5K0ZA

Cryo-em structure of lactate dehydrogenase (ldh) in inhibitor-bound state
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
331
structure length
317
Chain Sequence
ATLKEKLITPVTVPSNKITVVGVGQVGMACAISILGKGLCDELALVDVLEDKLKGEMMDLQHGSLFLQTHKIVADKDYAVTANSKIVVVTAGVLVQRNVNVFKFIIPQIVKYSPNCTILVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDTARFRYLMAERLGIHPTSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPAMGTDKDSENWKEVHKQVVESAYEVIRLKGYTNWAIGLSVAELCETMLKNLYRVHSVSTLVKGTYGIENDVFLSLPCVLSASGLTSVINQKLKDDEVAQLKKSADTLWSIQKDLKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Breaking Cryo-EM Resolution Barriers to Facilitate Drug Discovery.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase B chain
total genus 88
structure length 317
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5k0zA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 5k0zA02
2B5WA 2NQTA 1V3UA 2GPTA 1X0XA 5JBIA 1ZSVA 3PTZA 3QIVA 4IMRA 4XYGA 4MKZA 1H6AA 1BW9A 1C0PA 4TKMA 5T64A 4YT5A 1DRVA 4FD3A 4KMSA 1DHRA 1RKXA 2PH3A 4A2CA 3RD5A 1V0JA 3CSDA 1AHHA 1YVEI 4CMGA 1NWCA 1MG0A 4DRYA 4EEZA 1JAYA 1KBZA 1LQUA 3I5MA 1QRRA 3K2BA 1NAIA 1FDWA 3PZRA 3RC2A 4GGPA 3BZUA 2IZ1A 4R1SA 2JHFA 3JQBC 3Q9UA 2D0IA 3TDKA 4E3ZA 4B7CA 1IL0A 3GG2A 1ADBA 3HB4X 2CNBA 2WD7B 3JQ8A 4NBUA 4HFNA 3JQDA 5I9MA 1Y8QA 3QV1A 1H9AA 5CG1A 2C59A 2PY6A 3OIDA 1T1SA 4CQMA 4J9VA 3JQGA 3DZKA 3RCBA 4BNYA 2JHGA 4QFDA 5HWSA 4DPMA 1YE3A 1YQDA 1VRWA 3KLPX 3DHEA 4J2HA 3B1FA 4DPLA 2X9GA 1EE2A 2LDXA 4MVJP 4TRRA 1UAYA 2UDPA 3I6IA 1PZGA 4PCVA 3BTUA 4DLLA 4YPOA 1QLHA 8ADHA 3VZSA 3KBOA 3WGYA 3UAGA 1EDOA 1R0LA 3FTPA 3L9WA 4CMIB 4WLOA 3WGGA 3DAPA 3EZYA 1HZJA 1NFFA 1ZW1A 2QRKA 3AOEC 1CWUA 2Q99A 3BMNA 3O38A 2DPHA 5G2OA 2ZB4A 4K1LA 3DOOA 2WMDA 3ZHBA 1UDCA 4JBHA 2X58A 3QP9A 4WCDA 3FWZA 2VUSA 5G0UA 2YFQA 5CHEA 3I1JA 2J3KA 2WTBA 2WD8A 1RM5A 1QV7A 3BMCB 4CV2A 4YXFA 5K9ZA 3ZN2A 4MVJG 5CDYA 3FWNA 3HN2A 2IYPA 2CDBA 5I8WA 1NFRA 2CVQA 3HB5X 3P2OA 1TVEA 4ZRNA 3OEWA 3C3XA 1YGYA 3BMQA 2VUTA 1U8FO 4CM8B 3DQPA 2ZB8A 2QW8A 2Y68A 4B7UA 1B16A 3V5NA 1G0NA 1N9GB 2GZ2A 1QYDA 4YAEA 3G17A 1Z73A 1IZ9A 3RROA 3B20A 2DC1A 2J5RA 3P5SA 4E5KA 4R5MA 4WCFC 2AA3A 2C2XA 1R4MA 3GLQA 4EZBA 3MJCA 1VJ1A 3E6AA 4LMPA 3PK0A 3FSRA 3UVEA 2Q50A 3FF4A 3U4CA 1YH3A 4KWIA 5JE8A 1N92A 1I3NA 3DZJA 3EUWA 3ROMA 2ZYGA 4J4BA 1KEVA 1MUUA 2D3TA 2X6TA 3UUWA 3JYPA 1TB4A 4XIYA 3PRJA 5LCXA 1K6IA 2PFGA 4N5MA 1NVTA 4XRRA 4JX8A 2AQHA 3D3WA 3KLMX 3OJEA 3BMOA 1FK8A 3E03A 3OICA 2OMEA 3V2HA 3IAHA 1YB1A 3PIDA 3ZNQA 3PFWO 4FW8A 1U5CA 2Y93A 1E5QA 2FZWA 4BNNA 3F1LA 1IUKA 1E3JA 1UH5A 4EITA 2Q1TA 1E3WB 1WW8A 3WSVA 2DBZA 4B4OA 3IQDB 1ZK0A 1EDZA 2EKQA 4XQEA 4XYMA 4TVBA 4UEKA 1OBFO 3KEOA 2YY7A 1SEVA 2ZIZA 3DDNA 5IFLA 1AXEA 4B8WA 1DIBA 2C07A 5TF4A 3TOZA 1R6DA 3G79A 1I3KA 4ZQEA 1LBEA 3LC1O 1A5ZA 2Y1OA 3OSUA 3ZWBA 2H9IA 2IODA 4QEDA 4OSPA 3NGLA 1NPTO 4RDIA 5FI5A 4Q3DA 3SEFA 4P4LA 4IBOA 2E82A 2EG9A 1O0SA 3IKTA 1EFKA 1EK6A 4BO4A 2OL4A 1IULA 3OIFA 4CMEC 3QVXA 2C7GA 4TQGA 3A9WA 4LN1A 1J0XO 3BHJA 4RGBA 5IF3A 3E9QA 1CETA 4GMFA 1CQJA 1VE9A 3ETEA 3OM9A 4R41A 4WCFB 4LCEA 4EYEA 4D43A 2O3TA 2UYYA 3E9MA 1EVIA 5FWNA 3FPCA 2BFOA 4BNWA 2WE8A 2I66A 3H7AA 3ROKA 1G0OA 2Q1UA 3LT0A 1SAYA 4HFJA 4OAQA 2QIOA 1IYZA 1QSGA 1TXGA 3KUXA 2I65A 4AJJA 2VCYA 3HADA 4YJGA 4FFLA 4IZIA 2Z1NA 4M8SA 2VTDA 4KUGA 2P2SA 4PG6A 1E3LA 3QWAA 1ONPA 2OHXA 3GDOA 4WEOA 1FJHA 4ZU3A 3RBZA 1MG5A 1UXIA 1BDMA 4GX5A 5BQFA 3I9NA 3QRWA 2JAHA 4Q3EA 2NU9A 1NQAO 5IZ4A 3F46A 1F0YA 4KOAA 1ZXLA 5BSEA 2QQ5A 4A27A 4O63O 4GGOA 4NJMB 1C3VA 1PJSA 3I23A 1RPNA 4L0QA 4OOFA 1XU7A 3TWOA 2NVUB 3QW2A 1WWKA 5TIIA 4DREA 5EN4A 3U4IA 5KJ6A 4FR5A 1VL0A 3ZGYA 2Z1MA 3R1IA 3WTBA 4LVCA 4RLSA 3D3EA 4PIVA 5JYDA 1CYDA 3ZV3A 3QA9A 1SB8A 4K28A 2YQ4A 1MX3A 2I3GA 3WMWA 1HLDA 2P5UA 4WE3A 1GU7A 3OEYA 4J43A 4RVHA 1PQUA 3JYNA 4RPJA 4D41A 4BNJA 4RVSA 1P9LA 2VTEA 3ENNA 2PR2A 3JQ9C 4G81A 4YT2A 3GPDG 4I5DA 4NHEA 5F1KA 2G76A 3HG7A 3OHSX 4TVOA 3MZ0A 1B26A 4ZGWA 1Z75A 1J4AA 1O94A 4G65A 3D4OA 3EDMA 4CM9D 4D46A 4M86A 5JFOA 1I36A 1X7DA 2QX7A 2BF7A 1HDCA 4B8ZA 3FD8A 3JYLA 2GSDA 2UVDA 2PLAA 3LZ6A 3ONFA 4W9NA 4YRDA 5AVOA 2V6MA 1D1TA 3GMSA 4QTZA 4ZQFA 3ZCXA 2QHXA 3AUTA 3ORFA 2EP7A 3WR5A 5A9SB 3Q1LA 3GEDA 4YRBA 1SEPA 3E5RA 3M1LA 4YACA 3JD0A 2AEJA 1HDZA 5HM8A 1HXHA 4OXKA 5KIAA 2JKVA 3TSCA 5F3RA 3RI3A 2V6BA 5FF9A 1NAHA 2NV6A 4ALLA 3RWBA 3OQ6A 3AY6A 1PSDA 2VYND 4NBWA 2VWHA 3FI9A 4JQCA 3S2GA 1D4FA 3CZRA 4JBGA 5MDHA 1I01A 4B4WA 5L95A 3GF4A 3WXBA 3DAFA 4ND3A 3STHA 5TC4A 3VPXA 1QKIA 4MVJH 3KRTA 2EW2A 1GYQA 1WVGA 2ZJ1A 4YT4A 1BGVA 3OJOA 3FNGA 3B6ZA 1JWAB 3Q11A 2QG4A 1B3RA 3CE6A 5B4UA 1U4SA 4TRJA 4E31A 3PWKA 1PJTA 3GN2A 5DNAA 3ZHZA 1R66A 3JSAA 1ARZA 3L9XA 2NNLD 1PGQA 4IUYA 1HDOA 1FMCA 4QSMA 2YV1A 3PHGA 1EVYA 1E1NA 1HLPA 1KEUA 3LYLA 3FHLA 3D5TA 3PHLA 4M87A 2ZTLA 3WGZA 3WWZA 4YJGB 1ISGA 2NVWA 1DRUA 1V9LA 3K92A 2JD0A 1KOLA 1HYHA 1N7HA 1PS0A 3D0OA 3ADPA 4M89A 3GQVA 4X54A 3K30A 2C5EA 1P33A 3O26A 3X2EA 2J3JA 1KS9A 2ZTMA 4HFRA 3UICA 3ULKA 4IJUA 5I9NA 2W2KA 1LLQA 1SPXA 2BHLA 4LK3A 2RH8A 1HL3A 2EKPA 4FJ1A 3H65A 4Z0HO 1K3TA 1K0UA 4J1QA 1JWBB 1H6CA 