4CG0A

Savinase crystal structures for combined single crystal diffraction and powder diffraction analysis
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
269
structure length
269
Chain Sequence
AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of an Industrial Production Suspension of Bacillus Lentus Subtilisin Crystals by Powder Diffraction: A Powerful Quality-Control Tool.
pubmed doi rcsb
source organism Bacillus lentus
molecule tags Hydrolase
molecule keywords SUBTILISIN SAVINASE
total genus 99
structure length 269
sequence length 269
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2013-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 4cg0A00
2SICE 2SNIE 3DE3X 3P5BA 1GNVA 1Y4DE 5CW1A 1KDYA 1GTG1 3BGOS 3Q40A 3DWEX 1ST2A 2Z2YA 3BPSA 3EIFA 1AK9A 1OYOA 1GCIA 4FONA 3CNQS 3DE5X 1SIBE 3DW3X 3WQBA 4YN3A 2W2OA 2ZWPA 1SBHA 4JP8A 1NDUA 1YJCA 3H42B 1SBCA 1JEAA 1Y9ZA 3LPDA 1TK2A 2HD4A 4H6VA 1SUEA 2WWTA 5ARBA 5ARCA 4HVLA 4NMXB 1Y48E 1YU6A 1BE8A 4ZARA 3F7MA 4CFYA 3AJ8A 2P4EA 5AQEA 1SBNE 3OSZA 2W2PA 2X8JA 3DVSX 2SBTA 4M1ZA 3WIVA 1CSEE 1SCNE 4OV6B 1WSDA 1TECE 3AFGA 1MPTA 3DE0X 2PMWB 3DDZX 4NE7A 3DVRX 1OYVA 4DZTA 1KDZA 1SCAA 1V5IA 4KG7A 1SBIA 2GKOA 5JXHA 2E1PA 3LPAA 4DJ5X 1SUAA 2PKCA 1P8JA 3UNXA 1S2NA 4LVNA 5FBZA 4KPGA 1R6VA 3DE1X 4AKTA 2DQKA 4DWWA 1EA7A 1DUIA 1WMEA 1PTKA 3DE6X 3ZXYA 3VV3A 4LVOA 4WOBA 2XTJA 3VYVA 1AV7A 1C9NA 2SECE 5AMXA 4ZOQI 1R64A 1TM5E 1OT5A 3QFHA 1BH6A 1ZVKA 4WOCA 5ARDA 3VHQA 1BFKA 1GA1A 1P7WA 1MEEA 4C3UA 3A3PA 3QTLA 3SICE 4NE9A 3BX1A 5JMOA 1AVTA 1YJBA 5I9SA 1SUBA 1GA6A 5FAXA 1S02A 1GT91 1GNSA 3GCWA 1SBTA 1A2QA 1TM3E 1Y3FE 1AQNA 1YJAA 3A3NA 2DUJA 5FFNA 1HT3A 3DE7X 3QMPA 3LXUX 1IC6A 4HX2A 2W2NA 1LW6E 1XF1A 2W2QA 3HJRA 3PTLA 4I0WB 4K8RB 4KB5A 1AH2A 1AU9A 2WUWE 2W2MA 5K7SA 2Z57A 1KE2A 1SUCA 1C3LA 2ID8A 2V8BA 2IY9A 1Y34E 3F49S 3GCXA 1BFUA 1SCJA 3D43A 1DBIA 1T1GA 5AVKA 3DE4X 2DP4E 2Z30A 3VTAA 3Q5GA 3TI9A 1PJ8A 3DYBA 2PYZA 2WUVA 1CNMA 3A3OA 2Z58A 1GTL1 1GA4A 1SUPA 1THMA 2Z2XA 3LPCA 4MZDA 1BJRE 5SICE 5B1EA 1TO1E 1WMDA 5AVJA 4CFZA 3PRKE 1SVNA 1T1EA 3WIUA 1S01A 3SQOA 2ID4A 3WHIA 3VV2A 1SCDA 3GT3A 1UBNA 1SUDA 4OMCA 2Z56A 1C9MA 1TM4E 4OMDA 2PRKA 5JXJA 5JXGA 5JXIA 4B5LA 1T1IA 2PWBA 2PWAA 3TI7A 1SCBA 4H6WA 1C9JA 1SH7A 3I34X 3VSBA 4AKSA 1EGQA 3I2YX 2ZWOA 3DE2X 1WMFA 2QTWB 3T41A 4CG0A 2B6NA 3TECE 1SIOA 1SN7A 1Y3BE 1Y4AE 1ST3A 2HPZA 2WV7A 3I30X 1TMGE 2TECE 1NLUA 2ZRQA 3EE6A 1Y33E 2Z2ZA 1SELA 2X8JB 3EDYA 3F7OA 3DW1X 4RYDA 1P7VA 1PEKE 1Q5PA 1SIUA 1WVMA 2ST1A 1GTJ1 1IAVA 3I37X 1KE1A 1TM1E 1Y3CE 2PQ2A 2G4VA 3CO0S 4GI3A 1SPBS 1TO2E 3DVQX 3GT4A 1V6CA 4H6XA 3L1KA 1PFGA 3ZXXA 1Y1KE 4J94A 2XRMA 1BE6A 2IXTA 3D9QX 5B1DA 1TM7E 1KDVA 1VSBA 4C3VA 3AJ9A 4BWGA 4Z2AA 1AF4A 1R0RE 1NDQA 1ZVJA 1Y3DE
chains in the Genus database with same CATH superfamily
3VX3A 1SOWA 4UU8A 2QE7D 1WDKA 5ILQA 3WLPA 2B8WA 2AZXA 1VA5A 3QHQA 1DKLA 3OE1A 1GG2A 1GHTA 5FA6A 1NM5C 1SQ5A 4EBBA 1YAHA 4J75A 2CHUA 3OCZA 2QAGA 3R76A 2ZJ5A 3CFYA 3RS0A 4D3FA 3HY3A 3G2JA 5FWYA 2ONKA 2ATVA 4PNPA 3GO4A 2GJKA 2C5AA 4G67A 2WTAA 5C18A 1ZD4A 4JOSA 4KIWA 2YKGA 3P32A 4RPCA 4N82A 1KJZA 1Z5WA 3CVYA 3FZEA 5FTWA 3VR4A 3AY3A 1UMCA 2BSAA 2VC2B 4KVZA 6AT1A 2QG6A 3G2PA 1ULAA 3ONWA 3LUJA 3ZZ1A 3O4VA 2EJTA 3TNYA 4X97A 4H1WA 2RIRA 4AX8A 2Q1TA 5FBLB 2QM0A 2OLEA 4F2DA 3N2LA 3DKIA 3I2IA 3NHYA 1WPQA 1J21A 4N12A 2HNKA 3OWHA 2B94A 2CCGA 1AZWA 3BH0A 4RKFA 3ML1A 3QVWA 1G8JA 2ZCUA 4ZT5A 1XZAA 3B13B 3EGDA 3L0IB 2NV2B 4R40A 1M1ZA 3CEMA 4OHXA 3FNBA 4JLPA 1OFUX 2EXXA 1AKUA 1CR6A 2H2IA 3C8DA 1WQ1R 2ZZNA 3KM0A 4U00A 3OP4A 4B7CA 4B6JA 4LK3A 3AHFA 2ZBQA 4KV9A 1VKOA 3F6CA 1YJBA 4P4NA 3SQDA 5U9CA 4GLOA 2WVJA 4MVWA 2PO7A 1L5WA 1BAPA 4G41A 4Z4GA 2RB5A 2C5FA 3KOYA 4YAOA 5M5BA 5AFSA 3PTLA 3LRTA 1PTJA 2GN2A 1MEOA 3E3AA 5H4HA 3WRXC 3QF4B 2Q4BA 3AXSA 3JQRA 4IJKA 2DP4E 1Y8RB 3FFXA 1YVPA 1RMYA 1AKEA 2EW8A 5ALQA 2PL9A 2QL7A 4DLVA 2GSWA 1RD4A 1SUPA 3DMHA 3FOBA 3RSZA 3DXYA 4FYMA 3SBDA 3O75A 1QKJA 4YXFA 4U5QA 3HCDA 4HAVA 3PJFA 3JAMA 3QJ5A 3FWKA 3VISA 2Q2NA 3WHIA 4ESHA 5MFZA 2GUWA 4HRAA 4MPJA 4Y1FA 3SHQA 2FPSA 3IHLA 1D09A 3Q5EA 4DNXA 3QOFA 3WL8A 1VIVA 1RU3A 5ADWA 2FW0A 2XZDA 2C4HA 2IYSA 4Z51A 1ISIA 1KU6A 1YRBA 3LE8A 5F9MA 4AKSA 4LYEA 4KNVA 1G8AA 1T36A 3ZWMA 2FKNA 1JEYB 3QUSA 5HZMA 4G5XA 4LGVA 3H86A 1NLUA 2J5BA 2GN8A 4QC2A 4NS4A 4XFKA 2D13A 2SCUB 2YV4A 1PJ4A 2IKQA 2VWGA 3PB3A 4RE5A 5F51A 1GPH1 3ZUGA 4GSKA 2HREA 1V8BA 2R5NA 1HWYA 1NVKA 1L5GB 2VDWB 5GVSA 4LSWA 1PLJA 1XEWY 3BA1A 4IG4A 2ORWA 4IVNA 4D6PA 5EKXA 1A0OA 4AJJA 2DCUA 3UK6A 1GUFA 3UWOA 5A5GA 1R7RA 1V11A 4BO7A 3BWEA 2AC7A 5I9MA 2HSDA 5CH8A 2BTQB 4KO1S 4L73A 3VZPA 2GVZC 5ICEA 1QQAA 3BL6A 2BP7A 3TS1A 3BF7A 3IULA 3G1TA 3EMBA 1FL9A 2V7QD 2R8OA 2RHGB 4DLBA 1DKNA 1WLYA 3ZGNA 4WJLA 3DPUA 2CHVA 2AJ8A 5ALIA 4EJ0A 3F46A 2ZWPA 4LBYA 2AFIE 4FOSA 4S1OA 2V7TA 2NSYA 1GGFA 1GILA 4B3SB 1KDOA 2GBLC 3T7CA 3JTMA 3TB4A 5EL0A 3I6IA 9LDBA 3G2LA 2V55B 2B4KA 1M1XB 4II7A 2D8AA 5FBWB 4F3KA 4QPCA 3MAJA 4PG6A 4K05A 2BGNA 4RABA 3OZCA 2ATCA 3GRZA 4MS4B 4DEYA 3PFNA 2OZPA 5BWNA 1IZ7A 1YR8A 1MAWA 2BHTA 1PJLA 5BO5A 4NE7A 