4AJKA

Rat ldha in complex with n-(2-(methylamino)-1,3-benzothiazol-6-yl) acetamide
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
331
structure length
330
Chain Sequence
AALKDQLIVNLLKEQVPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLKTPKIVSSKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPQCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPQLGTDADKEQWKDVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCILGQNGISDVVKVTLTPDEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Design and Synthesis of Novel Lactate Dehydrogenase a Inhibitors by Fragment-Based Lead Generation
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase/inhibitor
molecule keywords L-LACTATE DEHYDROGENASE A CHAIN
total genus 115
structure length 330
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ajkA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4ajkA02
3K5PA 1OC2A 1SOVA 4J9VA 1XDWA 3V8BA 2A9FA 2AMFA 4GVXA 2GNAA 4OOEA 3ADOA 3IP3A 1KETA 1I0ZA 2GPTA 4I5FA 2Y99A 3KYDA 3OA2A 1ZK3A 1NQ5A 2C07A 3AUTA 4B3HA 4IDGA 3LSYA 4OXYA 3DZJA 3UCXA 4BOYA 4UREA 1U5CA 4MVJD 4WLFA 5EERA 1T4DA 4DTIA 5FYDA 3KLPX 5A1TA 1UH5A 4XIYA 2HQ1A 1ZJZA 4ZVVA 5DBFA 3ICPA 1GPJA 2WD7B 1DHRA 1ONPA 2PZKA 3C7DB 4CLRA 3F47A 3V1UA 3GNTA 3D4OA 1VPDA 5JAQA 4TROA 1N1EA 4PG6A 1YQGA 1LC0A 1XLTA 2VHZA 3IIEA 3PWSA 4FFRA 4FJ2A 4R68A 4EUFA 1CF2O 2EGGA 3OICA 4I8XA 1X13A 4BV9A 3L07A 3GPDG 3WSVA 5KVVA 4K6CA 3GN1A 1YJ8A 2WD7A 5F5NA 3EYWA 5U4QA 3L9XA 3ZV3A 1A7KA 3Q3CA 4NU5A 4XX0A 5EINA 3PLNA 2VYVD 2H9IA 4B3JA 1NR1A 3TWOA 3K8ZA 3QVXA 3LT2A 1ZSYA 4J1TA 4R1UA 4CMHA 2ZTVA 3INRA 1VL8A 2VOEA 4N5MA 2Y0EA 4QXMA 4MPDA 4CUJA 3S2FA 4YA6A 3LZ6A 1CRWG 2HMTA 5KTKA 2HMWA 3FHLA 3AUUA 2VTEA 3WB9A 4AJ1A 3RBXA 5JS6A 5JAZA 1U1IA 1EBUA 4ZA2A 1E92A 1PTJA 5FI5A 1SC6A 1I24A 3DHNA 2B36A 1Q0LA 3WTBA 3R0IA 1E1LA 2P9EA 3RFVA 4AICA 2EIHA 3S8MA 1PJLA 1R16A 1ULUA 2DTDA 3NTQA 1LQTA 2QZZA 2OBYA 1C1DB 4L75A 1M66A 3VVBA 1B16A 1PSDA 3R3SA 4FOSA 4ALNA 1XU9A 1DFIA 2DFDA 4J3FA 4LISA 4MJLA 1Y1PA 4MVJI 4O5OA 1E5LA 2PZJA 2HK7A 2BGMA 5CDTA 5L40A 4J0EA 1F17A 4MO2A 1LRJA 3BHJA 4B4UA 2VHXA 4R3WA 4YQZA 4XZ3A 2B37A 2EKQA 2IE0A 4BNZA 1HDXA 3KXDA 3EY4A 1HWYA 1QR6A 3GT0A 3ZNNA 1WDLA 2A35A 3C7AA 5CG1A 4CM6A 3GG9A 1GY8A 5JW6A 5AOVA 2OHXA 1DHTA 4LCJA 5JSFA 2F00A 5U1PA 4UVIA 3UFXA 3WGTA 1B0AA 2FR0A 1I3NA 3PRJA 4B7CA 3BMNB 2NU6A 3BYZA 2IZ0A 2YQ5A 3SJ7A 5GZ1A 4B3IA 4DQVA 3GRPA 3D3WA 1X1TA 3JCZA 1NHGA 4NHEA 2O48X 3KEOA 1GUYA 5IXSA 4IY1A 3LF2A 4OM8A 1TA4A 5COAA 3STHA 3RJ5A 1U8FO 1UXKA 2AA3A 1DC6A 3RU9A 3VPHA 1VJTA 4BO7A 1ENPA 3QE3A 3JYOA 5CPFA 4OXNA 3RFXA 2ZB4A 1H9AA 4YT4A 1PQWA 3BMCB 4OMUA 2VN8A 1HDYA 5DP1A 4YACA 3OP4A 2X0JA 2Y0DA 3QV1A 1HRDA 3BTOA 2EW8A 5T64A 1HDRA 1NBOA 3MJCA 3QP9A 2QX7A 1HETA 3SBOA 3RUHA 1NAIA 4CM4B 4IQ0A 3PEFA 2VRCA 3PK0A 3HE3A 2VWPA 1MFZA 1CWUA 1QYXA 3GAZA 5U9CA 5G4KB 1GCUA 3M1AA 4J1QA 5EMHA 4ZQBA 1WZEA 3H5RA 1TT5B 3CMMA 1HZZA 2YYYA 3BHIA 2H6EA 1H9BA 3P2YA 4TRNA 5JCJA 1A5ZA 2Q1SA 1CQIA 3BTUA 1Q7BA 1Y8QB 1B8VA 5ENVA 4BMNA 3F3SA 5HS6A 4BKUA 4CLXA 5JXWA 1NQTA 5LCXA 4P22A 1WDKA 1WLYA 2VZ0A 1N7HA 3RCBA 3HG7A 5ENDA 3RAJA 3ZU2A 4DQUA 5C3MA 4WLEA 4E13A 4KQWA 1YXMA 1W73A 2Y1FA 5CHEA 1F8FA 4A03A 4ALMA 3DTYA 4IS2A 4W82A 2WEKA 4ZQHA 2CDAA 5H83A 4E30A 4UVHA 1YL7A 1G1AA 4CR6A 4KWIA 3B1FA 4Q3CA 5ILGA 4N5LA 4P4GA 1NXQA 3UXYA 2G17A 2UUOA 5A3JA 1EUDA 3IOYA 3VZPA 1ENYA 1GZ6A 4JBIA 3HDYA 2Q2QA 1TI7A 1T1SA 4M86A 3JYNA 3VDRA 1XR3A 1PJ4A 1LRKA 1QMGA 5AVOA 2FHSA 2W90A 3D4PA 5A03A 1X1EA 1D1TA 2WDZA 1KVUA 2X9GA 4O6VA 4BMSA 4KTTE 4IJUA 3PFFA 5JAIA 3W6UA 4XDYA 1U7HA 5L53A 4CV1A 4WCFB 3AUAA 4P4NA 5CP8A 1BXGA 1KEUA 2EG9A 4EITA 3PYXA 3ABIA 1U4OA 1B14A 2HDHA 1EMDA 2YV3A 3C3XA 3JD3A 4CUZA 3O26A 3DBVO 4EJMA 2Q50A 4O59O 4URFA 3BHMA 1X0VA 3QQPA 3F5QA 3NUGA 4BO1A 1HXHA 5B12A 1UAYA 4YXFA 3FNFA 5K6AA 1VKOA 1IY8A 9LDBA 4JCOA 3VH4A 3NRCA 2GN9A 3NDRA 4KQXA 2IZ1A 3CEAA 3NGLA 4FC6A 2HU2A 3NJ4A 3BMQB 4JQCA 2DBZA 4RF2A 2EW2A 1LSJA 3Q11A 1P45A 2BMAA 5ILOA 1UXJA 4BGVA 2FPPA 3BTVA 5TLSA 4AL4A 4JNKA 1V0JA 4J49A 4H16A 4XWYA 1ZUD1 3TF5A 3RKRA 4E2ZA 1LLCA 4RO0A 4K6FA 4WNIA 1E7QA 3AUSA 4DIOA 3E1KA 1FK8A 5IN4A 1EK6A 1LRLA 2DBRA 2JCXA 5I7VA 3DMTC 2FSSA 4UUNA 4BV8A 1P1HA 4KUHA 1QP8A 4XYGA 1S6YA 4IMPA 3MWDB 4XKJA 1E3WB 4NK5A 2FSVA 3RFTA 2EERA 4DMLA 3P19A 1NWCA 3Q9UA 4DC1A 1ZK4A 1P0FA 1H6AA 3SC4A 4CMIB 3CUKA 3HDJA 1TB4A 4RVUA 3OEYA 3E48A 2PKQP 1KEVA 5ADHA 2O3UA 4IMRA 3WYCA 3Q2IA 1PIWA 2B83A 4JBHA 3QWHA 2VT3A 3LT4A 4MVJF 4BO6A 4C7KA 4OSPA 1LDNA 2Y93A 3BTSA 2OP0A 3EW7A 2DKNA 1T26A 1U3UA 2HKIA 4J7XA 3MWEB 3EGOA 4XQGA 1KY4A 1ISMA 1CEQA 3GA0A 3VHRA 4CV0A 3EVTA 3GK3A 3ZWAA 3GFGA 2J6IA 2JCVA 3PHLA 4CMKA 1Z45A 1E3LA 5IDYA 2C82A 3DAFA 1P9LA 1ZXLA 4FIZA 4UEOA 3U09A 2B0JA 5DBGA 3F5SA 4IZIA 3ROPA 1JKFA 3NAQA 2AHRA 2JKVA 4QEDA 3A4VA 4R5HA 2HJRA 2YUTA 3GHYA 4L9RA 4XQCA 3GGOA 4OOFA 1YH3A 1T25A 3A28A 2V6GA 3OIGA 2AW5A 5TF4A 1C0IA 4BVAA 3F1LA 4ITUA 3ZHBA 5LDGA 1PR3A 4J9UE 2AE1A 1ONOA 4RLSA 4WK6A 1FDUA 2CVQA 1ID1A 4GMFA 4OYRA 1BW9B 1O94A 4HWKA 1UDAA 1ZNQO 1LLQA 1VSUA 3I9NA 1G6KA 3PHIA 1HT0A 2NTJA 3GZ4A 4AJKA 3U4CA 