4TMFA 5C5IA 4MP6A 1LRLA 4J0EA 1ZCJA 2V7PA 1E3WA 3BMNB 3WFIA 1Q7CA 2ZB3A 1Q7BA 5CPBA 1B0AA 2X8LA 3CIFA 1VL6A 4BHTA 3UCXA 3JQBA 4R1UA 5G4LA 1LDBA 1RYDA 1R0SA 2OBNA 4PLFA 4IDFA 1WZIA 2F00A 5DULA 1JKJA 3L6DA 2EGHA 4U0KA 1NWHA 2JFFA 2FZEA 1WMBA 1MLDA 1UP4A 1KC3A 1ZK3A 3CUKA 2G0TA 3GUYA 4ITUA 2GLXA 1PJQA 2OBYA 3ROPA 1P0CA 4W7IA 4DIOA 1M75A 5IZCC 4BO0A 3JQAD 4IY1A 1HWYA 4OJNA 3KTDA 1A72A 2O3QA 4WGGA 1XQ1A 4GX2A 1DB3A 3AOGA 5BNIA 4CV1A 4R68A 2Y1FA 4GSKA 5U1PA 5ILGA 2Q2VA 2O2YA 2D8AA 4CM7A 1NQOA 1C0IA 4NPCA 2FWMX 3GMDA 4OKNA 1DLIA 4MJLA 2VRCD 5IXYA 4BGUA 4EBFA 4IDCA 5L9AA 1GZ3A 2FHSA 2VRBA 3NAQA 3UOGA 3PGJA 4E0BA 4L4SA 2XPCA 9LDTA 2Y0DA 4BO7A 3T4XA 4XYEA 4RF2A 2PKQO 3MTGA 4RORA 3V1TC 3G49A 2H6EA 4NU6A 4A0SA 1HE3A 1P1IA 2BI8A 3GAFA 5JS6A 3M6IA 3I83A 3DOJA 1XA0A 4PZEA 3I3OA 3RKRA 3RU7A 4PG8A 1C1DB 3BYZA 5CDGA 1IOLA 1YL5A 3RUIA 4JGBA 4XYLA 4F6LA 1DRWA 4BNGA 4GBJA 4PG5A 4L75A 5T57A 5JSFA 4E2YA 4CM9A 3R0IA 1W0CA 3BHIA 4WOKA 5JDCA 2TMGA 4CUZA 3K5PA 2IXAA 4J1TA 2HO5A 2CZCA 3PLNA 1ZFNA 4BS9A 3GGGA 1NX6A 1K6XA 3U4DA 1EBFA 5JDIA 2WEKA 3WWYA 3ZU4A 2Y1DA 4H15A 3H5AA 2C5AA 4CLOA 4GLLA 1UZLA 5G4KB 2GYYA 2ZATA 3ON5A 4R9SA 3ZV5A 5F21A 5EJ2A 2GR9A 4EUEA 4BL5A 3E9NA 3PHIA 4PN3A 1L1FA 4YAGA 1H9BA 4ALNA 4PZCA 3L77A 1PX0A 4N5LA 2UUOA 3IIEA 3ZNPA 2EKLA 4G2NA 2HKIA 3ITDA 4HADA 1CDOA 4NJMA 3LLVA 3ZWYA 2O3JA 5A5EA 4H3VA 3GVPA 4E13A 1QYXA 1PS8A 1RJWA 2OFPA 4F46A 5KOIA 1PQPA 2FSSA 2E48A 3QQPA 5K6AC 3RUHA 1ISHA 1Q2XA 4EJ0A 2GRAA 4CUJA 4I08A 5ER9A 3WGTA 4QECA 3U49A 3WQRA 5ICSA 4IQGA 3PYLA 1JDJA 1T2CA 1TLTA 4KUEA 4TRNA 1I33A 1X14A 3NDRA 4ND4A 5DCYA 2NM0A 4CM8A 4Z9XA 3S55A 2WM3A 3G1UA 1UXGA 3DOCA 4XA8A 1VM6A 1QP8A 1NQTA 3DXFA 1R4NA 3H9UA 4J7XA 3PFFA 3RBXA 4BNVA 4CL3A 3D64A 4XJTA 4BO9A 4BMSA 1DXYA 3PQFA 1ISFA 5CAEA 1N2SA 3VZQA 3SC6A 2BFAA 2NLOA 5ITWA 2NADA 2GN4A 1VLLA 2ZQYA 3M2TA 4YB8A 3TQHA 3AM3A 3GZNA 4DIFA 2DUWA 3GFGA 1H5QA 4J3FA 3VDQA 3NDIA 3M2PA 5JNLA 2FPGA 2I5PO 5F5NA 3JD4A 2ZTUA 1N7GA 4FBGA 1B15A 4O59O 4FPXA 3K31A 4FGWA 4EW6A 1U3UA 3WX0A 1RWBA 5IN4A 2ET6A 3AI1A 4AJLA 3CXRA 3NJ8A 4NFYA 3ZWMA 1KC1A 4RVGA 5L7TA 3IS3A 1B7GO 2WE7A 4OGWA 3X2FA 3WGHA 4JXKA 3W8FA 1IHYA 3N7UA 5DBGA 4A5OA 1KY4A 1LRKA 2HMTA 1FDVA 3BMCA 3KB6A 2J8ZA 4YJHB 4ID9A 2NACA 1EUZA 1YWGO 4NJOA 5AXCA 5FFFA 4CL8A 1E7WA 3ZU3A 3CPSA 4MVJF 3UKOA 2YV3A 3KYDB 4RF4A 4XGIA 3GNTA 4PLCA 1PGPA 5EMHA 1MC4A 2YDXA 1E3SA 3C7DB 1NM5A 2NU7A 5BSFA 5L51A 4MO2A 1Y7TA 2B4TO 3N74A 5JCXA 4XX0A 5BNFA 1IZ0A 4BO8A 2W2LD 1XWFA 4PLWA 1NPDA 2B4QA 4CM4A 2NUAA 3RJ5A 1NASA 3ZWAA 4QO8A 1X13A 5DCWA 5GZ1A 2Y1CA 3ETGA 3DZBA 3LQFA 5B1YA 3HSKA 3F1KA 4R1NA 2VZ8A 1O95A 1GV1A 3RUCA 3MWEB 1UR5A 1JQBA 2HJRA 3DBLA 3R6DA 1XELA 4E4YA 1VSUA 3WBBA 1CF2O 1GZ6A 1X1TA 2HSDA 4NBRA 1FDUA 2QRJA 2GN9A 4CM1A 4BNZA 4OOEA 4A73A 3G1TA 1PJLA 4FFOA 1HSZA 3VTFA 1XYGA 4PLTA 3P19A 3S2EA 4ZHSA 5JMWA 5CFZA 3GVXA 3W4JA 4Q9NA 2DBRA 1BHSA 1DO8A 3OJFA 5DZSA 1T4BA 3W6UA 3RUAA 1KVUA 1I5RA 4AJNA 2AQIA 4GX0A 3ZV4A 1JVSA 3ONEA 3L4BC 4O0LA 4BNHA 3UCEA 2IZ0A 4QXMA 2XOXA 4E5YA 2BFMA 2DM6A 2GD1O 1QXSA 2VUUA 1YBVA 3WQQA 2W98A 1M6HA 1X1EA 4IMPA 4FJ0A 2E4AA 5IDQA 5TT0A 4WLNA 3EVNA 3SJUA 1UDAA 1GZ4A 3SLKA 2GNAA 2I76A 1XQ6A 2OO5A 1GUZA 1K6JA 4Q3BA 1KY5A 1PL6A 1LDEA 4XEHA 4AJ1A 3IJPA 4MVJA 1DSSG 1BVRA 4XR9A 1EEHA 1EK5A 3E8XA 2VZ9A 2TMDA 4XZ3A 5TS3A 3TL3A 3H5RA 4IDGA 2B69A 1FDSA 1XIVA 3RU9A 2EV9A 4ZN6A 3BMOB 2FN7A 4AJOA 2PKRA 5JAMA 3NUGA 3LF2A 4LW8A 5LDHA 1C1XB 1H6BA 1T2FA 4RDHA 1LXCA 1V8BA 1DFHA 3S1LA 3EW7A 3U09A 2BKAA 3QHAA 2BGMA 1HRDA 1ADCA 4L4XA 5TNXA 2O4UX 3D7LA 1DIAA 1GPJA 1NHGA 5B4TA 5IN5A 1PZHA 2I67A 3IJRA 1F17A 2GCGA 5CEFA 4ZVVA 2VYVA 2FMUA 3RAJA 1X15A 4KDFA 1DPGA 1G6KA 2Y05A 4JN6B 1R4MB 3TF5A 2HRBA 1KVTA 1Q0QA 1HF3A 4DUPA 4EEXA 1K89A 4R3NA 3VPFA 5L40A 2VN8A 3F9IA 5KJ1A 1GV0A 1MGOA 1YKFA 5TJHA 1GQQA 4Z0TA 4EUHA 1BXGB 4NIMA 3JQFC 2BFPA 2VHYA 3AM5A 4DQUA 2IZZA 3VHRA 3ICCA 1LSJA 1LU9A 4FIZA 2QZZA 3ZWPA 5IDWA 2OXIA 4FFRA 4MVJE 1T2DA 1LDYA 5CG2A 1NP3A 3IP3A 2AW5A 4J2OA 3RKUA 5JLAA 1QYVA 4JNKA 4LMRA 1E7RA 4ND2A 3SX2A 1YONA 3TZCA 4AJPA 1E1MA 4DVJA 1GADO 3A28A 4C7JA 5ITVA 1I10A 1RYEA 1PGJA 1P74A 1R37A 3WG9A 4E5MA 1XDWA 4FSHA 3ONDA 3VPGA 5A04A 5CDTA 3KHUA 1CIVA 1KVRA 4PZDA 4CMJA 2HK8A 4IQ0A 3PIIA 3HHPA 4O6VA 1ZUD1 5TX7A 4CLRB 1M66A 2JFHA 4RF3A 2HCTA 4MIYA 2X0RA 2CDAA 1LSUA 3OH8A 1FXSA 1WAMA 3OMLA 3KYCA 2ZCUA 2QRLA 2R6JA 3BTVA 2P91A 4UEJA 2CFCA 1HKUA 5G0SA 2X0JA 5DOZA 5I9LA 5EQDA 2POQX 3WMXA 3WSWA 4UREA 1UXKA 1HE5A 3ZI0A 4YR9A 4CPDA 4NNJA 2ZJ0A 1M2WA 3AW9A 3JQGB 3DFUA 1IY8A 1KETA 5KJEA 1P77A 2DLDA 3DZHA 4CR6A 1ZIDA 2B83A 5F5LA 3WFJA 3KYCB 3LF1A 3VKVA 4E21A 4YEDA 2C29D 4Q3AA 5FYDA 4CV0A 4XKJA 4TSKA 1ZKMA 3EHEA 2WD7A 3JQ8B 3ROQA 3SC4A 1IB6A 3GUCA 4WLVA 1TI7A 2O48X 3AU9A 3EMKA 4TWRA 5G0WA 5JDCC 1EVJA 2DT5A 4BO2A 4OH1A 4MIOA 4J6FA 1LX6A 3D3WB 5HS6A 4EDFA 2AMFA 2XXJA 4HXYA 1W6UA 3AUAA 5AQ1A 3WNQA 1Z6ZA 5ENVA 4BO5A 4E2WA 1DHTA 3WQSB 2LDBA 1XHLA 2VWGA 3AOEA 3DWFA 1E6UA 3S2FA 3JQCA 1JAXA 1BSVA 1J6UA 1UP6A 4GKVA 5TRTA 2RAFA 4OO3A 4CR7A 2GN8A 1XKQA 5DP2A 2CVZA 3QWHA 4YCAA 4RVDA 2IXBA 4XR4A 1N8KA 3GDGA 3E18A 2F1KA 1OMOA 3ZW9A 7ADHA 