4AJKA

Rat ldha in complex with n-(2-(methylamino)-1,3-benzothiazol-6-yl) acetamide
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
331
structure length
330
Chain Sequence
b'AALKDQLIVNLLKEQVPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLKTPKIVSSKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPQCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPQLGTDADKEQWKDVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCILGQNGISDVVKVTLTPDEEARLKKSADTLWGIQKELQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-LACTATE DEHYDROGENASE A CHAIN
publication title The Design and Synthesis of Novel Lactate Dehydrogenase a Inhibitors by Fragment-Based Lead Generation
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase/inhibitor
total genus 115
structure length 330
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ajkA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4ajkA02
3CZMA 4AFNA 1GCOA 3C24A 2OP0A 4N7RA 4I9HA 1YB5A 3H5AA 4I5EA 3GEMA 3V1YA 3FR8A 2VHXA 4G5HA 3I9OA 3O38A 4J1SA 4WLFA 2CF6A 5I8WA 3QIVA 1CQIA 1YXMA 2JAPA 3KM0A 5H81A 1NNUA 5H83A 5F1PA 1PS9A 3PIDA 5TGDA 2W2KA 1JU9A 2W90A 2A4KA 1FDTA 4XZ3A 3VTFA 1LSSA 1TVEA 1O94A 3P7MA 4N5LA 3IDSA 4W9NC 2ZJ0A 3W1VA 5HRUA 1XQ6A 4CQMB 1V3VA 1H2HA 3NAQA 5B4VA 4J43A 4HXYA 1BWSA 1Q0QA 3H9UA 4MP3A 2X5JO 3ADOA 4IIUA 1XYGA 3PP8A 5COBA 1Y81A 2GASA 4CMJA 3U9LA 3STHA 4MOWA 1T2CA 4XGNA 3UAGA 5L53A 3WFJA 3L77A 3LK7A 2X7HA 2I66A 2UUPA 1GZ4A 5K6AA 3H9EO 2DT5A 4Q3EA 3VDQA 5CFZA 3JQAA 1GQYA 3UFXA 4IBOA 3F46A 1LA2A 3C7DB 2Y1FA 3SJ7A 4OQYA 4A26A 1C0LA 1ORRA 5I9NA 4J7UA 1ISGA 3KSUA 1DBVO 4U6SA 3TDKA 1N2SA 2DTDA 3WMWA 4EYEA 1GEEA 3GHYA 3KEOA 4R9RA 3KYDA 1DC4A 2QX7A 1I8TA 1IE3A 4NK5A 3ST7A 4BKUA 1OOEA 5CG1A 2Y99A 4J49A 3ZWOA 1DC3A 3GVPA 3NT2A 4H15A 2B5VA 4AJOA 4HNGA 4MPDA 3OJEA 4KQXA 3V2GA 1ZBQA 2F00A 2CD9A 2VNSA 1C1XB 3COSA 3I9KA 4FIZA 1VM6A 4BMNA 1MXFA 3JQGB 4NG5A 1U4SA 4BO1A 2Q50A 4KTVE 3DBLA 4RVUA 4BNWA 2PGLA 1SO8A 2OUIA 3L4BC 2ZB3A 3ZWNA 1EVZA 4RLSA 3WIDA 4KWIA 4D3DA 2VYVD 1GL3A 4WLVA 1R0LA 1N8KA 2OO5A 2QRJA 6LDHA 4IMRA 5TQVA 4RO0A 2YDYA 1W8DA 2VUSA 3WWYA 4QUKA 3BZUA 3MJEA 4AJHA 4PLZA 1U7TA 2X0RA 3GT0A 5TLSA 4PLCA 3ICCA 3E8XA 4EW6A 4OYRA 4LW8A 3WLEA 4YB8A 1U3VA 4E2ZA 3NYWA 1YDEA 2ZCUA 3P2YA 1GV0A 2ZYAA 3HN7A 3ICPA 1A27A 5ICSA 4WLEA 1ZK0A 3ZU2A 2C29D 2UUOA 3DMTA 3UN1A 2IDZA 1A71A 1KVUA 1P9LA 3FWNA 3TZ6A 2AHRA 2IRWA 5IDYA 5BNFA 3VZSA 5JYDA 1F0YA 1LLQA 4MVJM 1O6ZA 1FDSA 4MIOA 4UUOA 1HDXA 5T8KA 1VE9A 1ZEJA 2PY6A 3ZNPA 3LLVA 3ROQA 5TNXA 1AHHA 3D4PA 1H2BA 2UV8A 3ZWVA 3L6DA 3BHIA 5DCUA 3PTZA 4BOYA 2P4HX 2PKRA 4FJ0A 4GMFA 2AMFA 4R69A 4XIYA 3H5RA 4PIVA 5DF1A 1ENOA 1Y8RB 1VPDA 2YW9A 3KO8A 4RQTA 4JROA 3O26A 5TC4A 1LSOA 1SOWA 4B8ZA 2A94A 3ZDFA 2D4AA 2D59A 8LDHA 3RWBA 2O7QA 1MG5A 1EDZA 2B4RO 1IULA 1IZ9A 4GKVA 4ND2A 4PG6A 5JDIA 2VTDA 3DONA 3TZHA 1ZJZA 3ENNA 1LRJA 4QECA 5CPFA 1AUPA 1DLJA 2X5OA 4AL4A 1FJHA 3ZNQA 1HWYA 5L3ZA 1ADBA 3VAZA 5A5FA 1QV7A 1HDOA 1DRWA 4PG5A 1U3WA 1ARZA 2OMEA 3FBTA 2GCGA 2OORA 2X9GA 2HO5A 4W7IA 1TXGA 2HDHA 3A4VA 3D3WA 1IY8A 3GRPA 1QR6A 1ML3A 1WNTA 2GNAA 3PHGA 1NFFA 4H3VA 3ETGA 3ZWBA 1QLJA 2W2LD 3TL3A 1Z73A 3BIOA 4CUKA 1YQDA 1PQPA 3OIDA 1ZJYA 2YDXA 1BG6A 4NHEA 1ZW1A 1JKJA 4QQRA 4K28A 3AUAA 4KQWA 1TT5B 1QYVA 1LDGA 3I9MA 5AOVA 1JTVA 2FP4A 4BNLA 2PGDA 2NTNA 1OAAA 2GLXA 5IN5A 2ZB8A 4IGFA 1WP4A 4RDHA 5JE8A 1H6CA 4FFLA 4IDAA 4XQGA 2X8LA 1IOLA 1JVBA 3AI1A 1X7GA 3RUHA 3VTZA 4D0RA 2FR8A 5F21A 4DQUA 2RCYA 4RVGA 5A5EA 3H5NA 3B20A 2Q46A 4CODB 4MP6A 5TT0A 1GV1A 3OQ6A 4IXWA 5BSEA 1CDOA 5HWSA 1EQUA 5JAQA 3AU9A 4TZKA 2NWQA 4TKLA 3VH4A 1NVTA 3U09A 3U4CA 3DWFA 4B8WA 1G6KA 1JAXA 1P1RA 2Q1SA 3GEDA 1LDBA 4XJSA 4YXFA 5EQDA 1Q7GA 2EKPA 3M6IA 3VPHA 5KTKA 2NV6A 4RPLA 1E5LA 5A04A 5U4QA 5AXDA 4E31A 2Z5LA 4NBUA 1J5PA 4CM4B 5JCJD 3DOJA 2GSDA 3DEYX 4M1QA 1Y5RA 1WXDA 1PGJA 3GVXA 2JHGA 3BA1A 3GUCA 4BO3A 4WLUA 4XR4A 4CLXA 4MVJP 2X5KO 2VWGA 1NAIA 3E6AA 4M87A 2J6IA 4TQGA 3AK4A 4OXYA 5IZCA 1Q7BA 2Q4BA 2BI8A 4WNIA 1DB3A 1R4MA 1SZJG 2EHDA 2NUAA 2FOIA 4L73A 3BMCA 1XSEA 1E6EA 1X1TA 3HQ4O 3IL2A 3EMKA 4BO0A 4R3NA 2WE8A 3ZU3A 4PRKA 4O59O 1JDJA 1E77A 4FFOA 4DWVA 1Z82A 4RV9A 2UDPA 2J3IA 3UGKA 5JYEA 1CYDA 1U3TA 3RUEA 3HWRA 5BNTA 4Y9DA 1XLTA 4R41A 2W2KB 3OP4A 1QORA 3F47A 4MDHA 5IDQA 4EGFA 5JFOA 4GGOA 5EERA 2EF1A 3NKLA 4R5HA 1PL6A 1T2FA 5A3VA 4CM8B 3AY3A 2C5EA 1HSZA 4GI2A 4AJEA 5DP2A 1QRRA 1A4UA 4MIYA 3PVZA 4YRAA 1XDWA 3VPSA 4TROA 4Z0PA 4OOFA 3SVTA 2WYUA 3V1TC 2Y1OA 5U9CA 3FRJA 4CUZA 4J1NA 4JGBA 4DIBA 4Q3BA 3E48A 1GYQA 5COAA 3JQAB 4ESOA 4QO8A 4BUCA 5JC1A 4DIOA 4IS3A 1DJQA 3H9GA 3ZN2A 3HHPA 1MLDA 5FI5A 5KWEA 3OECA 2E37A 2IXAA 1B3BA 1HDRA 1VKNA 3CUKA 4IDDA 3ROPA 2BRUA 2CVOA 3KYDB 4ITUA 1T25A 4YJHA 1QYXA 2TMDA 1X7DA 1E6UA 2AE1A 1U4OA 2EP7A 4MVJD 2VN8A 5ILOA 2ZK7A 5A03A 1N9GA 4HV4A 4BNUA 2OFPA 5JBIA 1VI2A 3MWDB 4R51A 4RCVA 2G76A 4W9NA 5LDGA 2D8AA 3U4IA 2VUTA 5CEFA 1YH3A 4E21A 2JCYA 2XXJA 2PD4A 1GPJA 2RH4A 3R6DA 3FPLA 3E9NA 3UH1A 4U5QA 3ZGYA 3ZV4A 4CMKA 3DBLB 1DHRA 4GVXA 4PVDA 5C7IO 1R16A 4AJ4A 1VC2A 1R15A 3BAZA 2BD0A 3L4SO 3GVIA 3VKUA 3VDRA 3ZWAA 2BGMA 3LT1A 1UR5A 