4CG0A

Savinase crystal structures for combined single crystal diffraction and powder diffraction analysis
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
269
structure length
269
Chain Sequence
AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUBTILISIN SAVINASE
publication title Analysis of an Industrial Production Suspension of Bacillus Lentus Subtilisin Crystals by Powder Diffraction: A Powerful Quality-Control Tool.
pubmed doi rcsb
source organism Bacillus lentus
molecule tags Hydrolase
total genus 99
structure length 269
sequence length 269
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2013-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 4cg0A00
4NE7A 1SIBE 1YJBA 3AJ9A 1Y1KE 1IAVA 1Y9ZA 1KDVA 2ID8A 3I37X 4OV6B 1GA4A 4BWGA 3DE7X 2X8JB 1TECE 3TI9A 1PEKE 1SCBA 4CFYA 5JXIA 2ZWPA 3F49S 3DE5X 3SICE 1C9NA 5B1DA 4CFZA 1ZVJA 4C3UA 1Y4AE 3DE4X 5FBZA 1SUCA 1SUBA 1KE2A 1WMFA 2GKOA 1CNMA 3HJRA 2ST1A 1AH2A 1SBTA 5ARCA 3VYVA 2DP4E 1V5IA 1GNSA 1P7VA 2PWAA 2WWTA 3A3PA 4C3VA 1BH6A 1TMGE 3OSZA 5AVJA 2SECE 3QMPA 1MEEA 1WVMA 1ZVKA 5CW1A 1Y48E 1C9JA 3I2YX 3DW1X 3WIUA 1TM7E 4HX2A 2TECE 2W2QA 2G4VA 2XRMA 2PMWB 4M1ZA 3AJ8A 1TO2E 1GTL1 1SCAA 1ST3A 1SUEA 4HVLA 3CO0S 1EA7A 4K8RB 3WIVA 1PFGA 1Y3DE 3TI7A 1JEAA 4YN3A 3DE1X 4AKTA 1GTJ1 4DJ5X 1XF1A 3Q5GA 1Y4DE 1YU6A 4LVOA 2SBTA 2QTWB 1TM3E 4NMXB 4OMDA 1PTKA 2HPZA 4ZARA 4WOCA 1TM1E 2W2OA 1GCIA 3LPDA 1HT3A 1NLUA 1S02A 3DYBA 4FONA 1R6VA 3PRKE 1BE8A 3DE6X 4GI3A 1GNVA 1T1EA 1TM5E 1DBIA 3DWEX 5ARDA 1CSEE 5JXGA 3WQBA 4H6WA 1R64A 5FAXA 1TO1E 5ARBA 3I30X 3GCXA 1S2NA 1KE1A 1AVTA 2PYZA 2E1PA 1GA6A 1S01A 3P5BA 1OT5A 2DUJA 1Y3CE 4ZOQI 3GCWA 1T1GA 3EE6A 3CNQS 2SNIE 1GA1A 4J94A 1KDYA 3LPCA 4B5LA 1GTG1 1SCJA 5K7SA 4NE9A 1VSBA 3I34X 2PKCA 1LW6E 3SQOA 2WV7A 3T41A 1A2QA 3BGOS 2DQKA 3Q40A 1OYOA 1AU9A 3DE3X 3DE0X 1WMDA 3AFGA 1SUAA 2Z57A 1YJAA 2PWBA 2W2MA 1P7WA 4CG0A 1SUPA 4AKSA 2XTJA 3BPSA 2IXTA 1BE6A 3GT3A 3GT4A 2W2PA 3D9QX 3ZXXA 1SUDA 2ZWOA 3H42B 3VV2A 1SBHA 2Z30A 5JMOA 2V8BA 2WUWE 4Z2AA 1WMEA 1V6CA 3BX1A 1SPBS 3ZXYA 1P8JA 1SBNE 1KDZA 3DVRX 3QTLA 1ST2A 2IY9A 1THMA 1Y33E 5AVKA 2WUVA 3VTAA 2ZRQA 1SH7A 1T1IA 3VSBA 1AK9A 3EIFA 1SVNA 1SCNE 3DVQX 4JP8A 3LPAA 2Z58A 1WSDA 3EDYA 1SCDA 1C3LA 3F7OA 1MPTA 2P4EA 2Z2YA 3DE2X 2X8JA 2B6NA 4KG7A 1Y34E 3QFHA 4DWWA 2Z56A 2W2NA 3LXUX 1PJ8A 5AMXA 1UBNA 3VV3A 4DZTA 1BJRE 5JXJA 2PRKA 1C9MA 1SN7A 2SICE 1NDQA 4RYDA 5FFNA 3A3NA 2ID4A 3F7MA 3WHIA 4LVNA 5I9SA 1SIUA 3D43A 1GT91 3DVSX 1TM4E 3TECE 1Y3FE 4KPGA 4H6XA 2PQ2A 1AV7A 3DW3X 1DUIA 5JXHA 1BFUA 1SIOA 1YJCA 1AQNA 5AQEA 4OMCA 1NDUA 1R0RE 3UNXA 1Q5PA 4WOBA 1AF4A 1BFKA 1SBCA 4MZDA 3L1KA 5SICE 1Y3BE 1TK2A 1SBIA 5B1EA 1OYVA 3DDZX 3PTLA 1SELA 4H6VA 2Z2ZA 2Z2XA 1IC6A 4KB5A 3VHQA 4I0WB 2HD4A 3A3OA 1EGQA
chains in the Genus database with same CATH superfamily
1KNXA 1RAHA 1LVUA 1X9IA 2RCYA 1JHAA 2FZ4A 3VPGA 4BMNA 2QVXX 1CULC 1PR5A 1YS7A 1Y1KE 3ETDA 4KQEA 1MA0A 4N1AA 4Q4DA 4YMIA 3E15A 3DHEA 3HFRA 5FF9A 1KDVA 1KYTA 3CN9A 3H5RA 5FI5A 2X0EA 3P2YA 3UXMA 3I37X 3ZV7A 4CM3A 3W5AA 4CNBA 5F76A 5CYOA 4YRMA 2R68A 3WJ1A 1GFWA 1PJSA 1CP2A 3IVAA 1F5SA 4QIHA 2FEXA 4NJMB 1FSGA 3CUKA 1T1JA 1OAKA 2WHRA 3QV1A 4BXOA 2ZJ4A 2CXTA 4FYIA 4IQ8A 4UAVA 3QXCA 2P9JA 2W2KA 5DE3A 1TF5A 3CLSC 3M83A 1CZUA 2EGUA 3B3JA 4I1UA 4LSGA 3VNSA 4JR2A 1RKXA 1MO4A 1U0BB 2JFYA 2ZRKA 3TE6A 1CUIA 1P45A 1RW4A 3PEWA 5D86A 2PUVA 2CT8A 1KIMA 13PKA 3SLGA 2CL5A 3KZ1E 1XTVA 2P2GA 3WAJA 4TRMA 4HYYA 4YAWA 2EIHA 5G1NA 1H2AS 1J22A 1KJQA 3AL2A 2O2XA 4JLUA 3WKEA 3KKPA 1XPRA 3EEIA 4EY8A 3QY0A 3T9EA 2ZR7A 4WZAB 3V2GA 3WYCA 4A9AA 2EWMA 2BGRA 1YB4A 1JL3A 4NENB 4ZCPA 2J59A 1OASA 3ZCTA 3GMIA 2ACWA 5CD9A 2OZPA 3JZIA 4DCUA 4YIHA 1U81A 3UCFA 1M2FA 4NVRA 4RJIA 2R8ZA 2G0TA 2WK1A 3L8HA 1QTQA 2CLKB 1LW7A 1J7JA 3RCBA 3JZDA 2XGJA 3FGNA 3JVEA 3UC5A 4M89A 4V0NA 1Y42X 5BT9A 3QEJA 2PWAA 3QE4A 2RHMA 1FP1D 1P2FA 3PXGA 4LC0A 3WNDA 1R0XA 5B4UA 5I3CA 1BWSA 1LWOA 3QLJA 4DSUA 1DU4A 3RVOA 1X1DA 2LR0A 4ENRA 1L4NA 4MA5A 2OENG 2WFAA 2Z8XA 5CNMA 1I7LA 3LCUA 4R6WA 2C7BA 2WTBA 4F0JA 1C3JA 5FV7A 3SZRA 4B85A 2BKAA 4IJMA 1RHMA 3MUOA 4JSRA 1XNGA 2EKZA 1E18A 2BR3A 2SECE 2A86A 2WUGA 2MMGA 2XGOA 2PU5A 3FI9A 3R3ZA 3V4ZA 1L5VA 1FLVA 2C5GA 3STHA 4E07A 4PYMA 1ZMTA 2FMUA 4UBOA 1ZRSA 3HV2A 1BMFA 3HNRA 4ZI5A 3UGQA 4ZGWA 3OQNA 4LYGA 4DR2B 3RIMA 2B8EA 1FU7A 1ORVA 2XA1A 3FGPA 3N2YA 4AY4A 2AHRA 4UOZA 3AHDA 4MLPA 5FUVA 1KH3A 5AVZA 5J4VA 3UKJA 4ZHQB 2VJLA 1K1EA 5CFNA 2IF0A 3GW8A 1XWWA 1ECBA 3RGWS 1F6WA 1O97D 5KS2A 2PJRA 1W0CA 2WSIA 3CS3A 4MHTA 3FSGA 1WU8A 3GLGB 1WXQA 2QE6A 4INOA 4BL5A 2P1ZA 3I6IA 4OK5A 1UH5A 1KYVA 2J3MA 3OJOA 4IHKA 2OAGA 3MAGA 4W6QA 4BX0A 1OB2A 4YRTA 1EIZA 4YRZA 3IR6A 4X60A 3MTIA 1J8MF 3CC8A 5J5VA 4O3FA 1L5YA 4Q4CA 1MXFA 3RTGA 3KHSA 3WKBA 5FPSA 5HPYB 1KMHB 4Y2JA 4GP7A 3NTRA 4N7MA 3VH4A 1Z17A 2WAAA 3ZLUA 2NUPB 4BRUA 2O2ZA 2O2DA 2WHYA 4O2BB 3OY7A 1E98A 2UXCB 1LNQA 2ZYIA 4A2PA 8MHTA 4LZLA 4H3VA 1JEAA 2Z9DA 4FBMA 5JCJA 4ER0A 3S81A 5AM1A 1YMVA 2AW5A 4MQ4A 4AKTA 3VJRA 4Y67A 1OBHA 4YACA 1ZLXA 4R83A 4RFSB 5CCBA 3BL8A 2JA2A 4NMHA 1E2JA 1E3SA 1J90A 1RI1A 5CG2A 