4OFXA

Crystal structure of a putative cystathionine beta-synthase from coxiella burnetii
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
316
structure length
288
Chain Sequence
MVLDNILQVIGKTPVVRLHRIGQSLPCELYGKCEFLNPGGSVKDRIGAAMIESAEKQGKIKPGDTLIEPTSGNTGIGIALAGAVKGYRVIITMPEKMSHEKQVVLEALGATIYRTPESHISLAKRLNQEIPNSYILDQYSNAENPDIHYQTTGQEILDDMGENLSMVVMGVGTGGTIIGVAKKLKEVNPSIQIIGVDPIGSILGGGDNNLIDEYIKINDKDSFLMARRLIREEGLLVGGSSGSAVWAACQAAQRLKEGERCLVILPDAIRNYLTKFVDDAWMKAQGFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Cystathionine beta-synthase
publication title Crystal Structure of a Putative Cystathionine beta-Synthase from Coxiella burnetii
rcsb
source organism Coxiella burnetii
total genus 99
structure length 288
sequence length 316
ec nomenclature ec 4.2.1.22: Cystathionine beta-synthase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ofxA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ofxA02
3V7NA 1J0AA 3AEXA 5DW3A 5I7HA 1BKSB 1WKVA 1X1QA 1TZ2A 2V03A 3IQHX 5C3UA 4L28A 4D9NA 4LI3X 1TZMA 2TRSB 3FCAA 3R0XA 1WTCA 3PR2B 3TBHA 4D9MA 1KFEB 1V7CA 2RH9B 3SPXA 4AECA 1BEUB 3DWGA 2J9ZB 2D1FA 1Z7YA 5CVCA 3HMKA 5DBHX 5KZMB 4D99A 4L3VA 2EFYA 2JC3A 3VSAA 2CLHB 4D8UA 1A5SB 5B1IA 4HN4B 1K7FB 1K8YB 3L6CA 4HO1X 5J43A 5DVZA 5I6DA 2ISQA 5J5VA 1TJPB 2CLMB 3R0ZA 3SS9X 1JBQA 5JJCA 5KINB 1QOQB 2C2BA 1TTQB 1A5BB 1K7XB 3PC4A 5CGQB 2EGUA 4D9GA 1KFKB 1UINA 3DKIA 4JBLA 4D9KA 4AIRA 2ECOA 1F2DA 2J9YB 3VSCA 1FCJA 1K8XB 3CEPB 1WBJB 4QYSA 2ZR8A 5IXJA 4ZQCB 3DWIA 4HT3B 1Y7LA 3ZEIA 1C29B 1C9DB 4D9CA 1K3UB 4IL5A 1KFJB 2DH6A 1QOPB 5T6MA 1P5JA 5DW0A 3FGPA 5B55A 2BHSA 1Z7WA 2CLKB 2ECQA 2GN2A 2O2JA 4JBNA 4LMAA 2Q3BA 2O2EA 4H27A 5IWCA 4D9BA 1PWHA 2PQMA 3IQIX 5DBEX 3RR2A 1TZJA 1K8ZB 5I7AA 5EY5B 3VSDA 2RHGB 3VBEA 5I7WA 4D96A 4XUGB 4ZU6X 2CLFB 4OFXA 4ZU1X 1O58A 1J0CA 1KL7A 2DH5A 1VE5A 3PC2A 1FUYB 1TDJA 3X43A 2C2GA 5I7RA 4NU8X 4NEGA 3AEYA 5B1HA 4D97A 1OASA 4D8WA 2Q3CA 3BM5A 4L0DA 2TSYB 2WSYB 5B3AA 2CLOB 4L27A 1A50B 1E5XA 2J9XB 4D92A 1RQXA 5D86A 3SS7X 1UBSB 2ZPUA 2Q3DA 2TYSB 3L6BA 5I7OA 2CLEB 1J0EA 2GN1A 5IW8A 2GN0A 3T4PA 1M54A 3VC3A 4HPXB 4WX2B 1KFCB 5BW6B 1J0DA 2ZSJA 5D84A 5B36A 1TZKA 1V8ZA 4D9IA 4COOA 5JISA 2CLIB 4HPJB 1A5AB 1KFBB 2RKBA 4Y6GB 1CW2B 2CLLB 1VE1A 1UIMA 5E0KB 1K7EB 5HBGA 4D8TA 4I1YA 4PCUA 3IAUA 4F4FA 1J0BA 3IQGX 4OREX 1PWEA 1TYZA 3PC3A 5B53A 3L6RA 1VB3A 1CX9B 2BHTA 1C8VB 5D85A 5D87A 1V71A 3X44A 4D9FA 4KKXB 1WDWB 1TTPB 4LMBA 1D6SA 4D9EA
chains in the Genus database with same CATH superfamily
1CJCA 1E3LA 2W4IA 5AKZA 3TFWA 4BFCA 5LDDC 2AG6A 4A2CA 1XOIA 3WJ7A 3ZW7A 3USZA 4ERXA 4XR9A 5LQAA 1PI3A 1S2IA 2FR0A 2FAXA 2ORWA 3HRKA 4X8HA 4UEOA 1Q3KA 3JPYA 1UMBA 3U3MA 2YHBA 2WSSD 2ZSDA 3O4IA 1C0KA 2YWXA 1CEYA 1U02A 4ZOBA 2WU1A 1TMYA 1SB8A 5ALGA 4CKWB 4C6TB 4AZVA 2AN9A 4OP2A 5AK3A 2QU8A 5J58A 2OUIA 3NHMA 3TCKA 5BN5A 4X0EA 4A8JC 4LE0A 3RS8A 1NYLA 2I6GA 3DH0A 5JNRA 4MV6A 1SEVA 3WIUA 4F8YA 3CEJA 2ZULA 3FWHA 2N1MA 1XA4A 3MT0A 4YRFA 1TLLA 1T0BA 4P4SB 2DPYA 3UHPA 4MRRA 3FPFA 3Q5EA 5HZMA 1N0HA 3RS9A 1YB2A 2XVMA 1HF3A 1M6NA 4I1IA 3QX3A 3DG9A 3O7WA 4LK3A 1NI4A 3IILA 2YJZA 3KHKA 1P39A 4XDHA 3KKNA 3ZK9A 2Q9UA 4Q24A 3UB2A 3RVOA 2JEZA 1E59A 2AG1A 1TA0A 1PX0A 2H5EA 4HB2A 4K6HA 4CCWA 3F6YA 1YKSA 3AUXA 3PBKA 4YJGB 2L18A 5KYGA 3L4JA 1D2AA 1AT1A 4D0GA 3MWJA 1U3GA 2AC4A 3L7NA 3IV6A 2BIFA 5AHRA 3SQXA 1GNVA 1YT5A 4K6CA 2BZSA 4BNNA 2O7QA 4P3YA 5GONB 2K5UA 3L8DA 1PE0A 1T8PA 3URKA 4HAOA 4QUBA 3FFTA 2C5GA 2MSCB 1IN8A 4MI9A 4W8HA 4GI7A 2UZ3A 5BYAA 3ESXA 1BDHA 4MQ6A 4WZAB 2PQ0A 3UN1A 3ENZA 1N0VC 3L1HA 3DEKA 1BN7A 3AI7A 3C70A 3H5AA 4EF4A 1A3CA 1GDDA 4B46A 3A4LA 1Z8DA 3O1HB 4RELA 2Y8EA 3V2UA 1AV7A 3CCCA 5B1HA 2QAGB 2BEJA 2IHYA 2YMMA 3O5AA 2GTIA 2OSBA 1KARA 3O8QB 1UXOA 3MAJA 3ND7A 3F74A 4FNGA 3MTEA 4XQ9A 4KDEA 4QUGA 2HYIC 3HY6A 1DG1G 4H7HA 3TR0A 2GXQA 4A0GA 1AKYA 1PJZA 2WWFA 2FGJA 2P40A 3EOZA 4JVMA 4RVOA 1PX2A 2C7PA 2BRUC 2XT0A 2VI5A 2XGSA 1ISIA 4UXJA 4I1OA 1XZDA 4PN3A 3MNFA 2QA5A 3B1WA 3FYHA 3OT4A 4GYYA 4XJTA 3KQTA 5LWHA 1RJDA 2C58A 3M5CA 1J5EB 2O3JA 4ZVVA 2WZCA 1N2SA 4M99A 1HT2E 3N2ZB 5EJGA 3ZNQA 3K4QA 1YZKA 4EHFA 3G0HA 1SXIA 1Y9DA 3CNBA 3PNOA 4ESEA 4B5LA 3C3EA 3WLEA 5AIAA 1VHQA 1NRIA 1MAAA 1BX1A 3DXYA 3CM0A 4OBWA 4Q1EA 5KKAA 3T0GA 2QVZX 5JSYA 5I5EA 3GJ3A 3FPAA 3E3NA 4ZQGA 1ITZA 2WEKA 2F3SA 3PVZA 1Z0DA 3SC6A 3SEZA 1GQFA 3FUCA 3OURA 3ZBTA 4I8DA 2UZ1A 1YZ3A 4MITA 2JLBA 4PFQA 4FFPA 1GU0A 1ZU5A 3HKCA 3OOYA 1G6HA 5TF0A 3WB1A 4C1NA 1GFWA 1AGNA 1KZ9A 1ULUA 2JI9A 5DJ5A 2Q7OE 1NRXA 2ZJ8A 3IMFA 5AM4A 2GDZA 1ZNWA 1WOYA 1E9EA 4J75A 1BCRA 4RJKA 2OWEA 4UAGA 3TUJC 4A6DA 4BZQA 1CLUA 2JCYA 1AG9A 3FDFA 4GOND 4GXNA 2Q9AA 4JUIA 4EAQA 4IIDA 2QP4A 2SCUA 2YRWA 3MCUA 3QFTA 1DQZA 2DUMA 1LDGA 2FPMA 1YQTA 4MVJA 2FPXA 4MWTA 1V7CA 1O6FA 2ZJ0A 1JJ7A 4QASA 5F23A 4MRAA 4REMA 3VYRB 3B5JA 2FW7A 1JI0A 3MXTA 4DN6A 2LD4A 3I0MA 1SQ6A 4FI3C 4RDXA 5L3SB 3H2ZA 5NULA 4OFWA 3BTSA 1GQSA 3OPQA 1IPEA 5B2ZA 1MEEA 2YMPA 3DFUA 2WMOB 2YCLA 3BCSA 4IMPA 1I7LA 2HU7A 1NN5A 2XGGA 4R2MA 4CTOA 2FUNB 3P0IA 1I2CA 1Q77A 1UP4A 2FR1A 4LOJA 1Y9ZA 3PC4A 3UPUA 3DC7A 3ZGOA 4JBLA 4NI5A 2Z2ZA 4OHRA 