5K0ZA

Cryo-em structure of lactate dehydrogenase (ldh) in inhibitor-bound state
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
331
structure length
317
Chain Sequence
ATLKEKLITPVTVPSNKITVVGVGQVGMACAISILGKGLCDELALVDVLEDKLKGEMMDLQHGSLFLQTHKIVADKDYAVTANSKIVVVTAGVLVQRNVNVFKFIIPQIVKYSPNCTILVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDTARFRYLMAERLGIHPTSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPAMGTDKDSENWKEVHKQVVESAYEVIRLKGYTNWAIGLSVAELCETMLKNLYRVHSVSTLVKGTYGIENDVFLSLPCVLSASGLTSVINQKLKDDEVAQLKKSADTLWSIQKDLKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase B chain
publication title Breaking Cryo-EM Resolution Barriers to Facilitate Drug Discovery.
pubmed doi rcsb
source organism Gallus gallus
total genus 88
structure length 317
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5k0zA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 5k0zA02
3TF5A 1HETA 4BO5A 4M87A 1P1FA 4L0QA 3Q2KA 2CDCA 1YJQA 2GN9A 3FNEA 4BQRA 1Y5MA 2AE2A 4XEHA 2Q45A 1UXHA 4K28A 1HXHA 3JD4A 4DL9A 3V2HA 3JQGB 3C85A 4DIFA 1Z82A 1PS9A 3LLVA 1C0PA 3OA0A 2VOEA 1E1KA 3DBLB 4BMNA 3LF2A 4EEZA 3NEPX 3S2FA 2O3JA 3IDSA 4GQAA 2J5KA 3DHYA 1X7GA 2OGUA 5IXSA 4NFYA 1A72A 4J2HA 4R68A 1FDUA 4UEOA 3PDJA 1E1LA 1PX0A 4YQZA 1JTVA 3AWDA 3PHJA 4ZQHA 4L8VA 1U4SA 4ESOA 1YQXA 2X58A 3JQ8A 3EZYA 2X4GA 3WJAA 3NJ4A 4TKMA 4XYBA 3MWDB 5JBIA 2QHXA 4WLOA 2FZEA 1Q0HA 1H0KA 2Q1UA 3OICA 3E9MA 1F8GA 2UDPA 1YS4A 1OC2A 1B3BA 4J9VA 1NP3A 3PIDA 4BNTA 5JYDA 2VHXA 3HB4X 4XQGA 3MJCA 2ZQZA 4R51A 4EZBA 5KTKA 4XKJA 2CF5A 2DM6A 2UVDA 1NHWA 4GX1A 3GUCA 2X0RA 1AGNA 4K1LA 4CR6A 1AHIA 2HMWA 1N9GA 4BO1A 2Y93A 4NZ9A 3ORFA 1KVQA 1AN9A 1KC3A 3VH2A 2PKRA 4OJNA 2AA3A 3RU9A 3K73O 4MVJA 2J3KA 2Y1GA 4LCEA 4XDYA 4CQLA 3WOHA 4RF5A 5CHEA 5U9CA 2DVMA 2HO5A 1IHYA 1ZFNA 2Z1NA 4JCOA 4HNGA 5IDWA 1UDAA 1YRLA 4NPCA 1Q2XA 3C7AA 2FSVA 1HL3A 2YHIA 2B0JA 4R4JA 4TZKA 1UXKA 4CV1A 5A9SB 5GZ1A 2X5KO 2X23A 4IDCA 5ENDA 4GBJA 2WDZA 3HG7A 3G1UA 3JQCA 3E9QA 4UVEA 2CF6A 1GV0A 1DRWA 2X9NA 3F1KA 3QP9A 5I9MA 5KJEA 3ZWBA 2JCYA 3T7CA 3BXXA 2V6BA 3PIIA 4FGSA 3LT2A 3QVXA 3WGHA 1K89A 3DAFA 2VRCD 4I1IA 1E5LA 3K8ZA 3SEFA 1B15A 1QV7A 3QIVA 5ITWA 3T4EA 2BFAA 3VDQA 4EITA 3G1TA 2O7QA 3G0OA 4GMFA 4YBZA 2HLPA 1E3WB 4BVAA 4AJ4A 2P2SA 1QYVA 3NT5A 3TNLA 1R0LA 4W4TA 2R00A 4XDZA 4PLHA 1SAYA 4GX5A 1PZGA 1N1GA 1FDSA 1O0SA 4G2NA 4GPD1 2QX7A 3P2OA 3GVHA 4XYLA 1SC6A 1JA9A 4PVDA 3WMWA 4ID9A 5DOZA 1R15A 2GD1O 3TDKA 3Q9NA 4WEOA 4J3FA 1NPTO 3GA0A 3O8QA 1B3RA 5TNXA 3WG9A 3Q1LA 4B4WA 5L4SA 1GEEA 1WWKA 2BGMA 4NFHA 1E0DA 4BO8A 1QP8A 2JD0A 3HDQA 3BMOB 3TZKA 1HWYA 5CDSA 3WJ7A 1YBAA 2W2KA 5JDCC 2HMTA 4CLRA 3DR3A 2X86A 4YWJA 1GYQA 3D3EA 2CUKA 4BNKA 3QWAA 3PTZA 4YA6A 4HNHA 5CAEA 3LT1A 3DFUA 4RQUA 4R9RA 1KY5A 5KVCA 1OI7A 1LC0A 1J0XO 1DLIA 2PR2A 1I32A 1C0IA 4TRJA 3EW7A 4DYDA 5GY7A 3GFGA 4DGSA 1H9BA 1DO8A 3RKUA 1I3NA 1NQTA 1YL5A 3INRA 2I99A 3RU7A 2NNLD 3G17A 4GWKA 2OBNA 3LQFA 4KUEA 3NAQA 4XGIA 3RC7A 1U7HA 2OP0A 1DRVA 4P4NA 3KB6A 4HADA 4CM7A 2A35A 2ZTVA 3OEWA 4B3IA 1ISIA 1T4BA 3VHRA 5JO9A 2IZZA 3FNGA 2E82A 3RUCA 3HDYA 3OHSX 5ES3A 1WPQA 2EWMA 4JP3A 3DBRB 5A9RA 2PH3A 4QO7A 2AE1A 3OECA 2NSDA 5T57A 2Q4BA 4PVCA 2DTDA 6LDHA 1V3UA 5JC1A 1H9AA 1PZFA 4EYEA 3CKYA 1LLUA 3VPHA 4BQPA 4JGBA 3EMKA 5AXCA 5ICSA 1LXCA 3UICA 5A06A 4CV3A 4WUVA 3GY0A 4BO6A 3MCVA 3GR6A 4FJ1A 3TOXA 3PLRA 2ZB8A 5T64A 4A26A 3OIFA 4NMHA 5KKAA 3U0BA 4PRKA 3WX0A 9LDTA 1VJ0A 5L9AA 1L7EA 1NNUA 3DZFA 3TWOA 4E5PA 5B1YA 2NVUB 3D4PA 1KOLA 5HRUA 5EN4A 3RUEA 3PI7A 1YONA 3I9JA 5JLAA 2C0CA 2O3QA 4AJJA 4FFLA 4YYZA 5A04A 2NQ8A 4ZQFA 3BTUA 2V6GA 1HYHA 3U4CA 4BO3A 2UUOA 2VWHA 3WMXA 1OAAA 4YAEA 4Y67A 4AG3A 3IC5A 4CM5A 3NJ8A 3FF4A 3PJEA 3RROA 3JSAA 4EDFA 1DBVO 3HN2A 4ZQGA 3BHIA 3H9JA 3GC6A 4WPGA 3JYOA 2DUUA 4NDNE 4CLOB 2G5CA 2RH4A 3ZWXA 1E7WA 2BF7A 4L74A 2E37A 1P0FA 1KC1A 4M89A 2XAAA 1WMAA 2DTXA 2JFGA 3K9QO 2NU8A 4RV9A 3VPFA 1ONNA 3GK3A 2ZKLA 1ZKMA 3HUDA 1R16A 1XQ1A 1B16A 4XR4A 3SXPA 4OAQA 1V8BA 5BT9A 4ALKA 1D7OA 3HFSA 2V65A 1X0VA 1ZEJA 3WWYA 4NI5A 1WVGA 3I9NA 3PHLA 2CDBA 4CQMD 1LC3A 1SZJG 3HWRA 2AMFA 1LSJA 4ZQEA 1CRWG 3H2SA 1JKJA 4W7IA 3SLGA 4ALIA 1HDXA 4D44A 3IJPA 3F47A 2C5EA 3ZV5A 4FFRA 3D4OA 4FW8A 3SLKA 2FMUA 3PVZA 4LRSB 3MWEB 1M67A 2Y0CA 3EVNA 3K30A 1SPXA 2VZ9A 1PQWA 4E12A 3TZHA 3VH3A 4YJGA 1EK5A 5EINA 5BSFA 5JCXA 4GKBA 2B4QA 1HDCA 4JXKA 2OOSA 3D64A 5JDCA 1H93A 2XOXA 1R66A 5A5EA 5KJCA 1I3LA 2CNBA 1OZAA 4L4XA 1XLTA 3EUWA 4EUFA 1J49A 4FC6A 1I36A 4RVGA 2C29D 5GZ6A 4NH4A 4CL8A 1S6YA 3R3JA 4RPKA 1T1SA 2VNSA 2XXBA 1XIVA 3KYCA 4NFSA 4UEKA 4TROA 1O6ZA 3EK2A 4DC0A 2Z95A 1VL8A 3KO8A 3RBXA 3WB9A 5KKCA 1E6EA 4OQZA 2WTBA 1B26A 1U9JA 4PLPA 4CM9D 4HBGA 1UXIA 4BB5A 4E13A 3PHGA 1LRJA 1ADBA 1VKNA 4B8ZA 3S2EA 5AXAA 8LDHA 4WLNA 3Q3CA 1RKXA 4KDFA 3GEDA 5IDYA 2PNFA 3O38A 2XF8A 2D4AA 3C8MA 3I5MA 4AJKA 3ZW8A 2J5RA 4RO0A 1EQUA 1KERA 1V3VA 5C3MA 2BGKA 1XCBA 3NT2A 2Y68A 3PK0A 2WD7B 3KZVA 4U5QA 4J1TA 2P4QA 4BO7A 2C2XA 2G82A 5HA5A 4INAA 3BMCA 1ZXBA 1H6DA 4IGEA 2JD2A 4DMMA 1GYPA 1L1FA 4RORA 3ZNPA 4IIVA 5A1TA 1OBFO 4UVDA 1UAGA 4ZA2A 2Y99A 3GGGA 2Y1EA 3OIDA 3U3XA 2O4CA 4FR5A 