2LDBA 3CPSA 3DHEA 4XGIA 4I9UA 2Y1GA 3RROA 1WP4A 3TFQA 4CM4A 4U6SA 1FDSA 5DF1A 3DBRA 5KJCA 4BNKA 1I30A 1T2FA 1U3VA 1A71A 4C4OA 4HX5A 4NG5A 3CXRA 4QECA 3OQ6A 3GZNB 1ZMTA 3WX0A 3NT2A 4ZQGA 5TT0A 1FDVA 1PZFA 1HSOA 3VZSA 1JWAB 4Z3DA 3RUFA 3V2UA 4CODB 3AM5A 3CKYA 3LLVA 3K73O 1DLJA 3HFGA 5B4UA 2YHIA 4W4TA 1C0LA 5ICMA 2C54A 3SEFA 1WW8A 3AWDA 5JMWA 4R3NA 3WGYA 2OXIA 5KVSA 1SAYA 3TZCA 4BNIA 4RF3A 5EL0A 2OP1A 3C7CB 3OEWA 3UN1A 5JYEA 3C8MA 1T2AA 4CM8A 2PGDA 4YT5A 3IUSA 1N92A 3QW2A 5TC4A 3SLKA 3VVCA 4YYZA 4Y6SA 4TWRA 3WNVA 2IEDA 3WLFA 1QYVA 2B4TO 4B7XA 1FF9A 4NJMA 2WYVA 4XGNA 3U4DA 1EVYA 4U0KA 3G49A 3EZLA 3KVOA 1DRUA 5C5IA 5JMPA 1U9JA 3QY9A 4XYMA 2IEBA 4M54A 2DTEA 5K9ZA 4XCVA 4HXYA 3G3EA 2CNBA 2D59A 5G4LA 3WR5A 3E5RA 4F3YA 3EMKA 3UF0A 1UP4A 1ONNA 1PS8A 2E6UX 2Y1OA 4UUMA 5J23A 4BNFA 4GH5A 3GGGA 4TVOA 4PRKA 2X7HA 1Q0QA 3JQ9A 2C7VA 1ZZEA 3IKTA 3I3OA 4CUKA 2YFQA 4A5OA 1H6CA 2OOSA 2H5LA 4W99A 3HN2A 3O4RA 4M49A 3RUDA 5IZCA 4UUOA 1XSEA 3PVZA 2OL4A 1IL0A 2DFVA 4FSHA 5BNFA 4GSLA 4Q3EA 2BFAA 2PH3A 2Q46A 2YZ7A 4IDBA 2ZQZA 3RBVA 5IG2A 3WMWA 4XYLA 5JC8A 2O4UX 3JQCA 5G4KA 2XOXA 4YPOA 1LDYA 2DPGA 3I23A 2X23A 3I5MA 3KO8A 1T24A 2G5CA 3W4IA 4NBTA 4YAKA 3ZWCA 4XD2A 3GMSA 1R37A 2B5VA 2FWMX 4MKXA 5THQA 4ZRMA 4D45A 1PS0A 3O8QB 1MB4A 3VPXA 4FFMA 3ZV6A 3CZRA 1I01A 2NTNA 4L0QA 4N5NA 1ADBA 4G65A 1W4ZA 3D7LA 1K6IA 1PQUA 4M89A 2FPGA 3I4FA 1DJNA 4Z0TA 1YWGO 2NWQA 1Z7EA 1LNQA 1QRRA 3DBHA 5IDXA 4B4VA 4E4YA 3WTCA 1C1XA 3HZZA 4LK3A 5F1KA 1LDBA 1RYDA 3ANLA 3GG2A 1V6AA 3Q2KA 4BQRA 5IXYA 4LRSB 4QFDA 3I6IA 3GR6A 2B4RO 4A0SA 1AUPA 2IODA 3K30A 2P9GA 4KMSA 4R51A 4AVYA 3G1UA 3WLEA 1I3MA 4HKTA 3JQ9C 4DBZA 5A5EA 3QWAA 4G2NA 4I5DA 3VTFA 4Y98A 1LA2A 1O9BA 1WNTA 4E2YA 3JQ7B 3UAGA 1R4NA 3EUWA 4ND4A 3VPFA 2O3QA 5HWSA 5CPBA 5ER6A 4B8WA 4DC0A 4B79A 4CR7A 5TNXA 4ALJA 1Y6JA 3BMOB 2HMSA 4OHUA 4NJOA 3JD0A 2X8LA 3INGA 9LDTA 2VTDA 1WVGA 3ZH2A 4UVDA 1E3JA 2GGSA 5TGDA 1GL3A 2NVUB 3QSGA 1AGNA 4ND5A 3TQHA 3GPIA 2HLPA 2HO5A 3U0BA 3GVCA 1E1KA 3RC9A 3DOOA 3VPSA 3OJEA 1H6DA 3A1NA 3PJEA 3AOEC 4W7IA 4WOJA 4BS9A 1P0CA 2D0IA 3CINA 2VYND 4IDCA 3RBZA 3IL2A 1UXIA 4HY3A 2NV6A 2WSBA 3QVTA 5F3RA 5L95A 1E3EA 3ON5A 4N7RA 3B6ZA 1HF3A 3ETGA 1YQXA 3SJUA 3W8EA 1WDMA 1IZ0A 2BFMA 3GAFA 4TRRA 2EKLA 1R4NB 2EJWA 3DOCA 1XQ6A 3NJ8A 3O8QA 4ND3A 2O50A 1N9GB 5A3VA 4ZGWA 3AK4A 2QHXA 4XQ9A 2AEJA 4YAEA 3GOHA 4L8VA 4E12A 4BO5A 4MVJP 3B20A 4BO2A 1DFHA 4A10A 1FDTA 5LDHA 2JAHA 2JL1A 3PPIA 1U3WA 5FEUA 3NV9A 3KRTA 4E5KA 3RJ9A 2YHUA 1RKXA 3FI9A 3ENNA 1EUCA 1F0YA 5IZ4A 1NNUA 1BW9A 1DC5A 1ZO8A 3JYQA 1JN0A 4MINA 1CETA 3LF1A 5CG2A 4J1NA 1SCUA 5TJ9A 4PGFA 2HAEA 2P68A 3JQDA 4WPGA 1OI7A 5HRUA 1E77A 2GD1O 3WJAA 4ZU3A 1ULSA 1MG0A 3DO5A 4GWGA 2BFOA 1XGKA 1U5AA 4CMEC 3LLSA 3ZV4A 2HRZA 3U49A 1PJBA 5I9NA 4B7UA 4A26A 1OOEA 3UOGA 3PGXA 3EZYA 4ND1A 2WE8A 3OJOA 3ZWWA 3JQGA 3JQEA 1NQAO 4E5PA 2VWGA 3H9GA 4WE3A 3RKUA 5B4TA 1GU7A 1EQ2A 1KVQA 1UR5A 2IXBA 4I08A 1YB4A 2VCYA 4WLUA 3ZU4A 1YGYA 2X5OA 1YS4A 3TL3A 4XR9A 2EWMA 1PGNA 3QVSA 1PL7A 5B4VA 4WCFC 2HRBA 3DZHA 3BZUA 3TZHA 4BNJA 3RC7A 1WMBA 3O38A 5T8KC 2I67A 5BR7A 2FR8A 4GAEA 1G0NA 1EVZA 4Q39A 3PYMA 2A94A 5AXAA 1K5HA 4PN3A 2GZ1A 1K6XA 1R6DA 2AQIA 2Q49A 5JYDA 2J5KA 5CDYA 1RM4A 3GMDA 1LJ8A 4YJFB 1O6ZA 2QW8A 3ASUA 3GEDA 5AXCA 3QIVA 2BELA 1B15A 2X22A 5ITWA 4YJHA 1ADCA 4NK4A 3ROMA 1SEVA 4PLCA 1PWZA 1YE3A 4G5HA 4RGBA 4CV3A 1J49A 1YJQA 1SNYA 1UUFA 3HB4X 4J0FA 1UP6A 4NJMB 8ADHA 5KWEA 3I4CA 4Y67A 3GFBA 5KVCA 4DPMA 3ZDFA 3LC7O 2NSDA 2X1HA 1LU9A 4JXKA 3JQAA 3L0DA 5F21A 1Z73A 2OFPA 4CM7A 3AI1A 1DBVO 1PS9A 5IF3A 1U2DA 1PJ3A 2XPCA 1GYPA 4U8GA 4KP7A 3LT1A 2PTGA 4BB6A 3S2IA 3AFNA 3QWBA 4DWVA 1DEHA 3PHJA 1NQOA 3GY0A 4HFRA 3IKVA 1JQBA 3V1YA 3ZNPA 3KEQA 4YJHB 3H2SA 4YJGB 3IC5A 1RPNA 3DBLA 4Z9YA 4Z3KA 3ZWOA 2QRJA 5FF9A 2SCUA 4K26A 3CH6A 5KKCA 3FWNA 3E8XA 5FI3A 3ZHXA 3H5AA 4DRYA 1BXGB 4BNTA 1B2LA 1NM5A 4FQ8A 1A9YA 3RUCA 2C29D 5BSHA 1B8PA 2QIOA 1IPFA 3KZVA 4BKOA 2BGLA 2J5QA 2JHGA 1R4MB 3V1TC 5KJFA 4ALKA 7ADHA 1O95A 3EC7A 4GI2A 1EEHA 2P2SA 4KUEA 5I8WA 4R1SA 3ZW9A 3VPGA 4D79A 3ONDA 4DPLA 2J3JA 2BH9A 1JTVA 4D0RA 1I33A 4XYBA 3TZKA 1ZKMA 4R16A 3VKUA 1HZJA 3GVPA 4OKNA 2DUWA 1DAOA 2BFPA 3AW9A 4Q3DA 4BNHA 3JQGB 2WYUA 3SLGA 4HV4A 1NVTA 4FBGA 1P31A 3AJRA 5JFOA 4ILKA 1HE2A 1KBZA 3D0OA 3DZGA 3D4NA 2GLXA 4GLLA 3NDJA 3KOUA 4NH4A 1LSOA 3BMCA 1S7CA 1TVEA 4EJ0A 1HDOA 5AQ1A 5ITVA 2Q4BA 3ASVA 3F9IA 2VWQA 4JP2A 5JE8A 3IMFA 4JBGA 2PGJA 1TXGA 1K3TA 3E18A 2VT2A 2WJPA 1GADO 2R2GA 2P4HX 4WEQA 3IJRA 1O0SA 4F6LA 5L7WA 4YBZA 1JVSA 1NPYA 3LDHA 4TRMA 3LVFO 3I1JA 4A73A 2NU9A 3R1IA 4CMAA 4LCEA 3WMXA 3ETEA 1M75A 3WS7A 2ET6A 4BNYA 1X7HA 1N8KA 1PGQA 3KSDO 5B1YA 3BMNA 1I2CA 5A9TA 4BIIA 3BXXA 1T1RA 2GUGA 1ZK0A 3ITDA 3K6JA 5IJZA 4CM9A 1EFKA 5L4NA 4RQTA 5C7IO 5TX7A 4PLWA 1XG5A 1GQQA 4GX2A 4RZHA 1GZ4A 2G1UA 2QYSA 4JLWA 4K9DA 3AOGA 4IIUA 1XU7A 2C2XA 4MP8A 1M6WA 2D2IA 4RLHA 4DBVO 3FTPA 5JO9A 4RJTA 2CZCA 1V35A 3JQ6A 4CR8A 1U3TA 3DXFA 8LDHA 3DBLB 2WM3A 2FZEA 1DOHA 3K9QO 2DLDA 1CYDA 3QWFA 1PZHA 3GEGA 3I9MA 4HFMA 4YJGA 2FRDA 5C7LO 3VOSA 2GN6A 4L76A 4E5YA 1OZAA 2Y66A 4WCFA 3OJ0A 5L7TA 3IJPA 1PEDA 1PGPA 1B8UA 3OMLA 