2WTBA 1D1TA 4Z3KA 2ZYDA 1E92A 2BF7A 7MDHA 2O3RA 3HDYA 1DIBA 3RVDA 4XX0A 4NBRA 5A9TA 1P1FA 1UH5A 1V35A 2RHRA 4CM6A 4EJMA 2O3SA 1EVIA 4XYEA 5KKCA 3FTPA 5J23A 2X9NA 3E9MA 1U7HA 1I2CA 3WFIA 1QV6A 1SC6A 3HB4X 4GX1A 1XA0A 4UUNA 2IODA 5HS4A 3I52A 5L45A 3G3EA 3E82A 1UZLA 2J3KA 2WJPA 3GPDG 4RPKA 4CR8A 4DUPA 1NVMB 1P33A 1KYQA 1AHIA 1I30A 1U1IA 2ZQYA 3DZJA 4HFJA 3SC4A 3WS7A 3DHYA 2J5KA 3WGQA 4OOEA 3ZU5A 3UOGA 3WOHA 3VZQA 1K6XA 2AEMA 1WMBA 1LEHA 1HZZA 3JSAA 1KVRA 4M49A 1R66A 3SBOA 4BKPA 4CMHA 2ZB7A 3D64A 3I9NA 1H9BA 2YV2A 2NNLD 5BSHA 4WOJA 4DBVO 2X9VA 3RIHA 5A9SA 4WCDA 1DAPA 3U3XA 3ASVA 4O63O 5CHEA 2GZ1A 4RLHA 4R1TA 3F4BA 3K2EA 3AI3A 4GLOA 1E6WA 2JCXA 1R0KA 3G17A 4NMHA 5KKAA 5EPOA 3D5QA 4I08A 1T2DA 2VYNA 2O3UA 3IP1A 3WDSA 1SB9A 2RBEA 5HBRA 3VOSA 4A5OA 3PWKA 3IUSA 3JQ7B 2GRAA 3F9IA 3S2EA 2G82A 5DBGA 3BMNA 1E1NA 1N92A 4J4HA 2E49A 5HM8A 1HDGO 3KV3O 1FF9A 5GZ1A 4WOKA 1G0OA 4UVDA 5HS6A 4A03A 4S1VA 5L4LA 2PKQO 2R00C 4Y6SA 5CG2A 4E5PA 1ONOA 1B8UA 3AWDA 4XQEA 1DXYA 4XYMA 4WLNA 1E5QA 2NACA 3D3WB 3OF2A 3RC9A 5A06A 1HZJA 3JQEA 1C0IA 4ZQEA 5EMHA 1LRKA 1RKXA 5CDSA 2E4AA 1EDOA 1H9AA 3MWEB 2DLDA 4AVYA 1SOVA 3WGHA 3WTCA 1HTBA 1NX6A 4AJNA 4YJFA 2NTJA 3S2GA 1F06A 1D7OA 2OHXA 3B6ZA 3K73O 2VRCA 1EVJA 3W4KA 4BQPA 2C7VA 1I3LA 1QSGA 1I3KA 1O5IA 2LDXA 2EXXA 1YJQA 2ZJ1A 3E18A 3FNHA 4LMRA 4PLVA 2PZMA 4XEHA 3JQ8A 4FSHA 4RF2A 2ZIZA 1NP3A 1YWGO 1A9YA 1RPNA 4INAA 3FNGA 2JFHA 4OHUA 1Z45A 4XR9A 2CZCA 3KETA 2Y1DA 2ZQZA 4OGWA 1E3WA 2NTVA 4CLRB 4ND1A 3E1KA 4OO3A 5DCWA 2DVMA 2UAGA 1YB1A 3HZZA 4PG4A 2I99A 2JL1A 4W99A 3I9JA 2DBQA 1J0XO 1ZVMA 1W4ZA 1PJSA 4N18A 3EZYA 4JNKA 2P91A 3H3JA 3PJDA 5I7SA 3A28A 5EQFA 3QVSA 2PH3A 1HE4A 4JBHA 1ZEMA 1GADO 3O8QA 4FPXA 3H2ZA 9LDTA 1ZXBA 3TZKA 3WG9A 3ZWXA 4B4UA 2HQ1A 4YPOA 5L7WA 1F8FA 1TLTA 3I23A 4FFNA 2Q4EA 4BNZA 1KY4A 1CERA 2BFAA 1F8GA 4XB1A 1K5HA 3E9QA 5DT9A 3C1AA 3F4LA 4ZHSA 3DFUA 3GK3A 3SJUA 1QP8A 5EJ2A 2FHSA 1UXJA 3WGIA 1PJQA 2ZTVA 4K6CA 4E3ZA 3I5MA 1FDVA 3RKUA 4WASA 1NWCA 4ZQGA 5JMPA 4ILKA 1M76A 2P2SA 1WDMA 3T7EA 2NQTA 2XOXA 1RYEA 4YAGA 2CDAA 4NFSA 1KEUA 3NEPX 1P1JA 1N7GA 1DDOA 2O2SA 4TRNA 3PIIA 3JQ9C 3NT5A 2VHZA 4U7WA 2HSDA 3BMOA 1J6UA 1R4MB 5TT1A 4AJIA 3ORFA 4F45A 5KVSA 2P5YA 2PD6A 4R4JA 1ENZA 2GZ2A 1IB6A 2DTEA 4P38A 1IHXA 5EL0A 1GQ2A 3GGGA 2QYTA 1DSSG 3K6JA 5DOZA 1H93A 3LSYA 2X23A 3ENKA 3OBBA 4MKXA 1XHLA 1MP0A 3ONFA 2EKLA 2UVDA 3EVNA 3K31A 2HCTA 3EDMA 3OJLA 4FC6A 2IE0A 2O7SA 5AXAA 3S55A 3WJ7A 4TVBA 1VL0A 1V8BA 4NJMB 4B4VA 1KC1A 3OJ0A 5G0UA 5ITWA 2W98A 1I5RA 2VT2A 3RKRA 1UXGA 3Q11A 2EJWA 4IDGA 3FTNA 3EW7A 3F1LA 2NU8A 4IXTA 4BL5A 1HL3A 1YS4A 2ZATA 3B1JA 4MVJF 4UVHA 2Q3EA 3W8DA 1PSDA 3NDRA 3R3SA 3RU9A 1E7YA 1ZMTA 3ITKA 2W8ZA 3TFQA 3QVWA 2QQ5A 3H2SA 3KLMX 5B1YA 2CDCA 1PGNA 4BHTA 3OETA 3HUDA 1L1FA 2PWZA 2NU7A 3OFSA 5ADHA 3JQFC 1UZMA 1ZZEA 3PYLA 1KBZA 4Y67A 4EUHA 3CKYA 3DAGA 2IZ1A 3PLRA 4PLTA 3GVHA 2Y1GA 3FBGA 3HE3A 4J1QA 1FK8A 4KDEA 3HN2A 4ROSA 2TMGA 1C0KA 3U0BA 2Y0DA 4Z0TA 1GUYA 1Y9EA 4HKTA 1OMOA 4CR6A 3OICA 4CMIA 2NM0A 2FMUA 2EIHA 5C37A 4HFMA 3RBXA 2C7GA 1X0VA 1MFZA 1XQ1A 5TSDA 1I01A 3AM3A 3WYEA 1CETA 1ONPA 1S7CA 2HMVA 4AJ1A 2NVUA 5BNIA 2EW8A 5CEJA 4LISA 2OP1A 1GFSA 3V2HA 1N9GB 4D3SA 5GZ3A 4PZEA 1FMCA 1QG6A 1GAEO 2BI7A 1MC4A 1PGQA 4WECA 4BNIA 1KEVA 3AFNA 4RJTA 4ZU3A 3LU1A 4GBJA 1W6UA 4J9UE 5KIAA 4A2CA 3ANNA 1V0JA 2C2YA 2VYVA 1G0NA 1EUZA 2H9IA 3OEWA 3GNSA 5FYDA 1YL6A 3VH3A 4CLOA 3L6EA 4R01A 2H1SA 4PLGA 4PVCA 3Q1LA 4TSKA 2YY7A 2X58A 4C7JA 2YFQA 3RC7A 1ADGA 1LLCA 5DCYA 4BNXA 4E2XA 1DIRA 1SEVA 2V6GA 3I4FA 3KSZO 2Q99A 1OC4A 2IZZA 5GMOA 4ZQHA 1GYPA 1UXKA 3NDIA 3PZRA 4D79A 4F6LA 4CL3A 1JLLA 1NHGA 4J16A 2VZ9A 3O03A 3ZNNA 3Q2KA 4JN6B 4BKOA 3OM9A 4J7XA 4CM7A 4CLDA 4WLOA 4ZRNA 1PJTA 2QZ9A 2HKIA 3TSCA 3KBOA 2GN4A 4QT0A 1LBEA 3EGOA 2ILTA 1LRLA 4E6PA 4AJJA 1MUUA 4PFJA 2X4GA 3WICA 1M75A 3GR6A 1A5ZA 4NFHA 1K6JA 4NQZA 4IS2A 5FWNA 2B35A 4GX0A 3UICA 4MVJG 3OEYA 3R3JA 4DPMA 1YQXA 1ZK3A 4DQXA 2YQ5A 5EINA 3GNTA 1O89A 4N5NA 5IXSA 3MJSA 1J4AA 1QLHA 1ENYA 3L9WA 1GCUA 1CIVA 3DTTA 3GY0A 3QA9A 4KP7A 5IG2A 1I10A 3RFTA 3OQBA 2VT3A 4YRDA 2Z1NA 3PHHA 4YDRA 2P4QA 3PQEA 1P1HA 3PRJA 4YT4A 1PX0A 3LDHA 1U2DA 3X2EA 1VRWA 1GTMA 3QSGA 2O48X 3K96A 2B5WA 3DAFA 4F3YA 3WMXA 3BMNB 1LI4A 3BYZA 3OA0A 1PS8A 4M86A 4XRRA 5K9ZA 4O5OA 2H5LA 2I76A 1E1MA 2GN9A 2NU9A 3H9JA 4BB6A 1N1GA 1P1IA 1XIVA 1IHYA 4OXKA 2HJRA 4XRGA 3LT4A 5AVOA 3VZPA 4B3IA 4YAIA 1GEGA 4J0FA 4BNKA 1IPFA 1A7KA 5CP8A 1RM4A 4M89A 3BMQB 4KUHA 2ZTUA 4KDFA 4EUEA 3GZ4A 3VC7A 1I33A 2W2LA 5L7TA 5JC8A 3JTMA 3FR7A 2O23A 3R1IA 4J3FA 3TQHA 1ZO8A 3U4DA 3KXDA 2RH8A 2PR2A 3VVBA 1SEPA 4ALNA 2X0JA 3DDNA 3HDHA 3QW2A 4WJZA 3WWZA 1BXGA 2Q1WA 1RM5A 4P4NA 3GMSA 4MVJH 4U0JA 1E0DA 2C07A 2LDBA 4JXKA 4DXHA 1RM3A 1XU7A 1E1KA 2D1YA 4J2OA 4AJPA 1LDEA 1JAYA 4CM9D 1ULUA 4D45A 3HJAA 1B7GO 3AY7A 3ZH2A 3PJFA 3RUCA 2Y0EA 3D5TA 2AEJA 2C54A 2OBNA 3HFSA 4N54A 4UAGA 2O4CA 4DIFA 2V65A 5THKA 1NWHA 1Z7EA 5THQA 4ZQFA 4OM8A 2NSDA 3M1LA 4PG8A 1E3WB 3VVCA 3C1TA 1MX3A 2AQKA 1JQBA 3ADPA 1U3UA 4M55A 9LDBA 3OIGA 3NT4A 2EERA 5G2OA 5B37A 3G1UA 1U8XX 2DBRA 3RQSA 3PJGA 4R9SA 1ISMA 1T2EA 2DC1A 4QEDA 5KJFA 2VOJA 