1T29A 1V5GA 3TN7A 2VNSA 1NF9A 3KQOA 3NLLA 4UUBA 1K3TA 1Y1SA 5H70A 5G41A 2HRBA 1OFHA 2QRVA 1U2QA 1NNUA 3KEGA 3T7JA 2B1IA 2EIHA 4TWJA 1R9NA 2CNOA 2HWXA 3BYZA 3KT8A 3Q3EA 1MO5A 1LSJA 2O3JA 1Q14A 3WIBA 1MHTA 3GVXA 1L5HA 2BC9A 3EBLA 1QIJA 4FIDA 4GC5A 4N40A 5DBFA 3CLTD 5FOTA 2WU8A 1XALA 3H11A 4W4TA 4Z0PA 4NXMB 2OP0A 4YPVA 5BWMA 5FTLA 3JD1A 3V55A 1GLNA 2A92A 1R27A 1FP4A 3AQ4A 3FGZA 4NPCA 3AEZA 5I9SA 4AS1A 3IR6A 2CLDX 2I1QA 3K8YA 3O8LA 3KJQA 3QYJA 4EUHA 5I4IA 1QYWA 2H07A 4L72A 3W7AA 3DOIA 4OMFG 3B5IA 3EC2A 1FXWA 4S1WA 3GLIB 3ZHXA 4L5IA 4F45A 2AK3A 2YZMA 4BIMA 1EB8A 3W9SA 1QUEA 1U2SA 4S2EA 1THZA 2OD9A 2PH5A 4M0UA 2QORA 2B21A 3ZTYA 1LS1A 3AB7A 3QF7A 4JLSA 2CMKA 4MQBA 3KCQA 2X8WA 3C7AA 3QE3A 3DOHA 4MV4A 4AF8A 2NTVA 3PNVA 4P4LA 5DGDA 4EKNB 2NZXA 3N0WA 3IOYA 4A8JA 4IQGA 2FPUA 2BKEA 4MUYA 4XX0A 3BT7A 2X5NA 1OHHD 3TDKA 2IEBA 4AMUA 3NDRA 1U02A 3HVIA 4JC5A 4MDYA 4ZC1A 4ZVLA 5CT4A 4CEJA 1JFRA 1EK2A 2AHOA 4IHKA 1PUIA 2VYNA 1JYSA 1EKXA 3SS9X 3OA0A 1UMBB 2PV0A 4RF2A 1NDHA 3HXPA 5LD2C 3CIFA 4EY8A 4DJTA 4MRMB 2X7HA 4DJEC 2QLBA 5BSEA 2P9HA 3B3JA 1KYVA 3VJRA 4GPZA 3AFNA 4JS0A 4NY1A 5GPBA 2TS1A 3SEAA 3PPVA 5ELMA 4ZEOA 4A0GA 4JYPA 5ER9A 3QITA 1R0WA 4AD8A 1L3CA 3BUSA 2IGBA 1KJJA 1Y7LA 3FF1A 4XGRA 4YLGA 4J9VA 5JHGB 5JRJA 3ICEA 1C0KA 1TTQB 1GPBA 3CNLA 4GMDA 1U0NA 3FUTA 3PZRA 4OA8A 3L7DA 4O02B 1E3IA 5ER6A 1XMOB 2JJ1D 1QFMA 1UBCA 3TQQA 3F3MA 2C58A 3AL3A 3U40A 3EOBI 3R9KA 1Q0SA 1WKVA 2ZYVX 4J03A 3DW3X 2XBUA 3HWRA 3WMEA 2FPLA 2X9LA 3IELA 2DG2A 1ELOA 1U9ZA 3P0IA 1I4EB 3KB8A 1MA0A 3HFGA 3ZVKA 1JG6A 1TMKA 5FJIA 2ZQZA 1ESNA 1SWVA 4NCJA 1C3OA 4INAA 3WIVA 4E13A 4QTTB 4YAWA 3J80A 1ODTC 2PNFA 2VDWA 3DR5A 2W6NA 3CPHA 3Q3IA 721PA 4GPAA 4JODA 1JU9A 1DIOB 4R2MA 1G8KA 5FEUA 3H1BA 1Y4SA 4HQFA 5HBRA 1V11B 3JAKB 4LRSB 1JT2A 4PTZA 3OE5A 4YEDA 3R75A 3PXXA 5ICGA 4BJ5A 1MMFB 4YRKA 4BJ3A 5HF6A 5JCOA 1IIBA 1MC5A 2WHPB 2BP7B 3EVBA 4FOOA 3OQIB 4JUIA 4IDDA 4UNQA 2ZP1A 4CLXA 3TSOA 3FKSD 4UVHA 4A10A 3M6XA 3KKMA 4XYEA 5JANA 1GADO 1N4DA 4ZAWA 5CD1A 2R1ZA 4UNIA 2YJNA 1B8OA 2UYGA 3QKUA 3DYVA 2WNIA 2XWBF 3RWOA 1HR0B 3CB4A 3OZTA 4LXGA 4LOAA 4RK6A 1UUFA 1PWHA 4NMLA 5KWIA 5H0IA 4YK7A 4YASA 5TEVA 1QYXA 1I30A 1QFJA 2Y8EA 3KD2A 3CRRA 1CDZA 4KBGA 4MLZA 3WGGA 4J29A 3KSDO 4IEEA 4A82A 2P7IA 1J24A 1EEXB 3H9CA 2WHRA 3H0CA 4BVHA 5K7SA 1DIAA 1NT4A 1RC0A 1Z4PX 2GM5A 2H48A 1GRRA 2OV3A 1RWBA 2CLHB 5ALZA 2IYEA 3IQGX 3QE4A 4GF5A 2HWYA 3KVYA 2K4MA 4WNCA 1BOFA 4TV9A 4W7SA 2NP7A 3DB1A 2XSZD 2HR1A 2LD4A 4HNGA 1FXSA 1U8FO 1IEQA 1GU1A 3E7FA 3PWZA 3RV4A 5JVDA 4FOPA 2I62A 2RC5A 1TT7A 3KT3A 4C78A 1NMQA 4Z2YA 1BXRB 1R8XA 1P74A 1L5HB 4JUCA 2ZANA 3D4PA 5LL6P 2PGXA 1J33A 3KXIA 1M33A 3HYCA 4FFPA 4WQMA 1WDWB 2WFLA 3UMJA 4Q4CA 1KOLA 1LLFA 1T9AA 3LM8A 3HDGA 5GIPE 5TLSA 3MTIA 5F98A 2O3QA 5H7XA 4MR8B 1I94B 1DDOA 1SBYA 3SZLA 4LVNA 1VDZA 2WV7A 5CFOA 1OI4A 4EHIA 4KACA 3W3AH 4L5AA 1M1NA 1V1RB 4CETA 2HA5A 2JVKA 4RORA 2NSHA 3T5TA 3EC7A 2PT6A 2N47A 3CTMA 4Q48A 3M34A 3KFLA 3GLHA 2OLKA 1P0QA 3W9BA 3THWB 1YDGA 2N42A 1C7QA 1YL5A 3QELA 3N2IA 1V5FA 4Y6PA 1AF4A 3BE6A 1QUFA 1ZU4A 4FZJA 4NR0A 5LIRA 2M1XA 4ZRDA 2HK7A 3F98A 3CLUD 3KLNA 2E4ZA 4A8JB 4K87A 3M1IA 3OO0A 3OJXA 1DQYA 1EM6A 3DWEX 1XZKA 4QUJA 2H85A 4O59O 1V43A 4UEWA 5I7UA 3DC7A 1GPLA 5D5PA 3KZXA 4HC4A 5NLLA 1G7RA 2VJQA 3C0KA 4O2BB 3KSAC 1EUCA 2KW5A 1ZN9A 2QD4A 3UBMA 3PUWA 4K1LA 4OX9B 4IRMA 3W8NA 3DTVA 1KEVA 1TAUA 3G2OA 1C3JA 5IK2A 3HWX1 4GC9A 5CX1B 5HKLA 2JCXA 5DGHA 4HVTA 3MTBA 1DINA 1NP7A 2EBFX 2W2PA 2XE6A 4HDAA 5C31A 3KSUA 3WYDA 1JWBB 3OZRA 3QFCA 1OI3A 3OX3A 3TZCA 3GYBA 2GJAA 2HO4A 1Z3CA 1HT2E 3FOZA 1JHYA 4N3CA 1ISPA 4G86A 1HL3A 1JAYA 5AI9A 4X1IA 2ZRIA 1EZZA 5JSKA 3TCXB 5AW2A 3B7PA 3KU4A 4DR6B 5JXHA 1KK3A 4JLBA 2XUIA 3ZVMA 2QLTA 4HLUA 1L7AA 3DE1X 1HDIA 3BDIA 3R3UA 3SEQA 2O1WA 2Q50A 4Z8XA 4AKTA 4E3WA 1ZUWA 3H5NA 3HB1A 1NN1A 1TC1A 4DUPA 4URXR 1WBJB 4C6TA 1NF3A 1ULTA 1XZQA 2XGGA 2JJ1A 1FS6A 3C3KA 3R3YA 4HJXA 4FFLA 1QS0A 4QUIA 4RWEA 1RXVA 4ANFA 5IHXA 1K5PA 4ZKEA 2FB9A 3ZU4A 1KYZA 3EMKA 4PZZA 4OXIA 2HA0A 4P7GA 5EVJA 4A92A 1YFJA 5FAXA 4A8JC 3C1UA 2BFWA 2HADA 4N5MA 1A69A 4B09A 3JQCA 5AW0A 3PSHA 4DGQA 1SVUA 4JXJA 5MGNA 5AM5A 2CDAA 3EFHA 1U7PA 1WETA 3H3XA 1P4RA 1Z83A 4DHWA 2WTNA 1YQXA 3ILXA 4J4BA 1NVEA 5HIJA 7AT1A 1QGZA 4HQNA 4PCLA 3O92A 5HWSA 4PFQA 4RYLA 5LM3A 1KZ4A 4XVRA 5IHPA 3SP1A 5G1PA 3EVCA 1DO2A 1G2OA 4GR5A 4PLTA 3PD0A 4HWPA 1PL7A 4Q4JB 4QPJC 2V6MA 5LA6A 1TLLA 1ZI9A 4BO6A 5FULA 3F71A 5JS2A 5TSDA 2Q6KA 1Y3HA 2QSZA 4LDNA 3EQ9A 1X38A 3JAKA 4PRZA 5AVJA 2B98A 2OR3A 3ELUA 1YCDA 5AUQA 1FNMA 4AICA 4O4IF 2OBMA 1ZMRA 4ZTBA 5GJWC 1E1CA 4TUYF 2JW5A 3EGXA 1K8QA 4WESA 1PR0A 5DT9A 3ADOA 3VNSA 3PC7A 5CXQA 3U61B 4YTEA 4O08A 1P2GA 4OQFA 1JEQB 2NLOA 4MWSA 1F6BA 3R1IA 2P1ZA 3HU1A 3BHJA 3R0XA 5INTA 4D9MA 4FCWA 3G5AA 4BMVA 4NULA 4YT4A 1PT5A 1VL2A 5B1IA 2ODWA 3CW8X 1SHUX 3PRHA 4RMGA 2JFHA 4EIWA 1U1IA 3CX3A 5BQOA 3HY6A 1OAAA 1S7GA 3DF9A 2XA9A 4AZWA 2W4MA 4DQDA 1JWLA 2FSHA 2DQSA 4WWHA 4MQFB 3A1CA 3WIOA 3IQDB 2ZCJA 3RC3A 1VJ1A 4GEKA 1MZVA 4S12A 5AM4A 1QG6A 3QXJA 2PUCA 3AX6A 2CEKA 4B46A 3ZJTA 4UUQA 4CU2A 3TRIA 3SDSA 1FDWA 4HXYA 3NVDA 