UA 3ZHYA 4BOYA 3VTFA 4AJJA 5DCWA 2CUKA 2O3RA 1ZH8A 3CIFA 1KEWA 4XQEA 5TRTA 3W8DA 5AXAA 4B7UA 4B7XA 2QRKA 3GQVA 4W7IA 3DBLA 5K9ZA 3NT2A 1A27A 3NT5A 4II2A 3WGYA 5AXDA 3M6IA 1IULA 4JBGA 4CLRB 1PS0A 1U8FO 2B5WA 3OH8A 3AUTA 1U2GA 2PLAA 2V7PA 3LK7A 4HADA 1Q0HA 4DMLA 1GD1O 1DOHA 2IYOA 2JFGA 3DBHA 1HDCA 3VH3A 1I01A 1I36A 4YT8A 3WYBA 1I3LA 4NR0A 1E92A 3P2OA 3PLRA 1CEQA 2BHLA 3GF4A 3IDSA 2HMTA 1KC3A 3U4IA 1B8UA 2FZEA 1ADGA 1RM5A 1YB4A 5DZSA 1A71A 5ITWA 1K6IA 3W1VA 2X0NA 4AG3A 1X15A 2X6TA 1FK8A 1JKFA 2POQX 3H2SA 1FDVA 5B4UA 1GQYA 5K0ZA 2VCYA 2PGJA 1SPXA 4YT5A 3PXXA 3OQ1A 1DIGA 5TC4A 2BGLA 1QP8A 3ICPA 3I83A 2HKIA 5I9MA 1KVUA 3JQBA 4ND3A 1FDSA 4B4OA 1DC5A 3U4DA 2FP4A 4E2XA 2PZJA 3CINA 3ZWOA 4BO1A 4ROSA 3G1TA 1SCUA 4CM9D 5DOZA 1TI7A 4I5GA 1CWUA 1G6KA 1Z45A 3HFSA 3JQ9C 1PU2A 3GDOA 2FSVA 4BQRA 2VRCD 2TMGA 3ITKA 3WTBA 3FCOA 4I9UA 2FSSA 4PLCA 4YAGA 4R1SA 2AW5A 3SLGA 3DFZA 4R01A 5BT9A 1EEHA 2CF6A 3VAZA 3I6QA 4OSPA 3KRTA 2X9GA 4XQ9A 4Q39A 3EY4A 1Z75A 4OM8A 5T8KA 3VDQA 1BTOA 1KEPA 3FR7A 4E21A 3OA0A 5FFFA 3DBVO 1W8DA 3OSUA 4IDCA 5HTOA 4MDHA 4UREA 4DQUA 1HTBA 1EBUA 5U9CA 1J5PA 2PZLA 4XR4A 5KKAA 3ZWMA 4AVYA 4JLWA 5A3JA 2VN8A 3HDJA 1KERA 4CLOA 1LDBA 4J9VA 1KOLA 2AA3A 1VE9A 1N1GA 2CVZA 5FWNA 1JWBB 4LW8A 3KYDA 4PG8A 1BXKA 4TWRA 4N7RA 4BGEA 1NQ5A 1Y8RA 5A9TA 3V2GA 8LDHA 4ZRMA 3N74A 2RH4A 5AQ1A 4J4BA 3HB4X 2D59A 1ISMA 1DPGA 1X7GA 5B37A 5TLSA 3SXPA 4NFSA 1NBOA 1MC4A 1GL3A 2NSDA 4UVDA 4XRRA 4R3NA 3GFGA 4EZBA 4P22A 1RM0A 1EK5A 3I23A 4LN1A 1Z82A 1ORRA 4GVXA 2EP5A 1JDJA 2DFVA 1ZCJA 4HKTA 2DTDA 1K6JA 1L1FA 5J23A 4CR6A 3WMWA 5KVQA 3AI3A 5I9NA 4NFHA 3AW9A 5HRUA 2WYWA 4CLOB 1XWFA 2LDXA 1EUZA 3BHJA 3GDFA 4FGSA 3JQ6A 1DSSG 1HEUA 3D3WA 3KYDB 3PDUA 3UH1A 2J3HA 1Y8RB 2Q1UA 1GY8A 4DREA 2YFHA 2JD2A 1PJ3A 1P31A 4BNJA 2FN7A 3UCFA 4CV2A 4U8GA 1FJHA 3T4XA 4CMEC 1C0LA 3ZU2A 3WFJA 3E9NA 3BYZA 4HNHA 3RQSA 1LA2A 3U5TA 4BO6A 4Y67A 1VL8A 1E3LA 5ITVA 5JYEA 3B1JA 5KJ1A 4OXYA 4QTZA 3S2IA 3OIFA 5CFZA 1BHSA 4ZVVA 4E5MA 1IZ9A 1ZMTA 1T2CA 4QSMA 4IQGA 4YACA 4BV9A 3DMTC 4K28A 4LISA 3CUKA 1GYPA 4BGIA 4O6VA 3BTSA 3VZSA 3VDRA 3HZZA 4W6ZA 1LU9A 3D3WB 1Y5RA 1NYTA 1ZNQO 1IPEA 2C82A 4H15A 4I9HA 4A27A 4ALKA 4FOSA 4R9SA 4KQXA 2FRDA 1LLQA 2PV7A 5COBA 4Z9YA 1U4SA 4AJKA 1YBVA 4RPHA 3UUWA 3W6UA 4P8RA 2DUUA 2EGGA 2I99A 2PGDA 1CERA 2X7HA 1ML3A 4QUKA 1HDZA 2O50A 2C54A 2VNAA 3QVTA 4AJHA 3ZU5A 1GQ2A 2Y1EA 4QO8A 3RAJA 3K5PA 1QLHA 3B1KA 1HDYA 1X13A 4J91A 5DNAA 5TGDA 1WVGA 2C7GA 3ONDA 4IINA 5JCJA 3PIIA 2A4KA 4XQCA 4EYEA 1Y81A 1H9BA 3WLFA 4PRKA 3PEFA 4MVJM 4D42A 1P1IA 4NU5A 1FF9A 2J3IA 1YJ8A 4H16A 3PRJA 4CQMD 5CPBA 2XXBA 1QG6A 2GLXA 2QX7A 4NFYA 4WGGA 1EDZA 4BNXA 3GN2A 4TRRA 4D46A 2NACA 1P1JA 3BIOA 3PQEA 1XHLA 3EZYA 3NX4A 3FNEA 1WLYA 3FN4A 5U4QA 1LX6A 3VTZA 3RASA 3R1IA 2YQ5A 4EEZA 3QV1A 4P4NA 3WGZA 5JAMA 4NIMA 4Z9FA 5KNLA 2Y1FA 3OJFA 3TFOA 4IQ8A 2EG9A 2YUTA 5DT9A 1JU9A 1QV6A 4U6SA 4KTTE 4R41A 1LXCA 3D4OA 3NDRA 3JQGA 3I1JA 3W8EA 3FI9A 2Z95A 4ALNA 5FF9A 1DIRA 2ZTUA 3DHYA 4Y98A 1DBVO 1AXGA 3ITDA 5T6BA 3E18A 3X2FA 3JQCA 3UFXA 2VNSA 1EBFA 4OSOA 3PHIA 2J8ZA 4Q3DA 2X58A 3IQDB 1EQUA 3ZV3A 3V8BA 2GCGA 1AUPA 3U0BA 3SX2A 2NTJA 3GVIA 4Z6KA 5IDWA 3T7CA 4CLEA 1BSVA 3KLMX 2JCYA 5I7VA 4RO0A 4MIOA 5DF1A 1T4BA 1FDWA 5G0TA 1Y6JA 4YVFA 1WZEA 3R3JA 5BNIA 4E32A 1YL7A 4D43A 2Q1WA 2DBQA 4D3DA 2OBNA 2Q49A 2PFGA 2CSUA 2EEZA 3LYLA 1GU7A 4MVJP 3NGLA 4XIJA 4BS9A 8ADHA 1SC6A 4PCVA 3OIGA 3KTDA 1H6AA 3PZBA 3RC1A 3DDNA 1WNTA 3OEWA 4QO7A 2VHVA 4AL4A 4ZQGA 3K6JA 5L4SA 3NTRA 4LSWA 3GEDA 2V6GA 3OEYA 4FQ8A 3SJUA 2W2LA 2DU8A 1YQGA 4NJMA 4OIMA 1V3UA 2OUIA 1F14A 1SB9A 1NQTA 4BV8A 4J7UA 1NFQA 2ZYGA 4ESOA 3IOYA 2ZKLA 1N7GA 4XA8A 4FFRA 2I65A 2X5OA 3P5SA 1GV1A 4KOAA 2BFOA 4J2OA 3E8XA 3QE3A 3ZNNA 1EVZA 4J1QA 4FD3A 3QVSA 3G49A 1M75A 4XDYA 4DC0A 4I8XA 5B12A 2OXIA 4IUYA 4RF3A 1ONPA 1J6UA 2AE1A 4OMUA 4B79A 2XOXA 4RZIA 2WYVA 5KVVA 3HN2A 4XYGA 1QYWA 4ZHSA 3QQPA 3T4EA 4TVOA 4L9RA 1YH3A 2G17A 4IXTA 3GK3A 4R1NA 1U1IA 2X22A 3VVCA 4BKQA 1NVMB 1YQDA 5G0VA 4NJMB 4J3FA 4I1IA 4LMRA 4M55A 2DTXA 1O0SA 4JCOA 4ZICA 3GNSA 3LSYA 3OM9A 2NU6A 4LCJA 4XYMA 5DCUA 5JAIA 2AHRA 1QYDA 3OMLA 3KSZO 3DHNA 1IL0A 5JDCC 1M76A 2O3TA 3AI1A 2A94A 2FZWA 1F8GA 5JNLA 2QW8A 1AE1A 4PLPA 5CG1A 3VC7A 1C1XA 4OOFA 1ZO8A 2OGUA 4BNLA 1DAPA 2CVQA 2WYUA 2VZ9A 3OICA 3E82A 1LLUA 3LZ6A 3TZQA 1XQ6A 5A3VA 2VYVA 3OQBA 4RCVA 3D5TA 1MG0A 4R69A 2ZB3A 5F5NA 4DLLA 3L9WA 3H8VA 4J90A 1GCOA 2I3AA 4QQRA 3AUAA 4E6PA 1XEAA 2VHXA 3FNHA 3H3JA 4AJ4A 5IF3A 2P9GA 1O5IA 1NVTA 2BD0A 4TZTA 4NI5A 3E9MA 3QIVA 3GOHA 1P1KA 4N5MA 4NBUA 4PFJA 1GCUA 1FDTA 3HG7A 2EKLA 3NT4A 3R3SA 1U7HA 5CHEA 4OGWA 2J6IA 2A92A 3AM3A 2ZYDA 3DMYA 3D4NA 2W4QA 2PKQP 1ZEMA 2ZCVA 3L0DA 4PN3A 1E3IA 1ZEJA 2DBVO 4UEOA 2GZ2A 4ZD6A 4ZQFA 3Q11A 3ONFA 1HLPA 5JLAA 1UZMA 1C1XB 2PKRA 3F4LA 2GPTA 1E7YA 2R6JA 3VH1A 1QKIA 4JXKA 4WCFB 1WMBA 4BVAA 5A9SA 3QWBA 1J49A 4TSKA 1OFGA 1GEEA 3N58A 4YYZA 2V6BA 1A4IA 4L74A 5GZ1A 