4DL9A 5L9AA 3O8QB 4FDAA 4GWKA 4BKRA 3P19A 1A72A 1PGOA 3WGTA 5JCJA 5TJHA 1O9BA 2IYOA 3AM4A 4YJGA 4BNNA 2GYYA 2JFFA 2X6TA 3I9LA 2O4UX 3WBBA 4CQLA 4IDBA 2FPPA 3DBRA 3GEGA 3QVTA 4RL6A 3WGOA 4MVJE 3EYWA 1T4BA 1P45A 4FB5A 1CWUA 4BO7A 3NGLA 4B7XA 1E7QA 1NAHA 3GMDA 3WQRA 4OSPA 4J4BA 2WDZA 4PGFA 1WPQA 4AICA 4CMEA 1K2WA 1KC3A 3AUUA 4FCCA 1BTOA 4IZIA 1ADFA 2BGKA 3PLNA 4ONEA 5CDUA 3AY6A 3U4HA 1I3NA 5DULA 3MJ4A 1BVRA 3Q2IA 3H65A 4HBGA 5A3JA 3F5SA 3PI7A 4IM7A 1UXHA 2PTGA 4IDFA 1DPGA 2WM3A 1QKIA 4D46A 1UAYA 3V5NA 4TRRA 5CAEA 4FFPA 5JDCC 1HDZA 2WSBA 4NFYA 4OKNA 2YUTA 4D43A 5AYVA 3ABIA 2EKQA 1PZEA 1ADCA 3TWOA 1PTJA 4MIEA 3IIEA 3TJRA 3N74A 2C59A 4ZN6A 1EE9A 5L7YA 2X22A 1NQTA 2HU2A 4E5MA 1HT0A 2H6EA 1NTOA 1P0FA 4LRTB 5DDIP 1JWBB 4RZHA 2NLOA 1IL0A 4E0BA 4BNFA 1PQUA 4E32A 1BDBA 2D5CA 3R0IA 4Z3DA 2DBZA 3LC7O 3T7CA 5BSFA 1QYDA 2I6TA 2PD3A 3H9QA 4HP8A 1H6AA 5KOIA 4ALJA 1NQ5A 4LSMA 4O6VA 4E2WA 3DXFA 4IQGA 4CR7A 4XWYA 1EE2A 2Y66A 1B3RA 4CMIB 4BNHA 5JXWA 3FWZA 4WCFA 3F6YA 3SC6A 1T1SA 1V3UA 3VPXA 4FQ8A 5T6BA 1R12A 2HMUA 1HYGA 3QWAA 4OJNA 2D5AA 1S6YA 3VZRA 4MVJA 4P22A 3PHLA 4OL9A 4BO2A 5CPBA 3QWHA 2NVUB 4DBZA 2POQX 3RUFA 1YRLA 4GVLA 1KEWA 2HUNA 4E12A 1LJ8A 4B3JA 3WB9A 4DLAA 3MJTA 4GPD1 4RPGA 4JBIA 2G5CA 4YAEA 1VSVA 4NPCA 3ZZNA 2PK3A 1WVGA 4R5MA 5A9RA 1C3VA 2Q2QA 3IQDB 4IY1A 4R3WA 2WYWA 2JHFA 3TOZA 3TL2A 1M6HA 3WGGA 3WLFA 1ZH8A 3K30A 4BGUA 1I3MA 3RCBA 1HE5A 3JD4A 4W4TA 4C4OA 3I3OA 3FF4A 4CJXA 4CV2A 3K92A 4RVDA 5ENVA 2QZZA 2B83A 4NI5A 3X2FA 4CLOB 3LVFO 4EJ0A 1MA0A 3H7AA 5JO9A 3JYQA 3NJ8A 2WEKA 3UCEA 1NXQA 1WDLA 2AEFA 3U5TA 1B26A 3JQCA 2GR9A 3F3SA 3LF2A 4CM3A 4L4RA 1XEAA 1X13A 2V6MA 1GDHA 3OMLA 4I5DA 3MCVA 4YCAA 4IZHA 3IS3A 4IJWA 4YQZA 4ZA2A 4CM5A 3MOGA 1LDYA 4MO2A 2XF8A 4RPJA 2B36A 4Y6PA 1K3TA 2DFDA 1I0ZA 5I8ZA 3JYOA 4XGKA 5F5NA 1KOLA 4LVCA 4IJVA 2O3TA 1TA4A 4TVOA 1T2AA 3RBVA 4MINA 3PFFA 1W0CA 2AG8A 1UP7A 5C3MA 3FI9A 3KYCA 3QHAA 3TN7A 3IP3A 1YJ8A 1QXSA 3JYNA 4URFA 5LC1A 4IGEA 2GPTA 4CMGA 4YTEA 2J3HA 4GAEA 1QYCA 3AOEC 2BH9A 4WKGA 3CINA 4P8RA 1O8CA 4GGPA 2HMSA 4B4OA 3CXRA 5IJZA 1K6IA 2YFHA 4J6FA 3L07A 2I3AA 5B4UA 5A02A 5F1KA 1VKOA 4FJ2A 2Q1UA 2I3GA 1B15A 4AJ2A 3FN4A 2B69A 1ZIDA 2DUWA 4IJKA 1CJCA 4BO5A 3ZWCA 1EZ4A 2FZEA 3SEFA 3AM5A 3GZNA 3HADA 2FSSA 3QJ5A 4YR9A 1PL7A 4B7CA 3IJPA 2VRBA 3AFMA 3IOYA 4CQMD 1UXIA 3DMTC 2C0CA 5FF9A 3D0OA 4L76A 3ZV5A 5KJCA 4JCOA 4K1LA 3W6UA 1WWKA 3L4BA 3AOGA 3ZCXA 2EJVA 4LVUA 4QTZA 2HLPA 3GC6A 4L9RA 3UCXA 1WZEA 3RASA 1LLDA 1DRVA 1LUAA 2Q2WA 1HDYA 3JQGA 3IC5A 3QQPA 2JAHA 2OZPA 4K6FA 4ZJUA 2GZ3A 3W8FA 1E3SA 1ID1A 3LF1A 1DFIA 2ZTLA 4P4LA 1NR1A 1PJBA 3HSKA 4DREA 4PN3A 5ICMA 4YVFA 1BXGB 3LYLA 2VNAA 1Q2XA 1X14A 4BNTA 2GO1A 1EK6A 1M67A 1XGKA 1P0CA 2P68A 3CTMA 3HDQA 4LSWA 4ND4A 5DNAA 2FRDA 3L9XA 3BHJA 1DIAA 1I32A 2EW2A 3ZWYA 3Q6IA 3WQQA 4MJLA 4WEQA 1VL6A 3KEQA 4CMBA 4UEKA 3D3EA 3CEAA 3ZI0A 2EWMA 3HDJA 5JDIC 2D0IA 4IINA 2G17A 4L75A 5FEUA 1P31A 2C5AA 2JD0A 1DFHA 2B37A 4D41A 3GA0A 4O1MA 4A27A 1YDWA 1ZMOA 1DAOA 4TWRA 2HAEA 1YONA 2YJZA 3AJRA 1SCUA 3VKVA 3U62A 2J5QA 1ZK4A 3M2PA 4I5GA 5ER9A 4BNVA 1BW9A 1KVQA 2Q45A 3RSHA 4DPKA 4ZGWA 5B12A 1T1RA 4TRMA 1I24A 4IPTA 3V2UA 3MTJA 3TOXA 1E7RA 1F17A 1NHWA 1TI7A 2ET6A 5ENDA 5KJEA 1JW9B 4OSOA 1PU2A 1YE3A 3CMCO 1P3DA 4XQ9A 2A92A 2QHXA 3C1OA 1E3LA 1OI7A 3NTOA 3BTUA 2BFMA 5KNLA 1OC2A 1A9ZA 3BTVA 4RORA 3W6ZA 4E30A 1PZHA 4YJGB 4PLPA 3EVTA 1MB4A 1KETA 3JV7A 5A1TA 4UEOA 2QRLA 3DBRB 5DN9A 5DBFA 1EMDA 1V9LA 4Y98A 1EVYA 3LT0A 5ER6A 4OXNA 4CPDA 1BGVA 1D8AA 4MKRA 3E5RA 4HFNA 1KS9A 3PEFA 4PCVA 4PZCA 2CVQA 4R16A 3INTA 3H4VA 5MDHA 3DL2A 3CSDA 3INGA 3N7UA 3D1LA 3UHAA 4J1TA 2FR0A 3FCOA 2YHIA 4RF3A 3EAGA 1KEPA 5TF4A 1RM0A 1NQOA 3P5SA 4NJOA 4WPGA 4E13A 3DFZA 2B0JA 2AA3A 4DC0A 5JY6A 3INRA 4EJ6A 4PRLA 1ONNA 3WNVA 1HDCA 5CEEA 2Y1CA 4A73A 2I5PO 3WX0A 1XR3A 3L6OO 3DMYA 1BMDA 1JN0A 4DQVA 1R4NA 3CZRA 2FWMX 2Z95A 3ZU4A 5F3RA 4BV8A 1C14A 1RWBA 2DFVA 3ANMA 1X7HA 3BMCB 2VHYA 1ISFA 3QE3A 2WD8A 4XCVA 3GRKA 2OL4A 5CDTA 3L0DA 3WYBA 1F12A 4FR5A 4ALIA 5IZCC 5KCZA 4JK3A 2O3JA 2VWQA 1LSUA 3KB6A 4DYVA 5IAAA 2XPCA 4FFRA 4YACA 3PWZA 3JQ6A 3NJ4A 3ZNOA 2Y1EA 1DIGA 1XELA 5DZSA 4U0KA 1OBFO 4NK4A 4WEOA 4ZQBA 3CE6A 2F1KA 4YEDA 3KSDO 4R54A 1HRDA 3DB2A 1LU9A 3JYLA 4WCFB 4YA6A 5I9MA 3JYPA 2DM6A 1E7MA 1G1AA 4E33A 1DC5A 4IQ0A 2OXIA 4ZVVA 2P5UA 3P2OA 4YAJA 1UP4A 1X1EA 3I1JA 3RI3A 2X1HA 3GFBA 4OQZA 4JJFA 3ZHYA 2HK8A 4A10A 4ND3A 1RJWA 2AXQA 4ID9A 3QWIA 4HY3A 4CMAA 3DBHA 1Y5MA 4GL4A 4CV3A 4EITA 2C2XA 1ZSVA 1JKIA 5EESA 3ITDA 2BFPA 4EDFA 3KVOA 2V6BA 2BGLA 1TT7A 5G0VA 2EEZA 4XQCA 3ZHBA 2B4TO 4QFDA 4DLLA 3Q9NA 4IDCA 3WSVA 4BVAA 2DTXA 3DZIA 2DPGA 3OA2A 4NH4A 5B4TA 1P44A 1H6DA 2IEBA 4IUYA 4YJHB 4LK3A 4CM1A 1N5DA 2VQ3A 3HB5X 4NBTA 4XDYA 4NU6A 1C1DA 4II3A 4YQYA 1U9JA 4R1SA 3VPFA 1JKFA 1ZK2A 2PFGA 4HNHA 1MFPA 4OIMA 4XYBA 5JW6A 2EGHA 1ZXLA 1T4DA 1VJTA 2VWHA 3GH3A 3JD0A 1BXKA 1UDBA 3DAPA 3KTDA 2J8ZA 4CL8A 1HLPA 5JS6A 3UUWA 1KVTA 2E82A 1NFRA 3DOOA 2JD2A 4GSKA 4RDIA 4CM8A 3RJ9A 5JNLA 4LCJA 4Y6RA 1Y8QA 4RQUA 4YT2A 1HSOA 2VHVA 3KYCB 2FR1A 4TRJA 4HUJA 1PJ4A 4JP2A 4LMPA 3RFXA 3TFOA 4LCEA 1GYRA 3IJRA 4EBFA 1BHSA 2P9EA 