4JBIA 5JVDB 3A7DA 4P92A 3Q40A 2FWRA 1YBAA 1XEXB 2J3IA 4Z0TA 2I67A 3X1XA 1JEYA 4Q3BA 2W2OA 4N8DA 2O2JA 3N07A 4KJXA 1GPWB 2PSSA 2SCUA 4PLVA 5DTMA 5KTNA 4RACA 1KTIA 4IW3B 4K28A 3K2IA 4B74A 4EB3A 3QLUC 3R3XA 3LHFA 4CM3A 3CT4A 2HA3A 1R10A 3R2JA 4QBHA 2P8SA 3NB0A 5DULA 4MR8A 1W1WA 4DUGA 3IB3A 4WN3A 3Q7RA 3HUDA 5KTOA 3CUEF 1M1NB 5CA0B 3TMAA 2FHPA 3QNMA 5TQ2B 2Q7DA 3THRA 2JGMA 2R1TB 1LGYA 5KTKA 5IT4A 5K3AA 4PQEA 1Q6YA 2IP4A 4J1QA 3FYSA 3NBFA 1T6YA 4KIUA 3ZOZA 1W48A 4B3TB 3L4EA 4AZ3A 3LPAA 1EGMB 1TIBA 2OZLA 3LKVA 3JAWA 4O1IA 2P6PA 4BMNA 5CUQA 4R1LA 3RBVA 1CK4A 5G02A 1MB9A 4MJXA 5J1TB 1QGUA 1ZMBA 1GDTA 3PUZA 5AXCA 4CIDA 1J0EA 1CVRA 1ZYUA 4AY4A 1EU1A 2JRLA 4DEXA 3GUHA 2AOUB 3OIGA 5ADUS 1Z8NA 1SG6A 3TPCA 1AD2A 2QT9A 4XJSA 1NLMA 2WM8A 4GOXA 1EUCB 2GK4A 1SUBA 2X0NA 3DJYA 2C2KA 3HBJA 4C01A 1O96B 5KREA 4LNUB 2HIGA 2ZUEA 4G0YA 1IDN1 4JJGA 4OQEA 1FU8A 4KFTA 2H59A 4DMLA 1CE8A 2D1QA 1PFVA 4KV7A 5IC6A 1KIMA 3I52A 1UDXA 3LUCA 5IDVA 1ADGA 4U7WA 4RKEA 1VP3A 5B36A 5EEHA 5B2FA 3OI7A 1ZO8A 4Q0MA 1EIWA 1JI0A 3SSMA 1VPWA 3K70C 4BRUA 5CAEA 4QTZA 2QJRA 3GLGE 3JYOA 1T1JA 2XITA 2ODPA 1MC1A 1II0A 2EQ5A 2P9ZA 1ZW1A 3GN2A 5KAMA 3RYFA 4Q3CA 4PNZA 3FYUA 2LDXA 4MQ5A 4L4UA 4BXOB 1HZZA 4G65A 1UJ4A 5K8IA 1FB5A 1TM4E 2P0AA 1E1RA 4U9IS 3CCBA 2EJCA 2V97A 3DZJA 3VDQA 1YHYA 4N6NA 4U0KA 4YRFA 5ALHA 1G59A 5KYXB 1YR3A 1X15A 1CVIA 1YA8A 3SHTA 5CDYA 3SVLA 2P4SA 2IBMA 4XUDA 2FEAA 2FH5B 4NF2A 4XM2A 6LDHA 2ZSKA 1PEKE 3KVOA 3ORSA 1P3Y1 4FCCA 4N0PA 1TTPB 4P7JA 2J6IA 3AFHA 4ZMSA 1G4UR 3ZX5A 5JQGA 1L4BA 3A6GA 4LOKA 4MV9A 4WKCA 1A2OA 1NNEA 1YOVA 4K2AA 4AN4A 1RQ7A 2EARA 1E5DA 2CL7X 4Q4JA 3OM8A 4EGJA 4ZYTA 2RGNC 2DWQA 3IQHX 4BLRA 3PUHA 1D7OA 2JASA 2CEAA 4CNQA 1FYEA 4YJHA 4UXHA 3UB3A 1JJFA 2HQ1A 3H2SA 2Y9PB 3R7NA 5HKOA 1YTLA 2GCOA 4OI4A 4QELA 3OCJA 1H65A 1OLSA 1C41A 2JANA 2AXPA 5LCXA 1UK7A 4CEJB 2NG1A 1J56A 1C9KA 1E1CB 1VE6A 1WB6A 2Q7XA 2VAMA 3LY7A 3M0EA 3EXHB 2IYLD 3ZY4A 4KKVA 4UREA 2WJAA 1LLCA 1TQ2A 3D54D 5BW4A 2AVDA 5I01A 1Y1PA 4IO1A 5FO1A 4LNHA 4KHZA 1FLDA 5D3KA 4RPHA 3HHEA 3GJ5A 3A7EA 3D02A 3E22A 3LY5A 1ADJA 1XWWA 4GKAA 2AEFA 4Q37A 4RD4A 4ZDKA 3G1WA 2VYVD 4FHGA 3BMNB 3EYAA 2G5CA 2XF8A 4HLUC 3NPAA 2A1UB 1OSNA 1FCJA 3OCVA 2XR1A 3AC0A 1T9GS 4WASA 4KZKA 1NASA 4CV1A 1CEQA 2WAAA 4UFPA 2OSBA 3IXQA 5ITVA 4QDJA 1NRWA 4MJ3A 5FP0A 1P5ZB 4PS1A 3UMYA 4OH7A 1VGVA 4XIYA 3W04A 3VOTA 4V0SA 1K86A 5ESRA 4F0JA 1WZIA 1Z22A 3BGSA 4WEOA 4KXUA 4H1VA 1M5RA 3LPLA 4MGZR 1A1VA 2GN9A 4OCZA 5LDDC 3KOZA 2IIVA 3VJMA 3EZXA 1GA1A 3K0AB 1NOJA 2Q4RA 4BB9A 3KZMA 3TSWA 2BELA 2J5KA 1PVDA 4HNQA 3I4LA 1V48A 2KWIA 4CLHA 1H2WA 1QH1B 2WIDA 3JATA 3P2KA 4IIYA 4O63O 3AKDA 3LU1A 2BFCB 3REQB 1QO9A 1R0CA 1GUAA 4A5SA 1ZAYA 2QTTA 1PK7A 3GY0A 4UBLA 1UC5B 3MELA 1B26A 5U4XA 3RSQA 3MT7A 3EFBA 3KIPA 2Y0EA 2OBXA 3A31A 2Q4EA 1MNAA 1BRMA 4JFAA 1CXZA 1E3MA 3DAPA 3DO6A 2WHPA 4FILA 3LQ4A 2IYXA 5FORA 5HUQA 1LTQA 5LP6C 3BEOA 5ERGB 3DLTA 3OLZA 2WAYA 3U7FB 3ADDA 4PN3A 2MR5A 4EG8A 3IHKA 4EO4A 3H7IA 4HDKB 2O59A 3FDIA 4AN1A 1E2IA 3JAWB 2ZRDA 5BV7A 1Y6JA 3L0OA 2W6IA 4OFZA 3ST7A 3F4KA 1CS0B 2PCJA 2JAXA 4M36A 2VP0A 5L7TA 1MRZA 2Q8PA 4QTXA 3WNDA 2DTXA 1S2LA 1IPFA 3B60A 1BHSA 2IF0A 4Z3DA 1HNWB 4DJDC 1OMOA 2Z9CA 2ZUBA 1XQ9A 3VR5H 3VSEA 4BTVA 1J1UA 2BUAA 4D4IA 3R44A 1RE1A 1ID1A 1QC5A 2V4MA 3EULA 3SU8A 4BEBA 4FIZA 1PG5A 2ONZA 4O4LB 1DMSA 1NN5A 1W1UA 4YECA 5LP6F 2HXSA 3BULA 3UHOA 2BFBA 1ZK4A 2GPBA 2BBTA 3DP9A 5K51A 2AXEA 4XUGB 5IF9A 1IATA 5C1PA 4AXXA 4DCCA 3DHVA 1KBOA 3ONEA 1WEKA 4HR7A 1EDOA 3TM4A 4MRVA 4O4HA 3FHJA 3KZCA 3LT0A 1POXA 2NXNA 4GPBA 1TZJA 5JV5A 4TQGA 4YQYA 4RS3A 3GX1A 1SXJB 3FVTA 4U2KA 2WFLB 3P5BA 2O3SA 2HY7A 4M0MA 2HXYA 1OBVA 2QD5A 4QYWA 2AG5A 4ZYVA 1XAHA 3IUSA 3KFXA 3CNQS 3GJ3A 2EKLA 1PZHA 3DE5X 6Q21A 3FBTA 2QZJA 1N8TA 3HKCB 5CLQA 4ITUA 3IEXA 1DUVG 1R4MB 2XVXA 3KKEA 1SUIA 1PR4A 3RKUA 1XRRA 2H0RA 1R12A 4JT8A 3TEFA 1WXDA 2C00A 2ORVA 2XJ9A 3L79A 3KSRA 4GMKA 1MA3A 5U1PA 1VCNA 2VHVA 1B6TA 3PU6A 4WCFC 3BWVA 4PO9A 1H66A 2YYSA 3MJVA 4YUYA 3G8DA 5ES4B 5HJ5A 2FPRA 2M6SA 3LBYA 3GFGA 4US2R 2QAIA 2ZTMA 1Z88A 5BMVF 5IWAB 1FFXB 4R41A 3U80A 1SA0A 3U4QB 2C3UA 3DQPA 1DDIA 2ATXA 2ZTUA 3WK5A 4CI9A 1PJRA 2CNDA 4WACA 4G0XA 1E2NA 2H2GA 4O2RA 4Q01A 4ER3A 1PFWA 2WABA 3A1UA 4Q05A 5HBGA 1U2DC 4AUMA 2AHRA 2GZ2A 5TS3A 4P53A 2SKCA 2H11A 3ETLA 3GRAA 4F2HA 2B3DA 3UENA 5ENVA 3QTTA 2QBYA 4V03A 2P75A 5GZ3A 3NP9A 2FUNB 2GCOB 3N74A 4FGWA 4ASUA 2WB4A 1G8YA 4QTYA 4FDMA 5TMBA 4PBTA 4BPRA 2XE7A 4NJMB 1ADBA 2X86A 1VLLA 2PQ6A 2VKQA 1OXVA 4R0VA 5K8JB 4J7UA 2GI4A 1GJRA 1YDHA 5ALRA 2XHZA 4OK5A 2GYVA 1GFSA 2F64A 3F6BX 3L0YA 3FTNA 4P7KA 2FUCA 4QFCA 3WS7A 1QR2A 3E22B 4E1VA 1HDCA 2JB9A 4LXXA 3LCUA 1AQNA 1E2HA 3COYA 3OQ6A 3N6VA 4K8RB 4TROA 3RS2A 2ENWA 1U0FA 2JAWA 2QLNA 2P68A 2XLCA 3PJRA 4QIHA 3CR7A 4RTKA 3Q5GA 1E6UA 1KZ1A 4KQKA 1EA5A 1AN9A 3UAZA 1YS9A 1JEOA 1L4UA 3DTNA 1ENPA 3K96A 3L7OA 4MRAA 3OD1A 4C30A 1UEJA 4C6TB 5EWJB 2CZCA 5FOVA 1U65A 1V2GA 2HDOA 2VP4A 2WG1A 2VSOA 2H1IA 4QECA 4UULA 3STHA 2I4TA 3B6EA 3DSRA 4YRMA 4JI7B 4BAGA 3ETCA 1GFIA 3F2IA 4IDOA 1SM4A 4TLMB 2DAPA 1GUDA 4BY9E 4RVSA 4U7GA 3NJRA 1WSWA 3O95A 