3GC6A 1MFZA 2ZQZA 2JD2A 2CUKA 4WJZA 4DBVO 4IDAA 5KWEA 1K2WA 3DB2A 5I7VA 3RC1A 3NKLA 1T25A 1E7MA 3FR7A 1I2BA 4R1TA 2V65A 4N7RA 2DPGA 4HNHA 3A4VA 2P4HX 2B37A 4JBIA 3QJ5A 3Q0EA 3NDJA 4GVXA 4U7WA 1CQIA 1HTBA 3IMFA 3JQ7B 2P68A 2A4KA 2C0CA 1J49A 3VAZA 2BD0A 1N1GA 1JVBA 3TZHA 5A06A 2O3UA 4Z9FA 2FPPA 5B37A 3WGIA 2X1HA 2Q2QA 2ZB7A 3H6KA 4GWGA 1WDMA 1U1IA 3FR8A 4NFSA 2AE2A 3ADOA 1H2HA 3UGKA 1TT7A 1PS9A 5JAZA 2UUPA 3WIEA 3TZ6A 3KETA 1FF9A 2Z5LA 3MJSA 2YJZA 1OZAA 1ZK4A 1PGNA 1ZJZA 1UAGA 1WZEA 3L6OO 3EC7A 1MXFA 2GN6A 1DAPA 4UULA 2PZKA 5A1TA 2D2IA 3HDHA 3WGOA 1LLCA 1R15A 3LT1A 4AJHA 4IGEA 5T67A 3GVCA 1T1RA 3MJTA 4OHUA 3TRIA 1IHXA 1DEHA 3ASUA 4JIGA 3U0BA 4ALMA 4DTIA 3NT5A 4RVFA 2HUNA 2CSUA 2BELA 5JCJA 3A06A 1V3VA 4N5NA 2IEBA 3PPIA 1F14A 4PFJA 1ENPA 1S6YA 1H2BA 1JA9A 1LLDA 2W8ZA 4BO6A 2BH9A 4DC0A 1YB5A 3PYMA 3GY0A 3ZHYA 1LQTA 3PHJA 3GZNB 3GRKA 1XG5A 1L7DA 4DC1A 3GHYA 1GUYA 2WYUA 4J90A 2PZJA 4LCJA 3N58A 4FQ8A 1RM4A 3JQFA 3MCVA 3ZHXA 1P1KA 2NVBA 3E1KA 5T8KC 3GA0A 4AJKA 1AN9A 4B4UA 4IJVA 1MC5A 1ZSNA 1GTMA 1Q0HA 4QT0A 1M67A 5C3MA 4JJGA 4WLEA 1PZFA 4P4GA 3ETDA 4R01A 5CEJA 5COAA 1BDBA 1ZJYA 4CQLB 3DBRA 4HY3A 4ZA2A 1PGOA 3D5QA 4Y9DA 3FPLA 5T8KA 1N9GA 1U8XX 3IL2A 3SVTA 4RO0A 1KIFA 4RPLA 2DAPA 4FOOA 3DZFA 1EUCA 3IDSA 3AFNA 5JO9A 4DA9A 3GK3A 1GD1O 1U5AA 4A26A 3GPIA 4B79A 4CM5A 1NR7A 2P9CA 4DLBA 2DUUA 4J0FA 3WTCA 4Z3KA 1QLJA 2Q3EA 3BA1A 3BHMA 1U2DA 4PLPA 5A3JA 5ICMA 2VQ3A 2DVMA 4N54A 2Y67A 3QVSA 3VC7A 2FOIA 3HDQA 4YJHA 4IZHA 5EINA 1HDRA 3ABIA 1YB4A 4D3FA 4H16A 1A71A 1ZO8A 4D3DA 3F47A 5MGBA 2D5AA 3H8VA 3OETA 2GZ3A 1LLUA 1Y5RA 3O8QA 1YDEA 2PA3A 1W8DA 2VZ0A 3TFOA 3EGOA 1UUFA 1MV8A 2D4AA 4I9UA 3WLFA 2E49A 4MKXA 2C82A 1PZEA 4CMIA 4UVGA 1P0FA 3VKUA 3E48A 3HFSA 3CZMA 1ULUA 2X23A 4PGFA 4ZD6A 3C24A 2VT3A 1SNYA 3ZDFA 2FR0A 2IEDA 1YOVB 4D45A 1LRJA 3QSGA 2YW9A 4CMBA 4BMNA 2WJPA 4NQZA 3JQEA 5JO0A 2EW8A 3ZWXA 3FNHA 4BKPA 1T2EA 3OQ1A 1U3TA 1WDLA 3W8EA 1R12A 1I8TA 1NNUA 3KVOA 4JK3A 4XIJA 5DT9A 5JMPA 1PR3A 1P44A 1P1HA 1F06A 4RF5A 3GGOA 4AJ2A 1I30A 1PR9A 1IPFA 4J4HA 2RBEA 5DN9A 1GAEO 2AXQA 1XSEA 7MDHA 1GCUA 2A92A 3MJEA 4G5HA 2O2SA 1L7EA 2VNAA 4JJFA 4MVJM 5ADHA 3F4LA 4U5QA 5L45A 1Z7BA 5TLSA 3HUDA 3LVFO 5DP1A 3WIDA 3B1KA 3QVTA 3NRCA 1TT5A 1QYWA 1VPDA 2EHDA 2UV8A 4A7PA 2VOEA 1C1DA 1SB9A 1X7GA 3W4IA 3C1OA 4A10A 4DGSA 4E5PA 2VYVD 4CMCA 4BQRA 4U6QA 3KSDO 4GMGA 5T5QA 5B4VA 2NSDA 3ZWVA 4OKIA 1BW9B 4DPKA 2Y66A 5BSHA 4YDRA 1LSSA 2EIHA 2J6IA 4LVUA 4W99A 2B0JA 2DTDA 1Y1PA 3TNLA 1VJ0A 4NK4A 2RH4A 4KP7A 2FR1A 4AG3A 1PIWA 2D1YA 2DFVA 3VOSA 4XB1A 4AICA 1NHWA 4I5GA 4II2A 4CM6A 4XRGA 3JV7A 2A9FA 4E2XA 4OQYA 3PP8A 1P31A 1MFPA 2Q4BA 4J7CA 4Z6KA 3LC2O 5BR7A 4YJDA 5A5FA 2GDZA 4UUMA 4HUJA 3KYDA 2BRUA 2PWZA 1NFQA 1E7SA 3GGPA 3DONA 5I8ZA 3GAZA 1NVMB 5IAAA 2PV7A 3UCFA 2PGLA 3AFMA 3CMMA 4BB6A 4Z0PA 3RIHA 2I6TA 4WASA 3IKVA 2Q45A 5DCUA 5JYEA 4BGIA 1ZK1A 3K9QO 3Q2KA 3ZWWA 5KKAA 3M1AA 3RQSA 2RHRA 2OP0A 3ZNNA 1A27A 1NPYA 3PQDA 4ILKA 3GR6A 3NTQA 2HLPA 3ZH2A 4CLOB 3H9EO 3WNVA 1ZMTA 4YAJA 5L4SA 4CMKA 1F8FA 2P9EA 2EF1A 1B2LA 3ITKA 4RZHA 3OIGA 5L3ZA 5C7OO 4PLVA 1GCOA 1VKNA 2VWPA 3GEGA 3P7MA 2C20A 2OUIA 3OBBA 2O3RA 1N1EA 4OM8A 2C2YA 3JTMA 1HEUA 5JAIA 2FP4A 5I7SA 4I8XA 4OYRA 4CMAA 2FRDA 2J3IA 4J1NA 1E7YA 4D3SA 1EZ4A 1M6WA 1D3AA 5L7WA 4EJ6A 1VKOA 4M55A 3K73O 4WLFA 5A9TA 4Y6SA 1YBAA 4ND1A 1X0VA 4HBGA 4Y6RA 1LNQA 3GFBA 1Q7GA 1ISIA 5ES3A 1A7KA 2Y0EA 4MKRA 1H94A 5CEEA 5EL0A 1ZZEA 1HE4A 4OQZA 5IXSA 2BMAA 5F1OA 3CINA 2X5JO 3LK7A 1PWZA 5A4DA 1OFGA 1ENOA 4WNCA 2AG5A 2VT2A 3DR3A 4DLAA 3C1AA 4U6SA 1JKIA 3C7CB 4WECA 4EGFA 5ILOA 4MP8A 4NI5A 3R3SA 2RIRA 1ZNQO 2DU8A 2CMDA 3LC7O 3B70A 2O3SA 4BB5A 1PL7A 1EUDA 2OP1A 1A7AA 5C7LO 3WLEA 4TKLA 1LUAA 1ISJA 4Z3DA 2I3AA 4ZQGA 3FBGA 3W6ZA 2V6FA 2PZLA 4E33A 1ONOA 4ZJUA 3H4VA 4FC7A 4J49A 5JY6A 1CRWG 4J16A 3LU1A 3HWRA 1MB4A 4TRMA 2H5LA 3O9ZA 2J5KA 3ZW8A 5L4LA 2B36A 3F5QA 3AY7A 4CUKA 1I2CA 4BNLA 1E1KA 1E5LA 5H83A 3WDSA 1P45A 4XDZA 3UN1A 1OC2A 2YHIB 3G0OA 3NX4A 3HDJA 4HKTA 5GZ6A 4PLGA 3I9KA 4RPHA 2PZMA 1GY8A 4F3YA 2X7HA 3DMYA 3H9QA 4QX6A 4WEQA 2W4QA 4CM3A 2JL1A 3QWIA 2PD6A 2R00A 3ZNOA 2Q49A 1E3EA 2JCYA 3GHHA 1W4ZA 4UUPA 4XB2A 3FCOA 1V6AA 1QG6A 5U9CA 3O4RA 3CTMA 3FN4A 3AM4A 4PRLA 4BO1A 1UZNA 3C85A 3WOHA 4BNFA 1ZEJA 2JCVA 1EQ2A 4R5HA 1T2AA 4BKQA 4E30A 1YJ8A 2R00C 3L0DA 4ALJA 4WKGA 4DYDA 2B5VA 5KJFA 3DFZA 1QV6A 1LDNA 2Z95A 1P1JA 2I99A 3K8ZA 5JCJD 4NBTA 1LDMA 1V3TA 4NMHA 2RHCA 1VC2A 2HMVA 4PG4A 3H5NA 3IC5A 3D1LA 1SC6A 3HQ4O 1I0ZA 4XQ9A 1I24A 2HQ1A 3I9JA 4YAIA 1SO8A 4D42A 4Y98A 1PJ3A 3FNFA 3H2SA 4J7UA 1VI2A 1DC4A 2VHVA 3PXXA 4BNXA 2X22A 4RQTA 1E6EA 4R69A 4AFNA 4D0RA 4CJXA 3AU8A 3H3JA 4WUVA 2BGKA 4RQUA 3I9MA 4OMUA 3OA2A 1E0DA 4GVLA 2OOSA 4GPD1 2X9NA 3DHNA 1UP7A 3DMTA 1E3IA 2WWRA 4P22A 1HYGA 2YZ7A 2ZK7A 3DZGA 4I1IA 4S3MA 4IS3A 1B8UA 1LSOA 1YO6A 1GEGA 3LT2A 3PQEA 4H7PA 4L9RA 1C1XA 2CVOA 3TL2A 1DFIA 1UXHA 3SJ7A 3IUSA 4BOYA 4FS3A 2FY8A 5DBFA 1PJ2A 4UVHA 3JYQA 2IE0A 1C0LA 1RM3A 3WJ7A 3RUDA 3DMTC 5EQFA 3ZZNA 1WLYA 2FSVA 2X9VA 3LSYA 4AL4A 1HT0A 1TEHA 3BAZA 3PVZA 4WNIA 5JC8A 1ZXBA 3GEMA 4KTVE 2X0NA 4YAKA 3FTNA 2JJYA 3EY4A 2ZKLA 1XCBA 2VNSA 