2HK7A 3RUAA 3N58A 4BGEA 2GERA 3IUPA 3KZVA 2BKAA 3RBZA 1ISJA 2FY8A 1Y7TA 3AUSA 4IQ8A 2FPGA 2G1UA 2FZWA 5JMWA 4U8GA 2YQ4A 3PYXA 4II2A 4DVJA 4EUFA 1NR7A 2XXBA 2X0IA 4BS9A 1E1LA 1Q7CA 3QVXA 4Y8VA 2B4QA 4NNJA 2VOEA 2BFOA 2A9FA 3I4CA 5G4KA 3GZNB 4R1NA 1J49A 3GF4A 2WWRA 1E3IA 1GD1O 3FHLA 4G2NA 4PLHA 4DPLA 3KYBA 1NYTA 2I9PA 2NVBA 1GPDG 4I5FA 1D4FA 1Z75A 2PZJA 4WE3A 3DOCA 3S1LA 4D0SA 2DUUA 2Y0CA 3GLQA 3LT2A 3NX4A 4CLHA 1B0AA 1HXHA 4GSLA 2JKVA 3Q0EA 4RF5A 4JIGA 2BMAA 6ADHA 3V1UA 3KOUA 5A9SB 3I6QA 2HMWA 2V7PA 5TS3A 1WAMA 5L4SA 5L51A 5JPIA 3ONEA 2FN7A 1IZ0A 1H94A 1DHTA 1ULSA 2HRBA 3FPCA 4Q3DA 1P1KA 3JQAD 3QRWA 4KMSA 4E5YA 3AOEA 3HFGA 4GMGA 1GZ6A 4J91A 3GDOA 2DKNA 3Q3CA 3DO5A 3PJEA 4CM9A 1V6AA 2VCYA 3GVCA 4N5MA 5BR7A 4HWKA 3U49A 4JLWA 2HK9A 1YBVA 1ZCJA 2JFGA 4DLBA 4NBVA 3O9ZA 3F1KA 3IMFA 4MVJI 4J9VA 4HFRA 2BLLA 4WK6A 3WSWA 3EY4A 1PJCA 1PWZA 1B8VA 3ZW9A 3C7CB 3WQSB 3JQDA 3WTBA 1YGYA 2BELA 3A1NA 4E5NA 1K0UA 3CIFA 4FOOA 3PQDA 1PJLA 5G0WA 3WGZA 5JY1A 3IKVA 1KVSA 1Z7BA 5F1OA 3V8BA 1MG0A 3ETDA 1I36A 4IDEA 1M2WA 3F5QA 5DBIA 2A35A 3Q9UA 3ASUA 1ENPA 4F46A 1D1SA 1BW9B 4JJIA 4KUGA 1LLUA 3ETEA 5DP1A 2EGGA 3G79A 4YJFB 3GHHA 4CV1A 4RZIA 1EUDA 4AJKA 2PZLA 3WBFA 2ZCVA 4DMLA 3RAJA 1EFLA 2X86A 1TB4A 1GUZA 4I9NA 4W82A 1AGNA 5CDYA 3JQ8B 2QYSA 1VJ0A 1PIWA 1PR3A 1FXSA 2ZYGA 3RC1A 4NR0A 2ZB4A 3M1AA 4L0QA 1BDMA 2IXBA 4RGBA 1M66A 4CV0A 4YWJA 2CVZA 4UUMA 1ZUD1 4I8XA 4Z9FA 3WYCA 4ZRMA 3JQ7A 2UYYA 2R00A 4J7CA 3PK0A 1LC0A 4XB2A 5JAZA 1WW8A 1X15A 2BHLA 3RD5A 5JCXA 4GKBA 1DO8A 4GWGA 4EI2A 4BO9A 3GGOA 1UP6A 4IMPA 3A14A 5L4NA 3OHSX 2PNFA 1XG5A 1U5CA 4PG7A 2YHIB 1W73A 4I1IA 1A4IA 5C5IA 1EBFA 4PLYA 4FOSA 1HLDA 1SNYA 1P74A 1ISIA 1KIFA 4B7UA 5I7VA 3MZ0A 4C7KA 1NPYA 2WMDA 2O3QA 2PA3A 2D3TA 1QMGA 1AXGA 3AUTA 3PYMA 4QFCA 4OMUA 1UAGA 4DRYA 4BIIA 4FGWA 1VSUA 3EUWA 3E5MA 3FSRA 1ZFNA 3T4XA 1B14A 1P77A 4TMFA 3S2IA 4BB5A 3DQPA 3QWBA 4TZTA 3GDGA 2W4QA 1R4NB 3RUDA 2Y68A 2JJYA 3BMOB 2IEDA 1VL8A 4PZDA 4NU5A 2P9GA 3K5PA 5ILGA 5KJ6A 3WR5A 3VPGA 1DJNA 3GG9A 2X0NA 1H5QA 4JJGA 3UW3A 1KERA 3GOHA 1NVGA 1NFQA 5MGBA 4XD2A 4MKZA 3NTRA 3HNPA 4JBGA 3LQFA 4CLRA 4GH5A 2OOSA 1WDKA 1PWXA 2GN8A 4DGSA 3SLGA 5HTOA 1CF2O 1UZNA 3K8ZA 4BO8A 3D4OA 1ZKMA 3JQBC 4J90A 1HETA 4IJUA 5IF3A 3GUYA 2VWPA 4JQCA 2YV3A 1LDNA 3PHJA 4DC1A 2WD7A 3JD1A 1MC5A 1H6BA 3D4NA 3KUXA 1PQWA 4LGVA 3VH1A 3EC7A 3HG7A 4X54A 2Q49A 4JP3A 4BGIA 3OQ1A 3QWFA 5JLAA 5A05A 2ZTMA 4W6ZA 4WUVA 2C82A 3BHMA 2PZKA 1IPEA 4ND5A 4YT8A 5G0TA 1UJMA 3LLSA 1LXCA 1SBYA 2O2YA 1LX6A 2OBYA 4RF4A 2E48A 3FD8A 3T4EA 1U2GA 2PKQP 4H16A 3JQ9A 5CDGA 3W8EA 5T67A 3DBHB 3ZV6A 3WJAA 4GLLA 1ZNQO 4FBGA 2HRZA 1LQTA 4O0LA 2IYPA 3M2TA 4M8SA 2Z1MA 3EZLA 4HX5A 2NQ8A 2HMTA 1NASA 5BT9A 3TZQA 4E2YA 3ZWWA 4ALKA 4GX5A 4WNCA 2EG9A 3ONDA 3PZBA 2XAAA 1YBAA 4S3MA 2DPHA 3PFWO 5ITVA 1GR0A 1A7AA 1B2LA 1C0PA 7ADHA 1D3AA 1DRUA 5IDWA 2QG4A 4L8VA 2Q1TA 3GNQA 4D42A 3PWSA 4EEXA 1C1DB 1EFKA 3B1KA 4TKMA 5L40A 4YBZA 2YV1A 1Q1NA 2ZKLA 3W4JA 4KZPA 4NJMA 2DAPA 3BXXA 4XDZA 1SAYA 1EEHA 2Y67A 2JD1A 3H6KA 4BQRA 3EK2A 4LRSB 4J0EA 1HEUA 1PEDA 3GN1A 4XGIA 2RHCA 5C7OO 2VZ0A 4EZBA 5IFLA 4ZICA 5KVCA 3ZWPA 1Y9AA 1U5AA 3PDUA 3SXPA 4BO4A 1YOVA 3JQFA 3OJFA 1MGOA 1Y8QB 1XCBA 2GN6A 3LC2O 5HA5A 5T57A 1Q0HA 2O50A 4Z9XA 3CH6A 4QXMA 4AJLA 5K6AC 3TZCA 3FNFA 5FFFA 1SB8A 3RJ5A 4LN1A 4BNMA 2CY0A 2RIRA 3K2BA 2D2IA 3VHRA 4YT5A 5K0ZA 5L95A 3NV9A 1L7DA 1LTHR 1O95A 4BNGA 1OFGA 3PXXA 2GGSA 3MJVA 4BV9A 1PZFA 3SX2A 4F6CA 3UCFA 3SLKA 1BXZA 3DC2A 3PDJA 1DFGA 1DLIA 2HJSA 2PGJA 4RVSA 3GG2A 8ADHA 5IXYA 4FD3A 4RVHA 4UULA 4XKJA 1TEHA 2C20A 5G4KB 4DA9A 4WGGA 5BSGA 2CF5A 1XWFA 1E7WA 4JX8A 2CFCA 4NZ9A 4CQMA 3VH2A 1OZAA 3W4IA 4YRBA 4D44A 2Y05A 4NBWA 5BQFA 1HE2A 3RFVA 3G0OA 3MOIA 4D3FA 4YAKA 2GD1O 1L7EA 1UDAA 5I7EA 1KY5A 1R6DA 1DEHA 4BGVA 3ROMA 4DMMA 4GQAA 1GQQA 1Y6JA 3AU8A 2RAFA 2YHUA 3PHIA 5EN4A 2NADA 2J3JA 3UXYA 4QO7A 3ZV3A 1HYEA 4Z0HO 3EHEA 1MV8A 2NVWA 1PGPA 2GDZA 3C3XA 5GZ6A 1ZK1A 1FDWA 3B70A 1PR9A 1NPDA 1ISHA 1EQ2A 4AG3A 1SMKA 4Q3NA 3S2FA 1T24A 4Q9NA 1ZSYA 4QSMA 4DYDA 1WZIA 3DZFA 1C1XA 2QIOA 3GPIA 1VJ1A 2AE2A 2QRKA 4OH1A 5T8KC 3K9QO 4KOAA 5G4LA 5T5QA 2J5RA 3AI2A 4UVGA 1YVEI 3MJCA 4G65A 5I7FA 1CRWG 3IKTA 4FW8A 1O0SA 4BNYA 3ZWMA 1H0KA 4R68A 4CLEA 2R2GA 4Q3CA 3UKOA 4IIVA 1NM5A 1Z74A 5DOVA 1E3EA 1SPXA 1LSJA 3NGXA 3GAZA 3UVEA 3IAHA 3MEQA 3AW9A 1Y1PA 4Z9YA 3GGPA 1N7HA 3QP9A 3RC2A 5KJ1A 5IZ4A 1PZGA 4FJ1A 1K89A 1LNQA 1UDCA 3G1TA 3H3FA 4YJDA 3GDFA 4PLFA 1NQAO 3NTQA 4KWHA 5H82A 4B79A 4ZD6A 2FSVA 2VZ8A 3TRIA 1UUFA 5GY7A 1BRMA 1GY8A 2R6JA 3LC1O 4QX6A 1HF3A 5AXCA 1Z6ZA 3RU7A 5F5LA 3S8MA 3TNLA 2CSUA 1GU7A 1I2BA 4A0SA 3ULKA 4FGSA 4DTIA 3JCZA 1LC3A 4J2HA 2YZ7A 4D7AA 3ZW8A 3NUGA 3BMQA 2VHWA 3PGJA 1PJ2A 3DZGA 4P4GA 4UVEA 4BKQA 5KVVA 5T64A 4BMSA 2I67A 4FS3A 3ZHXA 5A4DA 4CUJA 2I65A 3G49A 4FN4A 3PPIA 3DR3A 3DZHA 3LZ6A 1DOHA 1Y8RA 3DHEA 4G81A 1AN9A 2WYVA 4Q3AA 4R1UA 3I83A 4EEZA 1M6WA 1PJ3A 2AQHA 2PH5A 2Y93A 4ALLA 4CQLB 1YL7A 4FC7A 2VYND 4RVFA 4B4WA 1CQJA 3PGXA 4NIMA 5AXBA 3A9WA 3QVOA 4UEJA 1N1EA 3C7AA 5TX7A 4PLWA 4UREA 4BO6A 5C7LO 3DTYA 5TIIA 4UVIA 1EK5A 3TF5A 3GN2A 2AW5A 3H8VA 3PQFA 2E6UX 2CDBA 3BTOA 3JD2A 