4OFXA

Crystal structure of a putative cystathionine beta-synthase from coxiella burnetii
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
316
structure length
288
Chain Sequence
MVLDNILQVIGKTPVVRLHRIGQSLPCELYGKCEFLNPGGSVKDRIGAAMIESAEKQGKIKPGDTLIEPTSGNTGIGIALAGAVKGYRVIITMPEKMSHEKQVVLEALGATIYRTPESHISLAKRLNQEIPNSYILDQYSNAENPDIHYQTTGQEILDDMGENLSMVVMGVGTGGTIIGVAKKLKEVNPSIQIIGVDPIGSILGGGDNNLIDEYIKINDKDSFLMARRLIREEGLLVGGSSGSAVWAACQAAQRLKEGERCLVILPDAIRNYLTKFVDDAWMKAQGFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cystathionine beta-synthase
publication title Crystal Structure of a Putative Cystathionine beta-Synthase from Coxiella burnetii
rcsb
source organism Coxiella burnetii
molecule tags Lyase
total genus 99
structure length 288
sequence length 316
ec nomenclature ec 4.2.1.22: Cystathionine beta-synthase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ofxA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ofxA02
1Z7YA 4HPXB 4LI3X 5DVZA 4JBLA 1UINA 4OFXA 2J9XB 4D9FA 1D6SA 1TZMA 2CLIB 3VBEA 3HMKA 5B3AA 3BM5A 5B1HA 4D9NA 5I7OA 2ECQA 1Z7WA 1J0CA 5E0KB 3SS9X 5IW8A 5IXJA 5I6DA 1RQXA 5D87A 2ECOA 2EGUA 1VE5A 4L3VA 4Y6GB 4D92A 3DKIA 4LMBA 1TTQB 5IWCA 2WSYB 3TBHA 3IQIX 4D97A 2TRSB 1UIMA 1KFBB 1K8YB 1Y7LA 4HN4B 2DH6A 1K8ZB 5T6MA 2ISQA 5DBHX 4XUGB 2TYSB 4LMAA 3SPXA 1K7FB 4F4FA 1F2DA 2CLEB 4D9KA 2CLLB 4IL5A 4HO1X 1BEUB 2RKBA 4KKXB 4HT3B 3AEYA 1QOPB 1TZ2A 2GN1A 3DWIA 2Q3DA 4QYSA 1KFJB 2DH5A 5DW0A 2BHTA 3PC2A 1C9DB 4D9MA 4NEGA 1P5JA 2Q3CA 3IAUA 4NU8X 4D9IA 5B55A 1KL7A 3IQGX 4I1YA 4AIRA 4D99A 5B1IA 5B53A 5J5VA 3RR2A 1V7CA 1V8ZA 3FGPA 5C3UA 1X1QA 1C29B 1PWEA 4ZU6X 1K7EB 2J9YB 1M54A 1KFKB 4OREX 5I7WA 1K3UB 1TJPB 2C2GA 2D1FA 2EFYA 2CLFB 3PC3A 1PWHA 2CLHB 3IQHX 1A5BB 2ZR8A 1KFEB 3R0ZA 2CLKB 3SS7X 1J0EA 1E5XA 1V71A 1VB3A 1WBJB 2GN2A 3L6BA 4L0DA 5D86A 2CLMB 1JBQA 2Q3BA 5DBEX 4D9CA 3R0XA 1UBSB 1A50B 5JJCA 5DW3A 5D84A 1CX9B 3V7NA 1WDWB 1OASA 4WX2B 4AECA 1WKVA 3DWGA 5CVCA 3FCAA 4ZQCB 3ZEIA 3VSCA 1A5SB 5I7HA 4HPJB 5KINB 2RH9B 2O2EA 1FCJA 4D8WA 1K7XB 4D8TA 1VE1A 5I7RA 3L6CA 5BW6B 2CLOB 2BHSA 1KFCB 3AEXA 5KZMB 2ZPUA 4ZU1X 4D9GA 3X44A 2PQMA 5EY5B 1A5AB 2C2BA 1FUYB 4L27A 4D9EA 3CEPB 1J0BA 1TTPB 4D96A 5HBGA 3T4PA 1TYZA 3PR2B 2TSYB 1TDJA 4COOA 5JISA 4JBNA 3L6RA 1WTCA 4D8UA 2V03A 1TZJA 2RHGB 1QOQB 1J0DA 3PC4A 5J43A 1TZKA 2O2JA 4D9BA 1J0AA 1O58A 5D85A 5B36A 5CGQB 1CW2B 2J9ZB 1C8VB 1BKSB 2ZSJA 2JC3A 5I7AA 1K8XB 3VSAA 4PCUA 2GN0A 4L28A 3VC3A 3X43A 3VSDA 4H27A
chains in the Genus database with same CATH superfamily
2O2IA 3HB7A 3O8QA 4HPXB 4MWTA 4N6NA 5EMJA 4F6LA 2V7UA 2QMZA 1FYVA 2ZRAA 2R6ZA 1RWWA 1RQGA 2VJCA 2PRJA 4JXKA 5CPBA 3JRWA 2O48X 3DBVO 4DLXA 3PTAA 2FQYA 2OP1A 2SKDA 1PT8A 4YJHA 1RAHA 3B3JA 3OZEA 4Q12A 3HTXA 3BMXA 2F1RA 3QF7A 3OECA 4BMNA 3IKTA 1HQDA 3QPBA 1OCEA 2VSFA 4FMCB 2WSYB 4NE9A 1MTOA 4E94A 1HT3A 2A0KA 4YV1A 4OYYA 5LP6C 3LC7O 4JGGA 3MIZA 3ND6A 4PVCA 5ESDA 4C0WA 1Z62A 1MXHA 1W0KA 3ETCA 4MKHA 1A9TA 4NOLA 3WIDA 1VCHA 2W0SA 3FBGA 2PRSA 4NL4H 4YCJA 3VZRA 5AW6A 1WUJS 2PN1A 2Q3FA 1ZJ6A 3TTYA 5E2BA 4JJEA 1XEAA 1WVGA 2PYDA 2F43A 4BKPA 2BE7A 2HKIA 3RE1A 3S8EA 4QDTA 4XOUA 1ID8A 3MB8A 2FEWB 2JFQA 3EIQA 3RJ9A 1VPTA 4OLBA 5CDHA 1G6OA 5JYDA 1GNRA 3JALA 3SF8B 4BCDA 2P8SA 4DV4B 3OJLA 4OIMA 2H0AA 4PX5A 4L75A 1I01A 1UT8A 4X8HA 3H2YA 4LZZA 2X14A 3A9CA 2GJ9A 5GINE 1OH7A 3EDYA 4C7OB 3GMDA 5EN4A 1OFIA 3O2NA 1QWOA 2I8CA 2P1DA 4GLOA 2X8WA 4P1ZA 5EQFA 1BGXT 2FETA 3EPPA 4UUPA 1Y1TA 4ZIRB 1TU0A 3AP3A 4LYDA 4IIJF 5JPIA 4KK4A 5CDFA 3QELB 2L17A 4HL6A 5A4MS 4TSFD 3ZHRA 2V3WA 2RGEA 5CYFA 5CB6A 5ISMA 3OSZA 2WMDA 1E2HA 4YYEA 3TNLA 1FU4A 3R24A 4ASUA 1QTRA 1Y9EA 1HZJA 2A59A 4MVJD 3PPWA 3GQBB 4W5JA 4EFKA 1GQ2A 2GX6A 4BBPA 5LKRA 4DSZA 1JJVA 1NBEA 1DCKA 5HIMA 2QL9A 2NOAA 2C2MA 4K9KA 1Q6ZA 3HWSA 4YT4A 1WNTA 2VP4A 3B52X 3FCAA 2WC1A 3RRFA 4DWVA 3KQSA 1E9EA 2EF0A 3WSWA 1HPLA 1C4WA 3P5SA 3L7CA 3W5JA 1FS6A 5JYEA 4B6OA 4YGYA 2YJNA 1X39A 3EFOB 2UZ4A 3GFQA 4YAJA 1KMHA 2P3LA 3PIDA 5BN1A 2OV3A 3ETNA 1NVVR 3C6KA 1L5OA 1MFPA 3DMFA 3E3LA 4M1ZA 2ID4A 2G25A 3OLQA 3C3KA 3MB5A 1GV0A 4TT8A 3N28A 1I9GA 4MKIA 4ZAVA 6PFKA 2PL9A 3WZ2A 1USUA 3RAFC 1SCJA 1KJNA 2ZJ7A 5C52B 1LTKA 1V8PA 1VIAA 3RFXA 5LZ2A 1O58A 1Q3HA 1PYGA 1OSNA 1QQ6A 2B2XA 2OYCA 3IUSA 3VXKA 2AE2A 1LDNA 3UJBA 4E5KA 1TJYA 5EKUA 5FTJA 5H9VA 3QEAZ 2Z2JA 1MQ9A 2OAEA 4I50F 5KSWB 4NARA 1AX9A 1MFZA 4YRBA 1R6DA 3DLBA 1LTQA 2XLCA 1WSBA 3C6XA 4OIFA 4DMKA 4PLHA 4YUWA 2ESRA 4QL3A 3S70A 5A3QA 1QQ5A 2HCTA 2WM9B 4ILKA 5AKLA 1D1PA 4D9FA 4BO3A 2QTVB 3BKWA 4G84A 1R6AA 2PLNA 4IFIA 4AB1A 4UAUA 1ZNXA 2VJQA 1SBQA 5REQB 1ZOSA 2VJMB 4HX5A 4AYXA 4ZAXA 3W78A 1ESDA 2J9GA 3U81A 2PJRA 4Q01A 1Q7GA 2TRSB 1UKBA 1DTWA 5JSZA 4P08A 4IY1A 3VSBA 3LFUA 3O38A 2YIVX 4IHAA 3HEAA 2YUTA 1SKUA 2ANCA 2NUTB 2YINC 4JP5A 4PLPA 4CUZA 4OXRA 1F20A 5EQTA 2YL2A 2CNLA 4CL3A 4NZ9A 3RS0A 2QPLA 3WGHA 5C81A 1QHEA 2GXSA 3LV8A 4HADA 5DYIA 4GVPA 3RF6A 3ZDQA 4PSAA 1OUMA 3E5RA 3WGTA 2REQA 3OEHD 4K3UA 3VV2A 2OFPA 1EVIA 1MXFA 4X8MA 2WP0A 5JNUA 4NAVA 2Q9UA 5KMGA 1E1CA 1G60A 1CUAA 3UHPA 3UVEA 4Q9HA 2YQZA 2CDRA 3EEFA 1JG3A 1GG9A 4B76A 4XUCA 5FWAA 4QASA 