4OFXA

Crystal structure of a putative cystathionine beta-synthase from coxiella burnetii
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
316
structure length
288
Chain Sequence
MVLDNILQVIGKTPVVRLHRIGQSLPCELYGKCEFLNPGGSVKDRIGAAMIESAEKQGKIKPGDTLIEPTSGNTGIGIALAGAVKGYRVIITMPEKMSHEKQVVLEALGATIYRTPESHISLAKRLNQEIPNSYILDQYSNAENPDIHYQTTGQEILDDMGENLSMVVMGVGTGGTIIGVAKKLKEVNPSIQIIGVDPIGSILGGGDNNLIDEYIKINDKDSFLMARRLIREEGLLVGGSSGSAVWAACQAAQRLKEGERCLVILPDAIRNYLTKFVDDAWMKAQGFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Putative Cystathionine beta-Synthase from Coxiella burnetii
rcsb
source organism Coxiella burnetii
molecule tags Lyase
molecule keywords Cystathionine beta-synthase
total genus 99
structure length 288
sequence length 316
ec nomenclature ec 4.2.1.22: Cystathionine beta-synthase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ofxA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ofxA02
3IQHX 2EFYA 5KINB 4NU8X 5IWCA 4LMBA 1TYZA 4I1YA 2CLLB 1UIMA 1TDJA 4ZU1X 4HT3B 5JJCA 1X1QA 4IL5A 2GN0A 5CGQB 5D85A 4XUGB 5J43A 1TJPB 3R0ZA 1J0EA 4D99A 3L6BA 1C29B 1FCJA 2ECOA 1O58A 3DKIA 3SS7X 4OREX 1VE1A 4D9KA 4LMAA 4D92A 2TSYB 2D1FA 1VB3A 1A50B 5I7WA 1A5SB 1K7XB 4F4FA 3AEXA 2ISQA 3PC3A 5BW6B 5DW0A 5I7AA 1TZMA 4ZU6X 1UBSB 1KFKB 5B1HA 5I7OA 3FCAA 5B3AA 1Z7YA 4OFXA 1K8YB 4D9CA 1BKSB 1KFCB 1OASA 2EGUA 4D9EA 5E0KB 3DWIA 2RKBA 1C9DB 1FUYB 2J9ZB 2Q3CA 2CLHB 3HMKA 5D87A 5DVZA 2GN1A 1Y7LA 5CVCA 1CW2B 3VC3A 1WDWB 1PWEA 2CLMB 3L6RA 4JBLA 4D8TA 4L27A 1C8VB 1TZ2A 1V7CA 1K7FB 1J0BA 1F2DA 3FGPA 2Q3DA 5D84A 1Z7WA 4D8WA 1JBQA 5I7RA 2C2GA 4L0DA 4H27A 3R0XA 1E5XA 2CLKB 4HO1X 2PQMA 1P5JA 3IQIX 1V8ZA 5T6MA 4HPXB 1K7EB 2ZR8A 2BHSA 5HBGA 5IW8A 4COOA 4D96A 1KFBB 2DH5A 1QOPB 5JISA 1WBJB 1PWHA 5DBEX 2RH9B 3SS9X 4AECA 3IAUA 1TTPB 2RHGB 2TYSB 4JBNA 4D9FA 2O2EA 4NEGA 3RR2A 1K3UB 1J0CA 2DH6A 5D86A 5DW3A 4QYSA 1RQXA 4HN4B 3VBEA 5J5VA 4L28A 3VSDA 1CX9B 1TZJA 3PC2A 4D9BA 5B55A 1V71A 1WKVA 4D97A 3PR2B 2J9XB 2BHTA 2V03A 3DWGA 3X43A 2CLOB 1A5AB 5B36A 1QOQB 5KZMB 2J9YB 3V7NA 1KFEB 1BEUB 1TZKA 3T4PA 4D8UA 4WX2B 5I7HA 2CLEB 5DBHX 4AIRA 4ZQCB 1K8ZB 3IQGX 3TBHA 1TTQB 2ZSJA 1J0DA 2ECQA 4D9GA 1K8XB 4Y6GB 3ZEIA 3L6CA 1KL7A 3CEPB 4KKXB 5B1IA 3VSAA 5I6DA 3X44A 2JC3A 3AEYA 2CLFB 1WTCA 1J0AA 2Q3BA 2TRSB 4D9MA 1A5BB 4LI3X 5B53A 4L3VA 5EY5B 4HPJB 1KFJB 2C2BA 2GN2A 3BM5A 3SPXA 4D9NA 2CLIB 3VSCA 1VE5A 2O2JA 2WSYB 4D9IA 1UINA 3PC4A 1M54A 4PCUA 5C3UA 5IXJA 1D6SA 2ZPUA
chains in the Genus database with same CATH superfamily
4LYHA 4UPVA 3T9CA 3U5TA 4ZVQA 3AQ4A 3QITA 1ENPA 4I1YA 1RLOA 4RK1A 1OX4A 3B38A 1MABB 5TQJA 3O84A 1Z34A 4NENA 421PA 4DQVA 2IODA 4X71A 4Z8YA 4LSWA 5HUHA 2FWPA 3MPUA 3MWFA 1PUJA 3MRVA 4Y8VA 5LB4A 3T12A 3T3MB 4ZPXA 3ABRB 2IE8A 1II0A 3OJLA 1ENOA 3KTFA 4H7JA 1DS6A 4J4BA 4MGIR 2ZFUA 4LKRA 1T6BY 2OAEA 2UVDA 4WXMA 1C30B 4PHTA 1ZXLA 4CL0A 2PZJA 3NHFA 2B9EA 4A8PA 5LUAA 1JU3A 3A2NA 2P79A 3E8XA 4MV5A 4LV8B 3OU7A 3I05A 3OBBA 4J29A 4B7XA 4N5NA 2FUKA 2GZHA 2O7SA 3D3NA 5IK2A 4A82A 2F4VB 3PC3A 3B60A 3E8MA 3MRTA 1X39A 2Q6KA 3ED5A 4IR7A 3R9IA 3LP5A 3N2IA 1BU8A 2JEYA 3I9LA 4G26A 4F8YA 1R1DA 5DTJA 4D9EA 2VF4X 3NHPA 2A5GA 4QBIA 1VKNA 4H59A 1J25A 1FXSA 1Z33A 4YJ2F 1R0ZA 2P11A 1JR2A 2Q0QA 5ENZA 4B82A 4ALKA 2B8JA 3ZHCA 2AXEA 2QYSA 5CDGA 5K8UA 3SZRA 4LC1A 3FDXA 5A5GA 2W2PA 1IZYA 3A1NA 3EBLA 1O5OA 1JQBA 1LPPA 3ID6C 3KFXA 3A2LA 3D4PA 5LQKA 1WBDA 5KHAA 1QP7A 5AM0A 4LS3A 4PBTA 5D5QA 1DQRA 4M8SA 4MO2A 1KE2A 1C4WA 2FE4A 3RFTA 3ZY2A 721PA 2VDUE 4M1OA 1G7TA 1ULTA 1ZNYA 4H27A 1EEHA 1NNUA 3B3JA 1IBSA 1TM3E 4OIMA 3U7RA 3IE0A 1TA4A 2ETVA 2ONJA 4BZPA 1C3EA 1S4MA 1WCYA 5AP9A 2VYFA 2RI1A 2J3MA 3THWA 2ZJ6A 3MWEB 3QVMA 3VJMA 3BGWA 1YR8A 1VFNA 1WBJB 3ESCA 1L4UA 3DTNA 4MUNA 3N0XA 5BMVF 3KT8A 4BVBA 1UC9A 4TTIA 5CITA 2WSSA 4BY9E 1ZVMA 4JSTA 4E12A 1RQNA 2JGDA 2VZ0A 1PS8A 3W5SA 3AEQA 4JI4B 2HSEA 2R1UA 1XYYA 5E4YA 3LSTA 1FX0A 1DDGA 3KJNA 3KFLA 2AHRA 3I9KA 1OC4A 1P9WA 1L6RA 3UN1A 5AI6A 1MJ5A 1BMFA 1W1UA 1ZH0A 1DAHA 2CLOB 3BRCA 3MHPA 4ZXPA 2ZDHA 1AG9A 4LTMA 2QBYB 3KSRA 4LGCA 2VJNA 4GGMX 1AQYA 1ZEJA 3PUJA 1LDNA 2VK2A 5D6NA 1RSZA 1DT3A 3E3LA 5KSPA 5DP2A 1JPUA 1JEAA 5FL3A 4ZV7A 5DV9A 4NSNA 3C3PA 4QOHA 5EXPA 2G9NA 1G5QA 1ISRA 1N3BA 1CG6A 2HPAA 2JFXA 3FUVA 7REQA 9ABPA 4QARA 5C8DA 4PVCA 1OVMA 2FQWA 2GBCA 2JAUA 3H9QA 4D97A 3TXXA 4HDSA 1A5BB 1NV9A 3QXHA 4PLCA 4L3VA 4Y1GA 2WIJA 1WB6A 2QXYA 1UJBA 2OQ2A 1O54A 3L0PA 3U1VA 1BU5A 2NGRA 4BNNA 4F45A 4G5RA 1ZN8A 1ZCJA 1XG5A 5E9WA 4RD3A 5CBPB 1IQPA 1N9KA 3BRQA 4J3NA 2JLZA 1ZW1A 2WP8J 3TW8A 3HS3A 2IPMA 4MYRA 1UQTA 1Z2NX 1EDOA 4OMUA 1CF4A 3EHEA 4RVFA 4XUGB 4MAMA 4OHPA 2P9ZA 4O6VA 4AO6A 4CIYA 1AV7A 1GV0A 2O8NA 4QTYA 1M33A 3TW0A 2QM0A 5THKA 1ABBA 2FCAA 1X9GA 4BXOB 1A3CA 4U7PB 4DANA 2D0DA 2QZJA 4YDHB 3IUQA 4FI3F 3MJDA 3TIXB 1YHYA 4NFLA 2OZEA 1MQ8B 8OHMA 4B3XA 1V8FA 1OJ7A 1ZI8A 4R1QA 3BKWA 3W05A 4CL3A 5JAHA 4EG0A 2OCPA 2OGUA 2OXCA 5KI6A 4AF7A 3GEEA 3TLYA 5I9NA 3N2GA 4D02A 5JD6A 3OX3A 1GR1A 4YBZA 5I9BA 4PZ0A 2JCVA 4RZ2A 5EINA 3DBRB 2P8SA 4M1SA 2HIMA 4TV8A 3H2GA 2H1VA 3DMPA 2JIZD 3IA7A 4TN1A 3UGQA 8GPBA 1BKDR 2GHRA 2ZSHA 1E6WA 3EVTA 