4O4JA 2BHLA 3PNBA 4P3XA 1IHYA 3KXKA 4RK1A 1YU6A 4RPCA 5HGXA 2GSDA 2VAPA 4PW0A 4QBGB 1Q91A 3IDOA 2ZJ7A 2J9GA 2P5UA 1W9HA 3PI7A 1YXMA 3ZEIA 4NX2A 3H4IA 5CIQA 5F2EA 1ZRMA 2VBCA 4BVJA 4J91A 4LWQA 1AKYA 4OLJA 2X0DA 3VH1A 3D8TA 2J9YB 3K09C 3SQMA 3H83A 4P35A 2NUAB 3CW2A 2PXXA 4Y2QA 2TMYA 2BH2A 4TQGA 1MB9A 1X3SA 4GSYA 3ILSA 1YA6A 2VDUE 1SG9A 3N1UA 3OOJA 3OJEA 4JJEA 1PJBA 3NOQA 3ZDXB 1BDIA 4ALKA 1ZXBA 2OLKA 1A72A 2XJ9A 2YINC 1LDBA 3FPEA 4QJ5A 4RVFA 4V0RA 1EFRA 2IKSA 3OE4A 1YUBA 3SM3A 4BBZA 1ULUA 2CHUA 3N87A 1D0IA 4PR0A 2V98A 1U0RA 1V16B 1Z2EA 2Q8QA 3QX7A 4BRZA 3KWLA 3QFRA 4C0SA 4ENTA 3ZDEA 4ZFNA 5KDDA 1E3DA 2QU8A 2O3TA 5EVCA 2XUDA 3OPVA 1E1NA 1E1KA 4HNRA 4ONEA 5CR9A 2FN4A 5FBKA 1CSEE 2F1RA 1GAWA 2ZYRA 2F1OA 2H16A 3SMVA 3AF4A 4FZ5A 3I73A 1W48A 3I2GA 1MZVA 3C4JA 3RT1A 3LP5A 2G8NA 3IEUA 2QZJA 4G0MA 3ZN2A 1XUOA 4CT0A 3OIFA 4WZ6A 3GAFA 4UD6A 4FGJA 1DFHA 1JH9A 1QQ6A 2VUSA 3BIWA 2Z5VA 2AR9A 4BKOA 5CVUA 3OPNA 4AF8A 4EJ2A 3A4NA 4PGGA 3JAMA 3CVWA 2AG6A 3WLTA 1JEYB 1OLOA 4GICA 3EFEA 5KNBD 2XMGA 5TEWA 5JLJA 1PDOA 5F5XA 4X20B 1QS0A 3VAYA 5CFMA 4M3NA 1GCGA 2YQ4A 1CY8A 3EYAA 5HRAA 5AJWA 4N0EA 5I3ZA 4OYHA 1K6IA 2VWPA 2POQX 2C57A 1JUDA 4DC9A 2VDKB 5K45A 3EE6A 1I4WA 2BF7A 4PSDA 3IQIX 4YO8A 2NVUB 4OHYA 1IJBA 1Y7PA 4RTSA 4MPJA 4EJSB 2ZYWX 1JI3A 2C0PA 3L4BA 4H1HA 1Z62A 1C7RA 3PXBA 4JJ8A 3IB3A 5HKLA 1VIVA 1HDOA 4HS4A 3U56A 3KTOA 1IAQA 4PNEA 2YNMA 5LUBA 1YAHA 2JCSA 4JVOA 3I0MA 3RAGA 4B7CA 1Q6YA 3C8UA 4G0PA 1HKHA 2ZVQX 3O38A 2GTPA 1QKKA 3T12A 4LZNA 1E6LA 4NATA 2PGAA 3AM5A 4ZJUA 2QN1A 3PC8C 5FFFA 5H7XA 1E8MA 4MS1B 1RWNA 4QL3A 2WG1A 1AXEA 5CCEA 4B3MB 2NSDA 1L4GA 2JBHA 4IV5A 1XLTA 2Q4TA 2G25A 5FRDA 5A06A 2ZW9A 4WCVA 2WWWA 3K9HA 1Y98A 5K3FB 121PA 1J2YA 1NWHA 1XJCA 1YGYA 3LYUA 3Q40A 1CW2B 1YT5A 3BL5A 4TL6A 1X3LA 1AU9A 3KT0A 2XEXA 2NU7B 5F78A 3IUPA 5DHUA 4HAWA 2P65A 4DCCA 3DTVA 3AFGA 3LZDA 2H0AA 3PR2B 4A3SA 5FUBA 2N0SA 1J0BA 3CV3A 3RRYA 3JQ9C 5KQPA 1IXKA 4QODA 3BOSA 1RCTE 2UYQA 1HC7A 1NQAO 3E9NA 4CDNA 4PU0A 1E3JA 3C1AA 4JQCA 1I8TA 1WLSA 5EE0A 3QI2A 1F2DA 4XH9B 1QZTA 4JP1A 5J63A 1L1QA 2C2OA 2XYQA 3IPCA 1WEHA 3JTEA 3A4MA 3OU6A 3SQXA 3A4TA 2A3NA 1OBFO 1GCUA 3HMKA 4LHEA 1TAQA 3NBFA 2IUFA 5C5IA 1SBHA 3NIDB 1XK6A 2I3BA 3OIDA 3RKSA 5D3KA 1Q7CA 5I8WA 2OFFA 1WB5A 3ESZA 1EX1A 3EGDB 1JRLA 3LS2A 4IIXA 4AZSA 4RTRA 5JS7A 2I54A 3R5JA 3BX1A 3OIWA 4MQBA 2ZVDA 5D5QA 4G26A 2WV9A 4G8JA 3G7UA 4WA7A 4EECA 3AW9A 1ZGCA 2X76A 2PUWA 2R00C 3G49A 3T3OA 2A5DA 2H4FA 4GVLA 2QM7A 3SS8A 2XVMA 5DHRA 2YV5A 1EI9A 3O1JC 5CAEB 4HG2A 4FI3C 2H1HA 4N54A 1V1MB 1E9CA 2R5WA 3AW8A 2JLSA 3NANA 3OIGA 2VWHA 1XMJA 4I8IA 5FUXA 1HBJA 5HF9A 2J0QA 3J7TA 2RBKA 1THMA 3HN7A 5C8YA 5CJJA 3WYBA 1W0KD 3BKXA 3FPSA 3GHYA 3IAAA 2CNKA 5TV2A 3QVJA 3P5SA 2BI8A 4J0EA 5H8WA 5KYWB 1IEXA 4ND2A 6NULA 1UBTS 3LLSA 2EHDA 3H1TA 4JENA 3ICCA 2HK7A 4P86A 1TPZA 3KJNA 1VFPA 1ZJ4A 4KYTA 1RI3A 3L3BA 1HXHA 5EIOA 3R7DA 1HYBA 1BE0A 4C4RA 1UIMA 3G7SA 2BKXA 3EQ6A 1S3SA 2ZIEA 4PBTA 5EJ2A 3AVWA 4L0CA 2DERA 4M7WA 3ORYA 2AE1A 3GLVA 5LQDA 3NMUF 4WZBB 4D9JA 4MI1A 1MJNA 3DVQX 3GX1A 5FL7A 2JD2A 5JI3E 4ZOEA 3LPAA 4MWTA 4BATA 1Z5ZA 2VTVA 1HM5A 1UXIA 1X0XA 2IP4A 2XWPA 3H84A 4GC9A 3BHJA 2WAYA 4MDEA 3QEKA 3NDIA 4BO6A 1R0BA 1CE8B 1SXJE 4MHOA 3AG5A 4JBHA 6PFKA 2H4JA 1RAFA 1NRJB 3NXSA 3CUWA 1MB2A 1F0YA 2HLNA 5DLDA 3VX3A 2OESA 2W6ID 4I4NA 4DQXA 3O8QB 4HQ0A 3JQEA 4G8CA 3CSSA 4JCCA 3GAAA 2HWKA 3L7DA 2XV1A 3TAHA 5CIWA 3AY7A 4AKEA 3VU9B 1H2EA 2IHJA 4IH4A 3SF8A 3R4VA 2XCRB 1MV8A 1XDSA 3UK0A 3TNLA 4IDGA 3NT4A 4XEHA 2Q99A 3A7DA 4PAWA 2HZBA 4P2BA 4BFTA 1QLWA 1GQ2A 4DPLA 4G5XA 1CIPA 1Q7RA 1LJUA 3O73A 2ZU6A 4M8SA 3WIDA 1IULA 1JSRA 1CDZA 4YQYA 2DEUA 2RKOA 4JAVC 4IIGA 4GT1A 3RS9A 1QKJA 4JC5A 4XOIA 1KY2A 5FA8A 4ETNA 4FSHA 1MX3A 3N59A 3LUJA 2GTHA 5DMXA 3OC0A 4LGYA 2ZEJA 2XF8A 3GBVA 3EUFA 3PDIB 5HVNA 3N8NA 5CW2A 5A9SA 4LXYA 3C6XA 1MLDA 4B0PA 3Q2IA 2ZI4A 4Q9HA 2IEZA 2RKWA 5IANA 2H1FA 3AHFA 4NMLA 5GM2A 2ZITA 1QK3A 1ZD2P 3VZCA 1H6AA 3VR4D 2B4RO 4CM4A 4DWOA 1LNZA 5KHAA 5ITZB 2QTBA 1E7QA 3B1WA 2EJBA 3KQUA 3C6KA 4HWKA 1HRDA 1QOPB 2UYGA 5DGDA 1UPAA 1PYGA 4LDPA 1QG4A 3DZCA 2CBZA 2PRIA 3NHZA 3NBUA 3SBXA 5A04A 2G5TA 3SNKA 3MILA 4DLKA 1Z8HA 5DZSA 3WDMA 4B7AA 3CF4G 1ZN8A 2JEZA 5CYPA 5C0OE 1FU8A 3NUQA 2XUGA 1GAEO 2ZBPA 2A5YB 1YKFA 2Z3VA 3EARA 3IO5A 5JMTA 1VCIA 5LA6B 1ZBQA 4BHTA 2LKDA 2VT2A 3BD7A 3IP8A 2BISA 3DGEC 4H0FA 5DNWA 5AXBA 6REQA 1WCIB 2HRCA 2EZ8A 5DN9A 2Q6IA 5KQMA 5M04A 3IXLA 3VISA 5ALGA 4E32A 5FPQA 3EZNA 2J5XA 4ED9A 1GZ5A 1DIBA 1HNZB 2IF2A 4R1MA 2QTHA 2FKAA 1SBIA 1BQ3A 3UOWA 1P2SA 1D9XA 4E5VA 2MIIA 2PV0A 3AF0A 1W59A 1GG9A 2IXAA 1IM8A 1R1DA 2QVYX 3N7TA 4Y9UA 3V8VA 1Y7TA 3NBMA 4O4LF 1QFXA 1W75A 2PAAA 3PL5A 1OLXB 3Q9NA 1EXVA 3TM4A 3UUWA 4RLSA 3PVCA 3F67A 3IPAA 5H0IA 3VGPA 1VMEA 4M4SA 3AESB 3WOHA 3SVTA 1PFYA 2XWJI 1TCCA 2H54A 3CNNA 3K1JA 1D8AA 2FQXA 2QNRA 4KX3A 5DDIP 3Q8KA 4OLFA 1FNBA 1KI1A 4RVGA 1YZGA 3A6JA 3BWYA 3QMVA 3GRKA 2NTNA 3C8ZA 4M0PA 4Q12A 3ZVKA 4L75A 2ZPTX 3EGCA 2VYVA 1H4TA 4PQYA 2D4AA 2JLAA 3RQIA 1X7DA 2GAOA 2VJMB 3B53X 3NHWA 2BDUA 5AKGA 5HM8A 1NIJA 4HDRB 2G8LA 4FMDB 3VHQA 1U3TA 4YDRA 1YFZA 1TMOA 