4BOYA 1LQTA 2GCGA 1LRKA 4BMVA 2IDZA 2IZ0A 3QVOA 3ADPA 5I9LA 1HSOA 3MOIA 4BGEA 4BO2A 1MUUA 3ZWPA 1X1EA 5CP8A 5T67A 1HSZA 1XQ6A 1YQGA 4I8XA 2GYYA 3LSYA 3HDHA 4Y98A 2FOIA 3GQVA 3W1VA 3WICA 2W4QA 1HDYA 2ZTUA 2H5LA 5DCUA 1G6KA 2TMGA 3IS3A 4YTEA 5G4KB 1X7HA 4YJHB 4B7CA 3WGZA 3LC2O 1AUPA 5FEUA 1Q0QA 5JAZA 4JJGA 3IL2A 4CQMB 1RJWA 2VZ8A 2EXXA 2NACA 4FS3A 4Q3AA 5T5QA 5AVOA 4BO0A 3PGJA 3WGOA 1T25A 3WQSB 4IJWA 4FB5A 5KVSA 1EE9A 1YDEA 5A4DA 5BSGA 1BVUA 3E48A 2EW8A 1XWFA 4XX0A 2B35A 3WGGA 3INTA 1Z6ZA 2C7VA 2HCTA 1U5AA 3AU8A 2HMUA 3ENKA 4ZICA 1VSVA 2DUWA 2WMDA 4WLUA 4YT2A 4CM8A 4JBHA 3K2BA 5IFLA 4PGFA 2HRBA 1BW9B 3OBBA 1I30A 1N7GA 4G5HA 3TL2A 1YL7A 4IDDA 1HKUA 2W90A 3GH3A 4WGGA 2HQ1A 4DLBA 5CEJA 3D3WA 4L9RA 1ZVMA 4BKOA 1Y7TA 3QWIA 4CR8A 1Y6JA 2RAFA 4II2A 1HYEA 1JVBA 4LCJA 4BGUA 4J9UE 5FI5A 5IDXA 3QA9A 4HV4A 4MVJP 2YDYA 3UCEA 3U9LA 3BMNB 1S7CA 5H81A 1PGOA 5TT1A 1YE3A 4EEXA 1P0CA 3CZMA 3KSZO 4Q39A 2VUSA 2Q3EA 4WLVA 4XCVA 4ALJA 3P2YA 4CLXA 3JYLA 1N1EA 3ETDA 4Y8VA 2ZCUA 3KBOA 1BGVA 5AYVA 3BMQA 4RVHA 3QV1A 3VH4A 3OQ6A 5K0ZA 1DIGA 1O89A 2Y66A 2X8LA 4B3JA 4GSLA 1GQQA 3INGA 1X0XA 5EIOA 5I7VA 3OMLA 3C7DB 4ALLA 3CINA 4WCDA 4R5MA 1DIAA 1C0KA 3ZNOA 5JCJD 5ILGA 4S3MA 3DZIA 4YJFA 4XA8A 4A10A 3TFQA 5JS6A 1KETA 5K6AC 2OUIA 4ND5A 8ADHA 5TSDA 4TWRA 4DPMA 3H9QA 2GN8A 3DEYX 5L4LA 3RUIA 3G49A 1QYXA 4GMGA 4E5YA 4R54A 3AM3A 1DIHA 1BHSA 3OH8A 4J4TA 4Z9XA 1BRMA 2Y1FA 1ENOA 4A7PA 1R12A 1GL3A 4TQGA 4BNGA 4DA9A 2QW8A 1BMDA 2JAPA 2AG8A 2O3TA 4TRMA 1D4FA 3IOYA 1I5RA 1M75A 5ILOA 2JCXA 3I9LA 3WQRA 4KQWA 2ZJ1A 4CQLB 5BQFA 1MC4A 2NM0A 4MIOA 1W0CA 1V3TA 3GNTA 4HKTA 1VL0A 3Q11A 1IZ9A 1EZ4A 2ZYDA 1PU2A 2DBQA 3UXYA 1PZEA 3GNSA 1IL0A 4GH5A 4LISA 3JV7A 4D46A 5JC8A 2VCYA 2W2LD 1GFSA 1NHGA 4L4RA 4P8RA 3W4KA 3AM4A 1BTOA 4RPHA 3L0DA 1WDKA 3ICCA 1YBMA 1KY4A 4NBWA 4C7JA 2WSBA 3BHMA 2I5PO 4TRRA 1VRWA 3KLMX 2QG4A 3N74A 4GWGA 4E5KA 3B70A 2IEBA 3H9EO 2EGGA 2TMDA 2CDAA 4MP3A 3K92A 3L9WA 3RUAA 1RM5A 1ENZA 2YZ7A 2FPGA 5TT0A 2WJPA 4TVBA 4F6CA 3BTOA 1HDGO 3KXDA 3KTDA 1FF9A 3RC9A 4WLEA 3UAGA 3D4NA 1E92A 4J0EA 3VKVA 2PZLA 1IZ0A 1ID1A 2C7GA 3AI2A 1JKIA 1DFGA 4B3HA 3DXFA 1DDOA 3PFWO 3FNHA 4J91A 3TOZA 3RJ9A 3VZQA 4AICA 2B4RO 3QWHA 4HFRA 3TZCA 1K0UA 4E0BA 3MOGA 3DFZA 2X0NA 1EUCA 3EAGA 3F3SA 4RCVA 5BNIA 1LEHA 4PLCA 3JQ7A 2WYWA 4TSKA 4DLAA 4PG8A 3E9NA 1P31A 1WLYA 2P91A 4OIMA 2VYND 5G0SA 3JQ6A 1GADO 1G1AA 4O59O 3WQQA 4CLRB 4OOFA 4PG7A 1GDHA 1R6DA 3IJRA 3GEGA 5DOVA 1EMDA 3DZKA 2QYTA 3NGXA 5DP2A 3HSKA 2VWPA 4I5EA 2QIOA 1A7KA 3H8VA 4YT8A 3WGQA 4IDFA 1PSDA 4A73A 1F0YA 1V9LA 4BO9A 3C1AA 2ZTLA 3VTFA 5A3VA 4J2OA 4B4VA 1N8KA 1MFZA 1YBVA 3FR7A 2AG5A 2I65A 2HK8A 4DVJA 4OSOA 1VC2A 1DIBA 4W6ZA 3IKTA 2EJWA 2J3JA 1I10A 2VWQA 4BV8A 1NAHA 1ISHA 4RF2A 3UKOA 4JK3A 1E3EA 1ZNQO 3L4SO 4DRYA 1HDRA 4PLGA 2QRLA 4GSKA 4TKLA 3ZU3A 2PD4A 2OORA 4E30A 3CTMA 1Z7EA 3IP3A 3PHHA 4J7XA 4QT0A 4CMIA 3WLFA 4BNUA 1I0ZA 1LLQA 4TZTA 3KRTA 2JD1A 3CE6A 3RWBA 3S55A 1MG5A 5HWSA 3KUXA 4Y6SA 4DIOA 1H2HA 3FHLA 1XHLA 3CEAA 3PZBA 1QRRA 4IQGA 1JKFA 4XIJA 5EPOA 5K6AA 5KIAA 2BLLA 2FR8A 2IE0A 4OQYA 4L4SA 4Y6RA 5B4VA 2JFHA 5L7WA 2PK3A 2FSSA 1UP7A 1E7MA 1LX6A 4CLEA 1VJ1A 4BKPA 2BD0A 4CM4A 3IUSA 2GN6A 1XU7A 2NU9A 1OMOA 1UH5A 2VHWA 5DZSA 2CVZA 4NHEA 5DDIP 1PTJA 4QSMA 4I5FA 3DOJA 1VKOA 3WR5A 3ETEA 3RBZA 3S2IA 5KJFA 3O9ZA 3DL2A 1Q7BA 3W8FA 4MVJE 4WCFC 1GU7A 3W6UA 1T26A 5MGBA 2E6UX 4CMCA 3ZHBA 3STHA 3CMCO 3D1LA 1QMGA 1I2ZA 5L7YA 2QZZA 4QEDA 4RPGA 4CMBA 1EDOA 1QYDA 1RWBA 5I8WA 3NYWA 3TJRA 2RHCA 2YDXA 4CPDA 4GGPA 1EUZA 1NFRA 4JP2A 4AJEA 3QE3A 4P22A 4FFOA 4AJ1A 4URFA 3KYDA 4MIYA 2B36A 5FWNA 1DPGA 1LSSA 2NVBA 3RKRA 1Y5RA 2ZCVA 3NTOA 2ET6A 3I9OA 3FTPA 4UVHA 3L6OO 3ROPA 5HS4A 4EUEA 4QTZA 2FPIA 3GDOA 3BIOA 1SNYA 1PL8A 1ORRA 4PN3A 3GNQA 1ARZA 1ISFA 3D5QA 3SC6A 1GPJA 1WP4A 4RVFA 3LC1O 1BVRA 1T2FA 4LMRA 4NBRA 4DPLA 4Z3DA 1ZEMA 1C1XA 4I9HA 3PFFA 3ASVA 4YQYA 1H6CA 5ENVA 4BNNA 2HSDA 4Z0HO 4M86A 1IUKA 5H82A 3H6KA 3U4HA 4CMGA 4RL6A 4R3WA 4E5NA 3UVEA 3NV9A 1YOVB 3H3FA 2I67A 4TVOA 3IIEA 2C2YA 1U8XX 3JD1A 4YJGB 2ZB7A 5JO0A 1TA4A 1MA0A 1D3AA 2B4TO 3WNVA 3AOGA 3HFGA 4RDHA 2GGSA 1Q7GA 1KBZA 3MJSA 2IZ1A 1VE9A 1W73A 2Y1CA 4F45A 5ER9A 4EJMA 3RQSA 2VT3A 4F46A 3AY6A 2ZQYA 2Y1OA 4U7WA 4YRAA 4KUGA 1HZZA 1V6AA 3DDNA 4FFNA 3WBBA 3ZHXA 1CF2O 4CMHA 1WZEA 1GUZA 4RLSA 5TQVA 3PYXA 1VLLA 3PLNA 3JQDA 3ONDA 4D42A 1NR1A 4FD3A 1EFKA 1NPYA 3PP8A 1NVGA 1LSUA 4I5GA 4BNWA 2XXJA 2X0IA 1IPEA 2X1HA 4CUJA 1UAYA 1M66A 5CDTA 3FD8A 1EE2A 2NU6A 1E6UA 3HQ4O 5IZCC 5F1OA 5EQDA 3CPSA 1U3VA 4CJXA 3JQGA 3V5NA 1NM5A 5G0VA 3O26A 1ADCA 1N2SA 1QSGA 3DBLA 1PR9A 3JYNA 3CXRA 4ZRNA 2EKPA 3U62A 2EJVA 2HK9A 5TIIA 5EL0A 2IRWA 2O7SA 4DBZA 3RUFA 1YQDA 3BMCB 2JAHA 3JQFC 2JL1A 2YQ4A 3AM5A 3LZ6A 3UF0A 1DB3A 1RYDA 2DU8A 5C7OO 4WNIA 3FSRA 2DKNA 4UUMA 5BR7A 2RCYA 1YKFA 2X9VA 3NGLA 4KQXA 2CY0A 4HP8A 4JNKA 4WE3A 3TQHA 2GZ3A 1GAEO 1DC3A 3AUTA 4FOSA 3D5TA 2C07A 1GZ4A 4WCFA 3WXBA 1DXYA 2YYYA 1EBUA 1NPDA 1GV1A 4LK3A 5DT9A 3ZU4A 4ZD6A 4ZGWA 4B7XA 2FHSA 3DBHB 1WNTA 3WWZA 2NQTA 3ZU2A 1QR6A 4FJ2A 1DAOA 2JCVA 2DFVA 1M6WA 3Q9UA 5IJZA 1LU9A 4E6PA 2G17A 1BXGB 2GLXA 1TEHA 3EZLA 3K5PA 1N7HA 1SMKA 