3PLNA 1ISFA 6LDHA 1U5CA 3W4JA 4W99A 3DWFA 2NLOA 3F6YA 1R4NA 1O89A 3WYEA 4F6CA 3ENNA 4XGIA 3I9NA 1DFHA 1ISJA 5I9LA 4YQYA 3LC2O 4A2CA 2C20A 2NM0A 5T67A 1ONOA 2NU8A 2P4HX 3U3XA 4EBFA 3I9OA 2GZ3A 2Y68A 2YV2A 3LLSA 4PLHA 4MOWA 4TZKA 4BNVA 1SZJG 3GRKA 3L77A 4AJOA 4PLZA 1HF3A 2DPHA 4D41A 3HQ4O 1XU7A 3UCEA 3KYCA 3WIEA 1W73A 1GPDG 1EFKA 2NU9A 2Q4BA 4MP8A 3WWZA 5A9SB 1EVYA 3BHMA 3U9LA 2FR0A 4E5KA 1E3EA 2IEDA 3TFQA 3IJRA 1A7AA 3KBOA 1EUCA 4MVJI 1H94A 1X0XA 2B69A 2BKAA 3C7CB 4MP6A 4QFCA 3SC6A 4BL5A 5EJ2A 3ZN2A 2HSDA 1R4NB 1ZUD1 1TT5A 4BB6A 5L7YA 2HDHA 3ROMA 3KV3O 4WLEA 2C5EA 2NV6A 3N7UA 1HRDA 3JD0A 4JQCA 2IODA 2V6FA 3EUWA 4UUPA 1EE9A 1K6XA 1P74A 3O8QA 3QRWA 4XB2A 4D7AA 3RUFA 4KP7A 4PVCA 1XDWA 7MDHA 1UAYA 3OFSA 2EP7A 4IJKA 5GZ6A 2GDZA 5KOIA 3KYCB 3F4BA 3F5QA 4Z0HO 1HSOA 4CR8A 1KIFA 5JAZA 3ZNOA 4PLTA 1ZVMA 3JYNA 2GERA 4AJ1A 1Y8QA 4ZA2A 1HZZA 1P77A 4Q3EA 4PLGA 4DBZA 2VUSA 4M86A 3ZWWA 1TT5B 3O26A 3WMXA 3EDMA 1NHGA 4OXNA 4YEDA 4U5QA 4CMBA 2D5AA 3HB5X 1W6UA 2RH8A 1HE3A 3FNGA 3TZHA 2QRLA 3O8QB 1GUYA 1Q1NA 2IZZA 3NGXA 1PGJA 4FPXA 3PP8A 4Y6PA 3L07A 2Y0CA 4E31A 1Z7BA 3MCVA 1GTMA 4W9NC 5GMOA 1ZSVA 4BO8A 1Y8QB 2X0JA 2Q2QA 3V5NA 3TSCA 1P1RA 4KDEA 1E6WA 4QFDA 1I24A 1HDOA 3ZU4A 3TJRA 2OP1A 4XIYA 4FC7A 4B8ZA 4L4XA 2YHIA 2VUTA 4BMVA 3OECA 2I6TA 3QLJA 4ZQBA 4NMHA 4RPGA 4KTVE 4GVLA 1EDOA 3D4PA 1U7TA 3RUDA 2Q99A 4UEKA 1I3MA 3FRJA 2C0CA 5C3MA 1CJCA 2DAPA 1E7MA 1VL6A 4NQZA 1Q0QA 1K3TA 4BMSA 5L40A 2P4QA 4QECA 4ZGWA 1GYQA 2PD6A 4BO2A 5B4VA 1PIWA 3VVBA 2BGKA 4FJ1A 4JBHA 5IJZA 1IB6A 1XLTA 2Y99A 2Z1NA 3C8MA 2ZB7A 2WJPA 1Z6ZA 4ONEA 4ND5A 3GEGA 3C7AA 4CV3A 2NADA 5ILOA 4RLSA 1AXEA 3ADPA 3HN7A 3ZHBA 3I6IA 4CUJA 3QWFA 1PGNA 1B26A 4J7CA 1LDEA 2AEMA 2R00A 2WE7A 3CMMA 4IXWA 3RU7A 2YHIB 3CTMA 3K31A 4XYLA 3H3FA 3HHPA 4N5LA 3UF0A 2VOJA 5CDYA 1ZK0A 1V3VA 1DEHA 3OJ0A 4BKUA 1A9YA 5IXSA 4HX5A 2NVUA 4RVHA 2D5CA 4IDBA 4DIOA 3I3OA 3W6ZA 2GN9A 2JKVA 3ULKA 1PJTA 2ZTVA 3BMOA 4O63O 4R68A 1UP6A 1I2CA 1T2FA 3GGGA 2D1YA 2VHYA 3WS7A 1UDAA 2BF7A 3AWDA 3BXXA 4TQGA 2EXXA 1VL0A 3WWYA 4IIVA 3FTPA 3COSA 1RJWA 2X0RA 4IM7A 3DC2A 4YA6A 4OYRA 1HT0A 4M87A 3RUAA 2ZJ0A 4MIYA 1NHWA 2O3SA 3C1TA 1F0YA 1E1LA 1AHIA 2E4AA 1VI2A 1MX3A 3WLEA 5A1TA 1LC0A 1UXKA 1GR0A 1HSZA 1UUFA 2GUGA 1IZ0A 1HXHA 2BI7A 2GYYA 2NVUB 2X4GA 3GGOA 4L75A 2J3JA 3EK2A 3IL2A 3BMOB 1E1NA 4PG7A 4YT4A 3NDJA 3TWOA 3PYMA 2Y05A 5ER9A 3V2UA 4EUEA 5HM8A 3TQHA 1PS9A 1H2HA 4FOOA 3OQ6A 4C7JA 3C24A 3OBBA 3WICA 4E33A 2BFAA 1SEPA 3KEOA 3Q2KA 5T64A 1PWZA 1R4MA 3AK4A 1SEVA 1SOVA 3W4IA 4E3ZA 2PKQO 3PDJA 3IKVA 1YDEA 4RGBA 3EZLA 1KEUA 1B14A 3P2YA 2JD1A 3ZHXA 2RBEA 1T2AA 1NP3A 3I9LA 5L3ZA 4AJNA 4HY3A 2BELA 4NK4A 3OJLA 1OOEA 3JTMA 3IKTA 4DIBA 2I5PO 1UJMA 4CL3A 1UP4A 4GMFA 1LQUA 4L4RA 1PEDA 3CPSA 1BXZA 2ILTA 3KM0A 4AJIA 2ZJ1A 4RL6A 4CM4A 1SB8A 2PR2A 1CRWG 2P9CA 2YFQA 4RJTA 3DB2A 1AN9A 4WLNA 1R12A 2TMDA 1KVRA 2Z1MA 3BAZA 1U3WA 4AJ2A 4KMSA 3I4CA 2NQTA 2GGSA 9LDTA 1ENZA 2HAEA 3DEYX 2HMWA 1R4MB 2J5QA 4DGSA 3FHLA 2WTBA 3JQ7A 2WMDA 9LDBA 3QSGA 5JS6A 3CH6A 3U09A 4MKRA 2X9VA 3QHAA 1OC4A 4HNGA 2E37A 3KEQA 1DHTA 1GPJA 1GEGA 4RZHA 4BO9A 5BSEA 4A7PA 2RIRA 5B1YA 3PI7A 1PSDA 2Y0EA 3W8FA 1D3AA 4HFJA 5CDUA 1ID1A 3DAPA 5BQFA 1JKIA 3LT4A 5T8KC 4BO5A 4PLVA 4RF5A 2P2SA 3PYLA 1ULSA 1LI4A 5IN5A 1VLLA 1WDMA 3NV9A 1E3SA 1GFSA 2E6UX 2F1KA 1UR5A 4PG6A 4CM4B 3VH4A 3KETA 2AMFA 2IYPA 3C1AA 4B8WA 1P9LA 1R0KA 3NRCA 4BO4A 1KVQA 2ZQZA 5HBRA 2EJVA 2DBRA 1LSOA 1H6BA 3DZJA 3U49A 3L4BA 3BMCA 3JQ7B 4CMEA 2BH9A 3A06A 3DOCA 3DOOA 2HRZA 3GN1A 2NNLD 1GDHA 1PTJA 1MA0A 1PWXA 1DDOA 5KWEA 4IZHA 3INTA 4Z3KA 2HK9A 5ER6A 1QYXA 4J0EA 3IJPA 2BRUA 3PHGA 5JDIC 1VSVA 5B4TA 4Q9NA 3DMTA 1LNQA 4YJFA 3DZIA 4CM9A 3WGTA 4CQLA 1MXHA 1NNUA 2JAHA 1A72A 5G2OA 3QVXA 5I7FA 5L45A 3TF5A 4E2ZA 1UZNA 3LF2A 1OBFO 2C2YA 3H2ZA 4PZDA 4OKIA 3L6OO 1F8FA 1ZK1A 1E7RA 4ALJA 1HYEA 1M6WA 3PK0A 3EHEA 2VRCA 2FPGA 2H63A 2VYND 2X5JO 5IZCA 3BMCB 1YQXA 1H93A 1EK6A 3WGGA 1Q7BA 4NPCA 4MIEA 3WGOA 1YL5A 1QR6A 1E5LA 3PJGA 1NASA 1E77A 1I2ZA 1X14A 1ZZEA 2W98A 2GD1O 1HETA 2QYSA 1LRKA 1RKXA 3H5RA 4KZPA 3PWKA 1YBAA 4D44A 2G82A 1DJNA 4YB8A 1L7DA 5JC1A 5JYDA 1PZHA 1BXGB 3FWZA 3NTQA 1MB4A 1H6CA 3PGXA 4XDZA 4YJFB 3IMFA 3MJCA 4CODB 4CQLB 4L0QA 4YRAA 5I8ZA 1C0KA 3BZUA 4Q3AA 3FNFA 2I66A 1UXJA 2H1SA 3QVWA 1D1TA 5KCZA 3C85A 3AM5A 3V1UA 3AOGA 4MO2A 5F5LA 2DPGA 1S6YA 1YONA 1LQTA 3GZ4A 2CMDA 3FBGA 3IC5A 2VUUA 5FEUA 1UXGA 1MGOA 3PWSA 6ADHA 4RVDA 3TL3A 1H9AA 2B37A 4NU6A 1LDYA 2YV1A 1JAXA 2ZK7A 5CEEA 2DTEA 2EIHA 1A7KA 5ICSA 5JMWA 3GVXA 1J0XO 2PD3A 3BA1A 4BNWA 1E7WA 1ARZA 2PK3A 5BNTA 4RORA 1LDMA 3UN1A 2B0JA 3DTTA 1H0KA 3TZ6A 5CDGA 1U9JA 4BNFA 4QT0A 4GX1A 5T57A 4BNUA 3AY7A 3IP1A 3ZWYA 4RF2A 1QYVA 2XPCA 4CPDA 4CM3A 2PH5A 4KUHA 5A4DA 1JTVA 4TMFA 4XB1A 4BNIA 2CY0A 3VZPA 1KY4A 4FGWA 1ADFA 5EL0A 1E3WA 4CM1A 1G0OA 4YAEA 3GAFA 4RPKA 2ZB4A 2PZKA 3H9JA 3JQFC 2Y1OA 1TEHA 2SCUA 2FR8A 3M2TA 3BTOA 4MVJD 3VHRA 4BNTA 1QYCA 