4OFXA

Crystal structure of a putative cystathionine beta-synthase from coxiella burnetii
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
316
structure length
288
Chain Sequence
MVLDNILQVIGKTPVVRLHRIGQSLPCELYGKCEFLNPGGSVKDRIGAAMIESAEKQGKIKPGDTLIEPTSGNTGIGIALAGAVKGYRVIITMPEKMSHEKQVVLEALGATIYRTPESHISLAKRLNQEIPNSYILDQYSNAENPDIHYQTTGQEILDDMGENLSMVVMGVGTGGTIIGVAKKLKEVNPSIQIIGVDPIGSILGGGDNNLIDEYIKINDKDSFLMARRLIREEGLLVGGSSGSAVWAACQAAQRLKEGERCLVILPDAIRNYLTKFVDDAWMKAQGFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cystathionine beta-synthase
publication title Crystal Structure of a Putative Cystathionine beta-Synthase from Coxiella burnetii
rcsb
source organism Coxiella burnetii
molecule tags Lyase
total genus 99
structure length 288
sequence length 316
ec nomenclature ec 4.2.1.22: Cystathionine beta-synthase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ofxA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ofxA02
1WBJB 1J0EA 5B3AA 3IAUA 2TSYB 4Y6GB 5I6DA 5B55A 1K8XB 2RKBA 1Z7YA 5B1IA 1KFKB 2EGUA 5I7WA 2ZSJA 4L28A 5DBHX 2ZR8A 1F2DA 4D9BA 1K8YB 1WTCA 4ZQCB 5EY5B 5T6MA 1C9DB 4WX2B 1K7EB 5B53A 1A5SB 1O58A 5DVZA 5I7HA 5E0KB 2GN1A 5BW6B 2Q3DA 2V03A 2J9XB 3IQGX 4LI3X 3SPXA 3VC3A 2ECOA 2Q3BA 1A50B 1KL7A 1VE1A 1WDWB 1KFJB 2CLKB 1A5BB 3HMKA 3L6RA 1X1QA 1C8VB 3RR2A 4D8UA 5IWCA 1QOQB 1M54A 1WKVA 2C2GA 2D1FA 4D9EA 4L27A 1TJPB 2TRSB 1K7XB 3IQHX 5DW3A 1TZJA 1FUYB 3FGPA 2ZPUA 1Z7WA 3X43A 1TZMA 2RHGB 1K3UB 1E5XA 2CLHB 2RH9B 4KKXB 5DW0A 4D9FA 5IXJA 4D9KA 4JBNA 4D9IA 3AEXA 3L6CA 5KZMB 5IW8A 4HPJB 4NU8X 5CVCA 5D85A 5I7AA 4D8WA 5C3UA 2PQMA 1KFCB 1P5JA 1TTPB 2BHSA 4LMBA 4HN4B 4PCUA 2GN2A 1K7FB 3IQIX 2J9YB 4I1YA 1D6SA 2ECQA 2ISQA 1FCJA 2BHTA 3VSAA 2CLIB 4D9NA 3VSDA 1RQXA 1TYZA 2O2EA 4D92A 4D9GA 4HPXB 1V71A 3DWIA 5B36A 4AECA 1BEUB 1JBQA 3PC3A 1UIMA 5JISA 1CW2B 4L3VA 4OREX 1BKSB 1CX9B 1V7CA 1OASA 4HT3B 3DKIA 4COOA 5KINB 3PR2B 2CLFB 1PWEA 5CGQB 3SS7X 4D97A 4D99A 1TDJA 4D8TA 4D9CA 1PWHA 2TYSB 1UINA 4QYSA 3DWGA 2CLOB 2Q3CA 4D96A 2O2JA 5DBEX 4ZU6X 1VE5A 2J9ZB 3VSCA 4LMAA 2GN0A 1UBSB 3ZEIA 2EFYA 4D9MA 1Y7LA 3VBEA 2DH6A 4ZU1X 5J5VA 5I7OA 4H27A 3X44A 4AIRA 4L0DA 1KFBB 4NEGA 2C2BA 1QOPB 5I7RA 4OFXA 3T4PA 3R0XA 3SS9X 3FCAA 3AEYA 2WSYB 4HO1X 5JJCA 1J0CA 4F4FA 4JBLA 1VB3A 1TZKA 1J0AA 1J0DA 1C29B 1KFEB 3V7NA 2JC3A 4IL5A 3L6BA 2CLLB 1TZ2A 1K8ZB 5J43A 3BM5A 5D86A 3TBHA 4XUGB 3R0ZA 2CLMB 5B1HA 2CLEB 3PC4A 3PC2A 5HBGA 1V8ZA 2DH5A 3CEPB 5D87A 1A5AB 1TTQB 5D84A 1J0BA
chains in the Genus database with same CATH superfamily
1IZ8A 5DGTA 3K70D 1D09A 3KZOA 4PYQA 3I28A 4H7HA 4DLSA 1C1HA 1DFIA 3BMQA 3QF7A 4MUXA 2FUKA 2X9VA 1DINA 3LD9A 2EP8A 5HX7A 3O1JC 4BE4A 1LK0A 4HBZA 4R8SA 3M49A 3MMNA 4WXEA 4K8OA 3W6UA 4A91A 3ZGXA 1YE5A 5DX1A 4QUHA 2O19A 3HYTA 1UWVA 3TI7A 2NZUG 4N65A 4DA7A 4BNNA 2F8MA 5HZKA 3S2GA 3OIFA 3LRPA 3ROQA 2J0UB 1ZZEA 1UM9B 3VH4A 3MJVA 4URYR 2CCJA 2XMZA 1XHEA 1BH2A 2ZP1A 3AP1A 3QYFA 3CRZA 2GAJA 2QX8A 2Z1NA 2VNSA 4LV6A 4Z4HA 4NPAA 1RXEA 1JSXA 3FF4A 4KQEA 3SC2A 3DDCA 1XDZA 4DBZA 3T4EA 3VPSA 2O8CA 5DHUA 2ERXA 1GG9A 1QUEA 2ZUTA 5ARCA 1TXGA 1OXMA 2VAXA 5IJAA 1TAHA 2AOVA 3KOZA 4MQMA 4A5OA 