1JVSA 3KRTA 2Q2VA 3OH8A 4L4XA 4NDNE 1RYDA 3UF0A 4CMCA 1B16A 1BSVA 1WLYA 4XJTA 2IZ0A 2DQ4A 4Q39A 2DU8A 1T26A 5IN4A 4ALMA 1U28A 4CMEC 1WMAA 1LQUA 3O4RA 1YL5A 1YKFA 1HE3A 3FNEA 1Q0LA 1LDMA 3DZBA 2V6FA 3OSUA 4A7PA 1E3JA 4GX2A 2AQ8A 2EV9A 1PS0A 1I2ZA 1NBOA 4OAQA 3I6IA 2NU6A 1YO6A 3QV1A 4W7HA 3WIEA 2WD7B 1TT5A 2VUUA 1R37A 1GZ3A 3JD3A 4KTTE 4K26A 3CMMA 2CUKA 4BMVA 1X0XA 4XIJA 2JCVA 4U6QA 2VRCD 4RPHA 5LCXA 5LDHA 4HADA 3DHNA 2AQIA 3WNQA 1U8FO 2PV7A 5FI3A 5U1PA 3GQVA 1GUFA 2CMDA 2P9CA 4J4TA 1VLLA 5TRTA 2QW8A 3QLJA 4YYZA 2WE7A 4XYLA 2YYYA 1YBMA 1NPTO 4Z6KA 1XKQA 4E5KA 3ZHZA 2VTEA 1EUCA 4I9UA 3KLPX 4UUPA 5KVQA 4BNJA 2OGUA 3MTGA 2H63A 4K9DA 3RROA 3E03A 3C85A 3DBVO 5JO0A 2SCUA 1HKUA 4MP8A 3B1FA 2PLAA 4FFMA 2FPIA 1DC6A 2EP5A 5JSFA 2GUGA 1JWAB 1HYHA 1R0SA 1YQGA 1V3TA 3A06A 3OIFA 1MXHA 2CNBA 4L74A 5AQ1A 5TJ9A 1ZSNA 4L4SA 2AG5A 3GAFA 1B8PA 5JAIA 3JQBA 5I9LA 3DZKA 5JDCA 1BVUA 3BTSA 4CM4A 1AXEA 1YB4A 1PL8A 2G0TA 3ROKA 1E7SA 4WCFC 5G0SA 1XU9A 2GF2A 4H7PA 1F14A 4XA8A 4E4YA 4XYGA 1CEQA 5IDXA 4B3HA 3NDJA 1DIHA 3ON5A 5COQA 3ANLA 3WGYA 1QYWA 3CPSA 3C8MA 3OJOA 5JAMA 3D7LA 3RUIA 3KHUA 3GFGA 1JA9A 1IUKA 3TPCA 3WXBA 4KUEA 1YOVB 5ES3A 2DBVO 3NRCA 1EBUA 1FDUA 4OKIA 1AE1A 1IYZA 5EIOA 3QY9A 4M54A
chains in the Genus database with same CATH superfamily
4AFNA 3PNOA 3RS8A 2NO0A 4NOJA 3AETB 4BLUA 2OP0A 1Z17A 2BEWA 1V16B 1ACLA 4N7RA 2QZ4A 3V1YA 1KOGA 2D13A 2VUIB 4XJXA 1W85B 3B89A 1CR4A 3KKKA 4HDNA 1CQIA 4KJXA 1YXMA 3A31A 1B42A 3ODGA 1G3IA 5H81A 1ISPA 2KLBA 2W7TA 2W2KA 4Y2HA 1HM5A 3C15C 4JI6B 3BFPA 2MSNA 4M1SA 4S1PA 4XZ3A 4EEKA 1CRPA 3HFJA 3LBNA 3W1VA 3DKVA 2PWBA 4O8ZA 3AKZA 3JALB 1N5LA 1BU8A 1YQEA 1YNSA 3BIWA 4MMZB 4CQMB 5GVSA 3MN1A 4RJIA 4HXYA 3IQIX 5IVPA 1JECA 1MJFA 5HQ3A 1WB5A 5AM2A 1UBJS 5TEVA 2I3DA 5COBA 4DA8A 5BYAA 1Y81A 2GASA 5JRJA 3EXEA 3NBAA 5FFMA 3UAGA 2WICA 4P35A 3AVXA 3ABZA 4F6RB 4Z2AA 3NBZC 2O5RA 2FQYA 2XQVA 1XZ8A 2UUPA 1CV2A 1OFVA 1CK4A 2J08A 2JFVA 3OO1A 4G5QA 4CKBB 3H9EO 5CFZA 1GNRA 3IT3A 1QQBA 4IBOA 1KAGA 1TZMA 4G01B 1GL7A 2F9MA 4R84A 2OHVA 1NN1A 3O91A 5I9NA 4J7UA 1ISGA 4DABA 3RC8A 3UV7A 4U6SA 3TDKA 4FFSA 3MCWA 2I4RA 1Y5IA 1GEEA 1T5SA 3GHYA 2OD9A 4Q1EA 3HDVA 3WRXC 1Y1KE 3ZHSA 4QJBA 3CEMA 3G5LA 3T1TA 2CHFA 4J49A 4R6WA 1NXPA 4FFDA 5KI6A 1B6SA 3BILA 2J6HA 3HVUA 3M83A 3QEAZ 5CLHA 4AJOA 4BFZA 4HNGA 1R8JA 3I6BA 4MPDA 5B53A 4N0EA 4BLQA 1C9JA 3DGEC 1QVVA 4KN8A 3OJEA 4QYIB 4ZJYA 5IUNC 2XXAB 3EEFA 4I4CA 1I3OA 3MELA 3X1YA 5DASA 3N0XA 3NNDA 2PT5A 2PUAA 1ZJ6A 1WULS 4OHVA 1VM6A 1ZOPA 5CXQA 3FHCB 5SZIA 3MMNA 4D8VA 5JCZA 1EFPA 4KQIA 4E46A 2Q50A 4LC0A 5FTKA 4AU1A 3GLGA 2AD5A 4BNWA 2PGLA 5F7XA 1NW4A 1SO8A 3ZWNA 3PRKE 3ZVNA 3PEUA 4RLSA 1C3LA 3CLTD 2P3OA 3GJ8A 3IEVA 1KP2A 3DE1X 3O8DA 4WLVA 1R0LA 1N8KA 3M6FA 3MUFA 2OO5A 3TQOA 6LDHA 2VO1A 1Z4PX 1Z6XA 1H1TA 1WJGA 1JHOA 1FUEA 4DEYA 3FDIA 4B3MB 3ZKWB 3K5HA 1KORA 1FPMA 3BB1A 1UF9A 2WT8A 1MW9X 5AK4A 5LQKA 5EUCA 6ABPA 4LDJA 2UZ0A 3D1JA 3HHEA 5TLSA 2ZJYA 5IT9A 3KT0A 4DV4B 3H99A 4CCSA 3HBNA 3V9PA 4AXBA 2R8BA 5LOVF 4OFWA 3N53A 2Y9PB 4YB8A 1EFVA 1YDEA 4AYWA 2DWUA 4KYTA 5CJPA 5DWDA 2ONJA 3WO0A 1SFRA 3UA4A 2FZKA 1SXQA 3GJXC 2YL2A 4GZ5A 4X1IB 5D6NA 3RHZA 3OD1A 1XLUA 3UYKA 3UN1A 2MMCA 4N12A 5BNFA 3UB3A 4JBLA 2CLEB 3ZOKA 4OFXA 4MVJM 3QMVA 1FCJA 2FK8A 5H3CA 4JHXA 1HDXA 1T5HX 3MQ2A 1VE9A 4W5WA 4WZBB 4WBXC 5LZ7A 4URZR 8ATCA 1TU3A 3IBCA 3ZWVA 1H2BA 5GTDA 3HC7A 3PTZA 2P4HX 2PKRA 4FJ0A 2ECPA 2AMFA 4GMFA 4R69A 5ICFA 4LXHA 1UT8A 1JXQA 2I2WA 2FZLA 3H5RA 3VR4D 3O8BA 1Y8RB 4KHZA 1L1RA 1M2OB 1VPDA 3QUQA 3U17A 4FLMA 5KQRA 3K94A 3W8NA 1KRHA 3UW1A 1GG8A 2C00A 2K87A 5TC4A 4I3GA 4GP9A 1G55A 3V33A 4PO1A 2O7QA 5DRTA 2XYPA 3FB4A 4FGJA 3K9CA 2B4RO 1CQJB 4O4LB 1ODCA 2B3TA 3D0QA 4AAYA 4PG6A 2XMSA 2GBCA 3D59A 3DONA 4G0ZA 1WV0A 2IPXA 3ANSA 5DHQA 1DLJA 4UNQA 1FJHA 4AL4A 5HSGA 3ZNQA 2PNJA 1HWYA 4PSUA 5J5VA 2BBOA 3M3HA 3OOEA 4ZVOA 3UK0A 5ADVA 1QV7A 4H6WA 1ONBA 1XVUA 2XUQA 3H84A 5DBOA 4AMYA 5HYVA 2OMEA 2GCGA 4BY9E 2LKCA 1HFJA 1RLTA 2QL6A 4NATA 3B1VA 3D3WA 1P7CA 4DR1B 1DO2A 1WNTA 1ML3A 1HOXA 3B7GA 2GNAA 1REQA 3TSYA 1ZC4A 1SBZA 2ZIWB 3I05A 4GC5A 5E7JA 4CQJA 3BIOA 4UJ5A 1USKA 4G0QA 3OIDA 3PCXA 1PD1A 2IY9A 2G6TA 2VS1A 5DI3A 5AW2A 3R9WA 1V7QA 3OOWA 4F1WA 4B09A 4G4SO 4GM4A 3PT9A 4FBMA 1ZW1A 1JKJA 1KO8A 2WKWA 4NHEA 3GGCA 5FBLB 1NBIA 3AUAA 2QE6A 2WQ6A 2BCGY 2B4AA 1LDGA 4MJ3A 5B64A 2O19A 4MV0A 5CBPB 2PGDA 2Q3JA 2QJWA 3EFOB 1RRGA 3B12A 3KKLA 4Q6WA 3SNHA 1X2EA 4ZIRB 2FQXA 3OG9A 5BSRA 4F9GA 5B6IA 1WP4A 2ROQA 5DT2A 4RX1A 4C4TA 4BJ5A 1UANA 4FFLA 4EKDA 4IDAA 3VI3B 4KRFA 3AERA 4XUGB 9ATCA 1G6Q1 4G1BA 2JAXA 4URHA 5I4IA 1Q91A 4RVGA 1ST3A 4HN2A 1KJ9A 3B20A 3VTKA 2FWPA 1HY3A 4CODB 4CDRA 5H8WA 4MP6A 1GQRA 1UADA 3QNMA 3NUQA 4NQRA 5B2ZA 4MS3A 5B57C 1GV1A 1ZU4A 2A67A 3K0EA 4US2R 5IANA 4YAWA 2OGTA 4D3YA 1A5BB 2MOKA 5JAQA 5JFGA 5LQUA 3A6PC 3HR4A 1MABA 3UJ3X 4UOZA 1NVTA 3U09A 4LY0A 4PCUA 1W0JD 3T5CA 2GK3A 3GMTA 4BVEA 1L3IA 1YVDA 1SUWA 1G6KA 1TLLA 1UM9B 1DT5A 5IYZF 1LDBA 1XCOA 2CYCA 3FHOA 4KB5A 4RELA 4QAQA 4LXTA 1ZJWA 3FPBA 3D8UA 1VG9B 2NV6A 3WKEA 1SXPA 2H1RA 4BX8A 4GOMD 4PYNA 5A04A 4JI2B 2A5GA 3EQ9A 3TQTA 1N6KA 1TF2A 1UBTS 3QG1A 