4JIGA 1HL3A 3RC1A 2VRBA 2BLLA 5L9AA 4FFLA 4F46A 2EEZA 1GEEA 1QV6A 3BMOA 3BMQA 4L73A 1EDOA 1X7GA 2X9VA 3PIIA 1RM0A 4Z9FA 3U5TA 2D5CA 3AY6A 4W9NA 5BQFA 1DIAA 3MEQA 4DLLA 4AG3A 2NVWA 4D41A 1R66A 3B1JA 4Q9NA 3UCFA 2P4QA 2ZB8A 3FNGA 3E03A 1JKIA 3NYWA 1E7WA 3WGIA 2Q2VA 1MXHA 5BNTA 2PGLA 2EGHA 3U4HA 2I99A 3FBGA 4XYEA 3RU7A 5FFFA 2Q45A 1Z7BA 3OF2A 4CM5A 4YT8A 3AY7A 2VNSA 4RF5A 3BIOA 3DBHB 4OL9A 3ZZNA 1ZCJA 3H8VA 1HDZA 1VSVA 1H93A 4RCVA 1IE3A 1JVBA 1X0XA 3PWKA 2X86A 1FXSA 3WQRA 1ZH8A 4UAGA 4QT0A 2ZYAA 1LDEA 1NAHA 2OBNA 2BGKA 4IINA 5K6AC 4CMBA 2QQ5A 4D3FA 4RL6A 4MP3A 1AXEA 2Y1DA 2OORA 5TS3A 1HLPA 4EUHA 5I9MA 2F1KA 1O8CA 3HDQA 5L51A 5JCJD 3HADA 1Z74A 3QVOA 1BG6A 1I3KA 1QORA 5TT1A 2I6TA 1W0CA 4XRRA 2V6MA 4KOAA 4OQZA 2CD9A 3GDFA 4XJTA 5T57A 1U8XX 4ZRNA 1QYWA 4OGWA 4WOKA 1E7YA 3S1LA 2WMDA 5HBRA 1CIVA 1D7OA 1UAGA 2BHLA 4W9NC 1QYDA 4NFYA 3W1VA 4Z6KA 2PY6A 4R9SA 3K92A 3O9ZA 4F6CA 1E7RA 4OO3A 3VAZA 4CM8B 4S3MA 3VC7A 1A7AA 1UJMA 4R01A 3WJ7A 1WZIA 2BRUA 4G81A 2DTXA 3IS3A 1IHXA 4BNUA 3DFZA 3RC2A 4JROA 1LTHR 4I1IA 4CLDA 2VUUA 5A04A 2O7QA 2HUNA 5A02A 3OFSA 3H7AA 2VHYA 4CLOA 2VRCD 5COQA 4MVJH 1GEGA 1EQUA 1LX6A 2VHVA 4ND2A 3QJ5A 4FPXA 2FN7A 5DN9A 2EHDA 1LUAA 3RVDA 3F6YA 3PQEA 4E31A 1BVUA 1O89A 5B37A 3JQ7A 1Y5RA 2X0RA 3D5TA 4UEJA 4WASA 4N54A 3PYLA 4E3ZA 3TJRA 3WFIA 4EYEA 3AI2A 1TT7A 4K1LA 3UUWA 1AHIA 1GQYA 2DPHA 3A9WA 3F1KA 3H65A 4AJNA 1DJQA 1BXKA 1MFPA 3HJAA 5CAEA 3S55A 3D3WB 4P8RA 3M2TA 1K6JA 4ZQFA 3HDHA 4FFNA 4M55A 3K2BA 2XAAA 3ORFA 5F5LA 1PQPA 3ANMA 2X5KO 4AJ2A 3U62A 4MKZA 1I10A 1YBVA 1ZEJA 4NQZA 4RVFA 1H5QA 3ZI0A 1L7DA 3DOJA 1NPDA 2RHRA 5JY6A 4ROSA 4WLNA 5JDIC 3PDUA 3AI3A 1EZ4A 1MUUA 1ZJYA 3GZNA 1V8BA 1R15A 3T4XA 3ZWVA 3M2PA 1HE5A 5JC1A 3DMTA 1V3UA 4YAIA 4R9RA 4EEZA 3DAPA 4O63O 3Q1LA 2AQKA 2CMDA 2RH4A 3WSWA 3JYPA 1VE9A 3FPLA 5DCYA 4BO4A 1LQUA 2GSDA 2C5AA 3WBBA 1IB6A 3ZHZA 4FB5A 5KVQA 4YRBA 2UYYA 3ICCA 3VKVA 2VYVA 3LYLA 4BKQA 4BNWA 1JLLA 1GR0A 4L4XA 4LMPA 3LU1A 4EGFA 3H9UA 3TZQA 5JBIA 5JDCC 4RF4A 4WUVA 2EV9A 2PLAA 1L1FA 4PVCA 1M67A 1VRWA 1EK5A 1M6HA 2O23A 4GPD1 4PLPA 2FOIA 5L3ZA 4E33A 5IAAA 3I83A 2FY8A 5DULA 2BF7A 4KTVE 2GZ2A 5A9SA 2Q1WA 2J3IA 3OJLA 4CLHA 1NASA 2OO5A 2B69A 1A4IA 2J5RA 3I9KA 4YB8A 3DTTA 2I5PO 4BL5A 2FZWA 3GHHA 1PR9A 4RPKA 1YRLA 4PCVA 4WGGA 4PLHA 3KV3O 5I7FA 3PFWO 1NR7A 2O3SA 4KUGA 3RUIA 5CDSA 2YV2A 1OAAA 1XWFA 3KSZO 1D3AA 1JAXA 1UZNA 2I9PA 4E32A 1T2EA 1PL6A 3HWRA 5K0ZA 4FOOA 3GC6A 4L4RA 2NUAA 3D3EA 3O03A 3CTMA 1XEAA 3L4SO 4FS3A 1Y5MA 3ONFA 4PVDA 2GDZA 2PR2A 4PLGA 1N7GA 3I9JA 2P9CA 1Q1NA 1JDJA 4GX5A 2DC1A 4MOWA 5GZ3A 2NU8A 4AJPA 1DIHA 2JD1A 2ZATA 3NGXA 1HE4A 3AU9A 5G0VA 3MOIA 3TPCA 4DGSA 1CQJA 4Y8VA 1ZXBA 3AU8A 4R1TA 1YOVB 5C37A 4QUKA 1SB9A 3KYCA 1IOLA 4NBVA 1XELA 2GN8A 3NTRA 1GAEO 2E4AA 4JJIA 3JQ8B 2GERA 2Y1CA 3WQSB 2WWRA 4A7PA 2NNLD 3OECA 3I6QA 1DC3A 3QA9A 4YEDA 2HMVA 3EDMA 3W8DA 4C7JA 3W6ZA 3I52A 1VLLA 2ZYDA 4INAA 5LC1A 2AE2A 1XIVA 1YDWA 2D1YA 4BGIA 2VUTA 4ZICA 2W98A 5GZ6A 3E9NA 4HADA 2VHWA 2IDZA 2QRKA 3C85A 3L9WA 3T7EA 4CQLA 4GQAA 1HSZA 4IUYA 2ZJ0A 3HNPA 5DOZA 1HDGO 3X2FA 1I36A 4DYVA 4GBJA 4XB1A 5HS4A 1KEPA 1OBFO 2Z95A 4QQRA 1JAYA 5DOVA 2YFHA 3MJSA 3COSA 5DP2A 4I5GA 3H3JA 1DRVA 1MP0A 1ENOA 4BNMA 2AQHA 3OBBA 2JFGA 5ICSA 1SB8A 2HMUA 2TMDA 2Y0CA 3FWZA 2D3TA 1VL6A 4XJSA 2O2SA 3WGOA 3GGPA 3A14A 1HLDA 4Z0HO 3FTNA 1SMKA 2H63A 3QRWA 4AJLA 1R0SA 4DPKA 1UXGA 4NI5A 2C5EA 3N74A 1QKIA 1H0KA 2X6TA 4J7UA 3VH3A 3DBRB 5H81A 4TZTA 3ZWBA 1I5RA 3HHPA 5EN4A 1ARZA 3BAZA 4AJIA 4PFJA 1EE2A 2ZB3A 3DZFA 4XR4A 5I8ZA 5BNIA 4RVHA 2PZMA 2PK3A 3M6IA 3BA1A 4IDEA 2NM0A 2YV1A 5H82A 3RUEA 3DZBA 2BI8A 4MIYA 1VI2A 4MKRA 1ADFA 5KJ1A 3KM0A 1RJWA 4PZEA 4BNXA 1JKJA 2NU7A 1D4FA 3ZU3A 4DLAA 1GFSA 1HYEA 3L77A 4J6FA 2GASA 3E9MA 4ONEA 1XYGA 4CMGA 1B7GO 2ZKLA 5CDUA 4DLBA 3SXPA 1E3WA 4HBGA 1NP3A 4NFSA 3ULKA 1DIRA 2NQ8A 4YTEA 3KSUA 4AFNA 1Y9AA 1BTOA 3MJEA 3Q9NA 4D42A 1PWXA 2C59A 1SOWA 1XKQA 2ZYGA 3GDGA 5L45A 4U5QA 1A4UA 5GY7A 2OGUA 3WIDA 3CE6A 1X7DA 3PLRA 4DYDA 1X14A 2WE7A 1T2CA 4LGVA 3OM9A 3OQBA 1I8TA 2CF5A 4UULA 2JD2A 1A27A 1VKNA 2IYPA 3HB5X 3TN7A 1R4MA 4LSMA 3VZRA 2RHCA 1BSVA 3JQBA 4ALLA 2GCGA 4IBOA 4M1QA 2O4CA 4IDFA 4WJZA 1KEWA 1YQDA 3DZIA 5G0TA 2P91A 4EJ6A 2NADA 2Z1NA 2DVMA 3KLMX 3FR8A 4BMVA 3P7MA 3GVHA 4DVJA 2W2KA 1L7EA 1N9GA 1RYEA 3TZ6A 4D7AA 1HE3A 4LVUA 3E5MA 1P3DA 2ZCVA 1B3BA 4FN4A 1IPEA 1YDEA 5EQFA 3LC2O 4J7CA 1K89A 3TNLA 1BRMA 3ZWNA 2UUPA 3JD4A 2A92A 4KZPA 2W2LD 1PJTA 3W4JA 4B8ZA 4D0SA 3DEYX 4RQUA 3JQAB 4UVEA 1H2BA 3K31A 3UH1A 1PU2A 2VUSA 4PG4A 4ZQEA 4EEXA 4YAGA 4BKPA 1B3RA 4YJDA 1AE1A 3GLQA 4M87A 4TQGA 2Q4EA 3VH1A 4YAJA 2NVUA 4RPHA 2J3HA 1LI4A 2QG4A 1OC4A 3C1TA 5G0UA 3JQ8A 1LDMA 2PFGA 2PKQO 2B5WA 4Q3BA 1GUFA 5JY1A 5F1PA 3P5SA 1GD1O 1YBAA 4I5EA 3IUPA 3AY3A 2X58A 4JX8A 4JP3A 3VDQA 4E6PA 2RAFA 4NPCA 3PJFA 4YJFA 3WICA 3SVTA 3NT4A 4IGEA 2DT5A 2ZTMA 1IYZA 1D1SA 3EAGA 3AFMA 1ISIA 1KC3A 1H6BA 1ZIDA 3FRJA 1R0LA 3C1AA 5DCWA 4FGWA 1JW9B 3PHGA 3PWZA 4HFJA 5I7EA 1A72A 5IFLA 4FFOA 1N2SA 1N1GA 2FMUA 4XRGA 1NWHA 1FJHA 1KERA 1D8AA 3ZGYA 1Y9EA 5T8KA 3CIFA 4GGOA 4AJEA 3GNSA 1ZVMA 5G0SA 2WYWA 5A4DA 4UEKA 1J6UA 3ZWXA 1LXCA 