3ND7A 1HURA 2P91A 1TKCA 1XMQB 4Y0VA 1TECE 4P81A 4URUR 3SMVA 3VR3D 4LJ7A 5M5BA 2AQIA 3WKBA 2D2IA 3CZ9A 2FHSA 3TR5A 1D0IA 3BMQA 4R8RA 2QR3A 1O1YA 3HVUA 4HOYA 4AG5A 2Q5HA 1RTTA 2Z2YA 1ZGAA 3FNQA 2XE8A 1Q1QA 2YZKA 3IQHX 2GJKA 1RC0A 5IAKA 3V8NA 1B8NA 2Q1TA 2EAUA 2JDIA 4M0MA 2ZBFA 3DHYA 4Q3CA 3HJGA 1PUXA 2FJUA 3C3WA 2IYLD 3RDPA 6REQA 2P90A 1CR4A 1TC2A 3AONB 3ZW8A 3N58A 4EX6A 1ARZA 2JLVA 2O2SA 1WXXA 1Z06A 4DVGA 2AR7A 5ELXA 4E70A 1Y3DE 1EDDA 1PLLA 1OASA 3S2IA 4TXMA 3FYCA 3SQDA 3L0PA 1CHDA 3E3AA 2WSSA 4ZI3A 2CNBA 2YHSA 1F2VA 1A5SB 2UVPB 2X86A 3DBHA 4B71A 4PPQA 4X7MA 2P41A 4ALKA 3ZY2A 2AW3A 2OBFA 2XIQA 1WCWA 3BGDA 4AJ1A 4YRJA 4NEHB 3SZGA 4ZPJA 1SKQA 4BMYA 2EU8A 3PXUA 3QHAA 4GI2A 1ZI9A 2R79A 3FCOA 5AVKA 3M3HA 2V9CA 3D5QA 4Z51A 5AW5A 3R7SA 5JJ5A 4YYZA 1F9EA 4NYIQ 3WMEA 5IVPA 3LUHA 1SK8A 4ZI5A 4L9WA 4V0NA 3G0GA 2OVBA 2QTBA 4KXMA 5LBUA 2EIXA 3M1LA 1UZUA 4B09A 2A1UB 4KN5A 2HU8A 4ZJUA 1TX4B 4GI7A 3WYBA 3KWMA 3KEFA 1AOXA 1AUQA 4A3SA 3L92A 1EFUA 4CM8A 1I3OA 1O94C 4B3FX 3UF0A 3X3HA 4MPPA 4C07A 1EVEA 2W8BB 1K8XB 2HFJA 3AX6A 5ADHA 4RULA 2XDQB 1OWLA 3IDAA 4LDNA 4Z9YA 2H3HA 1R88A 1VHQA 4PZYA 4XZ3A 2GXAA 3RIEA 4DQLA 2X9GA 4GX2A 2XQVA 3WDSA 3MQ4A 4G26A 2A5YB 5FWYA 5FI0B 4GO1A 4QJ4A 4M4SA 4FD2A 4M38A 4BMZA 1JAXA 1V16B 4M8IA 3HCNA 2I7XA 4R2IA 1JHQA 2VLBA 3BGVA 2B4RO 4RPHA 2OCXA 4NDNE 4EUFA 4OJKA 4BGVA 4DV6B 1M0SA 3BB1A 1FTGA 3EMKA 1XZDA 2ZTUA 3OM9A 2A0FA 1M83A 2RB4A 1KVTA 3DZBA 3HB4X 3PVCA 3W2TA 3MSXA 4PFQA 3IBYA 3G7NA 3W5BA 2GAJA 1FYDA 4XUGB 2PGDA 4MOWA 3CVVA 2ZJ8A 4PWZA 3T9EA 3T9DA 3DB1A 5A4AA 2B4TO 4I6JA 3QBEA 4UE3S 2H29A 3NYWA 1WDLA 5CR9A 2I7DA 1CWUA 1EDBA 4C6RA 2W2KA 2HXGA 5GZ1A 1AHIA 1J20A 3DE4X 4JB3A 4KGZA 4NHOA 3RH0A 3PITA 2FPSA 4DR6B 5EIAA 5GV7A 4QJ3A 1CRZA 2XMSA 2RONA 3A6JA 2PZJA 2DFTA 1E58A 5CT6A 3D6UA 1D2MA 1KFJB 2GHIA 4DLSA 1UMDB 4B3CA 1ZIDA 3KQHA 2VYVD 3STWA 2ZSDA 3BE6A 1YAJA 3UKDA 1EWTA 2J3LA 1QNFA 2E1RA 4M88A 5B57C 3GK3A 4D4GA 5JD4A 5LA6F 2PKQO 2LKDA 2DCUA 1UJ5A 2NZ8A 2QVLA 2J0UA 3JYLA 2WKQA 2ZSAA 3O74A 1G4AE 2FRDC 2G9QA 1N7JA 2XTJA 1KFKB 4QDXA 3NBYC 5F5NA 2D1FA 3ZXYA 3E9CA 4QYXA 3UAWA 1EZ4A 3JVUA 4KQEA 5FOTA 2X6QA 2QXYA 3G2NA 2XCUA 2IIVA 4JT2A 3KQWA 4B3HA 2HGSA 1V35A 3FAKA 3P9SA 5BMVB 1SCQA 5LZ4A 3WXBA 5CM8B 1H8ED 3UXYA 1HK7A 2F00A 4GNKA 5A1JA 5BURA 1WQ4A 2RI6A 2A1TS 3QG1A 4Q18A 5AKEA 5AW3A 1JVSA 5KTRA 1NSFA 3ILXA 4MPRA 2I4RA 4GYYA 1CUEA 3ONWA 4JT8A 1MPXA 3F73A 4Z1MD 2V1UA 3JD2A 1LTHR 3ML1A 4MS3A 1E3LA 5D84A 4V1CB 1EUCB 4KXLA 2VNKA 1KYZA 2IK8A 3QLJA 4X54A 5T6BA 5CB8A 3CN9A 4KGXA 1C9NA 5C8DA 4RM3A 1T0UA 2ZJ2A 4Q1CA 1GAJA 3DMRA 4WXEA 3G6KA 3OC6A 5A4FS 5I7RA 2MT9A 1GEGA 3F6SA 3ETJA 3KDAA 1WV1A 5EAIA 3RVOA 1EGQA 1UBJS 4M1YA 4W99A 3D4NA 4HEJA 3GC6A 3RSHA 3GLHE 2AXQA 4DV2B 4K6OA 1QZZA 3DTVD 2QLFA 2YIJA 4F06A 1BVRA 2Q6IA 1I2CA 3ANLA 4CFZA 5IJWA 2VAWA 3IAS6 1PLKA 4BNNA 1CXZA 1KS2A 1PKXA 3WYEA 1BXGB 1WWKA 2SECE 3PKZA 4J0DA 2PL3A 5FPKA 2XUQA 4NBNA 4PZ0A 4HH0A 3H9GA 5FORA 4PHCA 5DNYB 2EEPA 8MHTA 2O20A 2F2TA 3PI7A 5ALKA 1N7GA 2D5CA 3EW9A 3FDZB 3IT0A 4PGHA 5F51A 1QIKA 2WWWA 4JQYA 3VYSB 5DM70 2DEUA 5MN5A 3KPVA 2W37A 1NQUA 2ZRIA 1VHTA 2GTPA 1SVUA 3I1YA 1IPEA 2QTHA 3LHKA 3G3EA 4RKEA 3COYA 1CJTC 4FEGA 1LFAA 1JDBB 1V8FA 3VO9A 1YR3A 4RENA 4WLVA 4E7OA 1DJNA 5BN3A 3OF2A 3REQB 3SNKA 3WIVA 4TVKA 3NWEA 5JDCC 4D6YA 2EFJA 4CDNA 4QXPA 2QJRA 4I3GA 5CYPA 3G0BA 1OIVA 2YNMC 4QU0A 3HG7A 3ET5A 3CB2A 3K20A 3OJXA 4WNAB 3TW0A 1RABA 4DA7A 4CIWA 4AX4A 4Z4GA 2KPOA 3R0JA 1PZGA 2K2QB 1O4VA 2DR0A 4X85A 3N6XA 4MWSA 3F49S 3A9UA 2EKLA 5HBRA 4ZARA 1ZGJA 2Y9MB 1JZQA 1G1AA 3NKLA 5JCJA 3KKPA 3BRCA 3I2FA 4C6TA 3PXGA 3ONFA 5LWHA 2O2GA 1NTRA 1QF7A 1UP4A 3FYUB 3IVXA 3CLRC 3HO8A 4GRIA 4RK6A 3SZMA 2JIDA 3CS3A 3JQBC 4EJSA 1VIMA 4D9KA 4YRRA 3FETA 3FI0A 1NBMD 4H7KA 1L8LA 4FGKA 3WLAA 4DB4A 1QGAA 1XEXB 1OFUX 2CLCX 3D31A 1C14A 2ZCJA 3GFVA 5KUTA 1PNRA 1I3CA 4ZREA 1VLLA 2I55A 2P5UA 3UMMA 1P0MA 4ITVA 3OCYA 5E8RA 1U2DC 4XCXA 2P40A 1M8KA 4JXJA 3NBMA 5FV7A 4D0RA 4DN6A 5IKPA 3N8NA 2PV0A 2V0NA 4R7ZA 1I14A 3ZWVA 4ZZ0A 4MR7B 5BVHA 1M0TA 5TXGA 3T0FA 4GXNA 3JSAA 4FBGA 1D0SA 4P0PB 4LK2A 4YQZA 1FNMA 1X7ZB 3UUGA 4NECA 4HRXA 1PUIA 5KYXB 3U61B 5JJKA 4AKEA 5IX8A 4RGBA 3AEUA 4BXOA 4LNUA 4TMYA 2Q2NA 1ESMA 1ZPDA 4K9OA 4UHCA 4CLOB 3HZOA 1XYYA 1LLQA 1MC1A 3MBOA 4FK8A 3BT7A 2LP4Y 1UP6A 3S2EA 5BPFA 5IKOA 2PWZA 5FI1B 2EX0A 5CXXA 4G89A 3VNQA 3QXHA 6CHYA 3LCVB 4J7AA 1PGOA 1HYBA 1LY1A 1R37A 2ACVA 1HOTA 3DAOA 1Y98A 3JYNA 4KIUA 4TS1A 5GGYA 3ZK7A 4BGUA 3FPSA 4ZYWA 3P0IA 4R9RA 3K8OE 3DLIA 3KOYA 1OVGA 4JSTA 5FHQA 1JIVA 1WW2A 2WPDA 3FCYA 4MIEA 4P80A 2NV0A 3DE0X 1DBQA 3OE4A 3Q4GA 4TTTS 5GPBA 3CURA 4INOA 1N6RA 4RTRA 2IEIA 3L6CA 1OC4A 4I6EA 4X24A 2WM3A 1U0EA 4MUJA 4Y2QA 5J2TA 4FMPA 3EIEA 3LVQE 2FFRA 1QH9A 2XSZD 1KZYC 4ZEOA 1TRKA 5LLSA 1ZGBA 1SU4A 5H4GA 5KEIA 2E7ZA 2JJQA 4HB3A 3TQRA 1T9DA 1VA5A 3NPAA 1BROA 4EHLA 4Z6KA 3DDOA 2NNWB 4I8XA 5E9JA 1X9HA 4LKOA 9MHTA 2ZRBA 721PA 2QD1A 1E69A 5L3QB 5DHRA 3N8HA 1QDUA 5KWEA 5GZ6A 1THMA 1QVWA 1P9LA 4GWLA 3ER9A 3OJFA 5EPUA 4P54A 4TVOA 1RYDA 5DMXA 4MEAA 3V34A 4D74A 5TT0A 3PICA 1ZN2A 4TWZA 3EYWA 2JHGA 2XCOA 2V6MA 2B5VA 4KFSA 1MGOA 4CDMA 1Y8QA 1S8NA 