4C0XA 5KZMB 4PQYA 2BF7A 1MJHA 3EIWA 3W5JA 1UWKA 3P52A 1I4TD 1TU4A 1XZMA 2VZ0A 4PWZA 3KEOA 2A3RA 3IQXA 3ODPA 3LYAA 3PDIA 2IV7A 3IKMB 4E5KA 1L5QA 3EOZA 2Y3IA 1TGYA 2BFCA 1TJ3A 2GHTA 2FW8A 1XTRA 2IDZA 2OP1A 5CT6A 5F2NA 3NWBA 3ZDRA 1MCZA 1ZJYA 3ZV5A 4U2EA 4CM9A 5FL3A 4IVRA 3DVQX 4RQBA 2VHUA 2J0UB 1WNTA 2PD4A 2HPVA 3FNFA 1NMSA 1KL7A 2HGZA 1DCTA 2P27A 3NW9A 1OYWA 2DWUA 5IKXA 1MRSA 3CEAA 1U7DA 3EGXB 4V0RA 1FFHA 3G5TA 2J7PD 1KI1A 4E21A 5FLYA 1M5UA 4YI3A 2QMEA 1XLWA 1Q17A 3PXBA 1GZ5A 1N2CE 5FBHA 2PO5A 4URVR 2C4TA 2J0VA 1JSLA 3I45A 2W6PA 5FWDA 2I2AA 4KMRA 3X1KA 4ZJZA 4U7HA 2V1UA 1FMJA 4OJMX 1V7QA 3GEEA 4MUXA 1XLUA 4Y1GA 3U44A 5KC8A 1E5VA 1RNLA 3CE6A 4FFBA 4ROTA 5E6UB 5F2OA 2V7WA 4HDNB 1XKLA 2PZMA 5A62A 1NFRA 1T91A 2B4AA 1FTSA 1PE0A 2YWDA 3JR3A 4ZT6A 1ZWLA 2A14A 3AKCA 3VHRA 1OPXA 2J9RA 4G8CA 1SJ9A 1T24A 2XCUA 5J4VA 5KCMA 1H8ED 2YV5A 2WYHA 1VJCA 5C3UA 5JJIA 3TLBA 3A11A 4OX9Y 3TUZC 4IZHA 4LJKA 3QUQA 5DT2A 1NHGA 3WIDA 2O4UX 1P8AA 1UFQA 1XZ8A 4BNHA 2H17A 2QPTA 2VHTA 3P9ZA 4BE7B 1P61B 2IYAA 2ZYUX 4O4HB 1UFVA 2OHGA 2ZRGA 3KVRA 1QF7A 5T4HA 4C05A 2WTBA 3KB6A 1MAHA 3S44A 4JL8A 3V9PA 3FSGD 1YC5A 1EDEA 3R5XA 4KQXA 1I13A 3AUAA 1PQ4A 5KJCA 1EVEA 3B82A 1ZLXA 4GYYA 1PYDA 1D04A 1EGVB 1KI6A 1YIDA 3UB2A 4FX5A 4I5EA 5HJ2A 1MGPA 3MWDB 3RADC 2V54A 2ZIAA 3GD7A 4X91A 1JDUA 2VQSA 3L9XA 5T8KC 3X1DA 1MC4A 2NUBA 1YS2X 3HKCA 4GM0A 4RGBA 1R4MA 5IVPA 4PLHA 5GVRA 2NSJA 4DNPA 2NADA 2JJMA 2OBLA 2PSDA 3G0BA 1FDTA 3PE6A 4KX5A 2IOFK 3MS7A 3ZNPA 1RYNA 2GA8A 5TQ2A 5EIAA 1FVXA 2E2WA 3IDQA 2VHZA 1C14A 3MTEA 1EFAA 1IC6A 1JKMA 1QLWA 2W2QA 1HDRA 4QUBA 5F5NA 3ZHBA 1M2FA 3F9IA 4X24A 1MN6A 2OCYC 3QXHA 2MYUA 5LA6F 1X94A 3UJ9A 2CD9A 1IBLB 2R84A 3C16C 3DAYA 2CWDA 3K1ZA 4Y6OA 3K6KA 2Q3HA 3KLMX 1EGAA 2G04A 3R3JA 4FHEA 4G4SO 4YCCA 4KOAA 3AR3A 5ECGC 4G8JA 5FI0B 5CK4A 2BEKA 2OWEA 4FLFA 1EFVB 1U0OC 2AOUA 2V7UA 3RTBA 1SQFA 4O1HA 3WR5A 4LBVA 3JQAD 3R8FA 3ROFA 3TSZA 2XNKA 2B37A 4LYDA 4IO0A 4OFWA 2PCLA 3FVRA 1RI2A 5LFAA 4D25A 5JXIA 5A6VA 1BCRB 1CZHA 1XJ5A 5CEEA 3I3OA 2B7LA 5IDXA 1D2CA 4KFSA 4QVGA 3JYPA 4G24A 3I30X 3VO1A 1QYIA 2BIFA 4GP7A 1PBTA 5FBRB 1KORA 2UZ3A 3D31A 3HPRA 3ASUA 3W5VA 1ZGGA 4HMQA 121PA 2X1HA 5FUQA 4P5EA 3K0EA 1GLGA 3BCHA 4LJSA 4W8OA 5BVGB 5IH7A 2H6EA 1G8PA 1NJGA 2BEUA 5JY1A 5LKAA 1E4OA 1N1EA 4GI7A 1UZMA 1K0FA 1DELA 3FFTA 1NDQA 4TXMA 1IXKA 3V42A 4DDTA 3DKKA 3HJBA 1BFDA 4D8XA 1YRLA 4LC9A 3D6TB 3TX2A 4F9TA 4A6EA 2NT3A 2D0PB 4JYCA 5NULA 4LAFA 2Q07A 4XDGA 4CKBB 3R24A 3DYIA 4ILKA 2TMKA 5KYWA 4OJTA 1G3MA 4N8EA 4YDQA 3UUEA 2Y76A 3ZE1B 2D8MA 2PL5A 2QMYA 2XMGA 3SF8B 1L1RA 2B8NA 1JWAB 4ETNA 5CDFA 3LFTA 2P3LA 4JSRA 4PYOA 3ZE9A 3SIRA 1E9EA 3SX2A 1RYHA 3NS7A 5HYVA 1YE8A 2EKDA 2I71A 1CRZA 4JDPA 1HKHA 1EXDA 1JT9A 3AJ8A 3R4VA 4YJ3F 1THTA 2XJ4A 3RYTC 2WHEA 1WEHA 1T8YA 2I80A 4XFDA 5HKAA 1I2MA 4YJHB 1T9ZA 3MRXA 5DHPA 1W36B 4QDZA 1R15A 4UMFA 2MSCB 3GJRA 1BS1A 1OBOA 1ZUHA 2Q2WA 5TGZA 1OLSB 2GK3A 4MINA 3FPHA 5KNCD 2LIPA 3DTYA 3D5EA 3EEQA 3EXAA 4RCVA 1HDEA 2ZS8A 4ZO8A 5MDHA 2BUBA 1K0UA 1PFUA 1UK9A 3I6QA 5EPEA 4ZJPA 1TZ2A 1Z4IA 3E05A 1E99A 4TTPA 5AOVA 3VYVA 4AY3A 4BBZA 4DYVA 3CM0A 3L8FA 4BEWA 2AZ4A 2IL1A 2A3NA 2AKAB 1KS2A 3QGMA 1ULHA 1P9RA 3OX1A 4QO8A 3U44B 1E5TA 2G7ZA 3QVKA 2YNMA 1BW9B 4FFBB 3E6AA 2AYYA 2IPXA 5KCZA 2A1UA 3U49A 3MCUA 2H5LA 3TNJA 3TIXB 3QFSA 5J2UB 2FGKA 4ZQFA 1PGJA 2DECA 1H93A 4NIMA 4LDAA 1L5SA 4LV8B 3FETA 3ZTWA 4D56A 5HIAA 1GGNA 2G1UA 2W4QA 1ZJJA 3JYNA 3L6EA 3Q3HA 3OZUA 4Q7LA 4RE6A 1X70A 4YCDA 3FD8A 3IVCA 3SOPA 4AO6A 3AR7A 3EB9A 1RI1A 1W4BA 3DE4X 3F90A 3IJRA 3ZWKA 1DPGA 1SO8A 4QM7A 3H5OA 2A5DA 4C7XA 1H69A 2QR5A 4EUKA 1AKRA 5SICE 1R4NB 2NSDA 2WD7A 1GIAA 1JXQA 1ZNYA 3UW1A 2E21A 3RK0A 1LWOA 2Q9CA 3WYGA 3A27A 1ZCZA 1MT3A 3PHCA 3WJ1A 3C14C 1D2NA 2GVDC 4TKZA 4YO7A 3M5PA 1T2DA 5KVCA 3L7AA 4S3MA 1NW9B 4NEHB 4ARCA 1FMLA 4GX0A 4P86A 5EESA 2GM4A 3F4BA 2C2BA 1USGA 1NBMD 2OC4A 3BWXA 3KALA 3OM9A 1EK6A 4QICA 2R79A 3I0MA 5K1ZA 1C80A 2E6UX 4OQPA 4V3CA 1DP4A 3OT5A 2PR7A 4XD7D 1P0IA 2VP6A 2ZB2A 3ABSB 3LWNA 1KZ6A 1U7XA 4YT2A 3UA4A 3CH5A 4HRVA 3RVPA 4AG6A 4ASUD 4ZVOA 1DZIA 1KE1A 4MVYA 5K2OA 3GFSA 5IBQA 5C8YA 4LG1A 1OZHA 2FJUA 1NOKA 2IEIA 3WYBA 3NYQA 2XUKA 4GAEA 2H5IA 3PQFA 1F0PA 1P9OA 4HDKA 4B3GA 3BRCA 3AHJA 3U4DA 1GZSA 2GPAA 5JAHA 5JT1A 1F8UA 3DOFA 1I3LA 4REQB 4KE9A 5KDOA 2DJ5A 3P5SA 1CEEA 1X8XA 3PITA 1G38A 2ZE8A 1EFVA 1ZXBA 2GKSA 4L51A 4G5RA 5AJUA 1P91A 1X7DA 1PGPA 2VEDA 4IJWA 1E0DA 2IHJA 4G5SA 4RFLA 2H4WA 4AYTA 1UQUA 1WAMA 2C0CA 4FZRA 4UAVA 5LLDA 4LZWA 4XRGA 2FVYA 2RH9B 3CW9A 2WG0A 1GNRA 2Y1FA 1Z0FA 4ZXPA 4ND1A 2PMCA 5TPWA 1FFAA 3LQFA 3WRXA 4B0OA 4TZTA 4BNUA 3ZDQA 3IEIA 4DG8A 5ESXA 5KIAA 3RUPA 4HZUA 5IJWA 1OWLA 5AI4A 4O0LA 1LJ8A 5AVZA 1M6EX 2XQKA 1R6DA 2G0NA 5CR9A 4J0QA 4I8DA 3K8ZA 3SKVA 1K5GA 3R20A 5BOSB 2PKCA 2P2DA 3A4LA 3BCUA 4BVEA 3VZBA 5HZKA 5AM3A 3R9WA 1OXTA 1YUBA 1JHOA 3TZKA 1IG0A 4F06A 3AKZA 2YJ4A 2DPMA 3H1TA 3HN6A 4D9CA 1U94A 1XAIA 4WOCA 4DF3A 4OXKA 4TYMA 1KEWA 3UV7A 4LF8B 2VNKA 2G06A 4RK7A 4BX0A 1Z74A 1U0LA 3HL0A 2O5EA 2FSSA 2JKYA 4Y0VA 1PQWA 1ZN8A 1UFRA 2V9ZA 3BWYA 1HZJA 4P3XA 4QFDA 1FFXA 4F3NA 3NAQA 5HXAA 3A3NA 