4FD3A 4FCCA 1WWKA 1Q7CA 2O3JA 3DONA 4DA9A 2CUKA 3L6DA 1BMDA 1KVTA 1R0KA 2AG8A 4PZDA 4GX0A 2WD8A 2JD0A 4IDDA 5IZCC 2PV7A 3V2HA 5GMOA 2VZ9A 3LQFA 1WPQA 4I9NA 3P2OA 5JDCA 5TRTA 4CM3A 2PH5A 3GH3A 4CMJA 1RWBA 4D43A 5KCZA 4Y6PA 2PD4A 3E82A 3UICA 4CMEA 4YRAA 1XCBA 2PD6A 4R41A 4XA8A 2Q3EA 1AHHA 4HUJA 1AN9A 2DAPA 5IDWA 5TSDA 1W6UA 3ETDA 4D3DA 4DUPA 4MVJM 1XA0A 4ZN6A 1SEPA 1ZMOA 3QHAA 5EQDA 5BSFA 2Z5LA 3H6KA 2DQ4A 4R4JA 5A9RA 5KJ6A 1BXZA 1UZLA 4WKGA 4BO3A 4BQPA 3WOHA 2ZTLA 2IYOA 1IULA 3ONEA 1P74A 4R69A 1GPDG 4CM1A 4DMMA 1BDBA 4J4HA 4J91A 3ST7A 3IAHA 4IJWA 4XB2A 4XEHA 3JQBC 5THKA 3OH8A 2V6FA 5A05A 4J16A 4BKRA 3U9LA 3JTMA 4MVJA 5T67A 3NT5A 4QO7A 4J4TA 4XDZA 3OHSX 4PLTA 4JJFA 5JNLA 4NU6A 3G1TA 3WWZA 1PJSA 3IQDB 5CDGA 4IXTA 3EVNA 1QG6A 1GDHA 2CDBA 4U6QA 2X0IA 3PDJA 4GWKA 2J3KA 3GQVA 1SPXA 4LW8A 1KOLA 1U2GA 2X9NA 1E6UA 3WWYA 4CPDA 1YB5A 2PNFA 3OIFA 4LRTB 3ZWMA 4YQYA 2CVOA 2E49A 2EKPA 3G0OA 4GX1A 2CF6A 3V5NA 4A2CA 1U7TA 4YCAA 5HTOA 1UDBA 2P5YA 4EDFA 1HDCA 1YO6A 4CQMA 4YDRA 1E3SA 3MTJA 2E48A 2EF1A 1BDMA 1OFGA 3FPCA 1C0PA 4OXKA 5EESA 1CDOA 3VZQA 4RVGA 3L4BA 3KYDB 2JCYA 3UHAA 4Q3AA 1YBMA 1ZSNA 1K0UA 4R5MA 3D64A 2NACA 1Z75A 1KVRA 3D1LA 5G0WA 4BO0A 2HCTA 3H9QA 3EHEA 1Q0HA 3AM3A 3E6AA 1DXYA 3T4EA 1DRWA 4BB5A 1GCOA 3LK7A 1IUKA 2GR9A 4GSKA 1KY5A 1RM5A 4J4BA 4NIMA 3PTZA 4OJNA 1NFFA 4EZBA 1GYQA 2ZCUA 3JD1A 3WIEA 1JA9A 3DC2A 1JWBB 3PZBA 4MIEA 4QFCA 1P1FA 1VJ0A 2X5JO 4YWJA 2Q1TA 2JFHA 5T5QA 1EDZA 4II3A 2DU8A 4NMHA 4PZCA 3TRIA 1DPGA 4Y6RA 4P4LA 3JQFC 4AJOA 5MGBA 1SBYA 2Y05A 5DBIA 3ZNQA 1P77A 3R3JA 4XIJA 2FP4A 4KWHA 4RPLA 1YL5A 1QLJA 2YY7A 3CSDA 3RWBA 2BKAA 3UCEA 5CEEA 1UDCA 3ROQA 3JD2A 1J4AA 1QLHA 2I76A 4BHTA 1E7SA 4CJXA 1EVJA 3PHHA 4NFHA 4UUPA 3W8FA 3GRKA 1CJCA 1T2DA 1BVRA 1ADGA 3UKOA 1ISGA 4WEOA 3KTDA 4JK3A 4WLVA 3PQFA 2IZZA 3JYLA 1ISFA 1ZK1A 2H1SA 3DR3A 4XGKA 1NFRA 3WQQA 4MVJG 1NYTA 4FJ0A 2DM6A 4TKLA 3T7CA 1C1DA 5BSGA 2D8AA 1Y8RA 3GVXA 4RPJA 3NTOA 2V6BA 5COBA 5FWNA 2ZTUA 4IGFA 5TQVA 4WECA 4CQMB 2ILTA 1T4BA 3PXXA 4JJGA 1R12A 4OAQA 4WNCA 3I9LA 6LDHA 1Y7TA 4GKVA 3ZHYA 1ZSVA 4CLRB 4S1VA 3F4BA 4D46A 4PLZA 4J90A 2QZ9A 4CLOB 4EW6A 4RVSA 3WGZA 1V3TA 2YJZA 2JAPA 3FR7A 5CEJA 2R00C 4J2HA 4KDEA 3H5NA 4YVFA 1BWSA 4HFNA 2P5UA 1LLDA 4RDHA 4ESOA 3DDNA 1GYRA 4LSWA 1G0OA 3FD8A 3DL2A 3GN2A 4PIVA 3ZWYA 1V9LA 3GDOA 3JSAA 1VM6A 1C0KA 4AJJA 3UVEA 4E21A 2GRAA 2G0TA 1Y81A 4PLFA 3U3XA 1DSSG 3E9QA 5JLAA 2CVZA 1GTMA 1K2WA 1DO8A 3OJFA 2O2YA 3OA0A 2LDXA 4GLOA 4CMIA 1IZ9A 4IZHA 4L74A 1U28A 4RDIA 4W6ZA 1PJQA 4GKBA 6ADHA 4Z0PA 3HN7A 3B1KA 4RPGA 4DREA 5JAMA 4MDHA 2JFFA 2I65A 3JQAD 2I3GA 4TRJA 3MTGA 3PI7A 1QSGA 3UW3A 4BNNA 3DZKA 3FF4A 2RIRA 3GEMA 2EP7A 2HJSA 5I9LA 3ENKA 3H9EO 2JJYA 1MV8A 3KHUA 4KDFA 2ZQYA 1GV1A 1N5DA 2VYNA 4II2A 2E82A 4YR9A 3PIDA 1P33A 1ZW1A 5G2OA 5DT9A 2DUUA 3JV7A 4MIOA 4GVLA 2QRLA 1Y8RB 3R6DA 2NQTA 4AJ4A 1XQ1A 4QO8A 3TDKA 2VWHA 3CMCO 3KB6A 5AXBA 1SO8A 3TFOA 2I3AA 2FPIA 3VTZA 2YQ4A 5TIIA 5AXDA 2YHIB 1SZJG 4R1NA 4NBRA 3QLJA 5TJHA 2RH8A 1FMCA 3GNQA 2UV8A 1P44A 1AXGA 3TL2A 2AQ8A 2R6JA 2W4QA 1F8GA 2IRWA 3MOGA 1LDGA 4BNLA 5T6BA 5CEFA 3TOZA 4CL8A 3WFJA 4LMRA 4E5MA 1BGVA 1DFGA 2CDCA 2O7SA 3H4VA 4DIFA 2PZLA 3OQ1A 4HNGA 5KIAA 4BNGA 2UVDA 1YL6A 3MZ0A 4WLOA 3K2EA 3TOXA 3L6EA 3FBTA 3OETA 3RD5A 4FFPA 1UZMA 4DXHA 3A06A 3RI3A 2UAGA 3ITKA 1GQ2A 3WNQA 4IQGA 1NHWA 3HQ4O 1MGOA 4W7HA 1NTOA 2NTVA 2XF8A 3G79A 1BHSA 2DBVO 4FR5A 4FW8A 1ZBQA 2FR1A 2EJVA 2HK8A 2Y68A 4IS3A 4RZIA 1DIBA 1LC3A 2Q2WA 4EBFA 3KYBA 4N18A 2ZIZA 5MDHA 1JU9A 3MJVA 2DBQA 3ZN2A 4MP6A 1LSSA 1VJ1A 1LEHA 3MJTA 3PJDA 3S2GA 1XHLA 4BGUA 2OMEA 1TEHA 4RV9A 1KIFA 3DQPA 3WXBA 3NEPX 3PJGA 4IIVA 4AJHA 1F12A 3HUDA 1LLUA 3ZNOA 4E2XA 2V65A 4UVGA 5A06A 3JQFA 2JHFA 2AEMA 4BO8A 1MG5A 3FN4A 1PJCA 2A4KA 2POQX 1W8DA 1E6EA 3WBFA 3ZWPA 1M76A 3B70A 4PG5A 1GUZA 4D3SA 5KNLA 2RBEA 1TLTA 2W2LA 2YDXA 3UGKA 1NVMB 4ID9A 1C3VA 2XXJA 4K28A 3N7UA 4IXWA 1UXHA 1HYGA 4IJVA 5EJ2A 1PL8A 5IDQA 2QYTA 5JCXA 4FC7A 4ALIA 4A27A 1O5IA 4I9HA 1P1JA 2VQ3A 2X4GA 3OIDA 3X2EA 1Y8QA 1RM3A 1E6WA 1IHYA 3NKLA 4CL3A 2IXAA 4H7PA 5JO0A 1MC5A 1DLIA 1E7MA 2B4QA 3F46A 1MC4A 5L7YA 1MX3A 1H94A 1QV7A 2G76A 3GUCA 5EPOA 3L4BC 2Y1EA 3WGHA 3DB2A 1P1IA 3KUXA 3H3FA 3U4IA 5BSEA 3AM4A 4CV2A 5EIOA 2GZ3A 4B4OA 1YVEI 4B4WA 3WYEA 3Q0EA 1ISJA 1PX0A 3NX4A 5KJEA 4LVCA 2O3RA 3I9OA 3L6OO 2VNAA 1ENZA 1QXSA 2Q1UA 2BI7A 1MXFA 4LN1A 4M8SA 1NPTO 1UP7A 1ML3A 3LT0A 1M2WA 1A9ZA 4J1SA 5HA5A 3D5QA 3VH2A 2D4AA 2PWZA 2VZ8A 4DL9A 2YDYA 1EE9A 3ZV5A 4OKIA 1B26A 1EBFA 3H9JA 4TVBA 3IDSA 4FGSA 2HK9A 4RORA 1E1NA 4OSOA 4GGPA 2NVBA 2HSDA 5DZSA 2GO1A 4D44A 1DIGA 1NX6A 2AG5A 3F4LA 4FDAA 2EXXA 3ANNA 4YT2A 4BUCA 4IPTA 4CLEA 3HSKA 4Q3NA 1VC2A 3WDSA 4BNVA 2C0CA 3WYBA 4IM7A 5L4LA 3DFUA 2ZK7A 1YOVA 3WGQA 4L4SA 2PD3A 1HTBA 1Q7GA 3N58A 5I7SA 1V3VA 3M1LA 2BD0A 3RASA 1LSUA 2V7PA 2R00A 3CZMA 2W8ZA 3ADPA 1HYHA 1GV0A 1ZK2A 4MVJE 2OUIA 7MDHA 3RIHA 5L4SA 3INTA 4DQXA 4ZHSA 4IJKA 4E2WA 1DB3A 2ZB7A 1J5PA 1OMOA 4WCDA 1KVSA 3ZU5A 4PG8A 5DCUA 2GF2A 2NLOA 1KC1A 5KOIA 3C1OA 4X54A 2UDPA 1C14A 1U4SA 3KBOA 4CQMD 3KYCB 2O3TA 3FCOA 3V2GA 4Y9DA 1E3IA 3PZRA 3DAGA 1YB1A 5A9SB 3EK2A 3MCVA 2ZJ1A 