1Y1RA 3FVRA 5D01A 3I73A 5EXTA 3S2ZA 3VSCA 2NP6A 5FOUA 4EG4A 5JJKA 4ZAXA 5K0GA 2EZ8A 2PL9A 1QIKA 2VJKA 1DWPA 4X90A 3FF1A 3CT4A 3I9OA 1IUPA 2GYYA 5CFRA 3ANSA 3C7TA 4MVJD 3RYHB 1Z3CA 2BW0A 4AMGA 621PA 1O6GA 5HNKA 4JJ6A 4MWBA 3GVHA 3VDXA 4YAEA 4AJ9A 3W6OA 2WI8A 3LC7O 3HM9A 1TE2A 1JN0A 1HT0A 4GC9A 4RENA 5EERA 2ATXA 2OD9A 3PC6A 5ER9A 1VCHA 1H0RA 3WXMA 4B4UA 4HLCA 5BW4A 5LXTA 2ECQA 2EL7A 2NXCA 5DNVA 3DJFA 4TS1A 1KDRA 2RDMA 2H4JA 3W8NA 5THXA 1WUHS 2VUIB 1XZJA 3JYHA 4UJ5A 1KU0A 4GR4A 1QV9A 5ALNA 1KE2A 3B82A 4X1YB 3ZH2A 4CCSA 4CN9A 4XUGB 1XK6A 3IHLA 1GD1O 1H2XA 2PSSA 1CUZA 1WU7A 4CMEC 1MB0A 3PUJA 1EQAA 2OGWA 1QPBA 1NKTA 4WJKB 4PYJA 1BMDA 3AIIA 1AVTA 2ZRLA 3I6MA 4FWBA 1QF7A 4MJ3A 4OO3A 4JYZA 3DEJA 3OIDA 4N0QA 3MPUA 1AHNA 2P9QA 4OHBA 3GJ8A 1N7JA 4IIJF 1T2AA 4TMXA 3RV3A 3SHTA 1QRUA 4O1HA 3CUTA 3IKJA 3L41A 4DYDA 1OYVA 2PSJA 4E51A 1FNMA 2R0QC 1MJGM 3CGWA 3CRQA 4H3VA 5IZ4A 2MHCA 4LXQA 1T5LA 4B4WA 1RQXA 3GPCA 1H0KA 1TM4E 3OCCA 3CE6A 5HCUA 2EV9A 2Z0MA 3OEHA 4WY5A 2GK7A 1NG1A 4K3VA 4Q9IA 4QG7A 3CW9A 2V5VA 1QFMA 4N40A 2YOHA 4F9GA 1T8SA 5CGZA 1NJ2A 3GA7A 1XZCA 1X2BA 3M6XA 2ATVA 3H18A 2W2LA 2XUQA 2ZWMA 4HJXA 4JCOA 1U2SA 2NU7A 2GRJA 3Q8XB 5HK8A 4AVYA 1Y80A 2Q3JA 1WL8A 3KEGA 1M34A 3PNPA 3ZU2A 721PA 2QTCA 3HJAA 5AWFC 4MYRA 3A2LA 2GPTA 2ZYVX 5FR1A 1XHFA 2WW8A 3Q2KA 5IXSA 4IICA 5HRUA 5CBKA 3NHYA 3CX7A 3KFVA 1U3FA 1ACJA 3ETGA 3KALA 4AKSA 4DLKA 3ZKWA 4D9FA 4LDNA 4DOMA 3MWYW 3BUSA 4WLVA 3BGIA 3OEHD 2Q1YA 3K05A 4G8BA 4K2AA 3LQRA 4KWTA 4WDRA 2AN3A 4GI2A 2XOKA 3KB1A 5DN6A 4G67A 1XZBA 1P80A 3SJAA 3A1EA 2FPIB 3BB1A 3B7PA 3A1DA 1HFWA 2HH9A 3KYDA 3LPNA 2X0FA 2BMDA 3A58B 1U5BA 2CE7A 2W2LD 2AMJA 4IHKA 4MJXA 3LH5A 5JUWA 3ZE1B 1GPUA 4M46A 2V9PA 4PZLA 2YY5A 4KXNA 5CDTA 3GD7A 1W88A 4GRIA 5B64A 1E6MA 1OZAA 1RWQA 2NXJA 2PGOA 2I4NA 1IY1A 3OLVA 3ZBPA 3VR1A 2ZCUA 4YO8A 1R6VA 3UVEA 5KDOA 1L4BA 4XFDA 4R54A 3PC7A 2JZCA 1GCGA 1SU6A 4HGYA 3OPYA 2CMDA 4LYYA 3G2KA 5FWXB 5K7SA 4Y0AA 2VBCA 2OHXA 4O4JB 1NI5A 5DVZA 4ZEVA 4OTZA 5DN6D 3P9YA 2HNKA 4WFJA 2XOKD 3HUTA 1F20A 1NBME 3KVVA 4D4GA 1B74A 3LCJA 3K6RA 1M2JA 3GX1A 1P2TA 2Q5IA 3NV9A 1RBYA 1N1DA 3DWFA 2D5IA 4ND8A 4QQ8A 4ZQFA 5IVDA 3VH2A 5MFZA 4NQRA 2WB2A 3U61B 2II6A 2C54A 2HK6A 4AP5A 3WK7A 5IJWA 1AUQA 1QYXA 5C8ZA 1N2GA 3OX4A 2FPPA 4FOOA 2UXCB 2COKA 3QKRA 7REQB 1OIWA 4NOKA 3A1NA 1WXWA 1HLGA 4ANFA 4D1YA 1GV1A 4BX9A 4POOA 1I7DA 1K6XA 1XXHE 4ZI5A 2Q9CA 3ZE7A 2WF7A 3JWEA 3GEBA 2OV4A 5EIWA 2OXTA 1V1MB 4DMKA 4UBMA 1ZRHA 1USWA 1QU3A 5K3OA 1JQKA 1O95A 1ISSA 5E2IA 5K6TA 2VPXA 4XGNA 2NT4A 2J6BA 1UMBB 1OBVA 1P19A 3JWGA 3O1JC 1JQLB 3VO2A 5D1HA 1UMDA 3CEAA 4FR0A 5AKIA 4XYMA 1RJEA 2EZUA 2FX5A 3HHPA 3KOUA 4J1NA 5FYQA 4DF3A 4EJ2A 1F5SA 1PDVA 1GLVA 2ZE8A 5E2BA 4AWAA 3ABQB 3F3YA 4KXYA 1XA0A 3WWZA 3AL0C 4HAXA 5JYEA 4UMFA 4M0FA 2NO9A 1P1CA 1JDUA 2F43A 4H6WA 2ETVA 1IEVA 4MR8A 1IXKA 4R83A 4FEAA 3FNHA 5BN5B 5T4HA 5DYWA 4F11A 1SOMA 2D1SA 4PR3A 5DXFA 3SX0A 3IVRA 3TR5A 4YCNA 2GKGA 4IP0A 4MS1A 3KJFA 4S1NA 4F0JA 2B3TA 5TY0A 1T9ZA 2RB4A 3IQXA 5CA0F 1AQJA 4MQFA 1EX9A 4IDQA 2UVDA 3IAXA 1O95D 2GBCA 2VXOA 3PL5A 1K08A 5T4FA 1K6JA 1N8TA 1NI4B 1YQGA 1CR6A 2PPLA 3KOWA 2Q2NA 5BQXA 1RRCA 1JF8A 2PMDA 4CKEA 5GZ1A 3CJTA 3DD1A 4U2KA 5EVJA 1ZJ4A 5BN4A 4UUBA 1ZP6A 2B35A 3MCVA 5JSZA 3PX7A 1RFLA 1WB6A 3G88A 1TQHA 2NO6A 2R1TB 2VHCA 1GZVA 2ZU0C 4M0DA 3J7AC 2WRZA 1TK2A 3L9XA 1ZVVA 5D2CA 1VMKA 2Q3MA 4EG7A 3AXTA 2QZ4A 4LTMA 2XITA 3LPLA 2NU6A 5KYKA 1E1YA 1ZINA 4C4AA 2AI2A 2VF2A 3JR7A 5D85A 3WDSA 5KOIA 3CR3C 5C1DA 1ZU4A 1H6CA 2JGDA 4LY0A 2C4WA 2R62A 3FPSA 3ZCQA 1OX6A 2JIOA 3CKYA 1KKMA 1N6NA 3D6UA 3LP8A 4HSEA 4LOHA 3WLOA 3DVSX 5AK0A 1EFUA 4CUZA 3BA6A 5DI3A 4ZIRA 2SBTA 4JXZA 1J39A 4PZYA 3PR2B 1A2QA 3F2IA 2OGSA 3A4NA 1U7XA 1LY1A 2VR1A 5LNK6 1G3MA 2IZ5A 3N2GA 4V0MA 3SZMA 4BP3A 2GN6A 2J5KA 3QBTA 1BE0A 2AF4C 2IVFA 4HDQB 4RIHA 2ZYGA 1OLXB 3AVTA 2ICAA 3PLNA 3LQ4A 4Z2AA 4OIMA 2JLVA 3I52A 5LA6A 5ICCA 4FR2A 3ZJVA 2HWYA 3AFGA 2O57A 3DKRA 3PSHA 1G8SA 4TKUA 3CNNA 2LUOA 4WNAA 5AOBA 1EDEA 3UWKA 1QOZA 4JGBA 4ZI2A 3ZD6A 1T4BA 3MWLA 5BV7A 1CUGA 1KJ8A 4AL4A 3H4IA 1A9RA 3DKIA 1LI7A 2WKPA 1NBEA 4EPTA 4YJHA 1IMOA 3DDHA 3ZWDA 5HK9A 3CEPB 1YTLA 4ND6A 3X1ZA 3SBOA 4MULA 3K9GA 1Y6GA 4HRYA 5CIWA 5CM9C 3R9XA 1XSEA 4IRUB 1RU3A 2PYZA 3OKAA 1EVKA 3L05A 4IKOA 1CNEA 5I9IA 1NRJB 1UP7A 3PFKA 2HDOA 5DF1A 2YDYA 4PPQA 2UZ1B 3H4TA 4AG3A 2B94A 1A27A 1T3HA 4I5DA 5IAGA 1PJCA 1VL6A 1XYYA 1PQYA 1SBHA 4PX5A 3COYA 1KDYA 3RU9A 2BH9A 1HMYA 5EP2A 2A9JA 1XRRA 4QGSA 3USCS 4BX8A 3QE9Y 4RVHA 1PSWA 2D1TA 3IHKA 1LVGA 3M4YA 2OL4A 4GOJA 3C7CB 2H5JA 1VKZA 1I33A 4PYIA 2M6LA 1S02A 4CKBA 3ZDYB 2FX3A 2IYFA 1JA1A 4KFTA 4DILA 2C9ZA 3OF3A 3SFTA 5JRDS 2AZMA 4TL6A 2O3TA 3LVFO 3PHJA 4JD5A 5DHAA 3KNZA 2WMYA 3Q3CA 5JXWA 1PZMA 1CS0A 4ABTA 1TUBA 2RGGA 2OUKA 2XDQA 2BMEA 2CCKA 5LPNA 3LLVA 1V8FA 1L7VC 2B0JA 3IP1A 1TOAA 2EFJA 2QL7A 3U7QA 2W43A 3FTQA 1OI2A 5HIJA 1FW8A 2VWGA 4Y2QA 1QXSA 4BLVA 1JTVA 2E4ZA 3ABZA 3QUBA 4Y2TA 3I9MA 1HR0B 2PKCA 5ERXA 3G82C 3KOXA 4NK5A 1L4YA 3DNMA 3JVDA 2J5XA 1Q15A 1SXJA 1UK8A 2QWXA 2PGLA 4M0LA 4JMLA 1W36D 3LZDA 1TZCA 4I19A 3R8CA 5FWYA 2QYSA 1SBYA 2BKLA 4FHFA 1JDSA 2HGSA 3AETA 4G0PA 4G5XA 