1UMCA 2OSBA 5K2OA 4JSRA 3BCRA 5KTSA 4H16A 5CA0A 4EGCB 1G1MA 1ZSYA 5DVZA 1M1NA 5DBGA 4KQMA 4YCBA 3PPYA 1FLAA 3W9SA 4ZGBA 3CR3C 4LRTB 1P4RA 3DBOB 1TIKA 4DSTA 2DHQA 1LBSA 4N6OA 4RPKA 1C5KA 4LFBB 5CTAA 1MA0A 1PJTA 4LC9A 2W2NA 4QO7A 4BP9A 5TQ2B 5AICA 1QG0A 2BMDA 4D97A 3WRWA 1NL3A 3DTVB 5AM5A 4BKOA 3G5AA 5JS2A 3T4EA 4IDFA 2VJOA 4K2AA 1IJKA 3K1AA 1OLSB 2AWOA 3SJZA 2HF2A 2PXXA 2PMWB 2ZJBA 1JIXA 3L7KA 1CK4A 4DCGA 1KZ9A 1WOYA 1TZCA 2FSFA 4ZN6A 1ZN7A 2HTEA 1WZCA 5JCXA 4KEAA 4OQQA 5ENVA 3TZHA 3P71T 1M34B 1YQWA 4FB5A 3ME5A 1QQAA 4HQOA 1U5BA 4N39A 3ADKA 1YR2A 3IB6A 1KA9H 3SYNA 2BFAA 2WT8A 4AZTA 1QRTA 4KGVA 2EWVA 1P9WA 3EZNA 5DGHA 3H1TA 4JR0A 5E1BA 3GJ4A 1PEDA 4L9AA 4JBWA 4MV6A 4URXR 2BFDB 4OI0A 1WSAA 3BXOA 4HRAA 1HE8B 3BUSA 3W4IA 2OWDA 1KAQA 4PZPA 1PZMA 1BS1A 1PWYE 3TBFA 2YCLA 3FTPA 4FVTA 4GOXA 1NMEA 1K3UB 2SCUA 3ZHXA 4G9BA 4CM9D 4QVIA 5C5CA 5KNCD 2IIBA 1AKQA 3HY3A 1ECBA 2VTBA 3O4FA 4HNRA 3UZUA 4RVHA 1OI2A 4M86A 1CULC 3HY6A 4IIHA 4PLWA 3DZJA 2JAUA 5KYWB 1E3QA 1NVEA 3WHPA 1XRRA 3ITKA 3P8ZA 4H59A 2CNKA 4QDUA 1BFDA 1JDNA 2D0DA 3EWNA 4R2WA 4E03A 4DFDA 2D1YA 4TM8A 2JF0A 1GDDA 2A9VA 3G8DA 3L8DA 3CC8A 2FX3A 3QH4A 3ZWBA 3LBNA 1MEOA 3SEFA 3KNZA 1NC3A 2EJCA 3JQFA 1BX0A 2QX8A 4EG0A 3OU7A 2WUFA 3NTUA 4A2CA 3EGDA 3ZY3A 2F1IA 2GWRA 3ENQA 4OB8A 3NCTA 3UICA 1IOWA 2GXUA 2ZPUA 3UWPA 4OJMX 2ZRFA 1SC3A 1H94A 2C88A 5FWDA 3WHLA 4ZQBA 1U3UA 1LPPA 4OI2A 1JQ3A 3LMKA 5HQTA 4YJ2A 1DAFA 2PH7A 4YPOA 1QNLA 1E59A 2IPXA 3WFIA 4BE4A 3MGCA 2F3RA 2A7QA 2IOYA 2H5LA 4RVSA 1U8CB 2EGGA 2COKA 3KEOA 1UJ4A 1Z2PX 2AZDA 1VMEA 2JFGA 7ADHA 4IG9A 1SEVA 1CJSA 1K0UA 2XGSA 9LDTA 4N3BA 3LYLA 4AX8A 5KOJA 3KKOA 2HA5A 4B82A 1ULHA 1A9XA 4NJEB 5A71A 3TZQA 4QJBA 4UHJA 2QLMA 2JD0A 1UK8A 1YQ9A 1GRQA 2AEFA 2E89A 2CJYA 2J9FB 3LC2O 4V0SA 3CEAA 4YBRA 5J63A 5FWNA 5KIAA 1PT6A 1TL7C 4PTZA 4QC2A 2XECA 3R8XA 1T1RA 4ZAYA 3THOA 5ARCA 4RTOA 3V2HA 1RYEA 4MDEA 2NTJA 4WY2A 2ON6A 5C1PA 2ZIAA 2LWIA 4NQRA 3IP1A 3PSHA 2BGWA 1ZCJA 1DHTA 2WJJA 2WJ6A 2RGWA 1U80A 5CA1B 3D8HA 4QU5A 1C0KA 2HJ9A 1PG0A 4JUIA 4MRMB 3WBBA 1KFBB 4AAYA 1G3UA 2ASEA 3G0CA 4M0EA 4OFWA 3LECA 3RT1A 4YCMA 2GGSA 3FUXA 4HDSB 3ISJA 2ZR7A 1ADFA 1PL6A 4OH7A 4AW9A 1DHRA 1VI5A 4AYTA 4F12A 3DV0A 2ZREA 3CW9A 1PGQA 2QU7A 2YYSA 4URYR 4MIOA 4O0LA 3QBVA 5CXUA 1PDVA 3E27A 3IHWA 4TL7A 2CLLB 3PDHA 4N0PA 1NQAO 2O23A 3R6TA 1RI1A 3WBJA 4DWOA 1DVRA 3FVTA 2R7MA 4DMRA 5BV8A 5C7LO 4GZ6A 4QICA 1YZNA 3KWJA 1H6CA 2EKDA 4GPIB 5LWQA 1NSYA 2GASA 2XHEA 3MGGA 1YQQA 1PX2A 2GZHA 3BJMA 3BSSA 4ZODA 4EB6B 1FDWA 4QZVA 2CJPA 1GT91 2OGTA 3THWA 3DT8A 5EUBA 2C0QA 2H52A 4MV5A 1EYZA 4EUKA 5KQPA 5IMSA 1IMOA 4LCEA 5F7XA 2WR8A 2GUWA 2BBWA 1D2AA 2AYYA 1KIFA 3OOSA 3ZDEA 5EJ8A 1RLJA 1JALA 1E3MA 3ZV5A 4C7KA 4YROA 4IDCA 1E2MA 4NBVA 2W70A 2ASVA 1XJ0A 3ZBQA 1NNLA 2L19A 3PUIA 2FF7A 4JC8A 2OHOA 3P52A 4RTNA 2HMYB 1YGPA 5D7BA 1AD2A 1GNTA 1P5RA 3IXQA 3DAFA 1YC5A 4M8LA 3NO4A 2OBNA 4KLAA 4KXWA 4LDZA 4NBWA 1U7TA 4PO1A 4I1IA 2WM2A 4RS4A 1D8AA 1HL3A 1E2GA 3CEJA 1MO2A 3QUTA 1XKQA 4RESA 2MCFA 5BUQA 4IFBA 2AUNA 4FOTA 3UHJA 3K6JA 4I50B 1SNYA 2P6NA 3CONA 3KEQA 4QBGB 5JE8A 4DYDA 4BPBA 2VBIA 5L6LB 3SOZA 3N1UA 4OU5A 1DOHA 4RZHA 5MHTA 1T29A 3HXLA 3KB6A 3ZHOA 1YU9A 3ADBA 2OFWA 1CF4A 2J46A 4WACA 3IBSA 4UTRA 3GHYA 3X44A 1GYRA 1T34A 2MSLA 4H0CA 1NX6A 5I7VA 2HA3A 3WGOA 2GK6A 1F2UA 2O5EA 2M1XA 3R2JA 4G25A 1I8TA 2ZR9A 5DTJA 3ZZMA 2JCYA 2J41A 4L9RA 3NEJA 2A5DA 1FX0B 4R68A 4HZGA 1EP9A 1GGVA 4LF9B 4LPSA 5LQKA 3MC1A 3ODGA 3DUFA 2HRZA 3RRMA 1D2NA 2H4ZA 1CETA 2QROA 3OZBA 4BGEA 2QTGA 4OG2A 4RDHA 3WTCA 3ZW9A 3BREA 5DYWA 5FFNA 4C1NA 1GRCA 1GA6A 3W5HA 5I47A 2PIAA 1FSPA 1RQPA 3S2UA 1JEJA 4J3FA 4FNMA 1A9SA 2ATVA 4RQTA 5EJAA 1B26A 1UZLA 1LLDA 2X8JB 4S0ZA 3HMKA 2G04A 3GFPA 1GNQA 2Q1UA 1KJQA 4BRUA 2IUEA 1R4MB 3L4SO 3MPUA 4KK3A 1QCYA 5GM1A 1PZEA 3ZHSA 4H3SA 2JBAB 4OHXA 4NXMB 3QW4B 4JY7A 1FFCA 1XJWA 2QRPA 1FXUA 2Q4TA 3GLFE 4YT5A 4M9RA 4CCAA 4XAQA 1E5TA 1FJHA 1QP4A 5NLLA 2E5FA 3D5TA 4XB2A 5FLEX 3E03A 4RY0A 3KU1A 2Z30A 1NF9A 2HF7A 3C16C 3EIFA 3GHHA 3CMCO 3MHPA 3N0TA 5LYJA 4RELA 5THQA 1KE1A 5LN1A 5J2UA 3IEKA 2JFNA 3C3CA 3QHPA 1B2RA 4BB9A 3F96A 3A2KA 4F84A 1NY6A 1GKUB 3O7WA 3KOXA 4P8RA 3WDLA 1K92A 1D3AA 4IG4A 3FYSA 3FG9A 4PQYA 5KYUB 2EP7A 2VF5X 4YGXB 3T9BA 3VH2A 1KU6A 3Q3EA 4KMOA 4YI5A 2DWOA 1Z0UA 4D9MA 3ZJ5A 1NATA 3CSUA 1B00A 3COPA 2HSZA 3MIIA 4K86A 4M53A 2P1RA 2Z6VA 3RHZA 2AG8A 3CR8A 2VZ0A 2BMWA 4TTVA 4ND7A 1TQ4A 4G0MA 4M1EA 5KDDA 1CZUA 1WXQA 2QGZA 1OTYA 1N5RA 1ZD4A 2HRRA 4KVAA 4MROA 1N34B 1N57A 2A35A 3HCBA 4KLCA 1DO0A 5CH3A 5HQJA 2W4QA 2AC4A 3H6GA 3L43A 4OBEA 3LL7A 3VX3A 5C32A 4MVXA 5AVYA 3OOEA 2G9UA 1X77A 1XKLA 2QN9A 4QEKA 1PCXA 3A6GA 4RJ2A 2IH5A 1A96A 5MFZA 3USZA 8ABPA 1HLFA 4X65B 1COWA 2XZLA 2FPGA 2VPPA 4Q24A 1Z6XA 2D8MA 3PU6A 4A0GA 1ST3A 1BYIA 3L84A 1JJBA 2D06A 3GRZA 4S1NA 3EQ9A 5AKKA 1FQJA 5DW3A 1QG2A 2YV2A 2EIHA 2XA1A 4A10A 5T41A 2AD1A 4OOFA 2OV1A 1PHRA 1RVDA 3E3NA 2VTVA 4NX2A 1N2BA 1NG1A 2R1UA 1S5PA 4OTZA 3K30A 3HE3A 3KJXA 5ALJA 3RABA 2IUTA 2JFWA 3RRXA 3I76A 4TMXA 2BFEA 5LXTA 1FCJA 1X0VA 4KH0A 4ZV4A 3T7TA 1QRRA 1JILA 5IVDA 4XASA 4TS4A 2CHUA 2P6MA 3WMWA 2FFBA 2FZEA 1O3YA 2IBTA 2QV7A 4P35A 1Z6GA 