4F45A 5JE8A 4UUMA 1N92A 4UVGA 4LCEA 2WD8A 3NAQA 3CZMA 3RJ9A 2AQKA 4ITUA 3SJ7A 4DYDA 2YHUA 5CG2A 5JY1A 3WGQA 1RYEA 2IEBA 2UUPA 2VRBA 2OZPA 1DIHA 3FPCA 1Q7CA 3WNVA 4UAGA 1DIAA 2X23A 3C3XA 2Q4EA 2P91A 1B3RA 4UUOA 1BWSA 4M54A 4A73A 4RDIA 3ZW8A 4J49A 3K30A 4BHTA 1VJ0A 1B15A 1E3WB 2C29D 2HJSA 2B83A 1NQAO 4XRGA 3L4SO 5G4KA 5I8WA 1IE3A 2PWZA 2G5CA 5TSDA 3JQEA 4G2NA 3EW7A 5I7EA 4D0RA 3HJAA 1DHRA 2JJYA 2NWQA 1Y7TA 2JL1A 1SBYA 3H9UA 4PVDA 3UW3A 3LVFO 3AUSA 3H5AA 1M6HA 3I5MA 2J5RA 5TS3A 5TT0A 4M1QA 4WNCA 2IDZA 3IS3A 1TXGA 2UYYA 4QX6A 4E30A 4CMGA 3KOUA 4CQMA 1I0ZA 4J9UE 3RKRA 3FR8A 4AFNA 1Z7EA 1YS4A 1HDGO 1LDGA 4B4VA 3RBZA 2O7QA 4HFMA 3CMCO 1D7OA 5G0WA 2GN6A 4J1NA 1L7EA 4P4LA 1NWHA 1ZMOA 2G0TA 4RDHA 1PGPA 5F1OA 5G4KB 4KUGA 5EPOA 4IDAA 3EAGA 3GH3A 3GG9A 2QIOA 2J3KA 3DXFA 3LC1O 3DZHA 1HL3A 2IZ0A 1DLJA 2P5YA 4JJFA 4XX0A 2O3UA 4R54A 3PVZA 1PZGA 3GUYA 3QY9A 3IP3A 4MP3A 3GZNA 4AICA 4WOJA 5COQA 3R0IA 2JFHA 1KVTA 1WWKA 2FOIA 2NUAA 1T2DA 4RVUA 1T2EA 4CQMB 3E6AA 5EIOA 4YT2A 2GR9A 4EEXA 2Q3EA 3LQFA 4NBTA 4KDFA 4YDRA 2R2GA 3D64A 3ZV5A 1R37A 1XCBA 3HDYA 1OI7A 1T1RA 5H82A 3Q9UA 5KIAA 3AOEC 3GUCA 1XIVA 3MZ0A 4RPJA 2GASA 3I9JA 2JCXA 1DO8A 4WUVA 1SO8A 3JQDA 1MV8A 2JD0A 3AFMA 1MLDA 4HP8A 3E5MA 4B4UA 5I7SA 1NTOA 4KUEA 1HYGA 1YO6A 5TT1A 2HRBA 1VPDA 4OQYA 4JJIA 4RVFA 4WCFA 2Q50A 3ETGA 4W82A 4ZQHA 4PG5A 1DC3A 4NJOA 4B7CA 1NVGA 3HADA 2Y66A 5JO0A 2NTVA 2XF8A 3GZNB 4BUCA 5BR7A 5CDTA 3DFUA 1O95A 1I10A 1U3VA 5C7IO 3KLPX 2YV3A 4BGUA 2D4AA 4IIUA 3JQAD 3ROPA 4CM5A 3MTJA 2Z5LA 4GMGA 5JO9A 1QXSA 2EV9A 1N2SA 2ZATA 1YBMA 1R16A 4RPLA 3ZU3A 3RWBA 2QZ9A 3H9GA 2VT2A 4BKRA 3KYBA 5LCXA 1CYDA 1WZIA 2CDBA 4NNJA 2EGHA 1LRLA 4H7PA 3MOIA 4E5YA 1IOLA 1RPNA 4IMPA 4DMMA 2EERA 4UVHA 4YWJA 2VWQA 5GY7A 1UH5A 1TB4A 1Q2XA 2JHGA 2LDBA 5AXCA 2RHCA 4DQVA 2DVMA 1IYZA 4RF4A 1E1KA 5ENDA 1B8PA 4GQAA 4DC1A 1ENOA 1GZ4A 3DR3A 4FSHA 1IY8A 3KB6A 3EVTA 3O9ZA 2IXBA 1X7DA 1UP7A 2Y1CA 3VPHA 4A5OA 2ZTLA 1AGNA 3TN7A 3PHHA 4J4HA 4R9RA 4NDNE 4XYBA 1I5RA 1W0CA 1YWGO 3PQDA 2EKQA 4MJLA 1YKFA 3LT2A 2GN4A 1DFIA 4J1TA 3WX0A 5L7WA 4KWHA 3WG9A 3UVEA 5IAAA 1G0NA 2VWGA 4BKOA 2I67A 2Q1SA 3H65A 4TKMA 5C5IA 1QRRA 1O9BA 2X86A 1KVSA 3AY6A 4FJ2A 3INRA 1HE2A 1G1AA 3IUPA 4Z3DA 2D0IA 3ZHZA 2H6EA 3PJDA 1DFGA 4GKVA 4BO3A 1UDBA 2FR1A 5AYVA 4YTEA 1XYGA 5CP8A 3A28A 3A14A 4OXKA 3CSDA 1VM6A 1P3DA 1CQIA 1B16A 1TVEA 3EMKA 5T5QA 4DVJA 2X9NA 4TRMA 3ZGYA 1DRVA 1M2WA 3TPCA 4C7KA 4ALIA 3PIDA 4M89A 1ZIDA 4JP2A 1P0CA 3OJOA 3RC7A 2AQHA 4BO7A 1GUFA 4MVJH 2BLLA 4IBOA 5LC1A 5IDYA 4ZU3A 2Q1TA 1M67A 3A1NA 4JJGA 3GGPA 1XQ1A 2IXAA 1JKJA 4BQPA 1PGOA 1Y1PA 5DN9A 3NYWA 3SEFA 3K2EA 5EQDA 4E5PA 3RFTA 1I33A 4A0SA 2QG4A 5A04A 1EVJA 5IG2A 1LJ8A 1ADBA 2WE8A 5L53A 5AOVA 1TLTA 2JAPA 1PJ2A 4WLOA 1Y9EA 1HKUA 1SMKA 5U1PA 3PZRA 1TA4A 4D3SA 4W9NA 3I52A 4D0SA 2O48X 4WLUA 1Z74A 3RKUA 2AE2A 1HDXA 4LK3A 3WJ7A 3WJAA 3ZCXA 4IDEA 3WQQA 2EW8A 3ZWVA 3OF2A 1T4DA 1XG5A 4HUJA 3VPGA 2E48A 3GRPA 5L95A 4XYEA 4MKZA 4YXFA 1NAHA 1VKNA 4XKJA 3RCBA 4YRDA 4BNNA 4YRBA 1ISGA 4XCVA 3DOJA 5DDIP 2GRAA 4WLFA 3VKVA 2W2KA 1SAYA 4P4GA 2P9EA 3EYWA 3WQRA 4D45A 3JQ8A 2DT5A 4MVJE 3UKOA 2OOSA 1V35A 1DRUA 2PZMA 3D7LA 4EDFA 3K8ZA 3G1UA 1R6DA 5JW6A 2O23A 4XR9A 1VJTA 3GNTA 2P5UA 2PH3A 5L7TA 3RVDA 4UUNA 2I76A 1B7GO 1U3TA 4NBVA 2HCTA 4BMNA 1P1HA 1DXYA 4G65A 1JAYA 3F5SA 1V8BA 3WDSA 4DRYA 3WGIA 4OJNA 4XJTA 3AJRA 7ADHA 2YW9A 4YBZA 3AU9A 3UXYA 1HE4A 4I5DA 1CIVA 3GVHA 5CAEA 4XWYA 3B6ZA 3HUDA 2Q46A 3U62A 3VH2A 1DAOA 1CF2O 2W2KB 4FBGA 4HXYA 1XR3A 5K6AC 4BNKA 1E7SA 4PZEA 3GG2A 3JQ8B 3E03A 1V9LA 3FSRA 5FYDA 3ZZNA 2IRWA 4QXMA 4E0BA 1KS9A 1P0FA 4FIZA 4U6QA 4XQGA 3JCZA 4WASA 4CLXA 3H4VA 1Y5MA 3H5NA 1BDBA 3ANMA 1CDOA 1C0IA 1JN0A 4G5HA 4GSLA 5DCYA 2OFPA 3MJVA 5KTKA 4CLDA 1X0VA 4MVJF 5MDHA 5JFOA 3QW2A 3GLQA 1KETA 1EUDA 4Z0PA 2DKNA 2HQ1A 1PL6A 4OAQA 4WOKA 5HA5A 3VPSA 3NTOA 4K26A 3RIHA 4I08A 2XAAA 4IDDA 3D5QA 3QP9A 4IQ0A 3GA0A 1JQBA 3F46A 2R00C 1A4UA 2WM3A 3E1KA 3M1LA 1PL8A 1YGYA 4MPDA 3AUUA 4FN4A 1NX6A 2NTNA 3GFBA 1HZJA 3K9QO 2OL4A 1XGKA 3MJTA 4IZIA 3P7MA 3ZNQA 2VTEA 3KZVA 4L73A 4JIGA 5CEFA 5KJ6A 1GYRA 3DBRA 3GEMA 4Q3BA 2FMUA 4HFRA 1R15A 3ZDFA 3CKYA 1YB1A 4R1UA 3JYOA 1Z73A 2X0IA 3QVOA 4INAA 4B3IA 3PFFA 4BNHA 4YCAA 1UXHA 1LEHA 1VKOA 1X1EA 3JQ9A 3D3EA 3GC6A 3F47A 5HS4A 4O59O 2UUOA 2O7SA 2C7VA 1N1EA 2O2YA 3JV7A 1C1DA 3DHEA 3HDHA 3TL2A 2CD9A 4B3JA 4CMCA 4I5FA 3TDKA 1ZSYA 3LF1A 4GLLA 4BNYA 3RJ5A 4R5MA 3UHAA 3W4KA 3DBLB 3ANNA 4GGPA 3PHJA 1WAMA 3KXDA 4PLWA 4Z9XA 4O1MA 4LRSB 3QJ5A 3DBRB 3UCXA 1C14A 3JQBC 1PJSA 1YL6A 2FPPA 3Q9NA 5H81A 5C7OO 3DBHB 4FFPA 1YOVA 5EINA 1ENYA 1OC2A 3SLKA 4IJWA 4PG4A 4HFNA 2H5LA 4D3FA 4R1TA 5LDGA 1T1SA 1ZXLA 4EITA 3HSKA 3NEPX 2D3TA 3ANLA 5F1KA 4IGEA 3GAZA 4CM7A 1PJCA 4UVEA 1M66A 4EJ0A 4WCDA 4TROA 1OZAA 2Q2VA 3Q2IA 4YAIA 3GMDA 5A5EA 3ST7A 3INGA 4A26A 4QEDA 5TJHA 1C1DB 2EJWA 5AXBA 4CMKA 1V3TA 1C0PA 1PJLA 1LC3A 2QYTA 4CV0A 5JC8A 1EZ4A 3PJFA 3VPFA 4K1LA 