4MIOA 5CLJA 2RAUA 4RD1A 1MC5A 2H2IA 1SU7A 4MS4A 4ZCMA 3RKUA 2V7EA 4Q4JA 4RHYA 4A0HA 5TB5A 3WKDA 1Z0IA 2H92A 3ISTA 4L4SA 2O8FA 6REQB 2IYNA 3C24A 1FS4A 2HHCA 3KX2A 3OZSA 1JEEA 2Q1WA 5DBGA 5FX2A 1U2GC 2NX2A 1TL7C 2GAOA 3G7NA 1FRNA 4I7EA 1A9OA 2CK3A 5E1OA 3I6IA 4FFWA 4JFRA 4BLWA 1CYEA 3UOWA 1A7KA 1E2IA 2OHJA 1LK7A 1XB2A 2FFBA 1T5HX 3CN9A 1SKQA 3MT7A 4OLFA 2M98A 3U6BA 2B37A 1SXJD 4FSHA 4R40A 1DAOA 5KZMB 4YQZA 5DO9A 4U7HA 4B6QA 4V24A 1NW8A 3D3WB 3SAJA 1XU9A 1YHNA 2O6HA 2HBRA 3G8BA 1YCFA 1LQ2A 2XWQA 4IJ5A 4O2AA 4PLTA 5ICGA 1QU2A 1XDWA 4WZ6A 2G5PA 3LUCA 4M8IA 2B1GA 3U19A 3E3LA 3TLYA 3EBPA 4RY2A 5JJCA 4WNYA 2FOIA 2RIRA 1ENYA 4R8LA 4GX0A 4YONB 2EKBA 4EVQA 3GEEA 2NU7B 3RK0A 3HBNA 1N5JA 4L4UA 5EZQA 4XGRA 4HVCA 4RJJA 2CK3D 1M34B 4ZAZA 5JC1A 1MT3A 1JA9A 1UWVA 5JZSA 1T5IA 5UKDA 5F2OA 2C4TA 2D7CA 1N5RA 5ALQA 4IF6A 3KL4A 4G37A 3B78A 1V1RA 4O4HA 2FWRA 3TTYA 3ZKWB 2PEZA 5G41A 1B1AA 4MV7A 4WOKA 4YJ3A 3OQIA 3BH6A 4PM4A 1JT2A 2ZEJA 3E1KA 3K20A 4JEUA 3LT0A 1S8NA 1VECA 3U4QA 3TLCA 4PZ0A 3F5QA 4CM9A 2XBMA 5EIBD 2NZUG 2QZ9A 4UM8B 3CWCA 1I8TA 5EP1A 4IINA 4D4KA 3THWA 3V8QA 1YDEA 1R9GA 4RCYA 1QV6A 2VJDA 1U5BB 2RC6A 4KV7A 5K3SA 4M1SA 4MAFA 3H9GA 4CM8A 1DCMA 4EEXA 2W2TA 3KBOA 5EZYA 1Q95A 4O4LF 1ZD5A 4XVHA 4J03A 4U4AA 3ONWA 1CQPA 1T3TA 2R6CA 3CUVA 3OKCA 4RTMA 1W88B 3MWGA 2O59A 5CNKA 1OASA 1OGIA 2RGEA 2JAPA 1LRJA 2WU3A 1EE1A 3BG5A 4QGAA 4QKQA 1TGYA 1JEAA 4RPHA 2PT6A 3R23A 2UU9B 4MR9A 1CZRA 2QTWB 4QUHA 3TNYA 1G7RA 2PJDA 1CUSA 4NAUA 4CM9D 4JEMA 5JS7A 3NRCA 3QMPA 3ZJUA 2OHHA 5GV8A 2HA5A 2IEGA 3CRVA 3VKFA 4F4JA 5B7GA 1YC5A 1HEUA 4MAMA 5IT9A 3I4CA 4FGLA 2J67A 4ND8B 1SVWA 1QUFA 2W8ZA 4UBKA 2EXXA 1GPMA 2V7GA 5LCXA 5IT5A 3M4NA 4COOA 4MDYA 2NV0A 3WQRA 4BRUA 3KFLA 5MGBA 2Z2KA 4DCMA 4Y2UA 3IUBA 2FPPB 3ZXUB 3KTDA 4E4YA 4GC5A 1UT6A 3AR6A 1DIRA 3EZ2A 2GDJA 1GJRA 4AD8A 5K8IA 4PANA 3PZRA 1Y9AA 4LJAA 4TT3A 3T4UA 4OYRA 1Y5IA 2RJ3A 3YASA 5IKEA 2FUG6 4M8LA 1UJ5A 3USES 2VATA 3TIFA 2N42A 2XRZA 4JA0A 3LUAA 2V1UA 5JH7B 3GIWA 3K5IA 3EH1A 2FZCA 1VYVA 1FQWA 2HBZA 1H3NA 2VEDA 3U0VA 2YV5A 1SA0A 3N8HA 4HQNA 2ZTSA 3TX2A 1UMDB 1W34A 4GMXA 4QXMA 5AIBA 1MV5A 5A9SA 3VDRA 1EMDA 3HYLA 4HAVA 1PSZA 4I4TA 4TV8A 5K8TA 1JWLA 4AI6A 3R8FA 4OHZA 1ORWA 1PUJA 2F43B 4YV7A 4IXNA 2H17A 2WJIA 4KLZA 1PZXA 4TT3D 1W9HA 3CCBA 4MS1B 3UHAA 4KZPA 5DBHX 1N2CE 3G9UA 2DP4E 1XMJA 1Z45A 3L7DA 5IK2A 1H4TA 3I5YA 2QDKA 5DHUA 5DM60 5DHSA 1RJ9A 3LXMA 4CM7A 3G1UA 2HQBA 3VJLA 5C4GB 4KFSA 2DWPA 5HE8A 2OWDA 3SIRA 4Y0NA 1JJVA 1O95C 4CKEB 5IFLA 3QXJA 2MYPA 3WAJA 1XQYA 5BN4B 4R9RA 1IUKA 3FSEA 3LPCA 4IFTA 4YAWA 4R6XA 4POAA 2Y1OA 4OYYA 3R3HA 1G5HA 1DC6A 3PRJA 3PQ5A 4RXUA 4FB5A 4HDKA 4YQEA 2QD1A 1VBNA 2PXCA 3AJ8A 1KO7A 4FDLA 3ROEA 4IG9A 4BN0A 1XPRA 2AUMA 2QAIA 4AUKA 4U8HA 4AY6A 3A9RA 2NU6B 1FK8A 2XGMA 2YZ2A 4JL8A 4KG7A 2ZRDA 2XNCA 4OVKA 2NZJA 3FDZA 1PAUA 4F4DA 5IK2D 1YFZA 5K0CA 2JGDB 2VQDA 4PZDA 3BGDA 3ICVA 5E8JA 4OUKX 4RIIA 1E1LA 1RE1A 3KR2A 4UCXA 4F04A 4BWVA 1W96A 4G36A 4ZIRB 2J32A 4JKOA 3T1YB 1EE9A 3JATA 1NBIA 5DI3B 5ICFA 2GBPA 3WI7A 5B37A 2RI6A 4EGAA 1JFLA 5HZHA 3CZMA 4GUDA 4MXDA 1WXIA 3QPWA 3TDMA 2YHIB 3N2GB 2JAXA 3RRFA 1GR1A 2P6OA 2IY9A 1RWWA 2FZ4A 3NFRA 3F6SA 2RJNA 3O8OA 5FA5A 3K9QO 3CVXA 3V1MA 4PLYA 3DONA 4BVJA 1IBLB 2PM8A 4PSCA 3TQOA 2H54A 1ZMTA 2OB1A 3R3JA 4IOKA 4PSVA 4Q03A 5HHTA 3GC6A 4D25A 2C9MA 4CG1A 1I2BA 1I32A 1N2ZA 1WPRA 2OCLA 5IM5A 4E31A 5DK4A 3O4VA 1LDEA 1RWPA 3N0WA 3TL3A 4Q4HA 1C7JA 2AMYA 3VMMA 2O54A 3VPHA 1I10A 2M1XA 2GPYA 2DG2A 3RAGA 1U11A 2BFDA 2HRQA 4LQDA 2DFLA 4U2FA 1UFOA 1CP3A 1M54A 1QVRA 2DZDA 1X92A 4LRUA 1ZH8A 1AKVA 1VXRA 5IVIA 1ZH4A 2FR8C 3PYXA 1W4LA 1YS4A 1Q7GA 1EUCA 4IBOA 4WKPA 3CUKA 1ORHA 3WGMA 5F2NA 1JPJA 3R9XB 4YLGA 4WHMA 3RG2A 1SUSA 4OLAA 1MJHA 2EF1A 5KQPA 4ARUA 4ODIA 1EFAA 3QX7A 4P3XA 3A1UA 4QZVA 3JARA 5DTIA 1RM5A 3S7ZA 4LVCA 2JBHA 3D8TA 4KMSA 2HPHA 3X2FA 4KEAA 3TLGA 3UCEA 2ZYDA 4XWTA 4GP9A 2HIAA 3GOHA 4HVLA 5ULLA 2HK8A 2QI9C 3HU2A 3PJFA 4D56A 5CDFE 5JNTA 4F4CA 2WAXA 1E2GA 1UL1X 3D4PA 3ROZA 4KR9A 1WKVA 1EJ0A 2HLPA 1PNRA 3EQ2A 1K1EA 1P7VA 4GYWA 3O1IC 4J0HA 4EHKA 4IDEA 1RRFA 1RZVA 3FDJA 2DPXA 2LGJA 4IIBA 4MYSA 2CZGA 2YWFA 2P3QA 3EDYA 4ME6A 4AWXA 4CKBB 4MROA 1VMEA 3TL2A 2GD6A 1NXSA 2NN3C 3FHOA 5BPHA 3VHRA 3DNFA 4Z54A 1JX6A 3GHYA 3PEUA 4YALA 4YRPA 5G3ZA 1ZCZA 4RHXA 4HZUA 1TUBB 1VZ3A 1Y5MA 1YRHA 2BI7A 2PZMA 2IT1A 4FCCA 4KAAA 4FEGA 3FR8A 4YI3A 1LPPA 2UZ0A 1XLTC 2XDQB 2VXYA 4JOSA 5AKEA 1ID8A 1H93A 1WW2A 2CKDA 1G59A 5H9VA 1TIPA 4C0LA 4UCFA 1T9DA 4XCQA 2X3UA 3DE5X 4G85A 1IG0A 1BXZA 2W8BB 2BEUA 2I8LA 5EIAA 1S3IA 3RVRA 3BMCA 2GVDC 4KJZA 5TPWB 3MSXA 3WGHA 1JLLA 1KIMA 1XVUA 3REOA 5ED4A 1A9SA 3R0IA 2YL2A 4MW0A 5HUQA 1QQ5A 1SXJB 2CD9A 1PGOA 2QXUA 4HAWA 4RX1A 1HK7A 1QOPB 5FWYB 1EWYA 4FHEA 1Y81A 4TMVA 4URZR 5JADA 4OL0A 4JHXA 5LDGA 1E1MA 1P7CA 2DKOA 1W36C 4QREA 3MHTA 4DV5B 5TMPA 1V48A 1XAIA 3CRNA 1MAUA 3F5DA 1VFPA 1TZJA 4LOLA 4Q1CA 1TQDA 2O8FB 2LCIA 1GOTA 3KR0A 1E1KA 1Y33E 4WZBB 3RSOA 3ESYA 5IXYA 5K0ZA 2P2SA 1Z8HA 2ORVA 3O47A 3FPCA 3F71A 1IJBA 4GP6A 3DLAA 3W5AA 3RJMA 1UXHA 3Q3VA 5FLKA 2FP4B 2HJRA 1RWBA 2PUVA 2CGEA 3EARA 3AESB 4OD0A 4QE3A 1QHYA 5EHIA 2HSDA 3PQCA 3F5FA 