1PR2A 3IIJA 1JU4A 2I6UA 4M1MA 4X93A 3WISA 3T06B 3O75A 4GM0A 4COKA 2CUZA 5DTIA 2ENWA 1VGVA 3JAWB 5ICGA 1U0RA 4RV4A 2UUAB 2RCNA 3WGIA 3KX2A 5K0NA 3MBIA 4QYMA 1MABA 1QOQB 4MVWA 2UYOA 2XMGA 4DCMA 5K6TA 1LLCA 3S1AB 1WXHA 4W8OA 1V8DA 2XUGA 3BXZA 4KQXA 4BQFA 3UMYA 3JTEA 2YMMA 1S2LA 3PE6A 4E6PA 4ZDKA 2OBMA 4HB0A 1UWLA 1DS6A 2YZNA 3KTAB 1LXCA 1W88A 3OQIB 4FT2A 4L28A 4FHFA 4G86A 3F3SA 4HFRA 4QU8A 4R41A 4R1PA 5KX5A 1VPDA 3GOHA 4NH0A 3PUYA 1XP8A 3EQ7A 1FFAA 1K0FA 1L5YA 2BTQA 5DISB 3DDNA 2AW5A 5JNVA 1XF9A 4IHJB 1GOTA 4YRAA 3DW3X 1O6FA 3HEMA 4K9PA 5FIUA 3OF5A 5DU2A 3U2QA 4JDPA 4J3NA 1NW7A 3OIWA 2YJ4A 5DH9A 1LVUA 3OESA 3K53A 5LA6B 1MX9A 2R2GA 4C87A 2XYHA 3WRXA 5JYCA 1NI5A 3OQBA 4DKJA 1E2UA 1P7PA 2CUTA 4GT1A 1I32A 3CUEF 5DASA 1GTRA 2BH2A 1H2RS 4PZLA 2O2DA 2R6CA 5DFAA 2P8JA 3A9WA 3MT0A 5ILGA 1NKTA 2OP0A 4BJ6A 4CTKA 1DC6A 5L7TA 4IH4A 2A1TR 2AJTA 5JCOC 3EF3A 3FCSB 5K0LA 5JCZA 1FNCA 2H06A 2J59A 1GQQA 4KYUA 4TKZA 3UEOA 4ER3A 3BD8A 3EQ8A 1E9DA 2RDMA 1ZESA 4XGKA 1G4HA 2PXCA 4O3MA 2WA1A 4UDYX 2FP4A 1NJ5A 1R8JA 2MWMA 3WA6A 3ESDA 1A2KC 1ISGA 4Y2SA 5AW4A 4EPVA 3QFHA 1V7PC 1DFHA 3GH1A 1IDN1 1W1IA 3OX4A 1JSZA 2BJWA 4AULA 1WR8A 3NRBA 2FP3A 3EA4A 4NICA 4UPVA 3UWMA 4MRAA 1JEAA 1N1DA 4D99A 4BQIA 5ELMA 1U0BB 2IT1A 2W2MA 3SYTA 1MO3A 4QTZA 2R60A 4HPWA 1GVNB 2AI3A 2WKWA 4Q1FA 3EA0A 5DMHA 3UCXA 1KO8A 2Q07A 3OX2A 3QKSA 3WYNA 3S4YA 3E22A 1CDOA 1U1GA 2AC7A 2C2KA 1TVMA 5H70A 3PI6A 2F1KA 5IBPA 2ZS9A 4FDLA 3O2QB 1RKBA 4NDAA 4B74A 2ZLBA 1CUBA 4YMLA 2JNWA 4KQIA 3ISTA 4BTVA 2G83A 5DBFA 4IWYA 5ILQA 5LNK1 1A8PA 2Q3BA 1E2DA 2Y1EA 3KRTA 4QSHA 1KVUA 2JGDA 2GZMA 5JSYA 1R9JA 3SR3A 1O6GA 4RF2A 3GRUA 1MHTA 1ZD8A 2XY4A 4TKUA 1EKXA 3L0OA 5K6RA 1Z25A 3MLAA 2Q3EA 3CXUA 4GXRA 3ZS9A 4FYMA 4IINA 4DEXA 1N5DA 3V6LA 3LXRA 3D0KA 1NU6A 2V5AA 3KQMA 3NYIA 1LLFA 4PY2A 3UGKA 1XCPA 2VHJA 2FSVC 1J8DA 1V5IA 3K9FC 3N7TA 2DYKA 4UVIA 3V00A 1IJFA 3LZDA 3VVBA 2PQMA 2QVZX 4ED9A 3P2IA 5E8JA 3GEGA 1PQ4A 5I8PA 1ISMA 3AJ9A 2GBGA 3BWVA 4F4UA 1XDDA 4FZ3A 2DG2A 4LPKA 1H5UA 4ZOEA 2H2AA 4BGDA 1HWYA 2RHGB 3EPHA 2ZKLA 4H31A 3PNPA 4LXHA 5ALEA 5D85A 1IHDA 2RGNA 2XVZA 4GR5A 3O92A 3ILYA 3QE9Y 4FYVA 3KSBC 4RXTA 3G0IA 4HNUA 4MW9A 1BD3A 1T3ZA 4F8EA 1NVMB 2XCTB 4HNGA 2XF8A 1II0A 3GEPA 4ABYA 4PINA 1PEYA 3DCIA 1JQBA 1RRGA 2ONKA 2Q3JA 3A4YA 2XUAA 4IGKA 5AMXA 3VDQA 1MZPA 2OQVA 2FSHA 4I14A 3VYWA 4F5ZA 4CI0B 1DJPA 1XD9A 3K2IA 1P9NA 3OMXA 1JKIA 4URHA 3LQQA 1TLTA 4YWHA 4EF6A 2XLBA 3IT3A 1SHKA 3JQRA 4MKRA 2YJGA 2X6TA 6AT1A 1MQSA 1F1BA 3F7OA 4X6UA 3OWHA 3RS4A 4ZOLF 1FK8A 4QEZA 1QTQA 4WAUA 4FFBB 4PRYA 3OT1B 4EFNA 1B74A 4ZVUA 2ZJZA 4RGYA 3HSSA 1H1TA 4BZPA 3B5IA 2XUFA 4PCLA 3X2EA 2IYOA 4LVOA 1P5FA 1NZJA 3OLYA 3TPZA 2BEUA 2Q0XA 4B0PA 3KWLA 3ZXIA 3QVTA 5AM1A 3WO1A 4I1UA 2ZYVX 5KNBA 3DDHA 1EIZA 2Z1NA 3L1VA 1P7VA 1E4OA 1CEEA 3RSFA 5DF1A 3V8VA 4CCSA 4B3TB 2D0IA 2K7ZA 2W6CX 1MORA 2CFSA 3Q5EA 4PLCA 4QFDA 5AJZA 1FEZA 1WMEA 3A04A 3RV3A 4X1YB 1GUFA 4E2WA 1Z2NX 2X9NA 5IDQA 3L8FA 5JECA 4AF8A 3K3PA 1EVQA 5EJMA 3TIXB 3K6SA 2VO1A 2HLNA 4ZHQA 2HJHA 3OZVA 3F8SA 1P81A 4UNQA 1ZM2A 2TS1A 2B35A 1O2DA 1W1UA 2HNKA 1RYBA 1GCGA 4TN1A 5DWDA 5P8WA 3C4QA 4Y9TA 5BOSB 1YA8A 2HDOA 3IRUA 5K3AA 1EESA 2C4VA 1J7JA 1VXRA 4HHEA 4KBFA 5KQLA 3K2EA 1FS5A 3F1LA 3V2IA 5FHRA 1USVA 4EPYA 5JVDF 5LMNB 4QGHA 1KMQA 5CPFA 3UJ6A 2DFLA 1LB1B 4IO0A 3ZKAA 4K9LA 3SM9A 4YV0A 5EXSA 1A82A 2DUJA 4HRVA 5A5EA 5TMPA 1IXKA 2JZOA 4WX2B 3G13A 3IP3A 4IX1A 3ZDYB 4WEOA 5CFPA 1IQRA 1XQWA 1N1GA 5I9MA 1H9AA 4KLZA 3GVHA 4RS3A 1OGYA 3H87A 3EY4A 4HQKA 3ZQ6A 3CPSA 4JLSA 5K4GA 4PG5A 4A5OA 4UM5A 4XJXA 5H3LA 1AZWA 1XWWA 1V1JA 2CLOB 1VRVA 3DMYA 3PGVA 4L5BA 2V74B 3OQ6A 3U1TA 1B4DA 3ZE9A 4YUZA 1VYVA 4XJVA 1U8EA 3IT1A 2ZBQA 2RAUA 1UDCA 1PFWA 3HFSA 3DULA 2HBZA 4FCVA 2VI5A 2IPOA 3QF4B 2I03A 4BZXA 4FZ5A 5K01A 1L7AA 1ADYA 3EUFA 4TSRA 4Y2VA 4FOSA 5E7QA 3R9IA 1AO0A 2EZ8A 2GZ3A 4GDMA 5C51B 1KC1A 1WP9A 3FA2A 4JP3A 3PE4A 3ZH2A 4TMTA 5GIPE 2VAPA 1CNFA 1X7YB 2R5NA 1A4IA 3C85A 3C7AA 4X9XA 4ZO6A 3ZLVA 5BNIA 5IJ9A 4YCSA 3GLGA 2QI9F 3R7FA 1TW2A 4LHEA 1U7ZA 5EKXA 1T8TA 2V98A 3CLUD 4IF4A 1J09A 3EPKA 1ORDA 2A1IA 3DMTC 4IS2A 3MHTA 1WQ3A 1MJGM 1W4LA 4IF6A 5BYBA 1R6BX 2I8AA 4Y6RA 5ENDA 1XNJA 4N7MA 2FXVA 2L42A 1WIWA 1IUPA 3MWYW 4FFMA 3SNHA 1C30A 2J87A 2OO5A 1QIJA 2WIFA 4JS0A 3UIEA 5JMOA 1HR0B 4MLZA 2KLBA 1NHWA 1GA4A 3CTPA 3N7AA 4MV1A 3GLHB 4XWTA 1TCVA 1XR3A 5ECGC 4DDHA 1SOUA 3D3NA 1AKYA 4Q34A 5BR1A 1E1MA 4BAUA 4V39A 1R0XA 4KAXA 2YFYA 2N1MA 4O2BF 3U7EB 1FJXA 1GZ4A 5AM4A 3EXFB 4ALLA 4OHBA 3CPHA 1CLUA 1UKVY 1GN9A 2OXEA 2P7HA 2Y68A 5TPZA 3A4LA 2C29D 2IYFA 5CH8A 3S1LA 5HF6A 3WLMA 2XVMA 1J33A 4GOOD 4UREA 4E12A 4F4JA 2WQ6A 4U7HA 2B4QA 2ZRPA 3UENA 5EHQA 2IS4A 1PR1A 3FB4A 4LZWA 5JO9A 2VWGA 3LUBA 1Q7CA 1V39A 2YMPA 3H4TA 4FNAA 5JPDA 2PH1A 4GMGA 2J3EA 4BKUA 4EQ6A 4EQZA 5KSYA 3TD2A 2GNPA 1ZUD1 1PSWA 2I0FA 1F7UA 3RS3A 1N36B 5C3MA 4I19A 1GRNA 4CQJA 1ZJZA 4L4XA 5BSVA 2YYZA 3QA9A 2LIPA 4P32A 3LCUA 3VTFA 4PCVA 3LFTA 4MGYR 5B6IA 2J7PA 2BFPA 3ZGLA 3Q7QA 1K7CA 3GD7A 1QHHB 2H00A 3KUCA 1PR4A 3OFKA 4FXPA 4RO0A 1WG8A 4EEZA 1OIWA 3IP6A 4Z4QA 3U4QA 2BFFB 3FCEA 3AFOA 1ABBA 1ZHOA 5AUPB 1ZNQO 3K0AA 4MV4A 1GARA 1BEEA 