2I66A 4J2OA 1YONA 2WTBA 1WAMA 5F1OA 4R54A 2D5AA 3ZW8A 4ZD6A 1ZFNA 2OZPA 2YW9A 3PGJA 1KYQA 4NBUA 2W2KB 4YRDA 3IP1A 3DHYA 4PRLA 1QYCA 3DWFA 1FDWA 3FSRA 4TKMA 4NNJA 5C7OO 1PGOA 1E0DA 4TZKA 4TMFA 5HM8A 4PLYA 1E5QA 1PZGA 2E37A 4OIMA 1DAPA 5A5FA 4ZJUA 2PKRA 5BT9A 5KKAA 2GYYA 4OH1A 5DNAA 1MA0A 4QSMA 4QX6A 4O0LA 1EVIA 2J8ZA 2B35A 4PLVA 1EUZA 3W4KA 1EFLA 3QVWA 1PGJA 3S2EA 2EP5A 2VOJA 1TT5A 4NDNE 5ES3A 4J43A 3LC1O 3SX2A 3TSCA 2G82A 1ORRA 2PA3A 4E0BA 1P1RA 5DDIP 3ROKA 3PP8A 1Q2XA 2Z1MA 1J0XO 4NZ9A 4BO9A 2CSUA 1PJ2A 1HKUA 1I32A 1NFQA 3Q6IA 2GN4A 4JN6B 4FJ1A 4PG7A 1PZEA 4XQEA 2C7GA 4NR0A 3G17A 4CMCA 2CFCA 2AEFA 1X15A 4H15A 1F14A 4NBWA 3WGGA 3ZCXA 1MLDA 5IN5A 1DDOA 3MJ4A 1E1MA 3NDIA 4EI2A 4HP8A 3FNHA 4EUEA 3C24A 4F45A 2Y67A 4CQLB 5CFZA 3AOEA 1H2HA 1Z82A 4RVDA 1WMAA 1CERA 3GVIA 3RUAA 1GZ3A 1YKFA 5ER9A 4DIBA 2XXBA 1HEUA 3HFSA 4U0JA 1WXDA 4GL4A 3RSHA 4Z9XA 2Q99A 4JGBA 3KETA 4GMGA 3DMYA 3QWIA 3H2ZA 4QTZA 3GUYA 1ISHA 1Z6ZA 4E5NA 2C2YA 3K96A 3FNEA 3PQDA 1I3LA 4P38A 3GF4A 4HNHA 4OQYA 1DC4A 1I2ZA 1VL0A 1ZEMA 1KS9A 5AYVA 2C20A 1NVGA 2TMGA 4TSKA 1F06A 1I2BA 5JDIA 4O1MA 1P1KA 2X0NA 2RCYA 3WG9A 1LBEA 4IDAA 3SC6A 1C1XB 5JPIA 4BGEA 2AXQA 2CY0A 4IQ8A 4U7WA 4H3VA 3RQSA 4CM9D 3OSUA
chains in the Genus database with same CATH superfamily
3RC3A 3E3OA 4BJ5A 3K5PA 1OC2A 3CFYA 4HH0A 5FWYA 2F3SA 2PX4A 1H3FA 3CEMA 1KHHA 2X0KA 4JI0B 4G5RA 4NONA 1AHPA 2G7MC 2W4MA 4MKGA 4LHSA 1MCZA 3PLAE 3IP3A 3RS3A 2GPTA 1I0ZA 3CTPA 4O4HB 1OX4B 3ZK8A 3RGGA 3QFSA 1UINA 3DVQX 5I3ZA 1CF9A 3PG5A 3KE8A 4DUGD 5TMDA 4EHLA 3VBCA 2QUZA 3IR6A 4JI7B 4KV7A 3AVWA 1MJ5A 2FMIA 3DZJA 2C42A 3UCXA 1L9KA 1U5CA 1LPSA 4BNDA 4BEWA 1W87A 5EERA 1ZN2A 1K8ZB 1Z2AA 5FYDA 3WKEA 2H4XA 2A5JA 3KLPX 2YJ6A 2GWRA 2HQ1A 2ADMA 2IEYA 5BOSA 1NMQA 2YINC 2PRYA 4MRVA 1MT0A 2CBXA 1NJGA 1DHRA 1KSFX 3G59A 2QENA 3QVMA 4HEA1 2I3DA 1M5TA 3F47A 3V1UA 2AVNA 3GNTA 3G7NA 5JAQA 2B4KA 1N1EA 1FIUA 2A1TS 2SICE 1UMCA 2N1MA 2O8CB 4QQ8A 1XLTA 3UZUA 3OG9A 3ZHSA 4XAQA 2Q9AA 2OGZA 4LFBB 3E5NA 4OB6A 4WFJA 4FFRA 4FJ2A 2P35A 3P9CA 4OLFA 1D2HA 2Y0BA 2QOEA 4BB0A 3AVYA 2ZRFA 1CF2O 1Z0ZA 3OICA 4I8XA 5HDBB 4Q9JA 4F84A 2Z6QA 2JDIA 4QQKA 4LVNA 5KVVA 4G5SA 3WJ2A 2NOAA 3W3AA 4K6CA 2IUUA 2ONYA 5KB3A 1EJ2A 3EYWA 5LMNB 2WG1A 3BE5A 4NU5A 4XX0A 2D4HA 3SZMA 3TYXA 1JHVA 2G08A 1T9KA 4ZHQF 2R44A 2C98A 5IEBA 4FDMA 2C31A 4OBXA 1XDGA 1AQIA 1W44A 3DNPA 3HMQA 4DWOA 3QLUA 4KC0A 4PS0A 4TMZA 3WQBA 4KQKA 3ZBTA 5BQPA 3C4JA 5T3UA 4ARZB 3INRA 4LI0A 3RGWS 2Y0EA 5BOVA 1KY2A 1Y1LA 4BMDA 4W1SA 2HMTA 1DTWB 2IHVA 4ZO9A 3VSCA 5KTKA 3FHLA 4A6PA 2VTEA 4BVKA 2A0WA 3GRCA 4L5CA 1C1YA 4L9WA 1E2FA 4EA6A 5HVNA 5JS6A 3P9ZA 1EBUA 4AMBA 5LQRA 4HGRA 5BVGB 1I24A 3DHNA 2B36A 3HTXA 4J94A 3OE7D 1N2HA 2C97A 3HZOA 5D7BA 2F9LA 2EIHA 3AJ9A 3I8SA 1V8ZA 4Q34A 4H35A 1T5BA 4FYIA 4NMXB 1R16A 3ESAA 1ULUA 1LLFA 2QZZA 1DXOA 3MJFA 1F9AA 4FOTA 1YHYA 2C4HA 6CHYA 4OHVA 3AG5A 4HVTA 1JXQA 3R3SA 4FOSA 1MR3F 4YCBA 4ALNA 5E9WA 1CY4A 1YZUA 3HDGA 4F4JA 4ZYZA 3PFCA 1KJNA 1QUFA 2H1RA 2HK7A 5DX8A 4AN1A 5CDTA 4M7WA 2J6CA 1RWVA 2IEIA 4XIGS 4LF7B 1WCXA 5J58A 4ED9A 4YQZA 1MW9X 4LDAA 1JZTA 1Z18A 3RVQA 4MULA 4G5YA 3U4QA 1QMPA 1U31A 3R0XA 2IE0A 3H5IA 4H1VA 5G53C 4RTNA 3KXDA 2ETXA 1HWYA 3NH6A 4LV6A 4TN5A 1WDLA 2A35A 3IKLA 3LHSA 1GVHA 1K68A 3K0CA 1G3IA 5DXJA 5JW6A 4JI2B 1OTXA 5TARA 4HLDA 2OHXA 2PGXA 1T1EA 4EVRA 4U9IS 3PNQA 5SICE 4WT7A 3T1NA 4AN4A 1ZQ1A 1Y5IA 1RKQA 3DP7A 4L8YA 2XYHA 1KS2A 3T6KA 4WFKA 1V5IA 1BMFD 1S2GA 1T0PA 3R0ZA 4WADA 3EG9A 1E6KA 3PRJA 2RGNA 4OH7A 4B7CA 3BYZA 4H60A 2KLHA 2ONZA 5AKXA 3SJ7A 3ZKAA 3VU9A 3ZY6A 2HSGA 3EQ2A 4DQVA 1AO3A 4ZOLF 1NU8A 1IXRC 1F2TA 3GJRA 3V48A 2BEVA 8OHMA 2JHPA 3BM5A 1G55A 2XB6A 2Z5VA 1P7VA 1TA4A 3LF2A 3B9RA 1QZUA 2OCLA 3B51X 3OTWA 3RJ5A 3FOEC 2ADOA 1U5BA 2WHPA 1RC8A 2DSTA 4JASB 3BD8A 1HYQA 3VPHA 1VJTA 4EW2A 3DZDA 1NQUA 1VP3A 2M6LA 1ZAKA 3BC1A 1AKVA 4PC2A 1NBMA 1D0IA 4MJXA 4Z4CA 2ZJ4A 3Q10A 2WB2A 1VMAA 2ZBDA 3EHDA 3ILSA 4OMUA 4RFVA 5DP1A 1OLOA 2H2HA 4TSRA 4ECEA 4MW5A 1UKZA 3ERCA 2AOXA 4JNCA 3C3WA 4MW2A 1N2CA 1ZNWA 1HRDA 2PUVA 5B6PA 2ZE5A 1DQNA 3QP9A 3LBFA 4XPIA 1YT5A 2JH8A 4CM4B 1NW3A 4IQ0A 2RI0A 2VRCA 4KRFA 3PK0A 3NOQA 2OMKA 4M8IA 4Q4LA 1GZDA 2REQA 2CWDA 3HE3A 1MFZA 3PR2B 1CWUA 5CJJA 3FSJX 4OXQA 1A8SA 5LQAA 1VKJA 3VV2A 1HZZA 2YYYA 3LZCA 4EHAA 3KQHA 1NQWA 1UANA 5FEMA 3F5FA 3WRXA 3MINA 2PUEA 2COKA 3IAM6 3TOCA 1CE8B 3NIWA 1RTKA 2ZT8A 2YHAA 4KXMA 3MWEA 3QI7A 5JXWA 4XWWA 5I4BA 5LCXA 2WM8A 1D2NA 4O2LA 3R0QA 1NURA 3PXEA 3ND8A 3C5VA 4DAEA 3ESDA 4LDQA 5BQOA 5AVRA 1HX7A 2C88A 3N2GB 4P0PB 2VH5R 4NMMA 5JROA 2BBSA 1Y3BE 4C6RA 5ALZA 2EOAA 5LLSA 1FMFA 5GWXA 1F8FA 3KR1A 5AKEA 3IPAA 3VPAA 2CDAA 3DEHA 1V2HE 4IQFA 4UTOA 4QSHA 4E30A 1MU0A 1YL7A 3IE2A 1BCRA 1G1AA 4GKAA 4CR6A 5ICCA 4KWIA 3RTAA 2H1HA 2RHJA 2WQZA 4P4GA 3IO5A 4BRWA 2GPSA 2FMXA 4FHGA 4XH9B 2OA0A 4GOLD 1R9GA 1KZ4A 1X8XA 4RJLA 3O3NB 1EFVA 2G17A 3UXYA 5A3JA 5JHHB 5LUBA 5JU6A 2FN3A 1GZ6A 2Q2NA 5FUBA 4DNPA 3H1GA 5IAGA 1W5BA 1TI7A 5JXJA 2ZRJA 4LZZA 4M86A 2MT9A 2PYIA 4LGYA 3JYNA 3ZZUA 5D3MA 3Q5GA 3VDRA 1PJ4A 1QMGA 3ZE2B 3VU3A 1D1TA 1HLGA 4TXLA 4BMSA 2YJ4A 2JIZA 2X5NA 1ZPDA 4KTTE 4UMVA 3H2IA 