2DFVA 4RSMA 4V0LA 3EMDA 1HT1E 1T6ZA 2D2XA 4US2R 2DUWA 1NONA 4QJIA 4HLNA 1TADA 3BJMA 5AI9A 3CLKA 2WAMA 2ZYTX 2WIFA 4R8KA 5BNWA 5DB4A 2H31A 3JQAB 4JKOA 2AFIB 4G0QA 3AUTA 1Y5RA 2JF0A 1TUBB 5J47A 2GO1A 4K1XA 4HFMA 5LCXA 3BHMA 4M8NE 7AT1A 3OTIA 1KOJA 4E07A 3WO1A 2YY6A 4H6WA 1EBBA 3P19A 2GA8A 5FXMA 3WL6A 4MJ7A 2JIOA 5DT2A 5BORA 5ALKA 4G2NA 3OIYA 1SUDA 2BCEA 2H18A 4K0RA 2QUJA 2ZU6A 4O08A 4JASB 1SBYA 5HTOA 3WFJA 1ECPA 2QV0A 2QR5A 1JX6A 1WKBA 4C7JA 1FRQA 1DELA 4EF6A 5HE8A 1X77A 2ZTMA 2H06A 4EUNA 3QE3A 1YZQA 5KQRA 1U0GA 2BHTA 2VRBA 3O26A 3PE6A 3X43A 1W581 1DHTA 4CT5A 4EMBA 3UBMA 2QAGB 3WWPA 4F2GA 3I9MA 2CMDA 1QDLB 1DKOA 1W36D 3OC6A 4QM6A 4JA2A 4LY3A 4QL3A 1SBNE 4QPZA 1WDMA 3NJ8A 1A9XB 3R7WA 4F9EA 1XMQB 2WZQA 5BSEA 1OIXA 5EJ8A 2QZPA 3Q87B 4K3UA 3ZEIA 1MAVA 2SKDA 1H2ZA 3L6CA 4RA6A 3UJ9A 1OYYA 1VCOA 1QYWA 4KWHA 1IUPA 5E38A 1TT7A 3UC5A 3AM1A 4PGHA 4NU6A 5B3KA 2J5KA 1T5OA 2OAGA 2OV6A 3U7QB 3DSRA 5AVUA 2YC2C 2X0NA 4TTJA 2R8BA 4HGPA 3GJQA 1XJ0A 5LP1A 4ML3A 4PW0A 2ZAIA 2BW0A 5CNJA 5JOQA 4G07A 4Z0NA 3W0LB 4F60A 3OJCA 3EFEA 4R2IA 4JEHA 4UVGA 1AN9A 2DEUA 1SGWA 4KXFB 3HFSA 3IKLA 3OCXA 4LDPA 3W2TA 4CLEA 821PA 1ZS9A 1J1UA 2H1OA 1WVIA 1CC1S 1T9KA 4PSDA 1AXEA 4BLRA 3GRFA 4IV5A 1AOXA 1Z4JA 2DSNA 2JFUA 3QXCA 3R3YA 3FPEA 3QWIA 4MUHA 4MHSA 4O4LB 2QRNA 1YCDA 5AKYA 1TAQA 4PZ9A 5KSZA 5B7PA 4EG4A 2C2KA 3V4SA 1A8QA 4JITA 1J5PA 1W59A 1N9ZA 3PUIA 4BNVA 1OPRA 1WPQA 2W2TA 2FEXA 1UFKA 4ZCSA 5B58T 3C5VA 3WRYC 2AK2A 5H81A 2PKWA 4PYNA 4AJEA 4O3FA 1GSAA 1ORHA 4LAFA 3DVLA 3OESA 4FCVA 4L7VA 2IC5A 2HCTA 4XTCS 2BEKA 1VMDA 1ISSA 1K9VF 1T3SA 3F46A 4BQOA 3WFZA 4EK9A 3LCJA 4JSYA 3W5UA 2AHOA 2VYVA 1ISIA 3HB4X 3KZOA 3D7MA 3NWBA 4ZOCA 1L7EA 3JVUA 1T9ZA 3SF0A 2JAWA 3GA0A 3IMCA 4GXTA 3BGDA 3Q0EA 1BE6A 2IZZA 3AW8A 4BAGA 4O4JA 3B8HA 2WF9A 4WY5A 3M6VA 4EW2A 4N6OA 2A5DA 1QK5A 3ACBA 2R7AA 2YV2A 4G5OA 4I14A 4IIDA 2CDCA 1EINA 2Q8PA 3LXXA 3V1YA 1J0BA 2C20A 2QYOA 2Z9BA 3AOEC 6ABPA 4EY6A 4GOLD 2AFVA 1XT6A 4BKQA 3DB1A 3W9UA 2XADA 4LRXA 1L5HB 2YRWA 5ICCA 1H9BA 1JMVA 4YCBA 1Z63A 3VO1A 5EHNA 3I52A 1Z06A 3ZWBA 1APBA 5FTKA 1GFZA 2G1UA 4DUZB 1IATA 4JLAA 4EVSA 1K6JA 1Z7EA 2B25A 2Y1GA 1L4EA 3HWX1 5E6UB 4QTZA 3R6LA 1CTQA 5HRCA 3L7OA 5AVKA 2QPTA 1UAGA 2CD7A 3CSDA 3NOOA 4N03A 5AVRA 1XWFA 1YJ5A 1LK7A 2PQ6A 2QTVA 1VLVA 3FTNA 3FJ1A 1NOIA 5D86A 1VLJA 5C7OO 5JAZA 1L4NA 1PW5A 4YP7A 4Z3DA 5JZMA 1G17A 1PL0A 1JG1A 1XVLA 2CEAA 3LCRA 4L5BA 3FUXA 5BPFA 3TGPA 1RKQA 3CZ9A 3T5BA 2O8FA 3SF8A 3T5CA 1IFXA 2CLCX 4Q18A 5T67A 1CIVA 5JXJA 3KV1A 4MVJH 3E35A 4WVLA 1EXNA 4UUAA 1Q2UA 4GVXA 4LRTB 2XMCA 4ARBA 1TTHA 3QW2A 5A9SB 3KE9A 2QL5A 4LNHA 2WFLB 4TX1A 1H2XA 2Q3BA 1JHPA 1W85A 5GV7A 2E1PA 1MV5A 2TRSB 2WVHA 3CFYA 3KDPA 1P5ZB 1ZOIA 3NTVA 3TQTA 1J8VA 5J4VA 4LQLA 5EE5B 3GMDA 3K1ZA 2FPLA 5ERXA 4D42A 1T3TA 4YREA 1BKYA 1CZRA 2OQIA 4YRAA 4KYTA 1FJXA 4N54A 2PY6A 4BEJA 4MRAA 4X93A 3KYCA 1H6AA 1MDFA 4P83A 3VNRA 3EG5A 2JI6A 1SK9A 1PGJA 1LFDB 4Y0VA 2C99A 3HUDA 2MOKA 1GP2A 4NR0A 2WJGA 2HWYA 3STUA 2O1WA 1V7QA 2GTPA 3NT2A 2D06A 3KXIA 2IS6A 4KXVA 4DCOA 5LJIA 4NMLA 4OREX 2NXWA 4F12A 2OXFA 1X38A 3ECAA 4AJ4A 5JDIC 2OHOA 1PZXA 3GMIA 4TWJA 3VV3A 2VSOA 3L0ZA 4UJ3A 1PFYA 4W9MC 2VJAA 1BEEA 2C8JA 3BC1A 2YJ4A 4OCZA 3V97A 3THWB 1H5NA 4WFKA 4XVCA 1EJBA 1VI2A 1ND6A 3P9KA 4RGBA 4YCLA 4YR7A 4OXIA 4TSKA 2Z2JA 3OX4A 3I58A 4IDGA 4K88A 3UWMA 1RBMA 1D2NA 1I4EB 3RWOA 4D44A 1MQ9A 3HZRA 3PLAE 4LRYA 2EKLA 2OGTA 5EE0A 2IWRA 2QNBA 4W5JA 2OG1A 4E4TA 4TN5A 4A5SA 3PNLA 5AXAA 1IOZA 1V5FA 1GIAA 4QJ4A 1ZJJA 4PC1A 3TJMA 1CUEA 1VGVA 3HCNA 4W7HA 1EXWA 1N5JA 1X2EA 4A73A 2CV2A 1AQUA 4LJ5A 4FXPA 2XDWA 4J0JA 4XE5A 2QGFA 1O1YA 2C5SA 3OAAD 4HGYA 4UASA 3GP5A 4MEJA 2HJVA 1T1SA 5D84A 1H1LB 4B4OA 3DZDA 2R60A 1P2VA 1OBVA 3HU5A 4BL5A 1QH8B 3QE4A 2V3CC 2BFDA 2QPOA 4O2AA 3EVFA 4YJ3F 3SBEA 1TM4E 3LUJA 2HDWA 3OPVA 4G63A 2ZIXB 4PX3A 2LXNA 1VRVA 3KC2A 5AKLA 1H85A 4EA9A 2XYQA 1JIXA 2AOUB 4KN6A 1B76A 3QELB 3FMIA 1C2TA 1R0SA 2I3GA 3BZBA 2BD0A 1DC3A 3H2KA 1C5KA 1CZOA 4K9SA 4CMIB 3L92A 2BI8A 4MIEA 1HE1C 3G9ZA 1GSOA 1HE4A 5AI5A 1XRJA 4YV0A 4KQ6A 3U6BA 4GOOD 4M0CA 1WZNA 3OFVA 4B74A 2HUPA 4UTPA 1N6PA 1WDKA 2O2IA 2QTMA 3PSAA 1ADCA 3LL4A 1L4BA 2W5UA 4G2TA 2X2OA 1JPVA 1CP2A 2ZQZA 3DEYX 2D7CA 4FMDF 4BGUA 1ORIA 1QLWA 3B53X 3R1IA 4F9GA 3ZD8A 1TCVA 3A04A 3F7OA 1Z4LA 1OMOA 4IMPA 4BWVA 1BEUB 1U8YA 3UF0A 4AXXA 5IT4A 4MCAA 3TUZC 2VWGA 2Z9DA 3SC3A 4E21A 1Y0BA 4NZ9A 4MVJM 1J0DA 2DBZA 4R31A 2BZGA 4CDMA 4D0RA 1JSLA 1ZBQA 1KP3A 1W4AA 4QO7A 4HR7A 1R6DA 4NFYA 4RO0A 3U49A 1ESEA 4UDYX 1J33A 3P2OA 2BM1A 3AY0A 3HHEA 2YXLA 3AOEA 3HYLA 4Z0HO 4XM1A 1THGA 4B48A 2HCRA 4WASA 1C3JA 3BEOA 2NVUB 2PLFA 1WPGA 2EIHA 2Z2KA 1JXOA 3U7FB 2W2NA 5JS6A 4CG3A 4HDKB 5DYIA 1Y8QA 1HRDA 2F48A 3O2QB 4YO8A 3HADA 3T5AA 4EHKA 5FI5A 4QGSA 5KTYA 1GLGA 5HJ5A 5CA1A 5FWDA 4KL8S 5EESA 5JH7B 1M54A 3WIEA 5K7SA 3U48A 3CF0A 1LBEA 1AC5A 4RFSB 2WTNA 4GC9A 1Y6JA 1AVTA 3D54D 3N2LA 3W7VA 1PDOA 3EXAA 2JHFA 3QX7A 2HYIC 2BFEA 4MO9A 1T2AA 3HKCA 1OZAA 4L5CA 5J43A 3TI9A 2Q07A 1TPYA 3UANA 1XPUA 4B6GA 4DR4B 5A6SA 2O3UA 4PAOA 1YCFA 4OAQA 2XA9A 3OE7D 2YW2A 1MVNA 1E3DA 3O8QB 2UZ3A 1PEDA 1FK8A 2ROQA 3ZCQA 2P6OA 5LNK6 8ATCA 5KTTA 