3L8MA 3R5HA 1QDLB 621PA 1LLDA 2ZJ1A 2WKWA 4IUYA 4N18A 4D25A 3GCGA 3U5TA 5B6JA 1T2UA 2HPHA 2PKEA 2ORED 3C5HA 1CUWA 1N1GA 5JSUA 2ACEA 4ENSA 5L4SA 1FOEB 1RYFA 3PUIA 1TA4A 4KVGA 5IAJA 1IIRA 1Z2PX 1HO3A 1UJ5A 2Q45A 3L4EA 5G4KB 1Z6AA 1V41E 4BKUA 4Q24A 3VTZA 2BHRA 4YPVA 3G2IA 1BD4A 4DYHA 2ZSBA 5C32A 1SOMA 5BP7A 4CKWA 4IM7A 2ASVA 3U3JA 5TQ2A 1XRJA 1C1XA 5I48A 4X24A 3AR9A 2ZRJA 2IUSA 3EOBI 2ZBFA 4V2UA 2Y1CA 4D79A 5JADA 5M7EA 4HNQA 4UUQA 4EJFA 3TLJA 4A8JA 1NJ5A 3WXMA 1K6XA 1UK7A 5CU7A 2C2HA 4FFBA 1E2DA 2PSSA 3ILHA 4HS9A 4G4JA 4ASUD 4BIMA 1ISJA 4D9GA 4KQXA 3SICE 2XNJA 4MQFB 2QSJA 4K9RA 4HQKA 4MV0A 3H05A 4MVCA 4ERXA 2NMVA 1RXWA 1LF5A 1NBWB 4PRKA 3K9LA 4E7OA 3V33A 4JLWA 1GM5A 4JGIA 3L49A 1U5AA 3X44A 2PBZA 2GBIA 2PVCA 1G2IA 2WQZA 3EIEA 3N74A 4N9QA 3ZD7A 1DXQA 3LFUA 3R5TA 3L40A 5DNDA 2A5LA 4JT8A 3HKEA 2F8SA 2GHIA 1ZJWA 2IPOA 3IDFA 4TYPA 3M6IA 2H85A 1AB5A 2BP7B 3HN2A 1AZSC 4J0GA 2HO5A 4HX5A 1ND5A 2ZBVA 2YV1A 3F8WA 1UXHA 3SR3A 2AZXA 3F8TA 3E0QA 5CH8A 1XCGB 2D4HA 2YMMA 2V7TA 3HO6A 4ZI7B 3ZVLA 1FLAA 1NE7A 4UAJA 1K63A 4U2GA 4GYJA 3S28A 4NCJA 3WHPA 3R24A 3GU3A 2IXBA 4X6UA 4DMHA 1NXOA 2VHVA 2UYYA 3L1UA 3AT1A 1A8UA 1I6WA 4O6VA 2AOUA 3G8DA 4DQDA 2YZ2A 1NW4A 3O4IA 1RYDA 1O9GA 3NJ8A 1G18A 3CLUD 4KXUA 4Y6RA 3FCOA 3KE8A 3U40A 5AKZA 1TDJA 3Q1KA 1DKRA 2VNJA 3ER9A 3MPUA 3R7WA 4B9EA 4EDHA 5BSFA 1YRYE 5CB8A 1E89A 2FZVA 2X8BA 3DDOA 1KTVA 5HGJA 1P6QA 5LZ2A 1SKYE 1YCHA 1X7YA 3IOEA 5IJ9B 3DL4A 4RF3A 3JVUA 4MGHA 2PFGA 3S6JA 4E3ZA 3TKLA 3PI6A 1XDZA 4Z7NB 2FJUA 3EVAA 4EPRA 4IX9A 3O95A 4L5JA 3RVDA 2H1SA 3TZKA 1MC4A 3R5SA 1N5LA 1VSQA 4F85A 3ZBUA 3D4LA 2DPLA 1VHLA 5BR1A 3EPHA 5BVGB 1M1YE 5LA6F 4I8XA 4L8YA 2AJCA 1UBRS 3DBVO 4M83A 3V4VB 2V9CA 3NHSA 4Q1BA 5HIIA 3WJAA 4LQDA 3ZVRA 4AG3A 3FNQA 4HXGA 4X8HA 5I7SA 2I2WA 3EMVA 3GRAA 3KXPA 4GBED 1W0JD 4MRSA 3SX2A 4BGVA 1EP9A 1M2OA 4X7PA 1QC5A 4I9HA 2I55A 3PD1A 2ZJ6A 4I55F 1SUEA 1NLFA 4AC9A 1N92A 5G0WA 1MQSA 1VZ3A 3T4EA 1M7BA 1M34B 3VHRA 1J8QA 2HQBA 1KJZA 4P83A 4DTCA 1G8HA 4HGNA 4R9RA 5JJIA 1A97A 3LLUA 2X5OA 3ZCVA 1CP3A 1HE3A 3KPUA 4O4JB 3SZGA 2P5YA 2QD5A 5CB4B 3IKVA 4CR6A 3H6GA 1KBOA 3EC2A 1GFZA 3DFUA 2FN9A 2V58A 2RG1A 2HIMA 4F3YA 2P4SA 2HSWA 3CPJB 3P2OA 4RA6A 5DOZA 3SEAA 2DG2A 3ZQ4A 4XDZA 2LGJA 1GRRA 3H5VA 4LVOA 1ACMA 1E8NA 4HQLA 3JALA 2BGTA 2XSZD 1HK7A 3DT8A 1WXXA 1ML4A 2EU8A 2XUQA 2ZUBA 4BN0A 3EWNA 1SXQA 4OHOA 3WHLA 1W94A 1ZZEA 3GV0A 3NNSA 4TMFA 1D04A 2H08A 3KOUA 1E7RA 2G77B 1A4UA 2HC9A 5HCUA 1DP4A 2LV8A 2OXEA 1GRCA 4IIUA 1YMQA 5ALLA 2G6TA 1NAIA 3EUEA 1ZN9A 4II7A 5AYVA 1JEJA 4HMOA 1F8FA 3KO8A 1PWYE 1GCIA 2JLXA 4R69A 1NJ8A 1ZH2A 1NLUA 2J6HA 4OY3A 1YBVA 1KY3A 5I6DA 4C5BA 5JYCA 3TOVA 1NN1A 5IAAA 5J2TA 4KUHA 3G88A 3LA8A 3O4FA 3MWDA 3THXA 2ZATA 1KR5A 1VRWA 2FOXA 1ODJA 2ZRIA 3TRIA 1GKUB 1UXKA 5EFZA 4IMIB 3DC7A 5FJIA 4D8XA 4R1QA 2AX3A 2H6EA 4KV9A 5KTRA 5AHRA 5G3ZA 1L6IA 3WNVA 1DX6A 3B13B 1TNDA 4J3FA 2XXJA 3K0HA 1N2HA 2JG3A 4IICA 3IULA 3FNFA 2WJGA 4O1HA 4BO1A 5JD6A 1KXZA 1IN1A 5BR4A 4HWGA 4QOHA 1CQZA 4PQEA 3QK7A 4DLUA 4O8ZA 3STVA 3PLRA 4MV7A 2FFAA 2OV3A 5DGTA 1XAJA 2WWHA 2P6NA 5A5EA 3QVMA 4D8UA 1I5OA 2QVZX 2BFBB 3B78A 1Y9DA 1T5DX 2AQHA 3JPYA 2HA5A 4Q7KA 5JS6A 1YK1A 3F5MA 2W48A 4X71A 5K2OA 5CCXA 3WADA 3LWBA 2OM2A 1XD9A 2CHFA 4RGYA 3BIXA 1OLSB 1KPHA 4Y6PA 1QRTA 4K9MA 3ECCA 2JIPA 1RXIA 1UWLA 4CKEA 1SCUB 1MJHA 1WUIS 3D4OA 4ZAXA 4Z0PA 3RFCA 4TZKA 4YRCA 2ODEA 4HDKA 5DF1A 1T2CA 3RABA 5CEJA 2QQ0A 3DA8A 3RV3A 5EIAA 1R8SA 3O3CA 1DVRA 3ZWAA 2ZS9A 4TS1A 2NNLD 2V6MA 3BYZA 3F5FA 3NVAA 3LZ6A 1K98A 1L7EA 3BZBA 3PSAA 4NAVA 2QTFA 3LU1A 2Q6VA 4W8HA 1XXHB 1GXSB 1Y6GA 1XQWA 3A05A 4D1YA 4KREA 4JQYA 4L3WA 3E81A 1XD2B 4LDNA 5BYKA 1S8NA 1CUZA 2N1BA 1XT6A 3FA2A 1C7EA 1IEQA 5AW8A 3MINB 1RKUA 2VH1A 1SIWA 3STXA 1JAXA 1Y4ZA 1NHWA 2CLCX 3DOUA 3FETA 3VZRA 4X7MA 4FDUA 4CLHA 5AKYA 4QAJA 1JECA 3BGOS 2A0UA 3VKUA 3B9PA 3IBCA 3QFFA 2VG8A 3MCWA 3R75A 6YASA 3BE5A 4JKOA 3HDVA 4KO1S 3AXTA 4UFNA 3EBLA 5FPPA 1TZMA 3RSCA 3M5DA 3WB1A 1GTZA 1R4MB 2B3DA 4DWJA 1EBBA 1TYDE 2JGLA 1ONNA 4JHLA 3UWKA 5DXAA 4IWNA 3KLOA 3P2KA 4WDRA 3P26A 1TRKA 1SQFA 7REQB 1R0YA 4Y1RA 3TJZA 2IYXA 3SSAA 1XP5A 2ISQA 5H9WA 5L3ZA 3H2YA 1ADCA 4X62B 2F9LA 4WBNB 3K1AA 5CURA 3VH2A 4J3JA 4PLGA 4YIKA 2AD5A 5DRYA 5T3UA 7MHTA 5CVVA 3NIWA 1OREA 2BFDA 4Z4FA 4XYBA 5CDFA 2RHBA 4RTNA 4O4JF 2P5TB 3EQ8A 3T94A 3ZQUA 3C3JA 5CB4F 1QHHB 3RTBA 3JQGA 2CNWA 1J2UA 1KAQA 4M8IA 4TLMB 1XX6A 3KYJB 3OZIA 3U60B 4U02A 4ZMSA 5EMHA 5AW4A 3UMBA 2HA6A 2O8EA 3WB0A 1FFDA 3GEDA 3RYHA 4AK9A 2PBFA 4FEEA 5H02A 5TE9A 2JLWA 1WM1A 3H9EO 2ZRHA 1VIDA 2BSXA 2OV2A 1EEHA 2DFPA 1A5SB 1ZVMA 2H7XA 4UUAA 1EQ2A 3ZHSA 3BJRA 3I9FA 1TC2A 3AK4A 4F4HA 1HQYE 3L06A 4Z51A 3ZUGA 5JCOC 1BMFD 1L7DA 2HDHA 4DDWA 4RUKA 3VKWA 3N2KB 1JKXA 3IOBA 3BDAA 4Q00A 1Q0HA 4MJLA 4LPKA 3OCUA 4RD3A 4GM1A 4DMMA 1A4RA 2WZBA 4J4BA 4AS1A 1N6LA 4U8HA 4J7AA 2QZ9A 4W5HA 1ZONA 2PGLA 3D3WB 4O33A 5HXAA 3QHPA 5DMHA 3AFOA 4ZC1A 1R3UA 5GADl 3FSGD 3RC2A 4KV7A 2VJBA 4XM1A 4KMSA 1IRXA 1XE3A 2D1RA 1KQ3A 4BCDA 1ONBA 4EY4A 4AKIA 3AUFA 2QP3A 1CYDA 2OZKA 2OGUA 3VSBA 1DHRA 3G8CA 2YJZA 1VA4A 4DIKA 4RK5A 1C14A 2YHIB 3BWXA 1JB1A 