3T9FA 5U4QA 1ILWA 3MA0A 4KMRA 5AXDA 1E1CB 4IHQA 1DJPA 3MXTA 1G5IA 1XTIA 1HE8B 2ZYVX 3DOJA 3P9IA 3ZX5A 4G1FA 1AK1A 1Z35A 2J07A 4M1QA 1KOFA 4Q9HA 4HYQA 2AJDA 3BC1A 4KODA 1QQ5A 2JHGA 1QIMA 3L7OA 3BA1A 5BWNA 5BRAA 5BRJA 1ORTA 1XTZA 4AW9A 1Q95A 2QDKA 2AN9A 2QGNA 3BE8A 3K9WA 3N07A 4WZAB 3TR5A 3JQPA 2ODQA 5G53C 5B6PA 4PZZA 2PSEA 4BRWA 3MSXA 3CLUD 3NXKA 2MR5A 1OVMA 2VJMB 3R0JA 5EUQB 4F72A 5JATA 5IZCA 1QU3A 4BZPA 5I7HA 2Q4BA 3AVQA 2CLHB 5JS1A 4BN4A 1R4MA 2I7XA 2EHDA 3BE4A 3BMCA 4L5YA 4EF6A 1E6EA 1L5MA 3NOVA 4GNRA 1X1TA 3QFCA 3DD1A 3DUWA 2YVUA 2JLUA 3EGIA 3U26A 1ZBDA 2WE8A 4PRYA 5ALOA 4DDKA 4W8GA 3WMRA 4O1HA 4AMBA 1U2SA 2WJ6A 4H0FA 1YOBA 1ZMBA 1X8JA 3X1XA 3E7FA 2UDPA 2J3IA 3E23A 3KKZA 3NWOA 5NLLA 1YCFA 4UMVA 1CQIB 3EYAA 2IPLA 4UAUA 1QCZA 4RWZA 4M88A 4EYGA 5AESA 5JYEA 1DBSA 4JWTA 3TG8A 1C9DB 2NV2B 5C1BA 5GAJA 4RZ3A 4OJYA 2W93A 4PR3A 4EPRA 4OHYA 4TV8A 4MW2A 2ANCA 4JI5B 3I04A 2W2KB 4JVLA 1CEXA 4F1KA 5JFOA 1ECBA 2PX4A 3QFRA 1FQWA 1P5HA 1H42A 2GBLA 5ED0A 3NMUF 4GOKA 4R5HA 3ZTTA 1K7SN 4RVFA 5FI1B 2I7DA 3SVZA 3P4YA 4P34A 4IHJF 3A2KA 1TKCA 1VB3A 2C5EA 2ZIFA 4C3UA 4BECA 1QRRA 1GTJ1 3GJYA 5HQ3B 2WZBA 3WK7A 2OO3A 4TROA 4GXNA 4LOHA 4B34A 4IEEA 1GLVA 1NYRA 1XN4A 3EXEB 2IUEA 3DC7A 2FFJA 3CV3A 3IE0A 4J1NA 2XMZA 4QQNA 2GF9A 4FHEA 1KJZA 4TTQA 4ENWA 1NMSA 2FYTA 3P9QA 1FP4A 3EEBA 4S1OA 1MC8A 3G2LA 3KE8A 4ESOA 4QO8A 3JRNA 5JAOA 5JC1A 4DIOA 5IWCA 4Q01A 2XVXA 2I54A 1DJQA 3H9GA 1XYYA 3RHSA 3VSBA 2W2MA 1ONSA 1K7CA 2ZKIA 3ICWA 3ZN2A 4OLBA 3FYUA 3OECA 5KWEA 1B3BA 4H60A 1YDMA 3ACBA 2QL7A 1T25A 3U6BA 2EFJA 2TMDA 1BFKA 1SKAA 1T0HB 3JASA 2EP7A 5REQA 4NBKA 2Q5JA 4GWLA 5EI5A 5A0VA 2ZK7A 1ORIA 2B21A 4QM6A 3NHPA 2W58A 1LGYA 5JBIA 4V0NA 5KOHB 2ZSFA 1YZLA 4M7OA 1AUQA 2VUTA 1Z0FA 1YH3A 2JCYA 3N0RA 4HWGA 1RBZA 4YHBA 1AVTA 4ARZA 1EFPB 3A6HA 4U5QA 3RG2A 3ZGYA 3KZNA 3ZV4A 3LCJA 3SOZA 2XRYA 1UJBA 3N8GA 4O4JF 2HLNA 3KT3A 2HRQA 2LE0A 3A0UA 2QPOA 1ND6A 2WIFA 5E6UA 5B55A 1MT3A 2BGMA 2I1LA 3UEOA 4Z3KA 4N76A 3IP8A 1E92A 2BF7A 4LWZA 2O3RA 3HDYA 2IHZA 1XVLA 1G8SA 4ATNA 2L2QA 1ZOIA 1AUXA 1S7GA 3BKXA 3EEYA 4FWIB 3RVDA 2ZB2A 4OU4A 1BEZA 5A9TA 3UPDA 1QZ3A 1C1YA 3H75A 3UPTA 2ZRQA 1TZJA 2H1CA 1E9RA 2RHRA 3D6FA 4GEKA 4AECA 4A3SA 3Q8LA 1PVOA 2HRDA 2A4MA 4O4HF 4G24A 1NI3A 1RDFA 3BRQA 3KOYA 3N76A 4UOEA 3HB4X 4GX1A 1EQAA 3VU9A 5JAPA 2CC2A 2GXSA 2JIZA 4IVQA 1ZD5A 4DLRA 3IAS1 3G3EA 3E82A 1UZLA 1PR6A 3ENZA 1F48A 4PAOA 1P33A 4JNCA 5AWFC 1QAQA 2BM8A 1O8BA 2KM1A 3CLHA 3DZJA 3EHDA 2DHQA 3RTGA 4IDQA 3EIHA 3RTDA 3LMKA 3WOHA 4YRKA 1KVRA 1IBCA 1KMQA 4ARCA 1Z8NA 4IWYA 2I6XA 2ZB7A 3JZAA 4C0JA 4YX9A 1WEKA 4QLAA 4M0CA 2P8JA 5BSHA 4PC2A 2PMEA 5A9SA 4M37A 4HNSA 4N5IX 4RENA 2GZ1A 3O1IC 1JIVA 4MITA 1JEAA 4R1TA 4RLHA 4AB1A 3FAZA 2BBWA 4GLOA 5B5SA 4Q1VA 4MRSA 1VIVA 3M1YA 3VISA 1II8A 4CFSA 4PAGA 5ALYA 1T2UA 4XUCA 2VTKA 5CVDA 3R5SA 2VYNA 3IP1A 1JH9A 5HBRA 3Q85A 1CE8A 1XCMA 3IUSA 3G68A 3R24A 3GXOA 1PK9A 3JQ7B 1A4RA 1BN6A 3B3QA 5A6SA 5DBGA 1RCTE 3R3ZA 1FYWA 1N92A 4OGKA 3HUFA 4QATA 2A0KA 2HREA 5D5HA 3K0CC 1E3MA 1PHPA 2DKFA 3RYCA 1ZD1A 4J0CA 1JQ5A 3H19A 1Y48E 2C4MA 5L4LA 1Y3AA 3HYRA 2DP4E 4Y18A 4Y6SA 5E2IA 1M7HA 5CG2A 2JC3A 3WKCA 1ABFA 1B8UA 2EKDA 2M6RA 2QMOA 1WSDA 1OU0A 2C9BA 1AGYA 1PUXA 1TM5E 2P8SA 3N87A 1D2NA 1Q7RA 4XSGA 1PR5A 3UKDA 1QK4A 3D3WB 3DLPX 1J8QA 3HZOA 4KFTA 4WZ6A 1REQB 5H59A 4ZQEA 4U5XA 1J99A 3IBTA 5EP4A 2WSMA 4DWOA 2V7TA 2C83A 5C8ZA 2ZUCA 2C7PA 2AVDA 5DI3B 3MCAA 3O8CA 4L4UA 3JAWA 2GBGA 2IY7A 5BY2A 3T1VA 4IUBS 2XGJA 1IWBB 4PNHA 2C4UA 1PLLA 2NV0A 1JKJB 2O14A 1H9AA 1TO6A 2C2BA 1RNLA 2CLCX 2DLDA 1LS1A 2PS0A 4AVYA 1R0YA 3LP5A 2H07A 3HCRA 4YJFA 1XTPA 4GW3A 5K3OA 3GRYA 3NORA 5ALHA 3UMCA 2BHRA 4BLPA 5C0OE 1EESA 2C9ZA 3B6ZA 1EK2A 2G36A 2VRCA 2YWEA 4U9IS 3W4KA 4FHDA 2C7VA 1RVDA 1BKDR 1O5IA 1T9AA 2EXXA 3FNHA 2W37A 4B35A 4LMRA 1I2DA 2PO5A 3AEZA 1Y8ZA 2F64A 2XUFA 3JQ8A 2JATA 4M1EA 1AURA 1O87A 3AERB 1MMFB 1YWGO 3S1SA 3HV0A 5F1YA 1BVHA 3Q7TA 1NBMD 2W8BA 3DPIA 3THRA 4J3NA 5HOEA 1QYRA 1WUHS 4HQLA 3PNQA 5FJIA 4X90A 4B80A 2XDAA 2JF0A 3DE0X 4ND1A 3E1KA 1G7TA 4CLRB 1CIPA 2UAGA 3FFAA 1OBOA 3HZZA 4MS3B 2OCGA 2QZSA 2I99A 4JBYA 5CLLA 4FMCB 1FBNA 3LIIA 1MABB 1GGNA 4QFBA 5F4ZA 2J3DA 1JTEA 3N9IA 3TQCA 4KQ2A 2QW1A 2R8XA 2GBFA 4N18A 1BD4A 3EZYA 1MX1A 1JI0A 4OXIA 3FFTA 2DB3A 3PC7A 4ZKDA 3O8QA 4C76A 1TW3A 2OCIA 3CRNA 2JAWA 3V4VB 3TPFA 3W2TA 1HLFA 2QY6A 1ZGJA 2VEOA 3TZKA 3ZWXA 4B4UA 5TMPA 4ZAFA 1OH8A 5BSTA 4FFNA 4LYJA 2ZDGA 3ZJYA 1F8GA 5AJZA 4ENVA 3AY0A 1Z28A 1KI6B 4IVRA 1RAHA 2W11A 4PAWA 3C1AA 5DT9A 4ZHSA 3SSOA 3HM9A 1FMJA 1XTVA 3QLTA 4ZVRA 3O2SB 4QPNA 4C1BA 2WF7A 3ZH9B 5C35A 1SQ0A 5FPSA 3RKUA 4WASA 5IH7A 4M8LA 1Q17A 4M9QA 4R0VA 1LF0A 5DWVA 5JVDB 4Z1OA 4QOFA 4ZI5A 4DM4A 3HY6A 3T9BA 2NQTA 3L7MA 5G1NA 3QKIA 1XU4A 4NFSA 1G8MA 2MYUA 4L8GA 2ZWPA 2Q9AA 2VHZA 1J6UA 3ZIAA 1R4MB 1YZGA 2IU3A 1WCWA 2JGJA 3ORFA 4ND7A 4OREX 1RZRD 4RHEA 5KVSA 1ENZA 3DTVB 4QWWA 5CRIA 5CD1A 1IHXA 5EL0A 5F52A 1GQ2A 3GGGA 1VLHA 2CNWA 2QJOA 4OF4A 5JWHA 4O8CA 1H93A 4RAQA 4U9HS 3I6ZA 2BKUA 2YWFA 3E9ZA 4FS8A 3FJ1A 1GG9A 2KLHA 3ENKA 3TLZA 4ZK2A 1QIFA 3TKAA 3ONFA 2HDOA 4YH1A 1R88A 2WC1A 2ZTHA 3UWOA 3K31A 3MLEA 2SBTA 