1MW8X 3KJFA 3ZHQA 1D5WA 1H85A 2WZBA 2GNPA 1U7HA 2ABWA 3DLIA 1IQUA 3K94A 4LYDA 4XDYA 4N76A 4P4NA 1IBLB 5FX2A 1KEUA 3C6BA 3U6KA 2QUIA 2H4YA 4MWGA 5DGTA 3TTVA 1II0A 4EY6A 1ZNXA 3ESCA 1UIRA 4ND8B 4PAOA 3TUIC 3UPUA 1JQ3A 4YMTA 4UASA 2HDHA 5CNJA 3JD3A 5SYMA 3C3XA 3SR4A 1UK6A 1VPVA 4DRZA 2ZW9A 4XTCS 2Q50A 3A31A 4CU2A 4ZJZA 2ECFA 2ZWVA 2F8TA 4BO1A 1IN8A 4X90A 1VLMA 1N6LA 3L1UA 2HH9A 1MH1A 2YOHA 5E6SA 4COOA 2AF3C 1QVVA 1VIVA 1V9CA 2IIQA 3FNFA 4MZDA 5CDHA 1IY8A 4G0MA 5CFOA 4ZCMA 1XTQA 4WL0A 5EKUA 3NRCA 3UMVA 1E79A 3IUNA 5E95A 5E3HA 1X92A 1IHDA 1JX6A 2YIVX 3V7WA 4UM5A 1R00A 3K9BA 2HNAA 4ZAZA 3NJ4A 2ID8A 4RF2A 1S4QA 1EJ0A 1CUEA 1OFVA 4FZRA 3G0IA 1TCUA 3A6DA 1OVGA 4RA9B 1TFRA 3VR3D 3EEFA 1PJ8A 2I4RA 2J08A 3V4FA 4FWIB 4AL4A 4QTXA 3IVXA 2Z2JA 3ZHRA 1IU9A 1LPPA 2GILA 3B8EA 4QGFA 4X7PA 2O8EB 5FNVA 3CSUA 2CXRA 4WNIA 1VGVA 1IBRA 3V8EA 4DIOA 2WJ6A 4KQGA 4KH1A 1EK6A 3TEMA 4YUYA 3DMTC 1GLGA 2I29A 5DGHA 1M1YB 4F3TA 5HILA 1RAAA 2WT4A 3NATA 3TSWA 4L8FA 4E4TA 1GNVA 2UZAA 3E61A 2HO4A 2OK8A 2ZFUA 3BIWA 4LRWA 2OFFA 3CVYA 3VJRA 1QUEA 5EMKA 2IKQA 4XJXA 1A5BB 2EERA 2CXNA 4DMLA 3NWEA 4CIYA 3UW1A 5ED4A 1G38A 2CFRA 5GP1A 2BVNA 4L8LA 4QUHA 4U2DA 2V0CA 3T9AA 1N8SA 2QDXA 3HDJA 1L8QA 1PYDA 2PKQP 1KEVA 2H00A 3B1YA 1G8KA 2QMQA 3FG9A 4IMRA 3WYCA 3M34A 3Q2IA 4C21A 2B8TA 3KOZA 4JBHA 1T6XA 4QTUB 4PFKA 3FPGA 2PJZA 1KMHB 4BO6A 2J09A 5AHKA 2VAPA 4MJ3A 4YCNA 1Y4SA 4WGFA 1RJ9B 2A9KA 1T26A 4J7XA 3MWEB 1CEQA 4ZI2A 1SQFA 3MMPA 5JVDA 1V43A 3ZDRA 1EAYA 3M83A 2JCVA 4X3PA 4A36A 5CU7A 3X1WA 1ZIXA 2DT8A 4UE3S 3U19A 2R6GA 3DAFA 4FIZA 2C7BA 3DE5X 4UEOA 5DBGA 1JFRA 5EUCA 4IZIA 3ROPA 4ZK2A 3CPHA 3U09A 1EP9A 4QEDA 2MTBA 4CGZA 1QIJA 2CJWA 4L9SA 3A4VA 3KB2A 4QDZA 4R6XA 3QPWA 5ALYA 3V8MA 4YQFA 3M4XA 5LB2A 4AY2A 4XQCA 4NTZA 1KSJA 4QBIA 2V6GA 3L46A 3T06B 2ZBVA 3SCZA 1S1MA 5TF4A 1C0IA 3A3PA 4C87A 4ITUA 1KJIA 4KGXA 3ZHBA 5KNCD 1PR3A 4J9UE 1ONOA 2PGAA 3OKFA 2CVQA 4WK6A 1NN5A 1Y89A 5CYGA 4J0IA 1NE7A 3AJDA 1KQPA 5C53B 4JYCA 1LF5A 3T4PA 1HO3A 3A3NA 1ECGA 2KYRA 4HRXA 4EFLA 3Q8KA 5K03A 5AW0A 4NNOA 3IELA 2BGNA 4LKOA 1V26A 4J75A 4LBYA 2Z09A 2Y1GA 4NCNA 3W5IA 2VP5A 4L78A 3TFQA 4JEIA 4M37A 1AS3A 3ZS8A 4BNKA 2BEVB 4GSYA 2Y4OA 5LOVA 1RYHA 2EDCA 3V1MA 4G9GA 3KDSE 3N7AA 4NG5A 621PA 4MX8A 4QECA 4ARBA 1U0EA 1ZMTA 3GZNB 2J85A 3MWGA 2JIZD 1P4AA 4TV8B 3VGPA 2C7RA 1ZX1A 6PFKA 5DTRA 1JWAB 4Z3DA 5H4HA 3SQOA 4UEWA 2D2XA 2JRCA 3L92A 2R65A 3D6JA 2IOFK 5ALPA 2R5FA 2YHIA 4WDQA 5ICMA 3HGTA 1F3LA 3SEFA 2RGBA 4HUTA 1BDIA 1TQHA 3ORYA 4J3JA 4YAWA 5FOVA 3Q2OA 2I87A 3RO7A 4HVCA 1L7MA 4GI1A 3PENA 4RD3A 3K8YA 1ND6A 2YUIA 2W6IA 1ORDA 5IS2A 3S0JA 4W5HA 2PT9A 3T3PB 2OP1A 1IWBB 2UU9B 4OX9Y 4N40A 5CURA 4V0MA 5H3HA 1O9HA 2BV3A 2R87A 3GRYA 4M7RA 2YMPA 2YW2A 3ROGA 1BS2A 3F7NA 4KB5A 4YT5A 2A84A 2CXHA 2FWRA 2IELA 1S3SA 3WQHA 5BVGA 1TUIA 3QW2A 5DBEX 3DCNA 4L3WA 2VJMB 5KYKA 4LJKA 3VVLA 1PW7A 2NG1A 2IEDA 3C98A 2B4TO 3QEMB 1XTJA 1DQYA 1Y1RA 4QU0A 3U4DA 2XUGA 1M0EA 4O2BA 1MD9A 2YIJA 1DRUA 3RYIB 3V8NA 4IRUB 5JMPA 2AFHB 5C5IA 6NULA 2IEBA 5J9FA 4A4DA 4CF3A 3QYAA 3F74A 3EOBI 4Q5IA 1SG6A 2HMAA 4HXYA 5K9ZA 5J2UF 2HV9A 3D0KA 3G3EA 5AWFC 1UT5A 5B6JA 1Z2OX 3NFRA 1T5LA 3EFEA 4K87A 1PG0A 4JL8A 1GZVA 4DIEA 1PS8A 1JIVA 5DGIA 2ZRLA 3DE0X 5BW8A 3LE8A 4HGOA 3PRYA 1SG9A 3L6CA 3DDOA 3GGGA 4QGBA 3UKJA 4TVOA 5C8DA 3A9SA 3RHSA 2II6A 2PH7A 2FCAA 1SXJA 3UUGA 5C8XA 3WIOA 1ZZEA 3NH9A 4P2GA 4LF8B 3I3OA 9MHTA 2HA6A 3LM8A 4LQ4A 3MGCA 3MB8A 2YFQA 1ZCAA 3PT9A 2XD9A 2H5LA 1OUMA 4I81A 4HN4B 2VEDA 4MS3B 3HN2A 3O4RA 3RUDA 4ASUD 2RGRA 4G8JA 1J2JA 2O8CA 5IZCA 1US8A 3PVZA 2CVPA 2OB1A 1C29B 4YECA 3PXGA 1IL0A 4MRMA 5JRJA 4Q3EA 4BE7B 1RI4A 1XZPA 3KTOA 2IYRA 3WMWA 4I4LA 5C52B 2EDAA 3PVCA 5IWAB 3EPKA 3BQNB 1L3CA 2XOXA 4EH1A 5I51A 2XUHA 1QTIA 2F9FA 1FYFA 1QM5A 4JP8A 1T24A 3UWPA 2ENUA 5LBIA 3IJEB 2O2EA 3DL0A 2VQFB 1SOAA 2Y1LA 3SJZA 1R37A 2B5VA 1GGHA 1PS0A 2ROQA 4ZV7A 1ZJ5A 4P98A 1MB4A 3OTIA 2KJQA 3I28A 4FFMA 4X7BA 5GJWC 1DE0A 5CHYA 4IHQA 3IVCA 4QNRA 4G25A 1DP4A 5JH7F 4F5YA 4M89A 1O9GA 1EIZA 5DXAA 2FJPA 1R50A 1Z7EA 3E3LA 3OT1B 2FWBA 1WQ4A 1LK5A 4P5PA 2NW6A 5INTA 4CIBA 3KKQA 4E4YA 1C8LA 1C1XA 5AR1A 4DTCA 1FYDA 3RBAA 1LDBA 3GG2A 5IXYA 4QM6A 1V6AA 1XZKA 4LTDA 4LRSB 3GR6A 1ECCA 1UEXC 3T34A 4KMSA 2IODA 4G1FA 4I36A 4R51A 5P21A 5I45A 5DM4A 2OXCA 2WFLB 3PFHA 2WZQA 2V6IA 2YS6A 3OOEA 4MMZB 3NTUA 4X20B 4ZAVA 1ZUHA 4HKTA 1V37A 1KQNA 4DBZA 5A5EA 3FYTA 1E9DA 1Z47A 4I5DA 2X14A 4C88A 1N25A 3VTFA 4DHWA 1HKHA 1KGDA 3D5EA 1LA2A 5FTKA 1QV9A 2HZBA 5AJWA 1GGJA 1SUSA 3EUWA 4ND4A 2FB9A 3HBLA 3VPFA 4US2R 2O3QA 2V5VA 4RMIA 3EGCA 1ORTA 1EM8B 5HIKA 5HWSA 2H3HA 2COUA 1XVTA 1RYYA 4DC0A 5AFSA 3JZMA 4CR7A 5AHRA 4ZAWA 1Y6JA 4OGFA 1UJNA 2BH2A 5DBOA 1QX4A 3M8KA 4NJOA 3JD0A 1UBMS 4MWZA 2ODTX 1WVGA 2VPIA 4FMDF 4UVDA 3RIEA 2PZ8A 5IEJA 3IMCA 1NRXA 3I5UA 1GL3A 2ZE8A 1XF1A 5CB6A 5EJ7A 4PF1A 1ZINA 3GPIA 1YB7A 1ND5A 4A1FA 1QBKC 1Z0DA 3RC9A 3DOOA 3VPSA 4RC9A 3A1NA 3W06A 2FNAA 2XTZA 4YCLA 521PA 1YAHA 4BLQA 4DLWA 4FS8A 1JEQB 1P0CA 3P9NA 1IOVA 1XALA 5FFNA 2VYND 1YVDA 3ANSA 1QK5A 4HAXA 1UXIA 3UYLA 1YR6A 1J23A 2NV6A 3QVTA 3HCCA 4C78A 2GBPA 1ZN9A 2ZG6A 2C9ZA 2P3LA 4ZHQA 4TL6A 