2A5LA 3UMSA 3A6DA 2G4VA 3EF0A 3SSOA 4C2BA 4B7ZA 1K3TA 4I9GA 4KTTE 3I2YX 3MILA 4C06A 3HV0A 1XNRB 1QG0A 3VRHA 5DNYB 2ZUCA 5B1HA 4DMKA 1YR2A 2XUGA 1EIZA 4QQFA 5C8ZA 4B83A 2GBGA 2A1TS 2BMEA 2AKAB 1Z6QA 4MVXA 3LE8A 3HXKA 4QVIA 1QB8A 2IKQA 3AJ9A 4O5OA 1MOQA 3M8KA 2JCSA 4PYOA 1OH5A 3MD0A 1N2OA 3ZWYA 3IIKA 3CCBA 4B7CA 3OZRA 3GWZA 1DARA 5D3KA 2Y1OA 5KTKA 2GYVA 2CVHA 4YUAA 2QDXA 3IDAA 4W6QA 3W8RA 4FONA 1G3MA 3NVDA 5CX1B 5FLYA 4D8WA 1MX3A 3CJRA 2Z5FA 4BDTA 2I8CA 3R9WA 4ECEA 3EOBI 1BZYA 1RMTA 4YCMA 2BLNA 3ZUPA 2Y4OA 4LOJA 4LE2A 2CCGA 1W0CA 2EFGA 1UC5B 2QX6A 3HBJA 4M1TA 4RK0A 4C03A 1ISJA 1VPEA 3HYCA 3WXMA 4EHLA 2C7QA 4I3FA 4IXDA 4YLGA 1WHSA 4FD2A 1R0CA 3EEOA 3K7EA 4M7WA 2PLAA 4Q03A 1RJGA 1M2WA 2R96A 2R1ZA 3EWSA 1W4CA 1DOZA 3PG5A 1BWQA 3FZEA 1M75A 4LGYA 1P1CA 4PLGA 3AQIA 4DEXA 3QJGA 1CBUA 1DAFA 3DZIA 5LXTF 4CEIA 2W6JD 2ZSIA 3QEJA 1L8AA 1TJ3A 4GMXA 1ETUA 5JS2A 2QM8A 2BJWA 1KEPA 2EWWA 2ORIA 3MYYA 1KU0A 4MITA 3WLFA 1U7UA 3UJBA 3N7UA 3Q8KA 3KSUA 3ZXIA 3UT6A 3O7WA 3OHMA 5G0UA 2IU6A 4TXMA 4J03A 3VPGA 2L42A 2CZGA 3CX3A 3IRVA 3EEIA 3LVFO 2IYRA 2VCEA 5ALMA 3IQGX 3E9CA 2FOIA 3UUWA 2YMQA 4DSTA 3CG4A 4PFQA 4S05A 2GN4A 1KMQA 1CU1A 2C8LA 3E15A 2RONA 4YLYA 3ZWAA 1SY7A 1E0KA 4Y1RB 3K72B 3IMGA 1I6LA 1K88A 4NPAA 4MKXA 4GLJA 1V2HE 1F38A 2WW8A 1YUMA 4F5WA 1JDPA 5J2TA 1VMIA 1A97A 4OX9Y 3O47A 1IPHA 2X4GA 1FSPA 3EXG1 3K2IA 3NTLA 4GPZA 3W5IA 3RM3A 4UNIA 4E5VA 5FYQA 2GJ4A 1QX3A 2VK1A 1II8B 1XLUA 5I4KA 1BX1A 4JIMA 4ZHQB 4UTZA 4PCUA 3PDCA 4BXOA 1A72A 3GQBB 4ZT5A 3WK9A 4QOJA 1XZMA 1XZAA 3C8UA 2NTNA 3JD4A 5G3ZA 2GQ0A 1WIWA 2NNWB 3A8TA 3F3SA 4OG2A 4WKCA 3ODPA 4ZQHA 2MSCB 1QYRA 1SVWA 2Y1WA 3H16A 2FGJA 4Q3AA 1NF8A 2VJMB 4I46A 3EY9A 4ZOBA 1YTLA 1V6SA 1EYZA 4LSGA 1U8CB 3QKRB 1UP4A 3VKGA 1R6UA 1ZLYA 3MWKA 4PZDA 1ESMA 3EYWA 2HXSA 3P9SA 4NLLA 2J5BA 1SXJB 4WHMA 2A0KA 4YS6A 2FJUA 3RD5A 2JFWA 3GFGA 5G4KB 1GA4A 2YJZA 2FN7A 2J33A 2VPTA 3CZ4A 4QUDA 3SC4A 3BFJA 2Z09A 1EHYA 1LV7A 3KQHA 3A37A 4XKJA 5DW0A 3A1WA 1KFKB 4GGOA 3V5NA 4AF6A 2F1JA 3BTOA 4S2UA 1U7XA 3B20A 4XD2A 1GDHA 3QFFA 2VJQA 4UHCA 4YMWA 3TOXA 3TRHA 4MA5A 4IHJB 4O29A 1KDPA 5FUVA 1EFUA 2XOKA 4WKBA 1PQYA 1IVYA 5IBRA 3WL5A 1E2KA 1P2SA 3HV2A 4BTVA 4HYQA 1R5BA 4QQNA 1MCZA 2NO1A 3OD1A 1W19A 5IJXA 3VYRB 4BRZA 1R2QA 4UUOA 2EJCA 3U4MA 1AHHA 2C94A 4PG8A 4TSFD 2CVOA 3L77A 3I8OA 3AHJA 3IFSA 1QIKA 3EZYA 4Q1CA 5EUBA 2WB2A 3ITNA 2V1UA 3KBBA 5B6JA 1M9NA 3HNOA 4DA7A 4NECA 2FWMX 2YVUA 2OCGA 1BA3A 2SBTA 4WK2B 4KACA 2Q9CA 5E95A 3PA6A 2ABWA 4RPCA 2HXGA 2VYVD 1XDSA 3RRZA 1J7KA 4LYJA 1QF7A 2G1KA 2IPLA 3BFVA 3D8NA 4BMOB 4CPDA 5B3JC 4IG4A 2POQX 5BV2P 5KJCA 1B8OA 4HQ6A 3R7NA 2JDID 2OYSA 1NDHA 4KXQA 1A9TA 3FB1A 2DFPA 1FA9A 2WINI 2Z2YA 3RVQA 1QPGA 1PX2A 2GD1O 4QQ8A 3U9SA 2C07A 4KO8A 3K9LA 4Q1EA 3D2BA 3NKFA 4REQB 1C7RA 2E6KA 4P92A 3RSCA 4AZ0B 1Q95A 2HBZA 1KK1A 1E58A 2QLJA 3EDOA 1GZHB 4ZAVA 3KJGA 1UJ5A 2QJTA 5D6OA 3TIGA 1LPNA 3T3DA 4JS0A 4YJHB 1RHQA 2ZGVA 2WVGA 1LJ8A 5FNVB 2Q21A 1BHSA 5AUPB 5LXTB 1Z7GA 2EJVA 3D3WB 1FNCA 3F3KA 3GLUA 1K8QA 4FFBB 1MW8X 4BV3A 4CNBA 3E70C 1RPAA 1OT3A 4W1PA 2JH8A 3KR2A 3NUQA 4S2EA 1GV1A 2AN4A 5AM5A 3IDZA 3C4VA 4R83A 1ES9A 3PV0A 3EJ6A 4EG6A 3RVPA 1VP3A 4AKIA 3RODA 4DEVA 1H66A 4RHCA 3DLBA 2G5TA 1ZD1A 1EVQA 4GKBA 4CG1A 3LW8A 4UOEA 5ILOA 1N2CB 2O3QA 1WDTA 3ZKWB 1FQWA 1M5TA 1U7OA 2AFHE 4TT3D 1KI7A 3CR7A 5J2UF 4D9MA 3P2YA 2OLKA 4NOLA 2J41A 4FW8A 3KYDA 3S44A 5EMMA 1D2AA 1NDQA 1XXHE 2X9QA 4G5XA 1SKQA 1T1JA 2G82A 3Q8WA 4RZ3A 1D2CA 3JQDA 2HJ9A 3OF3A 5EJIA 3TLGA 3QXJA 3KKEA 5BYAA 1E4VA 1NF3A 4QUJA 3X1ZA 4NXMB 1YMVA 3B5EA 2BGLA 3SKXA 1WSBA 1PSZA 1A9QA 3GFSA 3Q7PA 4INZA 3RFXA 4D0LB 1VLHA 3DTVD 3I45A 4ZI2A 1UIMA 121PA 3SEFA 3QUQA 2F55A 1ULUA 2P27A 3OKFA 3TCNA 2R00A 2AXNA 3BGOS 1FDOA 1PBTA 5H68A 4TZ6A 2H2AA 3ACDA 1H6BA 3HKEB 4LQCA 3IT2A 4LXXA 2BMAA 4WZBB 1MHPA 3C24A 1QANA 3IJRA 5ALLA 3TVDA 4PGFA 4TV8F 3MT8A 3GCWA 4HAZA 1BCSA 1L2TA 3ZH2A 3UYKA 2KB0A 2OGSA 2EP7A 1E3EA 4KX5A 1BIFA 4R7ZA 1HDOA 2HDOA 2VDWB 3NPMA 4K9RA 4F3TA 2ZXFA 1T4BA 1WQ4A 1Y8RA 4MRMB 2IYUA 2WG1A 4GNKA 5F2KA 1QRSA 2DFNA 2BI4A 5LSAA 4MA0A 2D00A 1E0DA 1L8LA 2DQYA 3O8NA 1FFHA 1JG4A 4J94A 3BDIA 1F4PA 5A1TA 3AB3A 1I0ZA 2V7QD 2C8VA 5CNKA 2J3JA 1Z15A 1V7PC 5D3MB 3G2JA 1IEXA 3JTEA 1LF0A 5EA2A 4D2IA 5HYVA 5AUQA 4PGMA 1ZNZA 4HB0A 1NN3A 2F17A 4LISA 3NAGA 1FYEA 3A3YA 3VKWA 2HHHB 5JLAA 4HYTA 2WKPA 1WV0A 2BCJQ 4FK8A 3T5TA 1J23A 2JGMA 3GUVA 4L8YA 3VPBA 5A0VA 4OYHA 3LRXA 1E7SA 1ZK1A 3KWMA 3L46A 1JVBA 3BJEA 3E7DA 2IXTA 2AMVA 2REOA 1B3RA 2W43A 3IBSA 3KCQA 4TT3A 5IF3A 5H8WA 1BEZA 1CS0A 4S04A 3SZ3A 5CR9A 3EZ9A 3R09A 1ZOPA 2JZCA 2YHIB 1ILWA 3CLSC 4J4HA 4JT8A 2N0SA 4LJ9A 3SJ7A 2MSKA 5L4NA 5HM8A 4HVAA 4P2GA 4V0RA 2P2DA 5EPUA 4QUAA 3I5MA 4BFVA 4ZVPA 5CA0A 3SMQA 3HWRA 3Q40A 3WYBA 1KGSA 5DBGA 1H0SA 3OHPA 4ZOLA 4JI0B 4GLBA 4RADA 2FMXA 3HKCB 3FHJA 3ZVKA 3KJHA 2O8DB 3U13A 5JCPA 2R97A 3DBRA 5KZMB 2WSLA 3TKAA 1NRJB 1DCKA 4ZGWA 1NZDA 1EA7A 4OVKA 1QS0B 1W2WB 4MIYA 3IC5A 2F7SA 4FR5A 3C5WP 1OTYA 4RL6A 5BR7A 2ZULA 4OL0A 3K0BA 4FSXA 4LG1A 3U3DA 3FVTA 3V1UA 4IY1A 3W4KA 4BWGA 3OURA 1D7AA 4ZHSA 3L8MA 2L19A 1UAYA 3BFXA 3T9DA 2QD5A 3CH6A 1EXMA 1Q3HA 3Q5EA 4NYJQ 2HSJA 