3AI3A 5G4KA 1SOWA 1AE1A 1ZMOA 4JP2A 3WB9A 1E92A 4Q3CA 3NGXA 2GUGA 2QYSA 1KVSA 3W4KA 4KQWA 5AXDA 5DBIA 4GQAA 5TT1A 5BNTA 4GLOA 1CERA 1YQGA 4AJ4A 1WPQA 4B7XA 4ALIA 2Y99A 4CODB 3F4BA 4LRTB 4ROSA 2PGDA 1GR0A 4BNKA 1I32A 4FCCA 1JKFA 2NTJA 3OA0A 4BNIA 1YS4A 4Y6PA 3K96A 1Y8RA 3JQAA 3RVDA 2W90A 2WYWA 4PLHA 4P8RA 3OECA 4IDBA 1F12A 2YHIA 4W82A 5JW6A 4KZPA 5U4QA 5AXBA 5TJ9A 4U0JA 3TZQA 2Q2WA 3O03A 2ZTVA 1WDKA 1O6ZA 1WNTA 3RJ9A 4YWJA 1A9YA 4JLWA 3VH3A 3ANMA 3F6YA 1H93A 2AEMA 3L4BA 5KJCA 2ZCVA 1ISMA 1U7HA 4U8GA 4YQYA 5AXAA 3K2EA 4OIMA 3HJAA 3U4HA 4RZIA 3VH4A 2NU8A 2YFHA 1A4UA 4MDHA 2X86A 5G0TA 3CEAA 1BXKA 4FJ2A 3WYCA 3AWDA 4D7AA 3WICA 4GI2A 5CDUA 1ADGA 3KZVA 4E12A 3PEFA 5KVQA 1MA0A 2W2LA 4OSOA 4XGNA 4XGKA 5A9SA 1OI7A 4IDEA 5HS4A 2X4GA 4WCFA 3QLJA 4D44A 2H63A 5EERA 3RASA 3VVBA 1XU9A 2YDYA 4MIEA 4WOJA 3INRA 2HDHA 4ND5A 3T4EA 3FNEA 1B3BA 2HRZA 2BGLA 1D8AA 4BVAA 4CLXA 1P1RA 3NV9A 3OJ0A 2OGUA 4CQMD 1Y9EA 5A03A 1ADFA 4IS2A 3GNSA 3HFGA 4UAGA 2O7QA 4UEOA 1HZZA 3PWZA 2YHUA 5COBA 3C7AA 1Q0LA 3HE3A 3UHAA 3KO8A 1I3MA 1MXHA 1ULSA 3HDYA 2AEFA 4ZQBA 3EAGA 1RM0A 3JQ9A 4BGVA 4BNUA 2IDZA 3OJLA 3HNPA 3JCZA 3UW3A 4URFA 1ORRA 3K6JA 3W8DA 3G3EA 3IP1A 2BI7A 2HJSA 3PWSA 2DKNA 1U4OA 4I5FA 4IXTA 1TT5B 1LJ8A 2EGGA 2EXXA 3NT4A 4J9UE 4FB5A 1EVZA 1KERA 1U2GA 5CP8A 4L74A 3QY9A 3RUFA 4II3A 4IJWA 3AK4A 2IYOA 2CF5A 5TQVA 2SCUA 4E5NA 5JPIA 3PDJA 4KUHA 2CDCA 2C54A 1BG6A 1ML3A 5FEUA 1NR1A 1UZMA 1M76A 2HU2A 2OZPA 3V1UA 4IQ8A 1B8VA 3GZ4A 3OFSA 3Q2IA 3V8BA 3DBLB 1C14A 4CV3A 3UH1A 4LSMA 2JCXA 4XJSA 5IDYA 2NVUA 3VZRA 4D79A 1Y6JA 1CEQA 2AHRA 3VPHA 4EJMA 2FR8A 3U9LA 3QWFA 5THKA 4CM4B 5FI3A 4IGFA 4YQZA 4PLYA 3QVOA 5KVVA 3AUUA 3JQ6A 5COQA 1YOVA 5KCZA 5IG2A 3VVCA 4R4JA 2Q4EA 1IPEA 4BIIA 3BXXA 1E7QA 2VOJA 3INTA 1A4IA 2XF8A 2J5QA 3DTTA 1I2ZA 1PJCA 4ZRMA 1O8CA 4HV4A 2P4QA 3BTOA 1BTOA 2R2GA 1GEEA 1BVUA 4BV8A 3JD2A 4UVEA 4R51A 4YVFA 1YQXA 2O7SA 2P9GA 2DBVO 1VJTA 2PD3A 1XR3A 3MWDB 3VH2A 3IUPA 3U62A 3RFVA 4K9DA 4C7KA 1WP4A 5A3VA 4P38A 3CMCO 4ALKA 4DQXA 3DO5A 2AQ8A 4GKBA 3MJ4A 4BKRA 2PK3A 3U5TA 2ILTA 1U28A 2EWMA 3LLSA 1ZH8A 4JP3A 4J4TA 1DIGA 3LT4A 5KNLA 4JCOA 4QO7A 1YXMA 3GVHA 3EVTA 1D1SA 1G1AA 5LC1A 3EZLA 4YRAA 5B12A 2NQ8A 3KSUA 3GDFA 1GUFA 4DIBA 4JROA 3COSA 1LA2A 4YA6A 5DDIP 1DC5A 1GQYA 1VL8A 2B35A 5AOVA 1DOHA 2PD4A 4O5OA 4PG7A 1GDHA 1R16A 5KVSA 5BT9A 2Q46A 2GASA 4L8VA 1B8PA 1H0KA 1R0KA 4QFCA 3GH3A 1K5HA 4NH4A 4R16A 4NZ9A 5JY1A 2NWQA 2YV2A 3KXDA 4IDDA 4BUCA 3O8QB 3KM0A 1Z45A 3A14A 3AI2A 5IDXA 3B1JA 1C0KA 4AJIA 4FFPA 5JC1A 2GZ1A 4MINA 4FDAA 1Z74A 2Q1SA 3NT2A 3VDRA 1BMDA 2JAPA 1XLTA 1S7CA 4XQCA 1GL3A 2ZYAA 2OORA 3MTJA 4XCVA 4RLHA 2QYTA 3E5MA 4HP8A 1ZEMA 4RPKA 2VHXA 4D0SA 3MJVA 3PJGA 3MOIA 2DBQA 2NTNA 5AYVA 3NTOA 4ESOA 3GN1A 1ENYA 4K26A 2JFGA 2XXBA 2VHZA 3TOXA 5J23A 3WYEA 4CMEA 4FC6A 1YBMA 1TA4A 1JW9B 1N5DA 1U3WA 4IM7A 2DTEA 4RV9A 2AQKA 1DBVO 4FFMA 5IZCA 1U7TA 4Y8VA 4BKUA 1EBUA 3V2UA 4DQVA 1AUPA 1DC3A 4B3HA 4HX5A 1PTJA 1B14A 3A1NA 3ICPA 4CMHA 4YYZA 1Y9AA 3INGA 3D4NA 4WPGA 3HZZA 4NDNE 4XYBA 3I9OA 5DOVA 2J3HA 3NEPX 2A35A 4I9HA 4M54A 4YBZA 3WYBA 3PZBA 1O89A 3CKYA 1DFGA 4MVJI 3AY3A 3ZV6A 1JU9A 1ONNA 3UF0A 5BSGA 1O9BA 3V1YA 3H2ZA 3ZU5A 4CR8A 2PTGA 3DAGA 3DTYA 4XDYA 3RC7A 3CH6A 3SXPA 1E1LA 5HRUA 2HMWA 1OOEA 3NJ4A 4S1VA 4EUFA 2VHWA 1ZVMA 3W1VA 1NTOA 1HYEA 5A02A 2YUTA 4M49A 4BO3A 4XD2A 4FFNA 1DAOA 1DDOA 4OL9A 2NTVA 4A03A 4RJTA 1T4DA 3PDUA 3BMQB 3WS7A 4E32A 4RL6A 3MOGA 4J91A 4L4RA 1OAAA 1E77A 1Y81A 5CPFA 1A9ZA 4R3WA 5TGDA 3H9GA 1Z82A 4IIVA 5T6BA 4EI2A 9LDBA 3EK2A 4RCVA 1HDGO 4GWKA 1KVQA 4LGVA 3RBVA 2B4RO 3ZWCA 1PJBA 3T7EA 5I7EA 1LC0A 3U3XA 5H81A 5H82A 1XEAA 4ZICA 1HSOA 4Z9YA 4NFHA 1AXGA 4PLZA 3C1TA 1O5IA 4UVDA 4Q3NA 4IINA 3GOHA 1AHIA 4IIUA 2PKQP 2G82A 4CLDA 2JD1A 1Z7EA 2X0IA 4GAEA 3L07A 4ONEA 5JDIC 1JN0A 3JD3A 5LDGA 2HK9A 4XWYA 1NXQA 5HBRA 1X7HA 2GO1A 1QR6A 1SZJG 1W73A 1QYCA 3ANNA 3GRPA 4B4VA 3I52A 5EIOA 3OF2A 5JAQA 2E37A 3VZPA 4BNTA 2HK7A 3PGXA 1GPDG 3JQ7A 4BQPA 3PYXA 5C7IO 4CLRA 4TZTA 3SLGA 4DWVA 1EFLA 5KKCA 4PVDA 2D59A 2VWQA 2P5YA 3P2YA 2H1SA 4O1MA 2G5CA 2Y0CA 3LDHA 2AG8A 3DBVO 4CQMB 1LI4A 3DZIA 1SMKA 2Q1WA 4DL9A 3TZKA 2G1UA 3PJDA 1HDYA 1DJQA 1T24A 5K6AA 2HMSA 3IOYA 1PJ4A 3F3SA 5A9RA 1QORA 2CD9A 1HE2A 1KEWA 4NK5A 1VSVA 4MVJD 4I9NA 1U3VA 4NBVA 1LTHR 4FOSA 4XQGA 4HWKA 4PRKA 5EPOA 4W6ZA 3DL2A 3AJRA 4KQXA 3FBTA 4B3IA 1EMDA 1ZBQA 4LSWA 2CY0A 4QUKA 3S2IA 5CDSA 5I7FA 4IPTA 1NYTA 3Q3CA 1AGNA 2VYNA 3JD1A 3KYBA 3GT0A 3I6QA 4C4OA 1ZSYA 4IJKA 3VTZA 2W2KB 2ZYDA 3VH1A 1LEHA 2GF2A 2UAGA 2XAAA 2G17A 4BV9A 1YL6A 4NU5A 5IJZA 1JTVA 1NVGA 4LRSB 2WSBA 1KYQA 5A05A 3QWBA 4Q39A 1R4NB 4CLHA 4R9RA 1P3DA 3FRJA 3R3JA 2AE1A 1YDWA 4NG5A 1FDTA 4W4TA 4UVIA 3Q9NA 4Y67A 1UXJA 5K0ZA 3I4CA 5JXWA 1I3LA 4OXNA 3DHYA 4TZKA 4DBZA 3NTRA 4ZQHA 1QMGA 2O23A 4BKOA 2IRWA 1SBYA 5GZ3A 5KTKA 2C7VA 3WGQA 2GGSA 4GX1A 2RCYA 3ZWOA 1H6DA 3ST7A 4B3JA 2YYYA 1GYRA 1NQ5A 2D5CA 2E6UX 4RVUA 3RC9A 5L7YA 4MOWA 1ZK2A 2V6GA 3UXYA 3WBFA 1HETA 5THQA 3OP4A 1Q1NA 2X5OA 1T26A 1UJMA 4W7HA 5ER6A 3DEYX 3VPSA 1GYPA 2HAEA 1CJCA 4FGSA 4LISA 5DF1A 1IE3A 3I4FA 3GVIA 3OQBA 4OXYA 3MEQA 3L6EA 4GL4A 1ID1A 1WXDA 2EJWA 1MP0A 