1WMAA 1DJQA 3RUHA 2GNAA 1X7HA 2OBYA 3DZGA 4LMPA 4YJDA 3BMQA 3TZKA 4CMAA 3GVCA 4J6FA 1UZLA 1K89A 4WEOA 1PX0A 3U4CA 2HO5A 1ISHA 3F1KA 1YOVB 4NBRA 3D0OA 4H3VA 2O3QA 1LSJA 1YDWA 2DFDA 2UDPA 4ILKA 5JCJD 1V6AA 3MEQA 4PRLA 2I3GA 2BGMA 4UULA 3SC4A 3RI3A 1F17A 3RUEA 2B35A 4XD2A 2D8AA 3S1LA 4P38A 4WECA 1R66A 3X2EA 4CV1A 3G17A 4E2YA 2WDZA 5TJ9A 5JDIA 1KYQA 2BFPA 3OETA 3PFWO 4PGFA 3ZW9A 5BSGA 4ID9A 4IPTA 4UVIA 3BMQB 4LVUA 5A9RA 4J7XA 3H7AA 2OORA 1EQ2A 3D1LA 3LLVA 2NU7A 3JD3A 3B20A 4F3YA 1K0UA 2W8ZA 1BXGA 5L4NA 3ZV4A 1DRWA 1B3BA 1J4AA 1LDNA 3GDGA 4TVBA 1BMDA 1I30A 1UDCA 3ORFA 4HBGA 4WEQA 3DTYA 4BKPA 4KQWA 4JK3A 3DO5A 1BW9A 2AEJA 3Q6IA 1GQQA 2UAGA 2AXQA 5JSFA 3KSDO 3L4BC 1I3NA 4M49A 1IPFA 5BSFA 1ZFNA 1PGQA 4LGVA 4WK6A 3SBOA 2Y1DA 3WIDA 4YR9A 1UXIA 4AJPA 2CDCA 4GAEA 3K2BA 2Q45A 2W90A 3I9KA 3S55A 3ZWNA 5LDHA 3WR5A 1N5DA 2PTGA 1K5HA 4FC6A 1MXFA 1B2LA 1OAAA 1PZFA 2OP0A 1RM3A 5IDXA 3ZWAA 2RAFA 3BTUA 3JD2A 5C7LO 5THKA 4Q3NA 2IE0A 2NVBA 2O2SA 2VHWA 3EGOA 3BTVA 1I32A 2VZ8A 1VJ1A 1EFLA 3PGJA 4DL9A 5F21A 2BMAA 3JD4A 4DQXA 4NHEA 4LSMA 3ZWBA 1BDMA 4BNZA 3NJ8A 4XZ3A 3GHHA 4B4WA 5DULA 1BW9B 1P45A 4W4TA 4N5NA 3GVPA 5IZCC 4BB5A 1T24A 3UGKA 4YJHA 2IZ1A 1KEVA 3MOGA 1XELA 3WSWA 4PIVA 3G79A 5F1PA 1Y9AA 1O6ZA 1PL7A 3VZRA 1O94A 2CNBA 3M1AA 4IS3A 4PLYA 2RHRA 4FDAA 4E12A 3ETDA 4CUZA 1LBEA 4DTIA 3FD8A 4R16A 2W2LD 5H83A 4DA9A 4GGOA 4MINA 4FS3A 2DBZA 4Y9DA 3FPLA 4L8VA 1HYHA 3OA2A 3WFIA 5EERA 1IHXA 2YQ4A 4D79A 4WKGA 4CMHA 4II3A 3GPDG 2VHZA 3VKUA 1SNYA 3MJ4A 1N8KA 4ZQEA 3STHA 2B4TO 1LTHR 4CJXA 4DPLA 5EMHA 2BFMA 1ZK4A 2AEFA 1B0AA 3UICA 1MFPA 4Q3CA 1A5ZA 3ENKA 4S3MA 2ZTMA 5F3RA 1A9ZA 4YJHB 3JQFA 4LVCA 3RFVA 4TRJA 2X1HA 5KJEA 1NM5A 2XXJA 2C5AA 5TNXA 5DOVA 3ZWCA 1KY5A 3DAFA 3HNPA 1WP4A 5COAA 3PYXA 4WE3A 3GY0A 4J0FA 3PWZA 1NR7A 1PR3A 4TRNA 2VZ0A 3IUSA 3V1TC 2OMEA 4ND2A 1QORA 4Y8VA 1U8XX 1ZK2A 2HK7A 1R0SA 4MKXA 3PPIA 3GPIA 4R5HA 4FCCA 1KC1A 3R6DA 1OMOA 4L76A 4EGFA 3EC7A 4ALLA 1JA9A 4CMIA 3JYLA 3V1YA 4W7HA 1PS8A 3MWEB 1D1SA 2B36A 2VYNA 3K92A 5DP2A 1BVRA 5MGBA 1IUKA 2AQ8A 3S8MA 1ENPA 1U2DA 4I9NA 3C1OA 3CZRA 3RBXA 4B3HA 3CEAA 4OL9A 3VOSA 4IY1A 4RQTA 1BGVA 4N18A 1GV0A 1GZ3A 5L51A 1Q7GA 1N9GA 2H9IA 2FHSA 2PY6A 3Q0EA 4KWIA 2EKPA 4IGFA 5AVOA 3H6KA 1N7HA 3AY3A 3KVOA 1GAEO 4YAKA 4CLHA 4CR7A 3V2HA 2CFCA 2VYVD 5L9AA 4IS2A 1PQWA 1ZXBA 3HDQA 3JSAA 3Q1LA 2Y1GA 5JAQA 1QSGA 3JQGB 3ABIA 1WDKA 4K6FA 3WBFA 3LT1A 1NWCA 4PZCA 4WNIA 5FI3A 1RM4A 1NQOA 2YY7A 1D4FA 4FFOA 1CETA 4U0KA 5L4LA 3ETEA 1PR9A 4HWKA 1P44A 4R3WA 4EJ6A 2O3JA 4CMJA 4CMIB 4R4JA 3RC9A 1DIBA 2GZ1A 1F06A 1VSUA 5G0SA 1ZJYA 3GMSA 3DQPA 3NDIA 4ZJUA 4GBJA 3E5RA 1I2BA 4WLVA 3B70A 5TF4A 1ZW1A 1HDRA 1GUZA 3H9EO 4U0JA 4NH4A 3LDHA 1N9GB 3WBBA 3NKLA 3WB9A 5IFLA 1W4ZA 2YJZA 1PJQA 2G1UA 2ZYAA 3ON5A 2WSBA 1BVUA 4E13A 2F00A 3KUXA 2HMSA 3M2PA 5IN4A 1S7CA 1JVSA 1QLJA 1WW8A 1UAGA 1P1FA 5KJFA 1VC2A 4DBVO 2FPIA 5JPIA 4X54A 4FW8A 1NPDA 3LC7O 3A4VA 1XA0A 1DB3A 1MUUA 3L6DA 4EUHA 3C7DB 4CM6A 4F6LA 4GKBA 4OO3A 3MWDB 1YRLA 4GI2A 5JDCA 1JVBA 3AFNA 2ZQYA 1YB5A 1LLDA 3AOEA 4O5OA 4CM8A 3KO8A 1JWAB 2BI8A 3ZWPA 1DC4A 4RV9A 1JW9B 1CQJA 4NK5A 1GZ6A 4DUPA 1ZBQA 1LLCA 3PJEA 1D8AA 3L9XA 5DBIA 3VZQA 3RFXA 3F9IA 2DQ4A 4FFNA 3TOXA 5BSHA 1B8VA 3RC2A 5JBIA 2ZB8A 1ZKMA 4MVJA 1NFFA 2EHDA 4I5EA 3ZI0A 4FJ0A 2HMUA 3FF4A 3RU9A 3F1LA 4EI2A 1QV7A 4URFA 2X5KO 2HJRA 2WWRA 3O4RA 1E6EA 3ZNPA 1E3JA 4LRTB 5BNFA 3UOGA 3WQSB 3B1FA 5GZ3A 5C37A 2GF2A 2QHXA 2J5KA 5DBGA 2V6MA 3MJSA 5G0UA 2AQIA 4BO0A 4IMRA 1DC6A 4JROA 4U7WA 4CM8B 4K9DA 4OH1A 4DPKA 4GH5A 1LUAA 2VTDA 2C59A 1JLLA 4J43A 1DLIA 1NPTO 1U5AA 2I9PA 4CUKA 1PZEA 4YJGA 3PQFA 1KBZA 2JCVA 5TIIA 3JD1A 2ZCUA 4DLAA 4GPD1 2DC1A 5KVSA 4WCFC 1E1MA 1X1TA 3WSVA 4YPOA 1HLDA 4ZN6A 1XSEA 2G76A 2O4CA 1XKQA 1U3UA 1O8CA 1YVEI 3E9QA 4OQZA 5ES3A 5CEJA 4NBWA 4DPMA 5KVCA 4TKLA 1NPYA 3TNLA 5EN4A 4BNMA 1H2BA 5EQFA 3KSUA 4WPGA 3HFGA 4GX0A 1ZSNA 4E4YA 1NXQA 2PD4A 2HUNA 2PGLA 4MVJG 4RVSA 4DLBA 5IXYA 3L6EA 1P33A 1VRWA 2OO5A 2VT3A 5CDSA 2GO1A 3FBTA 3G0OA 2WD7A 3FTNA 3NJ4A 4HV4A 5A5FA 3TOZA 4S1VA 1ADCA 3E48A 4JN6B 3JYPA 4RQUA 4FB5A 1E0DA 1YE3A 4YJGB 3PHLA 3CE6A 1E7QA 3EVNA 1GADO 4EW6A 3DZBA 3GHYA 3OIDA 3WGHA 3G3EA 5A05A 3T7EA 2C07A 4EUFA 3RUIA 4J1SA 2EW2A 4N54A 3ROQA 5JCXA 5FI5A 1ULUA 3A9WA 4GX2A 4ND1A 5DBFA 3S2FA 1LSSA 1SOWA 3IAHA 4GSKA 2VOEA 2HLPA 3BMNA 2VQ3A 2YDXA 2V65A 4A10A 3MTGA 4JBIA 4XJSA 5TQVA 4R51A 3TRIA 4L4SA 3IIEA 3UAGA 1BG6A 5JMPA 1PQPA 5ADHA 3U4HA 2B4QA 5A06A 3ONEA 3QWHA 2HU2A 1T25A 1MP0A 3QWIA 1YJQA 1NAIA 3ZV6A 4FR5A 2UVDA 2NQ8A 2WD7B 4JX8A 2ET6A 1F12A 1ZJZA 4WJZA 3DAGA 3S2EA 3H9QA 4BGVA 2X8LA 2CVOA 1PJBA 4DXHA 4J16A 4A03A 1K2WA 1WXDA 3NUGA 3K96A 3WTCA 3K73O 1H5QA 3BHIA 1ZK3A 2DUWA 2O4UX 2A9FA 5A03A 2DLDA 4E2WA 3WOHA 2C2XA 3OP4A 3BMNB 4M8SA 4Z0TA 3RSHA 5KJCA 2JHFA 1Q0LA 4XGKA 3HE3A 4IJVA 3QA9A 5TX7A 5DP1A 1IHYA 3JQAA 1FDUA 1NFRA 4IJUA 5KKCA 3WNQA 4EJMA 4DIFA 4Y6RA 3GNQA 2EF1A 3O03A 3DZKA 4O0LA 4DWVA 3WYCA 3AU8A 4C4OA 5IDQA 5G4LA 2QZZA 2UV8A 3GR6A 3I9MA 2OHXA 3VPXA 4F46A 5ICMA 1WPQA 2VWPA 1FMCA 1LRJA 1PJ4A 5THQA 1I8TA 4ND4A 5HWSA 2B4RO 1T26A 4OOEA 1TT7A 3ROKA 1MG5A 2AG5A 1AHHA 2VWHA 2Y0DA 4XEHA 1EVIA 2YDYA 2Y93A 2FWMX 3ICCA 1FXSA 3AI2A 5ENVA 1I3KA 2E49A 1U28A 2WEKA 5ILGA 4OKNA 2B5VA 3TZCA 2GSDA 4AJLA 3JQAB 1EMDA 1HE5A 2Y67A 3OJEA 3RBVA 1MC5A 3O38A 4J4TA