1XQ1A 4RE5A 1HSOA 2VZLA 3CEHA 3N6VA 3GOHA 4OUDB 1DC7A 4IEEA 3P9IA 4JMLA 1C7EA 5AVJA 4RY2A 4NU5A 1ISFA 3R3SA 4E7OA 3TSWA 4IJVA 3O8DA 1H2WA 4G0YA 4BLVA 3DYBA 3U80A 3OZGA 2PWAA 1Y9EA 3QTBA 4JT2A 4K6HA 4R51A 3RSFA 1RYHA 3CUEF 2C5GA 3AVYA 2P9GA 4YCCA 4OPMA 4JC8A 4KE9A 1I1QB 4LY6A 2WFLA 2O3SA 3EZLA 1YOVA 2IF2A 4GX1A 4LMBA 3OE4A 1MAWA 5KDLA 2GJ9A 2COEA 3R5HA 1J90A 3FCYA 3DR5A 2UUAB 3CBQA 4PR3A 4QASA 5GONF 3TIFA 1SA0A 1EFLA 3C7AA 1YFZA 3FYUA 1E8NA 2WIGA 1RKVA 3K9CA 5JG7A 3N7AA 1KY4A 3TMKA 3WWEA 2A67A 1X7ZB 5E3IA 5IDVA 3X0DA 1YS4A 3OOYA 2UUCB 4L85A 2X7JA 4YXFA 3GZTB 1P6QA 3KBOA 4RETA 4UTRA 3HUUA 4AXBA 4DXAA 3HN6A 1YT5A 4RV4A 3VNUA 4MICA 2PO5A 1CPYA 2V7QA 1D6JA 1N2IA 3LBFA 3QEOA 4Y67A 4LF8B 1NI5A 4TMXA 4TV9A 4REOA 4OJKA 4I8DA 5CRIA 4BLQA 2Q5QA 5JNUA 3ORRA 4PHHA 1V4BA 1AA6A 4MR8A 3Q15C 3QI2A 2UUPA 3K9QO 3G8AA 4F92B 3GROA 1W0KD 2H7YA 1C8KA 2ECFA 1Y63A 2X42A 1ENYA 3E9QA 4NE9A 2EFDB 4N9WA 3TB6A 4FMDB 5JSHA 2FW1A 3PUYA 3ZEAA 2ECPA 3N2NA 4KU4A 2ZEJA 3X3HA 2ZB7A 3GT3A 4XUCA 3JYQA 3W5DA 4ICIA 4HLQB 4ND7A 2H5JA 3NJ4A 3A9WA 1B0PA 5DASA 2OKGA 1K66A 2PD4A 3MNFA 4DPLA 1P81A 1OLXB 2I9KA 2IXBA 1T43A 5DT9A 2IYXA 5J4HA 4P4LA 4L8FA 4PC7A 1CE8B 1WG8A 3GDFA 1Y6ZA 2QF7A 3OCZA 2TMKA 4BBPA 9LDTA 3FNHA 2QRUA 2J5XA 2UYGA 4HYEA 1WZ2A 2VYND 4ZODA 1FNBA 3OCVA 2XCQA 2CXXA 1QE5A 1SWVA 1F2TB 3QWBA 4HB4A 5D5HA 3WMWA 5JLJA 1OAAA 2PMKA 5AJYA 1GNRA 1VMAA 2OSBA 5DLQC 3DS8A 4OHZA 5CLIA 5SYNA 2V59A 5KNBA 5JCJA 4M7OA 3GLFB 2ZJ7A 1IEVA 2P62A 2P4HX 4MB6A 4XQEA 4KJZA 1TTPB 3EIQA 5C1BA 1F9AA 4ESOA 2AF4C 4DV1B 5G0TA 1M8JA 1N6NA 4ZQEA 1LBHA 1Q0QA 3KOMA 5CB6A 4W5RA 3NEAA 4B45A 2WT4A 1QM5A 1S2OA 1Z9BA 3KX2A 3SU8A 4C7XA 1CULC 1PFKA 1RI5A 4QEKA 1XTJA 2IU0A 2J4DA 3DNPA 1Q0SA 4XLZA 3UK2A 2ZWIA 1GUAA 4X97A 4J0CA 1D2GA 2Z83A 4OUKX 4RK4A 4IEFB 2ZE5A 4P3YA 1M0WA 4XSHA 4PSVA 1RW4A 4KNWA 1ZD5A 1HDZA 4H7EA 5TF0A 5HNKA 3OP4A 2WU0A 2EFCB 1UQRA 1R6XA 1JAIA 1H2RS 3RJTA 3PQ7A 4ZEXA 5T4FA 3TN7A 1T3ZA 2JRCA 3AEYA 3QEBZ 1V35A 4PX5A 4ZYUA 1NWCA 2BJHA 3K6SA 1HI9A 2WU4A 4HFRA 4TS4A 5GAJA 1KE1A 5KO2A 1CERA 2OR3A 3IKMB 1C0PA 4LZOA 1DBQA 1L7OA 2HO4A 5HF9A 1Z5GA 3LRPA 4E5MA 3O83A 4A0GA 2MINA 2DPMA 5JZ9A 4BCBA 1JAHA 2IOFA 3UXYA 4DRXA 1XV5A 5CH3A 1W47A 2E5FA 5AJXA 3HLTA 3T3GA 1KNXA 3WGHA 1MHTA 1L4YA 1XSEA 1QO7A 2XKBA 5LD2C 3F6EX 4R5MA 3KALA 2Q3MA 2Y0CA 4JJEA 2KM1A 4AY4A 2CFIA 2VNHA 3W6OA 3L6DA 4J7XA 1BJTA 5EP4A 4ABTA 1CLEA 2I3AA 1SXJC 4CM4A 2R87A 2QKYA 1J8FA 1VL2A 3NWEA 1V39A 3EF3A 4P36A 2QLTA 4II3A 3TLCA 1SBHA 1JDVA 1Y3BE 2XY4A 5FOUA 2WOJA 4C87A 5L53A 2RGGA 2FG6C 5CVUA 2I1WA 2OHHA 3RUAA 1D1TA 1V3VA 4OGWA 4CF6A 2P3QA 2QPLA 2YFHA 3U7JA 3AVXA 5EE1A 1H93A 1B26A 3ABSB 3GRCA 2ZTUA 4HEJA 4L4UA 1E92A 1X80A 4QLOA 1E2QA 1N4AA 3TR6A 1QBGA 3OM0A 4WAUA 1Y3AA 4JELA 3T9EA 3VX3A 4BUZA 1GPBA 3S8EA 2Y76A 2EGUA 2LDXA 2YWDA 4MVCA 3O8RA 1XKQA 3E18A 1U2QA 2WTEA 3IP5A 4MI1A 3IB6A 1ZIOA 2G67A 2ZJYA 4MAFA 1QFXA 3CLHA 2G6TA 3H99A 3TBKA 2EATA 5EP3A 4BJ6A 2AMLA 1RACA 4B85A 2GAFA 1Q17A 5T4HA 1L7XA 4NCIA 2C83A 2DQKA 3KSZO 2XTAA 4AO7A 3OF2A 4JJGA 3LT4A 1IY9A 3E22A 1KR2A 2F3SA 2FR8A 4L9RA 3QU9A 4O2BB 1RBZA 5C35A 2HMSA 4RVGA 2C97A 3VR5A 3FOEC 3PF9A 5I9IA 2H2FA 3KUCA 5CHEA 5JVDA 1YB7A 4CQLA 4FOLA 2R3SA 4H6XA 5IC6A 1JUDA 3HHPA 3EOZA 5CHYA 1T3LA 2B83A 1W2HA 4DLKA 4TVSA 3R0XA 4FMCB 1TU3A 2ZAMA 4O4JF 4GBED 5JJ5A 1ZSYA 2X0FA 2PMDA 2WM3A 2ZXEA 4G6ZA 2A7XA 2OQVA 2IZ1A 4F6RB 4H31A 1B6TA 4OSOA 2B8WA 1N6OA 1EFRA 3B85A 1S8NA 4S1VA 5IH7A 1RKUA 5FPQA 3M6UA 3ZU4A 1I2CA 1OREA 3NYWA 1KS9A 4B81A 2QZZA 4IM7A 4BFCA 3TQHA 2JI7A 2C9ZA 4IXTA 2WYIA 4LVOA 3SHFA 3I6MA 4BVEA 4EA8A 1I6WA 2GZSA 2DX7A 3RIEA 1MPTA 1SD5A 3QNWA 3Q3CA 5GTDA 1A7KA 1DLJA 1WCIA 2H1FA 3AOGA 1ONOA 3TSAA 3RRNA 1OVGA 4PQFA 1C1XB 2JLCA 2Y99A 2V54A 2VJYA 1QVZA 4PYQA 3L6OO 2IPOA 5CCXA 2IS2A 1EWRA 4G1FA 3UTCA 2XVZA 2AZDA 3KWLA 4OJTA 5IMBA 3VR1A 2CHQA 4MJXA 4XFKA 3T7AA 2DOKA 5SY9A 1MAHA 4DWJA 1TMGE 3OEEA 2G06A 4CM9D 1FFYA 2FMHA 2D0IA 5FD8A 3DXYA 1CQXA 1UKZA 3G5TA 3P97A 4C1BA 5KWVA 2GM3A 2VRWA 1DOHA 3JWJA 1E1KA 5K2MA 2BONA 3U4HA 4G5HA 1B73A 5CGZA 4DGQA 2LDBA 1FYXA 1HBJA 3DEZA 4I4CA 1XU4A 4N8DA 4C04A 2P65A 1JG7A 1PNOA 3A3PA 3WGZA 1KJ8A 2OBLA 1Z39A 3KJXA 4KXLA 1TM1E 2HA6A 5BQFA 2AYZA 1ZD4A 2CHUA 2WTAA 3F7TA 1XTSA 4U7WA 2E4VA 4ANFA 2WNIA 1Q0LA 4G0MA 1JBEA 1I3NA 3N1UA 5JS1A 3U1BA 1JSRA 4RXMA 3RU7A 4L50A 7REQB 3FRJA 1VE6A 1JG3A 1IK6A 3P5BA 4UCWA 3VHXA 3KWJA 4HDSB 2PANA 3I3OA 1E5VA 1E7QA 3F6SA 3OD5A 3OIUA 2VF5X 3ASUA 1X0XA 3EVCA 3ROKA 1C4XA 4GSLA 4KH0A 4BNIA 1KVQA 2NXEA 1D9ZA 1RQLA 4QT4A 1LDEA 3QXSA 3E5NA 5FBWB 1VKOA 4LYGA 5LDDC 1XCJA 3LOPA 1E2LA 2FZGA 1RE0A 4IPTA 1N8TA 2RBKA 2YICA 5KNDA 2V58A 5FPTA 3ZGOA 1T8WA 3JAWA 1EU1A 1E59A 1WB4A 4DQLA 1JDUA 5JQGA 5CCEA 1BS9A 5A4DA 1QZZA 4INPA 5SZJA 6Q21A 3TZKA 3EK2A 1J2EA 3HWWA 3UT5A 5KNDD 4U6SA 2H11A 3H11A 4ZOLB 1LSJA 2FPGA 1R9JA 3CE6A 1Z8FA 3ETDA 4H3VA 5EG5A 5A62A 4MV9A 1JKIA 1LC3A 4W6ZA 3W90A 3SVTA 4KFRA 4BOYA 2ZKIA 4Z9XA 2A88A 2V55B 2G28A 4CKZA 3EA5A 3H1FA 3H42B 2PH5A 1W44A 3QVWA 1E7RA 4HXYA 2ACVA 5J1TB 3HCAA 3UYLA 4EG8A 4JLJA 4LHZA 4M3NA 1T2UA 1NW7A 3WP0A 3HNPA 1Z5OA 4JYPA 3DBLA 4X1YA 3ZJVA 2TMGA 2EBWA 3MC1A 1OHHD 