4L02A 2VIIA 1VLZA 3BXPA 3NOOA 4KMRA 5BYKA 1E9SA 3QFHA 1EM8A 3KQTA 4C0JA 1IZ0A 4QM7A 5ESRA 1NI4B 5M2QA 3ECSA 3C97A 1ODFA 1U9ZA 2NO1A 2OC4A 1F20A 2EJWA 3C1UA 3O8QA 4QREA 5AK3A 2O50A 2YZKA 1N9GB 3CZ5A 4GECA 3AK4A 3QKIA 3NWPA 5T4FA 1SVSA 3Q8MA 3BGWA 1QZ3A 4J0QA 5CXXA 2HJ9A 2JGLA 2IS6A 1Z5NA 1SBHA 3B7GA 4RY8A 4A10A 4EF4A 1JHMA 2GZDA 5LDHA 4MCIA 3THXA 5DNWA 1E1CA 1U3WA 2XLBA 3RVJA 3OQPA 4NBKA 4YV0A 4E5KA 1J2UA 1N5JA 3GLTA 1O0CA 5DLPA 2YHUA 5HHTA 3U7JA 3F90A 4ITVA 4YUXA 2CHQA 1F0YA 1NNUA 5THXA 2AI3A 2FF7A 3IERA 4IIBA 2EX0A 1ZL0A 3LF1A 4I8IA 4EG8A 5TQJA 1R7RA 5EJFA 4ER6A 5FWXB 2XNJA 3CX8A 3NXSA 3NP7A 4LHXA 4J1NA 4L15A 5DRYA 5CG2A 1U1GA 1C9YA 3JQDA 3IRUA 1A7JA 3WYFA 1V45E 4ZV9A 4EHIA 2X1VA 1Y5NA 4N7MA 5HRUA 3AF1A 4K0RA 4QTTB 1X8LA 5LD2C 3IA7A 3OLXA 5SY9A 2P8SA 4U6NA 1AVTA 2PZAA 5B2ZA 5AIBA 3LLSA 3MIIA 1QQAA 1M8KA 3T5DA 4DGQA 4X00A 1G8JA 5DEIA 3RG8A 3PGXA 4FT2A 3E9ZA 2XQJA 4QRDA 3KD2A 3PNVA 4H6PA 4LHZA 4HAVA 5DT2A 3HU5A 4AC9A 3FKJA 1JKJB 1HNNA 3CYFA 3I92A 3CVOA 4L8GA 3ND6A 4WE3A 3TQIA 3W1WA 4F2PA 8ABPA 4HAZA 3SIXA 1UR5A 1HE1C 2UZ1A 2IXBA 2MYPA 5E2IA 1A8PA 1WL8A 1JR3E 3ZU4A 3GD7A 2X5OA 3TL3A 2EWMA 1PGNA 3PC8A 1ORWA 1ZG3A 2DEUA 4MRMB 2DP4E 4YRLA 4O4IF 3P0RA 2HRBA 4KVZA 1UK9A 4WXYB 5EP3A 4AX4A 2GZHA 4JB2A 4S12A 1FRVA 1CB0A 1OLXB 1WMBA 4KCGA 4MW4A 1E5TA 4OY3A 2E1RA 3WWEA 2WTNA 3P4UA 2FR8A 2ZUVA 1G0NA 1EVZA 1OT5A 2YZGA 4Q39A 4AZTA 3L1VA 1Y6ZA 2A94A 3PGVA 4PN3A 1NSTA 1OBHA 1QDUA 3D7NA 1N2IA 2AQIA 3I2KA 4J0KA 4JOQA 3RVNA 1X1RA 2C2BA 2HJHA 4I66A 4BU0A 4BZPA 3HGQA 2QMUA 1LJ8A 2NO6A 4MGHA 4NX2A 4YPFA 2QW8A 2DY0A 1ISSA 4L72A 4MYRA 4OUDB 4G9BA 1JQEA 2BELA 2JPDA 1PW5A 3R3XA 4K81B 1B15A 3OE1A 3WRWA 2H1OA 1EK2A 4C89A 3AV0B 4CDMA 3PEYA 5CVCA 1PWZA 3LCVB 1SVUA 4G5HA 3F67A 4HGPA 4KIUA 4WN9A 3REFA 2YWBA 4U7PB 1SNYA 1UUFA 3TZLA 4BLOA 1IUPA 1UP6A 1TRHA 2QSYA 8ADHA 2BUBA 1YCDA 3BMXA 1WNFA 3HWX1 5FIUA 1QNFA 5BSTA 3T61A 5KWEA 2IP4A 2OLEA 3GFBA 4QOEA 3QEKA 3R7FA 3SN6A 3KKMA 4C6SA 1ZGZA 4DA0A 3C87A 2WT9A 3V4OA 2DFTA 3SBDA 4RTOA 2WWFA 3OFND 2YYZA 2ZJ5A 4HMQA 5MFPA 4B17A 5ESDA 2XB2A 2X1HA 4JXKA 2G1AA 4OBWA 3K5IA 1Z73A 2Y9PB 5LWQA 1U2DA 3RFCA 1W1IA 3LPLA 1T5IA 4NS1A 4U8GA 1TYDE 4KP7A 2GM3A 1TMGE 2GUWA 3DDHA 3AY0A 3HRKA 3EXIB 3IDQA 5F3DA 3S2IA 4BB6A 1CXZA 4TYMA 1NQOA 3GY0A 2X3YA 3VYRB 4A0GA 1BOOA 4GD3Q 4WKCA 4YJGB 2ORVA 3KEGA 1ZGHA 3LHDA 2FCRA 1UF9A 2BE7A 4LBVA 5JJLA 4U2CA 4PZ9A 3ZWOA 3LT5A 2XCRB 2QRJA 2B8JA 4TQ9A 1ZOLA 5BWMA 5KKCA 3E8XA 5FI3A 2HNBA 1PX2A 2VDKB 3GV0A 1YVPA 2C99A 2AWNA 2B4AA 3DV0B 3P9YA 1VYTA 2R7NA 1BXGB 4MGEA 1QR2A 2JIDA 1GNTA 4FQ8A 3RUCA 3PU6A 2I7VA 1FXWF 4ZEXA 4BZXA 4MYUA 2QIOA 4Q18A 3UA4A 3VGJA 3CXUA 2BGLA 2GBGA 1RZUA 1YUMA 3OC6A 4UMEA 1R4MB 4UKDA 5KJFA 5EJ6A 4G9EA 2I1WA 3E15A 1NNSA 3E7DA 4O2AB 3K70D 1O95A 1SHUX 4P58A 2I6FA 4V24A 1JXOA 3B1VA 4QJ5A 1K66A 1GGVA 4LXYA 4MUXA 5HW0A 3O7WA 4B48A 1O95C 4QRHA 3VPGA 1CUUA 4MB2A 2J3JA 4DPLA 2Y2VA 1EWYA 2H4HA 2G5TA 4IJMA 1I33A 4D0RA 2R62A 2X77A 2EBFX 3PDCA 4ZFNA 2XITA 2FUKA 2ZI9A 4DF3A 3DUFB 3VKUA 1H69A 4OKNA 4M83A 2DUWA 1NM5C 2W6QA 4BNHA 4Q4DA 4R8SA 5FOQA 3AHIA 3KK0A 3MNFA 5HTKA 5AK4A 2WYUA 3I04M 4G84A 4LQLA 3KVVA 3TOSA 1DQRA 1NVTA 1TYBE 4M98A 3KG2A 4GI5A 2R96A 1FW8A 4GNRA 4F2HA 3DZGA 1M1XB 3E3MA 4OHBA 4O33A 3W9SA 3IQFA 1LSOA 1UKAA 1ESCA 3TX6A 1WF6A 4Q21A 3ASVA 3I58A 1T5SA 3F9IA 4F4UA 1RAEA 3TMYA 3PDHA 1U81A 5LB4A 1S0UA 4TKUB 1TJ5A 4AS3A 3HM9A 2B94A 4IYRA 1E32A 4D81A 1TXGA 3GT3A 1D6JA 2GCOB 2WJPA 2R2GA 2J9ZB 4EW3A 1M2VB 1NA5A 2C9CA 4CKYA 5KUTA 3PPYA 2QTWB 1CQIB 3LVFO 2B34A 1QAMA 2NU9A 2GXSA 1XDBA 2GHTA 3R1IA 4LCEA 1ODLA 1RXVA 1CDZA 4M8LA 1QP7A 5K3SA 1ZVKA 1N8KA 1PGQA 3EXHB 1TZMA 2QLFA 4G4IA 2QL9A 4UAUA 1I2CA 3HJGA 2Z2ZA 3AP1A 5A9TA 4BIIA 1QRDA 3BXXA 4F4DA 2FPMA 4L1KA 4PQFA 5IJZA 2BPOA 1DWQA 1EFKA 2FLVA 1NJ8A 5AVUA 4PLWA 2O6HA 4GX2A 1JA0A 1YGPA 3FYUB 3N9IA 3KPUA 5H7XA 3VC3A 3ZVLA 4F12A 3W9BA 4BFWA 2HL6A 3AETA 3N5KA 4YN3A 2A8YA 5D00A 4W8GA 4K9DA 4IIUA 1Q11A 1RWOA 3S2UA 2C2XA 1M6WA 4E2XA 3GBVA 4TSFA 1EFPB 3OO1A 3NAGA 4MPJA 2VC2B 3GARA 5CM9C 3PUIA 5JQGA 1VDZA 3GLGA 1H42A 1T29A 4AZ3B 1YQUA 4Z5XA 2QAGC 4CR8A 3AHHA 1RP7A 5FBQB 1DUIA 1UBNA 8LDHA 2DLDA 2QQFA 4HNAA 1PZHA 3I9MA 4IAOA 4XGQA 2BEWA 2VRWA 3H42B 1RBYA 2AG6A 2FRDA 3K15A 1XAHA 3UKDA 5LM3A 4ME6A 4TYPA 2GF9A 5EUBA 2IBSA 2YMQA 3MS7A 4WXEA 2XE7A 4PSAA 5AHOA 4WV3A 3SQDA 4RYLA 3RC1A 1D09A 3EXFA 2W2VA 3V9AA 4JLOA 4F46A 4PXYA 3S1AB 1QV6A 3OM1A 3T5MA 4DA8A 2VH1A 3NYRA 1EDOA 2G3YA 4JSRA 3BX1A 4O3MA 1RM0A 2GQ0A 1KMIY 1SC9A 1EQAA 3BL5A 3EEBA 4M0CA 1NNEA 1C3OB 1DARA 4OHXA 2P9BA 3THWA 5DTIA 4PZZA 3DNFA 1L2TA 3AY6A 3P20A 5BQFA 5LD2B 4U2EA 2F2TA 2W2OA 2RGNC 1DI0A 2GO7A 4LNUB 4DLLA 5JAOA 2WKRA 1R66A 1L4FA 1S8AA 4FINA 3KHKA 4FFWA 5F7JA 1CS0A 1Y3FE 5JEDA 4HB2A 3E03A 3MCAA 2BHTA 1CLEA 1TE2A 3AR5A 3FYDA 5CLQA 1SUPA 2QM8A 5I48A 2OBLA 4ESEA 1RI2A 1MXHA 1FVXA 3MFQA 3K0CC 3R76A 4A8TA 4EPVA 5CGZA 2FPIB 3U4HA 4DIKA 5LNK6 3TZBA 1XTIA 2Y2UA 1MAHA 4R2HA 3KQLA 5K3CA 5FFFA 1ID8A 3VSBA 1U7DA 3OF2A 1OREA 4CM5A 4JLDA 1VJCA 4A15A 4RF5A 2C9YA 2VNSA 3AESB 4M2LA 3ZHCA 5JRDS 5HIMA 5DK4A 1QYIA 3H8VA 3ENQA 5DIZA 3DVAB 2IEGA 4YIHA 2ST1A 