3TFQA 4JJIA 4DMLA 4DXHA 3C8MA 1U9JA 3DBHB 4F45A 5C37A 8LDHA 4MP3A 4TROA 2O4CA 5G0VA 3F5SA 5KVCA 2BLLA 4WK6A 4R54A 4E6PA 3ENKA 3E82A 4IXWA 3DBHA 3PJEA 1BRMA 1D7OA 3KEQA 3L4SO 3PLRA 5L53A 3AUSA 4RPGA 3UFXA 1NBOA 3RFXA 1XGKA 3KSZO 1DIRA 1EQUA 1V35A 1Y5MA 4YTEA 3ANLA 2Y1EA 3Q6IA 5ENDA 5L4NA 3ZU2A 4GSLA 3DBRB 1J5PA 1PU2A 3V2GA 2O50A 2HMUA 3I9LA 1KEPA 1DIHA 2X5KO 5F1PA 2CF6A 1GFSA 2DFDA 1LC3A 2NU6A 1BWSA 4CQLA 4L76A 3GNQA 3DC2A 3JYOA 4DMMA 3BTSA 3PHHA 2EERA 3TJRA 4BMVA 1P1FA 1F8GA 1DJNA 1YL7A 3H9JA 3RFTA 1DLJA 4QQRA 4P4NA 4K6FA 4UUOA 2GERA 5TSDA 4HFMA 4F6CA 4MPDA 5HTOA 2EEZA 5HA5A 1PWXA 3PI7A 2YQ5A 6ADHA 3QE3A 4PVCA 3ZWNA 2WDZA 2VRCA 4BNMA 2DQ4A 4AJEA 1BXGA 1UDBA 2FPIA 4I5EA 4K6CA 1EE9A 3KV3O 4NR0A 4WLUA 1PEDA 4GH5A 3RSHA 4CLEA 3ASVA 3SBOA 3QVWA 4AVYA 4KDEA 3TN7A 1DC6A 3T7CA 5EESA 4J1SA 2A94A 3D4PA 3WJAA 2PGJA 1HDXA 4L73A 1PQWA 2I9PA 2Y1GA 4KWHA 5GY7A 1YRLA 1JLLA 1E6WA 1WMAA 2PNFA 4YJFA 3RUEA 4M1QA 4HNGA 2PH5A 1Y8QB 3TPCA 1PL8A 3NYWA 2EJVA 4YT8A 6LDHA 4W9NC 1YJQA 1LDGA 1SCUA 4E2ZA 3BIOA 5GMOA 4DYVA 4INAA 3EYWA 2DTXA 1BXZA 4YJFB 3GG9A 1GQ2A 1SOVA 3KOUA 3S8MA 2WYVA 4FN4A 2QZ9A 4BGEA 1OC4A 3HN7A 4UUNA 4KTTE 1ENZA 3H3FA 1Y8RB 3JQAB 3PJFA 2EP5A 4N18A
chains in the Genus database with same CATH superfamily
1ZD3A 1CFZA 1X0XA 2GPTA 2JJ1A 3FWHA 4X60A 5G53C 4UCXA 5JBIA 4EHKA 3PTZA 3LBHA 4IMRA 3M4XA 4P92A 5EE5B 4F91B 4LSZA 1C0PA 3D1VA 1YK0A 2QAGA 5T64A 3URKA 3ZVLA 4YT5A 1CZLA 1NW5A 1WSDA 2ZSFA 1KP2A 3B3GA 4PYJA 1ODKA 1ZHHA 1UMDB 5ANRB 4ZDWA 1WZUA 3V1KA 2DG2A 2PR7A 4JODA 1LFAA 2YWDA 3EWNA 2V58A 1NWCA 4BDTA 1EKXA 4G1EB 1YZ3A 2FX3A 3N5KA 4HSEA 1VP3A 1KBZA 1Z29A 4DDWA 1U9YA 3PKIA 4MW2A 4O3MA 3K2BA 1NAIA 3Q10A 5FWXB 2A7XA 4R1SA 1ULTA 1QCCA 1RI1A 1XJ5A 3JQBC 5HGXA 1TQ2A 2P2DA 2WIKA 1LPAB 2EEPA 4FGKA 1QP0A 4MW7A 1LBSA 3GG2A 3IB3A 1T3GA 1NQXA 1PHRA 2OVBA 2FX5A 1H1DA 2SNIE 2ZJ8A 3AQIA 3JQ8A 3LUJA 4N49A 1N3YA 3GFFA 1R8JA 4C7BA 1HDIA 4G8JA 4WOCA 3JZMA 4IF4A 3KPUA 3JQDA 4RA6A 1Y8QA 4ECAA 4YMSA 4O2BA 4BZPA 1Q2UA 2FUKA 3NKVA 1NJ5A 1N6HA 3KKQA 3OIDA 4IIJA 4IKPA 4MGIR 4OY3A 3H1AA 4D4GA 4FWTA 2CXTA 4MCHA 3SX4A 3FAZA 1T1SA 3S2SA 2N1BA 1QGDA 1OGYA 1B6SA 1PZMA 4X8OA 5GOTA 1W44A 5HFNA 3G23A 3L1IA 3F7NA 1U0NA 2NU6B 3GQBA 4QFDA 4ZAVA 4DPMA 3NHKA 1J7KA 4G89A 5HKAA 1YQDA 4B2IA 2D1SA 4NYMQ 5EE1A 3V7YA 1E9FA 1KNXA 2GFQA 1TQ6A 2AHOA 5E1DA 3T1NA 1PZGA 1RE0A 1BZYA 2H48A 1K6EA 3BTUA 4IXMA 5D51S 4BUJA 3SYLA 4DLLA 2B1QA 3NH9A 3OZVA 4LHYA 4MYHA 4ARVA 1DMSA 1EDOA 3L9WA 1TF5A 4B1FA 1R2QA 3H5TA 4JJKA 3WGGA 1A5AB 4KV9A 5AK0A 1B73A 1NFFA 3CIOA 4MGYR 2RHHA 3RRBA 1ZW1A 5DX8A 3V4PB 5BSWA 3AOEC 2F9MA 1CWUA 2Q99A 2ZJFA 3DV2A 3QA3E 5TQ0A 1JEQB 1FS6A 4ARIA 2XNDD 2CV0A 5CU7A 4RNCA 3DOOA 3NHRA 1VGQA 2DLCX 1XAHA 4RADA 1ZI8A 4JBHA 1P5RA 3UAOA 4PPGA 3X1KA 2AMYA 2O2JA 3EGCA 3QP9A 3STWA 2V5VA 4WL0A 5G0UA 3HGQA 2YFQA 1YGPA 2J3KA 2WTBA 4ANFA 4ACBA 1UOEA 3RG8A 1KZ6A 4GKAA 4CIDA 4F9TA 4QIHA 4G0QA 4TM8A 1ZY2A 4QAJA 4GP9A 3IR5A 2VQ6A 3EGXB 1CZNA 1NMEA 2DT8A 2X0KA 3IVXA 2CVQA 3KVYA 4BRUA 1TVEA 3TQSA 1UKVY 3I32A 4LDQA 3G82C 1LJLA 1LK0A 3OEWA 2D62A 2NSJA 3BMQA 3RYHA 1U0OC 4QBGB 3WMGA 2FPGB 2VUTA 2J85A 3PE4A 5F64A 3FXAA 4CM8B 1KU6A 1SQ5A 2PS3A 2ZYSA 3B85A 4MQ4A 2F48A 2OGZA 4O4IB 4B7UA 3M7IA 4QSHA 3NDBB 1VXRA 1U80A 3N0VA 3UBTA 3OOEA 2ZSJA 3LUPA 3PQ6A 4X91A 3AESA 2J5RA 3BE8A 4E5KA 5FBQB 3O83A 4NC9A 4GOJA 4RA9A 5D85A 2IWHA 4MK4A 3ZWQA 5FPPA 4RZ2A 1EIWA 1Z4MA 3E6AA 4NRDA 4G25A 3R9IA 2ZAIA 3RGWS 2C9MA 5PNTA 4ENSA 3BGDA 4RC9A 2JFBA 4G85A 4MHSA 3TL6A 2B9VA 5JE8A 3U4CA 4BWYA 3EPJA 5AW7A 4LHZA 1I3NA 1VYTA 1UT8A 1RT9A 3D3KA 3IXLA 3ROMA 4EAQA 1G2OA 3A7DA 1X2EA 2PUBA 2ES4A 4DARA 5HCUA 2IS4A 1T8SA 4FDUA 2PRKA 3UUWA 3V97A 1U3CA 2NO7A 1G8HA 3EBOA 1NKVA 1TB4A 1Y6QA 2P67A 3D3QA 3JYPA 4XIYA 3WRXC 1NVWQ 5I9TA 4K1XA 1CJKC 3EVGA 2PFGA 3ZH9B 2FEKA 3EEQA 3N2KA 3GFOA 3LXRA 4N5MA 1P6UA 4P81A 3TMYA 2AQHA 4UHJA 3EOBI 5K0LA 1TLLA 4X8LA 2OMEA 3V2HA 1XNQB 3DTNA 1YB1A 5EOVA 5AVUA 1U5CA 4R40A 3CZ9A 4PFQA 1E5QA 1RWWA 2FZWA 1GGJA 4HRYA 3WNZA 1DV2A 3N2GB 4KXXA 4QGBA 3V9AA 4C4AA 1E3JA 1EFDN 2RGUA 16PKA 2X1LA 4QOJA 5DHAA 1W5TA 1E3WB 2Q1TA 3WSVA 3D4BA 2DBZA 4ZALA 3AL2A 1DTEA 1EDZA 4DIUA 4U2CA 1AZTA 3HACA 4GE3A 4CCWA 4R7TA 1XCJA 4Q1CA 4TVKA 2RH9B 2DB3A 4MYSA 1DTWA 1SEVA 4C14A 1AXEA 1L9XA 3IVAA 5EUMA 3T52A 4B8WA 1GTRA 1TAUA 3QEJA 3DYIA 3PCXA 4CKWA 3TOZA 5IP5A 1XZHA 1NC3A 2YZ2A 4CHTA 3G79A 4S12A 2ZSAA 2BGRA 3MB8A 4ZOLA 4ZQEA 4NJEA 4MJXA 5D3MA 2GN2A 2H0RA 5KSPA 1JJIA 3EF0A 1NURA 1RPAA 2ALJA 1W88A 2OCAA 3VV2A 4OVKA 4XSVA 4Q3DA 5T41A 5IAOA 3ONWA 4HLUC 5EY5B 4U7PB 3BREA 2EG9A 5EEGA 1O0SA 1STOA 4NWIA 4EG3A 1X8KA 1A8SA 1E2HA 3LE8A 1P60A 1EK6A 5AKJA 3UG6A 3ZDXB 4BO4A 3SDSA 1IULA 4KGDA 4NL4H 4C0KA 1FE8A 3IEUA 4Y1GA 3RLFA 1MA3A 3A9WA 4TS1A 1J0XO 1BXRA 2WA2A 2QGFA 3BHJA 3VR4H 4RCZA 1G17A 4DLZA 4FXPA 1FTGA 2RG1A 3GIWA 3F3MA 4KHZA 2HIMA 1VE9A 2Q0HA 3ETEA 3OM9A 3JVIA 5F2OA 3PA6A 2XDYA 4EYEA 4ZYLA 2W6MA 2DHDA 2Y27A 3IP6A 1H4TA 4EI7A 3R9XB 1O4VA 4E1VA 1TJ3A 4RVNA 3ESXA 4IH4A 4XX1A 2INGX 1ZN8A 3L7NA 1G0OA 1SXHA 2GPBA 3CUSA 1FS5A 4HFJA 3TBHA 1M3SA 2CK3D 1KKLA 4ZO8A 5E95A 5GM2A 4WFJA 1UC9A 1FSGA 