4OGKA 1L8QA 4NICA 5HCUA 1O94C 4KUEA 1EDZA 4JJKA 1XOIA 2G1AA 3DV0B 1JHMA 2QI9F 1WY5A 2XXBA 3A3YA 3EDCA 1U3VA 2ZBDA 3AHGA 4DBLE 1BU8A 3NYWA 3BQMB 2CXOA 2ZVDA 3P7MA 1OIVA 4IX1A 1TKAA 1C8LA 1XMIA 2WF5A 5FL7A 5FT9A 2QN2A 3BJMA 1GKYA 1KRHA 5BY2A 4JIMA 5E4FA 3GBSA 3DEYX 4KWHA 2ZI3A 2GN1A 3BFJA 3KQWA 1ZMTA 5L3SA 1KR5A 1IVNA 2B8TA 3BH6A 3C3WA 3T5BA 4H7EA 3E3MA 3QBDA 1FRNA 3TTWA 1QKIA 2C4VA 2FX3A 2VCEA 2YHAA 4C03A 4IG9A 1R0YA 2EX1A 3L49A 3FNEA 2HO5A 2ISSD 2YICA 1JHAA 1VRWA 3N2GA 4OMDA 4P7FA 1DJPA 3VDNB 5JALA 1X9IA 2EFCB 2OQIA 5CIQA 1N3YA 1CVLA 1ZRMA 3E35A 3UOAB 1A8HA 2XOEA 3B6IA 2F3QA 1RWVA 4JL5A 4OHOA 3GFRA 2HU8A 2GPWA 4WGGA 2VPQA 1L3IA 3AUSA 3AR4A 5CYPA 1WHSA 4Q93A 2FEWB 1ACMA 2Q5EA 4K6FA 4BRSA 2CV0A 3CLRD 4JKYA 4DM7A 1U2RA 2BGUA 3FKSA 2QQEA 4IJMA 4M87A 4UNRA 3A9WA 4JEHA 5G4KA 3PIDA 4CXMA 3AL2A 4JV5B 3D9QX 1JU4A 1T2FA 3M9WA 2G80A 3HSYA 3EWIA 3T15A 3AYXB 2QVLA 5A4DA 4F4HA 1G7TA 2F3RA 4TWAA 2P77A 1DGQA 3E9QA 1NPYA 5J59A 3TQOA 1BDBA 4PHCA 5E4YA 1P2VA 3MWEA 2I2CA 4JLMA 1YHNA 4UVEA 1UEXC 1K5HA 3NXKA 3NXSA 5JW6A 3LNTA 1ZC4A 2JFWA 3DCNA 4X6YA 5DV9A 1LQ2A 1Y8AA 3KU1A 4PHHA 1FYDA 4AS3A 2Q8NA 2FPIB 3A6LA 3NHRA 3I05A 3IX7A 3PUJA 4RHXA 1YHZA 4F11A 4X65B 3P0FA 1BTOA 3CZQA 1QNFA 4DNQA 3EW9A 4AJ9A 2WY2D 1IXZA 2LCFA 3E3LA 5DMHA 3WAKA 3ZU3A 2IUYA 1Z8FA 4J76A 3VR6A 3NNSA 3V1KA 3OTWA 3J81k 4L8GA 4RLFA 5KSYA 2HV8A 1EUYA 1M34E 3PC8C 4CIAA 2IITA 5H16A 4G36A 2DC1A 3LA8A 1SK9A 3NKFA 4HGZA 3T7AA 3RIEA 4F1KA 4K8OA 1V26A 1JAZA 5EMJA 2R5FA 2GOYA 1PJZA 4RV4A 3T0IA 4RK5A 4L22A 4REQA 5GZ6A 1C5KA 3JPYA 4G25A 3TIVA 2JFFA 3W05A 1OLOA 5HR5A 4RY8A 3ZI7A 1E2PA 1NYTA 1XRMA 3IJ5A 5DYNA 4W6QA 3TLGB 3VPSA 4AZ0A 4G1CA 3JVIA 2ZB7A 1CUUA 3VHQA 5KJ1A 3OOJA 3QY9A 2DEUA 1ZUNA 2P3QA 1NLYA 2OB1A 5CYGA 3DLPX 3AI1A 1KP3A 4YRQA 3ZYCA 4EB0A 2WAMA 4L3VA 4L7QA 4OHKA 5JH7A 4G09A 2N75A 1SHZA 3OHPA 3EMDA 4M3NA 1T0IA 5TGDA 2PT7A 3WNCA 1E6CA 3JD4A 1QBGA 5CDGA 3R7WA 1TAGA 1Y34E 3MMSA 2PM8A 1U4NA 3BK2A 4J1TC 1DEKA 3SE7A 4D46A 1SC3A 4Y2HA 3KDSE 4C4AA 1U3DA 2WYVA 3IP5A 2PX3A 4QARA 2HF2A 3A3OA 3E2MA 3T6KA 1V4NA 1KI6B 2P9CA 3O2QB 4XPZA 4QEDA 3IPYA 4LDJA 5B1EA 5BXQC 3MILA 1E79A 3IEKA 3QX8A 2PSHA 3U0VA 4BFVA 4U9UA 2P2ZA 3RI3A 4NYMR 3SQOA 3SR0A 2VA8A 4GBED 2Q2VA 4WXHA 1ZM4A 3RBXA 1BZYA 4IGAA 3TWOA 3TTSA 2XZOA 4J0FA 3HZOA 2V59A 1X7ZA 2FF5A 4Z7OB 2C7QA 5DHTA 4OQNA 4C14A 2JFBA 1F2UB 1TYAE 1UKBA 2N3ZA 2DFNA 3I9NA 4WXMA 4A03A 1PL0A 4XSVA 2BFAA 3IV6A 5ISMA 3A4MA 1MV5A 1F2VA 2VR1A 1I9GA 1CJVC 3PR2B 4RIGA 4UARA 4FM9A 3I01A 2DHDA 2PPVA 4B4UA 1JJ7A 1F5SA 5A0VA 3PLAE 4Q1AA 1ZNXA 4KUGA 1TZKA 1PSZA 2QU7A 5KVVA 1DT5A 2IEAA 2W00A 3N0RA 2ZSFA 3FLAA 1IBKB 1JQBA 1AQ6A 2LVBA 3GJ7A 2FWJA 3C6XA 1P2TA 4K6GA 2IXTA 2FEOA 1M2NA 3LDHA 4IJVA 4WLOA 5JMWA 2WLSA 3R0QA 5BN3A 5F9HA 1H2HA 1XZNA 3PXDA 4CQLA 1AUPA 2CLLB 2J48A 1YZVA 1MOZA 5HGJA 1Y4DE 4YRTA 2JBHA 2KI5A 3T3DA 3WGMA 1GTG1 2WTEA 1R66A 2ZQ5A 1KP9A 4NBRA 4ZREA 3K30A 4B1FA 3SVTA 4MP3A 3UAVA 4ZHQB 3A9RA 1SU7A 1NURA 3CJQA 1X1BA 2IDJA 3P4YA 2E5FA 4R1NA 3PIRA 4U6QA 4YHBA 4KR9A 3SZGA 4AJOA 1N34B 5IJXA 3H18A 1SBZA 1ZIPA 4PRKA 4BO5A 2Q1UA 2X42A 4GBMA 2YN4A 4OYRA 4FFDA 1PRYA 1UK8A 4NOLA 4CT4B 2C5BA 1XXHA 2VHCA 2WAOA 3WWCA 2FR0A 2FY8A 3IQFA 3LLUA 2QRUA 3ENWA 3ROPA 3JQDA 4YP1A 3TF5A 1QU3A 1R0XA 4AQYB 4AIRA 4EKIA 3FCCA 4KQ9A 5J5VA 2OC9A 3M5WA 4X9XA 5CJPA 2V5VA 3TQCA 1ITZA 2ZDHA 3OZSA 2PLWA 4OMUA 3TD6A 2WWGA 4BEVA 1N9GB 1R1DA 2XPCA 1OCEA 3MYRA 4KQGA 3IQWA 4M9ZA 4Q9IA 1K68A 3CSDA 3X1YA 3UV6A 1T9GR 3LBAA 4IIEA 4OOEA 3C5HA 1U0TA 3GLKA 2HSJA 4I6GA 1P2SA 1QDEA 3IUMA 4A1OA 1MB3A 1NKVA 3W9UA 2O06A 3A6ZA 1P0FA 3ITNA 4CM9D 4DM4A 1CP2A 3GYGA 4DB4A 1T8SA 3G2MA 4KE8A 4HQOA 4DCSA 3RAFC 5KNLA 4Q4HB 1JX6A 1P75A 4NCHA 2FR8A 4KE6A 4PO8A 3Q2OA 4X8OA 1WHTB 5KTRA 4GHWA 2QMQA 3MCWA 5JMOA 1P1HA 2WIBA 3EEIA 1GPMA 3OF3A 1UAYA 1TDJA 2A67A 2VPXA 3ND9A 4RZUA 5AUOB 1YRWA 3P9SA 4J49A 1BH2A 4XWOA 3FPBA 1W85B 4N6OA 4KGZA 3FWYA 4BEJA 5KYTA 3OZDA 1FYXA 4R69A 3VNAA 4C76A 5BN4A 4PAMA 4F04A 1YDFA 3LHSA 2BKXA 2XMZA 5K09A 1C8BA 1TZBA 4MYHA 4I3HA 4C6RA 2UUBB 5IP5A 3IKVA 3ZK9A 2NU6A 1IZ8A 2R6R1 1F8GA 4UAJA 1U3UA 4N7JA 4HFRA 1BN6A 1OR8A 2Z30A 3RU7A 3MLBA 2XMDA 4CKXA 1JDBC 2NIPA 4X6UA 1W2GA 5G0VA 1PDWA 4EW3A 2RI6A 1AKTA 2G28A 1KO1A 1NRJB 4XWYA 1TLFA 1E96A 1Q1QA 4X64B 1EFTA 1HQDA 1S3SA 4XFJA 4FHDA 5ED0A 5JDCA 1Y6QA 1KDRA 4WA7A 4UHFA 1PJSA 3RIMA 4EGAA 1RQRA 4UHDA 2VK4A 1BKSB 2C5SA 4AZ0B 1ZIOA 2F90A 2NO7A 2ODTX 3IE1A 5JEEA 1OV4A 5HQJA 1Q84A 4H3VA 3EW7A 3CVJA 4K0RA 1ZUNB 5DNAA 1NU8A 1L4YA 2O6LA 1F1BA 4OQMA 3I64A 3H8VA 3KSZO 4PFJA 621PA 1CHNA 4ID9A 1EE1A 5IUNC 5JH7B 5IAOA 3IEPA 1RYFA 1JEJA 2V4ZA 3IKJA 2GCPA 5M3BA 1SU6A 3YASA 3TQHA 2YX1A 4N47A 1UOOA 3FN4A 3L8CA 4E09A 1BXGB 3DZBA 3UWKA 2W5UA 2AJTA 3GZNB 5I9IA 2XKAA 4AX4A 4QGGA 1KDVA 4I5IA 2XUHA 1YVEI 3HRKA 2WIFA 1NQOA 2OCIA 2YV3A 4ZU1X 2YH2A 3T12A 5EIXA 2XDQA 4PYLA 2LCIA 3KBBA 4KMSA 4L78A 4AAYA 3ETJA 1H6CA 1NJFA 4BLTA 1M6WA 3L43A 1ZONA 4FWBA 2BLLA 3EDMA 4L4YA 3ZS9A 2FW9A 3U19A 2HC9A 1EZ4A 3ADCA 5L9AA 1EJBA 3IPCA 3L7MA 4DRXA 1GXSA 5D3QA 5H9VA 1D1QA 3PLNA 4JJAA 2QNRA 4ZO4A 1CJCA 4O2AF 1I4OA 1JSZA 1OFIA 1JE0A 