2BCGY 4H18A 2ZE5A 5E4YA 2G71A 1RKVA 3Q5DA 1DX9A 3MJEA 3A31A 2J33A 3AR5A 4HZIA 4I1RA 4JC4A 3AEQA 4DJFC 2HTFA 1OREA 2DWQA 2G40A 2YICA 4ZV9A 2NPFA 4RA9A 4B8WA 2WD7A 1I7SB 2ZUBA 4JP8A 1X87A 1HDCA 4IILA 4GBGA 4HS9A 3PHGA 3AVVA 2QNBA 2YJ3A 5ALWA 1PK7A 3DR3A 3G5UA 3OFJA 3BSYA 4D9CA 3QWIA 1KIMA 4JENA 4ZALA 1KZ7B 1RWXA 1XE3A 3TDNA 1Q0PA 4P4LA 3R6GA 1K4KA 4FYYA 4QJ5A 4F71A 5ARBA 3EC7A 3KT6A 3GAFA 3ZEIA 2B0CA 4Y1RB 3HS3A 3ZWYA 2FPWA 2GYYA 4JI0B 3OQNA 5H0IA 3W77A 2Q41A 5KHAA 4ZKDA 2IBSA 1KQPA 2PX0A 1OGIA 3KSZO 3OIGA 5C5EA 3H8WA 4XCVA 3SOPA 1XN1A 2ISCA 1DADA 2NV6A 4YRTA 2QZZA 1JAHA 3U3DA 3RGWS 2PE5A 1AQUA 1XQ9A 2X7XA 4WOKA 4E4TA 4ZOBA 2NZJA 2R7KA 1R0CA 2GN4A 4LSZA 3CH6A 1QO0A 3FBWA 3FLEA 5H02A 2WWHA 1GKKA 5GJWC 3HEBA 3W5SA 2OCDA 5D6OA 3KDPA 3TRFA 4O4IA 2BM0A 5I5GA 2WF7A 4G65A 4W5RA 4GGMX 5HZMA 5A0VA 3D7LA 2VSYA 1C8VB 1S2OA 3C6YA 4XD2A 4IR7A 4FUTA 2P9BA 5FOUA 5LZ7A 3RNOA 3E9YA 1T26A 2WIDA 2XUIA 3UB4A 2YZGA 1EA5A 3ZDXB 2CFOA 4IYRA 5J4LA 5IM4A 1G0OA 4HDNA 1XRQA 2NSJA 3IOYA 1EFHA 1KGDA 4PO8A 4GBJA 3WKAA 3RK4A 2JCSA 3UT5B 7MHTA 1RZ3A 4G0OA 1NYLA 1F8UA 3R6LA 3QU7A 4OKSA 3RYCA 2XGMA 1GUYA 1HDGO 3R9WA 1HFWA 2OV4A 1MG5A 1KYQA 2HSGA 1TUGA 3PUJA 3QVWA 1UBLS 3H5OA 3HBJA 4J1NA 4M9CA 3GJQA 4QPDA 1NASA 3PC6A 2OYRA 1DKLA 4TWBA 3T8YA 5KKNB 4OX9B 4KQGA 3T4XA 3UC5A 4QM6A 4JUDX 3IIIA 3M9LA 4TRMA 4TVSA 2W2LD 4BIMA 2IGBA 3P2OA 2X0RA 4JJIA 5EIFA 2QJOA 2NZ2A 3JU3A 1B6TA 4OUDA 4C0AC 2PXAA 2SKEA 4CFSA 3F6YA 2BGTA 1LD3A 4PZUA 3RAJA 3WK8A 3QYFA 3BS4A 2OQIA 1WMSA 4B8ZA 4G5GA 4DXDA 2G07A 1CS0B 2Z2KA 1E1QD 4J43A 2XRZA 4LW8A 4U3JA 4J7CA 4DTIA 1DUSA 4TLAA 3D7NA 1AV6A 4BS9A 1NIJA 1VL2A 4HJRA 5EIXA 1UK6A 3R3HA 3K2QA 4KQ1A 3DP7A 4JOCA 2OCGA 2OLEA 2PZAA 4XTCS 1V4BA 5MDHA 3MRSA 3KQQA 1NUAA 4OI4A 3V46A 5KYKA 2ATCA 2BH9A 2QL7A 2I3GA 4NATA 1C50A 4HAUA 3H8JA 2EOAA 1CBUA 3BH0A 1J49A 4J4HA 3HYNA 5M34A 3HKBA 4ZJZA 1FJGB 3QOYA 4LOAA 2ORED 2IEGA 4XWKA 1YFZA 1PQWA 1V8BA 4X94A 3OMWA 3MS7A 4WKGA 2X0EA 3TZBA 1WXFA 1S2DA 2CLHB 1JI3A 3KZNA 2CEAA 4YP9A 3N8GA 3BAFA 3ZKWA 1RYMA 1PVOA 3Q3HA 4WN3A 1QR2A 3ILSA 2AR0A 1E8DA 1MAHA 2ORYA 2VF2A 4WLOA 3LCJA 1TE2A 3SSAA 3VHQA 3ZV4A 1HYEA 1AQYA 1OBHA 3MK31 4HKTA 2BI7A 1IY0A 2OXFA 5AHXA 2Q5LA 3K4QA 3K5HA 4S3MA 2NSHA 2HLDA 3I92A 1FDUA 1F2TA 4OHPA 4C0HA 4XM1A 3WQRA 1VJTA 1WVIA 2WAAA 4L4YA 5LBTA 1CV2A 2I9PA 4HUJA 2GN9A 1B2LA 4BC1A 4EVIA 3KPJA 4NCNA 3W0LB 4TS9A 3V33A 4FGLA 1P2DA 4ZOCA 1IJEA 2H1FA 4I2NA 1A95A 1ZK4A 3ZJUA 3I6IA 4YDQA 3CO0S 3OE7D 2HQOA 4C3VA 5TR9A 2ZXEA 3VSEA 1D6NA 3BGOS 1GDTA 1ZP6A 4RDCA 3EDQA 1V6SA 1WX1A 3V1UA 1B6RA 1PZXA 1TC1A 5AJTA 1MIHA 3C8MA 2DR2A 2YC4C 2ACWA 3P2MA 5DTQA 2TSYB 1VDMA 2VDOB 4J1TA 3ZTWA 3F7NA 1AVTA 4LXGA 2NU9B 4BVFA 3LW7A 1VCIA 1YC2A 2O2JA 3HH8A 3K1TA 5AI5A 2BELA 5D01A 1SULA 3G1UA 5AKZA 1OC2A 5F3RA 4OI1A 3ZHZA 5IARA 1BMFD 2GVDC 1J56A 13PKA 5AHRA 5KPDA 1US8B 3PCTA 3GAZA 3JQ7A 4QVGA 4RYDA 3R74A 2OESA 1XTBA 1OFTA 4A8JC 2QW8A 3W8RA 2WJWA 3Q9LA 4DIOA 4QEDA 2H4FA 3HXPA 3OPNA 3LNTA 2VP3A 3I1IA 2OAQ1 3C43A 2B7BA 1HRKA 5CFOA 4ZVPA 3KQUA 3UBTA 5HJ2A 4Z4EA 3W6NA 3O9ZA 1WXIA 2WHYA 4BFVA 4D8VA 4JCCA 2JVIA 4B6SA 1SUCA 3N8IA 1QVZA 4KX3A 3DBIA 4A2QA 1IFXA 2IF0A 1Z6TA 3U6BA 4UTZA 2DXIA 3RC9A 3E9DA 3OEEA 4FONA 4QU9A 4XGIA 1U2QA 5DEOA 3WGMA 4DQUA 3ITDA 1D7OA 3BULA 3F71A 4NG5A 4CRWB 1P18A 4Z7QB 1SGWA 3JQAA 4OD0A 4YNBA 2G63A 4B3RB 1Z88A 5D8DA 3ZNPA 5BY2A 2PZFA 1F0PA 4IWNA 3R9XB 3JATB 3UMFA 4C05A 1VKRA 3F4BA 4DPLA 2KS6A 1B1AA 1T4BA 2BCJQ 2G3YA 2ID9A 2R00C 2QX7A 3G8AA 3NUZA 2D62A 4QJIA 4Y18A 2FPKA 5CGZA 4FMBB 5FEUA 1PJCA 3CQ9A 4FIZA 3W05A 4L0QA 3DLHA 4H7EA 2FWJA 4LNHA 1OX4A 4U6QA 1ZLXA 3WO0A 2MOKA 4AUEA 4E14A 1L7RA 4QOSA 1GPBA 3FUWA 1SAYA 3NC1C 4M0UA 4EDHA 1IZZA 1NUSA 2EWMA 5H81A 4WBNF 3GJRA 3KKNA 3M0EA 5KDLA 3IMFA 1NC1A 1JR3A 2JHAA 3SEZA 4FS3A 4CLXA 5EP1A 5AHWA 3CU5A 2EKZA 2P0AA 2PWAA 3UMGA 2WDPA 1QP8A 2ONZA 2JGIA 1F12A 1CIVA 2ZT5A 3ROZA 3MCUA 4BQEA 3QXXA 4GC5A 4CCYA 3B2QA 3WLLA 2PAFA 5CXQA 1BW9A 2CLKB 2VN8A 3DAHA 3TN7A 1EP1B 3DDSA 4L6CA 1Q0SA 1GTMA 3OO0A 4GL4A 3SM3A 2OGZA 1G8PA 2AS0A 1VGRA 4ML3A 4DIMA 2RB5A 5LQNA 2C9DA 2JJ1A 2J5QA 3F0TA 3EGIA 4N3CA 2QRMA 1DJQA 3KLNA 4M0PA 3HU2A 4M7PA 3JVEA 4MAFA 4UM8B 4EHNA 4JLDA 4PYQA 5EYPB 4EKDA 1GG8A 3GIDA 1XK7A 2B94A 2W7TA 4LY3A 4NF2A 3ZK8A 4ZCPA 3RANA 4CDRA 1A9RA 3SYRA 3GU3A 3WAKA 4C5BA 1M8PA 4WEQA 5A9SA 1H2BA 3I4CA 4JT9A 4E5MA 5HVNA 2X8BA 2ZUVA 2NO4A 3PV0A 1QH8B 1OWOA 5HS4A 3CZ4A 8LDHA 1RJWA 2Z8XA 4AXBA 3TLGB 4ESHA 4YR7A 1NAIA 3PPIA 5U1PA 1ZK3A 4BY9E 3M4ZA 1XGKA 2AXNA 6GPBA 5ER9A 4AZVA 3QLUA 2R7NA 4U5XA 2HA0A 2R4UA 4BUJA 4LV5B 1N0UA 3GPBA 1UP7A 4KE7A 2ZSKA 1ZX1A 2WU8A 1QLWA 3OCVA 1CRPA 3V7WA 3D6AA 4PN3A 5HGJA 8OHMA 3I23A 4G1CA 3Q10A 4FKZA 4P3PA 1DU4A 2X1LA 3HXKA 1YVPA 2IELA 1T6NA 1M2OB 3N8KA 5AW2A 4MGKR 3SHWA 3Q3IA 4DLPA 4UKDA 2H2GA 1TZKA 1BDJA 1PE0A 1F14A 1WF6A 3L7JA 2Y6UA 3NDJA 3C7TA 5D3MA 2PFKA 1D03A 2C77A 3CJRA 3TXYA 1BVYF 3PK0A 1YTUA 3G9XA 1PP4A 2JAXA 1GG2A 2A84A 1PTKA 2WJZB 1EJ2A 4DZZA 3JYOA 3FUUA 4B2IA 3DEYX 3IESA 4AZWA 3Q7IA 4S0XA 3SYMA 2OSVA 2F48A 3QWAA 1KOJA 4UMVA 4UTPA 2AZ4A 5HCIA 4D9NA 1JR2A 2DVMA 3NWOA 4HWKA 3QPDA 2VRNA 5ARDA 4IYJA 5BW8A 3W6OA 