5EAIA 3WK7A 1KQOA 1QSGA 1NVVQ 1Z8DA 4Q82A 2QR3A 2QTHA 2BV3A 2IDKA 1F3OA 1EFCA 3HADA 3PWTA 2OV4A 3CNLA 4YJGA 4ZVSA 2AFRA 2UZ4A 1G5FA 1A69A 1E3LA 5HZMA 3SC2A 1XPJA 2OHXA 1UOPA 1FJHA 2GFHA 2WG2A 3RBZA 3E81A 4V0KA 3TOSA 5E3HA 1BDMA 4CQJA 4BFCA 5LZ4A 3HP1A 1UBGA 2W2QA 3KZNA 1XEWX 4PX3A 4WY2A 4HDMA 1U2EA 2FOXA 2QRHA 1YTUA 2CLLB 4XTCS 13PKA 1TEXA 3A6EA 3N75A 5BSEA 5CB6A 3GLFA 1O94D 2OQVA 4A27A 4QDUA 2V0GA 1U3GA 1C3VA 3BICA 3I23A 4EF6A 2DULA 2XYHA 1C3OA 2GD0A 3BFVA 3BRCA 1E8MA 5ESXA 3RIGA 4IILA 2NVUB 5IC6A 4ZYYA 2NU8B 5EJAA 4ZTZB 5EN4A 3U4IA 5DXFA 5F35A 3CN7A 4A82A 4FR5A 4FHFA 4W5QA 2XCTB 5C3UA 2FW6A 3HC7A 4KKXB 4MMZB 3P9CA 4G8BA 3WRYA 5D00A 2ARKA 1MABB 2F67A 1SB8A 3QA9A 4FEEA 3W7VA 2H54A 4EFLA 2QKYA 4OV6B 1MX3A 4EOGA 1QZ3A 3CZPA 3WMWA 1U8AA 2P5UA 2MMCA 2XDQB 3LAWA 3NBQA 4YYEA 5KNBH 5LJIA 2MTBA 4GLJA 2XZPA 4QOFA 1GU7A 1JF8A 1H4VB 4GVPA 3PQ7A 4J43A 2Z2IA 2C7OA 2XVYA 2WVGA 3HU2A 2CUZA 4RMHA 4RPJA 3VU9B 3ESCA 1V8OA 4HX2A 5EIWA 3ENNA 3N6RA 3T4UA 3A3YA 1TMYA 3B52X 2VJMB 4DKJA 3GPDG 5EC8A 1ZAYA 1H8HD 3E3OA 4QRDA 5F1KA 3EGDB 3M4NA 4OAOA 3HG7A 1IZYA 4ZDIA 5DYGA 2C78A 3F49S 3G9ZA 1Z75A 1TUGA 4OQQA 4ZGWA 1V5IA 4CI9A 4JWTA 3U31A 2BISA 3D4OA 3EDMA 4S0ZA 3SQMA 1FNMA 4RD0A 3TW8A 1IIRA 4CM9D 3EXIB 1I36A 3B1WA 4FFVA 5DSTA 2QX7A 3HR4A 4JOQA 1HDCA 1L5OA 2XJ9A 3RS3A 5ALUA 2ID8A 4OB7A 4X8HA 4N6OA 2ZR7A 4G0OA 2PUEA 1M8JA 3MT8A 3ONFA 2FDXA 1PDVA 1V16A 2NW6A 2QM3A 3PICA 5E2AA 2CKDA 1WV1A 1Z6YA 2NXJA 3GMSA 4V0RA 5IASA 2VCHA 2E2WA 3DM5A 3K1AA 1T5LA 2I6UA 3JWHA 1KYWA 2FKAA 2WBLC 3GEDA 1QFXA 3WYGA 4UPVA 4UBLA 3JD0A 2AEJA 1FS4A 1HDZA 1UFQA 1HXHA 4YACA 3UUEA 3VYRB 3WKBA 3TSCA 1GPMA 2JHCA 5FF9A 1W75A 3P9PA 3RHTA 1NAHA 5JAHA 2OZEA 3EXHC 2DBYA 2OHFA 3OQ6A 5HYVA 2JLCA 5E6SA 5BN4B 3ZIAA 3FI9A 2W4IA 1A8IA 5FV4A 4KNWA 1IXKA 2JFPA 2AMJA 4X84A 3S2GA 5MDHA 5A3RA 5KSOA 2C9CA 2JGEA 1I01A 4P34A 2BHRA 5L95A 3QEKA 2REQA 4QOSA 3GF4A 2HU7A 3WXBA 1TA0A 1M9NA 1PNVA 3GP3A 3MIZA 1XZAA 3O6VA 4ND3A 3FWKA 1KI1A 1YS1X 3ML1A 4B6PA 4K3UA 4Z1MD 1G18A 2P9JA 4MVJH 3KL2A 2YXNA 1WVGA 1JDTA 1G8PA 3LW7A 4XVQA 3FNGA 5TQJA 3B6ZA 4HB4A 4GGMX 1D2AA 1NW7A 3AINA 4TMZA 3EN0A 3ND7A 1B3RA 1V48A 4MUMA 4EY3A 3OOSA 4ABTA 1GSHA 1MO2A 1NJSA 2PCLA 2PGXA 3ZHZA 3HWSA 4MAMA 4NMMA 1GNQA 5L3QA 7YASA 3SR3A 1W30A 2NNLD 4IUYA 5HQTA 5JATA 1YE5A 2F90A 4OEHA 4QSMA 3U13A 4DRXA 5JHGB 1NXSA 2G04A 3WA6A 1EVYA 1E1NA 2ZXEA 1V25A 3FHLA 4I81A 3KFXA 2VDQB 2UZIR 3B8EA 3WWZA 1LV7A 2ZWVA 1ISGA 2QN1A 4TTRA 5I8PA 3CPEA 4HNSA 3PLAE 1CUIA 4R3UC 4HDKB 2OC4A 1ADYA 1DRUA 3DBOB 5CTJA 4DF3A 5DI3B 4TQ9A 3H75A 3PFGA 3HKEA 3ESDA 1U2TA 3K30A 4AMGA 5LMCA 1SOUA 1FCJA 2J45A 3A9TA 3CH5A 3NOVA 4X1YA 5JS2A 5LP1A 2CNOA 3L8MA 3U3DA 3DJFA 3U0VA 4DY6A 4HNUA 1EX7A 3ZCVA 3HWX1 1YDGA 2DR3A 3KLOA 4CKWB 1BAPA 2ZPTX 3E84A 5DM60 5I9NA 5TMEA 3E15A 1SPXA 4LK3A 2FEXA 2GBLC 2G09A 2QX8A 4JOSA 1X8XA 4BVHA 3IUJA 1OWPA 3N7AA 1LW6E 1V5FA 1JWBB 3CZQA 4TMFA 4L4UA 4D9BA 1LRLA 5CVTA 4R41A 1YUMA 2NVOA 2QQ0A 2V7PA 1E3WA 2NG1A 1A5BB 3QXGA 9ATCA 4AXXA 4R6WA 4AK9A 1OXTA 2JVJA 2ZB3A 2JGFA 3KVRA 3O2SB 1PNTA 3THOA 4QOGA 1B0AA 2X8LA 3L7YA 3THXB 4BHTA 1C3JA 1W25A 3WLHA 1R0RE 1T9ZA 4W1SA 2JHPA 2WPDA 1R0SA 2BM1A 1X92A 2VSYA 4UUBA 3UT5B 4PZ0A 1ZD8A 1DAEA 2F00A 2VSNA 1KZ1A 1M7BA 1X8JA 2QUHA 3AF5A 2DPLA 4IDFA 4C01A 1NWHA 4L1KA 4AN1A 2FZEA 1UP4A 3CUKA 1ZK3A 3H97A 4PR3A 2G0TA 2QTVA 1JS1X 4KZKA 3ZDCA 4C4XA 4DSTA 2VAXA 1FFAA 1RBMA 1UEIA 2G8LA 4PQGA 5E6SB 1P0CA 4C04A 1G6Q1 5CA0F 2G5PA 4P3NA 4LQDA 4YRGA 3NVAA 2IUSA 1O4WA 1VXOA 1II9A 2O3QA 1FXWA 2HA4A 5DMXA 5HJ7A 4GX2A 5KYUB 1DB3A 2I4TA 1QH9A 4NENB 1YC5A 2CLCX 1ZESA 3IBCA 3SN6A 1YRYE 5HDBB 3O0DA 4CV1A 2VJDA 4HVTA 5IVIA 1O96B 2Y1FA 4R68A 3S29A 4X64B 1NATA 4M8LA 1SVKA 2JG3A 5HKBA 2VDVE 2O2YA 5DHTA 3VKWA 3QTBA 2H4FA 1NQOA 3O75A 3OKCA 2C3MA 2BC9A 3GMDA 4LTMA 3ILVA 3AKYA 5TGZA 3W1WA 2I2DA 3QX7A 2ZVJA 3BA6A 4IDCA 1KAQA 4CVNA 2FHSA 4DZTA 5L9AA 3PGJA 1KSFX 2XPCA 3FYSA 1KAHA 2JIQA 5LQKA 1JZQA 3PF8A 2IPLA 1FU7A 1OFUX 3WKDA 1HMPA 5SV2A 4DDTA 1BE8A 2PKQO 3DB1A 3HL4A 4RORA 3OFVA 2VDNB 3G49A 1RMQA 5BV8A 3RIXA 4NU6A 1P61B 2O19A 2AN9A 2JJ1D 4W1QA 1ETUA 2BI4A 3T1QA 3GAFA 4ZHQF 2YS6A 5DNUA 1C81A 5BV1A 2W6NA 3TLYA 3IKMB 1XA0A 4PZEA 3TNFA 3DJYA 4BN5A 2I7CA 3H42B 3RU7A 1TQHA 1QUEA 3BDIA 2G08A 3NB0A 1SC1A 4RWZA 2GBIA 3HXKA 3I73A 2HQBA 4UM9D 4FGLA 1HE1C 2YC2C 2F8LA 3FFBA 2GVDC 4N65A 1M0SA 2YVAA 5AHWA 1DRWA 3COJA 4GBJA 4PG5A 4EQ6B 1PW7A 4L75A 3IDQA 2HSWA 2OGTA 1VE7A 2VHEA 4LHVA 5JDCA 1IXSB 1L8OA 3K32A 3CLSD 1Z6QA 3TDMA 5IF9A 3COPA 2V7QA 1G291 4LE2A 1KARA 2IIPA 2V03A 3GGGA 3BK2A 5AI0A 1NX6A 1UEXC 4G37A 4DHWA 4CXMA 1K6XA 3N8GA 2QD5A 3DYVA 3DT6A 1AB6A 4GDMA 5JG7A 3WWYA 3ZU4A 3EEOA 4H15A 4DQKA 1MD9A 1UZLA 2GYYA 2ZPAA 3TAXA 1RRMA 1YI0A 3ON5A 4J1TC 3ISTA 3ZV5A 2C2BA 4XGQA 1AURA 1P2FA 1MR3F 1UDWA 1UMCB 4ZOBA 3WL7A 4RHCA 3P9ZA 3PHIA 4PN3A 1H9BA 1ZM3A 5ECWA 2JJMA 1NDUA 1PLLA 2F43B 5EIBD 4F2HA 5B1IA 4INZA 4G2NA 3ASYA 3FYDA 4LNUA 4ZVUA 1U1GA 2BLNA 5P8WA 3WLNA 4WN9A 3ITDA 1B42A 1RSZA 3DOHA 3PC4A 4ZCLA 2YOFA 3HVUA 3JU3A 4OK6A 4HUQB 2FZLA 4YS6A 4MGKR 3G9QA 1OYVA 4F46A 1PQPA 2FSSA 3I58A 1TADA 1KAOA 3QQPA 1ISHA 4RDXA 5B2ZA 3ROFA 