5B3KA 2HDNB 5AQEA 3A1DA 3HYTA 4KAXA 1XDSA 2P30A 2XUAA 4HJRA 3V48A 2RH4A 4KXFB 4LYAA 2FX2A 2COEA 2MOKA 4PM4A 3U4MA 1K4KA 1W87A 221PA 2FEXA 1E1RD 3GLRA 3OFKA 3FDZA 3IBSA 1U7HA 3PWKA 3ZD8A 4D96A 1SBIA 1R2QA 1BX3A 4HUQB 4FDLA 5FUWA 5KQMA 1TVMA 3TLYA 4IMJB 4OA5A 4JLDA 1RXEA 5B3AA 2MSEB 3M1LA 4GWGA 1ZOSA 3UJ7A 4B9AA 1WLSA 2C8KA 4NC9A 4RFSA 4AUEA 3V8NA 4KIJA 3DH0A 4UCFA 1NG1A 4TL7A 2C2YA 4HYQA 3AJEA 4IMPA 3LCRA 5T4BA 1V47A 2PAAA 1TM5E 4ZHQA 1Q16A 3D1JA 1JSRA 4HDRB 1AV6A 1BEEA 3IAS1 4URHA 3ANTA 1LC3A 1KZGB 2NXWA 3W34A 1QDUA 3MGGA 3MTGA 5BP7A 1UC9A 1ZD1A 1QSGA 4YPFA 4IKPA 3KG2A 1G20E 1J90A 1TKBA 4TTRA 2FF7A 5EMHA 5FWAA 3C98A 1M8PA 2GERA 2IYQA 4Y1RA 3RJTA 3ZDZB 2ZJYA 3BXEA 1KRXA 4ZMRA 3AG5A 4E1AA 4HMOA 1S3IA 2DH5A 4XGNA 1B6GA 3VM6A 3WSWA 3OMLA 3UJ3X 2W48A 1Q21A 1E2JA 3ANXA 3LPCA 4G1EB 4RO0A 3M6FA 4GL4A 1M75A 3AZPA 1SB9A 4E3ZA 4F93B 5HKKD 4PZUA 3CEHA 4BNIA 2FETA 3RC8A 3K9QO 3O47A 4M6WA 1S01A 2PVSA 3FPJA 5H3HA 4BWFB 4DV7B 3QEMB 4NP6A 1WCXA 1E9VA 5F2EA 3GLVA 3RAJA 4F5WA 3DEHA 3FHTA 5REQB 2PIDA 1KZ9A 3AHDA 1VBFA 4OQLA 4UQPA 4BQOA 4YA6A 1XU7A 2BKLA 4FEGA 4YBZA 1SH7A 1Q11A 3D4IA 3RARA 3U26A 3T1TA 3NO4A 4IFTA 2VT7A 5DK4A 3H5LA 3O9MA 3QTBA 4HS9A 2O54A 3HKDB 1OAOC 3LLMA 4YRIA 2ZRBA 3GEDA 4WY2A 5IM5A 3K0BA 1GTVA 4WKGA 1GNTA 4OEHA 3N5KA 3SFZA 3WWEA 2CXRA 1QFYA 3OOYA 4PE5B 2C1ZA 3V32A 4ZGWA 4O2LA 1A7AA 2PSFA 4BWVA 1K8YB 1U4OA 4M7PA 5IJ9B 1CCWA 1Z62A 1EH5A 2B3TA 2O50A 1U6JA 5LXTB 4ZC8A 3T5CA 4DQVA 3ZDCA 2M9MA 1V96A 5CX4A 2JGDB 3RBAA 3UKOA 3SJ7A 1CULC 1N2EA 3LPMA 1FLVA 4TXLA 4UKDA 4BFWA 3TGLA 3OCYA 5F7ZA 5JCZA 1J8MF 2ZBFA 4HGPA 4I99A 2I1WA 1H1TA 2Q5JA 3IILA 5JYCA 1C7JA 5JMPA 2Z2YA 3AR6A 4MLPA 4QASA 4UC0A 3G9QA 1XZHA 2D5BA 3N8DA 4TS4A 5EIBD 4ZAXA 1LJUA 1T2CA 5K99A 5JS1A 2AZMA 2ID7A 4RQUA 4AMYA 3ESXA 4IDFA 2NZJA 4K6OA 4PLWA 4EBFA 1SXJD 2ZFUA 3MFYA 1ZH0A 1RWPA 1KVTA 2BJVA 1BHO1 3F97A 2FMXA 1P72A 2BH9A 4INPA 4HBGA 2A58A 2YWBA 3B8EA 1DARA 1CUDA 2CL5A 4TXNA 3RIYA 3H99A 3U1VA 3T34A 1U9IA 1FTQA 1U8CB 2L17A 3GRRA 2IHBA 2CLCX 1RLTA 1FVOA 2X19A 3E0QA 4FB4A 1AXEA 3BFPA 5EHQA 5E6SA 1KY3A 4J0JA 2XEDA 5EI5A 1Z13A 1G19A 4MWEA 1VHQA 3WBBA 1QB7A 4KQIA 3LWZA 3DKPA 3NWEA 4NL4H 3KQKA 4MCJA 4BGEA 2G72A 3R5KA 2BGLA 5K0CA 1JYEA 1NN0A 2EWMA 4EI2A 1L6IA 3MC1A 4Q03A 4FMCB 4IKEA 4ZYUA 1XTIA 1FSPA 1L7XA 3CX8A 3O6VA 4EFNA 2ANBA 3D0KA 3OKCA 4NCXA 3PDHA 4BV3A 1E64A 1JXAA 4H0NA 1FDRA 1U99A 1WXHA 2JJ8A 1G63A 4GDMA 4J0HA 3FJYA 5LU8A 1G6KA 4TXHA 5JSZB 5CURA 2FMTA 4OLAA 4DRXB 1ZZGA 4D74A 2H3HA 2RGCA 2DLNA 1I3NA 4UPEA 1HQYE 4C7MA 4RJJA 1E6MA 1F51E 2DMRA 2CZQA 3CKKA 3OURA 1SKMA 2VHQA 1P6UA 1SQ6A 1Z7WA 2Y4OA 3SD7A 3TXYA 4FGZA 3UFXA 3WHPA 1G21A 4EUEA 3LIIA 1CY7A 4GP9A 3CC8A 5EUMA 3OIWA 3A36A 3EZ7A 4OATA 3UYKA 4ZP1A 4DA6A 1QG2A 4M1QA 1RTTA 3DYBA 3MB5A 4FWIB 3GLUA 3F3YA 5HHTA 4YT8A 1T5IA 4GSYA 1P5JA 4KPFC 4YRZA 1SKYB 2IX9A 4U02A 5DBGA 5ELXA 2DCMA 2V6IA 1TUEA 4FYPA 4MW7A 5IYZF 3NJ8A 3IO5A 1QJ4A 2OXRA 4LI3X 4IH1A 5B12A 2DU8A 2B1QA 4CEHB 1NVXQ 1LLQA 1CQJA 1QHHB 2VUUA 3NR2A 4DS3A 1IN4A 3R6TA 4JBNA 4LQ4A 2VOEA 4K6CA 2BTOA 4UBIA 5FOXA 3ZCQA 3ORYA 4NAVA 1Q95A 2IYOA 1PVOA 4F72A 1ST3A 4N54A 3ER9A 1EQ2A 4PCAA 5IEJA 4Y6QA 2QLLA 4ZAYA 4Y1RB 1VHDA 2FZCA 1VPEA 2MJLA 4JQCA 1KNQA 2XXAB 3C8HA 4ZEWA 4HI0E 1TCUA 2JGRA 4KGDA 1PR2A 2VS1A 3LCVB 3O4FA 4QNNA 5FBQB 3A4IA 1NSYA 1DG3A 1WB9A 1D6MA 4ENPA 2FZEA 5DYIA 4YJKA 5BR7A 1A4XA 1NC1A 5KKCA 1GGHA 2GXQA 1GAWA 2Z6QA 3MUFA 3QFHA 4YMVA 1ISRA 1DRKA 5CPFA 1J9ZA 3FYCA 1F2UA 4MCIA 4FFWA 5AD1A 4M6WB 1EBUA 1AM4D 2RC6A 3VOBA 2Y67A 4WAUA 1TUIA 1X7YA 3ZIUA 5K9ZA 2V9CA 2VQ6A 3SIPA 3ZWYA 3IQEA 1N2SA 2R85A 2C4MA 2FKAA 1QXSA 1X3LA 3P97A 2QXYA 3RT9A 4GX5A 4XTCS 5B53A 2HT1A 4NABA 2F59A 3IE2A 4LV5B 4E51A 2J59A 1D03A 3O8QB 1ZY2A 3L7CA 3WMXA 4WT7A 2OD2A 3TQRA 1TQ4A 4CUKA 1YK1A 4G97A 3GJ8A 3SFVA 5KEIA 3PGLA 4FFSA 1DRJA 4MGEA 4D8YA 1QO0A 1SCNE 3LVQE 2X8AA 1N5JA 1N92A 2BFFA 3FJOA 4LRQA 2OHHA 4KXYA 4OP2A 5JLAA 3WLNA 1P31A 4D8UA 2QF7A 4JVLA 4NK5A 2QP9X 3EIOA 2IS4A 1QLJA 4Q7MB 2BFDB 5TV2A 1KVQA 3D0OA 3K8QA 1NXPA 4OGFA 3EPHA 2IGTA 3GUZA 4W99A 4KJZA 1BVHA 2PS0A 1W5SA 1Q1ZA 4D3XA 2A9FA 1ZINA 1CQIA 2MT9A 1VE9A 4UOQA 1WR8A 3WZMA 1KEZA 1T2UA 1WOYA 2N1BA 3A9UA 3IUNA 3QVLA 1UXOA 3FPFA 3TINA 3D0RA 5EXPA 4NBLA 1H1LB 2JAUA 4BNGA 5I7HA 4IGKA 1X77A 4FJ0A 1S5PA 1F60A 5G0TA 2FQYA 4UU0A 4JGGA 1FDUA 4MUMA 2PLFA 2W6JA 3RUDA 5HRCA 1PJCA 2M98A 1HE3A 1L5VA 4QA9A 1CU1A 1S02A 4TV9F 1UJ2A 4L4SA 2HMYB 1NVTA 4B7AA 4CLDA 3G17A 5IANA 3L0PA 3WBFA 2NGRA 1N9GA 5KYUB 2GN4A 4Y2PA 5K0JA 1CJTC 2AMFA 4KAFA 3SAJA 1ILEA 1LZLA 5HX7A 4Q3EA 3L4JA 2WZBA 1G98A 1R5OA 1RJ9B 2C2XA 3D43A 3WKDA 3ZY6A 4IDGA 3VMMA 1ZJWA 2P2YA 3D6AA 3DFZA 2Z08A 4NU0A 1BO6A 3HN7A 3ORRA 3WO1A 2L0XA 2QIPA 4B2YA 4X6LA 2RGYA 1IZYA 1OBCA 3ENNA 4OHMA 2XLBA 2AF3C 5JJLA 2OT3B 1DFHA 1ODJA 1WM1A 4JJ8A 4M76B 2LNDA 4XGIA 1KAQA 1NLFA 4JJ4A 2YWRA 1CDEA 1WHTA 1SHTX 2WIGA 4P0QB 3W8FA 1U5BA 2NSLA 1T6ZA 4PIMA 4TWBA 1W75A 4IF4A 4LZOA 4RADA 3QKRB 4QRHA 5B4VA 4RV5A 3UMMA 3FVQA 3UPUA 4E5DA 3R40A 1YVDA 4JI0B 2FWPA 1NY5A 4PQGA 4HAWA 2HPZA 2Z3WA 4P2BA 2VAXA 4C4SA 1DXOA 3VR6D 3FWNA 3KQPA 4IIBA 4EPVA 3U1BA 