3NTVA 2AFVA 1HKUA 3JVIA 3U4AA 1ZX1A 2HK7A 1H23A 2CSUA 3LE8A 5B5SA 5IPFA 2QRJA 4C2UA 1SXJC 1U8XX 3DEYX 2QRZA 3D3JA 4PPGA 2IHZA 5DIFA 4O2AB 3HYSA 1EEHA 1XT6A 4JHLA 4RM2A 2PFGA 3ID6C 2JLSA 3LUBA 5AJXA 5ELMA 4LJ7A 1IULA 1TT5B 2GK3A 4MW5A 3SS7X 1EP9A 2FQ1A 3DZKA 3UJPA 2A9QA 3GR6A 1DRVA 3WMFA 2K4MA 4G1VA 1G60A 1G2IA 2YJ6A 4RH3A 3TDKA 4EX6A 1UDXA 4Y1GA 1JT9A 5HKLA 5KHOC 2AZXA 5A0FA 3CG0A 4AJLA 1NNEA 4JVNA 1RFGE 3B53X 4P3NA 1XDGA 1TKAA 4AKEA 4N9QA 5LP6A 4G0NA 4ALLA 1BJKA 1ORVA 1V1RB 2OR3A 2AKAB 3BD6A 4H0FA 4O4HB 4XWGA 2B8JA 4DBLE 1H2WA 1P2DA 3MK31 3OF5A 1HLFA 3OQIB 5GONF 2ZK7A 2FY8A 2BJWA 2FN8A 4MDHA 2QT1A 4DA0A 1V16A 3U4QB 1N34B 4X97A 2IZZA 3BWCA 3IPLA 4V0LA 5KYYA 1PDOA 2V7TA 4RAQA 4DADA 4A82A 4MUNA 3LSTA 4N41A 5CIQA 2FKAA 2INGX 4CM8B 5B4VA 3P2OA 4XD2A 4Z7OB 2NZYA 2ZTHA 5EZYB 2BGJA 1C14A 2DPGA 2PFKA 3HN2A 2C8VA 5FPYA 1TCUA 4C78A 3CINA 2B7LA 3R09A 1DKMA 4IZ6A 4AMZA 2TMGA 2ALJA 1ELOA 1Q7EA 1Y8RA 3Q11A 2C88A 1ZI9A 1PV4A 2C04A 2YW2A 4PLWA 5DM4A 5T41A 1QQBA 5BW8A 3SKVA 4OQEA 4QDUA 2REXB 1ZK0A 2ZVPX 4MR9B 4GLLA 1A5ZA 1FFWA 1DU4A 3D4NA 5BP7A 1CP2A 4R3UC 1QH8A 1TM7E 3E1GA 3NJ8A 1M10A 4TXHA 4A8PA 3K9FC 2FPUA 1U8CB 3QW4B 5IBCA 2OBYA 4L6CA 1CFZA 1Q11A 4IHAA 1U0BB 1ISFA 1OFHA 1OKKA 4OJQA 4XQGA 1LPOA 1Y4AE 1WXFA 2B4RO 3TQTA 1TTQB 4XSVA 3MUOA 3NDRA 1VHLA 1FRZA 1SPXA 3MQ4A 4FYHA 5GY7A 3V8EA 5C5DA 3FWKA 5CFQA 5C8YA 1FS5A 4OBXA 4FI3F 2PAFA 4RQTA 1P5RA 3GJSA 1Y8CA 4IDPA 3CNEA 1MP0A 4O2BA 4H7DA 1FFAA 3I6QA 2MR6A 3B1JA 3DS8A 1V4VA 4Y1EA 3ZZMA 4LRWA 5AOCA 5GGXA 5JPIA 3Q0TA 3U62A 2WOJA 3A31A 1GGVA 3DVQX 1I0LA 3UJ6A 1QZZA 1ADJA 1ZDMA 2ZBGA 5KWJA 2XADA 1NJGA 3EVZA 1Y7IA 3GLIB 5KNDA 5JZVA 3CIOA 1GCOA 1CXZA 1ZOPA 2WT4A 4WUTA 4Q9LA 1QE5A 1VIMA 1SA0B 2RHTA 4RD2A 1OKKD 2OD7A 1NBAA 3BDVA 4TMYA 1RLUA 3HEAA 5A9SB 1O77A 3WB0A 1KJ9A 1Z73A 3OY7A 4I4TB 4JC4A 2RHBA 5LUAA 2VHWA 3CY6A 3L7LA 1XQXA 1MKYA 2QQFA 1M33A 3LFUA 5EYPA 4OB6A 4DQXA 3AU8A 1GQQA 2NOAA 3Q87B 4DCSA 4FOPA 1QYWA 3S70A 4BJ6A 1ZN7A 3K4HA 2ZB7A 4H1HA 4WLFA 2K7FA 1FYEA 2Q50A 1JEDA 1N8SA 2W2OA 2L17A 1NLUA 1UJ2A 4BMYA 5C5IA 2W6OA 3D2AA 3KSZO 4QQKA 1A50B 3JVUA 2H1OA 2CJYA 1WF3A 4IMRA 1G63A 2ZIWB 3ZHCA 5KNDD 2AW3A 4IH4A 3DW1X 4MHSA 3ZV5A 1ESMA 5AVTA 1Q1AA 3VDNB 2WJYA 1PZEA 3T7KA 4JB2A 1KK2A 1GN9A 2VIIA 1CDZA 3H1TA 2QSZA 2GZHA 4E5YA 4ZYXA 5CG1A 1KWKA 5BR8B 3M5WA 1RR6A 1K63A 3HB0A 2ADFA 4P8RA 1GZ4A 2ZT6A 1M2HA 2CLIB 2XYPA 4HPJB 1X42A 4EKIA 5CB6A 3HZRA 2NU8A 4QUAA 1B73A 2E6KA 2FPOA 4BRZA 1ZO8A 3OLXA 3FKQA 4EP1A 1GQOA 1NUSA 3N0RA 2O8BA 3FDZB 4EJMA 2G08A 2WF5A 4HMOA 4MKFA 2NVUA 1YR9A 3DV9A 4ZYWA 5EHXA 3M7IA 4PCAA 5GGYA 4AZTA 1GGNA 2ZT5A 3O92A 3RJ5A 1FE8A 4E2ZA 1IJFA 3B2QA 3A25A 3KOZA 1NJ5A 5LZ2A 2JDID 3RSZA 4ZTBA 2HR1A 1YZQA 4IDGA 2BLNA 5HM6A 4JI3B 4KKVA 5KSYA 1EM8A 3MZ0A 1EP3B 1FP6A 3ZHYA 2ZIFA 3B8EA 5ALTA 4E7OA 3N3BC 1SHLA 1J7JA 4I3FA 2DY0A 4O08A 5GP1A 3RJZA 2ZRKA 4AB1A 4E5SA 2XKKA 1XQWA 3ICCA 4RA6A 3BFVA 2VDMB 3UQYS 3OA0A 1LW6E 3IEUA 4Q4HB 4DA9A 4CKXA 4C06A 1USUA 3FZEA 1QPZA 1RPNA 2OO7A 2EZ9A 2QR5A 3ANYB 3OZGA 4V0QA 1NQUA 2I4IA 2O0MA 4BO9A 1OU0A 5EZ6B 4R8SA 4DLRA 5BMVA 4CU2A 1GQRA 1T8TA 3AHCA 4K5QA 4X93A 4JV5B 1FUIA 4GMDA 1A5BB 4KLNA 2B2NA 1HE4A 4MIKA 1AXEA 3WWOA 2BAGA 4ROTA 3QNUA 5DGDA 1YMUA 4DSTA 4FYVA 3EHEA 1WRBA 4MPDA 2APJA 5K0JA 4G1UC 2PVSA 4IWNA 4CT5A 3KYBA 2VHQA 3OH8A 3R1IA 4NDAA 4MUKA 3S8EA 3WK5A 2HEGA 1MRZA 5DHRA 1ZKMA 2P4HX 4L57A 1S2OA 4OJNA 4UNNA 4YAJA 4CNQA 1OH8A 2C9BA 4CTKA 5C4IA 4I9UA 2YRFA 2OQIA 2HWXA 1HYBA 4L9RA 5I7AA 2Y2VA 4UHBA 3H1BA 1ZR2A 4UUNA 3RIEA 3HCBA 3BWDD 4BECA 1ZNQO 4UPEA 3ABOB 4Y7CA 2VUHB 3D4IA 2YNMA 3IAS6 2XZLA 5TDHA 4UXIA 2PGNA 2XT9A 1J33A 1KJZA 4QO8A 1XPOA 2FJ0A 1ZGHA 4CWAA 4EKNB 4K03A 4ZO8A 4HZUB 5EJAA 1SH7A 5IH7A 4ETWA 3SXJA 4C5BA 1DQNA 3FMPB 1C2TA 1OBHA 5GTDA 1VDMA 3IDSA 3V4ZA 3FD8A 2AR0A 4I1RA 5DNWA 4L9WA 4O4JF 5THQA 3TTTA 4YR7A 4U7PB 1G8HA 1KP2A 2VJAA 3QLVA 4M83A 4B44A 3PQ7A 2FFAA 4MI1A 4XZ3A 1MB4A 3GFTA 3K0FB 2JRLA 1PFVA 4KU4A 4N48A 5FT9A 1WO8A 2B4TO 3BMCB 3FYTA 2W48A 1JLLB 3UF0A 1ZGZA 1A7UA 4K0KB 2YNMD 1RLTA 1SEPA 1QX3A 4OSEA 2BY4A 3WISA 4B45A 4MP6A 1DL5A 2R8PA 3S2SA 4DCOA 2YVKA 1ISPA 3NR2A 4TZKA 5YASA 3F6PA 4KQ1A 3SICE 4YI5A 4TTVA 1J70A 1UANA 4URHA 1B4DA 3K9HA 1VE9A 4TUYA 2AOVA 2FDRA 1DAHA 2PX4A 4QOJA 3RVBA 5IWAB 3PC3A 3SS8A 1H8HA 5B53A 4R3NA 3AEKA 2BHTA 3Q6IA 4LVNA 1C8VB 1ESEA 2I4RA 5CB4A 2J0UB 1IM8A 1WDWB 1HOXA 2GERA 1Y3BE 4L0QA 3Q9LA 5EA2A 4MRVA 2IX3A 4V3BA 1I5OA 1S3SA 1C0EA 2JLQA 3AGPA 1J49A 5TGZA 2NW6A 1QRTA 1TUGA 4JQZA 4RTJA 1N9GA 3MRTA 5KWEA 3H5TA 4ZRDA 1T2EA 2VN8A 3A7DA 2RD2A 2ECKA 2G71A 1FFXB 1Y1PA 5AVZA 5L3VA 2ACWA 1QH9A 3E0QA 1VG9B 3DZCA 1Z35A 3PQDA 4K28A 3E9CA 3GJ0A 4FFMA 4Y9DA 4EELA 1LRKA 1FBNA 4MQLA 3NVAA 4IQ0A 2VSOA 4KJXA 4LWZA 4EGSA 1F8GA 3PGMA 2J6HA 4Y2SA 1H8HD 3QHAA 1TEZA 1L8XA 2RGDA 1EFVB 1TO1E 2I6SA 4B5KA 1F60A 3R3ZA 5IUKC 4IFBA 4QXRA 3HQ4O 2FOLA 3GARA 1XVAA 3C2QA 5I7EA 1YV9A 4CMGA 4C4XA 1JDBB 1N2JA 2XF8A 3DCJA 4LFBB 5TV2A 2RGBA 5AJUA 4E32A 5LP6B 2YN2A 2DCUA 1X1EA 2P6UA 3JQ7A 2B61A 3RVMA 4JR0A 1BMTA 5IUNC 1P44A 1VPDA 3AOEA 1OFUX 1Z8NA 2QU7A 5CTJA 4QFDA 5ITZA 3BK7A 1SBNE 5EEHA 1EDBA 4QBIA 4FMDB 1J09A 