2PU5A 4LJ7A 2QRVB 2B4AA 3RADC 4R1NA 3THYA 1M6VA 3M3HA 4N0QA 3S8YA 3EZ7A 1QNLA 2I65A 4KYIB 4UXHA 1T36A 2BGIA 2CMGA 2GJ4A 1EWRA 3H8VA 4HV4A 4LJRA 2Q3MA 1A9XA 2YMPA 1NC1A 1QCZA 2HQBA 3W06A 1UPUA 3C3XA 4E2XA 4Z4IA 3QVXA 4JQSA 1GFZA 3CJRA 2ZSAA 1D4OA 1EFKA 4GR4A 3QX8A 1JFSA 3AFNA 1Y4ZA 4G67A 1U63A 5KTNA 2PMDA 1KEWA 1FJ2A 4U7GA 2W58A 5F77A 4XKJA 5SZKB 3UBTA 2BSQA 3CU5A 1YQEA 3MD9A 4BFXA 3VKGA 4I8IA 1VL2A 4XQGA 2V45A 3ZE1B 4H6PA 4Q48A 2HHHB 3AERB 4R40A 5F52A 1UC9A 2IV7A 5AVTA 1NQXA 1L7DA 4Z8YA 5E38A 2CZGA 5IKPA 5F64A 3V2HA 3WNDA 3UNXA 3EXHB 1IHDA 2BBSA 4XQEA 2EATA 2IUEA 4ND2A 1W48A 3TXYA 2MYTA 4YUAA 3Q98A 2QZ9A 4CDGA 7AT1A 3QBEA 1S4QA 4F6CA 5IDXA 4B3IA 2C4UA 2KBFA 3GEPA 5IEJA 5L3VA 4KAJA 5LQNA 4DUZB 1EVLA 3LWNA 3OZ7A 2G1PA 2AVNA 5EC8A 1P44A 4MVJD 3R77A 3VBEA 4B6EA 5FBVB 2PKXA 2G71A 1V41E 5IPFA 4LJ5A 1PZXA 3WGOA 2GBPA 2IK8A 1VE6A 2FJ0A 3RTDA 5DXJA 5I7RA 5LP6F 1ZM2A 1XTUA 1PKEA 1OVGA 2VA8A 5REQA 4GOLD 3VR3D 2IOFK 1GNPA 1U0NA 2PY6A 1DQPA 4R8VA 3B5JA 3LL4A 2YZKA 4BO2A 2OV2A 1FL9A 1SKBA 1JHDA 3ASUA 4X92A 3ICPA 1WXIA 4BNMA 4EHKA 1JMKC 4U02A 3KC2A 1FP2A 1K8ZB 3AR7A 1RWQA 2NSHA 3PGVA 3KQQA 5IKMA 4FN5A 1TD9A 5D3ZA 2ZRLA 5E7MA 5BV7A 2BKVA 4HFJA 1TF2A 3CNNA 3C5VA 2NU9A 2G5GX 1XTBA 4Q7KA 1EAYA 3C4QA 4JVLA 5ALFA 3VUFA 2R7MA 3DLAA 4Y7DA 1SXIA 5BWOA 4IR7A 3H84A 4UKDA 1XMQB 1T1GA 4XD7D 5AVVA 4KOAA 4KXMA 2IYYA 4Q15A 1O03A 4QKQA 1BWRA 5AJUA 2XCQA 4UTXA 3E4DA 2FU5C 4KQGA 4U5QA 2LUOA 4B3TB 2FMFA 4BCDA 1LW6E 2RC5A 1A5ZA 1FRFS 4LVCA 5LBUA 1BDIA 5EFOA 1B3RA 5L51A 4TVKA 3U9SA 1A27A 1S9HA 1E1KA 1V8FA 2C9DA 4ZVRA 1OUMA 3ROPA 3WYNA 5TLSA 2J87A 5HXAA 3A37A 3LMKA 1LWOA 3K8ZA 5EJ2A 3VOBA 3ZE7A 4I1VA 3ZV5A 4LF9B 1NN0A 3LA6A 1UWLA 3SBEA 4D8UA 4BP9A 1V37A 4HRAA 4U6NA 2OM2A 2ZIVB 2FFHA 1S3FA 3A6HA 3N7UA 1E66A 1UT5A 4JAVC 3WP0A 4UD6A 1LLFA 3KBBA 2J4CA 3M6IA 1MT0A 4EG0A 3L7KA 1R50A 1VIDA 4L0MA 4MW2A 4HNHA 1SU8A 4ME6A 1T8PA 3AUKA 3VO1A 2GWRA 3W7BA 3QEMA 1KH2A 1YQXA 5KAPA 4YDQA 1E5DA 4EHJA 3A58B 1XK7A 1QZ3A 3ZZ0A 2JHCA 5AYVA 3N8KA 2I2CA 3WK5A 3DBVO 3CXUA 3ETLA 4D6PA 2AMLA 3WWYA 3U6BA 3P2KA 2IPAB 4RGQA 3GLGE 2PEZA 3OIDA 2H11A 5AOAA 2M9MA 1T5SA 2OPBA 4I2VA 4RA6B 4TXLA 1GCAA 2HBRA 1G20B 1KK2A 3JQBC 3NUQA 4JLVA 1SN7A 1IVSA 5CLQA 2KW5A 3ZIUA 3ZLVA 1CDEA 5C32A 3L7NA 4Q7EA 1YS6A 2CLFB 4WA7A 4IUDS 1U1EA 5JZOA 3HVUA 1EA7A 3GRAA 4KQHA 4GKKB 5HCNA 1J2RA 3JQGB 4PHCA 1S2NA 4K6HA 4TV8B 2OLEA 2V6MA 3L82B 1BCSA 4OLFA 3QFFA 2VJKA 3P2EA 4Y18A 2W2LD 4N0EA 3JQ6A 1V4NA 4L73A 5IC5A 2DJ5A 3EZLA 1YRLA 5F2EA 3F74A 1GKLA 2FSIA 1PJSA 3O9VA 1O5IA 3VR0A 4B7XA 1J25A 4QWWA 4ZYTA 1M0SA 1MJFA 3MYYA 2CJFA 3OZRA 3IR5A 1IUNA 3A25A 1ZNWA 1JR2A 2AC4A 5TGDA 1BSVA 1FRVA 4MUYA 3SZOA 3ZQ4A 5IK2A 3FW1A 1D1TA 2BD0A 2IUFA 1COWA 2WHEA 3T5DA 4F4FA 1M0TA 3I0ZA 3KKPA 4P5PA 4XUDA 3GCXA 4AIIA 2AW3A 2YJNA 1OX6A 3CLVA 3GW8A 2IEGA 4BE9A 4GECA 2O8EA 3BCRA 3BM5A 3AF0A 2ZYGA 3NKFA 4R0NA 2HMWA 5D86A 1YHZA 1O0BA 4PXYA 2X9NA 4JEUA 4H0CA 1PJTA 1KORA 4UATA 2GCOA 3UGTA 1Z07A 3ORFA 4G1UC 5EXEA 2VPTA 3Q0EA 1H8EA 4W1PA 2GMWA 2GN6A 2GDJA 1LK5A 1MQAA 4R8MA 1C1DB 1JKJA 1JT9A 1YZFA 5AJTA 1MX5A 3OPYB 2FR8A 3CZQA 1XRSB 3IEIA 4K9PA 3ETHA 1UPBA 4J3NA 1HYQA 2W83A 3IODA 3CGGA 1RSZA 