1C0PA 4CNQA 2ODNA 2HJHA 4HXEB 3LVBA 4DKJA 4TXMA 4QDUA 4WACA 3B1XA 2EP7A 2Q49A 4ZMRA 1CJMA 3C70A 4RM2A 3C6MA 1T2FA 3DMYA 2FR0A 3U1TA 5JCJD 1DC4A 2ZYSA 1SG0A 1TCBA 3CRNA 3OD5A 1GQOA 3LCJA 2VDQB 3K0CC 3PFHA 1NPDA 1U4SA 4LJ7A 1LV7A 4D80A 1FS6A 1U65A 3C15C 8GPBA 1K3FA 1Y34E 2ZROA 3MCZA 3HRHA 1YS4A 3VJKA 5EP4A 1E2PA 5IT9A 4Z4QA 4AQYB 1JLHA 3AQIA 4MIKA 4EKNB 4UOEA 2WSLA 5IMBA 4ZGBA 1OKKA 2RC5A 4I4CA 4RK7A 1J2EA 2J67A 3M8KA 4FZRA 4YJKA 3V7UA 1Z75A 2GNPA 3A1CA 4OL9A 4RF5A 1XZ8A 1EX7A 2HWWA 1GNTA 1PT5A 2X14A 3DOJA 3LXUX 1H2YA 4D56A 1Z6XA 2M6SA 2C4WA 2FSPA 3OHSX 1LPSA 2Q62A 2QTTA 3N76A 4GI7A 3TEJA 2AKEA 1NPYA 4ZN6A 5JBNA 4X66B 1E0KA 3ZXSA 2WLTA 4OJKA 3M49A 3IR7A 3QEBZ 3ETNA 4RYDA 4CTMA 5EWLB 2HFJA 2CHEA 4Q1AA 1LZLA 1U63A 8ATCA 4N5HX 1PEAA 3SMQA 1YO6A 1DAEA 3RIGA 3V3TA 1G20B 4YJGB 5HMLA 3AF2A 5ALVA 3QVUA 4U63A 1UQTA 4BAGA 5I9SA 1XPOA 4YH1A 1LBHA 1ZGBA 2XAAA 3GEEA 2OFOA 3DUWA 4JL5A 4XQEA 4BNKA 2R7LA 4CEIB 3UHJA 4WKCA 2X13A 3NRBA 3TW6A 3RLIA 1O9BA 5FUWA 3BWMA 4DLVA 1B3BA 2VYQA 4P98A 4C5AA 5HZMA 1TM4E 2BEUA 1GSHA 1QYVA 3L0YA 4HZUA 2PZAA 5DVZA 4DIBA 1RLUA 1V8ZA 1YS1X 2F43A 4L72A 3GFGA 3ZI4A 3C45A 2PQ2A 3AO0B 1ZD4A 5FHQA 5JI2E 4GPD1 1E6EA 4K6CA 1FW6A 3P0IA 1NP6A 5TPZA 3KQHA 3JQCA 1EFVA 2D8MA 4JJFA 4Q5IA 4YCAA 1G59A 2X86A 2BGKA 3H5IA 2CB0A 4KGVA 4Z7QB 3B1FA 5K2MA 4CEJA 3ZW9A 1HE4A 2DULA 2PZKA 5EZYB 4ZV7A 4I3FA 4P81A 5IP5A 1P75A 3NBQA 5IX8A 5GOZA 5E6SA 4B79A 1FRFS 4N3GA 2YHUA 3FTFA 3UWOA 3VOSA 3MJDA 3PITA 2JEOA 3OJFA 5CT8A 4WBNF 2WVAA 4HGOA 1PR2A 4KE9A 4OGKA 3ZOZA 1REQA 1D2RA 4PPYA 3UXEA 4MB0A 1XALA 1N2GA 2WVHA 4KLZA 5FX2A 1K6JA 1VOTA 3WLHA 1P0MA 4TUYB 4PEVA 4DJDC 2CHGA 2RBGA 3HCBA 2X6TA 1GG2A 1OLUA 4TL7A 5AVXA 4YT8A 2YNMD 2HBRA 4MDHA 3TN7A 1K08A 1GDHA 2VOJA 1XU7A 1C8KA 4S2EA 1Q17A 1XCBA 2PL1A 4ZOBA 2BZ1A 3U3KA 3UWMA 3X1YA 4PG6A 1LNSA 4KN9S 2GEDA 2VAVA 4RE6A 4XARA 1BVRA 4YWHA 3TB4A 1QVWA 4D0GA 3STUA 3T6KA 4LF6B 3WLMA 2I8CA 1O6CA 1JS1X 3V8EA 1YL7A 1RE1A 1G0NA 3CONA 4NBNA 4UHFA 2Z2IA 3V2HA 2EBHX 3NB0A 3Q9LA 4MIYA 4HYEA 4NEGA 5GTDA 4F3NA 5F9HA 3RU9A 5T6BA 5DBGA 5EHZA 4KYVA 3U37A 3JQFA 3RRJA 2GEFA 5CXUA 1R8XA 1XZEA 2PH7A 4G25A 1RQGA 1BKYA 3OZCA 2C03A 1SA0B 3DTVD 1QO0A 1EB9A 3KSRA 4OI2A 5D00A 3RUCA 4D4KA 2BGWA 2ADFA 3A3OA 3V1KA 1GITA 3L1IA 4M1QA 1OBOA 5EE3A 5E6UB 3MWYW 2WU4A 3ZJTA 3FHLA 2QD2A 3BJMA 2GQ0A 2NO7A 4JITA 2QKYA 4IINA 4OB7A 4PSAA 2JLRA 4ZO9A 3LPLA 5K6TA 2JJ8A 2PS9A 5BQ5A 2WVJA 1QFJA 1TYBE 1XMQB 3M9WA 3O1IC 1YZVA 1Z15A 2Z83A 3A58B 3L6CA 1B4DA 1OPRA 2CCJA 2CXNA 2CXPA 5EP1A 3RQSA 3BFKA 4W8OA 1OJLA 2O3RA 1B73A 4RZ3A 2IE0A 1G21E 1XEWX 1B74A 3PB3A 4DDHA 1DC5A 1BA3A 1E4YA 1Z7BA 3GNTA 5HOEA 3KYIB 3OTWA 1PWHA 2PWPA 2XUJA 4R9VA 3RGGA 1KP9A 1YFKA 3QUAA 4GVXA 2HQ1A 2JFUA 4W9NA 3RS2A 3G2QA 3GFQA 4XIFA 3P19A 4NSNA 4IGAA 4O3MA 4L08A 2HDOA 2WIKA 5CFLA 2XXBA 4TKZA 1W4CA 4ZICA 1YKGA 3UPTA 4BLPA 4CLOA 3FCAA 3ON5A 1SQ5A 1L2TA 2AHOA 2VKQA 3CUUA 4G5FA 4V24A 1J00A 1MX1A 1KO4A 1NM5C 1OJ7A 3U7QB 3WLEA 1C9NA 5E9AA 4BNGA 2WWXA 5K0JA 2F1HA 3O2NA 2J30A 3IUNA 1QF7A 3PHGA 3CE9A 3SYTA 4CDRA 3CINA 4OHWA 1JSLA 1CIJA 2H5EA 5LD2C 3TZCA 4QXOA 1DRKA 4OXIA 2R9VA 4IAOA 2JFOA 4HLUC 4C78A 2G67A 1ZY2A 2WJ4A 1BX3A 3FWNA 3K6SB 1LDNA 2GCOA 4CVNA 1SUCA 4DSTA 1A2OA 1GQSA 2EFJA 3VYUB 4BJ5A 1ZUNA 3U48A 2F3PA 1DBRA 2UZ3A 3WGUA 3U09A 4U7DA 4NMWA 3AB8A 1QYDA 3GUZA 3O2SB 4I6GA 5HA5A 3O4VA 3LAWA 2Y0BA 5ARCA 3USCS 4CCAA 2AOUB 4TTIA 5K01A 1K88A 3EXFA 1NVAA 1UT8A 3Q7IA 1ISMA 4EMSA 4LV8B 5JSQA 4CM6A 1JJIA 4B74A 2RARA 2DETA 1PEDA 2FA9A 3U44B 5FLYA 1EFLA 2HH9A 4RHEA 1XZPA 1ADFA 1F4LA 1C2TA 5DT9A 2WKRA 3REQA 3T99A 3HYNA 5BYBA 3UHPA 1C4KA 5FL7D 2V7VA 3WA6A 5D85A 2ECFA 2MSDB 3IPYA 2O59A 4FFWA 5BY2A 1UFRA 2NO1A 4C08A 2OOSA 4MQMA 3EH2A 5E7QA 3RF7A 2FPGB 5TC4A 1Q2UA 1WXHA 1ZINA 3HB9A 4UEWA 2RI0A 3OZSA 1UR5A 2Y77A 1DQRA 4QNMA 3GOQA 4B09A 5EWMB 1KI6B 2O52A 3V3KA 1FPQA 5JSHA 3QMPA 4GI2A 4TRJA 4WNCA 1T3GA 4HFMA 5FQNA 2O8NA 3K72B 3OJ0A 2B4AA 1A9TA 5JHHB 4IF4A 5CT6A 1NPTO 2JGKA 5EZYF 2GXSA 4OU4A 4EMTA 1XZBA 3HZRA 7ADHA 4OGWA 3B51X 1BCSA 1TT5A 4KACA 1T3ZA 3WLAA 4AYWA 3T1NA 2AC4A 3WIUA 3TUJC 4DT1A 4YUAA 5KJ1A 1ISIA 1GU7A 3GNLA 4JJIA 4RD6A 3OWOA 4C6TA 4DB4A 2R1TA 3IV7A 1EA5A 1NR1A 3DAOA 5CPBA 3DFFA 3F7NA 4Q15A 1L6RA 3MMSA 1VKZA 2A84A 2QTRA 4TUYF 4I50B 5G1PA 1KIAA 4P9NA 1R5NA 2R8OA 3BD6A 3CXRA 4I66A 3ZLTA 3V48A 1HFWA 1T36B 1ZYUA 4M1EA 3PCTA 4QULA 1TT7A 4PFQA 5DLEA 2RGGA 4HFNA 4CLEA 5C1BA 4PNHA 3E5HA 1AT1A 3F3MA 4XSHA 2QMOA 2IYVA 1F1BA 2W6JA 3AXSA 1M8PA 3FLBA 5IMSA 5MGNA 1FYVA 4I4IA 4F7WA 5EL0A 5C34B 1CUEA 1E6UA 1P8AA 2OB1A 3FG9A 1I51A 1RQPA 5ESDA 1XF1A 3A06A 3BM5A 3AX6A 4C2UA 2HTFA 3K4HA 1OV6A 2PIAA 2W00A 3AERA 3OKCA 4RPJA 3TLXA 2O2EA 4KPFC 1SQGA 2XIJA 1T1SA 1Z88A 3A27A 3O4JA 4URUR 2GD2A 5C1DA 2ZRBA 5JW6A 1ZM7A 4B4KA 1EFAA 2G63A 4EO4A 2A0KA 2JJYA 3FZNA 3VHXB 3D7LA 2WR8A 2WA1A 4R1NA 4EP1A 1Q1GA 1QH1A 3B6KA 3IL2A 1CS0A 4DMUB 2QORA 1XMIA 1E2MA 2A1TS 1E9RA 5A3QA 2XCLA 2E7ZA 3L1VA 4D74A 1NVGA 3TS1A 4UM9D 1VP9A 3PPXA 2PE5A 5EJ4A 3RH0A 2R6ZA 4WLFA 1A2BA 3TX2A 1CDDA 5IW8A 3WZLA 1SJ9A 1J7KA 2FLVA 3LPDA 4LDRA 1MXHA 3COJA 2R8YA 5CVJA 5EY5B 2OBXA 