3GLFA 1PYOA 3T7TA 1JSLA 1DQSA 1V16B 1G8KA 1ZNXA 2GFHA 4M88A 4X45A 4X41A 3O8CA 1FTNA 1LS1A 1L4LA 1Z2CA 1Z36A 1Z7WA 3DOFA 1EVLA 2Q1TA 3MUEA 3IUYA 3DAGA 1NW4A 3NP9A 3E2PA 1USIA 4QIHA 3FUVA 2RHMA 4DY6A 1MA3A 1C7FA 2KSQA 4N4AA 3DXZA 2J3HA 4WA8A 4L9SA 3VBEA 5B58C 2HZ7A 2R4TA 3MBOA 2BP7A 4KNVA 3OTGA 2A5LA 3P9XA 4RC9A 3E9DA 2DLCX 3RREA 3W1VA 1OAOC 4UTVA 1Y8RB 4LF9B 3WMWA 1KEUA 3R7LA 3ZWCA 2ZI6A 3PFNA 3RU7A 5BWCA 3B60A 3QFHA 3VR2A 4R0NA 3WBFA 3B38A 3ZGNA 4MP3A 3RVDA 4Q15A 4RS4A 2NVBA 2BFCA 4YCDA 3DLBA 3LWZA 2YJGA 3OQBA 4OQ4A 1TTHA 3NEAA 1MIHA 4R51A 3AVQA 4G5HA 4TRMA 4BFZA 8ATCA 2D3TA 2JAUA 3S99A 2HA3A 2H65A 5TXGA 2GZAA 2WWIA 3LMKA 4K9RA 1QO7A 2OVFA 4JS0A 4RWZA 3U56A 5C8YB 1YUBA 4NENA 1TF2A 4C88A 5KYWB 2QGFA 3PUZA 1SXQA 1U7WA 1LDMA 3W8DA 1OROA 4PVCA 4F84A 3QFCA 3EPHA 2DLDA 4ZEWA 5BQ3A 1RXYA 4GVLA 4LYGA 4RL6A 3TXAA 3VDMA 1W8DA 1WDTA 1BOFA 5JHGB 1MFPA 1XU4A 2J5BA 1GGHA 4U2GA 5TQVA 1F7UA 4KQWA 1EG7A 3EZNA 3VR2D 1FFSA 4BQIA 3IJRA 4RMIA 4W7HA 4M4SA 3NWJA 3QJGA 1K0UA 1GG8A 3P2JA 2WQ6A 1CQJA 1GZDA 1R18A 2XCQA 5IDYA 4RYLA 1ZH6A 3IMGA 3FUTA 5LQNA 3JXEA 1YMQA 5DV9A 3NOQA 1W0KD 3TJMA 4RY0A 4DPLA 4MVJF 2ZUEA 4BNYA 3NW9A 1C50A 1TZ2A 3GZNA 3GMSA 3H5NA 3Q5DA 4K2HA 4XGIA 5EYPB 3RTCA 1VTKA 3V1KA 5JLAA 1B6GA 4HDRA 3COJA 2IGTA 4BGIA 2DPLA 1GNTA 3KAPA 3CZ9A 2OP1A 3ZK7A 5ALXA 1P3Y1 4X64B 2Y66A 3I2FA 3UT0A 1HORA 1NC3A 3BF7A 1QHIA 2H1SA 3STVA 4BUZA 1M1YA 1UC5B 1ZM2A 2HQ1A 2PZEA 3PPVA 2W22A 3PWZA 4CCAA 1S9HA 1A8SA 1W5TA 2ZUCA 3I64A 4MLCA 4F60A 3NC1C 5LC1A 4BMDA 3WL6A 2RH8A 2ISQA 3P9RA 3KXDA 1X14A 2ID9A 3P0FA 2H4YA 2HSZA 1V0JA 3ASUA 2C95A 3ENQA 1WQ4A 2X86A 5LXTF 1YQQA 3AEUA 2GO7A 5FPSA 4A1OA 4TM7A 2O8BB 1NLMA 2H1HA 3MTGA 5AKLA 2CW5A 2GSDA 3AH8A 3GROA 5DRTA 3GJ5A 1U94A 3FPLA 4A73A 4CQLA 4EO7A 3HTXA 2NVUB 1XR3A 3RAJA 1NJ8A 4HNHA 3WK6A 3GCXA 4E2XA 1KAEA 1XZHA 2PKWA 5J23A 2O1XA 2FOXA 2W9XA 2IYRA 3HXPA 2W98A 1KRXA 4ZAWA 3DAFA 1AMNA 1BZYA 1KXJA 4JY7A 1FDOA 3TBFA 1J21A 4JZKA 3ZJ4A 3MGKA 4JGIA 2XMQA 3WLLA 4GEKA 1H8EA 1SCNE 3ICQB 2G07A 10MHA 4DR6B 3RRBA 3AIOA 3RTEA 3Q3HA 3G8AA 1PQUA 2Y6UA 4MUHA 5E6SA 2AOWA 2PR7A 3ETDA 1MHPA 5FBVB 5K01A 1Z62A 1W1UA 2ZRGA 1TF5A 3ZV4A 2ZUVA 1ETUA 1WA5A 2AA3A 4RA6B 4RKFA 2DSNA 4TTSA 3VZPA 4GQBA 4JXKA 3MAAC 4F12A 2R6ZA 1VHDA 4WOCA 4LJSA 3L49A 4WE3A 4CW7A 4QJ4A 1MFZA 4FT2A 1PK7A 1AV6A 5TGTA 2J9RA 1ZRNA 1MQAA 1CSEE 4M7WA 1RXIA 4MCHA 2J5RA 1PGPA 1JKMA 4XDZA 1VLLA 5JARA 5L4SA 3BJIC 3V8PA 2RGUA 3FG9A 2IHKA 4OKIA 3BDIA 3UANA 5BOSA 4GDFA 2YZKA 4GWLA 4WOPA 1QHHA 1L7MA 2ID7A 1ZW6A 1H8ED 2YJ5A 3H2JA 1YHYA 3MERA 4IZIA 1C80A 2QGZA 1XF1A 4O4IA 2GHTA 3N1UA 2FWAA 2BGKA 3L46A 1W93A 1L7BA 4TN5A 2NPOA 2HMYB 1LK0A 4H3SA 3AF0A 2JFGA 4A6EA 3OFSA 1NXTA 4HN9A 1N3YA 2IHVA 1NM5C 2JGFA 3K1TA 4PNPA 3TM5A 2YWDA 1U4NA 4R31A 3BB3A 5DXJA 3A6KA 2O52A 4KXXA 3AVWA 1UEIA 4NFYA 2Q0XA 3LXUX 2FTKE 1JAXA 1CERA 1IHUA 2JCBA 3IURA 4QXPA 4DRXB 1M6YA 5E7MA 3UPDA 1QHGA 2BGGA 2Q46A 1G8JA 4WLUA 5K3FB 1X1QA 5FTJA 4TLAA 4FW9A 3JWJA 3V46A 1N5LA 4QUKA 3WLHA 3T9FA 4EECA 4GMKA 1QNFA 1KWGA 3W9BA 1XCBA 3LHSA 3B3QA 4HX5A 3AFNA 5KO2A 2Q3FA 2K2WA 4YCBA 3ORHA 3WNQA 4W9MC 3FLBA 1IN5A 2FNAA 3M3PA 4J43A 3WLAA 1AS3A 2GYUA 3HU1A 1ODIA 4KQIA 4UBJA 3H1AA 1P4SA 2IOYA 2JD2A 5DGCA 1XC7A 5KNCH 1CZLA 3SCZA 4L50A 3UV3A 1ECJA 4YRSA 2R8OA 3LY5A 1AMUA 4PQEA 1R00A 1U9IC 4PO8A 2GZRA 2QTVA 3IV9A 1M2WA 4BQEA 2Q6KA 5H80A 1PTJA 3CLTD 5KINB 4TMZA 1EWKA 5I3CA 3PFHA 4RMGA 1CRZA 5CGQB 4BOYA 2H31A 3O6VA 2YNMC 3AL3A 2Z4RA 4BVFA 1EFRA 1LBTA 1MIOA 2I67A 5M34A 2EFCB 3PNKA 2O8DA 1SCIA 2Q7XA 4FKMA 4JQSA 3SE7A 3HH8A 1PUIA 3QVVA 4TUYB 5FPHA 4MOWA 1XQ1A 2XCUA 1G20E 2W6QA 4UREA 5GM2A 1ZM4A 2W4QA 5ALMA 1N3LA 1GDHA 1HDIA 1KU6A 3JAKA 1RI3A 4GX5A 4ZYZA 3IAEA 3Q1LA 3UMCA 3I45A 3NHZA 3TJZA 1OXXK 4EJSC 3FTFA 4KXQA 1MO3A 1PJLA 2GWRA 4G0WA 1EI9A 1KOFA 2I3BA 1M8KA 1YCGA 4OQQA 3V1NA 2XGJA 3RKRA 2FWIA 3F96A 3NDPA 4H4EA 1XKLA 3GG2A 2QVCA 3RUCA 3LNCA 4BTLA 3JD3A 1XTJA 1RRPA 3IULA 5IF9A 5KKNB 4IS2A 1U9YA 4D9HA 4A0RA 3HA2A 3CH5A 4ZVPA 4KE6A 2KB0A 1NHWA 3HJNA 1JDNA 2H06A 3TNFA 5DBFA 1SZDA 2QTFA 4XIIA 4KREA 1D04A 5D5QA 1K89A 2A0WA 2WJGA 2ZQ5A 3EY4A 4CDNA 5FH9A 5LQJA 2QNBA 1SUPA 4QVKA 1C3JA 4XR4A 2PBLA 3BM5A 3ADBA 1JPNA 5JFOA 4IX9A 1SKYE 4CKCA 3ZGVA 1GYPA 4LUCA 4QU0A 1TAHA 1HURA 4F8EA 5BORA 1H2BA 3HADA 1SBIA 5F3WB 3PPYA 3H2HA 3CLHA 3VYTB 1D2EA 3NWBA 3Q3JB 2F2TA 2QMUA 2GN1A 1QMPA 2ZP1A 1OT5A 1CUJA 1E9SA 3JQ7B 3OX3A 4G84A 1Y3DE 2ODTX 1Q7RA 3S40A 1TKRA 3ROKA 1SIUA 3N6XA 5CIYA 1UBRS 3REQA 5ITZB 4LMPA 3DEAA 3UPTA 2JLUA 4Y6GB 3FLMA 4GEGA 2HMWA 1ILEA 4INAA 3NVKI 1I6MA 4RSRA 1UBEA 4YK7A 1X2EA 4D46A 2FKNA 2PTHA 3D7NA 4YXFA 5BSWA 2R60A 2IXDA 1TEXA 1BS9A 3BIOA 2CJFA 4EUFA 2IOFA 3UTCA 1GAXA 3L6OO 3TRIA 1BDBA 1CYDA 3W90A 2WKRA 4RKEA 1G1MA 1HWYA 3ROGA 1ZLXA 1UBOS 2IBMA 3F5SA 2O05A 4DWWA 2BP7B 4GNRA 1W2WB 1KA9H 1E2QA 1AK1A 1QSGA 4UCQA 2PN1A 1A4UA 1D4FA 4MGZR 5DB4A 2DBZA 3HM2A 3REFA 3G9XA 1U9CA 3T3PB 3G5TA 4E03A 4ZTZB 2P67A 2IF2A 2RARA 3SJZA 3PX3A 1OR8A 1NZFA 4AZWA 4B43A 3FUWA 4BC1A 4B7AA 1D7AA 3QEMB 2QI9F 1SHJA 4MW2A 5LA6F 1VC2A 1M6HA 4L8GA 3I62A 5K6AA 3NT4A 3SGLA 3UWPA 3V48A 5IHXA 2BFCB 4X1OA 1OF1A 3K9LA 4XWKA 3SOZA 