1H2EA 2I4IA 2YWDA 4HEA6 1U31A 3KT8A 1CUJA 3TBHA 2GZ2A 5JZ9A 4MQFA 3TSOA 5TY0A 1NXOA 3DTYA 3GA0A 3SQMA 3I6QA 3GLIE 4YLYA 1KRHA 5EUCA 2JLSA 2XGOA 2AGVA 3B3GA 4TQUS 1ND5A 2A2ZA 2ZYAA 3C4JA 2VH5R 3V8BA 4DIBA 4PXYA 3M49A 3FOWA 5JZMA 1UJBA 2E4XA 1EFRA 2F17A 2QVYX 3W1EA 1ZN8A 4X60A 2XGGA 1OLXB 4BC0A 3U3MA 1JIKA 1NWHA 3LD9A 3PUKA 4G8DA 1KHHA 2ZB3A 4KACA 4ENUA 5HRAA 3MYYA 3ZDDA 1MVNA 1RHRA 4QNMA 3IAHA 4WK4B 4CKWB 4AMBA 2ZYWX 3OURA 2ZULA 4WOBA 3CCFA 4Z3KA 2G67A 4G23A 2PX8A 2GFIA 3HADA 4WH0A 4N5DA 2K7FA 5JANA 2PGOA 5F78A 4HQ6A 1PS8A 5KAMA 3V1LA 5CITA 4KXXA 2NXCA 1KSGA 2QD2A 4CZ2A 1V7CA 3H1AA 1V5GA 2D54A 1KMMA 1RYZA 4G07A 3RHFA 1JVNA 3GUYA 5C8YA 3TI9A 3VH1A 1FVFA 4UOEA 1LDGA 4QBHA 4HFMA 5HA5A 1JVBA 2CWWA 5JZSA 1P75A 2H48A 4PYKA 2E9SA 1OKKD 1D4AA 2CLSA 3CLSC 3FPLA 1E9VA 4KJZA 2P2NA 4XJSA 3MAJA 2GCPA 3MN1A 1IWOA 3AESA 1E1NA 1JR6A 4N3NA 4RH1A 3UCEA 4J16A 4X7RA 4BB5A 5LL6P 3ZE0B 3DZHA 3UW1A 2YFKA 4EHDA 4YWJA 2IWHA 3M6XA 3FE2A 3QXJA 4UFPA 3UV3A 2ZOSA 2CNOA 4YDRA 4HDCA 3H4MA 3P9IA 2IU6A 3IP9A 4KQ2A 1ZBDA 3HRKA 4RBNA 4LQDA 4J6FA 4Z99A 3SFTA 4EHFA 4EY7A 1CQJA 1SBYA 2O06A 3A1FA 3FAZA 4I9NA 5FQNA 3WDKA 3W8FA 1BDBA 1W30A 4MWZA 1LQ2A 2KBFA 3EMBA 1KVRA 1QCZA 1T3TA 3E1GA 5GONF 3ZY5A 3ND8A 3I04A 1J06A 1SA0A 4UMDA 3PIIA 5I9BA 1WO8A 3G23A 5CX4A 1N2CA 1T4DA 5G4KA 4CQMA 4BATA 2XGJA 4I9HA 4U2DA 1K5HA 1NW9B 1NXPA 3GEEA 3HDVA 4ETMA 1C3EA 1XTZA 1TQHA 4UXHA 2JLYA 2VHWA 3BGSA 1P72A 3V4LA 4LGYA 4Q9IA 4HH3C 1N1EA 3GFOA 4ZOLB 2I6QA 3SXUB 3D0QA 3BGIA 4HSEA 4UVHA 4DV7B 1FVOA 1N5IA 3H84A 2HZ7A 3HNOA 3D2LA 1RPAA 3HYRA 1ZHFA 1CLEA 1DQNA 1V41E 2ZIVB 4C3ZA 1JQKA 1MJFA 4FR5A 4KO3S 1C41A 5T8KA 4B5LA 1X1TA 1I0LA 3L8GA 3E7FA 4C4XA 3O73A 1A1VA 4LE1A 2C0PA 2VNAA 1N0HA 1TF2A 2C58A 3GJTA 3LQRA 3V4VB 1MW9X 2YIMA 2FI1A 3H0EA 1EINA 1NW4A 1X0XA 4HAZA 3WGYA 3KK0A 5FFMA 3FNBA 4G97A 3PQEA 1VE5A 4EPWA 1NJ6A 3TJMA 1EVKA 1CEQA 2YVUA 2Z57A 2ZVDA 4W6ZA 3MTGA 1OJLA 2VQ3A 3UK1A 3DOHA 3PXEA 5IC4A 4MNTA 1L5NA 2SICE 2AYXA 2XWPA 4Q7MB 2YASA 4M1OA 4C7OA 1E77A 2X0KA 1YS9A 1TD1A 3GG9A 3LKVA 4NU0A 4OAQA 1J8FA 2BR3A 2GBPA 2GS9A 2I76A 1QV7A 1I2BA 1YCHA 2BBTA 3DNFA 4PV7A 5H3CA 3GZJA 4NV0A 4CTNA 4ZIRA 3ROEA 1KAHA 3I58A 4RKQA 1O5TA 1R6UA 4QXMA 2CXOA 2VH1A 3QELA 3TKYA 3C8HA 3I05A 3R5HA 3HR8A 4TV8A 4X6XA 1EZZA 5EJIA 1CE8B 3PPXA 4LX0A 3UV7A 4A15A 1R1DA 1QORA 2FLKA 2NO0A 4HQ0A 3RO7A 3D81A 2V6JA 3IAUA 4RVOA 2C2ZA 1NXSA 2IITA 3BRWD 4OJTA 5EIHA 4LS3A 2HMWA 4MWCA 5KSZA 1W6RA 2Z58A 2PA0A 3GJZA 2WWXA 2FY8A 1ONOA 1Z73A 3OI7A 3NAMA 2IGTA 4F1KA 1XLTC 4RZ3A 4ZVMA 3TQIA 1W93A 2INGX 1T1EA 4CT5A 2AJCA 2OZVA 3F4KA 1XQ6A 1ATZA 2D2FA 3PG5A 3AR8A 1OY1A 4ZVLA 2CMHA 4MI9A 5C4MA 3EFOA 2J3JA 4KN6A 4WKNA 2Y66A 3LVRE 1CZHA 1GSHA 3DONA 4JQZA 3M6VA 5G1PA 1CUZA 3R5FA 3LGSA 4IIXA 2N75A 3BWDD 2VT2A 3D7MA 4ZQIA 3ZNOA 5I4KA 2AKYA 5JAZA 3PC8A 2WW8A 2D0PB 3CG0A 2P2GA 3Q88A 1E2IA 1OQAA 3B3QA 1L7EA 3ND5A 4OMUA 1V3UA 1ORRA 2OILA 1RLUA 3G2HA 5DRYA 4EYGA 1OPXA 5AW0A 1OI3A 4NABA 5BXQC 2HW8A 2XWBF 2MTBA 2ZPTX 2D1QA 3I2IA 2CJFA 1QRSA 3KQVA 4J94A 2Y1LA 3O1HB 4XDHA 1V11B 4E30A 4X62B 4B9EA 3PWKA 5HJ7A 3ZDFA 9LDBA 3ORFA 2NU8A 1OA0A 2ZJ0A 2P65A 4X6LA 4KW7A 1NVGA 1NW6A 4F6RB 4TXHA 1DB3A 1U2TA 1OBFO 5LUAA 2FR8A 4NULA 3OE5A 4Y9SA 3DF7A 4H7DA 1OXTA 2QTVA 4IV8A 2VDLB 4U63A 1OU4A 2N9UA 1E8MA 1G21E 4O2BB 5FA8A 2K6GA 4AY4A 2AIRA 2Q2WA 4N82A 3I12A 5JTTA 2VJMA 3UJ9A 3DBRB 3VDMA 1P2SA 3EIXA 1J0AA 1KDOA 3W5IA 1CUDA 4CPDA 1GAWA 3ZQJA 2RHMA 4O2AB 4DQ0A 4TRNA 3O1JC 5C18A 1HYQA 1V6AA 1XRSB 2VBGA 3R77A 4L8LA 3RVBA 3UCFA 1WZUA 2NUTA 2JIZD 1FXSA 4KQKA 2BM1A 1X19A 2I62A 4MMZB 3K9WA 5EUQB 2XHZA 4BO4A 3N7UA 3DLAA 3RYIB 2VTEA 3GLUA 4EUEA 1AMOA 4DJEC 5CFZA 2A94A 4BQRA 2ZU0C 1AXRA 3R8CA 1PN3A 1G2PA 1Y4UA 2YHIB 2NT4A 4TLCA 1OV6A 1RQLA 1Y6JA 2R1ZA 4LY6A 2ZIGA 3DCJA 2DM6A 5BR7A 2VYQA 1ZJ4A 1B0PA 4WCVA 1FNSA 1L4KA 1EFTA 1TQ6A 2VRWA 4QO8A 3TLJA 3EVZA 1GSAA 1M8FA 4WZZA 4JWKA 1RTKA 1VCOA 3NM5A 1VPVA 3PQ3A 3ZHVA 1CZKA 4BO9A 5A5GA 1D4FA 1SU7A 1UKCA 3E9NA 3T3PB 2PWPA 3G9UA 3UAVA 3G82C 3ZX4A 2PUCA 1Q17A 3NP7A 5BSTA 4DQXA 2IHZA 3TECE 3KXPA 3TFOA 5ALDA 1K08A 3U7QB 1CZNA 2VXOA 5BR4A 4W5WA 3K8ZA 5I51A 4XD7D 4DADA 3FUCA 4QECA 3NW9A 2GBIA 3K0HA 2YVKA 5DW0A 5DHUA 3P0RA 4IHQA 1DG3A 3ST7A 1V9SA 2BAGA 1TEHA 3PFGA 4JH0A 2IU0A 4Q03A 3VU3A 3GP5A 3TKLA 4CTJA 3B51X 1GXSB 1TAQA 3LXMA 1NVAA 1CUYA 5GVRA 5EVJA 5HP4A 4F7WA 2UVPA 3JR7A 4G3XA 1XTIA 4CMIB 4CIBA 2O8CA 2YWRA 5H82A 1JECA 2AXPA 3WWZA 1PD1A 3FN4A 5IU6A 2RD2A 1OVMA 2AV6A 1QIGA 3QNMA 4ZT4A 2ZRJA 3VDRA 5J4VA 3WK4A 2QRKA 2XTNA 2LCQA 2GAAA 5DYGA 5BRNA 4PEVA 4EHAA 3MSCA 1DXQA 2DFNA 1N3BA 3MLBA 4WPGA 2O1EA 4G5OA 3QLEA 4PAQA 1ZGHA 1J99A 1ZJYA 3G49A 2RIPA 3UYKA 3WWOA 5LC1A 4P6VF 4BV2A 2X41A 2PL1A 3LVFO 1W59A 1MB9A 1P4GA 3OFVA 5DO9A 5JYBA 2QX4A 2WIBA 1GL7A 2A1UA 2C42A 4JBXA 4QLAA 4FNGA 4TSFA 2H1CA 2BGIA 4OQXA 3AVQA 4ZEVA 1V47A 5KNBH 3DC2A 4WA8A 2NVOA 1BMDA 2V4MA 3AFHA 5T5QA 3F7MA 2G9RA 4MVJA 4OXXA 2FUCA 2H2FA 2C4NA 2XDQA 4BCBA 1JXOA 1Z47A 2VJNA 4URFA 3LHSA 4E33A 3DVQX 1CNMA 4YLEA 4RTJA 1H3NA 1U1IA 4GFDA 4RJIA 3GCDA 3I28A 3RIYA 4UBIA 4RY9A 4RY2A 1J0BA 2AQKA 3FBTA 4QGBA 4Y2XA 3SP1A 4CJXA 2IPNA 4KLRA 3R7DA 5AD1A 