5DNCA 5AI6A 1ODCA 2OA0A 1Q7TA 16PKA 5DNEA 5TPWA 2NSLA 4B4VA 1HL7A 4NY1A 3NDPA 1Z4NA 1GNVA 2ZB3A 1JDNA 1T6BY 1G1AA 1J97A 3DMFA 3R2JA 4FNMA 2BRUC 1A9QA 4V3BA 3VYWA 1ZRNA 1U9JA 5E4JA 4DLBA 3GARA 1L7XA 1WSBA 2R4UA 3UAOA 2FZKA 2NZXA 1G5IA 3GDFA 1X94A 2IS6A 1KZ7B 2EJVA 2HUPA 3SQLA 3ZE7A 2ZG6A 3EXHA 3PFFA 3V1LA 2ZYDA 4OUDA 4B6GA 3RSGA 4PX9A 3WTBA 1OFGA 1TO1E 3P7MA 3PXAA 3QOYA 3R3YA 5AVQA 1X7WB 3KTDA 2QLTA 2J1LA 3OZWA 1CR4A 4UATA 1L5KA 7MDHA 2BMEA 2CLDX 4DVJA 5I7HA 3DXXA 1THZA 3O1HB 4I99A 2VZEA 2D6FA 1JB9A 1GZHB 4DIDA 4I14A 1VJCA 5JDIC 1CZNA 5A9TA 5JATA 2OD7A 4QXAA 2E1PA 3CQ9A 2QMUA 2VYVD 1UT6A 4I46A 3RANA 1DDGA 2HQSA 3UCXA 2IQ5A 2A88A 1BXRB 4RU1A 2Q28A 5FB3A 3UMJA 2BVNA 1GZ7A 5K0TA 3U4QA 3MAAC 1X9GA 4ZYTA 2ATIA 3BTVA 1EAYA 5TMDA 3ZDRA 3ZX5A 3FIJA 3VZQA 4PYLA 4ROTA 1XQVA 5AXAA 1FYXA 3GCWA 1TQ8A 4D44A 1TTTA 2PNJA 4TYWA 2B7BA 3O4GA 4HAZA 4QASA 4CU5A 3L0IB 3LDFA 1O7JA 2PUAA 1SZDA 2VK1A 4UVIA 4JIGA 4O2LA 4AMBA 1DX9A 5G2OA 3FPFA 3N0RA 1TJPB 1E9BA 1N6PA 1VYHA 4RY2A 4QAQA 5A05A 3TQSA 3A6GA 3ZPXA 1ZPDA 4TKVA 1V1RA 4WZAE 2ZT6A 3DEHA 4CM8A 5ALIA 2GFHA 4R1TA 1VSBA 4M9RA 4O4HB 3M5CA 4YJFB 3FVWA 3QKSA 2GN0A 3DO8A 2IZ1A 3N3BC 3SQOA 5CDSA 2R5NA 3MZ0A 1L4FA 1PQYA 4WCFC 4YMTA 3C3MA 3VJLA 3THWB 2Z9BA 8AT1A 5BW4A 2ONZA 3FFBA 1AKMA 2CNNA 1Z5GA 4OH7A 4QJBA 5FJJA 3HSYA 1YR2A 2V74B 4FDVA 2GZDA 3IP1A 1S4QA 1B43A 3AOEC 3IVCA 3MWLA 3O2QB 4REQA 3K3PA 3K0KA 4V3CA 5AD1A 5JG7A 5EHNA 4GKJB 3DQPA 1OYOA 2BDEA 4RDHA 4TMXA 1ZA1A 3BN3A 1IQUA 1EVYA 4ZRDA 3EZLA 4G1FA 4MEJA 2JI4A 2B21A 5JO9A 1L7OA 2VBFA 3QVWA 4PN3A 1N9GA 3BWCA 5CNIA 3BT7A 3CF4A 5E1OA 3ZHCA 3FOEC 1IH8A 2YWDA 3KKZA 1F7UA 3C3PA 5KAMA 1QX4A 1J56A 2QQ5A 4D6YA 5CLQA 3U6BA 1C2YA 3CZPA 3VTKA 1IJKA 2FSVC 5FI1B 2DLCX 3HZOA 3K0BA 4L02A 4X1OA 4YBRA 2W2PA 3DDWA 3T7CA 1Y3IA 4M0LA 1GKYA 3LGXA 3H4VA 3RHFA 1CUXA 3KIPA 1XZNA 1N7IA 4B3JA 2ZT8A 3LDUA 4KQHA 3TCXB 1EGVB 2VAWA 2SKEA 3DKIA 2AYYA 3KJXA 4E4RA 3NAGA 1C29B 4YEDA 1S2IA 4FZ3A 4PQRA 1TE2A 4HDMA 4Z1MA 3RYHB 2WUWE 2ZSKA 2GO1A 3FLMA 4ZAVA 3ZGYA 1CPYA 2VDLB 3EGWA 3KHUA 1B1CA 3R3SA 3ECAA 4GPZA 5FUYA 1A69A 3PL1A 4D0LB 2PA3A 1PEYA 2K2WA 1V8PA 3DR5A 4QGGA 4ZOAA 2BBOA 1JE1A 2Y8EA 3D3KA 3LVFO 4IFTA 4JUIA 4IO1A 2QN8A 1ESDA 2CUKA 4PNPA 2FKNA 4TLBA 2E4UA 1O87A 3OEYA 4TXHA 3ZDQA 1YQXA 4D6XA 1KEUA 4GYYA 4RXTA 1I10A 4M53A 4AYTA 4C7XA 4KW7A 5G0SA 5F5LA 3L0CA 1G2OA 3T3PB 5F9FA 3IHTA 2RHDA 3HVKA 2AN1A 2HEGA 3AONB 5M3BA 4DM3A 2EFGA 3V8MA 2P67A 1IJFA 4IRUB 1I9GA 2YR0A 2Q7OE 4KRFA 2PTHA 4NP6A 1CUYA 1ULTA 1K9VF 3QRWA 3A6ZA 1WDKA 2IYZA 3IKJA 3KYCB 2DSTA 2FPIB 3M5WA 3EXEB 1CEEA 5HCIA 4FEGA 1NC1A 5K20A 4UEJA 2ZT5A 4B7XA 3H16A 1RRGA 4BNZA 1EXNA 1P5JA 5J2TF 1YQDA 1T9KA 4N82A 3OD1A 4WINA 4L9AA 3ZZMA 4ZOLB 1KDTA 5KWSA 1VM6A 2QD3A 2WM9B 3ZWMA 3FMVA 3H2KA 2JI6A 4MQ6A 2O07A 1R12A 4JJ6A 3MWKA 5ESXA 1ONOA 3AUYA 2VK2A 5EC8A 1Z6YA 2P2NA 3RDPA 4QDKA 3T5BA 2WWYA 2PQ6A 2W93A 3N2ZB 3OY2A 5B7GA 2IFTA 1OB5A 1C8LA 2JK0A 5JZOA 2WWGA 4IEIA 4ZVTA 3Q4GA 4BKPA 4DXDA 1GNLA 5LZ5A 2HDWA 5LB2A 1EFPA 1P0FA 1JKJB 1NR7A 2CF6A 2YXBA 1NGSA 2DBQA 3O94A 4PHHA 1PZXA 2OYRA 1W4LA 4FW8A 1L5MA 1Q21A 4A5SA 4EY7A 3B7GA 3EXG1 3IMEA 1QTNA 3TR0A 3VU8A 3NALA 3HPQA 3SC6A 2XUZA 3IPLA 4RHUA 1K75A 5B5SA 3WSTA 4TRNA 3TR6A 3WGJA 3BQNB 2VJAA 3N07A 5U9CA 5AI8A 3UOAB 1AV6A 2HOQA 4HVCA 3BD9A 4PZ0A 4ON9A 4C76A 1EQUA 1NMEA 2BH9A 4FJ0A 4YCDA 3T1VA 3GJ0A 3IILA 2R5FA 3S40A 3ZK9A 4LMBA 2G76A 1G64A 2G9QA 3G9UA 2PS1A 3ONDA 4XX1A 1U2DA 4KDEA 3LHKA 3GEGA 1IDN1 1DV2A 4FYWA 4QECA 1NQWA 3CLRD 4IDOA 1E9AA 1PO7A 1E6KA 4DPKA 4BNFA 2H29A 3NFYA 1L8LA 3F7MA 1VMDA 3GC6A 5IC5A 1B1AA 2B0JA 4GOKA 2ID7A 4A1OA 2BHNA 3DFKA 1RPZA 4COOA 4O4HF 1JG2A 1G7RA 5LBTA 1HE2A 4HH4A 1A96A 4HVAA 4IXMA 2IUYA 4BDSA 1N2SA 2PD4A 4DEXA 2GX6A 4DN6A 5C4GB 1ENOA 1SIUA 2PKRA 4GMXA 4MP3A 3SSMA 1G3MA 1U8EA 3W2GA 5BR8B 3ANSA 4GVPA 4INPA 1YAJA 3E9QA 2RCNA 5ICFA 4AN0A 3R40A 3LL7A 4A2QA 1QGUB 4DNFA 2IU0A 3N2GB 2AK2A 2ACKA 2ZBGA 3ZWXA 1Z5PA 1GL6A 3GYGA 3TBFA 4IDEA 4EVIA 3TZEA 2DPYA 2QT9A 4YUWA 2PGXA 2YX1A 2D5LA 3CF6R 1HT1E 1ZU5A 5HIAA 4QDJA 2VVTA 3HU2A 1E5XA 4S1VA 4KXYA 3WLKX 1R0RE 2AZ4A 1DBQA 3I39X 1WP9A 4PYQA 2YW9A 2QSYA 3B89A 2GH1A 2BTQB 4L73A 4FGSA 4KQFA 4DFDA 1BFKA 1MU0A 2IIQA 1XNQB 3GLHA 3QSYA 2GJ9A 1XNRB 2QRLA 1NW6A 4C4XA 2BBWA 1PS9A 3WNZA 1MN6A 1THTA 2NYVA 3SLKA 1YDFA 2CNDA 1HLDA 3I9OA 2KB0A 3OMXA 5DGCA 2XWQA 3UK2A 5LYJA 5HKKA 1E0JA 1RWQA 2WZQA 4KGXA 4LI3X 4RY9A 4GLJA 4M0FA 5G0UA 4WK4B 1XVAA 2I2BA 2XBMA 1UC8A 1WABA 1GEGA 1FVOA 3NBAA 3ITEA 3L8FA 3HXOA 3DDZX 1YZNA 2H1OA 3FBTA 1X42A 1KJYA 3AY3A 2G83A 2KMLA 1GAJA 4NI5A 2ZE7A 1O5OA 3UAVA 1LXCA 3ZWBA 3C1OA 5U4XA 3PQ5A 3ZJYA 4RD0A 2C4KA 1LPMA 2JDIA 1IUOA 1Y7IA 3M4YA 1B93A 2FJ0A 4FOPA 5A7GA 1EBUA 2W83A 3KR1A 3SBDA 4BE9A 1MC5A 4MV5A 3ROQA 5DGHA 4ZAWA 1PFWA 5T67A 5AVSA 4QVIA 4NFLA 1G38A 2IU4A 3TW0A 1X6VA 4LSMA 3VOBA 5J3JA 1RBYA 2H17A 1E2KA 5H59A 1ZU4A 3WQQA 1YR3A 2Q2NA 2WPDA 1D07A 1CUUA 3LY8A 1KEEB 5JEDA 3A36A 1N5JA 1N57A 4L8WB 4JVMA 1KDOA 5DBOA 3UMGA 1H4QA 3VKGA 1ZBDA 4U9UA 4BEWA 3KPYA 4D97A 3VNBA 5BV2P 1IPFA 4KQKA 4ZOLF 1QWSA 5DP2A 2OG1A 1CJCA 2ZRPA 1RPJA 1UPXA 1XELA 3W1VA 