2O48X 2FN7A 1Q1NA 4BNXA 4DLLA 1E3IA 1LRLA 3I83A 2BHLA 3OJ0A 2YFHA 4UVGA 3WBFA 2QRKA 2Q2QA 2VN8A 3KM0A 3WS7A 4ZJUA 4W82A 2JHGA 3UOGA 3WSWA 4J1QA 1XELA 5A9SA 3DO5A 1B14A 4DUPA 1TVEA 4JN6B 3AUUA 3GZ4A 3W6ZA 1A27A 5DULA 4P4GA 2PKQP 1X13A 4IJVA 1RM3A 1Y8QB 4OO3A 4BHTA 1K2WA 1H5QA 1D1SA 3PJGA 2VYVA 1A7AA 3WTBA 2PGLA 1KVSA 4D3SA 4HFNA 4XQ9A 3ADOA 1NX6A 1F14A 4DC1A 3ANLA 1YJ8A 4K26A 5CFZA 3GG9A 1HDOA 4AJPA 4NJMA 2BKAA 1AXGA 4R9SA 3OQ1A 3V2UA 2AW5A 1GY8A 4N5MA 4OL9A 2AXQA 2WD8A 4RF3A 3ZZNA 2GO1A 2OP1A 5MDHA 3OIGA 5CDUA 4YACA 4YRDA 5DF1A 1HE4A 3GN2A 3ICPA 2VTEA 3GFBA 4UUPA 4YT5A 1DFIA 2HMVA 3QLJA 3OJLA 2GSDA 1AXEA 1PJLA 1ULUA 4ALNA 1U3TA 3AI1A 4BIIA 2Q99A 4KOAA 2BGLA 3AOEC 2C59A 1YB4A 3BZUA 4P4LA 4H7PA 4RLHA 3PYLA 4QFCA 2HAEA 2VTDA 5L95A 1H94A 3O03A 2VHZA 2D2IA 3E5MA 3KLPX 5T8KC 3WNQA 4QECA 5HTOA 3QQPA 3L6EA 4YXFA 2PGJA 3COSA 3GMDA 4NG5A 3JQEA 5JE8A 1HF3A 1LTHR 3BMQB 3LU1A 4UAGA 3FBGA 1JAXA 3BMOA 2EHDA 2G76A 1DAPA 1JWBB 4Q3NA 4AJLA 1Y81A 3B20A 3QWFA 2WYVA 4J16A 3T7EA 2EKQA 2PWZA 3TRIA 3EY4A 4D0SA 1PR3A 2DLDA 3I6QA 1G0OA 3RUHA 5B4TA 2W98A 4DREA 1FJHA 4GKVA 4BV9A 3I6IA 4HUJA 3AFNA 1CYDA 4YJFB 1FDVA 5DBFA 3WIDA 5L53A 4J0FA 4WOKA 4HFMA 1H6BA 4ND4A 3EYWA 4JBGA 5G2OA 5IZCA 1I2BA 2B69A 4DBVO 3MZ0A 1ZW1A 1FK8A 3PZRA 3VDRA 4XYMA 2B5WA 3RFXA 3LK7A 4BNMA 3GVXA 2WEKA 2G0TA 1Y8RA 4RQTA 1CDOA 1GR0A 2BI7A 4PLWA 5IN4A 2PD3A 4IM7A 2AQKA 3MJTA 2E4AA 3O4RA 1I3MA 3NDJA 5IXYA 3DZBA 5DBGA 3ZNNA 4A0SA 1LLCA 1ZMTA 3GUYA 5LDHA 1QKIA 3ZDFA 3DBRA 1UZMA 2AEFA 5FI3A 4IJUA 5B37A 4NIMA 1SO8A 4NU6A 4IZIA 4DXHA 5CDYA 4OKIA 4BKQA 4WOJA 1MV8A 4IPTA 3H9UA 2UAGA 4KDEA 1PJ4A 3I52A 4I5DA 3F4LA 4B8WA 2J3HA 1R37A 3GG2A 2FRDA 4EJ6A 1VSUA 3S8MA 1TT5A 4H15A 1A9ZA 3PYMA 3ZCXA 3QY9A 1PEDA 4J7UA 3LDHA 5F3RA 2ILTA 1T24A 4M49A 1DC4A 2DC1A 3RUDA 5I9NA 3GT0A 1ZIDA 1E3LA 4CLHA 4MVJD 4EGFA 1TXGA 5CPBA 4PLVA 3AFMA 1PL6A 1JN0A 2GUGA 5F1PA 2EEZA 3ASUA 3DOCA 1IY8A 3KEOA 2AEJA 3ZV4A 4NBTA 4PZCA 1PWZA 4MJLA 1O5IA 4RJTA 3HE3A 6ADHA 1C1DB 2IYPA 3WYBA 4Z6KA 4PIVA 1P1JA 2VRCA 4GVLA 1YL6A 2Z1MA 3JD0A 1E7QA 2PFGA 3SBOA 2VNAA 5JFOA 2FWMX 1NWCA 3NDRA 1DIRA 3CH6A 1NVTA 2A9FA 4IZHA 4YPOA 3GHYA 3AUSA 4NU5A 4GAEA 3M2TA 1MX3A 1HE3A 5B4UA 1LDYA 1PS0A 4FGWA 5I7SA 4CLOA 2H1SA 1HZJA 3VC7A 4CMEC 3OSUA 3X2FA 4B4OA 4B4UA 4JJIA 4MKXA 2P5YA 1YWGO 3FNFA 3GZNA 3R1IA 4GX0A 4IDBA 4OM8A 5JNLA 1K6JA 1P9LA 1VL6A 1B8UA 2HDHA 3BTSA 3KHUA 3MJVA 4I9UA 4ALMA 3H5NA 2HK7A 9LDBA 1YO6A 1P44A 4R1NA 1X15A 1B7GO 5L40A 3E82A 4MVJG 1YXMA 1UDBA 4J7CA 3ON5A 1I3KA 3ZV6A 5C5IA 3E6AA 2X22A 1E7YA 2IXBA 5H83A 2EIHA 1T2EA 4LMPA 1TLTA 1EVJA 3RFTA 4LRTB 1GUFA 4WECA 4EI2A 4K6CA 4KTVE 4A03A 4RZIA 3AOEA 5K9ZA 1P74A 4XGKA 2IYOA 5U1PA 3UW3A 1PS8A 1CQJA 1KEUA 1ZK0A 4CUZA 5BSHA 1VI2A 5T8KA 3RAJA 4DMLA 5CG1A 5KWEA 1KS9A 3BA1A 1C0LA 2DFDA 1K3TA 3PQDA 5EMHA 1I24A 1EK6A 1Z75A 3T4XA 3GEMA 2GR9A 3HZZA 2Y1DA 1Z7BA 1MLDA 1LQUA 3GF4A 1IHXA 4OKNA 4JQCA 5IF3A 5G0WA 3AK4A 3W4IA 3H9GA 4A5OA 1RYEA 1UP6A 4JJFA 3U49A 1T2AA 2J6IA 5KJ6A 2RHRA 3P5SA 1UZLA 2BFOA 2GPTA 3QHAA 4PLZA 4LGVA 4LVUA 3JQ8B 1HE2A 1KEPA 1W6UA 3W4JA 2IXAA 2RBEA 1ZUD1 3K96A 3S1LA 3WTCA 3P19A 3PQEA 2YV1A 5LC1A 1ZZEA 4J4HA 1DJNA 1PGNA 2HMSA 2X0JA 4MINA 3GRKA 4DQUA 1U28A 2I9PA 3ZNQA 1DOHA 4CMKA 5ITVA 1V35A 1BG6A 3I4CA 4ROSA 1MP0A 3DOOA 5JMPA 1MXHA 1J4AA 4B7UA 3I23A 1XU9A 2YQ5A 3IQDB 3NTRA 4WK6A 3ANMA 3V1UA 1LDMA 5EQFA 1F06A 1XKQA 3OFSA 1N9GB 2PKQO 2Q2VA 3GGOA 3GVPA 3CIFA 1AHHA 1X7DA 3JQAA 2SCUA 2Q2WA 2BFMA 4MO2A 5COAA 4NBUA 4QO8A 1QG6A 3NT4A 5JY6A 4R16A 4XIYA 4IDAA 5CPFA 3OQBA 3ZWVA 4BO4A 1QV6A 1ZBQA 4RF4A 2D1YA 5DP1A 3ROQA 1H6AA 1SCUA 1U7TA 3PJFA 4Z3KA 1E5QA 2WD7A 2NTVA 2YHIB 1E7RA 3NKLA 4B79A 3W8DA 3B1JA 3F46A 3Q6IA 1HDZA 3E03A 3AU9A 1T4DA 1PJ3A 3UCXA 4YAGA 5BNTA 2LDXA 1Y9EA 2ZYGA 1Y9AA 3V8BA 5DCWA 4QUKA 4R3NA 4R5HA 1P1HA 3KV3O 3QWBA 3U4DA 1MC5A 4W7HA 1XDWA 1P1IA 3C24A 1JWAB 2O2YA 3IAHA 2Q4EA 3GGPA 3DB2A 1I01A 3GOHA 3M1AA 3JYPA 4YJDA 2GNAA 5G4LA 5JAIA 3P7MA 5A5FA 1V0JA 1B8PA 2NLOA 4FFPA 5FFFA 3RASA 3WIEA 3ZN2A 4N7RA 4XGNA 4CM6A 1NAIA 3M2PA 4MKZA 3H2ZA 2BH9A 3MJEA 2GERA 1UJMA 4BNIA 4CR7A 2DT5A 4KWHA 2PD6A 4RDIA 4CQMA 3O8QB 5TJ9A 3L4BC 3TZ6A 5TC4A 4I08A 3DHEA 4H16A 1ULSA 2CSUA 1HE5A 1ONOA 4O0LA 4A27A 2IEDA 1NFQA 3PWZA 1XEAA 2W2KB 5DNAA 4OGWA 1EVYA 4YAJA 1K5HA 1NWHA 3WFIA 4CMAA 4E32A 2NV6A 1UZNA 4WEQA 4PZDA 3QSGA 4Y6PA 4D43A 1HRDA 1BDBA 2DQ4A 2Q50A 3RFVA 3SX2A 4MVJF 4DPKA 1R4NA 4MVJM 3ZWMA 3QVWA 2OBYA 1GZ3A 2ZB3A 1VM6A 4JIGA 4Z0PA 1ADGA 4YAIA 4Q3DA 4HXYA 3H5RA 3FTNA 2D3TA 1JVSA 2BFPA 1N92A 1U8FO 1P1RA 2O3UA 3LF1A 1DEHA 1PZHA 3KEQA 1E1NA 3AUAA 4OOEA 4AJNA 1KEVA 4YRBA 4OSPA 4M8SA 3K2EA 1LDGA 4DYVA 5JAMA 4OYRA 2NTNA 3BMNA 4F6LA 3JQ9C 4AJIA 1D1TA 3TFOA 3ITKA 3PWKA 4C7KA 3EC7A 5L51A 5KNLA 3H65A 2I3AA 3NDIA 4LSMA 3KSUA 4CM9A 3GRPA 1R0SA 1U3WA 2RH8A 4E2ZA 4J1SA 4BL5A 4J49A 4W9NC 2VWGA 3FR8A 1J5PA 3DZJA 1MG0A 1KVRA 3ETGA 4ILKA 3H7AA 5TLSA 3I4FA 1CIVA 1UP4A 4M1QA 1F8FA 4BB6A 1DRUA 1F17A 4BNVA 4FQ8A 5I7FA 5AXBA 2BRUA 4PLTA 1WXDA 4UUNA 2E49A 4C4OA 1RM4A 4YR9A 3H5AA 5U4QA 2PZJA 3UUWA 4LSWA 2FR1A 2P4HX 3DTTA 3DMTC 2ZYAA 1E3SA 4FBGA 4AJHA 4IINA 4WLFA 5JAQA 