4NV3A 1SQ6A 1V16A 1U99A 4AI6A 3DA8A 1DIRA 4C0XA 4DUGD 4AKHA 5AHKA 5LP6F 5TQ0B 2VNJA 3QI2A 1AGRA 1EFCA 3BXXA 3R3UA 1CB0A 1UC4B 1ZI6A 2KX7A 2QN1A 4MW4A 3N0WA 4QQRA 4V38A 1MOPA 4HWGA 3VJKA 3LCMA 4ZYYA 1A2BA 1QV9A 2GH1A 2Q21A 1GV1A 2I71A 1ZU4A 4BMXA 5AH0A 2JGLA 3H18A 4M9XA 4JLPA 4OB7A 1KO1A 2B5OA 2YWBA 3FY4A 3W34A 4G56A 1AF7A 3GG2A 2VJAA 3K9QO 4PAWA 4YAEA 4YRIA 2C7QA 2PUBA 1SRRA 3Q8WA 3OFNA 2YMLA 2J5KA 1LU9A 2GEFA 4MJLA 3T7JA 3ZH9B 5AK6A 2HNAA 3U44B 3PT5A 4GWGA 5TQVA 2BFBA 1V9LA 4U7DA 4B3MB 2QRLA 4HDRB 4EG5A 4YIHA 2GEUA 3PHBE 3CYFA 1EFVB 1UMDA 3DYBA 3CG4A 4RKWA 1RI2A 2XE4A 3ANNA 2B8EA 1F8XA 2UZ1B 1N92A 2FKAA 2PX6A 3KOZA 5ESRA 4X90A 2HJWA 3ROXA 2FMHA 2HX1A 3WBFA 2PO7A 2G76A 2HBYA 1VKJA 3R6DA 2IOQA 1Q2XA 3ELYA 1CF2O 3BK7A 3WKDA 4JL8A 4E46A 2ONJA 3WL8A 3B6MA 1K5PA 2QAJA 2DQ4A 2H0RA 3COVA 2VPWA 3FNIA 1XZHA 1OT3A 1T1IA 5EWMB 2GPNA 4DLUA 3Q1KA 5EJ7A 5JRDS 3BQMB 2R65A 2BZ0A 5EHNA 5BMVA 4ENQA 2ODBA 2FEPA 5CM2Z 3VAZA 3NH6A 4Q9LA 5CJJA 4CG2A 4ND3A 1WL8A 3TG8A 4OL0A 3TO5A 2KSQA 3FYDA 5IBCA 5I8WA 1C2YA 3PZBA 1BE6A 1J8VA 1CJCA 1V7QA 3E4CA 2UAGA 1EUCA 1NLFA 3OIFA 1ORWA 4MUIA 3RIXA 3K71B 2Q5OA 1T2NA 1Q0ZA 5T4EA 2RHRA 5JARA 1ZS9A 3ZS8A 2JHPA 2P3QA 3I9KA 1MIOB 4H7IA 3LT0A 3U39A 3WBKA 1H1DA 2R6AA 2PGXA 4D8YA 1CDZA 4TLLB 3USCS 3L7DA 4ZK6A 3OLXA 3VR3A 1E9FA 1HYHA 1KQOA 1LRLA 3OLVA 3PF8A 1HT0A 3PDIB 1H1LB 4W5HA 4LF6B 2HSJA 2ECKA 4FFOA 1JEQA 1FA9A 1BXGA 2JI4A 2XNCA 2OBLA 2IDJA 5HZHA 3PNKA 4F2WA 1Z0IA 4EP1A 3RTAA 1LBQA 3ZYZA 3NDRA 5B3KA 4Q6WA 3FDZA 3FSJX 4EVQA 4POAA 5DTMA 1P1JA 4C0QC 1SPBS 3ELDA 4HUTA 4JI4B 5GADl 4G37A 3PNQA 1SHLA 2ZPAA 1G3MA 1SXHA 3KYCB 3ZIDA 3ZJVA 2QA5A 4KNYA 3VNAA 4V1CI 1Y0BA 1JEEA 1LC3A 3BAZA 4EELA 3C87A 4P84A 3TIFA 1Z36A 5HWSA 3ZU2A 4PG6A 4M1WA 4ARUA 2VCYA 2MMCA 3REQA 1TQDA 2EVWX 2N46A 4TYWA 1KJJA 3QFTA 2VUSA 1ZOOA 2EGHA 3GR6A 3HJUA 4IVRA 1AV7A 2DBYA 2IYQA 4LJLA 2Y4OA 4WNAA 1UIRA 3GZNB 2O5CA 1O97C 5FI3A 1GL9B 1T2DA 2H18A 3IALA 4GICA 1QV6A 4PQRA 4D45A 1ID1A 1EG7A 2LXNA 4LJYA 2RK3A 3KHKA 5G4LA 4KR9A 4DV1B 3ZZ1A 2A67A 3BXPA 4EEXA 2EC5A 4J1TC 1ABFA 2FZ4A 5C9ZA 1ZI8A 5I45A 3BX1A 3LBAA 4ARZB 1DOAA 1W94A 2AX4A 1LA2A 1G4UR 3AB7A 3FYUA 4K40A 1GJRA 4X6YA 4C7XA 4NKRA 2C7OA 4AP9A 4UCQA 4OFXA 3SXPA 2QDXA 3OOWA 2DP4E 5KNDD 4TYYA 5JMWA 2OKCA 1GD1O 1XEXA 2VDRB 4ZYTA 1NVXQ 1DWQA 1Y1SA 3ANYB 4I99A 2IX3A 3MCVA 5DSTA 4AJJA 3E58A 1I2MA 3QNWA 4WBNB 5EJ5A 2IHBA 1JHUA 1UDRA 3DEFA 5LOVA 2EQAA 4WKOA 2R6FA 3NNNA 3UGQA 2XMQA 2Q2OA 3F90A 2JGFA 1AZTA 2O7SA 4US0R 1BWPA 1Y7LA 2COUA 2H4HA 2Y1KA 3R7BA 5T6MA 1ZZGA 3IOCA 2JGJA 2GLXA 4FBMA 3FJ1A 1XFAA 4A8HA 4MR7A 1P5ZB 3V1MA 1AB5A 4M1SA 4K1LA 3AL2A 2VQDA 4LHVA 2ATEA 1YKSA 5IN4A 2V5UA 1LVHA 2Z83A 1X7ZA 3H17A 3KOUA 5G0TA 3BFXA 3M6AA 3LU1A 2D3TA 3X0DA 5I48A 3SX4A 2DAPA 4PX2A 1WPGA 4RHFA 1R0BA 1OZAA 1XVVA 3X1MA 3CNOA 4IBOA 2F4NA 5IFKA 4X7BA 1QG4A 2VT6A 1RQNA 3LOPA 3QPCA 4KPUB 2MYTA 1ZVVA 1VSQA 2F4VB 4DCTA 1Z5NA 4OV6B 5JSFA 4K0KB 2LPMA 1J24A 3TE6A 3I5XA 1U65A 1MCZA 5DIZA 5DCUA 1T8WA 5FNVB 1E2QA 2XI4A 2YTZA 5IVHA 4YV2A 5BOVA 1DWPA 1UZNA 3PNMA 2ES4A 4CWAA 4GBMA 5DCYA 5C31A 2HWYA 1X15A 2PMEA 2OMEA 4BVAA 4G24A 4YMWA 1BE0A 5B7NA 2VBFA 3T41A 1NVTA 2XDAA 2EATA 1A4RA 3ENVA 3GLGE 2HWXA 3GXBA 1I3NA 3GUZA 4B75A 2UVQA 1DWOA 1YR7A 4CFYA 2XB2A 1DP4A 4PE5B 1GZVA 2Z09A 3DO5A 4MVYA 3GRRA 3NQ41 4KFRA 5HX7A 1NRIA 1UAAA 2NAFA 1VMAA 1TQ8A 2C8KA 5L3QA 3ZGZA 5K4AA 3KHTA 3ZWMA 3KIPA 4IDOA 4Q4CA 5BUSA 1P6QA 2WTUA 4MHTA 3IAM1 4F97A 5IULC 4L22A 1H8EA 2CVFA 3GDHA 1GRVA 2OBBA 2WOOA 3FLBA 4XQ9A 4UMFA 4WDRA 2AN9A 3GLVA 1VBFA 3QWBA 1T3SA 5K0GA 3CCCA 3C3EA 1DQPA 2UVDA 4Z1MA 2ZUTA 4IAOA 2EHJA 2A8YA 4MV0A 4Q16A 4ANFA 2ZWAA 2V65A 2FMXA 1X1AA 2OD2A 3FUVA 3SLGA 2HQ1A 3WLEA 2AE1A 4HCJA 3I9JA 5JI2E 1R9NA 4CIVA 3WAGA 3RAPR 4UFNA 3H1PA 3S2FA 2B99A 5J5AA 1Q2UA 1KORA 4GZ3A 4L2IB 3RSQA 3VU9A 4X1OA 2QUBA 4DDKA 3UTCA 1N77A 1RACA 1CYDA 4QGGA 3P27A 4GD3Q 1DBPA 3H11B 4G0QA 2QP3A 5TQ2A 3K70D 2HRDA 1WB6A 2ZI5A 3U7RA 2GD0A 4XR9A 3WK7A 3DTVA 1T43A 2J0SA 1WB9A 1OLSA 4CIAA 3L6DA 4EFDA 3GL9A 5LNK6 4K9MA 4OYLA 2VA8A 2NUAB 3QEBZ 2AL7A 1IE3A 4DLBA 4GMKA 2I3BA 1NBAA 2PD6A 4E13A 1UINA 3ADPA 4ZCQA 5THXA 2J9XB 1R18A 3DDUA 2FN8A 2ZE6A 1YJAA 2ZRLA 4X3OA 3QSGA 2HU2A 3N53A 4HAOA 1N6IA 5CEFA 1GY8A 5IK2D 5IT0A 4LRQA 2HD4A 4EVRA 2OO7A 3VO8A 2CVQA 5JJBA 4ND2A 1Z0SA 3NJRA 4OP2A 3CLTC 2YWCA 1GTL1 2ZT7A 4HWSA 1T4GA 3UV6A 4BO2A 1JFVA 2OQ2A 2UXCB 2BFDA 1PS9A 1XAJA 3JD4A 3RVNA 3E61A 1U02A 2FSGA 5EJ9A 3CX6A 2Q6VA 1TM7E 3QVUA 4J76A 2K2WA 3Q98A 1Y8AA 2ZAGA 1IEVA 5HRUA 5DULA 5HKOA 4QYWA 4ND4A 2J0EA 4YS6A 5AWFC 2WUWE 4EATA 1VLVA 5F4ZA 1PYDA 2VHUA 4TYQA 4H6WA 2IOHA 4RL4A 1UJ6A 3ELWA 1J1UA 5KYWA 5TC4A 3UA4A 1E60A 4NEGA 4ZVTA 4B33A 1G8GA 1XNHA 2AMYA 3T0GA 4ALIA 4MCJA 4D9IA 4CEJB 1VZ2A 1YB6A 5IYZB 1EI9A 4N5NA 3QYAA 1PO7A 1NJGA 1DJOA 1P6XA 2QE7D 2Y9PB 3AW9A 3D4IA 2HSWA 2V6FA 1AUXA 3JWPA 4R1QA 3OICA 1AGNA 5ELLA 5JS6A 1W96A 3TIIA 5LQSA 4E15A 5U9CA 2A30A 1EXDA 2WYOA 5HFNA 3OJCA 1NP6A 2DWPA 2QTZA 2WUGA 4NYMQ 5CVDA 4BNTA 2DRIA 3DOIA 5AM0A 1SC1A 2EBWA 2HHHB 4X92A 1TA4A 5BN5B 3THXB 1TLLA 2FCAA 3V8PA 3ZWCA 5K4HA 3T35A 4RD2A 3RUPA 5HE8A 2VP2A 1Z17A 2E2WA 1PTJC 1ETUA 3BHJA 