chains in the Genus database with same CATH superfamily
3KPUA 2VIIA 1YCGA 2OPBA 3MFYA 2NO7A 3HKCA 1MQAA 1G8YA 1XX6A 1Y4DE 2ZVQX 1W36C 4ZKEA 3SVTA 2ZIZA 3SSAA 1ST3A 2IEGA 2P78A 3E3AA 4NPAA 4K6CA 5JXWA 3M9XA 1ZHOA 4HAVA 1KSGA 1NMSA 2Z08A 1W88A 2FSIA 2K7ZA 3RRMA 4KAFA 1V41E 1IK4A 3IB6A 4EHDA 3I37X 4Q01A 3SFZA 1U4OA 4XPIA 1FNDA 1XHEA 1ONNA 1YXMA 5DTRA 3H1GA 5EMLA 5E6SA 1KDVA 3MJEA 1EG2A 3C8UA 2YWXA 4MRVA 3Q7QA 3UJHA 1AUXA 5AUPB 3ADOA 3DL2A 4EAAA 4ENUA 3TYXA 6CHYA 1N1MA 1E61A 1XZKA 3PNQA 3ZBQA 4ZOQI 3HRHA 4Q4JA 3OLYA 1XXHE 2GN8A 5D3MA 2CDAA 5JRDS 1H6DA 2J3LA 1U94A 5JARA 4DG5A 4RWZA 1VHQA 1VJDA 4KODA 1BX0A 3D7SA 4XSHA 3HWRA 2CBXA 3REGA 3LU1A 4UASA 3FPFA 4J2HA 5D8DA 4ZVNA 2AG8A 2EJBA 4ALMA 3I76A 3TCNA 2W6IA 4EPYA 1HMYA 5LDDC 4ZRNA 3UB2A 4X64B 1IDN1 1YZNA 4I55A 3ELYA 5JZBA 1TKRA 5JNTA 2OOKA 1ULTA 3IUQA 4PLFA 1MTOA 4FYMA 1GRRA 1QHSA 4YAJA 4HDQB 3QMPA 2CZCA 1RWVA 2OLJA 4RM2A 4RKRA 1U6KA 2V9ZA 3P19A 4G81A 2YYSA 4LWZA 1GKKA 3GB9A 1FMTA 3LV8A 3DYBA 3GDHA 3PC4A 3I01A 3NHZA 4GPTA 4JP3A 5D1NA 4M83A 4KQ9A 1E5QA 4HN9A 8OHMA 3V8QA 1E6UA 2NXWA 2HEIA 3MQ2A 4F93B 5HUJA 2CUKA 2BKLA 2ZJZA 4XQEA 4BFLA 3BL6A 1UM9A 4B7XA 4TQ9A 3N0TA 1XU4A 1OYYA 1YS1X 2WTEA 2ZRMA 4AO8A 1A27A 3DWIA 1Q1BA 2OO3A 5JQGB 5K9ZA 4ZZ1A 3LY5A 4OQLA 13PKA 3N05A 1X6VA 1K27A 3CLVA 4XWAA 3B5JA 1KQFA 1A69A 1U8FO 2FVYA 4MB0A 3AUTA 3WZMA 4AMVA 2XMRA 3F67A 1W49A 4R8SA 3VTAA 1XTQA 2PLAA 3DVSX 4GO1A 4I19A 1LK0A 4KLNA 1YA8A 1I36A 3UUGA 4NR0A 3T6KA 3P2OA 3PLRA 1QG0A 3IDSA 3GF4A 2WM9B 1EEXB 1J06A 3IPLA 5KCMA 3T1TA 4NE7A 1VHWA 5D6NA 5KHLB 2X0NA 4AG3A 1MQ8B 2A84A 5KPJA 4ESEA 1FDVA 1OKKD 2PRZA 3EMVA 4QUEA 5B4UA 5HJ5A 1T5OA 2PGJA 3C3YA 1LV8A 1G2PA 3OQ1A 2KWIA 4MCJA 2PDAA 4ISCA 2YIVX 4KFSA 3NU1A 4ASUD 3RBAA 1J7JA 2HKIA 4DEYA 4H3SA 3OE7A 1UJ6A 1DC5A 4G41A 3VPCA 3U4DA 3MF4A 3ZHQA 1Y6ZA 1USUA 4BO1A 4QUJA 1DADA 4G5FA 1SCUA 3FJOA 1N2ZA 4NU0A 2GFHA 3GJZA 3HRKA 3L7IA 1GO2A 1MAWA 5EFZA 3X1WA 3VKGA 2QI9F 1VYUA 3AHIA 1X1AA 1CZLA 3G23A 4PNHA 4ZU6X 3F8WA 4I5GA 3QH4A 3ZWDA 1ZWKA 4OAOA 4O4IB 3F3KA 3T5DA 1J8QA 3AVQA 3H4TA 4LZNA 4B6JA 1OB2A 3GDOA 4FEGA 4XEUA 3C3EA 3L05A 3CX6A 4DDUA 4A6DA 1NZDA 4XVHA 5AT1A 3ITKA 5ELXA 1Y8CA 4JC0A 4QDTA 3KIPA 3S1AA 4I9UA 4R1SA 1OU0A 2ODNA 4R01A 4AO6A 3SK0A 4D96A 4E11A 4IJ6A 3I6QA 3VAZA 2GCNA 1W2HA 4XQ9A 3AVVA 5TE9A 3JQQA 4WJKB 5KPDA 2CYBA 3QUQA 1JEYA 2SKEA 2AI3A 3EY4A 5K4AA 5T8KA 1M2EA 5BYKA 3LP5A 2WUEA 3FR7A 3CRMA 3OZIA 4MUBA 1FP6A 2R1TA 1W8DA 2FP4B 4KH0A 3VHXB 2HU7A 4RXUA 1ESEA 1E4VA 4DQUA 1HTBA 3AJ9A 4TXJA 2PZLA 3NHBA 3O8LA 1JDVA 1T10A 2AI2A 2GN2A 2IKSA 4Q12A 3ZWMA 4PZ9A 4N0MA 2XB6A 3IH5A 2VN8A 2FFHA 4CLOA 4URHA 4J9VA 3TBKA 1Q2UA 1VE9A 2VDRB 4QG3A 1PUIA 3CLTD 3IEUA 3KZKA 2H1LA 4DJEC 4F06A 2FEWB 3TPFA 3OKFA 1ZJJA 4D74A 2NG1A 3KP1A 1I2MA 1MNAA 1Q91A 4HLCA 3IPCA 8LDHA 2O5CA 1VKJA 1Q15A 1JE1A 3HLKA 1Q7TA 5C52B 2XKJE 3ZEAA 3WKDA 3HB4X 4WCVA 1ISMA 1X7GA 5TLSA 3SXPA 1EA5A 1R00A 1NBOA 2XADA 1WXQA 1XN1A 4XRRA 1WQ1R 4KAJA 2FHPA 3GRCA 3S28A 3THSA 4ZCLA 3T0FA 1HTTA 2PUEA 4P22A 5DWQA 3EVGA 4KX3A 3FKSD 4EKDA 3I23A 4YK7A 2J9ZB 3HA5A 4DVGA 2V5AA 2DFVA 4PE5B 3BF8A 4UBOA 3JVDA 2H48A 2CDRA 3T4UA 5AHRA 5HJEA 2HX1A 3LH5A 1GT6A 3ZXXA 5KVQA 2HF8A 3OP1A 2X6QA 4MSUA 4NFHA 3AW9A 1XZNA 2QTVA 4JA0A 2EIXA 1WMEA 1T6NA 1YRQA 2WYWA 3SVZA 5AK0A 2ZREA 3BHJA 3OT4A 1G8MA 4YI5A 3UH1A 3KYDB 1ODTC 4DT1A 1M54A 4F84A 3GGSA 1Q11A 1MB3A 1GLNA 2Q1UA 2V7TA 3K35A 4LY9A 4TS1A 4OFBA 5G53C 2AX4A 2JD2A 4BNJA 4DREA 5KTNA 2CXTA 5ALXA 2JGEA 3DDCA 4Y1RA 5H70A 1QTRA 4XOIA 3CU5A 1FJHA 3LWNA 4H7JA 4PO1A 3C3KA 4TTQA 2PVCA 1C0LA 3HGTA 3LSTA 3RTAA 3T4XA 3WFJA 4E15A 4BEWA 2AOUB 2RAVA 4KPYA 2JGJA 3AEKB 4J2TA 1SIBE 2PX5A 3EWIA 4BO6A 5B3LA 1GQRA 3IMGA 1NT4A 3P26A 4QBGB 4EYKA 3VJMA 5JANA 4IVPA 4OXYA 3PUWA 5C7YA 3LA8A 3OIFA 4X20A 1GG2A 2MMGA 3UMVA 3QK7A 2G1PA 4L27A 1IZ9A 1ZMTA 4ICIA 1R0YA 4IQGA 4WH0A 5FTNA 4GKKB 5B55A 4UU0A 1FRNA 3SG0A 4WOCA 1GFWA 1V95A 4EPVA 3VMFA 1ZLYA 3CUKA 5BYAA 7YASA 2XCIA 2OXRA 3NCTA 3Q3JB 1JLKA 1NXXA 2R8OA 4Z4EA 1MTZA 3VKHA 4W6ZA 2PMWB 1FTQA 1IPEA 4YV1A 1F4PA 4ZVRA 1Z16A 1UZUA 4WBSA 4F5ZA 2B34A 4OJQA 1UT6A 1AU9A 2B1JA 4FOSA 4R9SA 2GEVA 3BQ9A 3IV7A 5AKZA 4KWEA 5CVCA 1M0EA 2FRDA 2PV7A 3LZDA 4C5BA 4DCOA 3S8YA 3PQ6A 5BN1A 2C0QA 2H4FA 1YBVA 3WV4A 3UUWA 3W6UA 3HKBB 2DFNA 4ZT6A 2R6R1 2YN4A 2PBLA 3MPOA 2I99A 2PGDA 4OI1A 2PMFA 2PWYA 2J0VA 5BQ3A 1HDZA 1U8ZA 2O50A 1VJ5A 2RH9B 4M9QA 4WZZA 1CZRA 2C54A 2EX0A 5EKTA 4AJHA 5DNUA 1AH2A 3N2GA 3UXEA 3H9CA 3ZOKA 2XE7A 3EIOA 4CIDA 1JQJC 1UBTS 1Y8AA 1NIPA 2XUZA 4J91A 1UDXA 