3E8XA 1JDZA 1ZM4A 4IY1A 4EBFA 1SKAA 2N46A 1HDZA 2BFEB 3FMFA 1RSZA 3AEUA 3MJVA 3PQ8A 5CTJA 5FDFA 5AKLA 3UFXA 1US8B 3IX7A 2M6RA 3B8EA 4IZHA 4F5YA 1DEOA 1Q44A 1RDFA 2DM6A 2QV7A 2XYVA 2YV4A 3HCPA 3PWZA 5GIOE 2CNLA 1NN5A 3Q41A 3U9LA 1YVUA 2I65A 3FGZA 3I2HA 4HEA1 3SQDA 1ULZA 2XA9A 4D43A 1PR4A 1YS6A 2CNWD 4MYUA 5CM8B 2CLLB 2HV9A 3ZHYA 3M5PA 2AMYA 3KZNA 3V1MA 4AYXA 5ENDA 2C7QA 2RKBA 4MPDA 4HNAB 2ODWA 3ONEA 1N0WA 2GMWA 2WAMA 4WZBE 2XYPA 3GPIA 2IYWA 3ICOA 3ZI7A 4YV7A 5I47A 3TFWA 3Q85A 1OXTA 4L28A 4G4SP 1UOEA 2GCOB 1EP3B 3MW8A 7ABPA 1OOEA 3U4HA 4G9GA 4L27A 2QIOA 4B6JA 4RHCA 4QOEA 3FOBA 3SIWA 4BS9A 1S6YA 4DDTA 1FX0B 3GDGA 4Q9JA 1ZCAA 2GZSA 5EHIA 1ISRA 2KSQA 4R8KA 3X1DA 1U2TA 3PC4A 4K0RA 2CKDA 4RVSA 1D0VA 1ELOA 2P3LA 1DAIA 1XCMA 3CW9A 3DMTC 1XPUA 1T2AA 2GKOA 5FBQB 5UKDA 1C3VA 3EGXB 3MT8A 4WFIA 1ZCFA 4FGLA 3TLZA 5A5GA 2EP8A 3GJTA 3MLEA 1GD1O 2Q9CA 2DP4E 3ASUA 3BGDA 2IDMA 3N8GA 4MVJM 3CNBA 3OZGA 2XZTA 5PGMA 1GNSA 1QQBA 4B40A 3DKPA 2YHSA 3WL7A 4I6EA 4JP2A 4OYRA 4DNPA 3W1WA 3M0EA 1KJ9A 3NOVA 3T3DA 1JFSA 2ALJA 1ZQ1A 3CVXA 3KLMX 1LBIA 2C5SA 3Q0TA 2O0KA 4Q47A 4XAQA 5B58T 2Y1XA 4YMLA 1PR1A 3NG1A 4ANFA 5KIAA 3CIOA 1LJLA 1P29A 1R7RA 1RWOA 1Z4KA 3GQBA 4I36A 4AO7A 3GLUA 3H13A 1XRNA 3ETHA 3MOIA 3KL2A 4ZC8A 2JGNA 2VP4A 1GNRA 1HTTA 4ZVUA 3HKCA 4KR0A 3FNRA 4PBSA 4JI7B 3MJFA 2ZI6A 4YUYA 5JAHA 3AVYA 1Q0LA 3U4MA 2KI5A 4G65A 2JIMA 3AM3A 1E79A 5E6RA 4DT1B 1KDRA 1OKKD 5EJFA 4QU9A 2ZUTA 2PMCA 2RH8A 3D5EA 3HA7A 3EA0A 5J5CA 2VHXA 2IKQA 1RJ9A 1I36A 2WNSA 5KB3A 3DF9A 2BFPA 1P4AA 2FWNA 4ZREA 4BEBA 4P92A 3ESRA 1QHNA 1B2RA 1Z36A 2P40A 1PR9A 3GRUA 3P2EA 4XYEA 5AJHA 2HEIA 4HMPA 3C5EA 1SXGA 2YFKA 2XVAA 2O2JA 3K73O 5CVTA 2BCGY 3I45A 1OFUA 3ETCA 5DNAA 4INZA 1WCXA 3HVHA 4BB0A 4B3GA 1VKOA 3MGGA 3LLCA 4LISA 5KWIA 4NKRA 2AEFA 3LGAA 2C59A 3DAYA 3M1IA 3GQVA 4LBYA 4GM0A 4L8LA 3RJMA 1AO0A 3V4OA 1H3NA 4BNIA 1H8EA 4C4AA 2FB9A 2ANCA 2BV3A 3HSSA 3K20A 5FNVB 4PLFA 5REQA 3O7MA 1JHPA 3AERB 2HREA 2JFQA 3I64A 4MH0R 4QKQA 4Q4AA 4QJ3A 1OXSC 1SKUA 1U7HA 1GUAA 2BUCA 2HPAA 3ROKA 3ZY4A 2AN5A 4AI6A 4I2NA 3VR1A 5E1BA 4EHFA 3QQ5A 3LCRA 3M2PA 1FE8A 1V4VA 4MCJA 3WMGA 2ZFUA 3SZ3A 1EEXB 5DX8A 3VR5A 3FUUA 3LIIA 4NBVA 1C3OB 3I5UA 2J41A 4EFLA 1OSNA 2SBTA 3O31A 1E99A 1T10A 2A3RA 5TPZD 2I99A 2AH5A 1NFQA 3RO7A 1IM2A 1NVVQ 3H3JA 4DLZA 2QM0A 4XWYA 3BKWA 5KOHA 5L95A 1OBVA 1B23P 3QXGA 4CMJA 2Q6LA 2VF4X 1NXVA 3TNDA 4BIIA 1PJLA 4XIYA 1YBMA 1LCIA 1PQ4A 1XFAA 3GWGA 4JEHA 4ZCMA 4JXXA 4LBWA 5TPWB 3WMEA 2Z8ZA 4EI9A 1RPAA 3BZUA 3VAZA 1DOZA 2VPQA 4CQJA 3W5CA 3GVHA 2BI4A 2H7VA 2JBAB 2ATVA 3P0JA 3QEMA 4EG1A 4HUQB 4B3XA 5IJWA 1GTVA 1VLHA 2ORYA 3EASA 3FZGA 3WV5A 4FYVA 1DIRA 4FXPA 5F3WB 1PV2A 2X42A 4WJKB 4Q82A 1ZD3A 1MABA 4OUDB 4D4MA 5ARDA 1MPXA 2C7GA 5F9MA 2C9MA 2FSIA 1RAEA 3A9RA 1S2GA 1QGAA 3AVUA 3UJCA 4C1NA 1EFUA 3OWXA 2XZLA 2I4MA 4IDPA 5CXXA 2H48A 4DRYA 3WKCA 4K1LA 4JT2A 1E2FA 1ORWA 2X2EA 2D1TA 3EF3A 3H7AA 3BJZA 4M2LA 4Q9LA 4ZKEA 4Q1DA 5I9LA 3H2JA 1AVTA 1IB0A 3HEAA 3G2MA 4D02A 1I1QB 1P0CA 1K7YA 4UMFA 1QIMA 1XAGA 1AY0A 2CEAA 1VB5A 1JQ3A 2XQJA 1QO0D 2R0QC 4FX2A 1WDTA 1W9MA 2N42A 1P5FA 3NV9A 4KOAA 1QK5A 3D0OA 3I01A 2ZRGA 2YFYA 3QTBA 1ODIA 1T4GA 2WG2A 4DLAA 3HDHA 2EL9A 1Y5MA 1UFQA 3HBNA 3HJAA 2HLDA 2SNIE 2NUBA 3B6EA 1JZQA 4YMWA 2WF8A 4Q1CA 5JV5A 2FX2A 4X44A 4AULA 4Y6OA 5BVHB 1QNLA 1T43A 2Y4NA 2ODBA 1DMSA 1S9HA 3QKSB 5AHXA 5C4IA 1GKLA 4YUXA 4RHYA 4QEKA 1PLJA 1UOPA 4B7ZA 3THYA 4FKBA 1XTPA 2ZJBA 5B1IA 3D3NA 4TS9A 3NWEA 4RFVA 3EZGA 3EF0A 3KJFA 5EIWA 2VHZA 2WAXA 4DXAA 4JN6B 3UQYS 3SYRA 3AI7A 3KR2A 4LXXA 3A1TA 4QG3A 3OUUA 2YJNA 4B3SB 1M2VA 2PX0A 2CJWB 1EM8A 3D1VA 1P77A 4RULA 4NXNB 2DQKA 2NU6A 2FNAA 4XW2A 2OHHA 1MTZA 1H0SA 2VRCD 4HL6A 5EYPB 5JPIA 3QUTA 1C7JA 4E5DA 3AL3A 2YOGA 1JLKA 3HU5A 3UJNA 2P2YA 2I8AA 4M6WB 2EARA 1OR8A 1GQQA 3B5EA 2CDRA 2O2HA 5AXCA 3ABIA 2WM2A 1M33A 4HLNA 4LJLA 2ECKA 3PHCA 4GLFA 1RQ2A 2ZCJA 3PJRA 3LYLA 3SVZA 2AOTA 5C35A 1D1SA 2ZI7A 4ZDWA 3V34A 2XCUA 3IT2A 3KU4A 1Z5WA 1VCMA 1W46A 3KZVA 4BX3A 5TQ0B 3V8PA 1J5EB 5H3CA 4FI3F 2FETA 4F4UA 1LGYA 2FFHA 3EPLA 1A4XA 3ZE1B 2Z4RA 4JSTA 4BTVA 5IPFA 4MVYA 3FTQA 1ZI6A 4YI3A 4M7RA 3HI4A 3VUEA 4BV8A 4CIVA 2RHJA 4J16C 1W5FA 5AUOB 2HRZA 3WKDA 1U9ZA 3JQ7A 2W98A 4CKXA 2PO7A 4F1JA 1TYAE 3I01M 1OFUX 2GA9A 4PG7A 1WMEA 3EVEA 3M6AA 5T4FA 4HWRA 1RLMA 4FUQA 4IDFA 3S1AA 5KNBH 5GWXA 1DIGA 3HGTA 5F64A 2C7RA 3DL0A 2IS2A 5KMGA 2QSUA 4EYQA 1XROA 1SOWA 2IZ0A 1JPUA 3HRIA 3LI2A 4IG4A 2G9VA 4XE5A 5DULA 3S70A 1M34E 3USZA 4BX8A 1C3XA 3G9TA 4NE2A 1ZM2A 4PGAA 2B1QA 1E63A 4LIPD 4MB6A 1J9ZA 5E0OA 1LQTA 3TOSA 3K70C 2FW6A 1FSFA 4YRSA 3FFTA 1J0AA 1Z0KA 3PEVA 5J43A 2Q3JA 4MUJA 5B37A 4YRJA 1II8B 3E1KA 2WUVA 3KJQA 4UEKA 4TN5A 2GFIA 2FDXA 5CDTA 2P9BA 3DEJA 3H2IA 4D5GA 2JAUA 4GBMA 1DAPA 5GM1A 5CVDA 2DSNA 5KSPA 4MRAA 3TLKA 1E2HA 3QVTA 3W5HA 3UT5A 2B8WA 1YCDA 2B9EA 1SZPA 1X7HA 2JJ2A 1FUKA 4FYKA 1M6WA 1C1DB 1AKTA 2GRUA 3RK0A 2GUWA 5CBPB 3GH1A 5C7OO 1X8KA 5IKMA 3KJGA 3K4QA 4A6DA 4CG2A 4YT4A 3UMSA 4QXMA 5JSKA 5GV8A 1V43A 5BPHA 1NQ5A 1NJGA 4CUZA 1FJ2A 4QZVA 2JLVA 3MTQA 4C21A 1GPH1 3FI0A 4XPIA 2M98A 4ECAA 1LB1B 4EUKA 2XVXA 3UMVA 2RGEA 4X1IB 