5EPEA 2HCTA 2DULA 2C2WA 4JUFA 1GLGA 2JKYA 4XWTA 1USWA 4KNYA 2O7SA 3CR8A 1V8BA 2XLBA 5ITWA 2RD2A 3QEBZ 2WUFA 3OQPA 5JQGA 2VT2A 3RKRA 3VI4B 5DGIA 1UXGA 4LJ5A 1GWNA 4K9MA 4NCBA 1N2EA 1C9NA 1WXFA 1HL3A 3OPNA 1U6IA 1U0EA 3OOJA 2H92A 3KZOA 1EGHA 3L43A 4TZ0A 4UVHA 3W8DA 3GLFE 1KKUA 2XQIA 3NDRA 1CBUA 3KB2A 2OMKA 1XZIA 3LUCA 1ZMTA 3R3SA 4HQ6A 4LSGA 4FWBA 3QVWA 4BFYA 3V32A 3KLMX 2ACKA 1LCIA 2CDCA 2XGMA 3WMGA 2HLDA 3WZMA 3BUSA 4BHTA 3OETA 1TO1E 3HUDA 3MPUA 2WWYA 2JG3A 5LXTF 3JPWA 1PBTA 1Y3CE 3OFSA 1Z4MA 2A5YB 2FEWB 2Q6KA 3GEEA 3PSAA 4NC9A 1UZMA 1ZZEA 2UYQA 2XB8A 3H5TA 3OZAA 7YASA 3ONNA 2QQEA 2WUDA 5KC9A 3HA3A 1GP2A 4S12A 3VSCA 1HQKA 1FP4B 1MIHA 1NXXA 3FBGA 3HE3A 3NANA 5DLQC 1FK8A 1L5WA 1RSZA 2QQGA 2VHQA 4YI5A 4LSZA 3RV3A 4ANFA 4KDEA 4ROSA 4F2PA 1N77A 1C0KA 1UM8A 2ZBGA 2Y0DA 4Z0TA 1WDTA 5F98A 1GUYA 1Y9EA 2G06A 3FCSB 2IU0A 2H7YA 5A6VA 1SVKA 1KI2A 2CMGA 2B34A 3FYUB 4HLCA 2WG0A 3IT1A 4MV9A 2H2FA 4F21A 4OQMA 1IQ0A 1XNGA 1I01A 1QO7A 3OM1A 2JGIA 2UYCA 4L4YA 3O21A 3WYEA 1J0CA 3OTGA 4KIUA 4LZJA 3T5MA 4IFBA 4MUGA 1L8QA 1NJ6A 5BNIA 1I7SB 2EW8A 1OIVA 5CEJA 1NQXA 3I30X 1GSOA 1SVMA 4XGQA 5D5QA 1GFSA 2PVPA 3UJAA 2GESA 4L0MA 3T1YB 1IN1A 4D3SA 5K5EA 1L4FA 2Q27A 1XXHB 5DK4A 5GGXA 1XZEA 3UM9A 4OQLA 3DUFA 1C9KA 2RAUA 3PVSA 2BI7A 1MC4A 1T3TA 3IUJA 3U4AA 4BNIA 3BMXA 1EH5A 2DR3A 3LDUA 1W5AA 4PTYA 4WGFA 4LEIA 3UMJA 1XTSA 2N3ZA 4ARZB 1W6UA 3PKZA 4NMMA 4BC0A 3ERCA 4ZGGA 3O9MA 2HWUA 3AZPA 3ORHA 2VYVA 4YRRA 1SHLA 3VHXA 2H5IA 3AR7A 3GIDA 1G0NA 3JR7A 4EF4A 3OEWA 4NZPA 3EDRA 4C9BA 4ER5A 5M7EA 1UMBA 1KGSA 2JDID 1H2WA 2OM2A 3IHLA 1YR3A 3BWBA 4LZNA 3M4ZA 4BWVA 1TQDA 1PT7A 1NNEA 5ALXA 5K1ZA 2PBRA 3UMMA 1R6VA 2DX7A 4G1EB 1ZI9A 5K51A 3VC1A 1DMRA 2YFQA 4WFKA 1Y7PA 2H3HA 4BNXA 1NVVQ 1YBHA 1T0PA 3NOXA 4JC8A 1SEVA 4OAOA 1FUIA 5JJLA 2GS9A 3KSZO 4PTLA 2MDTA 3DHVA 3I1IA 5IKXA 1KQ3A 1W96A 3IMCA 1EP1B 3NJRA 5KYVA 3VNRA 4B3BA 4D8TA 3ZK7A 3VU9B 4DUGA 4EIWA 3ZNNA 4BKOA 1XUOA 3Q2KA 4QASA 3OM9A 4PSCA 1TJ4A 3M6UA 1QPGA 2Z4SA 1PJTA 3E7PA 3TSCA 3V4LA 5C32A 1GTRA 1LBEA 1A4XA 3CVYA 2FE1A 3ZE8A 4AJJA 4HQOA 1MUUA 4KAFA 2FDRA 4PFJA 3VV2A 3TGPA 1U0HC 5JAUA 2NYVA 4N0PA 1A5ZA 2SNIE 3R3YA 3CO5A 2PHZA 3HYSA 1ISSA 1LTKA 4NFHA 2GZMA 3NBKA 3U19A 1S2LA 3K5IA 4MVJG 3I53A 4YUYA 4ME6A 1VJDA 5DM1A 3WL6A 4JKYA 3T5DA 3OTQA 4FYMA 4S1WA 3QKWA 1RAFA 3M3DA 1O5OA 2GBIA 1J4AA 1W76A 4MMYB 1QLHA 4RDCA 4UXHA 3HJTA 4G0NA 1Y4SA 4Q34A 3QA9A 3OPYA 3A6DA 4WWHA 1II8B 5IG2A 4O4HA 1DUSA 1JG1A 3OQBA 4ZAGA 4ZVQA 1TDJA 4OHOA 3ZCPA 1L7XA 1P1HA 2XTJA 1CE8B 4IXDA 3UMYA 5JS8A 3H3XA 5IEJA 2XB4A 4BAUA 1PS8A 3O2JA 2XT9A 3V6MA 1SPBS 1A50B 2I76A 2OESA 3A1EA 3H9JA 1N1GA 4N0MA 5J5CA 1CYEA 1ZM9A 2MSKA 1SQ5A 3AYXB 3LT4A 4QTXA 4PNPA 3U1TA 3ICOA 1GEGA 1DDIA 2AJTA 3R7WA 2VLBA 2CFRA 3HY4A 4FZRA 3U81A 5C5DA 1RM4A 4M89A 2C5SA 4KUHA 5KQGA 4EUEA 3GZ4A 3W3AA 1I33A 2W2LA 4ICIA 4MRRA 5L7TA 1N2ZA 2FE4A 5HHTA 3ZJ5A 3JTMA 3R1IA 4R0NA 3T41A 4HGYA 3WL4A 3DQQA 4KXXA 3WL3A 1M7GA 1ZO8A 1SWVA 3U4DA 1MAUA 2PR2A 1JR2A 2Z58A 3D6AA 3LVBA 4TKZA 1AS2A 3U1VA 3JAWB 4WJZA 4ALNA 1DL5A 1RMYA 3PQ6A 3WJ2A 4H17A 4P4NA 5LQDA 3GMSA 3MT7A 5JZMA 1X3SA 2V7GA 1FW6A 1P75A 2LDBA 2YWGA 3FAKA 1ZD4A 1G16A 3STTA 5LLSA 4AJPA 2VT6A 3K1JA 5FBQB 1JAYA 4D45A 5HFJA 1OXTA 1H9CA 3BWMA 3ZH2A 1DKUA 3L1VA 2ATIA 2JFZA 3EBLA 1KK2A 2C54A 3F71A 3GH1A 4MJ7A 4YRMA 4UAGA 1EM8A 1QE0A 4C14A 2QMYA 1QO0A 1Z0SA 1AKMA 1QWOA 5G3ZA 3R7DA 1ECGA 5THQA 4H9GA 3DLBA 2HJ9A 3UAOA 3PZBA 4MA5A 3QXXA 1D1QA 3RH0A 2BONA 4OM8A 4K9PA 3V55A 2W8BB 2NSDA 3YASA 3EODA 2HX1A 3ZY5A 2FDCA 3NS7A 1WHTA 3HCDA 6Q21A 4QD3A 2JK1A 2XYVA 2OSVA 3EBPA 4P3KA 5DTJA 1E5VA 2AQKA 1QNLA 2IP1A 3BXHA 2JFOA 5JZSA 5FUXA 3ZHOA 1GNVA 1U8XX 1AH2A 2GWHA 1LI7A 1ISMA 1KFCB 5BUCA 1M7BA 3EDCA 3SEQA 5KJFA 3S44A 1CRLA 4OB6A 2BMFA 5AH0A 1PFWA 2IYAA 5C7YA 2G08A 1P2FA 3O8QB 4FDAA 4JLDA 5DGHA 3NRBA 2JLWA 3TB6A 3LWDA 3P19A 1L5HA 4RIGA 3TTXA 3V42A 3ZJVA 3QW4B 4KPEC 1RWKA 1WP9A 2FFHA 1L5OA 4Y0VA 2CXHA 2MMGA 1FNCA 4ZODA 3STYA 1JHQA 2ACVA 2H2IA 1QX4A 4MHOA 1QH8A 2F48A 5FTWA 1E2MA 2IYOA 3TOCA 2HQBA 2A8YA 3QX9A 4YJGA 3DJFA 2JFFA 2IUSA 1FYDA 3TL6A 1KRXA 5HF5A 3ESBA 5ALVA 2XT6A 3PQ7A 3LZDA 3OWOA 4MQ5A 3W5CA 2E4WA 1IBSA 3I8SA 3QVTA 3GEGA 4RL6A 2BR3A 2H52A 4B31A 4DKXA 1U11A 4BLOA 2H8GA 1VCOA 1KE1A 5FTNA 2X8BA 3NGLA 1AQUA 1V11A 3GMDA 1D6SA 1XD9A 2VSQA 4OSPA 3Q6MA 4J4BA 1EK0A 2WDZA 3A3YA 1KBQA 4PGFA 4CMEA 1ZOOA 2FQ1A 3UMFA 1VFPA 3RS0A 1W35A 2PX2A 2GPJA 4AT1A 1BTOA 2R1UA 3GGSA 1JFSA 1WR8A 4WVLA 1G38A 4NXMB 3MJ4A 5IJZA 1KQGA 2QJFA 4FW9A 1P72A 2QLJA 1I5OA 3UC5A 1YUBA 2YIDA 4IM7A 3WP1B 3WYAA 1UXHA 2BGJA 1KZ6A 2DFPA 2V3VA 4DUZB 1XJQA 1D6MA 4PYIA 3PX7A 1QKIA 5FR2A 5FPYA 3R41A 1UAYA 3HA2A 2W71A 1EEXB 3JARA 1AMNA 4U6NA 2ZVDA 4NFYA 2ZAYA 4HLUC 3GFOA 4V0KA 4D43A 1OT5A 4MI6A 3ABIA 2VTBA 5JQGB 4NYMQ 4DR6B 3TWOA 1XEWX 1G19A 1WD5A 2VEDA 4UNRA 4MIEA 2FW1A 4IJ6A 1OXUA 4L22A 4OL0A 5D3KA 3GX1A 5GV7A 4DM3A 2HJWA 5CFQA 2R751 2NZ8A 3BGWA 4BWFB 1K06A 4CKXA 4DN6A 5IJ0A 4WI1A 3GWGA 3OIUA 1Z9BA 1GLNA 3DZDA 4AMGA 4HGZA 4I4TF 1HT0A 2H2DA 2Z9DA 4EAQA 1FP6A 1NTOA 3L7NA 1CQZA 4OHCA 2GAFA 5DDIP 2QLLA 4RKWA 2ZSUA 1GZUA 1MHPA 3TQRA 3RLIA 4E0BA 2H1LA 