5ERGB 5TGDA 4Q7LA 1RWQA 3LPMA 1SXJC 3IE2A 4JA2A 5L3QB 4MQFB 1DMRA 1WMFA 3ETJA 1YIDA 1H9BA 3TW6A 3WLFA 2CYAA 4PRKA 4EYQA 3PEFA 4FZJA 2GHTA 1QX3A 4OATA 4EJSC 4F5EA 4DXHA 4Z1MA 5JTUA 2GAOA 3OCJA 4LYGA 1A2QA 1QGYA 3Q3GE 1Z06A 3V4FA 4ZTUB 3G0GA 4PQFA 2FZKA 5CPBA 1IHDA 1MB9A 2OCKA 3KQKA 1DC7A 2DKOA 1L1EA 5DE3A 2QX7A 3PQ5A 1V11B 4HRYA 2V4UA 1EDZA 4NFYA 3GJ7A 3FOAA 4PO9A 4X6XA 2QBYA 2H0AA 4FR2A 4AKHA 2NACA 2ZJ5A 2Q6KA 3PQEA 1EAMA 4PSUA 3EGDA 4UNPA 3FNEA 3PUHA 4PU0A 1LX6A 3VTZA 1H3EA 2EYUA 4NOMA 4A8HA 3QEBZ 2YQ5A 1X7WB 2GZHA 2Q2NA 4GBED 3BKXA 5JAMA 3I53A 5KNLA 5DLPA 2ZIXA 4LDQA 5ALHA 3RUPA 1X70A 2AMVA 2EG9A 2LGJA 2VDKB 1L1QA 3LECA 2QQGA 3ITEA 4XWTA 1G8AA 1RAAA 1JHZA 3AH8A 3SKVA 4BFUA 4KTTE 4V0QA 1N32B 4R41A 2P6MA 3D4OA 3DLIA 1JJVA 4DA8A 1MHTA 1CG6A 3A3KA 4FFBA 3FI9A 2ZRGA 2DB3A 1TADA 3WLRA 1V4VA 5DW3A 2VDJA 1DIRA 1ZUHA 1I51A 3A9RA 4YH1A 5ALSA 3OFVA 5HUHA 3JQCA 2VNSA 1P0QA 2J8ZA 5KAMA 4YDHB 5EUMA 5AI9A 1V7ZA 1EQUA 1SXIA 2ZTSA 2OFWA 3V8BA 1M73E 2JBAB 1RWKA 4WZAA 4IDOA 2HSZA 2XECA 2UVPB 1JSLA 2J7KA 3DHWC 3GVIA 2ZCJA 1QVAA 4OHZA 4CLEA 2E4WA 1XJCA 1Y1SA 2H1OA 1L5YA 1ZNWA 2XDQA 2YMQA 3BJRA 4PXAA 3KOYA 5K0CA 5G0TA 1Y6JA 4YVFA 2WA2A 3I5XA 3QVMA 5DGHA 1L9XA 2ZBQA 3R3JA 1ZAKA 2FX5A 1FFGA 2PQ6A 2W8BA 1G18A 2ZI9A 3L93A 3OZUA 5K8TA 3HY6A 4ZC1A 1UMDA 3F5FA 4J76A 4D3DA 5HW0A 2QMQA 4ZCPA 1TCAA 1IN5A 1XTZA 2ISQA 4O3MA 3SQXA 2VAMA 2EEZA 2IY7A 3AP2A 1VMIA 2PLFA 4G0NA 4GZLA 4C3VA 5BXQC 2I8LA 3NGLA 4BS9A 1YS6A 1SC6A 1HURA 3EVDA 1E2UA 4AS1A 1H6AA 2ZJ6A 3O90A 3RC1A 1RSZA 1FUYB 4OLBA 1XA3A 2DLCX 2VUHB 3QJGA 4JT4A 4QO7A 3YASA 4OQNA 3LUJA 5CCXA 2F4NA 2Q6LA 1ZM3A 3DE7X 4HBZA 1EX1A 1LY1A 3TW4A 2GTIA 3U6BA 4LSWA 4U4AA 2V6GA 3N8HA 3DYIA 3PXGA 2RGWA 4C7OB 4RQAA 4NJMA 2FEAA 3CNOA 3KZOA 1UPCA 3MK31 4RTJA 4J7UA 1JKMA 1KI7A 1PJZA 4TV9F 3ACBA 1MRZA 2ZKLA 4ESOA 2WSIA 2J85A 2ZIUB 2P9TA 1GV1A 1XNJA 4KOAA 4AUKA 4D26A 3ESXA 1V47A 1QDLB 2W48A 4QDXA 2R97A 3UMCA 1DUSA 3ZNNA 4F5WA 2NXJA 1C9JA 3LFUA 4BZQA 4CKBB 4NOKA 1P75A 3GAMA 2F1RA 5H9VA 4EB3A 4LF7B 2VJYA 3MOSA 1PEAA 3G49A 3K5WA 2CV0A 1PG2A 2ETXA 2ODEA 2PSDA 3FPSA 3P97A 3IVRA 1N6HA 1Y4AE 3CLHA 3UMJA 2Q6IA 4FFVA 2CXOA 4OMUA 2UZ0A 2NUTA 2ZWPA 2XOXA 1XVLA 2EZ4A 4RZIA 4WXMA 1YR9A 4XTRA 2ZBDA 3I9V1 1YR2A 2WOJA 1ORWA 2XODA 3QQPA 4GBMA 1IN6A 2IY9A 4MWGA 4TVOA 2W2NA 4OGKA 4WN3A 3C48A 1HG1A 1L5HA 1SHJA 1SUCA 1EFUA 3BREA 4ZK6A 3W1EA 3T3IA 1UMBA 3GK3A 3LT5A 1F4VA 4R1NA 2OYRA 3VVCA 4R71A 1KA9H 1NVMB 5G0VA 3LP8A 5FULA 1I9CA 4B34A 1M2HA 3A3NA 3B51X 5A4KA 1G8KA 1O0SA 2A5DA 1G7SA 2WJZB 3S2ZA 4DDHA 5HKKD 4QDZA 2VHEA 2O8FA 1GGKA 1COWD 2VQ6A 4MS1B 4YRCA 1CY1A 3FE2A 3LSYA 1ZM7A 3WDMA 3CSUA 1AS0A 3O47A 4CFYA 3LHFA 5M34A 3N76A 4MS4B 3H6HA 2WAMA 5DCUA 3OMLA 2KBEA 1YMUA 2BAGA 3DXXA 4ARIA 2O3TA 5I4KA 3GI1A 2FZWA 5LM3A 2PYDA 1QGOA 1W85B 2BFWA 3M7IA 1F60A 5J4HA 5JNLA 2PIDA 2PZGA 4JP8A 4PLPA 1CF4A 5DM1A 2A1TS 3N0WA 1Y37A 1X7XB 3ND7A 3V00A 2B9EA 2OGUA 1HEIA 3LUBA 2CVQA 2P9HA 4TVKA 1JJAA 1LLUA 2XMZA 1YFLA 3MMPA 5CH8A 4JELA 3TZQA 3PBKA 3WP1B 1XQ6A 3LOPA 1Y3HA 1Z3IX 5A3VA 1PDOA 1MG0A 1LPSA 4R69A 1V5FA 3VGJA 3L5OA 4F96A 4UTPA 4RUKA 2AG0A 2VHXA 1W2GA 2BFEA 4G5RA 2BD0A 3TTWA 1IMOA 1T2UA 1LBHA 1MVLA 4DCJA 1WSBA 1E4OA 1TK3A 3O93A 4PFJA 3TR6A 3V48A 1WETA 3FCXA 1Z83A 3NT4A 3PGMA 1U7HA 2OCBA 1VP3A 4IRMA 4MR9A 3DMYA 4HWPA 4OGWA 3E7PA 2B7BA 4EFMA 3K0HA 1IVSA 2A86A 4ZOCA 2QVLA 2OB2A 4TS4A 4PN3A 3F90A 2O54A 4UEOA 4MTCA 1M1YE 3W77A 1QRAA 5JSZB 1N33B 1F6BA 3Q11A 3IDFA 4DY4A 1X9IA 1IVNA 3BCSA 2BMEA 2C5HA 5JLAA 1XXHB 1UZMA 2PKRA 4O4JF 3ENQA 3L0ZA 4D97A 3F4LA 5JJBA 3CUTA 1KS2A 2R6JA 4IUCS 1GTRA 1QKIA 2UXCB 2ZXUA 4ZDKA 2ID4A 4M1TA 1KYXA 4LTDA 3U40A 5A9SA 3QWBA 1J49A 4JDPA 4MYDA 1SUBA 2QNIA 3QPWA 1GEEA 1ZIPA 1R0RE 3K9FC 3M6AA 2IS6A 5DK6A 5FFNA 1E63A 4A0GA 1AXRA 3G0BA 1EFPA 2OSVA 3HEAA 3AF2A 4P80A 1W35A 2RHGB 4YHBA 3RSSA 1Q0PA 1X39A 1HL7A 1QFZA 5LOVB 3D3NA 3B7WA 3HB1A 2VHJA 1O8BA 5KQPA 1AZLA 1JV2B 1USKA 1RJDA 4PZUA 5K03A 4XGIA 3I9NA 1DFHA 1ISJA 1YJBA 2YMMA 3KT8A 4GE3A 2C20A 3ZLVA 4B6EA 3W8NA 3P9QA 4KNWA 5B58C 3FOFC 1QFJA 3FNBA 3I01M 2HWXA 3U3XA 4AF8A 4EBFA 5DW0A 5HR5A 4C1NA 2Y68A 4BLRA 4TUYF 1ZISA 3KU4A 2IBTA 2PXAA 3G59A 4G9BA 5JCOA 3FIUA 3IQXA 3P9RA 2DQSA 3L77A 4AJOA 3ICQB 3QUSA 1TEXA 1XVIA 3HQ4O 1QUFA 1XU7A 2PUWA 3BB1A 4RULA 3ILYA 5LZ8A 4R2WA 3T99A 3VR0A 5B7GA 1GPDG 2NU9A 4ZAFA 4CG0A 1HQKA 2WFLB 2C3MA 2FR0A 3IOBA 3O8DA 1TM1E 1LX7A 5CHEA 3SCZA 4U2BA 4FUTA 1D2CA 2IEDA 1OQAA 1HH4A 3FGPA 3K6RA 4POAA 3PXEA 1JJIA 1MV5A 3VC1A 4MVJI 3X1XA 3PQ3A 4MP6A 2V0NA 2C83A 1CEEA 5B5SA 3W1WA 1TT5A 2C1ZA 3I34X 1EDBA 4IJ5A 4YASA 4D8VA 4KN6A 3ROMA 2HDHA 3EFBA 3SQDA 4TL9A 1MCZA 4BYMA 4ZTBA 1XPUA 3A58B 3N7UA 3UTDA 1H9CA 5EP4A 1BFKA 2JHAA 2YXPX 4JQCA 2IODA 3R9WA 2JATA 1EG7A 2V3VA 3OZRA 3MM4A 3BZWA 1BQ4A 1RHKA 2N75A 2WF7A 5BV2P 4PVCA 7MDHA 4C9BA 1UAYA 4LOLA 3NASA 3IEXA 3LHDA 4HOYA 1CZKA 1GDTA 1A9SA 4JYBA 4KLCA 1PYOA 2F8MA 2RHMA 3WMEA 3AVPA 