2R66A 2ZYSA 3O90A 4REQA 4EGJA 4TLDA 1GEGA 1ZMBA 2XUQA 5J2UB 3H11B 5GV8A 2ORVA 3U2QA 2K2QB 5EE3A 2O3TA 3ZE2B 3AM5A 1HL3A 2MSDB 3KXDA 3KOZA 4LXIA 2H5EA 4LXHA 2O23A 1PT8A 4X95A 5BW8A 4KYVA 3TX6A 1YAJA 2R7LA 3NIBA 5IEBA 1VHLA 4FE7A 3CLVA 3U37A 4IG9A 3VU0A 4BNDB 3BIWA 3N8HA 3NRJA 1EFKA 3GNSA 5CVVA 3DAYA 1NZFA 4KO4S 3Q72A 1XCGB 5BURA 5H4HA 2CFOA 4ZQIA 4P7JA 5I5GA 3ZVLA 2VQEB 2OC9A 3RRMA 4DTCA 2XXAA 3GUCA 5T8KA 5TEWA 2RCNA 2ST1A 3MAJA 1SBIA 5F35A 4RH0A 3IT3A 4UE2A 2F00A 4DXDA 1U81A 2XMBA 2HCFA 1MUUA 2XXJA 1BSVA 3NYIA 3PL1A 3SOZA 2FR0A 3AP1A 2RC6A 2RGAA 3CF4A 5FI1B 1AF7A 4WBNA 4ZMSA 3VAZA 3ZCPA 1ODSA 5KJFA 3FYUB 2Q4EA 3NM6B 3GCZA 4DRZA 1U0LA 1XAGA 3AJ8A 3H2SA 3HJCA 3LNTA 3UMJA 4EY3A 2OK7A 3A11A 1OA0A 3OCCA 1HQDA 2X4DA 4Q82A 5DPMA 2JAHA 3L6UA 3W8NA 3GZNB 1FNNA 1ZRNA 1JZTA 1LX6A 3KR1A 3PPVA 5C0OE 4EIWA 3V4PB 1G7CA 5ESDA 5LP6C 4QHYA 2LCFA 3IUBA 3U44A 2XBUA 1PR5A 1GZUA 1OAOA 3JSAA 5A2QA 5FOQA 1L8QA 1X1TA 4G1VA 1KJYA 4ZRNA 2VQFB 4C3ZA 3SIWA 2NO7A 1V6CA 1XJWA 3RYHB 3LUGA 4FLEA 3MUEA 2B7CA 2DQSA 4XW2A 2C7PA 2PTHA 4F04A 1ZO8A 1PHRA 1O77A 3PVCA 4CQMD 4L73A 1E9RA 1U3WA 4KXYA 5IARA 2SKEA 4IVPA 4GYKA 4GS5A 2Q5EA 4IINA 2E18A 3L06A 2HK8A 2IEAA 4Z1MA 3MA0A 4D4HA 3WAKA 1GDDA 4HKTA 3EIXA 4EYGA 1WSDA 1SKYE 3UQYS 4YALA 2XGJA 5EHQA 4L16A 3RSGA 4RLHA 3EXHB 2CNDA 1BHO1 3OWOA 1Q11A 3MLBA 1RPJA 4O0MA 2ZYIA 4F06A 1VSBA 3A1EA 2FSUA 3W2FA 2ZREA 1GSIA 1MMFB 2JG3A 1YS7A 4AJHA 2PWZA 3I2HA 4HRAA 2VJBA 4LBWA 4PHGA 1XJQA 2YV5A 3JCZA 4LOAA 2W93A 2ZRIA 4OYLA 4D43A 1KKUA 5AK6A 3TQIA 2Q3CA 3R44A 4HH1A 3MFYA 3RJ9A 4Z86A 5KTNA 3A9CA 4I99A 3JAKA 4Y2VA 5TS3A 1RZUA 1E77A 2GMWA 1S2MA 1V5WA 1SUWA 3B9PA 3ZWOA 3THXA 3DT9A 2HCJB 1T0IA 3N58A 5F5LA 1CS0B 2ZB4A 4LY0A 3RF6A 4B7AA 2WPDD 1GGJA 1KMMA 2IHBA 5ALUA 2FW8A 3UWSA 1UBMS 4DV2B 1K7FB 4KIGA 4ABYA 4M9XA 1VBMA 3B51X 2QWXA 3L7IA 1KPHA 3HDGA 1ISHA 4HJRA 2IQIA 2W2MA 2E5LB 1Z6XA 4AMBA 5C5DA 1T4CB 1TO2E 1N2JA 2XQFA 4TQGA 4CR8A 3NTQA 3DBHA 4FGWA 4P1ZA 5JRJA 1GVNB 3MMNA 2PFSA 1Y33E 5A4JA 2Z3VA 1NU6A 3WWOA 2D2IA 3DZGA 5FKJA 3RFFA 4BU0A 1XVVA 2I5PO 2E1RA 3QPAA 5CDFE 1UBEA 1WUIS 5DYYA 3KKKA 1JFTA 3OZEA 2A1UA 4CXMA 3FUTA 2IV2X 1H8HD 2Q1SA 1FYDA 3OLQA 2H2WA 2II6A 4E5UA 4L22A 3DXXA 1RRGA 2EJUA 1Z74A 3LP6A 1ZUIA 5IH3A 2I1QA 3MJHA 3LY9A 3AVPA 4L0MA 3D1LA 1RIIA 3H8SA 4QUEA 5F7XA 5IBCA 2H57A 1I5RA 4TZ0A 3ENQA 1N0WA 2BEJA 3R0JA 1VKJA 3T5DA 2J0QA 4FUQA 1TECE 1MT0A 3F4KA 4P0TA 3U3RA 2QMZA 3QVLA 2ZI9A 4YRLA 2ZI5A 2X9VA 4N18A 2I66A 1TEVA 4X6YA 2ZVJA 2HYDA 4XSVA 4OIFA 4R16A 2DHDA 2UDPA 4Q48A 1F8UA 3UJCA 3PYXA 4DIUA 2NM0A 3KXPA 5JFGA 2R1VB 4PSAA 5DK4A 1F20A 5DHRA 3PU6A 1E98A 1NR5A 1VI6A 3LUBA 4QDKA 1B6RA 3PHHA 5FJIA 2O2JA 2X4IA 3TB4A 4JJ8A 4A91A 5B7QA 4F5ZA 2QT9A 1ILEA 3HZZA 1ZUWA 3EOAI 3F5FA 4UMEA 5DN6D 1YK0A 4JR2A 4XR4A 2H0RA 4KR2A 2ZIZA 2ZWMA 5DI3B 1CNFA 3PQ8A 1VIDA 2XYPA 5GIOE 1RAFA 3H1BA 3F47A 1TU4A 4OJMX 3ENVA 3HVUA 4RMGA 5EMNA 3SYMA 1YBHA 2YS6A 4HY3A 2A9KA 4CIWA 4PN7A 2YWBA 3T7RA 3ZQUA 1Z4PX 1O4WA 2WIBA 1F8FA 2LIPA 4WLVA 1VOTA 2TSYB 4HNUA 2H2DA 3D6MA 3DUFB 4GZMA 3NO4A 4YRNA 4KG7A 4PIMA 1NQTA 4US1R 5DWDA 5DZSA 3S70A 1ZESA 4QU5A 4UHHA 4YJFA 3SJCA 1FRNA 5I7WA 3ZVMA 5GJBA 1JLLA 3IJEB 4R1PA 4AWAA 1WXIA 5CT9A 2PUFA 3ORHA 4JYCA 2FAXA 5B3LA 4IOJA 5B3AA 3GAMA 1AZSC 2I3ZA 4IYJA 5D5PA 621PA 1BKSB 1NMEA 1QH0A 3KZNA 4F3NA 2A2ZA 4RDHA 3HYSA 1NMQA 2FNAA 3FRIA 4M0UA 2WG2A 4CIXA 2IU4A 2JKYA 1JSXA 3T52A 4RH1A 2V6FA 4BWYA 4QPJC 1R0BA 3DZHA 4DE5A 1KI4A 4JJ7A 3QEKA 1WXWA 1XZJA 1C8VB 3C8DA 4KLCA 4A27A 3S40A 3KQPA 2CXSA 1D8AA 2R2GA 3U7IA 4WGGA 2IZ7A 1MQSA 3JATB 1THTA 1USVA 2AB0A 1ND5A 2XAUA 3C7KA 3IT0A 2RI0A 3PEVA 3V7FA 3Q9SA 5L40A 3S8YA 1J21A 2GRUA 4U3JB 4POOA 2P2CA 2PAAA 4W9NA 1MC4A 2RI6A 3K8QA 3ASVA 1Z13A 4G0NA 4MWOA 3IIIA 3GLSA 2IWHA 2HEGA 1EFHA 3E82A 5AI4A 1Y3IA 3PUXA 4DYDA 2CLKB 5JO0A 4EMTA 2HU2A 2XAAA 3MJCA 4L3OA 1K7EB 3WYAA 2BMJA 1VJTA 2CLDX 4URZR 1SZDA 1U6JA 1XMXA 1HEUA 2WICA 2X1HA 3KTDA 1PVVA 3ENKA 5LVAA 1QTNA 3PUZA 1JQDA 2Q4OA 4J2HA 3EWAA 1DT5A 3RVLA 2XZTA 4BX9A 1WMSA 1QH9A 4F4DA 2D54A 3LJKA 4BV2A 4HN4B 1DIAA 3BD7A 3ED1A 1VHWA 5K3FA 3SXPA 3D0KA 3FPSA 2RB4A 5GGYA 3IOMA 3EEQA 4FVTA 2Z08A 2O5CA 3E7PA 2V7EA 4CTJA 4Z49A 3D8HA 3EC2A 3M6MD 4FMCF 4YUZA 1SG6A 2QJRA 1WL8A 3LPDA 4OX9B 1WCXA 4IYRA 3BMNB 2B5WA 4TRJA 1VCNA 3BN3A 2NAFA 1ONBA 5GVSA 1GXSA 4Q9JA 4D1YA 5LQCA 3CEPB 4J16A 5K1ZA 2HK9A 2XYGA 4KLRA 5JNRA 4KOAA 1UOOA 1OLUA 2WMOB 3K9WA 3O4GA 1VC2A 2OGZA 4C14A 2ZZMA 1GYPA 2ZJ0A 4E94A 4BQNA 2RGBA 2W70A 2AVNA 1Q44A 2F1KA 1CR2A 4B46A 1DC6A 5T64A 2Q2QA 4XWYA 1T2NA 3ENNA 3UXMA 3DLCA 4IP0A 1UJ6A 4YRMA 4W99A 3BFPA 1JB1A 1UZMA 5EZQA 5JRZA 2F6RA 1P3JA 2A9PA 3ZS9A 1AS3A 1AUXA 5CPFA 3GJ8A 1J9GA 5ALFA 4MYTA 1IZ7A 4P3KA 3E4CA 2HFKA 5KINB 4WQMA 3RRFA 1G21B 5LQRA 3V9PA 4O4LF 3CVYA 1WVMA 1VKHA 3BL8A 2AFIA 1P7CA 3F96A 1SU7A 4FTWA 2DHCA 5DSXA 4IIEA 4P5PA 1RAAA 3I09A 4E11A 3DEJA 3QPUA 4MIKA 5AKJA 1GWNA 1OFHA 3GLGA 2ZZNA 3JQ7A 2R85A 3PICA 3ZTTA 3L49A 3AINA 3RS7A 2VK8A 1T24A 3BJRA 4OSEA 1NFRA 1Z0ZA 3DQPA 1K7XB 3CNBA 2R47A 3FRHA 2AQIA 4J91A 2NSDA 3RSHA 3SHWA 5AJZA 4QRHA 5TJ9A 3RS0A 4G84A 4I5GA 3GMTA 4Y18A 3UJ3X 2Y9PB 1GARA 3N76A 3I04M 4ND6A 