3PGKA 4IIBA 3GWGA 3HZZA 4XW2A 5HP4A 2HGSA 4QASA 3LVFO 2AR0A 4N6GA 3CCCA 5LNK1 1FXWF 2AMJA 3A7EA 2QVZX 3PXCX 4WV3A 3W5HA 3C70A 3TW8B 1NZDA 1NKTA 2GTPA 2VHCA 2A9PA 3AFGA 1U9YA 3EXFB 1VI5A 3IPRA 4MQFB 3SKXA 2HIGA 3IAHA 4HFMA 3ZBUA 2QJWA 5JDIC 5JFGA 3B36A 1S7CA 4ER0A 1WETA 2KJQA 5AOCA 1TYCA 5TPWB 1C0EA 5F5LA 4E08A 4G5HA 1P0FA 3M3PA 1G5QA 2JAUA 1YTUA 4MEJA 1CUIA 3H1BA 3DB2A 2GCEA 4BCCA 1JHXA 2B69A 5A62A 2BGKA 2D1FA 2E4VA 3ANTA 3GEBA 3VR4A 1J49A 1KAMA 1G6OA 2A88A 4IIDA 5KYUB 1J06A 4KZKA 2NZ8A 4P8RA 5FL3A 1CUCA 4JCOA 4IIUA 4HNSA 4OH1A 3ZY3A 1JAXA 1XKTA 1NNSA 5ADUS 3ZDDA 5ADVA 1GCGA 2D4HA 1ZRNA 4O2AB 4C5BA 5LOVF 2IXEA 4DMLA 5D5PA 1GNLA 3M6FA 3RUAA 4JFAA 3I01M 2APJA 1PFGA 2W2KA 1QG4A 1F38A 4Y6PA 2BKAA 2VJCA 5L3QA 3UT5B 4AG3A 5B58C 2WE7A 2PKYX 1V6AA 3F5DA 3PUXA 1RHRA 2BOVA 2YWGA 1HQDA 4GMFA 1FFAA 4ZT6A 2C95A 3UJ8A 1CE8A 3AJEA 1EK1A 2CK3D 4CE6A 5KTYA 3AW9A 3DKIA 2ADMA 1XL0A 4TWAA 1E79A 4HWKA 4AUMA 2AK2A 2Q1YA 2PVSA 4JB3A 4M9XA 4CT5A 2QUIA 4EFDA 1QP0A 1MH1A 4NCNA 2HCBA 2CEKA 4FJ0A 4IIYA 2BTQA 1QONA 1Y5MA 4I55B 4P9NA 5A3VA 4F2GA 2ZUCA 2B2NA 5EJ6A 1DT5A 5LYJA 4BAZA 1NJ6A 2EWWA 3M34A 2XUZA 4LPKA 3V3KA 2B0CA 1M2WA 1T9GS 3W2IA 3EASA 4QEKA 5CLFA 4TZ6A 4Y6RA 1U0JA 1RTKA 1ZD9A 1ZJWA 1W0CA 1LSOA 5MFPA 4M99A 2DH6A 4UMEA 4EUSA 3UK1A 1LJUA 1QS0A 3MNFA 2F7SA 4R81A 1R0WA 2JJ8A 3IMKA 1KBOA 3SNKA 2NVWA 3DEZA 4YRQA 5KNDA 4S2EA 2D3TA 3ZXIA 1S3SA 4EKNB 3J7AC 3U17A 2WR8A 3HXPA 4XX1A 1ZIOA 2H1LA 2GJ8A 1NFRA 4EKGA 3E8MA 3G13A 5LKAA 2V7PA 2VAVA 4AZVA 2NAFA 3DMRA 1IB6A 2DUNA 4HWOA 4MLPA 4ARBA 5H59A 4TTSA 1GN8A 3VZBA 3NW9A 3GR6A 4EAAA 2O54A 4E46A 3ZX4A 1FUUA 4JI4B 1F4PA 3IKJA 3NQ41 3TSOA 4WNAB 1K3TA 4PNPA 1GYQA 1ZSYA 5ULLA 5K0LA 4EW6A 3BICA 2ZRHA 4Q3CA 2OQIA 2PJRA 3NALA 4EPTA 1K8XB 1N2JA 1EGAA 3RPEA 4EF4A 2H0QA 4R71A 5DHRA 4C3VA 1SUBA 3AY6A 3E7FA 2ZSJA 3BRWD 3CJTA 4OHOA 3AC0A 2YMLA 4ZZIA 4P0QB 3BIWA 3MCAA 4J29A 1GYPA 5D5QA 3BL8A 1XDWA 2YHAA 3WLQA 5BNTA 2VJPA 1XRRA 3NEAA 4QVGA 3OPQA 2I4OA 2OC9A 2PL5A 4GGPA 1YBVA 5JAUA 4R9VA 3ZVMA 2BR4A 1SNYA 3QYAA 3C3WA 4Y7CA 3UAXA 3RABA 2XTMA 1WJGA 1NQOA 2PQ0A 2ZDHA 4POOA 5CITA 5I9LA 1L5VA 3SCZA 1RW4A 2G36A 4W8GA 2O7NA 3D0KA 2Q6IA 4YJGA 4DTCA 1IB0A 2MT9A 4BO0A 4WOPA 1FSFA 2FTKE 1OU4A 1VBKA 4EX6A 2HFJA 2ONJA 3RTBA 3NHMA 4GOOD 2J8ZA 1XU7A 2MSKA 2NUPA 5JNRA 4DV0B 2PMFA 2XJ9A 3K1AB 5A1JA 1GFWA 2VF5X 1WPGA 2GA9A 1LBTA 4U2KA 1MX9A 3W2EA 4B40A 3M4XA 4WEOA 2BUAA 3L3BA 5IF3A 1JU4A 4XIYA 1AZWA 4S0XA 4M0PA 4Z3DA 2XZOA 1M9NA 4RLQA 2HYIC 1BNCA 1KJJA 3DE5X 1O94A 2NP7A 2WU8A 2NU8B 2VAMA 3LFHA 4Z7QB 1BFKA 3Q9LA 3WIUA 1J6UA 4MDEA 1A2OA 4RH0A 4ZAFA 1PNTA 3MERA 3THOA 4WBNB 3D7LA 3R4CA 4JXJA 5IU6A 4WAUA 3WIOA 1NXQA 3WBJA 1CR6A 3B9QA 3JPWA 4DZRA 4OJYA 3UKOA 1EE1A 1H2WA 4MCJA 3H42B 4ZIRB 1LS6A 4J3JA 4Z7NB 4MYUA 2VNHA 3NRJA 2QD1A 2Y2VA 3FWNA 3HB5X 4UNPA 3RC9A 4RA9B 3SIRA 4CIXA 4JC5A 3K6RA 4DPMA 3L07A 2R5WA 2BW0A 1CUFA 5BRAA 2ZB3A 1KSGA 2G77B 2HJ9A 1Z63A 1ZK4A 1FLVA 2EBFX 4X97A 4CDNA 1RXVA 3ASYA 4TSFA 2QVXX 5AW6A 4GMDA 3RUFA 3LT0A 4J90A 3CGWA 4GOND 2ZREA 3ADDA 3M1IA 5DHQA 1IZ7A 1CR4A 2J3QA 3A4YA 4WLUA 2A58A 4WXHA 1JIIA 5AXAA 5IC6A 1N2EA 3G0HA 1W49A 3S1AB 1TPZA 1KFBB 3B82A 2REBA 5FP0A 