3KOZA 3GEHA 2FE1A 3AJEA 4FLMA 5DO9A 3DOIA 3OURA 4JKOA 3TLXA 3UK1A 2YICA 4FWTA 4AMBA 3M81A 1Z6GA 5B1SA 3BF7A 2ZUSA 3EVFA 1P77A 1U5BB 2CKMA 2J5XA 5DB4A 4EO9A 4PLGA 4XDHA 3UIEA 1EUCB 3BL5A 3E7XA 3QXXA 2IU0A 5LB4A 5K6RA 3UFBA 4BAZA 3EEOA 2M6KA 2VJPA 3G82C 3ZWWA 2JLXA 4YRJA 4L4YA 2Q1YA 1YU9A 3EEYA 3M6UA 4M76B 4YEDA 2LIVA 3R6TA 3WXMA 2O8DB 3MT7A 2ONCA 4C20A 2GA9A 1EVLA 4K0RA 3D6MA 2J46A 5K4HA 1QO9A 3S1SA 2JANA 3KHTA 1T4GA 3BFPA 1U7DA 5BR4A 2Z5VA 3P9ZA 4AP5A 3ZXUB 2UZ4A 3I09A 1GAXA 1SIWA 3CH7A 1GCAA 2ZYHA 4B6OA 2IZZA 5F98A 1VPVA 4IGKA 3PP8A 4TM7A 5JSHA 3MWFA 3D6UA 5I9IA 2H59A 4A1FA 4D56A 3DQZA 4EHJA 2XYPA 4KMRA 3PEYA 1H85A 1KZYC 2AFIE 3OF5A 1TTQB 2FEPA 1ZSVA 2FRXA 3G5TA 3HS3A 3I2KA 1Y8QB 1UZAA 2Q2QA 2FRVA 4WW0A 3GEEA 2K4MA 2O2DA 3TEFA 3EA0A 1AHNA 3PUZA 3VI3B 5H80A 1E6WA 1T8RA 4FDLA 3BEOA 1I24A 2HZ7A 3C6QA 4ZI7F 2RGBA 3ZU4A 5J23A 2R4TA 2IP2A 2A67A 4H6VA 2B4KA 2IE8A 3D6FA 3DPUA 4LZLA 3X1KA 3ZHOA 5CBKA 3FMOB 2AXNA 3LIPA 3IEVA 1EWRA 1J42A 4ZQBA 5AOAA 2X42A 2GPJA 3KJZA 4G5YA 1WF6A 4ZP1A 4CU2A 4H35A 4TMWA 1UJNA 4UBNA 3LKBA 3A0RB 2YZGA 4PV7A 3LQKA 1JAZA 1XEWY 1QHXA 1I3MA 3L7KA 4GC5A 2IKQA 3G6WA 2C0CA 2R7LA 3B9PA 1BKDR 5HYVA 3NVMB 3CW2A 1T6XA 1TO1E 2OHOA 4I4LA 1DAIA 4URUR 5D3KA 4LZOA 4H60A 1Q0QA 2V97A 4KJZA 3OQIA 4BQQA 3RIYA 3V33A 4ZGWA 4BO2A 5B4VA 3FIJA 2QN7A 3C5HA 1K97A 3VVBA 2BGKA 4JBHA 1XLTA 3DAYA 3N86A 1SU4A 3GAAA 2REQA 2Z1NA 2AKAB 1W46A 3N0RA 4JGIA 4B3BA 4ZCIA 2WF5A 2WB4A 1RLJA 4XDGA 4CV3A 3C7AA 2WVJA 2NADA 2HSJA 1NXPA 1AXEA 3ADPA 5ABPA 3ZDBA 1BYIA 2CMFA 2XCTB 3O4GA 5EWLA 4LTMA 1PGNA 1B26A 4J7CA 4HNQA 2J0UA 1LDEA 2AEMA 3PNYA 4JJ8A 4LJKA 4PICA 4MHTA 2YHIB 3OC6A 3VBEA 2IUYA 3AP3A 3OESA 2B82A 2FB9A 2FWRA 1Y3IA 2VOJA 1ZK0A 1L5FA 2ZRPA 2RK3A 5IXSA 2NVUA 2HLDA 2VBIA 3GFVA 4W1SA 5BW4A 2AKEA 1WB9A 3W6ZA 4DA4A 2IIQA 1Q19A 5FV4A 1XC7A 3QKRB 2GN9A 3CG4A 3CVYA 4LZWA 3VZBA 3R4VA 3WRYA 4C06A 4DJJA 2D1YA 1KIAA 4MYTA 1UDAA 2BF7A 2AWOA 1Q3TA 2MSNA 3LBFA 4UTNA 5JWRA 3N28A 3ZDAA 1Z4NA 4V0RA 2HREA 1RJ9A 2O2ZA 3L8DA 2X0RA 4NV3A 3DC2A 4YA6A 1YTUA 4MQEB 1G7RA 1HT0A 1M1UA 2VYCA 1E1YA 1XNHA 4OVKA 5IKEA 2JGKA 4S35A 3A6HA 5KMGB 1T1GA 2JEYA 5LZ4A 3HH8A 3C1TA 2WNSA 1TO6A 3F8SA 5CMLA 1E1LA 2ICAA 3B9RA 5CAEB 4PC3A 4RHEA 1THZA 5BVHA 1JG7A 4JCCA 1MX3A 3ZCQA 4ERNA 3G8DA 3MIIA 3OPMA 4FSXA 1QU3A 2Y1XA 1B6TA 2GXUA 4BRWA 1GR0A 1HSZA 1RWNA 4UXIA 1DQNA 4FHCA 4GKJB 3QV2A 4XLZA 4DSOA 1WOMA 4WY5A 4YCLA 2JC3A 3K16A 5JEDA 5C53B 2OV4A 3BMOB 2E3JA 3FDZB 4P7JA 5HHTA 1C2TA 2G6TA 5HM8A 1FSGA 2RGCA 4TWIA 1YVRA 1IY0A 2ODQA 1GTVA 1CP2A 4RAQA 4C7JA 3C24A 3RYCB 3W06A 4ZVUA 1GPBA 1GPH1 2VF8A 3G13A 1PWZA 4LIPD 4TTVA 1SEVA 1VL2A 1N2BA 1BS1A 1L5QA 1BMQA 4QJBA 4D6PA 4E3ZA 2PKQO 1W7AA 1Z5WA 1E1QA 3STUA 1SA0B 3ZY2A 3KSAC 3ROZA 1DTWB 2XAUA 3FKQA 2PRJA 4JL8A 3SSOA 3ZHXA 2RHWA 5L3ZA 2PAFA 1PNRA 1G16A 4QAJA 3FXAA 1OOEA 4MDYA 4PY2A 4DIMA 2F9MA 4LKOA 2H08A 3IKTA 4DIBA 4F8JA 2NO5A 5AKJA 1HFJA 1QCYA 5AUOB 2ILTA 4Y3UA 4AJIA 2QAGC 3PWTA 4CM4A 3HO6A 1A4RA 3VR5A 1T5BA 1CRWG 2P9YA 2P9CA 3LVQE 1F0NA 1Z8FA 1AN9A 4XD7D 1ZICA 2QZJA 1RLTA 3V4OA 2WP8J 4L5AA 4R31A 3TQSA 3L7AA 4COOA 3BN3A 3DLPX 2Z1MA 1U3WA 1JQLB 4GW3A 1G8GA 3RVPA 2NQTA 3HJHA 3UWMA 3WY9A 4E1AA 2GGSA 9LDTA 1ENZA 4HRXA 4NPHA 2R44A 3Q9SA 3ANTA 5E7QA 3LXXA 1YA6A 4YY3B 2EQAA 2GYWA 1RHJA 1XEXB 1PKEA 4LV6A 4YGYA 3CH6A 2OB1A 3D54D 2ZAIA 4IX1A 3QHAA 4L8YA 1JXMA 1PNTA 3G2HA 2XD4A 4N3AA 2FUEA 1GEGA 4RZHA 5GWXA 1C7JA 4BO9A 2RIRA 1MNQA 3FSGA 2H7YA 4AUEA 3KC2A 3M4XA 1ID1A 4ETMA 3LT4A 4E22A 2P2YA 3MJDA 4PLVA 1O0CA 4TV9B 3PYLA 1VLLA 1VMDA 3LKZA 7MHTA 3I0MA 3NV9A 121PA 2I4IA 5LD2C 2F1KA 3CTPA 5JSQA 3DV0B 4YMSA 4HNAA 4LXXA 5IMSA 4F6RB 1UDWA 3AFIA 1CR6A 4BO4A 2WWXA 1A8QA 3A6KA 2XWBF 1ISSA 4JBYA 4JI3B 1DJMA 1G8FA 1U8UA 3OLWA 1DT5A 3EIUA 1EHYA 4G0OA 3ZWKA 3THXA 2WKPA 5CYPA 1XAJA 1U3GA 1NUPA 1RXIA 3G8AA 5DGTA 3G8YA 2FZ5A 2IXEA 4AXBA 3THYA 1ZUNA 2GVNA 5GV7A 5I7HA 4MYHA 2WWFA 2OGSA 3A06A 5FUYA 1UAAA 3R44A 2HRZA 3QXCA 4JL5A 5BOSA 3H11A 1IY2A 1GDHA 2P7IA 1PTJA 1XRRA 4EF4A 1MA0A 1RBZA 1BJTA 1DDOA 1RCUA 4IIJA 1RHRA 2GTHA 3INTA 3KD3A 1WD5A 2HK9A 3DVAB 3WMFA 3IJPA 4HYEA 3SHFA 1QQAA 3E35A 1JPUA 3VOTA 2XRZA 1VLZA 3EG9B 3CLUC 4G0VA 1LNQA 4I4CA 1P9OA 5AVYA 1VOTA 1JMYA 1U8TA 3GD5A 4YJFA 5AO9A 5CBPA 1P19A 4RFSB 1TYCA 4U7JA 3LS2A 4RJ2A 2ZE7A 2C84A 1A72A 1T2NA 4M0CA 1NNI1 1Z0JA 5E6UB 2AZDA 1UZNA 2BTOA 2EBHX 1OBFO 1T13A 2C2YA 3H2ZA 3LF2A 4OKIA 1F8FA 1OX4B 1W4LA 2QL6A 1V1MB 4LDRA 3EHEA 1EP9A 1NXTA 2IPOA 3T3EA 2VRCA 2FPGA 4M2LA 3UENA 2VYND 5BURA 3K7EA 4RIGA 3FYUB 1T0PA 5CT9A 5EFOA 3WA7A 3CZ5A 1H93A 1EK6A 3ADBA 4E5SA 4NPCA 1ULHA 1YL5A 1L7QA 4LRUA 2AN4A 2F62A 1NASA 1E77A 3A1UA 3HDGA 1LB1B 4MV4A 1KXZA 4PONA 2NZYA 4UTOA 1DE0A 2HPVA 2QYSA 3I9FA 4WAUA 4QLAA 2IX3A 1QCZA 5KDOA 4KZPA 3VTKA 4I8IA 3UW1A 1YBAA 1GWNA 2G82A 4ZWNA 2HOQA 4OHPA 5K7SA 3QE9Y 4MW0A 3C8DA 4YB8A 4ES6A 2WNHA 2OKGA 1I14A 1U8EA 3QKUA 4QULA 4ESVA 1LWOA 3EXIA 5CVTA 2JIPA 3IMFA 