3LGXA 4GU5A 1XNQB 4BVKA 1BDBA 3GZTB 3I1YA 2PFKA 5JPCA 4OXXA 4Z3DA 3ZZTA 3LC7O 4AS3A 2ACEA 3C4QA 1QYDA 2J9GA 3E3MA 2QTBA 1RYNA 1TIPA 1Y4ZA 2I6TA 1PBNA 2PD3A 1XDSA 4IWXA 5BV8A 4AZSA 5FRDA 3CRQA 4RKRA 4PE5B 4BZXA 4NOMA 4H7IA 4JFRA 4X3OA 4XWKA 4E2WA 2CYBA 3U7JA 2A1TR 2AYXA 1ZM2A 3AC0A 3LOUA 1NVFA 4BNHA 1YZQA 1TK3A 4IIHA 2FGKA 3F6YA 2ZRAA 3P32A 1T1SA 1V3UA 2JA2A 5DGXA 4IHAA 1R12A 5G02A 2G5PA 5T6BA 3WK5A 1OHHD 1TVKA 1KQFA 1HYGA 3ET4A 3QWAA 3SC6A 4EY6A 1UOQA 3VZRA 4P22A 1LW6E 4BO2A 1ZNYA 2POQX 1YRLA 4P7GA 3ZX4A 1T4GA 4B3JA 1KRWA 2AOXA 3A6EA 3LW8A 3AMVA 1KFEB 2X0KA 4JLOA 2F4NA 2OKGA 2NP7A 4GMHA 2C8LA 4QJ5A 1FA9A 4JUCA 2G5CA 2O5VA 4RPGA 2H4FA 2XX3A 5IX8A 3QM1A 2F1JA 4NPCA 1PN3A 1OKKD 1SOAA 1S1MA 3BJIC 4CKYA 4Q7KA 5FB3A 5TMDA 1GPLA 6GPBA 2FPKA 3TOZA 2WYWA 2JHFA 4MYCA 1XNRB 3P9YA 4NYIR 2UZ1A 4JT9A 3LM8A 3WGGA 1MB9A 4D9NA 4YXWA 3K30A 2CVHA 1DEXA 3E7WA 3K9GA 2AYYA 3HYNA 3P26A 2QRGA 1HE5A 3JD4A 1EI9A 3BH7A 5HIJA 1PV4A 1UMBB 2G8NA 4CJXA 4CV2A 3K92A 3ZCRA 3AESB 4L9WA 4Y6GB 1HOTA 2QTZA 4NI5A 4EJ0A 2WNHA 3CH4B 1ZNXA 3DTVD 2C7RA 2FV8A 1QCCA 4I0WB 2ONZA 4BRSA 1FSSA 4H31A 1CR1A 4OHZA 1E1QA 3U5TA 2EWWA 1FRFS 3E3OA 3JVVA 2W48A 3VHLB 1X9GA 3LA6A 5F12A 1TUBA 4IIGA 4QIHA 4TXJA 3L7CA 3N6VA 1NNSA 5B7PA 1ZY2A 3NEJA 2Y4NA 1OFIA 1CFJA 3OMLA 2CCJA 4YCAA 3CZ5A 1YZNA 3UAYA 4IZHA 4TV9A 5K03A 1JHXA 3QU9A 1YZYA 2J3EA 1CNMA 3ESQA 1Z5WA 4FFBA 3N2NA 2DG2A 2FSUA 4MO2A 4L51A 5LWQA 3A58B 5K0FA 1I7NA 1N6IA 2IUYA 2XBUA 3JYOA 4LWOA 4RIFA 2P0AA 5F5NA 2HV9A 1KOLA 3SIXA 2O3TA 2VDQB 5F23A 1RXWA 4B6EA 1HNZB 1MBZA 3AR6A 3UA3A 2X40A 1MJGM 3PFFA 1W0CA 2AG8A 1DKOA 1SCDA 1T1EA 3PLAE 3G2OA 1UBCA 2KB0A 1K9VF 3BXOA 3IP3A 2RGXA 3ZGNA 4M98A 4I99A 5LMZA 2GAIA 3NHBA 3DXZA 2H16A 3NTXA 2J3HA 4H7HA 4RS4A 4YTEA 1KZHA 4D8YA 3WL7A 2ZANA 3M6LA 3WIVA 1QHNA 1ZRNA 1BJTA 1ZN7A 2ZI9A 1O8CA 5GQSA 3RS7A 3IVXA 4WZBE 2ZW9A 2VK4A 1SY7A 1O95D 1YJ5A 4IIYA 1EA7A 2I3AA 4J6FA 3ZVRA 4Q82A 4CIAA 4YMSA 5FV4A 2IDMA 2EG5A 5BNZA 1JX6A 2TRSB 1ESEA 2AOTA 3FE2A 2JI6A 2RJOA 2XOKA 4FINA 4ZVTA 2QKYA 1COWD 3FN4A 1OWNA 2B69A 4KXFB 2ST1A 4IJKA 1CJCA 4R7ZA 1CUWA 4KQHA 1EZ4A 4C0AC 3SEFA 5HJ5A 1H2YA 2VIIA 2CXTA 2FSSA 1K9SA 2GK7A 3QJ5A 2AS0A 4TX1A 1TW2A 3NDPA 3SLRA 3T3EA 4N48A 3PX2A 1LY1A 2W2XA 3L18A 2VRBA 2W0MA 3RAPR 4FWTA 3DMGA 4LF6B 3KQVA 1EX1A 4N39A 3HLTA 3SPXA 3U7RA 2C0CA 3LLCA 3VU8A 1ZLXA 4DE5A 3W6UA 1RHQA 2INGX 4HEJA 1OY1A 1WWKA 1Q2UA 4PC6A 4QDZA 3ZCXA 3UBTA 3MILA 2DPYA 1KGDA 3JR3A 2PSFA 1QPBA 3UCXA 2CL0X 3I0MA 5DB4A 2IV2X 2V96A 5CXSA 1I4LD 1LUAA 3JQGA 1U9CA 4A5SA 4JB3A 3QQPA 4ZJUA 1QGOA 3LVRE 1RAEA 3W8FA 3ESRA 1ID1A 4YK7A 3F9CA 4KEAA 4KFRA 4F7WA 4DREA 4L0DA 4MB0A 2DWOA 4YVFA 3TLXA 1UXOA 4O3MA 1E6CA 3RNOA 3DMFA 4BNTA 4LKRA 2FLKA 3MRVA 3HDTA 3SZGA 2QRPA 2IZOA 5IM4F 1KYYA 1U7ZA 1M67A 1ZZGA 1Q0UA 3I6YA 4L95C 1GPKA 4GEGA 3KJQA 1Y6FA 4LSWA 4C04A 2VHTA 2ONYA 5DNAA 2QRZA 2XB9A 1PP4A 2F7SA 4M7PA 3V48A 1O03A 1U1EA 1X2BA 3FWKA 4BFWA 1EM8B 2GM9A 3CFYA 1XPRA 3ESDA 3NR2A 4YRCA 2GEBA 3HDJA 3LJKA 4MW1A 3M33A 3CVXA 2FSPA 4WBNF 1P31A 2C5AA 5FEUA 2JD0A 3AEYA 4I3FA 2XUOA 5DTEA 3GA0A 1WHTB 1ZMOA 1KSFX 1DAOA 3WQHA 2C8KA 1XO1A 2H2HA 2YJZA 2BSAA 3O8NA 2Q5HA 3Q3JB 3DV0A 3E61A 4G1MB 3G2NA 4G37A 4RYLA 5FQNA 4DR4B 3GFVA 1DBPA 1H3NA 4K3UA 2J5QA 1ZK4A 3DVRX 1NDQA 5ER9A 4ES6A 1BW9A 3OP1A 3PICA 1XOIA 2EOAA 3H5VA 3LUKA 1NN0A 5B12A 1DXOA 2WP8J 4WH0A 2XZOA 5I9SA 1TI7A 4HTFA 4QYXA 1SJ9A 4B46A 4HEA1 1W4RA 1RQ2A 2AEEA 5HKAA 1X8KA 1YE3A 3TK1A 1L5HB 3R23A 4UTNA 4DZZA 1P3DA 5FA5A 1G66A 1SOUA 1LVUA 4LMAA 1GTSA 3NTOA 2B8WA 5KNLA 2NZVG 2HHCA 5KNDH 1B4DA 2C7QA 4YJGB 2IIQA 3EVTA 4ENUA 1JDVA 2O8EB 2FX5A 3FMFA 3JV7A 2QXUA 4LRYA 1S9HA 3IO5A 4OA5A 1C1HA 2OCAA 4UEOA 2Y77A 3E5HA 2EFGA 3EE6A 3IURA 3NEYA 5D7NA 2AXPA 1JEQA 1OFUX 4A2QA 1SWWA 3K2IA 1QG4A 3Q6NA 4CE6A 4YIKA 2G77B 2DETA 1A77A 1FFCA 4WACA 1V11B 3U4QA 1SBCA 5D00A 4ZDIA 5HOQA 4TN1A 5ER6A 4IZOA 3PGMA 4RJ2A 4DMCA 1D8AA 4RFSA 3E5RA 3PEFA 4R16A 5AKHA 1E2IA 4C2AA 1GL6A 4WZAE 3INTA 4QUHA 3DL2A 5D85A 4XJVA 5F35A 2I3BA 3N3AC 5KAMA 3RWOA 4BMYA 4JU9A 1RLOA 5TDHA 3W5JA 2ERCA 4LX8A 2FR0A 2B99A 2Y4OA 2YHIA 4HAUA 5CNKA 4ER6A 3EAGA 3CZCA 1L6RA 2O05A 5TF4A 1RM0A 1V26A 3WLRA 1NQOA 2FW6A 2H4JA 2R25B 3OPXA 3VFDA 1JBEA 4CT5A 4A1FA 2B0JA 2ATVA 2AA3A 3DDCA 1QCDA 4DC0A 3ZLVA 3INRA 1JE1A 2GRUA 3QYFA 4EJ6A 2FW8A 1ONNA 3MT8A 3A1FA 3OPYI 4LUCA 4WNYA 5EGSA 3FETA 2HPAA 4JYPA 4M0DA 1NULA 4CTNA 5FH9A 2WSIA 1XE3A 3DMYA 3L6OO 3W2EA 3GYGA 3SJAA 2IU4A 5H80A 4E1VA 1DQRA 2QRVB 2A88A 1JV2B 2R60A 1JN0A 1TCUA 2CL5A 4KPYA 3IXMA 4YMUA 5L3RA 3IJ5A 1NYLA 3CZRA 1GQSA 2DUNA 5BXQC 5IJ0B 5PNTA 4DNFA 1O9GA 1XJ5A 4RHTA 1C14A 1B93A 1RWBA 2D62A 3D7SA 1ID8A 1ISFA 4UHEA 4YP7A 3KUUA 2B1RA 3L0DA 3MAJA 4HEA6 3U3ZA 3WYBA 1GU0A 4FR5A 4HB3A 2VWQA 5BOSA 1LSUA 7AT1A 1HV8A 3JRXA 4LBWA 3GRCA 1IZYA 1UFRA 1H2ZA 1YIOA 221PA 4YACA 3UAVA 4WUTA 3ZD6A 4TVKA 3WIOA 2ZVJA 1NY5A 3JZFA 1XELA 3BCHA 5DZSA 4LC1A 1N6OA 1OBFO 4NK4A 4YUWA 1IXRC 5LIRA 3AJAA 2F1KA 3PUXA 3FMIA 3AQIA 5GJCA 4E07A 2FMIA 4L6IA 2I1VB 4NAVA 5M34A 2JLBA 3ESYA 2V58A 4L16A 4Q02A 1VXRA 2E89A 3SF0A 1CS4C 1EVKA 3ED1A 1LU9A 5JNTA 3AVWA 3EF0A 3BKWA 2GAOA 3PDIB 2NSHA 1E7M