1UF9A 3WGTA 4MQFA 4U02A 3WQRA 3AF6A 1G9XA 1OKKA 3UG7A 4BC0A 4CCAA 3GJ5A 4JL6A 4IQGA 4RMNA 1T2CA 2X3YA 2WM8A 4JC4A 4KUEA 1X14A 3ZDRA 4EPVA 4CM8A 3W78A 4Y18A 5E9AA 1DG3A 2XWJI 3CO0S 3DOCA 4C0HA 1G2QA 3W5AA 1MF7A 3O91A 4OI4A 1NQTA 3DXFA 3H9UA 3EIHA 4J7XA 4XPIB 4F96A 3G85A 4BNVA 3VMFA 1QU3A 3LQ2A 1KRWA 5AJUA 1H65A 3K0HA 4BO9A 4BMSA 3PQFA 2CNDA 4OIFA 5I4BA 4ZI3A 3LY8A 1VLLA 4G9EA 4YB8A 1GTJ1 5EJ8A 3B53X 3PQ2A 4NCAA 1T5HX 1H5QA 4URZR 1FZTA 2PWPA 3S2ZA 5BURA 1JAHA 1GRCA 2GXQA 1ZYUA 3QYPA 4MB0A 5E7MA 5F5NA 4BMYA 3CISA 4BP9A 2ZTUA 3DE3X 2CJYA 3SVZA 2OENG 1HG0A 1DP4A 2DHQA 5C7YA 3VAYA 1G21B 4KFSA 1ELOA 3RHFA 3K31A 5GTDA 5JR3A 5B53A 3L7JA 4RQBA 1NOKA 2ZAOA 3HYNA 3DCYA 4FOPA 2JBHA 3AI1A 3KAKA 3A1EA 3CXRA 2GZDA 5BY2A 1PBNA 1R9NA 1BMTA 2B9EA 3IS3A 4GMDA 3EWSA 4MV8A 5E6RA 2C7RA 4A0RA 3JZAA 1RQXA 1JAZA 3N7UA 4TSRA 3TD2A 1LPOA 5DBGA 4N0PA 1HEYA 3CRRA 1U5BB 1FDVA 2NYUA 3NR2A 4BLTA 3V2IA 4YJHB 3QKRA 4NECA 2NACA 4TMYA 2HSJA 1CEEA 1YWGO 1TM4E 1NNEA 1WXWA 1P29A 2XKJE 1E7WA 1KSHA 1RYNA 4RGVA 5NULA 4CL8A 1KQGA 3UKOA 2TYSB 4WW0A 5IAJA 1SXGA 3VNRA 1SXIA 4WXEA 2B2NA 5ALVA 3VO1A 5J2TB 4PLCA 3C1UA 2FAXA 3Q88A 2G7ZA 4YCMA 3IPCA 4P7GA 1AS0A 4XD7D 3C7DB 5LZ7A 4F8YA 5BSFA 1ZOIA 5IW8A 4LNUB 2B4TO 3N74A 3OEEA 4MRNA 2AK2A 2O0LA 4XX0A 3VOAA 1XUOA 5J3JA 3GU3A 4IGAA 2FG6C 2FZKA 4PLWA 4F4UA 4CM4A 1YAHA 2LW7A 4BP8A 4DZZA 2GI4A 3OM0A 2Q07A 5BYAA 4PGGA 2HR1A 1UMBA 5JAOA 3HSKA 1JDVA 1GN8A 4RHEA 4RAQA 4QG3A 1PF7E 3PSAA 4EF5A 4ZYWA 3MWEB 1UR5A 3DBLA 2HJRA 1JHAA 1P39A 1TDJA 1XELA 1VSUA 1ZQ9A 4I7EA 2C5HA 4LV6A 3WBBA 3IURA 1GZ6A 2NX2A 5BMVF 4UHKA 3H0KA 2HSDA 1WSAA 4UMDA 1PG0A 2G1KA 2QRJA 3HBMA 3HCRA 3JWEA 1IQRA 1D07A 4F3NA 3FNIA 3KHSA 2P6PA 8MHTA 5AM3A 1S9HA 1O95C 1XYGA 3D7NA 1Z63A 5FOXA 4AD8A 3Q85A 4FMDF 4XUCA 3S2EA 2O2DA 5CA1A 1EQAA 3CVOA 3M9LA 2WAAA 1P2VA 1BHSA 3KTFA 3ZGLA 4DT1B 1T4BA 2ZBRA 4TXJA 3RUAA 2VP0A 2ZIXA 4ZRDA 3DKPA 3TCKA 1A8HA 1MRNA 1QAOA 4YWHA 2YJ4A 4O4JB 2FHPA 2BR4A 5JQWA 4DJDC 1N32B 1ISPA 1X1AA 2GEDA 1I4LD 1DXHA 1PNQA 4PGAA 2WA1A 4PWZA 3AG6A 2IZ0A 3V9PA 1BEZA 2J9ZB 3HBJA 4ZO6A 4FOLA 2XWSA 4QNMA 2BFMA 3GIDA 2WSSD 5FYQA 3TUIC 2VJAA 3PC6A 4M7OA 1WXGA 2WVAA 1GZ7A 1RXIA 2R47A 1YMVA 1SD2A 3ESQA 3KJQA 3KQYA 4R8MA 2E5LB 1QP4A 4IMPA 4FJ0A 2E4AA 4US0R 2E5FA 4I6GA 4XUDA 2Y0BA 3EVNA 4KN8A 3UMGA 5I45A 1XOIA 1T9GS 1XA4A 2HHJA 3BORA 2QBYA 1XQ6A 1GUZA 2A86A 1K6JA 1XTSA 1KY5A 3U3ZA 1PL6A 4AU1A 2IIVA 1ECBA 1PT9A 2B4AA 5K20A 1WF3A 4MUAA 2DY1A 4YMIA 3I6MA 4F6RA 4AYXA 1DSSG 2ZWAA 4Z4HA 3W3AD 2TMDA 3H5RA 4EARA 3SQXA 4PHHA 3WWCA 1T2NA 1WW3A 4M3NA 1M6VA 1W35A 3RU9A 4ZJPA 3SVLA 5JAMA 3I01M 5LDHA 2FXVA 3S7ZA 2XOKD 1H6BA 1C7ZA 2QD2A 1AQIA 1FRVA 3HDGA 1LXCA 3AV3A 4G07A 1UPCA 2OWDA 4AKGA 3FRIA 3HB9A 1T4GA 5AKYA 1HRDA 3R23A 4L4XA 2GEVA 4W5RA 1DIAA 4DNOA 1E60A 3S5JA 4C2AA 5A5VA 5BVHA 2IP2A 2FCAA 3KOMA 3KOZA 2V7QD 5K4AA 2WU4A 1CY7A 1CUZA 2XUFA 2W5UA 1NI4A 2Q0XA 1KK2A 2VCEA 3I30X 621PA 2V7UA 2C2WA 3RAJA 3B78A 1C8KA 2QY9A 3C3PA 1A5TA 2YWBA 3ELYA 5J40A 4ZKEA 3RU3A 4CFSA 4DV4B 3KR1A 5DEOA 4EUKA 4JT9A 2OZKA 3BXHA 4JN6B 1V11B 2O2ZA 4DV3B 1UKBA 1Q0QA 1TM3E 4DUPA 2UVPA 1K89A 4QUBA 3VPFA 3RABA 3WJ2A 4F3CA 2Q0QA 3IBFA 2OMKA 1SK8A 5C32A 3HKDB 5ALOA 1SFRA 4UNSA 5K4HA 3PC3A 1CJSA 1C2TA 2WFAA 5TJHA 5KNCH 2XE8A 3ROTA 3JQFC 1TTHA 2BFPA 3AUKA 3DOEA 2A9RA 4HLNA 5JJKA 1U7WA 3ICCA 1FFDA 3TXAA 5DNCA 2REXB 1POWA 4ZU6X 4JI1B 1VCNA 5JRZA 7MHTA 3O3CA 2OXIA 1Z4QA 3MYYA 4MVJE 3AJAA 1NE7A 1LDYA 1NP3A 4NYIQ 1JIJA 1FXUA 3IHTA 2AW5A 1HORA 2XV1A 3F97A 2CUTA 5HXAA 2RJNA 5JLAA 1QYVA 3ROXA 2O5EA 4JNKA 2VJPA 1Z5GA 2Q6TA 5ULLA 2XNSA 4DVJA 1ORTA 5KS2A 3GLFE 2AD5A 3K6SB 1GADO 2M1XA 5HRAA 2CLSA 2Z43A 4OBEA 3H1BA 2FMIA 3HPQA 1XDWA 3EZ2A 2CJWA 1IWBB 1RYHA 1ZOOA 3AEYA 4BIMA 5UKDA 5TPZD 1T0JB 4DCMA 3V8VA 2C2OA 4PZDA 3WIOA 4JMLA 4Y3UA 3FY4A 2E87A 4G0VA 4OSEA 3BF8A 3HHPA 4LC0A 4QEZA 1UK6A 4IJ6A 1TMGE 2QTBA 4HUQA 4TWZA 3MWYW 3RJMA 3WMFA 1LVHA 1PJ8A 4F72A 1QO9A 2JFHA 2VH2A 2HCTA 2QN7A 3R3HA 4MIYA 4K88A 1RBQA 4AO6A 1OH5A 2O54A 1X7WB 5EPEA 3WGVA 5ALHA 2ZCUA 2R6JA 3G2IA 4QGSA 1MEJA 1LB1B 1ZJ4A 2OZVA 2P91A 3E5NA 4G5YA 3GRVA 3C3EA 1GA6A 4BN4A 5AVTA 1Q3KA 1HE5A 1UXKA 3MWLA 1EX9A 1VYUA 4RYDA 4CPDA 2RAVA 3OQPA 1MZPA 3IHLA 3OO1A 4XAQA 3HCEA 3WQBA 2AJ8A 1M2WA 3GJXC 3AW9A 5KAMA 1KETA 1T34A 1BS2A 2PSJA 3Q3IA 3HI4A 4URXR 3AM1A 4TV8B 3DZHA 4AS1A 3QMPA 2B83A 3V55A 2ZDQA 3WFJA 2XMPA 1DAKA 1Z12A 3KYCB 5AWFC 2QN9A 3G2NA 2WSYB 1XK7A 3SFTA 3U80A 3HXPA 3LBYA 2AUTA 4JJ6A 1XPOA 4JSRA 3INYA 4TSKA 1QFJA 1RAEA 3SC4A 1GCGA 1J70A 2Z2YA 3DOFA 1JEEA 2GJAA 2PSHA 3AL3A 4PZ9A 3IKJA 3M3HA 4L5AA 4BO2A 2EFCB 2Q9BA 2LV8A 2IA5A 3R4CA 4J6FA 1LX6A 4C07A 2AMFA 2XXJA 4HXYA 4WVLA 1GL9B 1W6UA 3O92A 4MI3A 1E4YA 1I3CA 3AUAA 3NHAA 4L5IA 4LHWA 4WY8A 1DQPA 1SKQA 5GONB 4MV3A 5IBQA 1KE2A 4H1HA 5KQMA 3ORSA 2VWGA 3AOEA 4Q3LA 3CZ4A 4TMVA 8GPBA 3S2FA 1IBCA 1JAXA 1P73A 4Q6BA 2NTEA 2DFLA 2W6ID 4I1SA 4LJKA 3VSEA 1UP6A 1RQLA 1B2RA 2RAFA 2RGYA 4OO3A 3W0LB 1MW8X 3T3OA 1UT6A 3P9KA 4EMUA 3VVMA 4B17A 4XR4A 4D82A 6ABPA 2GHTA 2HWKA 2F1KA 2HXGA 4UATA 1FJGB 4P6VF 3I4LA 4I8IA 5CJPA 7ADHA 1L4KA 1P7ZA 3ADBA 2JD2A 4DBVO 4WJZA 4LF5B 1T9BA 4V0MA 