4KPGA 4KV9A 3GJXC 4N18A 4PLYA 4PYRA 5KYTA 1VKOA 4X71A 4CKBB 1IBRA 3ITNA 4Q7JB 1Z6QA 2JS7A 3I3OA 4PS1A 4DCNA 1VDZA 1U3GA 2ZITA 1BMQA 3I01M 4HB2A 3N0XA 4UBKA 3GGSA 4UMEA 4URZR 5EIBD 2CYCA 3NBZC 2H9IA 3PVZA 4B3GA 3AY3A 3BB3A 2ADMA 1RD4A 3GO4A 3LDHA 2YWFA 3QLVC 1Z4MA 3PTZA 1KSHA 1H93A 3F9IA 4WZ6A 1X1DA 2A9KA 2W2TA 4ZCLA 1XCGB 1JQJC 5C4IA 3D43A 3AM1A 4I4LA 4NJEA 1E1YA 2ZTVA 2NO1A 3FSRA 4E5SA 2AC2A 2J9FA 3JQDA 3HFRA 3Q5GA 2R6GA 3DKVA 1CR0A 1T8PA 4DIFA 4FDUA 3ZD7A 3UUEA 1U90A 1BS9A 3LQ2A 2PUTA 4YDSA 4CGYA 4GDFA 1B3RA 1P0IA 4WXMA 1K27A 4DDTA 1PL7A 3CRVA 2GBLA 2OL4A 4D9JA 3AB3A 3RSLA 2DERA 2O8FB 3GJ6A 3PR2B 1DAEA 2B9EA 1ZH8A 2B1GA 2DOKA 2ZJOA 3THSA 1WJGA 3E1KA 4B81A 1SUEA 5CA1A 3LWZA 2WTNA 1T4CA 2E4VA 3FMOB 3KSRA 4LSWA 4WUTA 4M7OA 1CR1A 4MRMA 1YI8A 4Q02A 1DQZA 3JD3A 4AMVA 1M33A 1D1QA 2XSZA 4GXQA 4LVCA 4XLZA 1N6KA 2GF0A 3PTLA 3V8MA 4QPJC 1QANA 2E21A 4BQSA 1M73E 5IJAA 1E3SA 2ZBEA 4BLRA 3FGNA 3FCUB 2GN6A 4QUGA 4R9VA 3U1BA 4AQYB 3ZU3A 2QRNA 3AL0C 1ZR4A 3OCWA 4EKIA 2IXTA 1RAEA 2X1VA 3KOWA 4EY8A 2G1UA 2HXSA 3FPHA 3ILHA 3QV2A 5I01A 3TG2A 1XKTA 1A8IA 1QE3A 3DE5X 3Q9SA 4LJ8A 1Q1GA 1H9CA 3N2KB 1P7WA 1X7XB 2PRKA 2WSBA 1KYWA 3QMWA 3QP9A 1WE2A 3UAXA 4Q4JB 2DTEA 3Q8XB 4PBTA 4XR4A 1L1FA 5EPOA 4EO7A 3R8FA 4RHTA 1E9CA 4EB6A 1KTVA 1R3UA 1NQVA 1PNTA 2F3TA 1GZDA 4GLFA 4JHXA 4LZOA 4RSMA 4HNQA 5I5EA 1EX9A 1ZVJA 3BQNB 4LUCA 1VJCA 2B6NA 3AJAA 5KHLB 3IEVA 3DXXA 4W1QA 1BDHA 2PUFA 4CI9A 1EBBA 3BFVA 4PBSA 4ND8B 1QONA 5HGXA 3SC6A 2ZQZA 3KBBA 1DXHA 1RAFA 2OHJA 4RMIA 3K70B 1G5FA 1NDUA 3TNFA 3VPDA 3CISA 1BC5A 4PQGA 2X9QA 2P75A 4BHTA 4J8PA 4BO8A 4CMJA 2IA5A 5LCXA 2QY6A 2FMUA 5DM2A 3NHPA 1SOMA 2QRHA 2QVBA 3RFUA 3S81A 4PONA 2QGFA 3UO8B 2WZBA 1XD8A 1ZL0A 3TXAA 4A0RA 4B3DA 3OCJA 3FWKA 2W8ZA 4GP9A 4L76A 4BZQA 3RYFA 1G8FA 4I50A 2QM7A 1A8HA 5SICE 3LXXA 1XD2A 1XDSA 3KE9A 1KYIA 4IDHA 5ECYA 4POOA 4LBZA 5L3SB 1LWNA 1FUEA 2CWDA 4GOJA 3BMNB 3GNSA 4MIYA 2DHEA 2VYFA 4CL2A 1WBJB 4N7RA 3L6BA 3L2OB 2AH5A 2XRFA 3LUKA 1LBIA 2CE7A 4N4AA 3LHFA 4ZTUB 4E5VA 3P2JA 4UW9A 4CN8A 2ZJ3A 1HEUA 4E31A 5IKMA 3Q9NA 4CXMA 2DPLA 3ZU6A 2OECA 2D1RA 2WWTA 2REBA 4HYTA 4WFJA 3TRIA 3EVGA 3RS2A 4RHEA 4Z3OA 1FSGA 3RYHB 4CM9A 4FYKA 2VP9A 4NJMB 5CVCA 3E5NA 5JLJA 1QF6A 4KTVE 5FPTA 1FQOA 2DTXA 4TT3D 2XKBA 5EZ5A 8ATCA 2IUFA 3PC8C 5I7HA 4E1BA 4EG8A 3QKTA 3A0UA 4FT4A 4L8VA 1DFIA 3BL6A 2P9ZA 1A8SA 4Q66C 1NHGA 2HU5A 4LEIA 4PFSA 3IBCA 3EOBI 3HGQA 3QFCA 2VYND 3COSA 1DDIA 3MUNA 3NHWA 3W04A 4KIJA 4M99A 4YV7A 1MH9A 5CLHA 4INJA 4RJTA 5KHOC 2HIGA 2JL1A 2ROQA 2V7PA 2H07A 2VWQA 3G5LA 4LDPA 4IHKA 1QPBA 2OZLB 1OYWA 3P0FA 4KVGA 4UBOA 1R4MA 1Y48E 3W5CA 1P6UA 4IFTA 3CE6A 2NZWA 1J90A 2JBAA 3IQXA 5TSDA 4P3KA 4XPZA 4AVYA 1W7AA 2WIJA 2ZT6A 3R4CA 4BJHB 2FR8C 3AF0A 3AF6A 1PFQA 2BKAA 3OPMA 3RC2A 4QDJA 4YUXA 3CVWA 5ALRA 4FCCA 4YRZA 2BKVA 4NMWA 3WWPA 1PFVA 4RZSA 4PCUA 3ZQKA 3RAEC 4ZMRA 4WLNA 4L7VA 4PZ9A 3C2QA 5JALA 2QPAA 4YRGA 1IN6A 1I7QB 2PRZA 1N2XA 3FR8A 4U7PB 3RUIA 3KKZA 5DHQA 4BUZA 4OXKA 1HRDA 2UZAA 4CR7A 4F2DA 5EFOA 2HEIA 4JOSA 1X13A 4WY8A 5KYUA 3C41J 2QUJA 3LXUX 3OWOA 4DT1A 2CT8A 1EB9A 1JS1X 3WLIA 2PT5A 1UF9A 4NOMA 4AROA 1JJIA 1KJIA 1AKMA 2VEOA 2R84A 3JQ6A 3M4JA 4Q82A 1GTVA 3QXSA 4YJ3F 3GFFA 1H8HD 4DY6A 2UYQA 4L1KA 4DJ5X 4J16C 4I6GA 3CW8X 1WPRA 4PR3A 4M8SA 4UD6A 4KQCA 4EHHA 4P7KA 4P7JA 4IJUA 1H2FA 1P4AA 10MHA 3FD8A 3VNUA 3QTBA 1MJGA 2IW1A 2VDUE 3RVSA 1QOPB 2NUBA 2PYIA 2W93A 2ZYGA 3KHUA 5D6NA 3TFWA 1YJ5A 4X8OA 1PJZA 4Z7JA 3GIWA 1M2WA 3D6MA 4CT0A 2Z9BA 2NM0A 2BL4A 1M66A 1MJHA 5G0SA 5HKAA 2C3OA 4IXMA 1IZ0A 2IV7A 3V3TA 4DEVA 2KJQA 3ELBA 3SQWA 3R75A 2SNIE 4OP1A 3K4HA 5KREA 3QYJA 5KJ6A 4U7FA 3ESCA 2NO5A 4LGVA 1N2OA 5LZ9A 4CF4A 2W6ID 3FRHA 3H3XA 1ZIOA 2OV8A 1XUOA 5FUBA 5HK9A 2R86A 1JE1A 1UFKA 2JAHA 4XQEA 2OLJA 4XSVA 1PWHA 5DDIP 5BN4B 3SBEA 4MUNA 4FILA 4PAOA 1D07A 5KQGA 3B5JA 1NUPA 3FTQA 4FP9A 5BSMA 2PBFA 5KC8A 1Z7BA 3U4AA 2BDUA 2NVUA 4TTAA 1SPXA 2FV8A 4EMBA 5LP6B 3WADA 2C2XA 3RS7A 2NZUG 2YBDA 2JBHA 4DQDA 2Z8YM 1JEDA 4FYJA 3JAWA 2ATIA 4ZAGA 3FYHA 3IOEA 4B3XA 5HSGA 2OC9A 3IQDB 4PNEA 2OLKA 3ROGA 1B23P 1XL0A 4YMSA 1DZ3A 5ALZA 3FF1A 3B13B 3HSKA 2A5LA 4ZO4A 4WK2B 4IMIB 3S1AA 4M83A 2FPXA 4KWIA 4W4TA 2Z98A 3L0YA 3GA5A 1MR3F 3EMDA 3HBAA 3KTAA 1JV2B 3OQIA 5FRDA 2H51A 1S2MA 3K73O 3U3ZA 5TPWB 1Z0ZA 4BU1A 3T34A 1T5SA 3RS8A 3V55A 1QU3A 4D4MA 1OBOA 4Q19A 1ENYA 2G28A 1R74A 4GU5A 4HN9A 2J7KA 3AVPA 4PC6A 1W5FA 4TXNA 4JX9A 1FNNA 4YC7A 3TBKA 3VVLA 1QGYA 5TV2A 1CHNA 2HREA 3LZCA 4IHJA 1IOVA 2D59A 3NDIA 1L4EA 3LOUA 2RIRA 1QC5B 4D8UA 4XPIB 3TKAA 4L7QA 5LA6A 3LSTA 2ZQ5A 2C03A 1I51A 4UM7A 1IZ9A 2C98A 5G4KB 3WIEA 1SVOA 2NXNA 5IZCC 2HO5A 2G17A 1VHJA 1G6KA 2R7AA 5A3VA 5FUYA 3HA7A 2YW2A 1QIDA 4KH1A 1O94D 4XVCA 3K0BA 1DRWA 3OLZA 2ZBDA 3UG6A 3HWRA 2CDNA 1DBRA 4K8RB 3OAAD 4ZTBA 4FOLA 2OXTA 2AKAB 4BZWA 4B6EA 1PBNA 1FSZA 4ZVSA 5DP1A 3EWIA 1VG1A 4WJLA 4FINA 1B41A 3TD6A 3C7CB 3GPDG 1RWMA 2ACEA 2E85A 1U0LA 4JZKA 1RXEA 3ENWA 5CJPA 3B53X 4R31A 2NYUA 3B1KA 3ZJYA 3DKIA 3TGPA 2ZI6A 1M6EX 2PCLA 2Q6TA 1DELA 2WLSA 3ABSB 3QEJA 2IZZA 3QEMB 5SZHB 4URWR 1E2JA 4BLTA 5LQAA 1MW8X 1JH9A 5CVTA 2Z0MA 1SIWA 3FPFA 1G21B 5KWIA 4B2YA 4TLEA 3PRJA 1GZ5A