3DEKA 1NAHA 4ZDWA 5AW3A 4E4RA 1ZU4A 1Y37A 2X0KA 2G3YA 3BWDD 1U0SY 4L4SA 4E88A 2IHYA 4U7DA 2HZ7A 4UKDA 3KEFA 1PWEA 1E6LA 3ZE0B 3LQQA 1KVTA 4NDZA 5LMNB 4HLCA 3K6RA 1D4OA 2FQYA 3D02A 2AJLI 5CFZA 3V46A 3REOA 5KVAA 5CDSA 4YRRA 3TINA 4YMHA 2QVXX 5EZ5A 4HRVA 4R5HA 3TOVA 3EBPA 4I2VA 2BSXA 1RYDA 2WAYA 3SWWA 3AEZA 1SXHA 4XWAA 3V80A 3V4VB 3FWKA 3GJTA 3KQTA 2D74A 1V8ZA 1UFRA 3STYA 2MSLA 1JIQA 1CQIB 1Y98A 2IS1A 2Z5LA 1C0KA 4R2MA 5JPDA 3PDIA 3KU4A 1TK2A 2H1RA 3LECA 2GXAA 5EUQB 1EM8B 2UXCB 1U2ZA 1O0SA 4R1MA 4LYFA 5U9CA 4DRYA 2E4XA 4CQLB 1KAMA 4BMPB 2HJWA 4JN6B 1QVVA 4C5AA 4UFPA 1GUYA 1C0IA 2C54A 2PZGA 2ZUWA 1H05A 3R3WA 4P53A 1PL6A 3VFDA 1RYBA 2QUZA 2ZITA 3A3KA 3OPXA 5DXAA 4FFSA 3JQPA 1S2NA 1X8XA 2V0NA 2ZBVA 2B21A 2Y0EA 1TUIA 3NKVA 3R3XA 4GZ3A 3JQRA 1M10A 1O6ZA 3HDQA 4FDUA 5WRFA 4QG3A 3FD8A 3LC7O 4GLLA 4GKKB 2F3RA 3HDYA 4AZSA 3CRVA 5LP6B 5TR9A 4YTEA 3M33A 1NA5A 2QGZA 4QGFA 5LIRA 1HGXA 2ZTHA 4QNRA 1G2PA 2NSHA 2PX3A 4C0JA 1EUDA 5I6DA 2LUOA 2PXCA 4U2KA 4ZOLF 3G2LA 2I99A 3NAMA 3UV3A 4EDHA 1NOKA 2P9FA 4M7RA 4YHHB 4XDGA 1DG9A 1WMAA 2CNWA 2LW7A 3HCDA 1TCCA 4Y6PA 4F4IA 1JE0A 4UZEA 5IAKA 4DCSA 4DIDA 1IHXA 1FDIA 1JHYA 2JDIA 2V7GA 5HJ7A 4B5LA 2Y27A 4RJ2A 2PS1A 1YR6A 2YWFA 4RVHA 4CMEC 3T3OA 4OM8A 1WXDA 4TKZA 5I9TA 3EFOA 2FMKA 5C3UA 4MUKA 4EY4A 3EMVA 4OFBA 1Q1AA 1WV1A 2CKDA 3K5IA 3NONA 4RCVA 1ZAYA 2RGXA 1QUFA 1QZTA 3ER8A 2EQBA 1G9TA 2WFAA 1T8RA 4P31A 3KLNA 1L3BA 2HLHA 1Y4ZA 2PJZA 3EMKA 3JWIA 1X87A 3ZZMA 4ZVSA 2HK6A 4WERA 4EJSC 1DXQA 2F1OA 4W7SA 2JATA 4CEJB 3NPAA 5HA5A 1HF3A 4N1AA 5TDHA 4FR2A 1NQAO 3KSDO 3QVSA 2XOKD 3CX7A 4LNAA 3UO8B 1KPIA 4MWCA 1C3OB 4O0LA 4PBRA 3S2FA 1RABA 1STOA 2QL9A 5AHWA 3AGQA 1CZKA 1WXEA 1XFAA 4UUNA 1K5DA 4AJ1A 4M0PA 3W5JA 4DJDC 1GL9B 2IA5A 2NPOA 3A6GA 4HV4A 4YQFA 2AG0A 1KQPA 2QA5A 4JMPA 5EZ6B 3OZIA 4JKYA 1W9HA 3L07A 2IHVA 2JJMA 1P1FA 4QECA 3ONEA 4S12A 4IJ5A 3ZS8A 2HD4A 3NTXA 3PYLA 3COPA 4QXOA 3HSKA 1A9YA 3WI7A 4A1OA 2XMSA 4X54A 8MHTA 2YC4C 1RRCA 4KGZA 1DX4A 1Q0PA 1GM5A 1YQQA 3CZQA 4R0MA 1FIUA 3RVMA 4CCAA 1X7YA 1ZK3A 3UFXB 2AWOA 3K6KA 5FULA 4E5PA 5K9ZA 4XOUA 4BIIA 1JIJA 4RHYA 2I7VA 3CCFA 1SULA 1UXJA 4BB0A 1DXYA 1Z7WA 4C29A 1ZFNA 2WOOA 4KBGA 3LT1A 1A1SA 3H5NA 3NR2A 5LQMA 4NCNA 3A6EA 5CJ2A 3KOWA 3NFRA 5AK0A 4YJHA 5G02A 2N42A 1ZGHA 4RJTA 1DQYA 5TPZA 5F1KA 4FDTA 2PHZA 3A7DA 3GVIA 2CJYA 2DXIA 3WL8A 3VR2A 3NGMA 1EDEA 3DYVA 3H6HA 1I1OA 2YX1A 4NK4A 2C5LA 4BO7A 5LA6A 5TPZD 1EFCA 2GEBA 4FCCA 4BE9A 3KJFA 3P4UA 2IP4A 1TAHA 3SFTA 1TRHA 3T5GA 4LEIA 4EJSB 1XD8A 3L1KA 3KETA 4W82A 3CW9A 2OOSA 3LFTA 3ZGNA 3N2ZB 2VWPA 3MGCA 4UUMA 2OENG 2QT1A 1XWWA 4ZO4A 3QI7A 3ZI0A 2Z30A 3C5CA 4JI8B 2B6NA 2D2EA 4P5DA 1TZKA 2G0TA 1JEOA 2YNMC 1J24A 3QTLA 4Q3OA 3X1MA 1V0JA 4BB9A 4C6RA 4DMFA 1RC1A 1RJDA 2D1TA 3PHBE 4MX8A 2BRUA 2CF6A 1SC3A 3TFWA 5HRUA 1DXHA 5A9RA 1L8OA 1P19A 5C7YA 5CFPA 3G1WA 4BVJA 3FY4A 3AU8A 5JSQA 1NVUQ 4IGKA 4V1CB 3GLIA 5FBHA 1DV2A 1TQ2A 4XPIA 4BZZA 1P5HA 1LVUA 2XDQA 4D8XA 1Y4UA 4YMVA 3FNIA 3DOOA 4J0EA 3K31A 3Q98A 4MUMA 4O4LA 4M1WA 3JVVA 3PUVA 4W5OA 2R68A 2ZIEA 4NXNB 4WD3A 3RUFA 3DBOB 1R9NA 3ZGXA 3UHFA 1T1GA 4Q4HB 1BH2A 4FMPA 3G59A 1FSSA 2X4LA 3CH4B 4HMQA 3CNOA 3IAS6 4PS0A 1PVOA 2BM0A 1N0VC 5KNCD 2A9VA 3W8FA 4DQ0A 4F4JA 3LLSA 4TLLB 1UZAA 1NVFA 5H3LA 1QF6A 5H1YA 2FV8A 4OJQA 1X1QA 1YB6A 1I4TD 2Z98A 2C2HA 1O3YA 2ZRGA 2DKNA 2X8BA 3G3EA 3JQ8A 1UBGA 3IAAA 1YKSA 4RTJA 2XCTB 4YRFA 1SCNE 4PQYA 3RYIA 3UAWA 1V3QE 4C7BA 5A5DA 3ETGA 3I2IA 3PQ2A 4AICA 2H1CA 1GHTA 2PNFA 4KITB 3VISA 3GFQA 5H3CA 3RT1A 1TMKA 2ATXA 1JAXA 2O14A 4RHFA 5AOVA 5IP5A 4CG0A 1YQ9A 5CMLA 3F4LA 4BLUA 1M2KA 1U28C 2IEBA 1IB0A 3EPHA 4CMIA 4Q34A 3T94A 2FPRA 3E84A 2GRAA 3ONDA 4WNIA 4F93B 2NZ2A 4LOLA 1ZA1A 4JY7A 2CUTA 2ILVA 2QRLA 2YKGA 1GTZA 3BD6A 1LS6A 2ZUBA 2CDNA 2GZ3A 5KYKA 3L0IB 1BXRB 3KKPA 1GN9A 1TLLA 3L79A 4IDOA 4YAUA 5E6SB 5KMGA 2WJVA 4ZOAA 5DYNA 1FUYB 2YV1A 4P7FA 1WEHA 5G1NA 4B3TB 3GIDA 3IV9A 1AKVA 4X6UA 2WWXA 2HQRA 5HWSA 3D9QX 4II7A 2XCUA 1RHRA 2Y92A 4CIAA 4ZVNA 1ZWLA 3KJIA 2C58A 5HGJA 3AUUA 2EDAA 1LDMA 1LPSA 1CWUA 1EQ2A 3CB4A 4JU8A 4A0QA 3U60B 1AKMA 2I6XA 3GNLA 4RLQA 3M89A 4JI3B 2HEIA 4YQYA 2WYWA 3BD9A 4JP8A 1XQYA 4AS3A 5B4VA 3WL3A 4I1IA 4F97A 1OYOA 1KQOA 1M7BA 1DQZA 1B0ZA 2C3YA 4M46A 1YE3A 2HU8A 4MQ6A 3NHRA 3BCRA 4TL7A 2ZR8A 1X86B 3O1IC 4Q4AA 1UH5A 2D5CA 2R65A 2HRRA 4RVOA 1TO1E 3CLUD 2WIDA 3PPWA 1PWHA 1EUCA 2ARKA 4X8LA 4MP6A 4B8WA 2ZATA 1KQFA 2P4EA 1KSGA 2O2EA 1HLFA 1VIMA 1SQSA 4XXHA 2ZK7A 4CN9A 5H70A 3GPLA 1J49A 2DAPA 2DE0X 1NW4A 1X74A 1REQA 3FAZA 1G8SA 3ICWA 4HNQA 4HXEB 1K5PA 1R4ZA 1OILA 2HU5A 4FE4A 2GN6A 3LBAA 4HQNA 4EHNA 1ZHHA 2GWHA 5FTNA 2EL7A 4M0FA 1E3WA 2I4OA 4KUEA 4TKLA 1XELA 2AZTA 3P4XA 3AZPA 1NVVR 4JWKA 4JBIA 4YEDA 1G4AE 1KNQA 3KR9A 4GD3Q 4DC0A 5A3JA 3Q8LA 3NW9A 2OOKA 2A0YA 3GNTA 4JQSA 1NNI1 2XUHA 4PFJA 4Y6GB 5CUQA 1T0BA 1OXKB 2H07A 1LSSA 3PQDA 5B1SA 4BEVA 1JECA 5BMVA 3E9RA 4LF5B 1I5EA 3TUJC 3NDIA 2VHXA 1GG8A 4QHTA 1X7WB 2AS0A 4W5TA 1GUBA 4MPDA 4UHFA 3N8IA 2XZDA 3T4XA 2ZAOA 1X42A 1ECJA 4X7MA 1QQ7A 4UXHA 5F98A 3GOQA 2VPXA 4HDMB 3ILYA 3D3KA 1F7UA 1NLYA 2WSYB 4ZYTA 1ZG3A 3EVEA 2BDUA 3FWPA 3QJYA 5HS6A 4KQHA 4O2BA 5DKFA 1SOVA 1IIRA 