4P5PA 1AS3A 2B92A 3NKLA 1XD8A 1HFJA 1T25A 1E7MA 3IAXA 4R1TA 5EWLA 1BROA 3AERB 3SY8A 4CE6A 5J47A 1HOXA 1AX9A 2BBOA 1B0UA 1M6NA 3QJ5A 1DKQA 4MR9A 5U9CA 4U6NA 1XKTA 1ZJWA 1JFLA 1W0JA 4QOHA 2R8BA 1SHTX 1SPBS 4X63A 2GAFA 3KR9A 5JPCA 4LFBB 2A3NA 2KSQA 2C0CA 1J49A 2FGJA 5E1OA 2ZCJA 2BD0A 3FYUA 4Q02A 3L93A 4M46A 4C4YA 3WGIA 1MABA 3ROGA 1WDWB 2X1HA 5IKMA 5F7ZA 4EW2A 1TM5E 1RHRA 1WDMA 1A9OA 4C76A 3VRHA 2D0OB 4JJZA 1WZ2A 3GUUA 1BYUA 1Q0ZA 3ZWDA 3UGKA 1TT7A 4P86A 1CPYA 3GGDA 3OZCA 3CB2A 1N0UA 3M89A 1TYZA 3HJUA 5IK2D 1YA6A 1PP4A 3M70A 1OVMA 2Z5LA 1A4XA 1CULC 5IXJA 1OZAA 1X9IA 1PGNA 3ROEA 1ZJZA 5JCZA 1WZEA 5KNCA 1R5BA 3EC7A 3PD0A 1DAPA 1RPTA 3EASA 2PZKA 4K0RA 1ECLA 2D2IA 2I6XA 2PANA 5AKLA 1MCZA 3LUBA 1TZJA 3AVWA 1NZFA 3JAWA 2FX2A 1YVUA 3GVCA 3MJTA 4OHUA 4RL4A 3J80A 1DEHA 3EFEA 5EKSA 2WVHA 4ALMA 1NYQA 2XA9A 3IPRA 1COWD 4QFMA 4KSCA 2CSUA 3FKQA 4G6ZA 4BLQA 2RFLA 4YMHA 4HDNA 3NWEA 1VHWA 2G72A 4UOEA 3RADC 2VJBA 1K5PA 4PFJA 2COEA 2I4IA 1JA9A 1LLDA 1SCDA 3AKEA 4OHRA 5AKHA 3RTAA 3GLHE 2BH9A 4DC0A 4KB5A 1JKXA 3EVZA 4ZT5A 2R60A 2ZXFA 3ZHYA 4FEAA 4OG2A 2ECQA 4TV9A 1P4GA 3ZQ6A 3W6OA 3KOOA 5FL3A 2A30A 2Q27A 1EFPB 2QZSA 5AOCA 3DMNA 1RIIA 1TFUA 2ECFA 1YRQA 4DTCA 2PWYA 3GLGB 1M2GA 3ZG6A 1P1KA 2JLQA 3E1KA 3NAGA 3TLMA 4AJKA 5C4MA 1AN9A 3QU4A 4IJVA 3LQRA 1MC5A 1P7CA 4XFKA 1GTMA 2EOAA 2N47A 1JB9A 1G5PA 3H2GA 5CLJA 2ISSD 1OH6A 2GXUA 1VB3A 1M67A 1U3FA 5C3MA 3I61A 1DEAA 2GKOA 1PZFA 3OPYB 2XWBF 4P4GA 1EYZA 3HI6A 1AK1A 1BDBA 2FMFA 2OXFA 3DD5A 4X45A 3KD2A 4HY3A 1OIVA 4I6EA 1IVSA 3R9WA 2QXYA 1LW7A 2R6CA 4D6XA 1U8XX 4CRWB 2QSYA 4QXQA 5BSVA 3SVTA 4RO0A 2DAPA 4X7MA 4YASA 3ZCSA 1EUCA 1XZFA 2P41A 3AFNA 4Y2UA 5LA6F 1Y9DA 3HEMA 4F9GA 1AK9A 4HAIA 5CYOA 1GD1O 4KI0A 1Y1SA 3TR0A 4A26A 4POAA 3MS7A 3UKJA 4B79A 4CM5A 5LP6F 1TGYA 1P7PA 4WN9B 5IKPA 5GGYA 3UH0A 3NJRA 2C7PA 1ZUWA 4S1TA 1SHZA 1N3BA 4PLPA 3DTVB 5DNVA 4ZCQA 4HGOA 1K9SA 3ZY2A 1NF3A 2IJGX 3K4HA 3B48A 4RENA 2YY6A 3HDQA 2D2VA 2WF6A 3HA5A 2JGMA 1JJBA 3HRKA 3ZQUA 5AW6A 1DAHA 4PAOA 5EINA 4IP0A 2B7CA 1O08A 3LPAA 1VG1A 3FPBA 1SELA 1Z07A 1XQVA 3W7BA 4PANA 3H8WA 4N3BA 2R751 1F2UB 2AOTB 3LA6A 1J20A 1L8LA 2ACWA 4G0YA 4GXRA 1ZIYA 5DXAA 1FPMA 3SQNA 1H2FA 1LLUA 1Y5RA 3O8QA 1W8DA 1PFGA 3BM5A 3WBJA 4G24A 4EZIA 3A6HA 4KPYA 1USUA 4QBHA 5DLPA 4G4SO 3RE1A 4ARCA 4MKXA 1QMPA 1Z06A 4JWKA 2BFCB 1KZ9A 3N3BC 3A4NA 1F1BA 5EP2A 1UINA 3N2IA 3PL1A 1YVPA 5JH7B 1GFZA 2FMXA 3HCPA 3H99A 1U7XA 4GS5A 2PBFA 3O2JA 2GCOB 1TZMA 2AOVA 2ODWA 2WJPA 3W9BA 3DNMA 1U7UA 4QYIB 3JQEA 5DGIA 5AK6A 1JRLA 1NBME 1OR8A 5IAKA 1T2EA 1Z5NA 4BKPA 5C2JB 1WDLA 2IYVA 4FSDA 4QGFA 1KQNA 3UAZA 2P69A 3DT9A 4BAZA 4DY4A 1I8TA 3KVOA 4G0ZA 4OFXA 1Q95A 1FQKA 3BK1A 1V1RA 3HKEB 1XTBA 2VK4A 1DIOB 1X7XA 2Q6IA 1MTZA 4LGMA 5JMPA 2WDPA 3KHKA 1EWRA 2FWRA 3B1VA 5JFTA 1P1HA 4RF5A 2WLSA 2QRZA 2VSXA 2WYIA 4AJ2A 1CZUA 2RBGA 4D9KA 1F1JA 5DN9A 4UPDA 3DV9A 3Q7RA 2L18A 3DMGA 3ZXSA 5IJ9B 4WKBA 2WFZA 5FRDA 1KMHB 5IMBA 3MJEA 4JJ7A 4PIPA 4B7AA 1R5NA 1KMQA 1E9BA 4MVJM 2R8OA 1QGED 5DTIA 4F60A 3RYIB 1CUBA 4YFVA 3HUDA 3C5WP 3LVFO 5DP1A 4IDHA 3PTAA 3B1KA 3QVTA 2BKLA 3QPAA 1O96A 2QJWA 1IUOA 3IHWA 1KY3A 2O8VA 2O8NA 2UV8A 2PX0A 4B3DA 3KZMA 3DLCA 2VOEA 1C1DA 1I2AA 1LBHA 1SB9A 4V38A 3QYFA 4E5PA 4CMCA 4KQIA 1D2GA 4L9WA 2F8SA 5F5XA 1YR1A 4OKIA 2G8NA 2Y66A 3B2NA 1LSSA 1SG6A 3ICWA 1LBQA 4UM9B 2C4HA 3U4QA 3HUTA 3TNLA 3M6AA 2DERA 1NXVA 4UZEA 2XMGA 2XGGA 1UJ5A 4PYMA 2D1YA 5E9JA 4RUKA 3FPKA 4YUWA 3ICEA 1NHWA 2NSYA 3EXHA 4I5GA 4KQGA 3AJ9A 3RPEA 1PSWA 2BFFA 1KYVA 2A9FA 2XR1A 2HYDA 4FW9A 4MVCA 4AF8A 4Y0NA 4WD3A 4Q66C 4M8NE 4J7CA 4MS4B 5JZVA 2F8MA 1QK4A 1D6NA 1OZFA 4YJDA 2GDZA 4F1KA 1GTL1 2VJOA 5SY9A 1FFWA 1PEAA 2IHZA 2FJ0A 2H8KA 1NFQA 2PT9A 3D6TB 4HATA 4HX9A 5I8ZA 2A33A 5JROA 1EP9A 1PWEA 3Q0TA 4H6VA 1CIPA 5F4ZA 4WASA 4GZ5A 5KCMA 3AUJB 3GFPA 3IKVA 5DCUA 4TYNA 5JYEA 3VPCA 2B8JA 3OEED 1XJ0A 4TM7A 3WHKA 3J7TA 3RIMA 3H2YA 3SZLA 1E98A 2Y77A 3RQSA 3USCS 2XUOA 2A5LA 2IZ5A 4W7SA 5I4CA 1IXZA 2E9SA 5J2UF 1JLMA 1MOQA 4AMUA 3H5VA 4DMRA 3PQDA 5FJJA 1E5TA 2NSHA 3H2IA 4B73A 4CKBB 1WXHA 1ZMTA 2C83A 1FPQA 1SU8A 2B1IA 1DKRA 3DDSA 4HYYA 4R2JA 4C30A 2HHHB 2NO5A 2X2FA 2ZIXB 3DP9A 1U7DA 3ITKA 4RZHA 2ZBPA 5L3ZA 4TL7A 3GLIA 2AN5A 4G09A 4J0JA 1SOAA 4F2PA 1BVHA 1GCOA 4A92A 3VMMA 4FQ5A 2B0CA 5KVSA 3PXGA 1H66A 2LIVA 2RGWA 3NETA 4D96A 4J03A 3OBBA 2DX7A 2I87A 3MUNA 3MYRA 3QVKA 1F6WA 3G2KA 1WY5A 2GDJA 3KWMA 4S1WA 2XB4A 4JLMA 2CHFA 1CNMA 5I7SA 5KKNB 4P7KA 1WMSA 4CMAA 2J3IA 4D3SA 1E7YA 3E9RA 3CG0A 2P8JA 3MXOA 5C53B 2Q1YA 5L7WA 2IOQA 4EJ6A 3K70D 2FETA 3ZJ5A 4LXXA 1AZSC 1S2IA 4ND1A 4EUNA 1RHKA 1LNQA 2NOAA 3HXMA 1CVRA 121PA 4YI5A 2H2HA 2VPQA 1ISIA 3LUHA 3DV0A 3HB0A 2W93A 2Y0EA 1H94A 1W2GA 5EL0A 1LLFA 5HGJA 2BUCA 5F1OA 5JYCA 3HKBB 2REBA 2JA1A 2X5JO 1PWZA 5KB3A 1OFGA 1ENOA 2FRVA 1U2SA 1QWSA 2Y4OA 2RGDA 4U7HA 2AG5A 4ZVOA 3N2LA 3KUUA 3LQYA 3V42A 3DR3A 4KV7A 3O8RA 1K92A 1JKIA 3IPAA 4WECA 3VXKA 5ILOA 1QRUA 1X1DA 1MENA 3E9EA 4L08A 3GV0A 4RSMA 4EHFA 3R20A 1TUBB 1JP7A 1USKA 1XCOA 3A1FA 4M0MA 2IHBA 2NN3C 2F64A 1Z0IA 5AJTA 4ZZ2A 2O3SA 3P0RA 1K0FA 4L85A 5AIAA 5HR5A 1ND6A 1PL7A 4LBYA 5C7LO 1OFIA 3SBXA 3WLEA 4TKLA 4PQEA