3VVCA 1KVUA 1SIUA 2ORED 4JC8A 1C7IA 2JIZA 2XNDA 2QGNA 4G81A 4MCHA 2BONA 3ACCA 4M55A 2FWNA 3RGGA 3GGGA 4DC9A 1JH8A 4RGQA 3V1NA 2FHSA 2YXLA 1GRNA 1S3GA 3FGNA 3KTDA 4N65A 5EYPB 1ISSA 2M6RA 4G4JA 3HWSA 2C2ZA 2IXAA 1W94A 3OICA 1ZMXA 4ZVSA 2H7XA 3BB4A 3VX4A 3G6KA 5LQJA 1WL8A 2AXNA 3SGLA 4KR3A 2ILTA 2BFEB 4LXUA 1MIOA 4R2IA 4I4TB 5G0SA 3RYIB 3EBOA 3AVOA 4C08A 5FV4A 2BPOA 3IS3A 2DY1A 1H5UA 4Z9XA 1PGOA 4PF1A 3H5AA 5BQXA 1UPCA 2WAXA 1VJGA 5C5EA 1PVVA 2Z4RA 4NZMA 1MUUA 1D8AA 4ZCQA 2OMEA 4J91A 2D6FA 1QIIA 1NQAO 2WIAA 4JLKA 4MV1A 3UTCA 4C4ZA 3BXZA 1TW2A 3C4VA 5J2TF 3HEAA 3O1JC 1Z35A 1LRLA 3BSSA 3ENVA 1T5TA 3H2IA 3NORA 1KKMA 1TAQA 3QPBA 1QVRA 1JLLB 1FBTA 3PGKA 1OYVA 2Y9MB 1I5EA 2CYBA 2EU8A 4MKXA 4B81A 5LYJF 1E77A 4V2IA 1QE3A 2JK0A 5JG7A 3I6MA 2P79A 2C2MA 3GQVA 1R6VA 1XA0A 4MTCA 2V4UA 4N01A 2P5YA 4QGFA 4Y2SA 3TZQA 3DE6X 4DKJA 4LVOA 5FR1A 2C97A 3T3OA 4ETWA 2YW9A 1GXSB 4BV9A 2AFIB 3GAAA 3S8EA 3AVWA 1X7YB 4XVUA 2YUTA 2C9DA 2ORYA 1XZBA 3CW2A 2WKPA 4NK4A 1M0TA 1WDLA 4NBUA 3K1JA 4KE7A 3RTEA 4HNSA 1TJPB 3OECA 5BUZA 1LI4A 3FTDA 3L93A 1OPRA 6ADHA 1AUVA 2B36A 1DKRA 1R74A 3EPRA 2JJQA 1T34A 3BMOB 3EGWA 4R1PA 1LW6E 1XF1A 5JTUA 1AA6A 1Z82A 2A1TR 2LRHA 3D7LA 4HUQA 3V3TA 4TUYA 1YKSA 2PWYA 2VF4X 5CP8A 4MAFA 5EJMA 2XY4A 5AVKA 4FGUA 3TL6A 4AF7A 4CLEA 2ZAIA 4W5QA 5HMLA 3W0LB 3DDCA 2A2ZA 2O5CA 2DUUA 1OA1A 4DR3B 3GG2A 5L3RA 3MQ4A 2I9KA 1G8HA 1VE3A 2NX2A 1FLAA 3WYAA 2XQFA 5AJXA 5E3JA 4YIKA 5HCNA 3EZ6A 2HLHA 2VDKB 3V8BA 1ZBQA 3TRJA 5B4TA 2VPZA 5EHXA 1SCDA 2QWXA 3ZZNA 1C0PA 4QREA 2VUTA 3G2QA 2WTUA 3K9GA 3V1TC 1J8YF 4IHQA 5DVZA 4YV7A 1RBYA 3F74A 3QUTA 4FYWA 2ZUWA 3Q7EA 3GN1A 4WNIA 3JRNA 3WIEA 2R00A 4YROA 4MRSA 2HRCA 1TUGA 1UDRA 2QZ4A 3NKLA 4J3JA 3SJAA 3K1AA 1WZCA 1EBFA 1M7BA 2JNWA 2Q3LA 2ZWVA 4NU5A 1YZFA 1MQ9A 4LX0A 4RFVA 4DN6A 5IN5A 2ILVA 3EWSA 2EG5A 5E2IA 3Q41A 3D8RA 5KYUA 5E4TA 1YA6A 4Q7QA 1S96A 2IYPA 4B5KA 1X2BA 4OGWA 1JDJA 2VJKA 3R0VA 1O0CA 2I6XA 1IUOA 4YGXB 1G3IA 3WLLA 1TZMA 2F2TA 2VJOA 3WRYA 4EJ2A 4MKRA 3SYLA 4P82A 1RLMA 2X76A 4LFCB 1WB5A 5A3RA 4EW2A 1CUAA 1OTYA 3O5AA 3AF6A 1UMKA 4DM3A 1ORHA 2HDHA 5BNTA 2HBYA 3CZPA 4MKGA 1DJQA 4IJUA 1U5BB 4P81A 2AOXA 4QODA 1C4KA 3BS4A 1JQAA 1QZXA 3HZHA 4HB3A 4JP5A 3LPDA 3WADA 5M04A 3ITEA 2ATIA 4DQKA 1QIEA 5CB4F 3OP1A 2G09A 3L1IA 4R5HA 1J8VA 5DBOA 4PYJA 1JZSA 2HU7A 4BLPA 4FEEA 4M0EA 2Z9DA 5KYYA 4NV0A 5T3YA 1X2EA 3G85A 2XRZA 4YCLA 2I6FA 1L8LA 4R1UA 2JGDA 3BQ9A 4LF6B 3B7WA 4LY9A 1G1MA 1O3YA 3I5MA 2UZ1B 4MMYB 3L8DA 2AH5A 2E7ZA 1JFTA 3UKJA 4PPQA 1RRFA 2JJYA 1U98A 4BZZA 1UC4B 2E1PA 3I2JA 4LQCA 4LOIA 2AXQA 1WP9A 2BGKA 2BI7A 2I76A 4JCCA 5JQGF 1JAIA 1YMVA 3CUWA 4D0RA 4EHKA 1DUIA 4B75A 1ZHFA 1IEXA 3L06A 4WOBA 1JR3E 2FLVA 4DANA 4C0BA 1JE1A 4FYHA 4M0FA 4JLUA 2CLMB 1OGIA 1MIOB 3HBAA 3OLVA 3RYIA 3WX0A 4B6QA 1X1TA 2MSLA 5A2GA 10MHA 4XGKA 2BUCA 2VYND 3A0RB 3UAWA 3EIEA 2PTHA 1B8NA 1V35A 3KE8A 3Q7PA 3BSYA 2XKBA 1A9OA 4PZYA 3VHXB 2ZITA 4DDKA 1ZJ5A 2RJOA 5E6SB 3I9KA 3HBNA 5EZYF 5FNVA 3B1KA 3SJBA 1LX6A 1UPAA 1N36B 4I50A 4QQFA 3EAGA 4E5PA 1DQZA 2C4KA 4HAYA 2IA5A 3IR5A 3PEVA 4CPDA 1CY6A 3CURA 4CQMD 1CNEA 3E1SA 1ZSYA 1C0EA 3KR1A 1YS1X 1XVIA 2DKFA 1RSZA 3OJOA 3TZEA 4BX8A 3UOGA 2QAGC 3MT9A 4I46A 2Y92A 5E7QA 2BGTA 1G5TA 2ADOA 3JQ7B 3L82B 4R81A 4UBMA 5HW0A 3OZFA 2OO5C 3GB9A 2V7BA 1GG5A 2A0XA 5C2JB 5GP1A 2VK8A 3KPJA 4EUNA 2C42A 1OROA 3IHWA 2FFHA 4QBKA 4CG3A 2H1VA 3B52X 2W2LD 4RETA 5DLYA 2IE8A 5ECWA 4H4EA 4QGHA 3ESZA 2X0FA 1FSFA 1FK8A 4BQSA 4JJ6A 5LQDA 3SJCA 1YB7A 1XK6A 4NAHA 1NWHA 1RXUA 3IMGA 4LJ9A 3DGFC 2PRYA 1GL9B 4OBEA 7GPBA 5LP1A 4ZMBA 2DUWA 2P11A 1MQSA 2QRJA 2SHKA 3QLVC 3ZBUA 1SN7A 1U0RA 4IZOA 4E5NA 2Z8YM 3FTEA 3B9RA 3PNLA 1PZNA 5A5FA 2C31A 4QT4A 2VHEA 1CUBA 3CLTC 3CNBA 1G291 1SU4A 2C94A 3ESCA 4P8RA 4PONA 3X1ZA 4D9JA 1T4CA 2D7DA 2QE6A 1DC4A 1O5TA 2NVUA 3H1AA 4Y6LA 4ZZIA 5KOHB 3AJAA 1FMCA 3D6UA 4OOFA 2ZUTA 2G08A 3VZCA 1MVLA 1JHZA 3DMNA 2V8OA 3L0BA 5L6LB 3C6QA 4HAZA 4B47A 1Z3IX 3B48A 2JIZD 2FZWA 1R4AA 4F9GA 2VQ3A 1DX6A 3KUDA 3BF8A 4I36A 4QU9A 5K3OA 2GEUA 4HWKA 4D3ZA 2JFUA 4UHBA 1UBKS 1DX9A 2FN7A 3Q0TA 1DFIA 2WSBA 1JHPA 3JQ9A 5AW3A 1ZNZA 4ZV7A 3ZTTA 1H6AA 3BVPA 5HFAA 4C6HA 3EPPA 5ARBA 2I7VA 4LWQA 1NG9A 3UHPA 1RXYA 1YB2A 1WCWA 1MTOA 5ETJA 3EJ6A 4RY0A 1ONPA 2XYHA 1FFSA 1O03A 3O3NB 4POAA 5C7OO 4BB6A 1RYBA 1YACA 2JC3A 1ZFNA 4I1OA 4MARA 4MPPA 4F71A 3ZHRA 2W0MA 2BFOA 3EFOB 3RTGA 1WUIS 2AQHA 2Q5OA 3V4PB 4LECA 1IY1A 1PZGA 1A95A 1SD2A 2AE2A 3I58A 3KV3O 3BGVA 3HA3A 4RY2A 4PR3A 1P73A 1E4EB 1CEYA 2BR4A 4PC2A 2PSEA 1JVBA 3HLTA 1PJ3A 1SKQA 3OLXA 5KO2A 1OU0A 3HCFA 1XVTA 2JG3A 4MWCA 1DBRA 2PS1A 2WU0A 4R84A 1KJ9A 1K5DA 2AS0A 2BHNA 2FWIA 2NO1A 3JQFA 3PF9A 1Y89A 4YP6A 5GONA 5BOVA 2OO7A 1GYRA 4C5BA 4YAGA 1ZK0A 1KYQA 3L2OB 2X0KA 1QE0A 4ZRNA 3TVYA 4ZCSA 3E9EA 4YMGA 4RQAA 4HN9A 2B4YA 2BL4A 2D5LA 2VAVA 1M0WA 3HBFA 3I73A 4E07A 1JR3A 1NW7A 2IH2A 2EX0A 3G7UA 4KQ1A 4JU8A 1NR7A 1NUHA 4ZYZA 1E6WA 1JFVA 4HF7A 3BJRA 2J30A 3USZA 4X62B 2FCAA 1XQ6A 2DBYA 3E58A 3VKVA 3CZCA 3GJ4A 3JARB 2R4QA 5J58A 5LZ4A 1XPOA 4MVJE 4DLAA 4DNOA 3FPLA 3MCAA 1C7ZA 1KFEB 2AW5A 2HSEA 4LA4A 4NJEA 4M0CA 2VLIA 4FMDB 4UM7A 3SDZA 3V8PA 