3A9WA 2O2SA 3DAPA 4WCFB 3SJ7A 2A94A 5T6BA 2R2GA 4E3ZA 2V7PA 1Y1PA 1ZJZA 2YY7A 3F6YA 4R1TA 3FBTA 3OF2A 4Z0TA 1R0KA 2DPHA 3SVTA 3ABIA 1DSSG 4YEDA 3ZU5A 1XYGA 3ZHYA 2X5OA 1CJCA 1NQOA 3DMYA 1U2DA 4MDHA 4GI2A 4D3DA 4RGBA 1JQBA 1QYWA 1R4MA 4A2CA 2OO5A 4S1VA 3S2GA 1ZK2A 3JTMA 4RPJA 4RVDA 4WASA 1P77A 4FSHA 5GMOA 2DBZA 5JMWA 4QFDA 5CDGA 1QORA 2G1UA 5KJ1A 4J1NA 2E48A 1MXFA 4K6FA 2R6JA 5KVQA 1O94A 3I3OA 4XZ3A 5DCYA 3NRCA 1ML3A 5FYDA 3OA2A 2X6TA 4PG4A 4AL4A 1ENPA 3GDFA 4ND1A 5G0UA 3EHEA 2Q1SA 4U0JA 3GAFA 2EG9A 5EESA 3GHHA 4Q9NA 3OETA 3A14A 2H6EA 4NJMB 2PLAA 2GF2A 1T1RA 3PWSA 2I3GA 1PJ2A 4PCVA 4MIEA 3QVTA 3ZHZA 3L4BA 3RSHA 4OXYA 3E18A 1BXZA 5EERA 5TRTA 4EUHA 3DBVO 3WGIA 2PV7A 4U6QA 2J8ZA 1PQUA 3AW9A 2ZK7A 5JW6A 4L76A 3B6ZA 1Q0LA 1LNQA 4LVCA 1PWXA 2PZMA 4JROA 3KYBA 4XJTA 1PJSA 2X7HA 4WJZA 5JYEA 1ZJYA 3F5SA 4MVJI 2QQ5A 4KZPA 3HB5X 4RPLA 5CEFA 1O8CA 2O50A 3EDMA 3FN4A 2LDBA 1JLLA 3G3EA 1L7DA 1NXQA 3ZWYA 5F21A 3ZWCA 4PRLA 5L45A 3KYCB 2Y0EA 4IBOA 2POQX 2F00A 2YV3A 3F9IA 4ZVVA 1BDMA 1IE3A 3MJ4A 1M2WA 1LA2A 4K9DA 3HHPA 5TF4A 5LCXA 1E77A 1U4OA 3PDUA 4WNCA 5IAAA 4UEJA 4U6SA 1WAMA 2ZJ0A 4OMUA 4XD2A 3ST7A 4RVUA 4BUCA 5CG2A 1ZSYA 2PZKA 7ADHA 2YUTA 3I9KA 2VOJA 4F3YA 2UV8A 4R69A 1P33A 2FY8A 4MKRA 3JQ9A 5JDIC 1Z74A 2V6FA 3VPGA 4GX2A 4IMRA 3PGXA 5JCJA 2GZ2A 1SOWA 1YDWA 4W9NA 1IYZA 3ANNA 1TI7A 4DQXA 1ZSNA 1UUFA 1Y8RB 2B83A 1SB9A 3I1JA 4D45A 5TS3A 2YV2A 3VVBA 1ADFA 2JKVA 3JYQA 4XB1A 1PIWA 3PQFA 3SJUA 3MEQA 3V2GA 5KVVA 1CERA 4E2YA 1WDMA 3NX4A 4XRRA 1EVZA 4D79A 1PJBA 1ISJA 2GDZA 4IGFA 4P38A 4O5OA 3UHAA 4E2WA 1A9YA 1ONPA 1PGJA 1HLDA 5B12A 4Z9FA 3DMTA 3TL3A 5KCZA 3ULKA 1SEVA 2CD9A 1E6WA 1GCUA 1I8TA 2C20A 4IQ0A 3VTZA 4Q3CA 3Q0EA 4TMFA 2PGDA 5C37A 2DBVO 4E33A 5A05A 2Y05A 4HX5A 3G79A 1TT5B 5THKA 4YT4A 2O3SA 3UN1A 3SC4A 4IMPA 3JQAD 2AEMA 2D59A 2XPCA 5JSFA 2BELA 2BMAA 1X14A 4CV2A 2OL4A 1NVMB 1HLPA 2W2LA 3DONA 2HU2A 2O4UX 3DWFA 3C1OA 3BAZA 3PXXA 3DTYA 3L6DA 4I9NA 2H63A 1BSVA 4IXTA 1IB6A 5ER6A 3LT0A 4OXNA 1DHTA 2Z5LA 3CUKA 4OXKA 4XYGA 3WDSA 3BTVA 3VZPA 3VKUA 3PPIA 3B1KA 2IODA 1YGYA 4FFMA 4NJOA 1YB5A 3FCOA 2EP7A 4BGIA 3ROMA 4Z9YA 1NTOA 1WZIA 4E2XA 1U1IA 4N54A 4KWIA 3BHJA 3DQPA 2OXIA 4U8GA 4D7AA 3N7UA 4EW6A 4CMJA 2PA3A 2A92A 2EV9A 3PRJA 4JX8A 1LDNA 5BNFA 4E5MA 1M6HA 1VPDA 1XR3A 4KP7A 3DAGA 5CEEA 1LI4A 3N58A 3I9MA 4CM1A 5COQA 5A03A 4ZQBA 2VRBA 5TJHA 3GZNB 4XB2A 4CM8B 3VZRA 3LVFO 4DQVA 4D3FA 4O1MA 4YB8A 1OFGA 3LC7O 4QX6A 5C7LO 3E8XA 3PEFA 3ZV3A 1U2GA 1UDCA 2HJRA 2Q1TA 1E3WA 2CFCA 3D3WB 3M1LA 1ZH8A 4N5NA 4E4YA 1EFLA 3GLQA 4J90A 1I2CA 4ZU3A 3HN7A 1LBEA 2VYNA 5L4NA 3OJEA 1A4UA 2CMDA 4JBIA 3DC2A 2NUAA 3IP1A 3FPCA 3GVIA 3AY7A 2H9IA 3VPXA 3CZRA 1A5ZA 2EP5A 1E7SA 5JXWA 3EGOA 1U3UA 4XR9A 2I76A 1DFHA 4Y9DA 5IDQA 1GEGA 3L9XA 4BNJA 1JW9B 2P5UA 3ZH2A 1VJTA 2JJYA 2P9GA 3VOSA 2C82A 3C1TA 1ZXLA 1YOVA 2DAPA 2O23A 4ND2A 1BWSA 2UUPA 4OHUA 5DBIA 2PTGA 4G81A 1LJ8A 1JAYA 2OMEA 3VAZA 1CQIA 1ZSVA 3FWNA 1X1TA 3VZSA 2RIRA 5HM8A 1QXSA 1W4ZA 1RPNA 4BNFA 4DIBA 1IULA 1HTBA 2NADA 1XG5A 4BNZA 1WMBA 5AQ1A 3ONEA 5JDIA 1GQ2A 3ZWOA 3OP4A 1EEHA 1DC5A 2WWRA 2J3IA 3ZW9A 1NQ5A 2YHUA 3JD3A 2VT2A 4LW8A 3JQBC 1C14A 2DPGA 4YDRA 5HBRA 3QVSA 5ICMA 1GQYA 1YH3A 2Y67A 4ZN6A 1YB1A 1H2BA 1ZK4A 4AJOA 4HWKA 2PY6A 1GUYA 4GLLA 4GVXA 4BKUA 2JFFA 1U5CA 1HYGA 4O6VA 1EDZA 3JQFA 5AXDA 2HKIA 2D5AA 1B0AA 3JQAB 3R3SA 4R1UA 3BYZA 3K6JA 2AHRA 4DTIA 3HADA 2PH5A 2Q46A 5FF9A 3B1FA 1E1MA 1HT0A 3UGKA 1XA0A 3CMMA 3H4VA 5I8ZA 3NUGA 1N5DA 1J6UA 4R41A 3U09A 3WGYA 3F5QA 1FDWA 2OZPA 4AVYA 1PJQA 3E5RA 3GMSA 3TZQA 3RJ5A 4LN1A 2VQ3A 3OJOA 2WM3A 1FXSA 4H3VA 1XSEA 3ZWAA 3TN7A 2Q1WA 5I7EA 4YAKA 1WW8A 5TGDA 2EW2A 3WFJA 3HJAA 3FWZA 1PGPA 2NVUA 3FRJA 4CL3A 5GZ3A 3VH1A 3LT4A 3ROKA 4E21A 1CETA 4FCCA 2VHVA 2VUUA 4MPDA 2X9GA 4DWVA 2C54A 4PLFA 1IPFA 3R6DA 4ZHSA 3DBHA 1T2DA 3EVTA 1TB4A 3WSVA 2EGHA 1P45A 4GL4A 1FMCA 4PFJA 2P9EA 1BXGA 1SEPA 1YVEI 4FN4A 4J6FA 2AQIA 1P1KA 2EERA 2HJSA 4D41A 2X5JO 3ITDA 2QYSA 1NR7A 5L7TA 1UXJA 3TSCA 2YW9A 3WYCA 4XYEA 3JQ7B 2NTJA 2NVWA 3AY3A 3F1LA 4PLYA 2WE8A 2WYUA 1LDEA 3HDJA 1GD1O 1AE1A 1JU9A 3L77A 3R0IA 1GPDG 1XGKA 1A71A 2WE7A 2B5VA 4FJ0A 4CLDA 5IG2A 2D8AA 1Y8QA 1OC4A 4ND3A 2DTEA 1Z45A 4QXMA 1QLHA 1SB8A 5JPIA 5THQA 4UVIA 4BNYA 2OFPA 1FDTA 1EUDA 2A4KA 3QRWA 4GLOA 5A9TA 1MB4A 1O9BA 3WLEA 1F12A 4IY1A 1R4NB 3ZWNA 2ZIZA 3W8EA 2QRJA 1LLDA 4N5LA 4MOWA 1ZCJA 4PG6A 1DHRA 4FC7A 1PJTA 4RZHA 1IOLA 1DJQA 3LLSA 1A4IA 2ZTMA 3DHNA 4BS9A 4FPXA 3PJDA 4IDEA 4NNJA 4NQZA 4E31A 2Q49A 1PQPA 1LSOA 1NBOA 1ISGA 1LDBA 2C5AA 5J23A 4KMSA 3PHIA 3RCBA 3H3JA 2ZB4A 1K6XA 1KYQA 4IIUA 2JHFA 4BMSA 2B37A 4CMIB 4GGOA 2YFQA 4NBVA 2AQ8A 3X2EA 1EQ2A 4TRNA 4W99A 1RM0A 4XQEA 5HS6A 5JY1A 4G65A 4NK5A 1Q7CA 2J5QA 2YJZA 4IS2A 5A3JA 1B2LA 4CODB 4AFNA 2EKLA 1T2CA 2CVOA 2FPPA 4ITUA 5AOVA 4FDAA 1UXGA 3RBVA 4OH1A 4ZRMA 4IDGA 1JDJA 2HRZA 1GZ6A 3JQBA 3M6IA 1SBYA 3FPLA 4NK4A 3WGTA 2Y0DA 4QQRA 4BNHA 4R1SA 4CM4B 4IS3A 4IUYA 3L07A 3OM9A 4UREA 4KUHA 3UCFA 3FI9A 5L3ZA 4NR0A 4RVSA 1E3JA 1QLJA 2P68A 3CSDA 4FIZA 4HFJA 4KTTE 1PGQA 3TPCA 3UFXA 1ISMA 3Q2IA 3HNPA 1QYCA 3E1KA 1KVUA 1O95A 1M76A 1C3VA 3UH1A 1ENYA 2I6TA 2QZ9A 4EBFA 2W8ZA 