4S12A 4ZZ3A 3NRJA 3MJCA 4TV8B 3A6DA 2J9RA 3ABZA 2PT9A 2QUBA 1XJ5A 1Z3CA 5DI9A 4Q3AA 2MYTA 4JLOA 1KRHA 3FNFA 4H6WA 3IP8A 1K88A 1UXJA 3LX5A 5IKMA 4EX6A 3M70A 3L06A 1G4HA 3SHTA 4D4GA 4G3XA 4MO2A 3EF0A 3LGSA 4BYGA 5LWHA 4BN5A 4KX5A 4O4JB 1FFCA 2CMDA 1KI6B 4HSEA 2Z4SA 1TIKA 2HRQA 1BH2A 1UXGA 2QRHA 3PWSA 2ZSAA 3R5SA 3MSXA 4GOMD 3R7NA 1Y80A 1OLUA 1GU0A 1PVOA 1U7PA 1XKXA 4TLCA 4NU6A 1MEOA 3HL4A 5ITVA 2YV1A 4WERA 2F3TA 2ZK7A 4K86A 2XT6A 2I2XB 1B93A 2BGGA 3DYVA 2DTEA 4IV8A 4R8KA 4RZQA 2C2KA 2F2TA 1M5RA 1BVHA 3X1JA 4BNWA 1A7JA 4MULA 4UMEA 2XVMA 2YVLA 1LDMA 2VXYA 3UN1A 2B0JA 1M1ZA 1ZY2A 3GA7A 5AW8A 4LXTA 3DTTA 3A4MA 3HEMA 1FP7A 1H0KA 3OHPA 4MI6A 3AL2A 4UCQA 5DSTA 1L5ZA 5G40A 4RSGA 3COYA 4R0VA 5DMXA 1AK1A 3QUCA 5FR1A 3TZ6A 3E1GA 3DQQA 4PGAA 3U26A 4GX1A 1K4YA 1TA0A 4BNUA 3IP1A 3L7OA 3MS2A 1A9OA 3RNLA 4CM3A 2BFDA 5BPFA 2C96A 1JTVA 4TUYB 1Y6RA 2CY0A 2H1RA 2NZ2A 4FGWA 1XFDA 4R2LA 1IN7A 1WRBA 2C03A 4UM8B 1YZGA 4C6TB 4EKNB 1G0OA 4MYSA 1ESMA 4YAEA 5EVCA 5EIWA 3VU9B 4BWVA 1M1YB 2ZB4A 1Q7EA 1IDOA 5LYJF 3ZVKA 1D1QA 1WUHS 1O03A 3WYFA 1IATA 1FNNA 3HN6A 3R8FA 4HVTA 3AVYA 1TEHA 2B78A 2FR8A 1G5IA 1S02A 3B1YA 3HM2A 3M2TA 4NY1A 3VHRA 3RS4A 1MOPA 4F45A 5JE8A 1IWBB 3C4QA 2CNNA 2P9ZA 4YCBA 1H0HA 4LCEA 2WD8A 3RJ9A 4DG9A 1R6VA 2AQKA 5LZ2A 5F7ZA 4X41A 1QWSA 1N6PA 3SJAA 1YB2A 5LQDA 1RYEA 3CWZA 3NANA 4LJYA 3UPUA 5IJ0A 3PV0A 4QGSA 3GGDA 2Q2OA 2AX3A 2BMDA 1VB5A 2P6PA 3NEJA 4KXNA 3VJLA 4ZYXA 1K8RA 1Q7CA 4UAGA 3IHLA 1Y3DE 2Q4EA 1JUDA 1UXOA 2PLRA 3IT2A 3Q4GA 1RDFA 4RDIA 3P9XA 1DT3A 3OFJA 4AT1A 3U44B 1NVVQ 3EZ7A 2H4HA 3VNAA 2H1CA 1SVOA 3OZAA 4BWYA 3VSBA 1NJGA 1NQAO 3ISVA 3K20A 3L4SO 2QGNA 3H4IA 2PWZA 4XRGA 2X15A 4ZV7A 1ZJ5A 1IAQA 1J99A 1ZOIA 4J6EA 2SCUB 4NZNA 5HDBB 4ARZB 1Y7TA 2A7XA 4QUHA 1Y3FE 4KMSA 1Z6YA 3AHEA 3AUSA 5AKXA 1PLKA 3LD9A 2J5RA 4RVCA 5TT0A 4DSTA 1RLIA 5K51A 3FZQA 2WYHA 4IXNA 2OEPA 4M1QA 2QM7A 4JU8A 2IDZA 2NO0A 2YRXA 1X80B 3GO4A 1Z4QA 5CM8B 2UYYA 3BSFA 4JJ6A 5HM6A 4LXQA 4PR0A 4CMGA 5C5CA 3QX8A 4Q3LA 2G1AA 3AUYA 1I0ZA 4J9UE 2YY6A 3FR8A 5AJHA 1SHKA 2GCIA 4LX8A 4AMUA 5BN3B 1NSYA 3WGLA 2YS6A 2ZBFA 5DHPA 4GD3Q 1HDGO 1LDGA 5EI5A 2AR0A 3WIOA 4B4VA 2O7QA 2Q27A 5AKYA 4AG5A 1XVVA 2ZULA 5IK2A 4FE7A 1SU6A 2PNJA 2W2XA 3CMCO 1D7OA 5HIKA 1PUXA 1MU0A 2RGEA 2GN6A 3BXZA 3LPAA 4J1NA 4RIIA 5SV2A 3S6JA 4BKMA 3CWQA 5LNK1 4BRSA 4HAUA 2YQZA 3C5WP 4RDHA 1ZMOA 2G0TA 2GBLC 4KYUA 4F4IA 1BO6A 2QP9X 5K2OA 4UPEA 2WD9A 5EPOA 4NAVA 3EAGA 3HBNA 1JYSA 3H8WA 2VHUA 1E3QA 2OO7A 3F5DA 3LC1O 1DLJA 5DM60 4BC0A 4U3JB 3D81A 3FMGA 4NRDA 2EKZA 2XVXA 4JT2A 3TTUA 1SFRA 3PVZA 4MEJA 2AN5A 4EL5A 3KSBC 2XMDA 5AJUA 3WLLA 4UNRA 3GUYA 4ZI7B 4EYOA 2I55A 2WUFA 4AICA 1ID8A 1FYDA 5A62A 3R0IA 1TJ4A 3HA3A 4WESA 3F6SA 4CQMB 5E1MA 3CYFA 4PIMA 3C6XA 4YP7A 1PDWA 2ZFUA 1UBMS 3M49A 1QZ3A 1UK6A 3HDYA 1KK0A 2X40A 4GZMA 4YRLA 3RFCA 2BBTA 5H82A 4HVAA 4F72A 4GR5A 3AOEC 5KIAA 3GUCA 5HCNA 2R8BA 4JNCA 3MZ0A 1BCRB 4RPJA 3GT3A 5ALPA 3RDPA 5T4FA 3I9JA 5BY2A 2JCXA 2NN3C 2OZEA 3R09A 1G3QA 1SO8A 1MV8A 1NUUA 4TT8A 3TUJC 3AFMA 4EARA 3J81k 1JHMA 1MLDA 3EEFA 4B4UA 3NOOA 1AGYA 1D2MA 2DJ5A 3L41A 5KUTA 1Y8ZA 2XQGA 1YO6A 5GADl 1XVAA 1AKTA 2HRBA 2PXCA 4K6MA 1L4LA 1P4RA 1RRKA 1YRYE 3QQ5A 2Q50A 4XX0B 4ZQHA 1X1QA 1BEZA 1ESCA 1WTCA 2VP5A 2X8JB 3RRZA 1WQ3A 2PJRA 1CB7A 4WUTA 1KQGA 4Y2XA 5J4LA 2ZI4A 2AFIB 2M98A 2BI4A 2M1ZA 2NTVA 2XF8A 3GZNB 4ZYZA 5KX5A 1G9TA 5CDTA 3SYTA 2GLTA 4OA5A 1O95A 1BNCA 4PYRA 4ZYUA 2G1JA 3DC7A 3LBYA 2CC2A 2D4AA 2JDID 1FFDA 3UJ9A 4WKPA 3ROPA 2ZUDA 3HRIA 3OSZA 3UWOA 1G5QA 2OHJA 3FPHA 3K8QA 5EXPA 3PENA 4FYIA 3VHQA 2P1ZA 1N77A 2ZATA 2W43A 1K06A 3ZU3A 4AY4A 1SR8A 4BMDA 4YV0A 1KYWA 1T3GA 1YASA 4BKRA 5LCXA 2UYOA 3OUUA 2DHCA 4P4SB 4DLWA 1UM8A 5AW6A 3PTAA 4G67A 4NG4A 2C7QA 4FNAA 3EYAA 2IV2X 4NNJA 1Q83A 2EGHA 2QL9A 3OX2A 4Q37A 1LRLA 4E46A 1XMXA 5FBVB 2IHKA 1IOLA 1TTHA 3EGXA 3WRWA 2EERA 1EM8A 2VRNA 4LPKA 2A0YA 4YWJA 4D1YA 1X1DA 5HZGA 3EWNA 2VWQA 2C04A 3EAFA 1K8XB 2IXFA 4AY3A 1U1EA 2FETA 3KJXA 2YHBA 4OI0A 4Y2YA 4DQVA 2RHCA 4GI3A 3RYIB 5GJVC 4OI4A 2O2XA 1E1KA 1N7JA 3GPCA 1B8PA 1SKYE 3I8XA 3OI7A 3R0ZA 4ML3A 1GZ4A 3NIBA 3OLVA 2ECPA 4FSHA 4QNNA 5I48A 2C77A 3DDUA 2VDUE 1Q6YA 3LKDA 4L6IA 1ZESA 3EY9A 3ZUPA 1JX6A 2YC2C 4DKXA 1EFVA 3FPAA 2CLMB 1Q20A 5GAJA 1R9NA 3KALA 3W5IA 3UZUA 4NCBA 4OB7A 5M7EA 3T1QA 2ZWVA 4CKWA 5H16A 4J1TA 2FFBA 4RY2A 3WX0A 3L8MA 2Z83A 2O2HA 3MB8A 3LQQA 4KWHA 1ES9A 3RVRA 4A0RA 3IO5A 5IAAA 3EZGA 2P6UA 3JY6A 5LXTB 4D4IA 3H65A 2RBGA 1P6XA 4TKMA 3V97A 1ZOSA 2ONYA 4M1OA 4BLVA 4L5CA 1CR4A 1O9BA 2BW0A 3V46A 3WO1A 1O9HA 2X86A 4DMHA 5CTJA 3ESAA 2VNKA 2XXAA 5EA2A 2OC9A 4WBNF 1SUDA 2P90A 4UPVA 1TKAA 4QARA 2MIIA 3F6RA 5ITSA 2PS3A 5K20A 4KR3A 1CBUA 3ZCVA 1E9VA 1HE2A 3P2KA 4RTRA 1MT0A 3IUPA 1XHFA 3HYRA 1ZRNA 1ELOA 1V5GA 3RANA 3HSSA 4KQEA 4PX9A 4GKVA 4R1MA 5KNCA 4R8RA 4HQKA 2CWWA 4BO3A 4BCBA 1CZHA 1GG9A 1UDBA 1YZYA 2AR9A 3NQ41 5AYVA 3O8OB 2C7PA 2W2MA 2ZP1A 3ODPA 1XYGA 5IJ9A 4M1YA<