3GG9A 4GMHA 5FV7A 4BPBA 2V7EA 3AM3A 2UZ1A 3IPAA 3UFBA 3EARA 1ZEJA 3IRUA 3U6BA 1THMA 2G25A 4UVIA 4QFMA 2IP1A 1ODKA 4GX2A 4BCDA 2AN1A 1N7HA 2DTDA 1YH3A 2WIJA 2XNCA 4KLZA 4UBNA 3QENA 4KN8A 1P4SA 5SZKB 3DDWA 3SOZA 3VUFA 2PA3A 1VHWA 3TTYA 1JKJA 2EBHX 4TOIA 5K3FA 3U9SA 5ALTA 1H5QA 5EJ8A 3BB1A 1E2KA 1WRBA 4TT8A 2R2AA 1FFDA 1EINA 1IK6A 1KI4A 4K1XA 1B76A 3C3CA 3VSBA 2KQUA 3QNWA 4L5YA 3FB1A 3CBQA 3ONVA 4OHCA 2CW5A 3S0JA 4AT1A 3R9XB 1UM9B 4RL6A 3V1YA 2KBFA 1RJ9A 3BIFA 4KQ6A 4PWYA 4XW2A 1Y4ZA 4OF4A 4NBVA 1E1MA 4AMGA 1AKMA 2HJWA 4OQZA 4DCOA 5E9WA 2NYRA 3RUFA 4B7UA 3MWGA 1RZVA 1C7RA 4I50B 4AROA 1Y3CE 1ODLA 4DXHA 4JA0A 4CGZA 3ZU5A 4MWZA 3UH0A 2RI0A 4KRYA 4MMZB 3QU9A 3EXIB 4HTFA 2CE7A 1Z6AA 2R00C 4US0R 3JQAA 1ECFA 4URWR 2EP7A 5H3LA 1Y3DE 4UHHA 4EA9A 3NTRA 1PAUA 3LFUA 1MPXA 3DCYA 3MERA 4ZQEA 1KQNA 3P9CA 1JKIA 4RDCA 1I6LA 1EUDA 4EY4A 3OKPA 3HVRA 2IV3A 5KINB 1A8QA 1NJ8A 3UGKA 1UKEA 4ZI7B 5BMVA 1F5NA 2ZYIA 4KN9S 4PZPA 5CNKA 3ROQA 4EO7A 3D3KA 4PLCA 5DI9A 1TA4A 3DMPA 4ZCMA 4HXFB 3A05A 3RFCA 4CTMA 4H59A 3W5UA 3D7NA 2GD2A 3LX4A 4J0IA 2C4WA 4FQ8A 1FS5A 4X93A 3TIIA 4IL5A 5C34B 1G3RA 5D7BA 5EYPA 4GQAA 3RRXA 4DHEA 2OM6A 1CUVA 3AUJB 3G88A 3OY7A 4YAEA 2QLFA 3A6FA 4YC7A 3ONFA 1L0BA 3TSYA 4CM8A 3N87A 5BQFA 1QHGA 2EFYA 4XEHA 3S2YA 4DZTA 2Q5IA 1XD8A 1IQUA 2GYWA 2OESA 2QNIA 1W76A 5CJ2A 1H8HD 2YIMA 2C3PA 2IXBA 2VF5X 3VPCA 4I4TA 1HDYA 3JZDA 4YUVA 4YRNA 3C7DB 1E4VA 3RREA 1JDSA 2XVAA 3DMFA 4TTJA 5JAMA 2OQRA 3LDUA 2TMDA 4U9HS 1JXOA 1DAPA 2OD7A 3PEFA 4NV1A 2WZCA 3BXHA 3GFBA 2JIMA 2I6TA 3S3TA 1JIVA 4BTEA 4UOZA 1U28A 2R6CA 4M9CA 5K6TA 3BSWA 1H8HA 3QMWA 3CO5A 4Q1FA 4F4DA 2ZJFA 3Q3GE 1C0IA 2YS6A 1L7RA 4QU0A 4DBZA 1J5XA 2VO1A 1D7AA 3WLTA 3Q12A 3A32A 4V0QA 4LHWA 1QHSA 4WE3A 4WTOA 2O1EA 3ZQKA 3EA4A 3IAS6 2OM2A 1JPVA 2O07A 4WZBB 2LP4Y 2DUMA 3ZWAA 2VDQB 1AXGA 4DLXA 2SKDA 4V0OA 3AJRA 2D5AA 4MEAA 4Y9TA 3ZN2A 3IPLA 2ZBRA 2NO0A 3CU5A 1UPBA 4K40A 3H4IA 5CNMA 3QKTA 2ZUDA 1RXCA 2OECA 5LBIA 1D9XA 3NV9A 4L9RA 1FF9A 1S2MA 1KAEA 2VF7A 4OKNA 3CF0A 4RHCA 3HH8A 3PGVA 1JDTA 5COQA 4F5YA 1ODCA 4IZ6A 1Q1EA 1GZVA 4M1KA 4ZK6A 1N2IA 3E9CA 2RFLA 2I6QA 5LQUA 1KR2A 2DF8A 2I7XA 4NDAA 4CIBA 3I1YA 4KO8A 5K0BA 5ALKA 4KPEC 2PUEA 1W9HA 4ARBA 2JHFA 1SWWA 3CLKA 1M8FA 1KY2A 5JC1A 1NTOA 4OAOA 4UNSA 4N3AA 4E88A 4Q3OA 4ESEA 4XIJA 1P1JA 1YFKA 3EGVA 4H6PA 1NI4B 4EI8A 3LAWA 4M99A 3K09A 3T41A 5ALLA 2AQIA 4BNVA 1T5HX 2V7VA 2BM8A 4Z1MD 1XTPA 5C8YF 2A9OA 4O5OA 4G8DA 5ALMA 1JDBB 3FROA 3HYNA 4O2BF 4RESA 4JT2A 5IABA 1CUEA 2HTEA 4GMXA 1W4ZA 3CZMA 4KIGA 4MV8A 4QU5A 4JI5B 3VVMA 4HY3A 1KEUA 1P62B 3S27A 4BLVA 5BWCA 2RSLA 1I1NA 2ZS9A 5JCOC 4JN6B 4PGFA 5HOEA 2GJ9A 3GP8A 1SRQA 1Z4QA 1EZ1A 1E2FA 2HHLA 3AVXA 4RCZA 3TKYA 2IYFA 5EE9A 5EFOA 4HXEB 5JE8A 4OLHA 1R37A 4Y18A 1RBZA 1NVMB 1OYOA 1SK8A 3KYCA 4TSRA 5ADVA 1J2RA 1GM5A 4QOSA 5JC8A 4OUDA 1P4JA 6REQB 2OMKA 1VTKA 3CUKA 16PKA 3GVPA 1O5IA 3M2PA 3A4TA 3K8OE 2XOXA 3PXUA 4I9NA 4LGMA 3TNLA 3EXHC 1ETHA 3PQ2A 2HK6A 5IAGA 1PW7A 3OIYA 1EX7A 3GW8A 4O8CA 2FEMA 4UZSA 3VR5A 5I9NA 1EVKA 3TYXA 3R9XA 2YZNA 2Z5GA 3K94A 3WLOA 3FFBA 1E9RA 5AKEA 3O0TA 2KBEA 1GDDA 3K09C 4L27A 3ED5A 5JPIA 1E9SA 3LNCA 4XQ9A 3UJBA 4DLLA 1D2MA 2VDVE 2QVZX 1CNFA 1XX6A 3LDAA 1MPTA 5FEMA 5LYJA 2JLUA 3L7NA 4YUAA 4PLFA 5GJCA 3L01A 1M8JA 1ORWA 1BNCA 2A59A 2Y0DA 4MJLA 1M5TA 3A1FA 4FLEA 3NV7A 3FOAA 2V74B 1BVUA 2FI1A 2I2DA 3Q15C 1AS0A 4K88A 1E66A 2GK6A 2O2SA 5FBZA 1MX5A 3ZC3A 1I8TA 1A72A 1AC5A 2APJA 3DZ8A 1CYDA 3QV1A 3TTXA 1RM3A 2WB2A 3P4UA 1XTVA 3OIVA 4W6ZA 2BF4A 1ZCBA 5ALFA 3EVFA 2XMCA 2ZM5A 5GMOA 1ZVKA 2QN6A 5E6RB 3KB1A 3UCFA 2UUPA 4MUAA 4ZANA 2OVBA 3ZY2A 3BK7A 5A3JA 2JEYA 4E5MA 1NI5A 3CWZA 2ZS7A 4IGFA 2EFEB 1VHTA 1RFLA 3ROZA 1QQTA 4KB5A 2EGHA 4PCVA 2FPWA 3RANA 4YH1A 1MG0A 4PS0A 4FB5A 3E9RA 4CODB 1U90A 2H31A 3DMDA 5IW8A 2C9MA 4ZCTA 2GUGA 1JPNA 1T3TA 2RGUA 3BB3A 3M1AA 3EA0A 3EXFA 1LPSA 1M2HA 1H0HA 3FRIA 4DLNA 3WMWA 4D4LA 4CTNA 1FFYA 1PGQA 1XZGA 2IX3A 1JQEA 3CNEA 2C3MA 4CL8A 3NHJA 3WTCA 2OG2A 3K5PA 5SYNA 1DC5A 2OGTA 4MQEA 5G3YA 4K7JA 3GI1A 3MVEA 3U4GA 4CEIA 4MPDA 3ND8A 5FO0A 1QVVA 1U1FA 5KWSA 5FA8A 3VHXA 5IDQA 4JUBA 1WNFA 3KXDA 4JQOA 4P83A 4QLOA 2HMAA 1JXMA 5LBUA 5JBQA 4P0PB 1BEZA 3IIIA 2DBVO 3PQEA 3FPEA 2CLKB 1UINA 4NONA 1R5NA 3TOCA 3KZVA 3HXKA 1MEJA 2O0LA 3A8TA 1IHOA 1MABB 2C95A 1SG0A 2CXPA 1EGHA 2VIIA 4MVJM 1DBQA 1CETA 2JLBA 4H15A 2YVLA 3ABQB 4P6VF 1HFWA 1Z9BA 3INGA 4BVFA 3PNPA 4P5PA 2BM1A 3I42A 5AP9A 3KR2A 4EZEA 3BD6A 5B7PA 2J1LA 2XEXA 1HYGA 2WD9A 1BMDA 1R3UA 3CEPB 2H8GA 3NBMA 5AOAA 1FYVA 2JGAA 4NYJQ 1YT5A 4NQRA 2ZM6B 2IOQA 2FPPA 2G9NA 2AEJA 1WPXA 4R3UC 3VO8A 5AM2A 1GZUA 2IRWA 4BNWA 3PX2A 1E2BA 1VCMA 3LP6A 4MV0A 3AZOA 1KZYC 3EZNA 2NTYC 2PZEA 7ADHA 5LWQA 2ECOA 3NU1A 3R7SA 1D4OA 3F5DA 2QA5A 1U5CA 4B40A 3AF2A 1Z4OA 4CTOA 4MX8A 4D02A 3MPOA 1NONA 4ZOCA 4WOJA 4AB1A 2QUIA 1CDDA 4EABA 1HOXA 5KOHA 3OX4A 3OIUA 2VDPB 3K4PA 1KPHA 1XYYA 1JJAA 4GD3Q 2IHYA 2PRJA 1LBHA 3IC5A 4DV1B 5MHTA 2BYTA 4C6SA 1NYQA 1NY6A 3W5BA 3DFKA 4UNNA 1A4RA 2O7NA 3KJXA 2AI2A 2G6BA 1FSZA 3UNXA 2FRXA 2XOKA 5GJVC 1C9DB 1PTKA 2MWMA 2WP8J 3WXBA 4PC7A 2RB4A 2ZR9A 2HV9A 2GPNA 3H0EA 1NC3A 1R