4D8YA 1IK4A 1NASA 3ORRA 1E3MA 5E6UA 4OXIA 3U7JA 1KI2A 2A58A 1HDYA 4MVJM 1LS6A 1UZNA 4NENB 1TVKA 1V5IA 1XD2A 4Z4CA 4GOLD 3FPKA 4HGRA 1Y98A 1CE8A 2HF2A 1JU9A 4MP8A 4GSKA 4EHHA 3BAFA 3EG9A 3C14C 1O89A 5C5EA 2H1WA 2J9YB 2NGRA 3OZWA 4HHEA 5HBRA 2IU0A 1FJ2A 1OJ7A 1QVVA 3UC5A 3G9ZA 3EDOA 1E62A 2GPSA 2WFLB 3A6DA 3SBEA 4CF7A 1TQ6A 2IBSA 1Y7LA 2GR9A 3A4TA 3QKIA 4PPNA 3H5RA 4TX1A 5PNTA 4ACBA 4EITA 3S81A 3PKIA 4HNGA 4E0BA 3TW8A 1LZKA 1WULS 4YQYA 1CQJB 2BL4A 2OZLA 5F4BA 3FH0A 4MKXA 3TZQA 4D5EA 4WCDA 1NNLA 5JXIA 2QTRA 3L7AA 3CRRA 5AJYA 3JQGB 4RFSA 2FWJA 3TD2A 5AUNB 4M8KA 3NMUF 3W5JA 4S04A 3GBVA 1XEXA 3GZNB 3HL4A 4X71A 5CDYA 4WXMA 2HJWA 4MVCA 3VYVA 4ENPA 2X2PA 5DOZA 3K6KA 4QPCA 2ZLBA 1DAFA 2YR0A 4FS3A 1R12A 1H1LA 4UMDA 3E23A 1RYZA 3ZN2A 3A6LA 4DWOA 2DBRA 3O73A 3FF4A 2AFIA 2HIMA 3ZHUA 2YV1A 3CTMA 1LBEA 3CEHA 1UODA 2XEXA 2ZSAA 4DGSA 4BWFB 4WCFA 4BGDA 1UWCA 4EG6A 4C76A 3HK2A 3DTYA 2R7LA 1XP8A 2FSHA 1UF9A 3U81A 4XYEA 3MIZA 3C8MA 3R0JA 2EATA 1CZNA 4J3FA 3ZDCA 5EXPA 3H83A 1UKZA 2G80A 1KNQA 4AS1A 4NHEA 3GRAA 4D82A 3FVTA 2CJPA 3COZA 1MN6A 4JUFA 2FW1A 3T9AA 1GUZA 1GUDA 3T1VA 4M49A 4GG1A 3AHIA 3JSAA 4RHCA 3SHWA 1CUCA 1SC9A 2CWWA 3OF2A 2QG6A 1L4FA 3ZIUA 2JI4A 1JMVA 1KQFA 5HM8A 2EQ5A 5JCPA 1L9KA 2Z3WA 4H3HB 4HEA1 1QGDA 4PQRA 3H9BA 3KCNA 4ENSA 3DQZA 3BXEA 3S29A 3RC3A 4NPAA 3DL0A 1EFLA 1FZTA 1ZK2A 2PRSA 2WSMA 1ATIA 1NMYA 5D87A 2BHLA 1BA3A 1EZ4A 3SEAA 5A02A 3BREA 3FMOB 3W2TA 5EIHA 2VJNA 1YXMA 3EGCA 4CTMA 2F9FA 2FCAA 2CJWB 3JD2A 1D2NA 1FNSA 1MX9A 2IEZA 3OQHA 4FHZA 1GILA 2W37A 3AHFA 5E6SB 5F7JA 3R44A 3HVKA 4F93B 1Q16A 2ZI4A 4U1RA 2R86A 2PV7A 1B7GO 1EVEA 3FZNA 4MVJH 4O2AF 1L5KA 3LPAA 2FEOA 2OOKA 5ISMA 2BEWA 3ZY5A 5EWLA 2BBOA 4YFVA 2G25A 3NOVA 1TFUA 1NN3A 1WD5A 5JZBA 4X63A 4XM1A 2PJRA 4QBTA 4GLFA 3HSYA 4LZZA 1T6ZA 2ILTA 3GPBA 3WIOA 4TGLA 4B2YA 5KTYA 4I4NA 2PUTA 3UHJA 3QWBA 4HAIA 1ZM9A 1PJRA 3WWCA 5LLTA 3GY0A 3FFAA 1KRHA 4Q93A 5BOSB 1Y1TA 1QHFA 1UADA 1P9WA 1QHHB 1VG0B 2VDVE 4Q7JB 2GVZC 5JBIA 4D02A 1U5AA 2PT5A 4Y2HA 1UFKA 2PLFA 2PS1A 1JDZA 3DVRX 4O4HF 1NW9B 4O4IB 1ULTA 1NPTO 4E08A 4RTLA 3BE6A 2NG1A 1GIAA 1Y3IA 3I5MA 2YJNA 4YJ3F 3WLQA 4F6LA 3KT3A 1EAMA 2X4IA 3ORYA 1KO4A 3UMRA 2O2XA 2Q5FA 2WQ7A 4E5NA 3AFHA 4FIDA 1N36B 5JR3A 3AG6A 5J1SB 3V00A 1IRIA 4L51A 4Q9AA 3HP7A 2X5OA 1J97A 6PFKA 4FFBA 2VDQB 2CL6X 1QGED 2JEOA 2O20A 3CSSA 3ESRA 3JALA 1DOZA 1KH1A 2JCVA 3R4VA 4UFOA 2VHJA 3WNVA 1B6RA 1MTOA 5EZYF 1RAGA 3K92A 2DECA 4FUQA 3RYIA 2JBWA 4BNXA 1DAMA 3Q7SA 4Y30A 1JIKA 1I7PA 3AEZA 3ER6A 3FNIA 1L7DA 3NBQA 4JJIA 4MRMA 1OYOA 2SKCA 3BSSA 5LZ5A 1NXWA 3WLSA 1CUWA 2QRVB 3ZY3A 2CLSA 1SD5A 4FW8A 1HQCA 2FW8A 4PYNA 3TG2A 4QATA 1HRDA 1OGJA 4C0SA 1FNBA 1N3IA 3PQEA 1YFKA 3MEQA 3HBAA 4KQMA 3EQ7A 4GP7A 4UEWA 3FGOA 4DC0A 1UKYA 5DM2A 3K0CC 3SP1A 4N65A 1HY3A 4GMHA 1E20A 3BS4A 2HRCA 3GMDA 1TEVA 4JP2A 2QTVB 3WDKA 3AI2A 3N70A 1R50A 3KU4A 3ZY6A 2E4XA 2DFDA 1IZ9A 1QQ6A 3C45A 1O08A 3L8GA 3MJVA 3PDHA 4K81B 4K9OA 4QSMA 5DGHA 4ML3A 3E4CA 3WRYC 3DKPA 1PVOA 3LUKA 1X1TA 4WX2B 1MIOB 1ZM7A 4JVLA 5KAMA 1LEHA 1RT9A 3KJXA 5FDFA 5JAPA 1YDFA 2P30A 3ZQUA 1WXGA 1SVLA 3PXEA 1EQUA 1PL8A 4KQHA 3R76A 2QL5A 2VAXA 2GLXA 1D9ZA 3EGEA 3QBJA 1SKMA 4R2WA 2FMHA 4DUZB 4A36A 4IJMA 2N75A 1KAGA 3PEVA 4BO6A 2YMQA 1JZSA 2VCYA 2AX4A 4FYMA 4YRRA 1NVGA 2ZJBA 4KR0A 4BMPB 1RI2A 1S4QA 4QARA 1DQYA 1GL7A 4WY2A 3HR4A 3GUZA 4M1QA 2A59A 1RXVA 4D3ZA 3SU8A 3MTIA 2QM7A 4FK8A 4I4TF 2MJLA 4RVNA 4TV8F 3SE0A 3V4OA 4LZLA 5AQ1A 1T34A 4ZYUA 1Q83A 3O90A 4IQ4A 2GNOA 2H5IA 1G21A 3GQBA 1PTJC 5HRCA 3AM4A 5FL7A 2JKVA 4EQZA 1U8AA 1C0LA 2I99A 3FI9A 2QVLA 1YB1A 2C7VA 3VYSB 3DD5A 4JUAA 5I7UA 4CIWA 1BGXT 1PQ4A 2C2WA 4IDCA 1WOMA 2GEVA 2HAEA 2QSYA 1FOEB 3K70B 1KYXA 2E2WA 4GF5A 1T0JB 5CD1A 2ZZMA 2IYSA 1IE3A 5BV1A 1KYYA 3CS3A 3O2SB 4CKCB 1GKUB 1BA2A 1U0JA 3DZIA 3S2YA 1ZI8A 1C2YA 4N6OA 3I2JA 4RD3A 1PT6A 2XQIA 1QRAA 4H18A 2GJKA 1V47A 1ST3A 2DTXA 5C8DA 1Z5GA 1YUNA 4WERA 1EGMB 1UAGA 4X20A 4M9SA 5CPBA 1LF5A 1RHKA 4YMVA 4FPXA 1AA6A 1BE8A 2Z56A 2QQGA 5FL7D 3WGYA 3R8XA 3REQB 3T5AA 2Z6QA 2OV6A 1NV8A 5A1TA 2Q5JA 3O75A 1A2BA 1E4EB 4MW1A 2V6BA 5EJ7A 5DP1A 2YJ4A 3PD7A 2BMAA 1BVYF 1U9ZA 5B58T 1GP2A 3TSOA 3TZEA 1S2GA 4OM8A 2AKEA 1B8PA 4R1OA 5E9AA 4WESA 4N6NA 4Q7KA 3DP9A 1ZVJA 4QOFA 4TTAA 4ETIA 4PAQA 1KE1A 4P9NA 3U44A 4PSDA 4BKMA 3IEVA 5G53C 3HCNA 1N25A 1Z6XA 4A27A 1K2VN 4P80A 2Z95A 3R7WB 3JQ8A 3FTEA 1UBLS 2QLTA 4TL9A 4JROA 1O58A 1CF4A 2H2DA 3D9QX 4BS9A 5ALYA 4XASA 4Y2XA 3DNPA 1Q6ZA 4NABA 2EOAA 2FFQA 3KKKA 1E7MA 2QM0A 3TJRA 3D0KA 4N0MA 5FL3A 3DEHA 2NSDA 3LK7A 2PL1A 3V6LA 1FFDA 4LHYA 3IELA 4W5JA 5IP5A 3RUHA 2WSYB 2UXDB 1K4MA 1L0BA 5E6UB 2WVGA 2H4FA 2J87A 3WMEA 3ZIAA 1Y4DE 3QXCA 4DLZA 1IEWA 3DKKA 3Q15C 1YWGO 4BFSA 1NVEA 1TVKB 1XD2B 4EG0A 5KQLA 3P19A 3TNLA 1U8TA 1QWSA 3OSUA 3HO1A 3I39X 4QULA 1Q3HA 3EG9B 3W2IA 2XB4A 3MRXA 2WSLA 4PX3A 5LMCA 3KQLA 1EWVA 4H9GA 5BYBA 3DZJA 3GJ7A 2PR2A 3QGMA 5FPPA 4B3IA 5TEVA 5EGNA 1OC4A 3GO4A 2H11A 1SCDA 4WN3A 4QFCA 4MO2A 4RCZA 1VE3A 4PZAA 1O9GA 4G25A 1XZNA 3TW8B 4KQGA 4H6XA 4BAUA 1HV8A 1E2PA 2OZLB 2JFQA 1PJ4A 2PQ6A 2MWMA 4ZGBA 3RRMA 5CAEA 2DSTA 3O0DA 3VC7A 1XJCA 2IYQA 2F1IA 4JEHA 2ZYSA 4II2A 4RFSB 3CUWA 