4D0RA 1PJCA 2CZCA 2AQHA 3GDGA 3A1NA 3GPIA 4II3A 4PZEA 4XQCA 1D8AA 3ONFA 3RIHA 2I66A 2CVQA 4BGVA 7MDHA 4J43A 4XRGA 3KYDB 4IXWA 1R4MB 3A28A 4BKRA 2EF1A 3RI3A 4XWYA 5F1KA 4J4BA 3U5TA 3MTJA 3F4BA 2VUTA 2D0IA 1NASA 4CM3A 2FP4A 4UULA 3C7CB 4Q3EA 4AJ2A 4N18A 5DN9A 4CV0A 3VVCA 1HEUA 1DLJA 5ADHA 2GRAA 4R01A 5A02A 3GVCA 4BNLA 3WYEA 1G0NA 3D7LA 2UYYA 5BSEA 2V6MA 4IJKA 5TX7A 1ZMOA 3ZGYA 1KVTA 1UR5A 3ZWWA 3OEYA 2GN4A 4M55A 5C7IO 1C1XB 3ENNA 1TT7A 3GN1A 4L75A 5G4KA 2P9CA 5G0TA 1MGOA 2VZ0A 3QJ5A 4YJHA 3RD5A 3ZI0A 4L73A 3KETA 1W8DA 4HY3A 4MP8A 3RVDA 1SOVA 3RC2A 1K6IA 3MTGA 5KOIA 3IKVA 1KEWA 4CMEA 3DZGA 2HUNA 1C1DA 3AJRA 1LUAA 3DZHA 4O63O 2GZ1A 3K31A 1GCOA 3JD2A 5EJ2A 4FOOA 4UUOA 1Z73A 1CEQA 1EBFA 1KIFA 1OOEA 2OHXA 2R00C 1PL7A 2VYVD 4M54A 1EVIA 4ONEA 5LDGA 3A06A 5COBA 5IZ4A 1GYRA 4XJSA 3IUPA 1GTMA 1DC6A 4MVJH 3V1YA 4Q3BA 1CWUA 3AI3A 4MP6A 3OJFA 5F5NA 3GAZA 2NWQA 3IMFA 3KOUA 3V1TC 4YVFA 2VHYA 2F1KA 2NU7A 3C3XA 2DBRA 3QW2A 4U0KA 4YCAA 3KVOA 1NQAO 1BW9A 1WDLA 1ZO8A 1I33A 4X54A 2D5CA 2FR0A 2FZWA 3NTQA 3GPDG 3D0OA 5F5LA 2GASA 3U4IA 4IQ8A 4WKGA 1B8VA 1ZK3A 4JLWA 3VPSA 5IN5A 3KSDO 1MFPA 3RC1A 2O3RA 2ZATA 1ZK1A 1P3DA 1NYTA 3A4VA 1BXKA 4PG5A 3JCZA 2BI8A 4CUKA 1NFFA 3LYLA 4EJ0A
chains in the Genus database with same CATH superfamily
3HCRA 5JEEA 3TF5A 1BN7A 2JH9A 3WRXA 4L0QA 3F3MA 1UOQA 1RQRA 2CDCA 2C4KA 4UHJA 4ZTZB 1Y5MA 4Q9IA 2A5JA 4HZUA 4ZXPA 2Q6OA 2QMUA 4AUKA 1I1HA 2MHCA 3IAEA 3JQGB 3C85A 1IUNA 4DIFA 2WKRA 3SXJA 1PS9A 3GLIE 4R1MA 2X3UA 3LW7A 1CY6A 2VOEA 4WIAA 3HBMA 1VFPA 3S2FA 3HCWA 4E88A 4KVZA 3D3JA 4GFDA 2YMQA 4LXHA 1OW3B 1JLKA 3TM4A 4HAIA 5MN6A 2XWPA 3B3GA 2OGUA 3DHYA 3OTGA 3ISVA 4DIDA 4NFYA 3E22B 4R68A 1IB0A 4W5RA 3UC9A 3MA0A 4YQZA 1JTVA 4K6MA 4AZWA 5LNK6 3PHJA 3PUWA 4ZQHA 1OGJA 4R1OA 4L8VA 4J6EA 3F2IA 4LXYA 5A2GA 4CKEA 4ESOA 3HUUA 1XTKA 1YQXA 2DZDA 2HHAA 3GUUA 4FDMA 5TPZD 4YQFA 2X4GA 4OI4A 5KYYA 2CLOB 3Q7IA 2BGRA 2O5RA 3B82A 3T06B 1TPYA 5EWLA 4K9SA 4K81B 1MW9X 2QHXA 1HQDA 5JBIA 1QP7A 1P8AA 4AQDA 4U6NA 4PZPA 2B30A 1DCTA 1KO8A 3OICA 4TSRA 3DQQA 3K1ZA 4UUQA 1OC2A 1SIWA 2YR0A 1D6NA 1NP3A 2QU8A 3CGWA 3W04A 4BNTA 2XZDA 5JYDA 4MXDA 1KOFA 1ZN7A 3MJCA 3L7MA 1H2EA 4Z1MD 1CCWA 2IOFK 3KSBC 1R0RE 2UVDA 2FOLA 4GX1A 1B76A 1M73E 1W1IA 3RYHA 3OCYA 5KQPA 2X0RA 5D86A 3IV9A 3PI6A 1GG8A 5DSTA 1AHIA 4G0QA 1NI4B 1JIUA 1N9GA 4YC7A 1G5PA 3QVJA 5JRJA 4IHJA 2Y93A 3H13A 4EO4A 2P9HA 3SOPA 2Q4OA 3P9PA 1DXQA 4YRRA 1U4NA 1IHOA 2J3KA 3OF3A 4MVJA 4XDYA 2VXBA 5KNDA 3NWJA 1VYUA 5U9CA 1NUUA 2QLTA 1ZFNA 5IDWA 3NV7A 1CR4A 3SJBA 1USIA 1UDAA 2DHDA 2GQ0A 2YMPA 3MERA 3FX2A 2YHIA 4TZKA 4CV1A 5KNCA 1TK9A 2WU1A 5GZ1A 4H08A 5K0FA 1NV9A 4IDCA 4ZTBA 1A95A 1CZRA 1MGPA 3LY8A 3SBEA 1KMMA 4HVAA 2VUHB 3FZGA 1TW2A 4HXFB 4Q18A 3G1UA 2X19A 1K0FA 3JQCA 3C6QA 4RHTA 4CYMA 2Y2VA 3Q9SA 3ZWBA 3F7NA 1V8FA 3QP9A 4OB8A 4D0LB 2IYVA 2V6BA 3PIIA 2FWBA 3GL9A 1SQGA 4FGSA 4WI1A 1V43A 4BMOB 1V11A 2EX4A 2I4IA 3OOYA 1YR9A 5KTNA 5HVNA 1AQYA 1K89A 3UK2A 1G9SA 4ERXA 3U1BA 4I6JA 4I1IA 3SZ3A 5ED4A 3AJEA 4KXFB 2Q3MA 2O7QA 4GMFA 4YBZA 1WM1A 2HLPA 3F6SA 4UNPA 2F8MA 1K7XB 4FMDB 4DA4A 2E4ZA 1UKZA 4LJ7A 1W8IA 3P27A 2C8JA 4MYTA 5EA2A 1IAVA 2GFIA 1J1ZA 2R00A 4MI6A 4BLUA 3U7IA 3KB8A 4BZPA 1Z5VA 4LZWA 4GX5A 1R7RA 5IAEA 5IVIA 2FK7A 1JA0A 1MC1A 2BKUA 5BMVF 2OECA 1NONA 5FKJA 5SZJA 1E4YA 4G2NA 4AN1A 1X87A 2HIAA 3GVHA 3ODPA 1PV4A 2AFIA 5CFMA 3N28A 4ID9A 1CHDA 3VR6D 1NLMA 2GD1O 2XI4A 2C5FA 3BQ9A 3IB6A 3TDKA 4DQDA 4UUBA 2O8CB 2FW6A 4DRZA 1LV8A 3MWGA 2R7KA 4DCVA 1K7FB 4TLCA 5AOAA 3WG9A 3MTBA 3Q1LA 3VNUA 4IIXA 3EFOB 1G63A 1GEEA 2BGMA 1E0DA 4KW7A 5AI0A 4BO8A 1IOWA 2DP4E 4HGZA 1Q0SA 3R3ZA 2DQKA 4F5ZA 3BMOB 5JYBA 3TZKA 4AZ0A 1NSYA 2F62A 2HNBA 3P9IA 3PS9A 3RLFA 4DFDA 5A62A 5B64A 3DR3A 1OFTA 1RHRA 4W5HA 4YWJA 3FPHA 1GYQA 3LV8A 4FR2A 4QFMA 4AF7A 2ZI4A 3PTZA 4KQ9A 4YA6A 4Z51A 1JTFA 4M36A 1FFAA 4LDRA 5DBHX 3LT1A 1KY5A 4D2IA 3GJSA 1J0XO 4MYSA 1XLTC 1I32A 3QFHA 2BGWA 4Q4AA 5DFAA 5GY7A 4OQPA 2HY7A 1F8UA 1DO8A 1O08A 3FGOA 3PKIA 1YL5A 3INRA 1B42A 3IIMA 3OFKA 5ALDA 3RU7A 1ATZA 4MR9B 1Z4JA 4FZ5A 4X64B 3WGUA 1XLVA 5JD4A 2OBNA 3KVYA 2C99A 4QKQA 3GEBA 2I54A 1I1QB 1QH1B 1IBCA 3NAQA 4PSDA 1U7HA 2OA0A 3K9HA 1SD1A 4AYXA 4DLVA 1SK9A 4Y0AA 4KNYA 4P4NA 2BFNA 1PYOA 4REQA 2C9DA 1N8NA 2YXPX 4U39A 3N39C 4EMSA 2N9UA 2A35A 1H42A 2FV8A 3EXAA 1ISIA 1AUQA 1T36B 2IYWA 5DSXA 3W1WA 2FFQA 1HEIA 1EJBA 1USKA 4GZLA 2NZUG 2X2PA 3RUCA 2JJ8A 2Q3HA 3NIGB 2IDJA 3OHSX 5ES3A 3DB1A 4CKCA 4IFTA 3D7MA 1HFEL 5LMZA 1KK0A 1WUHS 5IBCA 3DVLA 4OAOA 2PH3A 3NC1C 4RVOA 2QD5A 2NSDA 5EXSA 1QC5B 5FT9A 5G40A 4MUYA 1V3UA 4NBLA 3TLMA 3PUVA 2YS7A 3BDAA 4V0NA 2LBPA 5KYKA 4RC9A 1LLUA 1FVHA 1V5IA 1G3MA 2Q4RA 3PVCA 3L6BA 4YUVA 3U3RA 3UV6A 1LXCA 4CKWA 3D2AA 5DNEA 1U7OA 3GY0A 3NHBA 2JEOA 2PJDA 4FYKA 4I50B 1ZITA 2XGOA 3PLRA 5H68A 2XZTA 5I9IA 3FGPA 2IYTA 2ZB8A 5BMVA 5JECA 3HCNA 2ZZMA 4KXNA 3OIFA 2VK4A 4JWKA 5KKAA 4J0IA 3U0BA 3SSMA 2E21A 1VJ0A 1RYZA 5ULLA 3ZGXA 3ZXXA 4EKYA 1K4MA 1NJ2A 5BV8A 3FIUA 3ZZ0A 2CZQA 2IH5A 6GPBA 3GRFA 4E5PA 2NVUB 5HRUA 4Q1CA 5J2TB 5EN4A 1FNMA 3UAWA 4AW9A 2GESA 1Z0ZA 3BIJA 3K70D 2R11A 3EHDA 3LS2A 2AG6A 1CRLA 2IFTA 4RWZA 3FYTA 3PGVA 