2PNJA 5IT5A 4W5WA 3SX4A 3RYCB 2CNOA 2WFLA 2FDRA 1VLHA 4K6CA 1I2MA 2AE2A 3C7KA 2ZSIA 2Y76A 5I9SA 3IUYA 1U11A 1PQ4A 2V9ZA 5LBIA 3SZGA 1DV2A 3D7NA 3HLYA 5F4BA 3U62A 2FXIA 4X1IB 2J3HA 1BIFA 3R6DA 4L5IA 3H9JA 3IVCA 2QMEA 4QPDA 1S3GA 3RYIA 4DADA 3ZNNA 3U1BA 2Q5HA 4W5RA 4CEIB 4V1CB 1QGZA 3CUEF 2A0WA 3OQJA 3NXKA 4Q1AA 5KU1A 1ABEA 1GUYA 2OC4A 3K2BA 3LQ2A 5BSGA 1W5AA 1VJ5A 2OK7A 1Y7HA 4XVHA 4B71A 4R1QA 5TDHA 2JJYA 4RCZA 2F48A 3DULA 3W9SA 4AX4A 2ZT6A 1U4OA 1BU5A 3ISVA 1I24A 4OF4A 4FUQA 4F85A 1FDWA 5A04A 3FPLA 1RE1A 4ZO7A 5B3AA 4EI9A 4FEGA 5IP5A 3W6OA 1US8A 1OH8A 3FD8A 4RY2A 2IRWA 4DLBA 1Z0ZA 4Z4CA 2IOFA 3TF5A 4Y3UA 3P2IA 1B3BA 2W5UA 3H8SA 2QQ5A 3C85A 5JCOC 4WK4B 1ZN7A 4MV8A 4L76A 1IRXA 4PO8A 4X84A 2XUAA 1VKRA 5KS2A 4M53A 4QHTA 3G17A 1OPRA 2G09A 1E3LA 4DWWA 1FU7A 1KSFX 2ORWA 3S27A 1PEDA 4NFLA 4RHUA 4KLRA 5BQPA 1HMYA 3C3JA 4DC1A 3E9CA 4NPCA 1E9VA 4OUDA 4XYBA 5JAIA 3EOBI 1MBZA 4FFBA 2ZJ2A 2ZYUX 3OQOA 1UJ4A 4ACAA 3A26A 4DJFC 4UM8B 4E5NA 1JQLB 3U7RA 2BEVB 2ZE5A 3OZDA 5DRYA 4L9WA 3T3EA 4DJTA 1ML3A 4WGFA 5DE3A 3FOFC 4CDRA 1RQGA 4EO9A 1E2EA 4GGMX 4H1HA 4HPWA 5J4HA 3GQBB 4J8PA 3C45A 4OHFA 4KW7A 4MINA 3RKUA 2AWOA 3ZNQA 1CETA 1E7YA 4BVBA 2J07A 1L7QA 2RH9B 2A9OA 1TM5E 3KKOA 1H69A 3U4QB 2UUAB 4WZ6A 3WB2A 3WJ1A 1TVMA 2WTAA 1VLMA 2ZR9A 3HBLA 5CVCA 5F51A 5E8JA 4B83A 1U8ZA 2PZJA 1KOJA 5TE9A 2RHBA 3GELA 3OD1A 3VNQA 5JMWA 2UDPA 1P18A 4WASA 4C4TA 1D2MA 4LRTB 1P72A 4F2DA 5FD8A 1BEUB 1VDMA 5HM8A 2KX7A 4MWZA 2ADOA 1G8MA 3A6GA 3AJAA 3M6WA 3LV8A 2QE7A 4PYOA 4BLWA 1FFHA 4FX2A 1L4MA 1UWKA 3WMGA 4LQDA 4MV4A 1GG8A 1E9RA 3X1YA 5JT1A 4MKRA 4TXHA 4CQMB 1NRJB 3BQNB 5EJMA 4INJA 4RY8A 5IXSA 5BMOA 1EMDA 4RQBA 4MW4A 2XYGA 3GQVA 4ENTA 4FR2A 1HURA 1WCWA 3FAZA 2A2ZA 4LQ4A 4EABA 1K98A 1KO8A 2EX1A 4Q34A 4DQKA 4F72A 3ZHYA 5IWAB 1J1ZA 4CIDA 4PLWA 2R1TA 3OQIA 4N1AA 1OLUB 2RCYA 2WZDA 4FT2A 2O4CA 3REQA 2J3KA 1X3SA 1U7DA 4CZ2A 3KEQA 1SXGA 4HNUA 3HCEA 1W9HA 2WT4A 2VO1A 4JBXA 5FUYA 3TEFA 2HKIA 5DTMA 2X7JA 3OUTA 1V16A 3UQZA 3ZKWA 5HKKD 3ZXSA 4GC9A 4ZEWA 1J1IA 1G63A 2OAEA 1KOLA 3STUA 4MHSA 3RVJA 4RDCA 1DQZA 2OBMA 1XF9A 1K88A 2YJTD 2ZUDA 3ND8A 4QVKA 1CUYA 2ECPA 5JARA 2Q50A 3LCVB 2HV8A 1NYTA 3QH4A 1GXSB 4NH0A 3OIGA 4IPTA 4J03A 1CZRA 3W2TA 5U1PA 5CPFA 4GDFA 4HDAA 5LIPA 3LNCA 4LZNA 1KH1A 2IYWA 4U6SA 3O38A 2YV1A 4Q3EA 4EMSA 1OR8A 1TYBE 1ZD1A 4X45A 4DUGD 2PUTA 1GQYA 3L40A 4PZPA 1AA6A 4QQNA 1X1TA 1UT8A 2J3LA 4XPIA 1H65A 4H31A 1E2JA 4GLFA 3BMCA 2Q6TA 3R6TA 2NSLA 4ZTUB 2Z2IA 1HT3A 3MJDA 5DV9A 1KJYA 3B70A 4W5NA 5FBHA 4KK3A 1PCXA 1YL7A 2FE4A 2Y99A 3TYXA 2G1AA 1YA8A 4LY6A 1L4LA 2FPSA 3JQBA 3JYPA 3NKVA 2RSLA 3NI2A 2XUFA 4J0KA 5EIBC 3B8HA 5T67A 1NW5A 4EPWA 1DEOA 3CY6A 1YNOA 2QG4A 4I6GA 1G59A 2VDRB 3LLCA 1XZEA 5EVJA 1KVSA 3KSAC 3LBYA 1G6Q1 4LXUA 3VU3A 1ZUNB 2VHZA 1AN9A 3OFKA 4OQLA 4EB6A 1EK6A 3UJ7A 1Y1PA 1VMAA 4G41A 1U8YA 3GDFA 4RUKA 4ZC1A 2O7SA 3FY4A 4FYIA 2G7MC 3GUCA 3P9RA 1YMQA 1OA1A 4MAAA 1NVKA 3HY4A 1IIRA 1NATA 1YZGA 4GOXA 1H3EA 5G40A 3RRXA 2LWIA 1JEAA 1PVVA 3Q7TA 4HLQB 4DCGA 1KO5A 2F3RA 5K8VA 3KOMA 2V8OA 3D7MA 4NOLA 1NXOA 7REQB 4Q39A 4JI2B 3CZ5A 3GVPA 3MB8A 1MG0A 2XKKA 3RIXA 2GRUA 4EHLA 9ABPA 2G9UA 4BVGA 1AD2A 1GTZA 5BVGA 3MQ4A 