1DX9A 3ZIAD 1CTQA 2V3WA 4CDRA 4OXQA 1NQOA 1XEXB 1ANKA 4KWCA 1YAHA 2C5SA 3NB0A 1GA4A 1AGPA 4DZZA 1DS6A 5TQ2A 2WWVD 2GO1A 4ZOQI 1W49A 2OLJA 2VF7A 3M1YA 5C3UA 5BV2P 5JMWA 1FDIA 1JHAA 3RLIA 4WCVA 1GRQA 1RW4A 1LBHA 1LVUA 1O8BA 4HJRA 3AVOA 2JKYA 1JNYA 4M53A 2AFIB 2NO1A 2F67A 2KX7A 3I9LA 1NFFA 5K4AA 1C1DB 1XTVA 3DVAA 2XMRA 3QVJA 4WCFB 3EBOA 4LGCA 2VSXA 3UNXA 5IYZA 4E5VA 2JEYA 4KIWA 3H5LA 3W04A 4EZBA 2XECA 1IU9A 1OSNA 3BBLA 2LRHA 1SCJA 2XB6A 3BKXA 1QR6A 5JAQA 3VPFA 1PF7E 2ODWA 2BT4A 2IFTA 2QPLA 3EFBA 5IX8A 3PGKA 4QTZA 1TMOA 1N6HA 3D8NA 1ZJYA 2HF9A 1TVMA 3SFZA 2RFLA 1Z47A 2I6QA 2M6RA 1L5MA 2XUHA 3LHIA 4NBRA 3HJFA 1RQPA 1WSBA 3EW7A 1LPNA 5EESA 4ZOLA 4G26A 3KXLA 1NURA 4RD4A 2Y1FA 4FWTA 4BQFA 3QQ5A 1K9VF 4GGOA 1N5DA 3ZEIA 1K0FA 1QWOA 4Q1BA 3EXIA 1B6SA 1EWRA 2QD2A 4TTPA 4OGKA 4BNJA 4EG3A 2PRZA 1NTOA 1P5JA 2YV4A 4KCGA 4OI1A 3PI7A 1YL7A 3SM9A 1EINA 2OZPA 1VXOA 3MFYA 1WD7A 4QVGA 1UOOA 4NXMB 1FXWA 5FP0A 3T0FA 4D9BA 5GIPE 5ESDA 5JANA 5IF3A 1LPBB 3IGFA 5EIOA 3J80A 3ZQ6A 4IXTA 1U2PA 2VSYA 2AEJA 2EU8A 5ALFA 1SZJG 1CF2O 1VI6A 4CM4B 4QPZA 3AVPA 4IJKA 4XEUA 5JSUA 1KGSA 2WILA 1E6WA 3ZWVA 4TLEA 4F3CA 9ATCA 2QBYB 1P1HA 5AVWA 1QCYA 2G7MC 4E09A 3UGKA 4NC9A 3QMMA 4OMFG 2FZEA 2XRMA 1RLJA 1RCUA 1T1EA 4NOLA 5CLGA 5EWLB 3WWPA 3KEMA 4FT4A 2Q29A 1B26A 4ONEA 3MYYA 4XWWA 3DMTA 2PUGA 2PS3A 5DGIA 4JLKA 4WBXC 1VBKA 1R0XA 2BZ1A 2C1EA 3WRWA 3K71B 4G0OA 1SXHA 3JWIA 1P0PA 1D4OA 3D2LA 3II6X 1IJEA 3LQYA 4UNPA 1CJTC 1ORTA 3DE3X 1PU2A 1PK9A 4L8YA 1BWPA 4RXMA 4W1QA 1CQIA 5LP6F 2VNIA 3G1WA 3PF8A 2FEMA 4EYEA 1C0IA 3HB5X 3EIWA 1VHWA 1I1NA 1S2MA 1XZ8A 3WP1B 2JZNA 3VKUA 5A4FS 1VSQA 1ECGA 4KRFA 1G64A 3IP3A 2G06A 2OC9A 3BN3A 1VRCA 2ZWAA 3LBHA 3PV0A 5T4EA 3RLFA 5FLXA 5F98A 1M2KA 3HWX1 1QVZA 1ZGAA 5JTTA 2I7VA 1E3IA 1GVNB 1ZUNA 4QICA 4DDTA 2DFPA 4V3CA 2PWYA 3BWYA 2VBFA 3JALB 4KFCA 3AILA 4BMSA 1WMAA 5L3QA 1YMVA 4Q9KA 2FWMX 3C87A 1JR6A 3EDMA 2R8YA 3R20A 1P4RA 3GCZA 2FRXA 1E2LA 3IIMA 2OYCA 2AZTA 2WIJA 3OHMA 2G7ZA 4PG4A 3T5TA 1FX0A 2OB2A 3VTKA 5B57C 1PCXA 3UV6A 3KLNA 4HAZA 2OLEA 3LLCA 4MVJE 1M2EA 1IFXA 5KC9A 2JK0A 5BSMA 1JTFA 2PMBA 4NLLA 4RV4A 3X2SA 3IEKA 4NU5A 1Q0QA 3ER8A 4XGQA 3T0IA 1EXNA 1PYGA 1UDBA 1ILWA 1GGKA 4URFA 3GJ4A 1S2DA 2B3DA 3Q3GE 4IIEA 1D2RA 4PNZA 1ZWLA 1K7CA 3ITNA 1X8KA 4NU6A 4TQUS 3RO7A 5GIOE 1SG0A 3PS9A 3JQRA 1CG6A 3E5HA 5C8YF 3BPSA 1SIOA 2I76A 3DZ8A 4DEYA 1SHZA 2YN4A 3OFNA 4TVKA 4MUJA 1HKHA 2VZ8A 2FP3A 3L5OA 3TQQA 3IT3A 1QGAA 3HC7A 4O2BF 3CF4A 4TXJA 4BO3A 1F1BA 1NXQA 4D4MA 8GPBA 4DMGA 4AIRA 1E1CA 2HJGA 2O8CA 2EP5A 2VP5A 4PQYA 1XX6A 4C1BA 4J1TA 3IDOA 5C52B 3AB7A 4G1FA 3ABIA 2RH4A 3I0ZA 4QJBA 2OCDA 1NIPA 3M4JA 4G97A 1KZGB 2ZUBA 2HTFA 1OE0A 2GARA 5K5EA 3CEMA 2D0DA 4ZD6A 4EY4A 2CV0A 1J23A 1CF9A 1R4ZA 1RAAA 4DIFA 3L4BC 2VRCA 4HKTA 2CLKB 2MSNA 1ZZGA 4OQMA 1N7HA 5K99A 1HI9A 3PUKA 4G5GA 2A35A 1W76A 3OFND 4KN6A 5FRDA 1G21B 3GCWA 3GQBB 3SR4A 3GVPA 1W94A 3ZE8A 3K0SA 1JLSA 4YRCA 3CH6A 3H7AA 2AG8A 3PKJA 3V34A 5I7SA 1YIAA 5JS2A 3KKLA 3FWNA 3T5MA 3MBKA 4Y2GA 5AVXA 3DDCA 2AK3A 1C9NA 1CQWA 1R5BA 3KM0A 3HBLA 5DIZA 5KAPA 1ZR4A 5BQFA 4UTXA 2ZSBA 4KBYA 1BO6A 5I7RA 2VHEA 1RE0A 3M34A 3UGQA 1CUFA 3AV0B 1S1MA 3GRYA 4TYPA 2HLDA 3Q2OA 2Q0QA 2P9GA 2JHGA 2VRCD 2ZFUA 2ZIAA 2QM8A 1NVKA 3RH0A 3ZXSA 5ILOA 1J06A 1OXTA 3CBGA 3AQ4A 4KTTE 4Z4EA 1Y9EA 3KU1A 3LOUA 3MGCA 4QELA 5SY6A 4J2TA 2POQX 2Q41A 3DMGA 5C81A 2D5BA 1Q1BA 1TYCA 5COQA 3KZVA 3A05A 5EKDA 4MHTA 2W58A 5B36A 3IJ5A 1M34E 3LBAA 4QUDA 2X41A 2L19A 1WMDA 2WG2A 1FYXA 4DIMA 1BDIA 5IVHA 2PZJA 3FUXA 5FTMA 4WESB 2GA9A 5JAOA 3C41J 4P4UA 3NYWA 3AR9A 3WZ2A 2HLDD 2WG1A 2C4KA 3OJFA 5HF9A 3U3RA 2R5NA 1O4WA 1Y3HA 1IBMB 4MV9A 1WCXA 1DLIA 2FFJA 3NDBB 1Z75A 1ZJJA 3VTZA 4RZ2A 1UKCA 4YPOA 4IUCS 1CIVA 4H77A 5CT5A 1TCAA 4O3FA 3JQ8B 5KWVA 1G18A 1XZAA 3RRZA 1HYGA 2QLMA 4ES6A 3PQFA 1M1ZA 1EZ1A 1T4CA 2VK4A 1KSJA 4UTOA 4ZVMA 1MOSA 3IESA 1RM3A 3IAFA 4JT4A 3WE7A 1KQOA 4G8CA 4KGXA 2QENA 4W9RA 3UXEA 3PIRA 4AJJA 4HYTA 3Q4GA 2ODQA 1E2JA 4OGGA 4JT8A 4KO3S 4AECA 5HMMA 3A9VA 4I5IA 5GQSA 2ZANA 5BMVF 4KNYA 4AKIA 1XEWX 1QH1B 2Z5FA 1H0HA 3QHPA 4B3XA 4YVFA 1CEEA 2YW9A 5K3DA 5G2OA 2QY9A 3NONA 2JFYA 4WW0A 5JO0A 1IQRA 3Q0IA 3HA3A 4Y9UA 1TVCA 1TYAE 1MXFA 1OTYA 3AONB 3EWAA 3BJMA 3I9KA 3K9WA 4MPRA 3ASYA 4HBGA 3FPJA 2X7HA 3WFJA 4PPYA 2OGTA 5FO0A 3C0KA 4O1MA 4CR7A 1YZNA 1KO8A 1C1XA 1OAKA 4C2AA 4JP3A 1YS2X 3QLUA 2WSBA 2I55A 5LJLA 3CB4A 4I8XA 1FTWA 4AZ0A 3GLKA 4B3MB 3ZDAA 2HFJA 3ABSB 3DMHA 4ALNA 3FZGA 3T61A 1KR2A 1LV8A 1LTQA 4TV9A 3L3BA 2AMFA 4IKPA 5CAEB 2Z1DA 1PNQA 2G63A 3D7MA 2VZLA 2HT1A 2VH1A 4H59A 3SQOA 5CVUA 1JG4A 4G86A 5L9AA 3EEFA 1VLHA 3G2MA 1JNXX 1FB5A 1QP8A 1C8BA 2CDAA 4Q7LA 2VA8A 3M6LA 1LLDA 1F4PA 1ZH0A 3INRA 1SCKA 3WZLA 2ZBPA 1P0IA 1ESCA 1FLVA 3VU8A 1JI3A 1B0PA 1T4DA 3TBKA 2VFAA 2ZTLA 2W00A 1KORA 5FIUA 2EJBA 3N87A 5IBQA 5BO5A 1LI4A 1IATA 4V02A 2LXNA 3FCYA 1NGSA 4RJTA 4JJ4A 2GD0A 3MIIA 2DBYA 2JVJA 5K8VA 3H16A 2JFUA 2VDPB 3I09A 3LBIA 4MLPA 3TOXA 4W5TA 3U7HB 1N2HA 1ZN8A 3IBYA 5DTRA 5TT1A 1JKIA 1ZMRA 3KKOA 2YBDA 4LY9A 3OZXA 1Z38A 1SNYA 4XARA 3G02A 4DDHA 5HRAA 3ZK8A 3W8EA 4K05A 4Y6QA 3TOZA 7GPBA 1KDVA 3AVUA 1TAUA 2GN8A 3DTNA 1TADA 4BX3A 3BMNB 