4ZZ1A 1GGFA 1EINA 4EMUA 3PE4A 5DW3A 4EQ6B 4KH1A 1EB8A 4PSCA 4HLUA 4FOOA 2DU8A 3Q9UA 2YJTD 2NXCA 4B35A 1JWBB 4N65A 1FC0A 4ENPA 3HDYA 4A4DA 1KEKA 2HYIC 3VOAA 1RCUA 4L74A 5IAKA 5FLEX 3OOHA 1JHZA 2I2DA 3DBHB 3EGIA 3AFHA 5DM0A 3IQGX 3ZJVA 1KRXA 4YPOA 4V1CB 2Y92A 2RJOA 2Z56A 3QM1A 5B7QA 3WOVA 3MT7A 3R6TA 3PGLA 3NTUA 4AS2A 4L4ZA 1XDWA 4QFDA 2FQ1A 1RLIA 3FHJA 4P4TA 1OF1A 3VV3A 3FBGA 2QZPA 1DADA 1RPNA 4CCWA 3SHOA 4DWVA 3JWJA 4QNRA 1CJVC 2XX3A 4YJ2B 1RC0A 2P4UA 1C9MA 2PRKA 3DMPA 4OKSA 3NBZC 3SJBA 2OAP1 5K4HA 2NYRA 4L1KA 3WNBA 3N5CA 3W6UA 2NADA 1W44A 2V9PA 2I6QA 3E84A 3EJ6A 3G59A 4ND8A 4DLXA 3VKHA 4F71A 2YIDA 5JNUA 1MEOA 4QXQA 5ALZA 5K03A 5G3YA 1RPTA 5KYTA 4RKQA 2ZIUB 3AU9A 5CM2Z 2XTAA 1LBQA 2B4YA 1B0PA 4IHJF 1B8OA 1T8SA 2VNKA 2X0KA 3CM0A 3D7SA 3RIXA 1U02A 3BMNA 4K9OA 3UKOA 4B32A 2AOVA 3W5BA 5LQRA 4ESOA 3PWKA 4V03A 5LYYA 4B3DA 1TKAA 2V7PA 2B99A 3K35A 1OXVA 2TYSB 3AEQA 3I0NA 3O5AA 4LZJA 1I6KA 1XXHE 4ID9A 1TVMA 3QH4A 4MMZB 3PQEA 5FWYA 5LBUA 1T91A 3GRPA 3TIIA 2L19A 4PN7A 1PCXA 4GAEA 5EKSA 3KUDA 3QKIA 1N33B 4QBIA 1PFQA 4M9UA 1PGOA 1QMGA 3BHMA 1J39A 1M7HA 4HDQB 2WA2A 1IATA 1Q5PA 2X58A 2P69A 4MX8A 1IWOA 2IVFA 1LBSA 4R2MA 3EQ2A 5A0TA 1AF4A 3LKVA 2XWSA 5E8JA 1Z6PA 4MP8A 3ZTWA 3KSDO 2QRVA 4S3MA 3AGQA 5JJLA 4J9VA 4OA8A 1JFFB 1ABEA 3LLMA 1E4EB 2B35A 4QQNA 1WMBA 2PGJA 2X8AA 4G1BA 4EDFA 3FUTA 2V3WA 2IC5A 4GQBA 4Q05A 5D84A 4W5QA 9MHTA 4GIBA 4HOYA 4I4TB 2D74A 1OXKB 4P7FA 3ML1A 4W7SA 1AQLA 4C20A 3BC1A 3DCIA 3PGVA 4DRXA 3A9CA 4PFSA 2YXNA 3G2HA 3JYQA 2E6KA 5MN5A 3L9XA 2VC2B 1Z5OA 1PV1A 1DUVG 3F1LA 3P9XA 2O1EA 4UKDA 3UMRA 4UC0A 4BNWA 1U7XA 5EE5B 2C5BA 1MZPA 1C4OA 4H6VA 4IHJA 3FZQA 2I1WA 2GWHA 3ME5A 4GZ3A 5HF5A 2NU8A 5KNDA 3QU2A 3EW7A 3RHSA 2OXRA 4LJYA 1Y9EA 4OHMA 3WLFA 4HLQB 2VLIA 2FPRA 3H65A 4K28A 4C04A 2X9LA 3BTOA 3R5XA 4MKZA 1CVIA 2FR8C 5FOVA 4I0WB 3A4LA 4KQGA 1YC5A 1NV9A 2FN3A 3BJEA 3GLRA 3JRXA 5ALFA 5ICCA 1KO7A 3WSVA 4BGUA 4WLVA 2OP1A 2WFLA 2BRUA 3I23A 3M6VA 4CLXA 2IV3A 2IXDA 4U00A 3FJOA 5I4IA 4EKYA 4MDYA 2WTEA 3GUUA 2JLBA 3FDZA 2HHLA 3S5UA 2BD0A 2QM3A 4AJOA 4GFDA 3W4KA 1Z9BA 4TKUA 1XJ5A 1V9SA 1CZLA 1QH9A 4S1NA 3BEDA 4QTXA 5KYUA 4OV6B 1OU0A 2IVZA 1Y37A 3EH1A 2YYSA 5H16A 2J0UA 4BN4A 1ZHOA 4OIFA 1XC7A 4J4TA 4D4JA 4DAOA 4Z3DA 4ZALA 4BO2A 5EQJB 3R6WA 1MQ9A 3VR4H 5BMVB 1TXGA 2LIVA 4N5LA 1EJ6A 1N2BA 2LP4Y 3BQMB 3IBFA 1NBIA 2ZUUA 4IJUA 4Z1MD 3HWWA 2REBA 2P8JA 5DSXA 2PQ0A 2XHEA 1FBTA 5JRZA 1ODKA 1SXJA 2Z98A 1SVUA 4G5GA 3DDHA 4KRXA 2CC2A 4KDCA 1CB7A 1AS3A 3V7YA 3DFIA 3IA2A 2ZYUX 2FLKA 3EY9A 1A8PA 5SZIA 4CKBB 1PDWA 3AFMA 5BV1A 5HZHA 5MN6A 1PRYA 4E5MA 3F90A 2O2IA 4NNOA 3RT9A 3AIOA 3JQAA 2R47A 1OQAA 4X1YB 3LF1A 2VA8A 2J9FB 5CFOA 3OZRA 1KY5A 5FV4A 1NVMB 2DVMA 4IJKA 1N4DA 1TA0A 3H0EA 4PXYA 5BXYA 4OLBA 1FDTA 1RXYA 3D2BA 1M1UA 5FBZA 3F4KA 2FMTA 1SUBA 3VC2A 5ABPA 3A9VA 5MF6A 1XZGA 3MOSA 3SOZA 2AN4A 1EZ1A 4WCFA 1W36D 3K0AA 3DJFA 3HB5X 3PIDA 4QYTA 3MJ4A 3CLKA 1NG1A 2QI9F 1ZK1A 3AOEA 2Q8NA 1CEXA 1ZHFA 2OSVA 3GJ4A 2A9VA 4N4AA 3U2QA 5JYEA 1AMOA 2G9ZA 3BWBA 1UXGA 4UBKA 1JA0A 3TLBA 1PL6A 3FFWA 5BQ3A 3R77A 2OHVA 1ZH0A 1AQ6A 3IAM1 1QHYA 1LI7A 4BV9A 1CZKA 1KSFX 2JFFA 2H2GA 1TMGE 5IZCA 1XB2A 1L5QA 3JWGA 1XA0A 4KP7A 4BNDB 1QPZA 1G20E 5TF4A 5AKJA 3RS3A 3UB4A 1S3IA 1NVXQ 1PL0A 3R5FA 4I08A 2IYFA 5B1HA 5FWNA 2UUAB 4P4NA 1KZYC 2A0FA 4DZZA 5DISB 1LI4A 1VQ1A 3BORA 4JB3A 3WWOA 4XYGA 1G66A 2VSFA 1HRKA 1VG0B 1DKUA 2GD0A 3I92A 4Z8XA 2WJIA 5KQSA 4OTZA 2WJJA 1GVHA 3OZTA 2J5QA 3ZIUA 2WB2A 4PX5A 5IVHA 1H2WA 3HA3A 1B41A 2AF4C 4K40A 4ZYWA 1DT3A 2M6KA 3PPYA 3WICA 3JWPA 4QM7A 2FRXA 2R11A 3L07A 2C4UA 1KK3A 4HX2A 5LYJF 3AUJB 5F7ZA 4Y2XA 1YZLA 4HDNB 1ZXXA 2PV7A 4X93A 3DLAA 5HWSA 3H11B 3T3HA 3ZHOA 2DHRA 1RNLA 4N7JA 2PUCA 5FOWA 3H4MA 5DCUA 4BDTA 3GEPA 5A3RA 2R85A 3W06A 3PHBE 1TO2E 4BZPA 2IHYA 3B36A 5J40A 1IXRC 3IKMB 4I4TF 2JNWA 1U1EA 5EERA 4G3XA 1NVEA 1SZCA 3CO0S 1WKVA 2I1VB 4KXWA 3GLTA 4XTRA 4CMEA 4HMQA 1Y3DE 2PUBA 5G41A 4Z4GA 2PRZA 1JG6A 3EHEA 5JSZA 1PQUA 2VHTA 3GN1A 4Q9AA 2FPPB 4WL0A 4PLYA 2A1UA 2JEYA 3HCWA 4OAQA 4KSYA 1FTWA 3HEMA 3W9SA 5IDQA 2FTKE 1HSOA 3FMPB 5C8DA 3IA7A 1NT4A 3HUEA 3C3AA 2WSBA 4AJ1A 1W88A 3HCEA 5EIEA 4BLSA 3MM4A 1JT2A 4X8LA 5AI4A 1R37A 5TGTA 3PICA 4LG1A 4DYDA 5L40A 2HU5A 2Z04A 1SB8A 4QOGA 3M89A 3OSUA 4KQ9A 4LK3A 3RAPR 2XOEA 3Q88A 1ISSA 1UOOA 2HJGA 3L7IA 1LRLA 3LA6A 3WNCA 4PHCA 5IRCD 1VJGA 1O77A 4GNKA 4YMHA 4D4LA 4TT8A 3FNEA 3IR5A 3CGGA 5DYGA 4DA0A 1UFVA 4CWAA 5JS8A 1NMQA 4DMRA 2PZGA 1DLIA 3DOOA 3LF2A 4GQIA 1P2UA 4W5WA 1T4BA 1YRBA 1ZH6A 3G89A 4MLCA 1PJ3A 4B5KA 3GPCA 3CX8A 1DTWB 1L5ZA 3FUCA 3U13A 5HKKD 1SXIA 1ORDA 3NP9A 4JOCA 3GROA 1ZKMA 1M66A 1ZIYA 4QBHA 2ZE5A 4RH0A 3W2EA 1YH3A 2QW0X 3JYLA 4FK8A 4JI2B 3CVJA 1J6UA 4XB2A 1EZZA 3MTDA 3S2ZA 4D9BA 1W4AA 5LFAA 5BN1A 3T1QA 3PPVA 2DGDA 4KZPA 4XJSA 1JIVA 1G6Q1 4HXYA 5EE1A 4DCMA 4YY3B 4Q7QA 3P96A 1IBCA 4OI4A 2JBWA 4PGHA 4C0AC 2X7XA 3H6KA 4B81A 1G5HA 2JDID 4IQGA 2PH1A 4LKOA 3T3IA 3COSA 3NC1C 4QJIA 2X5KO 5EN4A 3LRTA 2A9QA 1H6DA 3KKQA 3K5PA 3KPWA 2OHOA 4DUPA 2OV6A 4P80A 5DYTA 2H7CA 1BTOA 1AC5A 4WH0A 3SYMA 1YHZA 3ULKA 2WM3A 1EUYA 1DRWA 4NBWA 1P4HA 4JB2A 4WY8A 2Y1DA 