4PLTA 2VJDA 4RQAA 3RU2A 4EECA 4MB2A 4BKQA 4DLLA 2R66A 2XA2A 3OFVA 4ZAZA 5F76A 1P81A 2BY4A 2P9BA 4CI9A 4KNWA 5LMZA 5HK8A 3IBGA 4F8JA 2F00A 4XX0B 2XT0A 2LD4A 5H3CA 4WPGA 4BQFA 1MOZA 3SX0A 3K35A 5A9RA 3QIAA 4PYIA 3UICA 3VJMA 5DLDA 1I0LA 1R6AA 1X6VA 2DQZA 2AXPA 3V4VB 4NBSA 3AY0A 4HDOB 4GOKA 3B78A 5LPNA 3ZHCA 3ESCA 1YKGA 2V1XA 3FZGA 3GH1A 4HX2A 5CUQA 5TMDA 3VHXA 2H48A 3ND9A 1N4DA 1HETA 2W6IA 3QTBA 3KCNA 5AK4A 4F91B 5T6BA 3CVVA 3D5EA 1QYVA 2E5FA 3RU7A 3AXSA 3GRCA 1C9NA 2DVMA 5KNCA 5JDIA 3JD0A 1CTQA 1CZOA 1GPLA 3PDJA 5DT9A 3BA1A 3KTAB 4KC0A 4EY8A 3FVTA 3AVPA 1YA6A 1YZVA 1ECCA 2B21A 2FW7A 3TQHA 3OFND 4KWIA 2LTAA 3QXXA 1OKKA 2ZATA 3H4IA 1FNMA 4DB2A 1TCCA 1WCYA 2ZBPA 1BKYA 1D1PA 1RZ3A 3W04A 2W4IA 1NP3A 4JJKA 4NBUA 1DO8A 2EC5A 4JYMA 2AT1A 1F06A 4EJSB 1GNRA 1UDAA 3KZNA 1XJCA 1ETHA 3FNRA 4HLDA 4G01B 3IAXA 4OHPA 1MB4A 1JF8A 2CLMB 1QGYA 2OVFA 3I9MA 4TSRA 1OB5A 4QUEA 1Q0PA 5CX4A 2ZUEA 4IDAA 3V8VA 1F8FA 2NWQA 2J46A 1JHZA 5EHNA 3FDFA 4LECA 1A7JA 1IHPA 3N0RA 1OBCA 1ZRMA 3SJAA 1OFTA 3JV7A 2WF8A 1SBHA 4HRYA 3Q3CA 1AKNA 1H2RS 4BL5A 3O21A 2WJPA 4G4SP 4WT7A 3TLEA 3C7AA 3CIOA 2WUFA 3K9CA 4I0WB 4HADA 1VJGA 4JQCA 4PPFA 1YBHA 1RXSA 2YZNA 4CQNA 3LL7A 4YS6A 4P4UA 4QUKA 3UMGA 1EXDA 1S6YA 1YOBA 1GTSA 3WKCA 3FZYA 4MYRA 3H2HA 4V2IA 1Z4IA 4OQQA 4QATA 3SAJA 5IBCA 5EKUA 3A1VA 5LVAA 3BBPA 3SOZA 3ST7A 1BW9B 1BXKA 2GXQA 4JUIA 4K9DA 4LZJA 4BVFA 3DVAA 5L53A 1CUBA 2O0HA 1BEEA 1M3SA 3UHPA 3OOEA 4YJDA 2CXOA 2C3MA 4LHWA 4EUEA 1ZH8A 1X77A 2V6IA 1U90A 3PGXA 5AI4A 4II7A 5EINA 1M2JA 3PCXA 1T4GA 5FEMA 3A1UA 5T5QA 4G8BA 4IGKA 4UEJA 2WZQA 2HADA 4URWR 5AHXA 3MOSA 1UBJS 2DX7A 2JI4A 3PD0A 4E09A 2JLQA 4QO7A 2D3WA 2WTNA 2IIQA 1FFWA 2BSXA 2FOLA 1X74A 3E03A 4OQPA 4D8WA 2VRBA 2NV2B 3A3KA 5E4YA 3VZRA 3LQYA 3Q3HA 3ETDA 5FHQA 4BGDA 2GKGA 2YV3A 4I81A 2IIVA 1R00A 4ZTZB 1U3WA 4L0QA 1A97A 5LZ9A 1RQXA 3GGDA 3MUOA 4FCWA 4OV6B 4PZYA 3NUGA 4YR7A 5IVHA 4P5DA 5ALDA 4P32A 2JFVA 4F9TA 1JDBC 4X8MA 3IEVA 4OREX 2FGKA 3AF5A 1G19A 2VYVA 1E3WB 1JMYA 1LV7A 1ELOA 3GJZA 3ETEA 2VP5A 1D03A 2NXJA 1V8OA 4OHZA 4IHJA 1X7XA 3QKSB 1EQAA 2VZ9A 3W3AA 2VDWB 2XNCA 4QWMA 1G291 2O2JA 4BJ6A 1R8YA 3IKVA 1VIAA 1O5TA 3M82A 5AMXA 5EWLA 5FOWA 2J45A 2GD0A 4IP0A 1Y63A 3TPZA 4A03A 3DXFA 1L4FA 3L06A 4PRLA 3ZK8A 1E7QA 2ZYWX 1UDCA 3IOYA 3SF8A 3SEQA 5B6IA 1Z25A 4IRMA 1G8PA 1ZU5A 2X4DA 4OQMA 5JNUA 1RXWA 4B33A 1JSZA 2H1FA 2WNIA 3EA5A 3ORRA 4A9AA 5HQ3A 3T1NA 2Y1FA 3WL6A 4L50A 3VI3B 3EEBA 2ZQ5A 3RI3A 3GLGA 3QVGB 3ANYB 1GQRA 1ULZA 2PSFA 2H54A 3IPCA 5JG7A 1MT3A 1DPFA 1Z7EA 4KPUA 5AHRA 3ZHVA 1E4YA 3B13B 1OBVA 2HO5A 5CJJA 1EVZA 1V6CA 1J0DA 2P7IA 3CT6A 1WM1A 3QKWA 4L9SA 4EO4A 3PBKA 1G66A 3GV0A 1AA9A 2JHFA 1UXGA 1P19A 4GI5A 3N2KA 2WP0A 2IHNA 2GXSA 1E59A 3L02A 2TS1A 2YKGA 3PUZA 1HFKA 3HBFA 4MQ5A 3O73A 3AWIA 4HDNA 2C9YA 1T8RA 4G4GA 4N3AA 5CB4A 3LXMA 1JBEA 2PT9A 3UCFA 3DUFA 5CLIA 3R5FA 3O8CA 1DBQA 3S44A 4G37A 2B92A 4TTAA 5A3QA 2O8FB 3O94A 4BN0A 1RPTA 2EERA 3NDJA 4DLXA 3ABRB 1ZD2P 3EC7A 5TMPA 4H4CA 2VDKB 1I0ZA 1ZXBA 1CEQA 4U3JB 3Q8LA 5CNJA 2PZFA 4L08A 4FD3A 2PXAA 4DJ5X 1FSGA 3RHSA 1FYWA 1C7JA 2JCSA 2J9XB 2UVDA 2FRDC 2W2MA 3AEZA 3CKMA 4LV8B 4QU8A 4RGBA 5BSFA 5DNVA 3VOSA 3CBQA 1VE1A 3FGZA 