4N65A 1DIRA 5CK5A 1FDTA 2J32A 1KJJA 4MP3A 1OX6A 3IO3A 4TXJA 4XH9B 2FX3A 3KQYA 4OKSA 2FK7A 2FR1A 4ZVLA 2CMKA 3KSMA 3QVXA 1P31A 4OHBA 4ZQGA 5JARA 2H3EA 4KK3A 4OQYA 3U4DA 1R0KA 5JD3A 3F5SA 1NT2A 4E5YA 5L3QB 1NBAA 3N87A 2D7JA 1VHDA 1AKQA 3PNOA 2YHSA 1COWA 1VG0B 2JIQA 2VDQB 4F56A 3C39A 3STHA 3W1WA 1BGXT 4QAJA 3K9NA 1EGQA 2NLOA 1X94A 1L5FA 1OBOA 3HU2A 4I6GA 1UMBA 1MRSA 4OGFA 1TQ6A 2P8JA 2FQ1A 3AR8A 1LLFA 2VK4A 4UU8A 4DAOA 1QV7A 3ZV3A 3ND9A 4KQWA 5HIAA 2JD1A 3K6JA 3K1YA 4EGSA 4LJLA 4IWYA 4C0AC 5TIIA 3DLIA 3R8CA 3LZ6A 3I62A 2Y05A 4UJ5A 5E0KB 4MXDA 3CJTA 3MIZA 1QR2A 3W06A 2ZIWB 1AK2A 3RYCA 1S5PA 2VJLA 4JBLA 1YGPA 2GJAA 2QIOA 4I50B 2FK8A 2VI5A 3GD5A 3GUHA 1YZNA 2HSWA 3N75A 4JBHA 4QWMA 4TXHA 1JT9A 4WY2A 5ALTA 5DRYA 3UW3A 1PR0A 3W2IA 1UK7A 4XGIA 4GO1A 4PFSA 2H9AA 4Q1AA 1FTNA 3GX1A 1CS4C 4FYYA 1D4ZA 1XEWY 4A03A 4EKIA 5FHRA 1HG1A 4JX9A 1N6KA 1XDZA 2PWYA 3R5JA 4D0NA 3VAAA 1KVUA 1A88A 1OLSB 3I9JA 4EF4A 1KQGA 3C3WA 2PUAA 3HCFA 1R6AA 1PFWA 5JE8A 4YQEA 1DMSA 4AZ3B 3ZWWA 3RYFB 5C7LO 4I50A 4RTPA 1OB2A 4WXPA 3OY2A 3NHZA 3CA8A 1RBQA 2BBSA 2C42A 2G63A 3R20A 5GGXA 5IW8A 4A23A 5JBNA 1N7HA 3KQMA 2IK8A 5DO9A 4BVKA 2BP7A 1LI4A 2JFNA 3DTYA 1UBNA 3EGCA 3IV6A 1RQ2A 3PD7A 1XU7A 4UDXX 1XQXA 3GYBA 1FFAA 1LF5A 2PSHA 3SZUA 4JQZA 3UB2A 2HLDD 1ZU5A 1BXGB 2OEPA 3W2EA 4D9FA 4M1ZA 3LGXA 3WXBA 1NVXQ 1M34B 2ZI7A 3S5JA 4C21A 1RM5A 1IPFA 3W5CA 1HEIA 4NFHA 2BSAA 1LUAA 2JPDA 3OLVA 4D74A 4DCPA 3OIVA 3N39C 4X8HA 3NCHA 4E2YA 5LR6A 3EZ6A 4FFPA 5JNLA 3HN7A 3IOEA 4X1IB 3OQ1A 1SWWA 4MVYA 1D1PA 1RHKA 1UEXC 4UFNA 3ZJTA 2Z9CA 3M34A 4QTUB 3G2KA 5C8VA 5LZ4A 3GA5A 4ZV4A 1VBFA 5G4KA 4FYWA 3CW2A 2PSJA 2JVKA 3JQ9C 3MZ0A 4M1KA 3UEOA 3G0HA 2ANCA 2I2BA 2X22A 5F5NA 1EZ1A 3N28A 5FORA 3GEDA 2NTEA 4QZVA 3ZWVA 2EKDA 2B8NA 3NNNA 4ZICA 1MT3A 1M1UA 3BM5A 3E05A 4ZAGA 2P68A 5TGDA 2QD4A 4PXYA 3P96A 4XM0A 2PUTA 3AM4A 5AKKA 2GTHA 2YWRA 1XF1A 3PPXA 3A05A 3W6ZA 4KHZA 4FS8A 1W36B 3NNSA 5BNIA 1BQEA 4WTOA 4B3BA 1UBKS 4YMSA 1MFPA 1G5PA 1VJ5A 4K7JA 2E7ZA 1BYIA 4WXRA 2O06A 1UWVA 2ZRNA 4G8JA 2H65A 4NZMA 2VNIA 4FC7A 4W4TA 1XVAA 1E61A 4FOTA 5AW7A 4ESVA 3O5AA 2GKOA 4NBWA 5I45A 4A2CA 3WGIA 3OY7A 1T29A 2J1LA 2HU7A 2MYTA 4V1CI 1T9BA 1FMTA 5A3QA 3PQCA 5HX7A 2RGWA 1X7HA 3E1SA 4OL9A 2VP6A 4MJ3A 1M1YE 5DTEA 3PFFA 1P1JA 1A8PA 1HDEA 3OFJA 5IM4A 1TQ4A 1UP7A 3LD9A 3H5RA 16PKA 1G98A 3EHDA 3FPHA 5DSZA 4ZVVA 5DYWA 3P2MA 3ZNPA 1G6OA 3ZHRA 5D1NA 3IP9A 2H8KA 4JBGA 1TYAE 2XRMA 3MUFA 4OY3A 4PTYA 2AOTA 3TTSA 3BT7A 4JLOA 3AXSA 3BXXA 3K4HA 1W34A 1RNLA 2I87A 2ATVA 2R79A 2PD3A 1U1CA 1M1NA 4OHKA 5JI3E 2OC4A 3ZY5A 4DIOA 2I4TA 2CE2X 2GCGA 3KAJA 3IOYA 5FI0B 1SD2A 2H4FA 1P7WA 2O20A 3L0CA 1KK2A 3PXBA 4X66B 5JBIA 3VPXA 4L8LA 1KIAA 4QJ5A 4I2NA 1ST3A 1NW9B 5CH8A 3ZBUA 5DNUA 2FUG1 4FJ1A 4BN4A 3FDZB 4IRMA 2FF5A 1JEQA 5CIQA 2FRDA 3MCVA 2IBSA 2YDYA 3AEUB 4PSUA 5EWLA 5B30A 1ZBDA 3A0UA 1GZVA 4LVCA 3ZV7A 2O8BB 2FPUA 2XQIA 3N59A 2CDBA 4CTMA 5E4TA 3CURA 4DXHA 1RQPA 2BWJA 3B1FA 2C7RA 3IAHA 1CUXA 2P2GA 5E9QA 4AECA 3MFQA 2BKXA 2QW0X 3NAZA 1PWZA 2XITA 4NG5A 1FQJA 1AHIA 5ALSA 1GRVA 2I4NA 3LQ2A 2H9YA 3BXGA 4YMIA 3ROZA 1SQFA 3PRHA 2WV7A 4F3CA 4R1NA 4Q4JA 2VIIA 1MIOB 1EXDA 4F7DA 4TTSA 4ZN6A 1KHHA 3FNFA 2M6KA 1KI6B 4HAVA 3VPFA 1SCBA 4PLHA 3QBDA 4D6PA 1EVJA 4U6QA 4BCCA 1T0HB 3D6NB 4DT1A 2IYYA 4MV4A 4MUAA 1TM7E 1GU1A 4YAWA 2VDVE 4CEIB 1AV6A 2NO6A 4Q19A 4WKOA 3GEHA 2J7KA 4EDFA 2F8SA 3CKMA 2PWPA 4N5LA 2CVZA 2UKDA 3EGDB 3NG1A 3O7MA 2RB5A 3DF9A 2J8ZA 2Q3LA 4QOGA 2V0GA 2ZROA 4GZ6A 3RSZA 4B3HA 2ZDQA 2CHFA 2HPHA 1Y7TA 4E2FA 5A4KA 4JX8A 4H7HA 4B4VA 1A7AA 4ROTA 4LXYA 3PVZA 4DR1B 4J0QA 4DDUA 3QLUC 2HWUA 3N86A 5SICE 4HSEA 1NXTA 3UB3A 4FILA 4HADA 3K70B 2A6PA 4X6LA 2XVYA 1PS0A 3L0OA 3VDQA 3SBXA 3CH5A 1GL3A 1PGPA 3L8HA 4TS1A 2DCUA 2WPDA 3KQSA 7MDHA 1E6EA 2R751 2ONZA 3HBLA 2R8XA 3P94A 5A7HA 5TARA 4NYMQ 3W3AA 5H16A 1V1MA 2CV1A 1KBZA 1UXGA 1TYEB 1LI5A 4IZIA 1AH2A 1I30A 1UK8A 1G8GA 2NYUA 3BMOB 5KAPA 4C2TA 4ITVA 3IPAA 1SPXA 3TTWA 1XRQA 4LI0A 2CLSA 2DBQA 3G5MA 3GN1A 1J9ZA 2H4XA 4LQ4A 3LPCA 3S28A 3H5TA 1KC3A 2MR6A 2VA8A 5CVTA 5LKAA 3RAEC 2BSQA 3EW9A 2X40A 5EQTA 3I2GA 2AFRA 1TAGA 4BO2A 2WYVA 2O59A 1XZEA 3L8GA 2HTEA 2O1EA 2VUIB 2LCIA 2QUKA 1I01A 4JYMA 5KDOA 4UHKA 4B75A 3L1UA 5CA0B 2YH2A 4MVJG 4X1YB 5F4BA 2FWBA 2IYAA 2JHCA 5CCBA 3RQSA 3EGXB 3QHPA 4KOEC 1NHWA 3IEUA 4IJMA 4K1LA 2BAGA 5A9TA 4R71A 1H3EA 3DLPX 3DJYA 1QOZA 3D43A 1V1RA 1H23A 2ZJ2A 4JA0A 5J63A 5HKKD 3QNUA 4AC9A 2AC4A 1LJUA 2I71A 1Q7EA 2IIPA 3EDCA 6CHYA 1N6RA 4ID3A 2DPLA 5E9JA 1JRLA 3EXIB 2I3DA 2WA2A 1QO0A 1Z47A 2J5RA 3I83A 2BFMA 3DLHA 4B2PA 2W2KB 4DC1A 4OXYA 4LX8A 4U7JA 3DCYA 4TM8A 3WVNA 5FPPA 2Y0PA 3DGEC 5JSZB 2WMNB 4JNCA 5I9SA 1JR3A 4RAOA 1FDVA 3TLZA 2D5IA 4OUDA 4A9AA 2ZM5A 2WF5A 1YJ8A 3V3KA 3B78A 4G5FA 4WN3A 10MHA 4ZVKA 1UT5A 4B40A 1MB9A 3A26A 3VR3D 1PQPA 1ZZEA 3H4TA 2C00A 3NS7A 4GI2A 1M6NA 2CVQA 2YJTD 3L40A 2IYTA 1PJQA 4H7DA 4I4TB 4JLPA 4E5NA 5C51B 4TYNA 2XIJA 3IAUA 4L4ZA 2PR2A 2ECKA 3ILXA 4UE6A 3EFHA 5F2NA 1KP2A 5I51A 5EIHA 2DR0A 2GVNA 1QBKC 1WLYA 2A94A 4OFZA 4GWGA 3DPSA 4DCUA 4IXNA 1YJXA 1ZA2A 4NNOA 3WOVA 4WBNF 2Q6TA 1I5OA 3W9SA 3LYUA 5EFZA 3PGMA 1X7ZA 3A2KA 1RI2A 1OAKA 1D4AA 