1OFIA 2PBLA 2VP5A 1NQXA 1ST2A 1MX1A 2NQ8A 1JEQA 3R6WA 4FFLA 1BZYA 3Q40A 1ZKDA 4H2DA 3U4CA 3CLHA 1Q1BA 4G63A 1F20A 3WMXA 2LRHA 4ZVOA 2DR0A 4XM2A 3RS8A 4AG3A 3IC5A 3ZHVA 4R8VA 4M2LA 3FF4A 5EZQA 2D74A 2J3QA 5CJJA 5E95A 4EDFA 5HUJA 2J3LA 5EE0A 1Z29A 3PEWA 5ERGB 1E1CA 3IVCA 3J81A 4DR6B 1FFYA 3LCVB 5AD1A 3HN2A 3KELA 4LV5B 4GOLD 5C5DA 5C8VA 5K45A 2DUUA 1T0PA 1YI0A 2BUBA 2C83A 1QFZA 2VKTA 4EL5A 2ORIA 4OI1A 4MGHA 2G5CA 1I4WA 1YR3A 4LE2A 4Q24A 4XJVA 3ZDEA 1ZOIA 4YMWA 3ZG6A 1E7WA 1DL5A 4X0EA 2CLKB 2FEPA 3UOWA 3ZKWB 2RGRA 1F4VA 1P0FA 3THXB 4HLCA 2X76A 4PFKA 2OG1A 1S8AA 1CB7A 1ORIA 5AW7A 3HUTA 2GJ9A 3HB7A 3CLUC 2IIBA 4BBZA 1Y1KE 2XXAB 4PIMA 3GK3A 3A7EA 1XQ1A 3BXZA 3OOSA 3UYKA 3D3NA 3LIIA 1EHCA 4MV0A 4DW8A 3B1YA 2V65A 2MYUA 5EIFA 2LXNA 4NI5A 4LXQA 4AYTA 1NN3A 3W5SA 3AP3A 3PHLA 4JOSA 3O84A 1FXWA 3KJEA 2I2DA 2XMSA 1WMEA 2VUIB 1R5OA 3HWRA 2EL9A 5B3JC 2XJ4A 2R97A 1CF9A 1KJQA 1VLJA 3H2SA 4C20A 2XVZA 2XMDA 3OMWA 4U9IS 1VBNA 1HDXA 1Z0SA 4HDSA 4ALIA 5REQA 2V0GA 4MUHA 4D44A 1DMRA 2CNOA 4CDNA 2HUPA 4ZEMA 2WUWE 5KWJA 2C5EA 4ZCQA 3ZV5A 1QQ5A 3D4OA 3GAMA 3R7DA 2BONA 4LDZA 3K30A 4GQIA 4NESA 1T6XA 4E12A 1L5WA 1ULZA 4K3VA 4CEJA 5FPYA 1HFKA 4ZYWA 2ZE6A 2C2KA 4M1SA 5JCXA 4OHZA 3A1UA 4GKBA 4PAOA 1GLNA 5FI1B 1NJ1A 3VNBA 2OOSA 3MMXA 1T1JA 4RTJA 4ZIRA 4CCAA 3CNLA 1JJIA 2WLSA 3EZFA 1YFKA 4B17A 2V6JA 5LB4A 5A5EA 4MQLA 5CCDA 1ZJ4A 3ILVA 3KD2A 5LP1A 3VA7A 3ZTWA 4GDFA 1H65A 4GM1A 2XEXA 4ZVLA 1OZAA 2V45A 3VYUB 2PSEA 3HP4A 4IXMA 3V1LA 3KJHA 2UUAB 1G3UA 2IQ5A 1Q2UA 3IR6A 1I36A 5CXUA 4C6TB 2C29D 4A8HA 1FFWA 1HE8B 2ZPTX 2HTFA 2AFVA 1KMIY 3EN0A 4V0MA 3OHPA 4QOFA 1ZJJA 1XDZA 3OE1A 1RZUA 3G5TA 3ZKAA 1W46A 1CUFA 2QRVB 4H6XA 4HLQB 1RFLA 2IHKA 4NYMR 4NABA 4TROA 3IRUA 5UKDA 3KUKA 3ZXSA 3DV9A 3OE4A 4BFWA 1FFXB 3CVYA 3N8GA 5EJ6A 4BGDA 1EDDA 1EXWA 3S2UA 5J4LA 3WB9A 2BH2A 1TUGA 4EH1A 3LDUA 3BILA 4C0AC 3GFSA 3D54D 1ZR2A 4OQZA 2NG1A 4CM9D 4PBRA 2WTNA 4A0FA 4E13A 4A0HA 1LRJA 3BE5A 4ER7A 3WYFA 2WNHA 1CQXA 2XYGA 3DULA 4YXWA 3S2EA 4EHAA 4V1CA 3Q3CA 1RKXA 1U2PA 4OHWA 1EX1A 1BKYA 1MJNA 4U02A 3PUXA 2XF8A 1KQFA 3BRCA 3NHLA 5AHOA 2WD9A 4AN0A 1XJWA 2BGKA 1X1SA 1XV5A 2Y68A 3HRKA 1TRHA 2HZ7A 3C6KA 5DN6D 1ZBDA 4J1TA 4QOGA 3H1AA 4INAA 4KO2S 3BMCA 4K9MA 4KR9A 1WMFA 2R79A 4AO8A 1EP1B 4DMMA 1GYPA 1XZCA 3M7IA 1L1FA 4RORA 1EZZA 3ZNPA 2Q3BA 1Z0FA 1NXPA 3ETCA 2X7XA 1OBFO 2B6NA 1C4WA 1UAGA 2Y99A 4AF6A 2FQ1A 4Z7QB 2Y4OA 1D2HA 2BEVB 2GF0A 3KZOA 4FR5A 4QE3A 4WVFA 2GCGA 4LPKA 1LRKA 5EWMA 5K0GA 2GHIA 4BMVA 4MMXB 2X9LA 2Q7XA 5I9LA 4OUDB 4AKTA 3FLAA 1JHUA 3U3MA 3DKRA 4BGEA 2DERA 5HNKA 1QU3A 1G8SA 2J9YB 3Q6MA 5CP8A 3E2MA 1M2KA 1Q84A 4MYRA 5T67A 3LLMA 1SXPA 2L42A 2A3NA 3HUFA 3AERB 4A8PA 2HT1A 2A1TS 5FFNA 1Y5LA 1C8BA 1HDYA 2X2EA 3SF0A 2H5LA 3LCRA 5DXAA 4HSGA 5DCUA 3WDLA 1QVAA 3A9UA 2V7QD 1S02A 2Q41A 4UM9D 5G4KB 4IJ5A 1P7YA 4C0XA 4B7CA 1SM4A 1SUDA 5EJAA 3LSTA 1N8TA 2O57A 3QEMA 4KR2A 1S1CA 2QTAA 4ABTA 4Z4IA 4P36A 3WAKA 2NZJA 2VZ8A 4QNRA 2LPMA 5KOJA 1FSZA 3DV0B 3I3SR 4Q3AA 2FEOA 2R6R1 2PHZA 4GXNA 3CHYA 4BO0A 1JXQA 2IGBA 2OWEA 2YJTD 3D43A 1UBEA 4LOIA 1ZC4A 4NCXA 4NYJR 1FBNA 4NPAA 4Y1GA 3WGOA 1EE9A 2Z2KA 5A4DA 3T7DA 1BVUA 4G97A 1LX7A 1SC3A 3WJ2A 2BZGA 2EW8A 3EXHC 3NCHA 5CGQB 4A0QA 3GIDA 1KOJA 3VO1A 2HCTA 1N0HA 1U5AA 1Z38A 2BR3A 3UB2A 1KJJA 4ZICA 1VSVA 1NQVA 2KHZA 3ZLTA 4IIJB 2JI4A 1IBLB 1K9SA 1JQ3A 4PX5A 2ZSJA 2DH5A 4D3ZA 3A9VA 3C3MA 5F98A 2G9RA 4PHHA 1N7GA 4G5HA 4JYMA 3TIVA 1RJDA 2PJZA 2HSZA 4JCCA 1HKUA 2PO5A 5JFTA 4RHUA 1BX0A 1TA0A 3D3WA 1WHSB 1Y7TA 2GBFA 4II7A 4FIDA 2XNKA 3GRUA 4FGZA 3TLZA 3T99A 3I34X 5KTSA 1H8HD 3NIWA 4CR8A 4II2A 1Y5IA 1JVBA 3LBIA 2B25A 1Z35A 3PFNA 4FKZA 4KV9A 3AR3A 2CMGA 4E31A 3QA9A 4HV4A 2CJPA 4MVJP 3A10A 5ALEA 2WHPB 4B3XA 2WUFA 3M33A 2HTEA 5JJBA 2PUGA 1JG7A 2EQ5A 5JBNA 2UZ1A 2ZRFA 3PNSA 5TT1A 4G26A 2H9AA 3QH4A 4Y30A 1R88A 4Y9RA 4TL9A 1Z6YA 4HZUB 5A0FA 4Q39A 4EEXA 5GJVC 1OWOA 4A91A 2EKDA 4WLVA 3WHPA 4ALJA 2QTWB 3A36A 1Y6RA 2QSJA 3HY3A 4CLXA 4POAA 1N1EA 3KUDA 3SJAA 2ZCUA 3QPBA 3JX9A 1G60A 1XQXA 3DTVA 2GETA 3N2ZB 5AYVA 1YT5A 1SKYB 2G09A 1CUHA 5K8LA 2UXDB 1GRNA 4TM8A 2DHCA 3ZUPA 2OMKA 1DIGA 1TVKA 3NHPA 4YRCA 4O3FA 5KSYA 2ZUWA 3R0ZA 3LWZA 4DJ5X 1TUBA 3OZXA 5EIOA 2HC9A 1GN9A 3CX4A 1ZM7A 1GITA 5FOSA 3C7DB 4ALLA 2Z6QA 1SXHA 1TM4E 4KYIB 1TRKA 3AHEA 3FVWA 2BN4A 3E0XA 2YC4C 5ELMA 4R5MA 5ED0A 3EMDA 1C0KA 3UUGA 2R0QC 3R5XA 5ILGA 2VHJA 5EWLB 3RRBA 3TCKA 4YCLA 2GCIA 1NNEA 4QA9A 4YJFA 3AB3A 3L93A 3TLKA 1Y1TA 4QDKA 3TFQA 2XT9A 5JS6A 1KETA 1W0JD 3O8LA 3OTQA 1YCGA 3ZLUA 4TKUA 3PD0A 5B58C 2EYUA 2Q3DA 5K0SA 2PUWA 3H9QA 2GN8A 4G0XA 4Q4LA 4ERNA 1A4XA 1RKQA 5CTAA 2PKCA 1QE5A 5JI2E 2R8BA 1NDUA 2Y1FA 4A7PA 3U7QB 4UASA 4IDPA 4TQGA 1GKYA 5B5SA 3IT1A 1PR2A 2HMYB 1IY2A 4CGZA 2JAPA 2AG8A 4X8OA 4A2PA 4I14A 1WX1A 2CLLB 1QGUA 2QR3A 2ZIGA 3KTOA 3NBAA 4FEGA 2OV4A 5B1EA 1XFDA 2J3EA 2BPOA 3AVPA 4ZAZA 5ILOA 3J81k 4KR0A 4A16A 3HVIA 4URWR 3EGEA 3FAKA 4KQWA 2ZJ1A 1MC4A 1A7JA 2AWNA 1XMSA 2NM0A 4IFIA 4MIOA 5BPFA 4A15A 1E66A 2VLBA 1W0CA 1FU7A 4ZC8A 2F2TA 4ZI3A 1ACJA 2XECA 2DWOA 1U0BB 3NETA 1IZ9A 1GWNA 1PU2A 3CZ5A 1KY2A 2FG6C 2YICA 1PZEA 5HYVA 3SYKA 2GX6A 4GH5A 4D46A 1YR2A 2W2LD 