3KZ1E 1KA9H 5C52B 1FTYA 3AK4A 5THKA 3GK3A 1EVQA 2ZJ0A 2GNAA 3CC8A 4RJ2A 2JH9A 3PWSA 4YLGA 1KO1A 5CG2A 4G1CA 5DOVA 1Q12A 1TEVA 1ATIA 3CRQA 3I37X 1KI6A 1PT8A 4N9WA 4NZ9A 5ALKA 4PG5A 1K2WA 4EY3A 3K0SA 1PSDA 4M0MA 1ZGAA 2W2TA 1E4EA 3AF4A 3G5AA 1Q3KA 3IC5A 1XZNA 4LA4A 4MJ7A 1XZGA 4NFHA 3JAWB 3W4KA 3D0QA 1R0ZA 3NATA 3COPA 2O14A 1EJ2A 3H16A 3LK6A 2ERCA 3GYGA 4UASA 2Y27A 3LT2A 4PYRA 4BFUA 4HYQA 3AQ4A 2CVOA 4IHKA 4Q03A 3OSZA 5EMMA 5FXMA 3TCXB 1YRBA 3TK1A 3HUEA 3TLGB 4QOJA 2R1UA 2QPLA 2E89A 1T9HA 3CZPA 3TZHA 3UXEA 4NBTA 2RGDA 4O4JF 1G8GA 3UWSA 4RD3A 2QT0A 3HNRA 3L1KA 3ZE9A 1WQ4A 3QLTA 4KE9A 2OQRA 1T24A 3CR7A 1UJ2A 1JNYA 1K68A 1T0HB 2WM9B 2XUDA 4FFOA 2DPHA 4XSVA 4HH1A 1G7CA 5F35A 4JFRA 2NW6A 4HP8A 1VSTA 2JZCA 4AMUA 1OH5A 2Q9AA 1Y5NA 4PG7A 3OEHA 3H7IA 4X44A 5KKAA 4M7WA 1JH9A 3IUQA 3NR2A 4CCSA 3LUBA 4WECA 3TGWA 1GUFA 4BJHB 1ZSVA 1G5HA 3LCRA 2A9JA 2V7WA 3NBKA 3OF5A 1D2NA 5JCOA 1JXQA 2ZS8A 4OY3A 1ZUIA 4O5AA 5FI1B 3D4NA 1GZ7A 3EISA 4ZPXA 1OBOA 1SEPA 3RWMB 2OGWA 4B2LA 1M75A 2F4NA 1U8EA 2CZQA 2I80A 3KR0A 9LDBA 2GCNA 2DERA 3THWB 3RS3A 3GUVA 3U7EB 2A1UA 4LSWA 1QKIA 1RLTA 3GPCA 1L0BA 2AZXA 1DI0A 4Y98A 2PPVA 2QRHA 3PNYA 4KAFA 2IPNA 1Z0AA 3IQFA 3K6KA 4UEWA 4WTOA 1DVRA 5E4FA 1XKXA 1ISRA 3F5QA 4NATA 3RH0A 2YHBA 1GKUB 1MEJA 2D62A 2P4SA 4NMMA 2IDJA 5CH8A 4EOGA 1NKSA 2V9PA 3KTOA 3PA6A 3D8HA 3FDIA 5DO9A 1WUJS 4HGRA 1ULAA 5GWXA 3MWEA 1G7SA 2IKQA 3AJDA 1QHXA 4P31A 4NESA 1P4JA 1QV7A 2HXYA 1LI7A 1DEAA 3H9CA 3KTFA 4G0QA 4HGZA 3AH8A 1HYGA 4NH4A 5EZYA 5BT8A 3LBAA 3LQQA 4HDMB 5IHXA 4B31A 4R1LA 1YS2X 1OV4A 2AJ8A 2R6DA 3I0NA 4NBVA 3SBDA 3ORYA 2WG0A 2J9GA 4LVOA 3H9GA 1YQDA 4OYRA 1XUOA 1A4RA 4Q16A 1T10A 1CJKC 2HRRA 3L7AA 4KR0A 2QN6A 1NAIA 3UKJA 2PN1A 4P4GA 3ZWAA 2AH5A 4AMBA 1GADO 5BPFA 4TUYB 4IVRA 4Z8XA 3VR6H 1TQ8A 3KOYA 2H3EA 4N8SA 3CV3A 4D9BA 4QLAA 5KNBA 4AF6A 1NULA 2R00C 2JGRA 1J2YA 1Y6QA 4MUIA 2RHDA 1IAQA 3F67A 1HUQA 2AG5A 3E6AA 3DL4A 2O1SA 2RB4A 2LXNA 3HCRA 1I30A 2Y1KA 4KIJA 1N8KA 2I67A 4JBGA 4PTYA 2P3SA 1EIWA 2ZI6A 2VYNA 2ARKA 4EM6A 1JA9A 4K05A 1GPMA 4N5IX 3S28A 1EUDB 1QH8A 2BFEA 4DWJA 4CKCA 5B7NA 2TMDA 4P54A 1X9HA 3O2QB 1Y8CA 4ENSA 2O57A 3GJ5A 4XYLA 2JZOA 4QFBA 3LZ6A 1NG9A 1Y7IA 2VTDA 2ZULA 1ES9A 1AUXA 1Z88A 4ZOAA 5CDFE 3GVIA 4QM6A 4MXDA 2QOEA 3WIVA 5D3MB 3DLPX 4I5IA 4ZVOA 4XWWA 1I7DA 3KAKA 5CB6A 1O08A 2CLHB 3QU4A 4AKTA 4D98A 1NM5C 2R5NA 4RHTA 3G9QA 5KCZA 1WZEA 2OHJA 2WG2A 5CYPA 1SC3A 4RS3A 5KHLB 3FNFA 5D85A 3BPSA 3GUHA 5A3RA 3GXBA 4MH0R 5D00A 4YONB 4HYEA 1AHPA 3FJYA 2MJLA 2ZB2A 3KE9A 4IS2A 4ZA2A 4BUJA 121PA 1YU6A 3IP1A 1PG5A 3KKNA 4JJZA 4MS1A 2CYBA 4U7PB 3VSDA 4AZ0B 4L74A 4DV1B 8ADHA 1HFJA 1MOPA 2RGYA 3HXMA 3BCUA 2Q4OA 5JQWA 3PQEA 5D7BA 1NF9A 2JK1A 3EZYA 5H83A 1Z4QA 2AXEA 3SM3A 1SPBS 4CWAA 3OZEA 4D3DA 4A4DA 4A1FA 4L4XA 2C98A 2YXNA 4WLEA 1UQUA 1MIHA 1XFDA 1YJAA 4TZKA 3W79A 2WSIA 3DWGA 1JSRA 1J99A 4PAWA 5IAKA 2BFWA 3ENKA 2NVUB 2BGJA 3ZYCA 2BGTA 1I2CA 2DRIA 1V9SA 3PEFA 4AM8A 1YFJA 3ZTWA 3AKDA 2CEAA 1NN1A 2XCTB 3DW1X 1HORA 2W2QA 1HSOA 1MAWA 2PX2A 4MO9A 2JDIA 4C7OA 1P0QA 1YI8A 2JFGA 3BXOA 3DOCA 3EHDA 2VOJA 3F3YA 1KYVA 1VMIA 3FPEA 4QBKA 2WILA 4ZXPA 3KQTA 1A9SA 3P9PA 1Y8QA 5E1DA 1Z2DA 4UXJA 4ZI2A 