1WY7A 1OBFO 4GBMA 4TGLA 1RXSA 2CWDA 1VBNA 2PA0A 2BISA 2JVIA 1C2YA 1JZSA 2W4QA 4GLFA 4BLPA 4DAEA 2I54A 1GQOA 4IIGA 4RACA 5IEJA 1AKYA 1Q20A 5E1MA 2EW1A 5EPOA 3Q3HA 4LDZA 4OB7A 5EEHA 1K89A 2OCYC 3VR5H 4B3GA 4G85A 4KK4A 2FMTA 1SB8A 3WKCA 3H2HA 5ICFA 5KYNA 2JIDA 1YDWA 1U8FO 1PK9A 5A0FA 2Y77A 3LI2A 2RKWA 5DULA 4EWLA 3D81A 3AC0A 4YRZA 3EA4A 3UC9A 4H35A 2D7DA 3PFBA 4EGAA 4XLLA 2LPMA 1ULSA 1V16A 2IXDA 1Y48E 3L4BA 3R5TA 5E2AA 4V1CA 2B4TO 2QTGA 3OKPA 3DC7A 2AG8A 2WM8A 1ZCZA 4QSMA 5JDCA 1N5MA 4UM9B 2CYBA 1BAPA 3H86A 3U0BA 3PQ4A 2NYRA 4QYWA 3C6XA 1DKMA 1XZIA 2IGBA 3QWHA 1FBNA 2DTEA 3AY3A 3GH1A 4UHEA 2WLTA 4RDCA 3RYHA 3H4IA 4BC1A 1YVPA 4IHQA 2PH3A 3NBFA 4BZXA 1YQTA 1WW8A 5P21A 2WJJA 1VSTA 5DTMA 3WB0A 4MW1A 1EZ4A 2EF0A 5TPWB 2FPPB 4NS4A 4WA7A 3NC4A 3THYA 5B57C 1FP7A 3MMXA 1SQ6A 1ARZA 3Q11A 2FKAA 2FRVA 4TMWA 2KX7A 1G66A 2EGGA 3FWNA 4KR0A 5B1EA 3U7EB 1QTRA 5I7AA 1M2VA 2ID9A 1Q7BA 2FFAA 1UDXA 3OZTA 3RYIB 1JAYA 1PHPA 4CKCB 3ZWMA 3O73A 2QTTA 2R8ZA 1NVMB 2C0CA 5LZ2A 3C3MA 4RV5A 2GLXA 1YVDA 2QJWA 4CKEA 1E9EA 4O1IA 2VP5A 3K20A 4UC0A 2ZANA 4BN0A 1QQAA 5CT8A 2FEKA 5KJEA 2QI9F 3VU9A 1SOWA 1PG0A 2CXQA 2JI8A 1CY4A 2JLRA 1D9XA 2WB4A 1Q1EA 3QXXA 1X1EA 4CWAA 2XJ4A 3HSSA 3LXUX 3COYA 1IXYA 3ZHSA 1MF7A 3KDSE 1ZMOA 3K1AB 3IP3A 2RIRA 4J1TA 4PNHA 4PRKA 4UHJA 2BCGY 4W1SA 3OBIA 3HGMA 4ZZ3A 1X6VA 3TRFA 1BXRA 1JQJC 2QMQA 5AKHA 3AVTA 3MWJA 4NBRA 3NORA 3VMFA 3NV9A 3VHRA 3BMOA 1DIOB 4H7FA 4JJKA 1GL6A 5DISB 1Y1SA 3R6TA 1IBKB 1CRZA 2BBTA 4MWTA 1XXHB 3HSYA 2Z4SA 4HDKA 5HRAA 3OA0A 1EGVB 1G60A 1CUFA 3QU4A 1CFJA 2W2QA 2YVKA 3RC2A 3KQUA 1Y9AA 3IBCA 3W2HA 5CA1B 1ZYUA 3R74A 1A27A 4M6WA 1AK9A 3ZN2A 4KVGA 2PS0A 2H2HA 3WIBA 1FDWA 1Z3CA 3M4ZA 5TEVA 2WJ6A 4WKPA 1XDGA 1XF9A 1VDMA 1BDJA 3BXPA 3C6QA 3DOIA 3A4NA 3ELUA 2I6SA 2Z57A 2ZBEA 4HNSA 5CG2A 3ZJ4A 3VVBA 3B48A 1NGSA 5DCUA 2XW6A 2BTOA 4NCAA 2FZ4A 5IKPA 2W71A 5IVKA 3NKLA 1TQDA 1PQ4A 2IH4A 4UNNA 1C7JA 1E8MA 3CUYA 3KLBA 2Q4BA 2ZJAA 2QRVA 2XNCA 2ZRHA 3PX3A 1L5LA 1E2GA 1H4QA 1IC6A 4G37A 3K32A 2R4UA 1GGMA 3HB1A 3GFTA 5L3SB 2WTUA 1H8EA 2PMBA 4AUNA 2NZYA 3R9KA 2CCKA 2J07A 1DZ3A 2WKWA 1HC7A 3PHJA 2IPNA 4MGZR 1P1IA 2QXUA 4XYGA 1JJFA 2I3BA 2O7NA 4MTCA 4R05A 4LI3X 1KZ1A 3DFKA 3BXHA 1SOUA 2XCLA 3GJ4A 1QFMA 5DNEA 5L4LA 1W0KA 1A2KC 3BQ9A 4J3JA 1EMDA 1WJGA 2PRZA 2Y68A 4TTQA 5DI9A 3Q85A 3H18A 3ZKAA 1Z45A 1UFVA 3NWPA 1RYYA 1XVIA 1XD2B 4KE6A 1PNRA 1CDZA 3HJFA 1ZN7A 3QKTA 2XT0A 1NOJA 2AI1A 1PT9A 4OGGA 4JVSB 2X5KO 4GNRA 2XZOA 3EUFA 1XU9A 4HH3C 2ZSFA 3RKUA 3ZJYA 1UIRA 3WMGA 3PCRB 2X76A 1DUVG 1SOMA 1V43A 5H9VA 4YO7A 3T99A 1XTZA 4V3BA 2X15A 4ZEVA 5I3CA 1O94D 5GZ3A 2GYYA 4XDZA 4YRDA 4OOFA 3LWBA 2CXTA 2NYVA 3UJ6A 1TF2A 3R6GA 2DLCX 1GTJ1 2AUTA 2EWMA 2I55A 3BWCA 3PC6A 2VT3A 2VPZA 1V11B 3EODA 3FCSB 4NKRA 3PI6A 2LRHA 3Q7TA 4BJHB 2R8OA 4BNYA 3KSBC 3AO0B 5HG0A 3B1XA 5FWXA 2ODPA 1F5SA 3HWSA 3IKTA 4S1TA 1GJRA 1P29A 1E2JA 2WVAA 4AROA 2HSZA 2O50A 4IOKA 1EVLA 2D1SA 4Z54A 1X1CA 1E0SA 2R7NA 1U9YA 3KEMA 2A92A 1RBYA 4WCFA 3SYLA 3WC4A 2WQZA 3F98A 4FFNA 3ISJA 3ADPA 4Y6QA 3ER9A 4RYDA 4IQ8A 1CP3A 3GJ0A 2C1XA 2ERXA 3X1WA 4DLLA 5TVGA 1SVMA 1IHUA 2JCXA 5K3CA 1GL7A 3VJKA 1FLDA 4LDNA 2QTCA 2O48X 2F9MA 2ZTVA 1XCOA 3FKSD 1DBWA 3NYQA 4BLTA 2CN1A 4IUBS 4OQ4A 4CNQA 1N8NA 1FFGA 2RCYA 2Y66A 4G1MB 2GZMA 3GI1A 3THOA 4HVTA 2XB2A 3H5LA 1E99A 5DGXA 4BWFB 2CXHA 3CM0A 3PCTA 1TA9A 3IXMA 4V0MA 1Z56C 1XN4A 1FUKA 1O08A 1CKEA 1U4OA 3IUMA 4TLBA 1RIFA 1G4HA 1Z29A 2EG9A 1BW9A 4FSDA 1Z5ZA 1J6UA 3TW8B 3WK8A 4BCDA 5EIXA 2GVZC 2PVCA 3V1TC 5K0LA 4N41A 4YI5A 3D7LA 3MMSA 2XF2A 2C2ZA 1RLTA 2J9XB 4EFKA 1COWD 3L7KA 4E1VA 4O4JB 3AKDA 3LK7A 5AD1A 3AFNA 3PL5A 4LF6B 3VUFA 4A6XA 4ARUA 2AF3C 5I7HA 3BGVA 2PGJA 1W30A 1FUUA 2CC2A 5IT5A 3MXTA 1GZ5A 2ZVQX 5D7BA 3BMCA 2JJYA 1E96A 4I7EA 3WZ2A 2F67A 1OFVA 3KEOA 3W8DA 3ZU3A 4PHCA 3M3DA 3E5RA 3OX2A 3ZV6A 2RHTA 4GOXA 3I34X 2OM6A 2IS4A 4URUR 4IJ6A 3S55A 3M3PA 4DY6A 3QBJA 2OKCA 2OFOA 1FX1A 3KUUA 4JLKA 4B3MB 2GXSA 3HA2A 1G3IA 4KN9S 1OH6A 5K0BA 4CM4B 1TW2A 3MCWA 1P2TA 2X6QA 1OWOA 1VZ2A 2O2CA 3DCNA 3DLTA 3O9MA 4U2EA 2YIMA 5FUWA 4DA8A 4Z7JA 3W78A 1KEWA 2PS9A 2J87A 2O3JA 5K0TA 4JLVA 3DZJA 4K46A 1YA8A 2X5NA 5TS2A 1JBKA 3U4QA 1GG5A 3AF2A 1E5LA 1NQXA 4KLZA 1TDJA 4ZU1X 3RTGA 4HT3B 5J2UA 2B9VA 3AR5A 4EABA 1NJ1A 3TPFA 3CISA 2YYSA 1A4XA 2RAVA 4PWZA 5K0SA 1RKXA 1CY1A 1JYSA 1Q83A 1VRCA 2W6MA 2YIDA 3NC1C 5CB8A 3GJXC 5JNWA 1I2ZA 3IVMA 2RGCA 3PKJA 3G1UA 4FHDA 1VGRA 2GWRA 3G9XA 3COZA 4OK3A 1ZEMA 5ICSA 4GDMA 2WWWA 2ZTSA 3DMFA 3S8MA 5DHAA 2I76A 3MJRA 1NW8A 1HZZC 3GEGA 2I67A 3EEBA 2GUWA 4TKUB 5ALVA 3BXZA 5CVEA 4FFMA 4NZZA 4RJIA 2WTXA 5AOBA 1YIOA 2E21A 3J7AC 3CLTD 1NDUA 3BK1A 4Y1EA 1VRWA 3LU1A 3L4SO 3C45A 2I2FA 3A6HA 4H7PA 2FI1A 3G9QA 4YGYA 4EI9A 2UV8A 1QQ6A 2GPJA 1J8DA 2NNLD 3M6LA 2O8EB 2XNDD 3B1ZA 3OO0A 5EIAA 1CUHA 1U9ZA 4U2DA 1M2EA 1FXWF 1YTUA 3RTAA 1Z68A 3P20A 3QA9A 3K1JA 4GMHA 2NUBA 4WBSA 1EBFA 4FDLA 1M0EA 4JQOA 1ZC4A 4M9SA 4KXMA 4IFEA 3RNOA 3RS4A 1E2DA 4UQPA 1SBTA 1AGNA 2J6CA 1FL9A 4L0DA 4Q93A 1VSQA 1JG2A 3H0CA 3KQNA 2AJCA 3T1QA 1GNVA 2N3ZA 1D7OA 2QRKA 1BG6A 1T91A 2PGIA 4MRRA 2G5CA 4C30A 5EJGA 4RABA 3WGKA 1FVOA 2D0PB 2V6IA 4HLUA 4TM7A 1J7JA 1ZZGA