4OSPA 1LW7A 4R81A 1XDSA 4OI4A 1B8VA 4ZOLB 1QIIA 3M9WA 4CM3A 4JYMA 3GVCA 4BQSA 4LC0A 4TUYF 2PRKA 3TQCA 2HMSA 3DXXA 3OOSA 4JOCA 4PRKA 1GDTA 1GTSA 2I4TA 1V6CA 2IOFK 2VNSA 3NNDA 3EXIB 4RMNA 3V4PB 1NP3A 2H7CA 1V2HE 4TRNA 3GGGA 2CDCA 5CB4F 1M0EA 3L8MA 2JBAA 3KKPA 1QBKC 5E7JA 2X6QA 1VKOA 2P1RA 1WUTA 1RYYA 4I1SA 3KSBC 3ML1A 4YDSA 2DPHA 1U2ZA 3KQYA 3X1YA 1M0TA 3FX2A 2PXHA 4K6FA 4OV6B 4X3OA 2C2XA 2GT1A 3H42B 5GJCA 5HKOA 1ZYUA 1NAHA 5TF4A 3IEIA 3HO8A 1JIIA 2XUZA 3DHVA 1P45A 3DJYA 1WDLA 1UEXC 4JBXA 2IV2X 3H9QA 5BUQA 1BWQA 3THSA 2VNKA 4Q01A 3QQPA 4CV0A 3LQ2A 1S7CA 4PQGA 3DC2A 4EFNA 4TMFA 2HA0A 3QE0A 2A0UA 3KEFA 4V0ME 2CFTA 3R0VA 2A5DA 2MMGA 3B70A 3UENA 5EE3A 5H16A 2CXQA 4JUBA 1L1EA 4UDXX 1Z17A 1DUIA 1CULC 2ZDGA 3O9VA 2E49A 2B0CA 4G4JA 2REQA 4FX2A 3UA3A 1YDWA 4EMTA 4JP1A 5DASA 4TM8A 4YLEA 2F9LA 4OATA 4I5EA 2V4UA 1MZVA 2ASEA 1FMTA 1OZHA 2IUSA 1H5UA 3G59A 3LUDA 3VO1A 1HZZC 4LISA 1XNQB 4A2PA 1CQIB 1O97D 4LV5B 3PKZA 3TEFA 1N2EA 2R7MA 3NHLA 4PYKA 4RQUA 2ZDHA 3KWMA 3QPDA 1YOBA 1QOQB 2BJVA 2COUA 1WB5A 3NOXA 3LL4A 1MX1A 2XCSB 1SXPA 1XZEA 1OI3A 3P8ZA 2Q4TA 4NZZA 4TL7A 4RDCA 1KZHA 5HJEA 2VT2A 1DADA 1WUYA 3DMNA 2YRXA 3LAWA 4FJ2A 1YS6A 4EA7A 4KVFA 4Q3BA 4C03A 5DM70 2REBA 5L3QB 4KSYA 3RSCA 1MR3F 5EGSA 4A2QA 2ON6A 1XAGA 3M82A 1PFKA 4DNXA 4JT9A 1EM6A 4A9AA 3UMFA 3AR7A 4ZCIA 3WLPA 2QRMA 3AQIA 3SYLA 2WM9B 1CLEA 4LSGA 5AVVA 3AFMA 3WYGA 2X0RA 4ZC8A 2LCQA 4BP1A 1UJ6A 1MGOA 3TLMA 2AG0A 2P6PA 4XWAA 2HA4A 2PANA 3MA0A 2YY6A 2EW1A 4JJAA 3O91A 4BNDA 1IK6A 5IKPA 2Q45A 4ZCSA 5AW2A 4ALMA 3Q3EA 3DFKA 4CFYA 1KI3A 1Y6ZA 2YV3A 3TO5A 3MXOA 1DFIA 2CNNA 1NDUA 3L84A 4UUQA 4V03A 1PEAA 2WE7A 4WN9A 2YQZA 1QB8A 2FE1A 1E9FA 1OWLA 3MRVA 4DCTA 4B6FA 4YDHB 2FSUA 5KIAA 3G6KA 3MAGA 1HZJA 4TTTS 3PR3A 5CLIA 2XQKA 4CMBA 3OMLA 1QTIA 2WUWE 1IHOA 4ENVA 1Z4KA 1EUYA 1E1CB 4F1JA 3PCRB 5DWDA 4HPXB 1UXGA 4ER5A 3DAPA 3ANTA 3FYUB 1OW3B 3L8CA 2C98A 2CHGA 2BFWA 4TKZA 1EFCA 2WDPA 3LM8A 3LRXA 4DS3A 1XEAA 1JYSA 4ARSA 1J20A 4C6SA 1I3CA 1SXJE 3B48A 4AJNA 3M1LA 3AF4A 4F2HA 4ZMBA 4YROA 4R1PA 2ZT7A 2ZSUA 3L06A 4P7JA 2JH3A 3W77A 4CFSA 1FW6A 2NUAA 2NYRA 3B12A 2BKEA 3RBXA 1E4YA 5HJ2A 4DIEA 1NSYA 2TMDA 4QDOA 4TLDA 3TD9A 3L4SO 1A97A 2VH5R 3NWEA 1RTTA 4FE7A 2JPDA 1AZLA 3KSDO 1PT8A 4OCZA 2W71A 4O0MA 1F8YA 3GLSA 4X6UA 2XX3A 1V9SA 1F2VA 3UO8B 5AKJA 1E7SA 5FUQA 2I2CA 2JCXA 4J1TC 5D7NA 3PJGA 5EIXA 1G8GA 1JW9B 3ZS9A 3F9CA 2C1ZA 3MS7A 1XNGA 1GTG1 1AQUA 3QPCA 2OSVA 1SBZA 1Y7PA 3F6RA 3ZHRA 3M5PA 2J9ZB 2YWCA 4IX1A 4DSNA 3HCEA 2WJ3A 5IBPA 2RGYA 3ST7A 4E5DA 4A7PA 3TINA 2J0EA 5KPDA 3FOWA 3M6WA 1PG2A 1WZUA 2X9VA 3OLQA 1I36A 3V7YA 1BWRA 5I9SA 2RKOA 2E5WA 4MWZA 3KLPX 1QJCA 4DV7B 1R6BX 3QV1A 2YVQA 3UUWA 4Q12A 2LTAA 3LLMA 4G2TA 4MGYR 2GZDA 1LD3A 1DKNA 1P2FA 4IFIA 4CG2A 4E1VA 2BFEA 3OZTA 4QOGA 4B9EA 3HXOA 1KI8A 1WBJB 2POCA 2B82A 4ID3A 1E3QA 3WGOA 4CIBA 2ZRBA 2UUBB 1V6SA 4M86A 1H9AA 2PL5A 5KSPA 4B76A 1CVLA 1ADCA 2NV6A 2VDKB 1GSIA 2ANCA 4GYJA 2D0OB 3A9CA 5F1YA 4Q3KA 3UGTA 1PLKA 3LECA 4GX2A 5FPTA 3AUAA 3T15A 4PGMA 1Z4PX 2AN4A 3A3KA 3PNLA 4OQYA 3WOVA 5KNDH 4W5QA 2J7PA 2BV3A 2O3UA 3A1SA 3RJ9A 1WW3A 1T4CB 2JFZA 2WAYA 4ENRA 1Q6YA 1ZKDA 3BFPA 1RABA 3JTMA 3SKYA 1TM5E 5ALUA 1YR2A 1DX6A 3RASA 2I1QA 4YV0A 1P29A 1DDOA 4KYVA 1MUUA 4NF2A 4ZV7A 1ADYA 1Z68A 2OBLA 3OQ1A 4IQ8A 3ZHVA 5LOVB 3IV7A 4R71A 3BXXA 2JLZA 2E0IA 4EI8A 2J41A 1MO6A 2R25B 1G17A 2OPBA 2Y93A 4Q21A 1YGYA 3C98A 3DE2X 4FGWA 4CF5A 1RLOA 4EA6A 4F1WA 3HDJA 3JW8A 1T8UA 3G2QA 3QLTA 1IN6A 1QG6A 2B1IA 4GPBA 4X60A 4AX4A 5B2FA 4QTYA 1ZRSA 3ZVMA 1PRYA 4Q4LA 4IOJA 1JQDA 3JX9A 2EIHA 5TX7A 1HX7A 1JAYA 2J7PD 4O4IF 1FUUA 3W1WA 5HPYB 4W1PA 2PGIA 5BNFA 4ZAFA 2P9CA 1C1XB 1GPAA 3EIFA 2QLFA 3E9QA 1A4IA 1Z5VA 2GJ4A 3GLRA 4NPHA 4ZVKA 3VU1A 4AZ0B 3FOEC 4WECA 1NN0A 2P9FA 2LDBA 4QOIA 2FUEA 5C1IA 3RROA 4HLNA 1IHDA 1S96A 3CR7A 4WIAA 2X58A 1T25A 2BEVA 2WWRA 1M73E 3L0SA 4IUBS 2G9NA 1GWNA 4DYVA 1X1BA 3UY4A 4F86A 1PO7A 3G2JA 2BTOA 3WGUA 4PEVA 2VPIA 1QYIA 4AO7A 1MABA 2PSHA 4RTRA 5ILGA 1JE1A 1JR4A 5FJJA 1LLUA 3FBGA 4AXXA 3GJQA 3AB8A 3SKXA 3C8ZA 1XNHA 4UNRA 3GLIE 1JZTA 3UMJA 3QW2A 3ZI7A 3DR3A 1DEXA 1OZFA 1V3VA 3L7YA 2XHEA 3WNCA 5K3EA 3WIBA 1GPBA 2JJ8A 1J22A 1GHTA 3GDHA 2QX4A 4ND1A 7ADHA 3ERCA 4G56A 1E94E 1AKWA 4Q6BA 5SYAA 3RTBA 5DTEA 3QLUC 4IIXA 3VOAA 2JKZA 3IP6A 2BGIA 5D3KA 4BX0A 2FRDC 2R1UA 5K2MA 4IEIA 4R1QA 4U7GA 4Q3OA 4N3CA 3TR6A 2O7VA 5BV8A 2IH5A 3EVCA 4YEDA 4GHWA 2RH9B 3FPGA 2D54A 1LVHA 4NBTA 4J4TA 3M3DA 1Y6QA 4BNHA 1BXRB 5ED0A 1EXVA 1DJQA 4D99A 2FB9A 3OMXA 2PX8A 3QLJA 4EW6A 2L2QA 2I2AA 1CB7A 4UBLA 4GXRA 2IZOA 2ZBFA 3L6EA 5DEIA 4BO5A 1B6TA 1XVIA 4HDNA 4KIFA 3MOIA 4YGXB 2J0QA 1X8XA 1DO0A 3I4FA 3DBIA 1EDDA 3OU2A 2GBLA 5K3BA 1M6VB 4A0FA 4ZT5A 3T5GA 1K92A 2LE0A 3IT1A 2N9UA 3NH9A 3Q88A 3ZX4A 4ZK6A 1J90A 3WS7A 2V7BA 4V0RA 1AQ6A 2YFQA 4ZOCA 1FPMA 4FKBA 2FEWB 4Q34A 1DFHA 2I34A 4LE2A 2EYUA 4IKEA 4D9CA 1OA0A 4ACAA 3V1UA 4EJ0A 3WAGA 2R8ZA 1O5TA 1F3OA 2VKTA 1NXOA 4W6QA 4J0QA 5H3CA 1P9RA 2YH2A 3WLRA 3D3QA 3HZHA 3PFBA 4GOKA 1ST2A 1USVA 2FA9A 3FNBA 1RC8A 1H6DA 1YRBA 2A78A 3A4YA 4OGLA 4FGUA 1C9EA 5HDBB 2HA6A 3KPJA 1ND6A 3JPWA 4HSGA 1DZ3A 4OFXA 5ALWA 1T9AA 1X77A 4LN1A 3RK1A 3FA2A