1LTKA 1Y48E 2Q28A 4Y0NA 4D25A 1ZVVA 2B8TA 1AKUA 2HPVA 1Z4PX 2FWPA 4TS9A 3INGA 2HSGA 4PVCA 2CDBA 5TQ0A 3ZY4A 4PC7A 4TM7A 1W46A 4X6XA 1KPIA 4RMIA 5NLLA 1YAHA 5BRJA 1A72A 4CIWA 4XAQA 5LA6F 1QRAA 1XXHA 1W47A 2FMUA 2XCLA 3AHFA 4MRNA 4XB6B 3COSA 1NY5A 2E9SA 3ZCUA 1U2ZA 2FEAA 1MFZA 1LDGA 1XZFA 2O2HA 4DDWA 3GPDG 1N33B 4K88A 1ODKA 5KSOA 3DP9A 2B61A 3L8EA 3GHHA 2REOA 1UJBA 2GHRA 4LF6B 2G9QA 5FOSA 2WJJA 4Y1FA 4MRVA 4KPFC 1NYLA 4PW0A 3U0VA 1Q7TA 1XELA 3IELA 1Z7YA 3KEGA 2XB8A 4G0NA 2LPMA 1NF2A 3FPCA 2VP0A 2QLFA 1I1OA 1JJ7A 1SQSA 2XHEA 1GDTA 1E92A 2MSEB 1AK9A 3JQAB 3PQ7A 3DQQA 1OJLA 2H9AA 5DYNA 5CURA 3ZU4A 2ZSUA 4C4ZA 4U9HS 2LCQA 4CKBA 4MARA 2B4TO 3ONWA 3CH7A 1ENZA 3X1MA 5BXQC 1NVBA 4HDKA 1P4GA 2GA8A 4O02B 5IG2A 4OA8A 3UIEA 2ET6A 2HK7A 1M2OB 3EAQA 5TARA 4BX8A 4BFWA 3M9WA 3OLZA 4JXKA 3UGKA 2FUNB 1TIKA 3O9MA 1NN3A 3ITEA 2JIDA 5JS6A 3G0IA 4Z3KA 1N78A 4MI6A 1YS4A 3U80A 4B6PA 4N7BA 4Y6OA 3WLHA 3MN1A 4EA6A 3UJNA 4FI3F 2VWQA 1K0UA 2IQ5A 5H82A 1NNI1 1F9EA 3DLCA 4L6IA 2OZLB 2JFZA 5IXYA 4HBGA 4C06A 1NVTA 4IOKA 1A96A 1UBUS 2IZOA 4ER7A 2Z43A 2PG3A 1XTTA 3BAFA 2JJMA 1XQVA 5EE3A 2CHQA 2QROA 2VSYA 2WHRA 5K6RA 4D9IA 3CT4A 4RZUA 1W93A 2C1XA 2G8NA 5HKBA 4JWKA 1Q21A 4I4CA 4PPNA 1DXQA 4MOWA 3T3HA 1Z39A 3HO8A 4IVNA 3TTUA 2NPOA 4I1YA 3USCS 2YBEA 4A0SA 4TMFA 1KY2A 3WMRA 4W8OA 3J81k 4QTYA 2YNMC 2G0NA 1YB5A 2PMBA 2YVUA 4EI2A 3QRWA 2PWBA 1JE0A 3LUJA 1JAYA 2PV7A 5KJEA 3PL1A 2EHDA 4JKOA 3WA6A 1RBQA 3GUUA 4BLSA 2BJWA 3HRHA 1S1CA 2DR2A 1BDBA 1GARA 3D6NB 3KSBC 3K15A 1KPHA 4DF3A 3H04A 2P8SA 4HQOA 4JCCA 4BX3A 1GEGA 2FJPA 3QWHA 4BNDA 4IZIA 2PX5A 1X86B 1RWNA 5LB4A 4OBXA 1GP2A 1PLKA 4YCJA 3IE0A 1NE2A 2F59A 4ZQGA 4YLYA 1NMYA 3SJ7A 1CQPA 2QJTA 3WRYC 1KXJA 4YJ2F 4EBBA 1G21E 2BFDB 4OK6A 1BKDR 2AR9A 5DM2A 4IUCS 2VF7A 3LM8A 3OQMA 3I2HA 4HJXA 2WJZB 1IEVA 4BC0A 4KRYA 2DMRA 3HDQA 4PC1A 1VJRA 4P7GA 5KWSA 2Z57A 1Q0SA 1TA0A 3T4XA 2PT7A 1GQFA 3LC2O 4OGLA 3ZXXA 1SOVA 1JEYA 3ZVKA 1DIOB 2QTTA 2XOKD 1OPXA 2WFZA 3JQAD 4J43A 1BVHA 2PLWA 4KN9S 2P9HA 3WHLA 3ESZA 1FSSA 1DMRA 3C6ZA 1QR2A 1DEKA 2HLNA 1UR5A 2F17A 4NZMA 5EQDA 4ANFA 2GCIA 1K4YA 4FNMA 1C9EA 4UCXA 3EEOA 3DFUA 4MQBA 2AJDA 2ZBFA 3GFOA 4P1ZA 1TIBA 1T6XA 4AO6A 1JLSA 1HLGA 1FJHA 1Z2PX 2R6CA 1DAOA 1F0NA 2ODBA 3L8FA 3MTEA 2W8BA 3PD7A 5D5HA 2H2HA 5F5XA 3WOHA 2VEDA 1ZM3A 5EJ5A 1DIAA 2JW5A 3UFXA 4F60A 2CVFA 2X2OA 2AFHB 1L7EA 1R6DA 1E18A 1W52X 1T4CA 4KMSA 2Q62A 5CA1F 2JJ2A 1IVNA 3GCZA 3HEAA 3KWJA 1GZ6A 1XNRB 4F6RB 2ZS7A 2O20A 4DQLA 5JVDA 1DOAA 3C1TA 3FSEA 4E5YA 3KB6A 1IBSA 3C15C 3JWHA 4BMPB 5T41A 1GTVA 1KYZA 2R96A 1H2ZA 1NW7A 1LPBB 1O6FA 2PPLA 2VHYA 2WG1A 4H1TA 4ND8B 1JR6A 1SXHA 2J0VA 5KOIA 5F9FA 2REQB 1H0KA 4IJ6A 1C9MA 1N75A 1QHSA 2VJAA 3MXOA 2E1PA 2G28A 1QLJA 1BDMA 2VEOA 3WL4A 4DCNA 1LQ2A 2NADA 2XGSA 3B85A 3PXAA 1JAZA 3OQPA 4X6YA 3SKVA 4PQRA 3X1XA 1W5SA 3A4IA 4KYVA 1PD0A 5AJWA 1T8YA 4DIKA 2NU7A 1UMBA 1A9PA 2C2GA 4GXQA 1A2QA 5ABPA 3PHJA 3ILYA 4IIGA 2ZPTX 3H9QA 2AQHA 1TZJA 1WVMA 5DDIP 1DUIA 1VZ3A 3G0GA 1M83A 2BN4A 3FYCA 5AQEA 4WIAA 4Q3LA 3CH5A 1TQ4A 4R31A 3JWGA 4UUNA 5I7EA 3FBGA 3LCUA 1EG2A 3RJ5A 2E7ZA 2W93A 1D1SA 3FMVA 3R5SA 1WSWA 1XCGB 1D8AA 1SK9A 2ZRBA 3CKKA 1M34B 3E5HA 4GRAA 4KE8A 