4L4RA 1JVNA 2ODQA 2GH1A 4P8RA 1BTOA 4RPHA 4Q12A 1YBMA 2QORA 4QFBA 4PANA 3PRHA 4RY0A 2WSBA 1V11B 3KLMX 2JJ2A 4R83A 1XJ0A 3B70A 1BIFA 3MNFA 2EGGA 3EEYA 1USWA 1JYFA 1QQTA 3ELUA 1TCBA 4B3TB 3VR2D 1ENZA 4TVBA 1BMFD 1IY1A 1IVYA 1N6IA 3AYZB 2FZ5A 4N8DA 1CQPA 3KLOA 3ZDQA 4CIAA 3H83A 4Y7CA 3TQOA 3D4NA 4ENUA 2NPFA 1KARA 3A04A 4UBNA 1IZ0A 1OASA 3CF6R 5SYMA 4C4SA 4B2LA 5AKIA 3T34A 4RADA 1JKIA 3OEHD 1XN4A 4HVTA 2FP3A 5JROA 2VSFA 2WDPA 3UMRA 2AOTB 2ZUTA 4J91A 3KK0A 3WKDA 5KYUB 2XMZA 3AL3A 4AICA 4LZPA 2B4RO 4D98A 1Z16A 2AFIB 2ZROA 3GLTA 3J7AC 3NOXA 2VC2B 1XCLA 4ZZ0A 2X0NA 3LZDA 1X1BA 4Q48A 5BNIA 3VU9B 3B3AA 5IVPA 1M0SA 1PE0A 1XB2A 1L2TA 1WE2A 3RT7A 3O4HA 4LCBA 3QEBZ 2Q7DA 2YBDA 4HLNA 1MMFB 1MOSA 3L01A 1OVGA 2VDUE 2DHEA 3F5DA 4IGIA 1VG8A 1P31A 1WLYA 1ZJWA 3G9XA 4FYYA 4O4HA 4RKYA 4CI0B 5G0SA 1GPNA 1E4EB 1FTNA 1P91A 2F1HA 3CA8A 1QRAA 2F9FA 3SIPA 4D99A 3BE8A 4G84A 2Z0MA 3IJRA 3IO3A 2PR7A 2FG5A 1Q3TA 1NN0A 2VYCA 3DZKA 4QXRA 5DP2A 4I5EA 2VWPA 1P2GA 2QIOA 3R4CA 3PJRA 4A73A 1PSDA 5MFPA 1F0YA 2B20A 3HCFA 3OJXA 3CGGA 3DLCA 4HF7A 3RSZA 4PNEA 1VQ1A 1XQYA 3BB4A 5HDBB 1IOZA 3FVRA 1MFZA 1E9RA 3QBTA 2NUBA 3D8RA 1BEEA 2HK8A 4S04A 1VC2A 4QYWA 3MTEA 4ADSG 4W6ZA 2EJWA 4BEWA 3CRNA 3VYTB 1I10A 2QVLA 2VF2A 4QYMA 4P7GA 3BQNB 4N76A 1CDDA 2P67A 4YMIA 2J9ZB 4EG0A 3NRJA 4EW2A 1EXVA 4IVPA 4QJ4A 3EPJA 3IAFA 1ISHA 1SKYE 4L0DA 1TZ2A 1BFUA 4WK0B 1E3EA 3CX7A 3A9SA 3AL0C 5LA6A 1NBEA 4BBAA 1T4CB 4GSKA 3ZU3A 3AVVA 2NQ2C 1BHQ1 3LCCA 3NYRA 3E7DA 3GRCA 2OORA 1A77A 1SCJA 2ODTX 2PWPA 1J8QA 1ZU5A 2NAFA 4YR7A 3COYA 4FYHA 4CMIA 1I0ZA 2P8JA 3EPKA 3M6MD 4X92A 3FLMA 4NZPA 3K0SA 1RLTA 3MBKA 1DEOA 4F9TA 4G89A 3A6HA 2QUHA 1E8DA 1Z4KA 2FEAA 2Q5IA 1FTGA 1G2QA 4BP9A 4G5YA 5IU6A 1X8XA 3PZBA 1BVHA 2ZWPA 5K6AA 4X1YA 2YOFA 4OQYA 5CA0F 3K9GA 5ITSA 2CVFA 3HLTA 1E9VA 2I1VB 3KKNA 1UP7A 3R0VA 3WE7A 4FFDA 2B0CA 2Y76A 4V2UA 2BZSA 2WWFA 3N2IA 1YGPA 3GEHA 1VJ1A 3M4NA 5J9FA 2BD0A 3BEOA 4CM4A 4QUDA 4HNTA 3IUSA 2ZVDA 5FLYA 4CT0A 3QF4B 1F2DA 1UH5A 2VHWA 2CVZA 4BUZA 4CF7A 1CIJA 4I5FA 1J21A 2WI8A 2ZJ5A 3RBZA 1Z83A 3AV0B 3NHSA 3O9ZA 3S2IA 1Q7BA 4ZKDA 3DVSX 1SHTX 4X65B 4MVJE 4WCFC 4KN9S 3BH7A 3IMKA 2GNPA 2E6UX 4DMFA 1JEQB 3R7LA 1KZHA 4CMCA 4PX9A 3STHA 1WMSA 4AWXA 5GVSA 2DR2A 1I2ZA 2L17A 2QPTA 2QZZA 3A6FA 1FFHA 1ORWA 1JQEA 4LDJA 4YMSA 5J63A 1P2VA 3C3JA 4WZBB 2WSYB 3F8TA 1VCMA 1X80A 3MBIA 1U9YA 3ZBQA 3A3PA 4KR3A 3NWBA 3ZQJA 4TZ6A 5IAKA 3LA6A 1E1CB 2HPHA 1M2JA 5HJ2A 2BV3A 1UPCA 2CXQA 4AJ1A 5LOVB 4OHBA 1UKCA 1L7VC 4LGYA 1MQAA 4U7TB 1FYDA 1DPGA 2XGGA 2J4CA 3GGDA 1UFVA 3B48A 2IELA 3HDGA 3F98A 4M98A 2IP1A 2QD4A 3MN1A 3MS2A 4HCJA 1RYMA 4CDMA 5AFSA 3FTPA 3AKDA 4CTJA 2QTTA 4KAXA 3USCS 4XVHA 2RE8A 2AN1A 2AXPA 2GMWA 5T4EA 3BULA 4EUEA 1X8KA 2Q5HA 2QV7A 1QTQA 3BIOA 5DISB 4PN3A 1TVCA 1EM8A 2WKQA 3GD5A 4V38A 1TTTA 1ARZA 2XIJA 3OAAA 1ISFA 2VXCA 1QNFA 3AP2A 1YFLA 4XPZA 5HSGA 1IXZA 1JRLA 2VH1A 4FKMA 1CEEA 2N1BA 3RE1A 1XZJA 4UDNA 3I5YA 4DPLA 4KH1A 1ZEMA 2YXNA 4MITA 1WXQA 1B74A 1C1XA 4I9HA 4BPRA 1EQAA 3OKAA 1DBIA 4IV8A 3ASVA 3AJAA 1PQYA 3AXSA 2NSHA 5BN4B 4QL3A 4HL6A 5ENVA 1NNLA 5K51A 5REQB 4G1VA 4Z0HO 1YZ3A 4HDAA 4K1XA 4RMGA 5HZGA 1OLXB 2Z56A 4CMGA 5JWRA 2WF9A 3EAFA 3UVEA 5HG0A 1L4KA 1DKRA 5B1SA 5KQLA 1WD5A 2C5GA 3O4GA 1LVUA 1U8XX 5CA0A 1QZXA 4D9EA 2WHXA 1TA4A 5CLIA 1VZ3A 1N2GA 1MA0A 3EB9A 5AW3A 1D3AA 5IAJA 2Y71A 5CBKA 4WXEA 5KAMA 2EZ4A 1WNFA 3GWGA 3HFGA 2FMTA 1VZ2A 3U16A 2G71A 3THOA 2GGSA 3FHTA 1HYQA 1DJPA 1KBZA 3COVA 3PE4A 4UBJA 5AW8A 2UU9B 2IZ1A 3LKDA 1WBBA 2X0KA 4F4HA 1H23A 4OQEA 4ECEA 1NYRA 5LJLA 1BGWA 1YU6A 3M70A 1ULBA 1X9GA 4U7WA 1N4DA 2ZRPA 3EWSA 1HZZA 1AG9A 1AZSC 1N7JA 3FWHA 1Y6FA 1U02A 4HHEA 3Q2OA 4QM7A 1V6AA 3DDNA 5KU7A 1NQUA 4KGDA 4FFNA 3WBBA 4F0JA 1RIIA 1ZONA 4CMHA 2JBWA 4BC1A 1GUZA 5TQVA 2W58A 1K3UB 4MV7A 5CD9A 1LNSA 5H4GA 1LK0A 1VLLA 3PLNA 4H1TA 3S2SA 3TEMA 4KRGA 2O9JA 2MSWA 3M5PA 1EFKA 1NPYA 2BBSA 3PP8A 1LSUA 5E7QA 4JI1B 5CFOA 5EE1A 5AUOB 2C9ZA 4HEHA 3TQFA 3WL6A 4CUJA 1M66A 2ZVJA 3EFBA 3FD8A 4V1CB 2A0FA 1E6UA 5F77A 1ZD1A 3HQ4O 1QANA 2XUIA 2O05A 2NIPA 2V03A 3MS7A 2Q6TA 4US2R 3JRXA 1IWOA 4CJXA 3EWIA 2HYIC 4IOKA 1NM5A 4HS9A 3PT9A 2IIPA 2ZSBA 1QSGA 4AECA 2DWUA 3DBLA 4UBIA 1PR9A 1I0LA 2REQB 1M6NA 2AI3A 2MJLA 2QDXA 4LZAA 4UNNA 3UAYA 2EKPA 2O6HA 1GARA 4A8JC 2CLIB 1T15A 3WB0A 4BU1A 4I1VA 3ZYCA 5FQOA 4GICA 2TMKA 3BMCB 4Y7DA 2JAHA 3JQFC 1YI1A 3IBSA 4G67A 3HCOA 3CVWA 5THXA 3DD5A 1RYDA 1Z4QA 4PC6A 3VO8A 2V7TA 5C7OO 5LU9A 4WNIA 3FSRA 2QAGA 5E7IA 2IH2A 1XEFA 2FW0A 4QEKA 1O95D 2X13A 3QFCA 3DVQX 3EQ7A 2AX3A 1YKFA 3L6UA 2BEJA 2A1UA 1FA9A 5IKXA 1D2NA 2WM8A 3OPVA 4HP8A 5EWMB 4JNKA 4WE3A 1YQQA 1GPAA 3TFWA 4TYMA 3AUTA 1KH2A 1U0OC 3U80A 3GEEA 4JX9A 1V95A 3C5HA 4EABA 5DT9A 1NPDA 2G1KA 2I6UA 3EUFA 3NC4A 1FX0A 2WF5A 3ZU4A 1UK9A 2NP6A 2CL7X 4ZGWA 2QPOA 5FOQA 1VA4A 2P3SA 2ZJAA 3GLGE 1Y6ZA 2QL7A 4UFNA 3KQHA 4FDLA 1KO5A 2HSEA 4MGKR 1OI3A 4L50A 1IOVA 2GZDA 5IJZA 2J9XB 4DRXA 4MUEA 1BXGB 2ZSKA 4E6PA 1YS1X 1Z62A 4IW3B 3GP8A 1OH8A 3ABZA 3K5PA 5HM6A 4LY0A 1KRHA 2AN3A 1B8OA 2GEBA 4JWTA 3E0QA 3QEMB 3STUA 1PZXA 1QYIA 1PFYA 3R0JA 3EMBA 1E3IA 4BNXA 4DAEA 2PE5A 2JVIA 4GR9A 4HGOA 4DDHA 5KINB 1JZTA 2A78A 