2WPDD 3H9GA 5LUAA 2H5LA 3W9UA 4Q4JB 3D0RA 1YUNA 3DVLA 4I5IA 4TMWA 1QYXA 4OAPA 3F73A 4B3RB 2QZSA 4R7GA 1CC1S 3FVRA 1YS9A 4OBXA 1JPJA 2B37A 4H4EA 4PYNA 4RLFA 1RQNA 4GSLA 4GP9A 2PLFA 4BO8A 1HGXA 4HO1X 4MR7A 3WB2A 2GN1A 5KREA 2FRVA 4IDAA 4US0R 4KLAA 2CV1A 1X8LA 1GZVA 1RYYA 4XGQA 2J6IA 2V54A 4ARZA 3BUSA 2LWIA 1ZW1A 2HIGA 4DC0A 2NP7A 2G1UA 3P52A 2JL1A 3IAEA 5CIYA 3P8ZA 1K8RA 2NLOA 4ZODA 3QG5A 1IPHA 2O0JA 2XCSB 1N2JA 1W5BA 1ZM3A 4DCNA 5DX0A 2SCUB 4YRAA 1PHRA 1OX6A 1O1YA 2BL4A 4A0FA 3N28A 5FTJA 1FFXA 3W05A 2CFIA 5JMPA 4NS1A 4RIHA 4X1KB 3D6JA 4CG3A 1OIWA 2DCUA 1KEWA 1UBMS 1XHEA 2B2CA 4NCHA 3ZEAA 4F6CA 3PQDA 2FGJA 3M6XA 4AN1A 4AY5A 1YTUA 4EJSC 1F2VA 5TGDA 3UYLA 2Q9BA 3ND5A 3PT5A 1M1YA 4R0VA 1XWIA 2FW7A 3NGMA 4IGKA 2KX7A 4BP9A 1YACA 4U4AA 2W2MA 1BO6A 1GFSA 1S7CA 2NO0A 3A9TA 3IOYA 4D8WA 1UBJS 2FQYA 2DXIA 2XTJA 3EGVA 3BPSA 5JBIA 4J29A 1O0SA 2C8JA 2CMKA 2NU9A 2ZYVX 4G81A 1PFUA 1PNVA 5JD3A 4RBNA 4Y2HA 1ECGA 1KVRA 2FUCA 1N36B 1G8PA 2B98A 2GF9A 3HH8A 3JQ7B 1VPWA 4A8HA 4B3CA 3ZXXA 2Y1GA 4TKMA 1WZUA 3AZPA 2HSEA 2Q3HA 4GEKA 4MXDA 3A0RB 1KSHA 3IPRA 5SY4A 2HZ7A 5G53C 3TSOA 4EG0A 5IC4A 2HX1A 3EIOA 3LO5A 3D1JA 1E3WA 1JPVA 4B84A 5DBEX 1A76A 3DMDA 2WTXA 3UB2A 2QG6A 4OM7A 2H2HA 5LP1A 3KZMA 1W6UA 1HYHA 4IVPA 1L5HA 3OO0A 3VPDA 3VMFA 4EKEA 4Y3UA 1ZX1A 1RCFA 3UV7A 1O3YA 5K6RA 4TM7A 3OP1A 2CZCA 5AJTA 5BMOA 2P91A 1YI8A 1U6KA 4IX1A 1E5LA 2VNSA 4LQCA 3VVMA 2WD8A 1E79D 1E20A 1XLVA 2AI2A 1AGPA 3DZHA 3PNYA 2Q1WA 5HTOA 1MDBA 2GPAA 3NVKI 5BV8A 2PUTA 1XRMA 3VH3A 4DEVA 4DPMA 4P4SB 2WT4A 4HDSA 2VIIA 2IPLA 5CYGA 4WHMA 4UTXA 2TMGA 3WISA 4P31A 5K0LA 1N1EA 4V0QA 4F8YA 5LIRA 2C07A 2Q0XA 3NM4A 3BJIC 5FFMA 3BMOB 2AGVA 1M2JA 3WNQA 1D1PA 3CUSA 3ZHXA 3A4VA 1VI2A 4IJ5A 4WBSA 1Q95A 3NUZA 1V7ZA 2ZJ5A 4X8MA 1X1AA 4KR7A 1IZZA 4KXNA 1TAUA 3FLAA 2DFVA 3HRKA 4JYZA 1WUKS 1YHNA 2PLNA 1ZM9A 2YXPX 3NH6A 4A92A 3FTEA 5KX5A 4TMYA 1SM4A 2H1RA 1E77A 4EFKA 1ZCJA 3JSAA 1G8YA 1H8ED 3BFVA 3ORQA 3U4CA 2NTYC 2IZOA 2OPBA 4MUHA 4AL4A 3H87A 3ISJA 4GOLD 1YCFA 3OQPA 3AOGA 2CBXA 2XECA 2I7TA 4ZTUB 1RBMA 4CGYA 3FTCA 1BVYF 4XJXA 1KA9H 1NZFA 2KBEA 2PSJA 4MYSA 2GEKA 5KZMB 2WE8A 1TUBA 1FMCA 4NZ9A 2PBRA 4Q3EA 4ZPXA 3VR5D 4F1WA 5CJPA 1UZMA 5BSMA 3UJ6A 4FDLA 2ZK7A 5SZKB 1T6XA 3ODGA 2O3UA 4QQFA 1JQAA 1WRBA 4JU8A 4XRRA 2W2NA 4F97A 4UARA 2QAGA 2WICA 1UJBA 2YN0A 4E1BA 2OHFA 1DS6A 1GO2A 2DWUA 4MJ7A 2FPSA 2IDJA 2WNHA 4DA9A 2C2WA 4B8WA 1AJEA 2HHCA 5D6NA 1A8HA 1CJSA 1UWVA 1Z0SA 3AKYA 3LBNA 1FVHA 3JU3A 1QWOA 3AM4A 3IBGA 4M1KA 5JZMA 3MMXA 2ZXFA 4DBZA 2XB8A 4QQRA 2QROA 2PA0A 3IMKA 4MUMA 3ZDDA 1P80A 2NGRA 2PZFA 3KBBA 3CX4A 4FGKA 1WY7A 4PHFA 4M87A 5AJYA 1ZIDA 1KNQA 1PX2A 1A9YA 7GPBA 2FP4B 2UZ1B 3KCQA 2B5OA 5IUJC 5KJFA 3IIJA 1GFIA 1TEVA 3B2EA 2NXNA 2Y0CA 4PYKA 4RD1A 1QHSA 3SSNA 3GCZA 4HVTA 1TLLA 5CMLA 1NDHA 2DBRA 3S4YA 1EFKA 4EL0A 1JBKA 4J49A 4YQEA 1H5UA 2OLJA 3EFOB 3IEXA 3PC3A 4CLRB 4KVZA 4KWIA 4DF3A 5HZGA 3ELYA 4U6QA 5AM3A 1YOVA 3IOMA 4YB8A 5DI3A 5L4NA 1DKLA 1SD1A 3N6VA 3DMGA 3OMLA 4CDGA 2VYNA 5JAUA 1Y8QB 2OG2A 5BN3B 1Y1LA 4GL4A 4HC4A 3TTYA 1O95A 4UHBA 3GIWA 2NX2A 2CVHA 1QAMA 5TS3A 3V7NA 2BOVA 1ONSA 2L0XA 3C43A 3I9V6 4PX2A 3D4IA 3PNLA 2F1IA 3D4NA 3G5TA 3NWJA 1H0HA 3ONWA 1UXJA 3VAAA 1RACA 3BRCA 4ARVA 5BN5A 1ZCBA 3KVYA 1EJ0A 3PXDA 1VE1A 1T24A 1WKBA 3M2TA 3A1FA 2IBMA 2BCJQ 3F71A 1U1CA 3FRJA 4TS4A 4C0BA 3W5UA 4ZZIA 4BFYA 1MKYA 4IBOA 1A9OA 1MNAA 2JH9A 2VSXA 2AMLA 2C9BA 2VP2A 3IB6A 3LM8A 1RVV1 2J6BA 3FYDA 4MUKA 1R5BA 2HLDD 3L77A 4Q3AA 4DGSA 2J5BA 1P6XA 3AJAA 1H4VB 4MMYB 3HA2A 2VP5A 5ELXA 1YR8A 4KKVA 4Q4HB 4N3AA 4CF3A 3C8DA 5EMJA 4GKKB 5H68A 5B3KA 3ZTTA 5ULLA 2CUZA 3WB9A 2O8FA 1E60A 4XGNA 3IJRA 1ZD8A 1JEQA 4GE0A 5FUMA 1CF9A 3QKWA 5KSYA 5CLGA 2WC1A 3I76A 4L0MA 1R6DA 1V3TA 4JHXA 4Y2YA 4CF4A 8ABPA 5M29A 4D82A 1QH0A 3OE7A 3D0KA 1IL0A 2I4TA 3B20A 5IAEA 1ISPA 3EWIA 3BIFA 2O8DA 1TCUA 4YK7A 4BC1A 2GPNA 5CDFE 3TGWA 4JEUA 4OAOA 3VPCA 2WDPA 2WVGA 4QT4A 2I5PO 4F4CA 2PXCA 2IXEA 1ENZA 1T5IA 1VPDA 2YWXA 1WF6A 4M54A 4RGVA 1QLJA 1RR6A 2YW2A 4RJTA 1RYZA 1B8NA 3QPCA 5HE8A 3HL4A 4YMUA 2JGFA 4W82A 2GZAA 3LD9A 3NYWA 3RYCA 4MKFA 3WMWA 4JV5B 4UTRA 2XKJE 2IHVA 4Q66C 3FCCA 4FU0A 1DRJA 4FE4A 5AM5A 5GJVC 3RFTA 3K9FC 4KN5A 4F4DA 3EEOA 3FOWA 3S1LA 2QBYA 3AETA 2C9CA 3ETLA 4F11A 2JF0A 2BEVB 2V7QA 1ZLYA 5K8VA 3I9MA 4OXQA 1EGQA 1K4KA 5I9MA 3S2IA 2DHCA 3O9MA 4TKUB 5LOVB 2XXAB 1UMDA 4AP9A 2IZ6A 4G0OA 1WDWB 3UOGA 1IHDA 1TL7C 4U3JB 3TL6A 5FTNA 4JI0B 4CFSA 4BO7A 1P62B 3Q6MA 1QFSA 4RGQA 3EXIA 4NYIR 1JR2A 4E3WA 5HQ3A 2JGMA 4N8DA 3QHAA 3RYFB 2VDWA 5CHEA 2Z5GA 2DPMA 5GOTA 3H9CA 5ER6A 3F5DA 2X8JB 4GR9A 2ZZKA 4I1YA 4Z6KA 1D2AA 1OH8A 3W7AA 3DHWC 5ILQA 5BUQA 2FW0A 3OWHA 1DQZA 4TVOA 4E51A 3DCYA 2ZGVA 2FEMA 1GNQA 4FC7A 2HPVA 5AICA 5EMMA 1N77A 4BVLA 5IKOA 3WGQA 2GESA 4DIMA 2Y6UA 3DE5X 4CU2A 1SQSA 3IDSA 2A14A 4KR2A 4PYJA 2VI5A 4URZR 1OIVA 1Z3IX 4F56A 1YIOA 2JAXA 3TOXA 1FCJA 1HA3A 2FFRA 3VYRB 4CFZA 1DPFA 1ECPA 2QVLA 2FWJA 3EX7C 2PY6A 3SNHA 2HU7A 2E87A 5B3JA 2IHZA 1T35A 3O8DA 4L85A 4UUOA 1L7AA 4H77A 4D9NA 2CVFA 3ZZTA 5JPDA 3DE4X 3H19A 5FR1A 3DONA 3QNMA 3SDSA 3A9UA 3ZQJA 5KWEA 1YK0A 2HUNA 2JB9A 3DLCA 2ZRNA