3DFMA 3LX6A 3N6VA 1JLLB 4RWEA 2ZYAA 1ZA1A 3KQQA 5EZYA 3OHPA 5JYBA 2Q5OA 3OX4A 4L7QA 5K6AC 1AGRA 1TVCA 4PU0A 2QXYA 3IOCA 1AXEA 2Y1DA 3DTVB 5HYVA 1VSQA 5F33A 1RRFA 1FTYA 1YI8A 3E9YA 2W48A 5FTWA 3I09A 4OSEA 1Z74A 3QVOA 5D7NA 5KNDD 4A8PA 3UJ3X 1QORA 4YUWA 5CR9A 4ZZ3A 1O8BA 1JDPA 1EFRA 2V6MA 2ZBRA 4FYWA 4N47A 2DULA 1USVA 2I2XB 5IH7A 2AC2A 4ZRNA 1FMLA 2PRIA 5IULC 1E7YA 1SR8A 5EUQB 2QUHA 3S1LA 4DZRA 1OD6A 3PC4A 2BHLA 4UM9D 1UJ2A 5JD5A 4X71A 1IY1A 3ZVNA 1Z2EA 2JJ8A 3G8CA 4IFBA 4UPDA 1US8B 4BUZA 4F5WA 4Z6KA 2Q29A 4R9SA 1CUSA 3K92A 3FMPB 3ZVMA 2GM9A 1E7RA 3VZBA 3G0HA 2EX1A 2XH8A 1A2BA 2B8WA 2FWPA 4QYIA 4S0ZA 1KO1A 2W6NA 4S3MA 1UJMA 3WNZA 4G09A 3GJ8A 4N0PA 1WZIA 3G23A 1MX9A 1CJTC 3IAFA 4ZI5A 3WKAA 3RQIA 3ILYA 1EXNA 1IHXA 1QOPB 5B7PA 3G2KA 4I1YA 4PXAA 3FUCA 3B1ZA 3MINB 3IILA 4LI3X 1ZD1A 1OBVA 1K7FB 2O7QA 3FUUA 1KOFA 4LDNA 4RJ2A 2WOOA 2VHYA 4MA4A 4WKNA 4F0JA 3ZJYA 2MSLA 1GSAA 1RW4A 3FB4A 2VBCA 3B85A 2YC2C 1U94A 1RXEA 4FDTA 1EQUA 2CKMA 3EQ7A 4ND2A 3SNHA 2WJAA 3LUCA 3IBFA 3QJ5A 2FN7A 3EDQA 1I1QB 3H2JA 4FPXA 3JZDA 5CH5A 5DN9A 5CB8A 3RYIA 5FA6A 4D26A 3F6YA 3THOA 3TD9A 1J1ZA 1RIFA 3SMQA 4B32A 3OOJA 5EPEA 3SQNA 5B37A 3DJYA 1Z88A 5DK6A 4JVSB 4PQEA 5FOSA 3EVDA 5TF0A 4MI3A 4N54A 1SUIA 4H6XA 3PYLA 1QK3A 5DWVA 1Q3TA 4I6EA 3CUWA 3RAGA 4EYEA 1C4KA 1U5BB 1YU9A 1Z22A 2WHPB 1TT7A 2IU4A 3H87A 4ZTBA 2HRCA 3RS2A 1GQYA 1FVOA 1H0HA 1OJ7A 1BXKA 2JCGA 1T0HB 3UAYA 5CAEA 1XXHE 3ES9A 3F6EX 1HT3A 1FFCA 1YOBA 1JSRA 1K6JA 1TVKA 2JEZA 4HEQA 4AKHA 2BKXA 4ZOBA 4OI1A 3HDHA 3W2TA 5F35A 4GMDA 3UHPA 2VF2A 2B82A 2H2GA 4EUNA 2IZ7A 1G21E 2UYGA 1J9ZA 4QUBA 3C7TA 4NQZA 2H0RA 1W0KA 4X44A 4BECA 1L7DA 2ZIXA 3DOJA 1NPDA 2CLSA 3GFPA 1T9ZA 1V4VA 1XRJA 2GM5A 2PLRA 1NBEA 4DRXA 1JXAA 4E4RA 5ILQA 1EZ4A 1MUUA 1PUJA 3WB2A 3GZNA 3CBQA 1FNNA 1G5HA 2HC9A 1V8BA 4C5CA 1YZTA 1R15A 4NPAA 4KXVA 3NVDA 3FFTA 1X7XB 3H04A 4BJ3A 1HE5A 5JC1A 3OZBA 3ESXA 3ESBA 1NMZA 3LNCA 4YAIA 1OGJA 4R9RA 1E8NA 4EEZA 4KOEC 1TU4A 4DMFA 4RTKA 1LZKA 4G97A 1VE9A 3COPA 1TMOA 4H1UA 4IIXA 1C30B 4LBZA 3N7TA 4JJKA 5EGNA 2Z4RA 2ZSIA 3AR4A 3ZHZA 5JS7A 4FB5A 2UYYA 4HX9A 3VKVA 3STWA 1E1YA 1Z33A 5ARBA 3AHJA 1I2MA 5B3JA 3C3KA 1JLLA 4NC9A 4W9MC 4W5QA 2ZLBA 4QWMA 2RGAA 4G8DA 4LMPA 3DLAA 1T3ZA 2QPTA 3OEED 3SYRA 4C0HA 4ZP1A 4S1NA 4OQXA 1BDJA 2K87A 4UOEA 3SF8B 4PVCA 1XPRA 1EK5A 1M6HA 4GPD1 4YMGA 2XNDD 3N2NA 2AFIB 4RHEA 1IJFA 2CE7A 3IQWA 5IAAA 1KRHA 3K1AA 2PQ0A 3I83A 2FY8A 4LZJA 1WF3A 4RZ2A 2GZ2A 2ID9A 2Q1WA 2I3ZA 2AH5A 2JAXA 4M0KA 4POAA 3NHPA 4XLTA 2J5RA 1N1DA 4HZIA 2EW1A 1FSSA 2IDMA 2AD1A 3RYCA 2D00A 3DTVD 1H3NA 1KF0A 1BGWA 1XJ0A 1A2QA 2FZWA 1PR9A 3GHHA 3LQQA 4HTFA 4LV5B 4CF4A 2E5WA 2XTAA 4LGMA 2VYQA 3FYCA 1DELA 4PLHA 2VDVE 1T8RA 1SKUA 5BQ3A 5I7FA 4UNIA 3PFWO 3WADA 1VRVA 1OAAA 1XWFA 3PBKA 1D3AA 3LY7A 4JLSA 3U13A 5MF6A 2O1XA 4BFLA 4G01B 1QO0A 3BIXA 5DISB 4QBHA 1WBDA 5L8VA 2EAUA 3GC6A 5EE1A 2NUAA 4EGJA 1CTQA 3FVWA 2VI5A 3N2YA 5LXTF 1RE1A 1Y5MA 1ZD5A 3L7CA 3ONFA 4DQDA 4PLGA 2PR2A 5K09A 2DWUA 1PNOA 1P9WA 2RAVA 3G8AA 1WZNA 3MS4A 1NF8A 2JFOA 2P9CA 4MDEA 3NDPA 2DC1A 3EF1A 3R7WA 3V42A 5GZ3A 2F8SA 3MTBA 1YASA 2X1MA 1I13A 1EGQA 1T0JB 2YVQA 4AULA 1NVWQ 3FNBA 3NGXA 2YL2A 1JQAA 4DGSA 4LE0A 2ZZNA 1K63A 3GQBA 1G8HA 3QE4A 2RGCA 4LC9A 5G1PA 4CBVA 2BWJA 2JFWA 2ZBEA 3X1ZA 4JL5A 3FOZA 3KYCA 4DKJA 5MN5A 1EFPA 4JJIA 4UDOA 1B1AA 1M8PA 1PT9A 2E4AA 4R8RA 5ALEA 3ZE0B 2V7QA 2GERA 3A2NA 2Y1CA 3CO5A 2PZBA 2NNLD 4B45A 3GIDA 4AECA 3PIRA 3UB4A 4H7FA 1NRIA 1IUNA 1XNJA 4IR7A 3FYUA 3FLBA 4BY9E 1XU4A 4INAA 1L7VC 1W47A 1XIVA 1YVRA 2D1YA 2MHCA 2YMMA 4INOA 4BGIA 4KN6A 1WVMA 3QNMA 4RJIA 3VU1A 3VO1A 1XTKA 1SN7A 2QRKA 4OV6B 1IN7A 1E6LA 2PSFA 4GQAA 4MQBA 1USIA 2H7VA 1CNFA 2OK7A 3NANA 2N0SA 1BZYA 1FUKA 2W6MA 2QLMA 3FGZA 4DMUB 5L6LB 4XB1A 2R8XA 5DW3A 3DOUA 1OBFO 2VPTA 3JSXA 4E08A 2F3QA 2HWKA 5HS4A 1SQ0A 3B6JA 3EQZA 2YFHA 3OFJA 1VYVA 3VR5H 3GGDA 4YALA 4EZIA 4E03A 1WZCA 4RELA 1W9MA 2JFGA 4N6OA 1W88A 1QG0A 3TNDA 1BQ3A 2TMDA 3ELWA 2IP1A 2JFVA 5K05A 4AMGA 3JALB 4EL0A 1KA9H 1YB6A 2JW5A 2XRMA 1W36B 1L1RA 1PK9A 3CUYA 1HQYE 3AUXA 2NSJA 3LWDA 2GXUA 2ZYWX 4M36A 1E3DA 3A14A 1SMKA 2FUEA 2UXDB 3WHKA 3OU6A 3TLZA 1UXGA 4G1CA 2C5EA 4GOOD 1N8TA 3BJRA 3I6ZA 3KZKA 1Y34E 3VH3A 1H0KA 2X6TA 5GPBA 1KEEA 1RTTA 3DBRB 4TTAA 4TZTA 1KJQA 1I5RA 3I30X 3OPQA 2G9QA 1XNQB 2B25A 2N9UA 1ARZA 3WMGA 2F67A 4J76A 3FCUB 1EE2A 5I8ZA 4RVHA 3S44A 5BURA 1KDZA 2YV1A 3OZGA 4F4IA 5GVRA 2P2CA 2PYZA 2QYOA 2IFTA 3SK0A 1ADFA 4RM3A 3I1FA 1SH7A 3O92A 2XNKA 1RJWA 4U00A 2F55A 1V5EA 4MWBA 4DLAA 4MUHA 3ND9A 3KZ1E 4HZUA 4LWQA 1HYEA 1PT8A 1OLUA 3L77A 3ZCVA 4ONEA 3E9MA 4N7JA 3R6GA 1MO6A 2G72A 3OO0A 5EJAA 2O8FA 3JARB 1DG9A 1K6EA 5CDUA 9ABPA 3FPFA 3JS5A 3SXPA 2QE7A 1KJWA 1JEAA 3IUEA 1X3SA 1CRPA 1DIRA 3URKA 1W35A 4BTLA 3KSUA 2DH6A 3P4XA 4IMIB 3DV9A 2W00A 4TMWA 6ABPA 1FYWA 2GJ8A 4TWAA 3W3AD 4C05A 1XKQA 4UPEA 4PGAA 2PGIA 2P41A 2ZYGA 3GDGA 4D3ZA 3KWLA 1G2PA 2O7NA 4FYPA 1P7WA 1KK2A 4DYDA 2ZU6A 3DOIA 2JLVA 1T2CA 4LGVA 3L93A 13PKA 3OM9A 1I8TA 3CRVA 1I5OA 1M6VA 4KLZA 1CP2A 1E1QA 1FFEA 1MAAA 1NC1A 1Z29A 1TAGA 2IYPA 4Y0NA 1A76A 4F86A 3TUZC 1XZMA 4TZ6A 1EX9A 4TS9A 5AW7A 1QGOA 4ACAA 2OY0A 2FTKE