2H7YA 3OJ0A 4GOKA 4H77A 4QPNA 4DM7A 2G7MC 2V3CC 1K2VN 3UXMA 2ENUA 2Q2QA 3PLAE 2GCNA 3GLFB 1DINA 3KM0A 3O1LA 2JIZA 2V74B 1J7JA 3VKHA 4LNUA 1J25A 5LZ8A 4W82A 2JHGA 3UOGA 2AJBA 3SZLA 4RCYA 2Z6UA 2ODBA 5ALNA 5GJWC 3IBFA 1G64A 3K72B 3WLHA 3PXUA 2C78A 1A27A 4P4GA 1GUAA 1FDIA 1Y8QB 3H86A 1GRCA 3M83A 1HT3A 3PJGA 3TTUA 3IB3A 3ZDXB 5EIXA 1SUSA 5FXMA 1Z06A 4NOMA 3WTBA 1FZTA 4D3SA 1D6SA 4XQ9A 2QTVA 1NX6A 3K0FB 3NNDA 4CKXA 2Q0SA 1JHQA 1KU6A 3OT5A 2UVPB 3ELDA 1HDOA 1KY3A 2PZ8A 3IR5A 2PBZA 1CJVC 2A0WA 3T94A 1GY8A 1YZFA 3DE4X 4RF3A 2WD8A 3PC3A 5I51A 4EI9A 4P08A 2A3RA 2JCGA 1WCIA 1RJ9A 1W52X 1W34A 3O74A 4HGQA 2J5BA 3GFBA 1H1DA 1NZFA 1E9AA 2FZVA 3KL4A 3OJLA 3RIEA 1Y34E 2DY1A 1Z4OA 1LBSA 2GAFA 1ULUA 4ZT5A 3DE1X 4WA8A 3ZXYA 5A3QA 1SR8A 3QELB 4OBBA 3NG1A 1N8SA 2J09A 4FNAA 2C59A 1YB4A 3ENQA 3LTEA 4RIFA 3SP1A 1A5AB 4EJSB 4HDMA 4RLHA 4W5TA 3AEUB 5DK4A 3L02A 1H94A 2QJTA 4QDOA 2Q5CA 5T8KC 3WNQA 2DKFA 2QTCA 2EDAA 4AKHA 3B1WA 4S0XA 4KQCA 2AK3A 2MWMA 3COSA 3JQEA 3MS4A 3C3KA 5JE8A 3DTVB 2R7MA 3LU1A 4EYSA 5D6OA 2FPPB 5BNWA 2GEKA 3FBGA 4IHQA 1TVKB 5KTMA 4EFNA 2PYIA 2ZR0A 4PPQA 3P2EA 3VU3A 4AJLA 3B20A 3QWFA 3UMVA 1C30A 1TUBB 1NOIA 2WYVA 1P0QA 4MUIA 4J16A 3ZE8A 4TT3A 1C9KA 5CM9C 2OK8A 2XQGA 3DL7A 3B36A 2R87A 2PWZA 1GTJ1 3TRIA 5K0TA 3I6QA 1J56A 4DCPA 5LMUB 5CVVA 5B4TA 3DDOA 2QP4A 4DREA 4GKVA 5DMXA 4HUJA 3AFNA 1CYDA 4YJFB 5DBFA 3WIDA 5DCLA 3P45A 4NEGA 4DNXA 4Q47A 3Q1KA 3Q3GE 4HFMA 4TLMB 1XDGA 3OQOA 1PG2A 3ANSA 3K05A 1TCVA 4JBGA 2DPYA 3A9TA 4TKUB 4IVRA 1ZW1A 1FK8A 1KI1A 3RAFC 2YL2A 4I1PA 1TM2A 4MRMA 3RYTC 1Q20A 3CZCA 3LI2A 3K35A 1N77A 3S27A 3GVXA 5DEIA 3EZ7A 2I8LA 2XEDA 2OQVA 5BSUA 4X97A 4LBWA 1E3TA 4JUFA 4RK4A 1FJ2A 1Z2AA 2Z8YM 2I7XA 5DYNA 3E3OA 3R20A 1REQA 3QIAA 4IM7A 1QGUB 2BHSA 2VT7A 3MJTA 2E4AA 1YJXA 3NDJA 4TWIA 3JWIA 4B44A 1FIUA 1GVNB 2NZXA 3GUYA 1J33A 1QK5A 4Q19A 5DEOA 1W5FA 3ICWA 3EGXB 4HAYA 3CLVA 5B37A 4B6OA 4YV2A 4BLVA 4CXMA 2ZBRA 4DXHA 3R44A 5IJXA 1KYVA 3K1TA 1X2EA 4JYAB 1Z7WA 2B5OA 4KK3A 1VRCA 1ESZA 2UAGA 2YINC 1GSIA 3ICVA 5D00A 1BMTA 1C7QA 1SCNE 4TWBA 1J06A 1H0HA 1YTLA 2B1IA 3F4LA 4WCVA 4B8WA 2J3HA 4JI8B 2FRDA 3LM8A 4EJ6A 1VL2A 1VSUA 3IEPA 1BXRB 1A9ZA 1Y48E 1T5SA 3G8AA 3L0YA 3PYMA 2EVWX 4P3XA 3T6KA 4YK7A 4BX3A 5ESWA 5BWMA 1QH8A 4TMWA 3LX5A 3EVDA 3CWCA 1HURA 2Z5GA 4M49A 4P83A 5AI9A 1DXHA 1KAQA 4EM6A 2HL6A 4M4SA 1IJEA 4MVJD 3S6JA 1RAFA 1TXGA 4XIGS 2GT1A 5KNDD 3QU2A 4PLVA 5CH8A 5M2QA 4MQ5A 2IS4A 3EA5A 2R8RA 5P8WA 3KEOA 4I9GA 3V7WA 4RTMA 3DMDA 2QYOA 4NBTA 4ETIA 1IMOA 3G9TA 2VT6A 4DDWA 3HE3A 3ZQKA 6ADHA 3D3QA 1G2PA 1K5GA 1W2HA 2IYPA 4JBWA 3EC1A 4PIVA 2Z3WA 4G0OA 1C7IA 1YL6A 2Z1MA 3UK0A 3YASA 4BPBA 3FNRA 3KHSA 3VC3A 2FWMX 1R74A 1NWCA 4S12A 3NDRA 3GWZA 5IABA 1ZOLA 2PX8A 1QK3A 5LL6P 3AILA 4ARZA 4C2UA 1ZG3A 1D2EA 4TL7A 1RAEA 1ZY2A 4NU5A 4GAEA 4HDKA 3M2TA 4JLAA 3GLSA 1MX3A 3WA6A 1FVOA 1HE3A 1IC6A 1PS0A 2WKWA 3ACDA 4OTZA 5CJ2A 5BRNA 1D9ZA 2ZPUA 3SR3A 4GD3Q 2FPLA 3FB1A 3HBAA 3LXMA 4FYMA 1ODCA 2K7FA 3VU8A 5CB4F 1Z6GA 3I58A 2OAQ1 3Q7PA 5E1BA 2O2EA 2OCBA 1K6JA 5IWAB 2XYHA 2TSYB 1MDFA 5CVEA 4O4HB 1P44A 5L40A 4DSUA 3ZX5A 2QP9X 2WF7A 3L1VA 2CVHA 1PTKA 4H1HA 4K6KA 1V1MA 5C5IA 5E38A 3IKLA 4KFTA 2BZ1A 1J09A 1CZKA 2DMRA 4GOXA 4BIMA 1KAGA 5AHKA 2EIHA 1YJCA 1JLMA 1T2EA 3I28A 1I6WA 1LS1A 2VDOB 2CCJA 3ONVA 3EOZA 2ZBDA 2D06A 4B80A 4CVNA 1Q1AA 2X7JA 3UAZA 1WSDA 3GA7A 3WK4A 4ER0A 5CX1B 2XVYA 1GUFA 1KNQA 3C97A 4K6CA 1FYWA 4A03A 2IPAB 1QCDA 1J2JA 1ZGCA 1UMKA 2FEXA 1PQ4A 4XGKA 1SJ9A 3RYCB 1JBEA 4I55A 1OILA 1CQJA 1B0UA 1BS2A 1KEUA 2EYQA 3HMKA 3RAJA 3KQNA 3BA1A 1C0LA 4RH3A 4FOTA 5EMHA 2OCIA 3T4XA 2FKNA 4HXGA 1NVWQ 4MR8B 5LA6B 4CIXA 2MIIA 3H19A 1TE2A 5GV7A 4IEFB 4ZT2A 1ZUNB 1IHXA 2OG2A 4OKNA 5AM0A 3AK4A 4QVIA 3H9GA 3SQNA 2JH3A 4G0NA 3B6MA 4MH0R 1QDUA 4R1PA 2BBWA 4U4AA 5AJHA 2RHRA 5DHTA 1BAPA 3ZD6A 1QTNA 3AR5A 4YALA 2QXYA 4ON9A 3P5SA 4XLTA 2BFOA 2C61A 1YQWA 3CUYA 2HBQA 4EWLA 2VHCA 1ZNWA 1HE2A 1OHHA 1W6UA 1E4VA 1YRBA 1ZUD1 2RBEA 1WXWA 3KKZA 2NXCA 2QTHA 3P19A 4N0DA 1UADA 3PQEA 5DI3A 3PL5A 4MB0A 1DJNA 3BL5A 2HMSA 1DWOA 4MINA 3TI9A 3GRKA 3ZHCA 5I9TA 1U28A 4FCVA 3H18A 4X3PA 2I9PA 4TS9A 4O2RA 4X1YB 2MYTA 1DOHA 3CSUA 4OQFA 5AK5A 4CMKA 5E2IA 1YB2A 1PDWA 4H4DA 1R0YA 2HR1A 3IUEA 4JBXA 5EIAA 3WWCA 5TMBA 3I92A 3RS3A 1D9XA 1MXHA 2IKQA 5B2EA 1LI5A 3I23A 3DVAA 4HGPA 1XU9A 2YQ5A 3WSTA 4C76A 4CF4A 5AJZA 3V1UA 5KEIA 5TB5A 3PPXA 3M5DA 1F06A 1KJ8A 1QPGA 4Q37A 1L3IA 1JBQA 2WP0A 2HIMA 2PZBA 1VKJA 2Z2JA 4FMCB 4D9HA 1TK3A 3JQAA 1WZ2A 2BFMA 5CD1A 3JRNA 4TYWA 1JMVA 3DWEX 3NT4A 4D9FA 1KDRA 4IDAA 4BO4A 2CMFA 1NBAA 2JBAA 3OOWA 1P6XA 4ED9A 3MRTA 3LOPA 1H6AA 2A7QA 2NYAA 4DCOA 2C1EA 2FEMA 1X8JA 3DM5A 1L7XA 2JH8A 2GSWA 4MUKA 4NVRA 4WY8A 2V6IA 1XMXA 2NTVA 1S2DA 2DUNA 1E7RA 2AMLA 3SHOA 4B79A 1N32B 1N5IA 4G4SO 4H6WA 3V7UA 4GYWA 2ERXA 3TW0A 2CLFB 3W78A 4X91A 4UNRA 4KGXA 3DF9A 2P0AA 2JVKA 2QN8A 4OLAA 1RS0A 1T4DA 3HO1A 2WUEA 1JYEA 1E6LA 4GWLA 4F8JA 2JG3A 3UCXA 4YAGA 2LDXA 1PNOA 1Y9EA 3I4LA 4GE3A 5DHFA 3CRQA 2DSNA 1KJ9A 1O3YA 4O1IA 2QSUA 3V8BA 4LE1A 1Z0JA 3QK7A 4R5HA 3KV3O 1T3GA 2HIGA 4LY6A 3U9SA 4AUNA 1IM8A 1XCPA 1P1IA 3A1CA 3OJWA 2VP9A 3P9XA 3C24A 3GP5A 4Y2GA