4QFMA 3ZCSA 4DNFA 3N2LA 4HB3A 4QJ5A 2D0IA 2IUSA 3WLMA 1EB9A 1SBIA 3KQWA 4E2WA 4XGRA 4D8VA 3BJEA 1O8CA 2Y1LA 3PZRA 1L5KA 3KQLA 3BMQB 1FFBA 1L3IA 2UYOA 3DE1X 2P5SA 3DDUA 3F0TA 4L2IA 5EPOA 3EVDA 1QKJA 3I2FA 4OJKA 3ZPXA 1PSZA 4L4YA 4HUQA 5C1IA 4TWRA 4FHFA 1TMOA 3RARA 1KMIY 1VG8A 4HZIA 2IHYA 5JR3A 3RAEC 1S0UA 5DM70 1WAMA 3E22B 1BWQA 3HB4X 2QUHA 3EH1A 4PQYA 1MO2A 4D81A 3DMYA 4RPGA 3D6UA 4PAGA 1FYFA 1NJSA 4O2BF 1ODLA 1XMJA 3HXTA 3LT4A 4K1LA 3SC2B 1I7QB 2FZCA 4YV7A 1UMDA 2FRDA 1KXZA 3QFCA 2WF7A 4LDPA 1TA4A 4RY9A 4ZU1X 4PIMA 4OXNA 5FQOA 1B16A 3MRTA 2CVPA 1V5FA 3BKXA 5CAEA 1MPTA 2HMSA 3GAMA 3K5IA 2CCGA 4IZ6A 4LDQA 3QX3A 2B2XA 3THYB 1M6VB 1U28C 5C8YB 5TVGA 3VDQA 2R8YA 3O31A 4MGHA 2DLDA 3ZOKA 3N70A 1IHOA 1AU9A 3Q2KA 3PXGA 1KEEB 1ORVA 1A9XB 2DR0A 2PX0A 4DBVO 4KLCA 1VOTA 3DM5A 3P8ZA 3E9NA 2QTWB 2ODAA 1UPFA 3CPSA 4O8CA 1ZIYA 4YUWA 1BE1A 3DO5A 5ERGB 4QGBA 5J4VA 3NDRA 3V1YA 2FWJA 1H5NA 1NVVR 4C87A 3T5AA 1K9SA 2P27A 3C7DB 5DXFA 2F9LA 4IDOA 3MTDA 1HOXA 4LY0A 3RVNA 3BE6A 1V0JA 2CXRA 3B89A 4Y2GA 1U0RA 3ELBA 2IW3A 4KXWA 3KNZA 2FLKA 1BS9A 2GRAA 2PR7A 2Q0XA 4KMRA 3RDPA 3FIJA 5BY2A 1Z6AA 1J33A 5DOZA 4JYAB 3EK2A 3F5MA 5LZ7A 5B1IA 3GLIE 3S2YA 1GQ2A 3FCCA 2F6RA 3WKDA 3G7UA 2XRYA 3HY6A 5I48A 1AO3A 3I1FA 2ZWMA 3EC2A 3SXJA 3MVEA 4ONEA 3ZDAA 1PVDA 3L18A 3Q9UA 3WGTA 1XEXB 1X2BA 5ALRA 5DM0A 4E94A 3E53A 1WS6A 3RG8A 4KH1A 5D3QA 1MG5A 2W6ZA 3ORHA 2H08A 2XKAA 1TF5A 2DR3A 1ZVQA 1EHIA 2HV9A 2ZUBA 3I83A 3LO5A 2VXCA 4KL8S 4YIKA 5HIAA 2ZSKA 3H9BA 5J3JA 1L1RA 4RSHA 5G4KA 3B9BA 4YXFA 2X19A 3EXG1 4ED9A 4ZHQF 5EXPA 4X60A 3T1HB 1K7XB 1AUVA 2C2WA 2G9NA 3V8NA 4CTJA 5AVUA 2FMHA 3TUZC 4P7BA 4HQRA 1AZSC 3I05A 3KVOA 4N9QA 1J00A 1E69A 3NHRA 3KVVA 3ZJYA 3W5AA 4EGQA 2GVNA 2YWCA 3GBSA 3C14C 1XZKA 3QJYA 4EEXA 1OC2A 2CHEA 1PJCA 3UCXA 4U2DA 4J7CA 2NU9B 3ADPA 2WICA 1M2EA 3W1VA 5K0BA 5FPPA 1TCAA 1QQAA 1IUPA 2FP4A 1BJKA 3CUUA 3FNIA 5HOQA 2GNOA 5CM9C 2FAXA 4B84A 5CIYA 3PA8A 2VP4A 4BGVA 4B3MB 4GEGA 1UK6A 4Q7MB 5KQPA 4RV4A 1JBQA 4S1VA 3LKZA 4J6FA 1HPLA 4G5OA 2NSJA 1JIJA 4JJFA 4U7WA 4TN5A 4EEZA 5C3MA 4GKJB 4UUQA 5TF4A 1RLUA 4R9RA 4LFAB 5CT6A 3CUSA 3HLKA 5KINB 2VDJA 5LMNB 2H1CA 1UXHA 1VLQA 2WKRA 4EA7A 2RE8A 3T5MA 2E6KA 3MMXA 3Q3JB 3EMVA 1JDJA 4KQFA 5C8ZA 1TU0A 2Q21A 5AW7A 3AUSA 1WE2A 4TLDA 4PXAA 4QBTA 4F3NA 2Q6KA 5CVUA 4CN8A 3OCUA 1ZNXA 4DDKA 2R00A 5IJXA 4R9SA 2PKQO 1XU4A 3M2TA 3HVJA 1QG0A 2O7RA 1U0EA 2FPIA 4GF5A 2XMDA 1KK0A 2HMUA 2J7PA 1CB0A 3MTJA 3TL6A 1ZMBA 1ECLA 4AIRA 1SIBE 3CJQA 2ABWA 4HXEB 4N5DA 2XHZA 3PGLA 4UE6A 2RHHA 3HBMA 5AK6A 5GY7A 1R37A 3B6MA 1V25A 3UJAA 4CIYA 1OXXK 2HTFA 2OVBA 2R8PA 4GICA 5KYXB 5A3SA 3QEMB 1XWIA 4E11A 3VR2D 1HR0B 1FRZA 3D8BA 4YAGA 3JQEA 1WD7A 2B25A 1N2IA 2FNAA 1VHWA 3D4BA 1KMHA 1R6BX 3QITA 4O29A 4R83A 1CQWA 1JJVA 2A78A 1YOVB 3F6CA 3RVKA 3AUJB 2GHTA 4OUKX 2A9QA 1NM5A 4J94A 1JG1A 5EZQA 4F4DA 4DB4A 1UKYA 3AL3A 1JQDA 5I7SA 3TDNA 1KBZA 2OD9A 4OXIA 3DWEX 5JLJA 2ORVA 1JHUA 1I5OA 4CKYA 4EVRA 1RCFA 1Z12A 3SGLA 4M1OA 4EYGA 2VTKA 5ECGC 1BOOA 3CUTA 1O4VA 2O59A 4M1WA 1J0BA 3ANLA 1N32B 3IMCA 4IH1A 1V5EA 3H6GA 1GLNA 3HP1A 1PFUA 1ZH4A 2XLBA 4J4TA 1UC8A 5CFZA 4UTNA 1ZAKA 2FWBA 3J7TA 1RRFA 1JEEA 4URUR 4WLOA 3VYWA 4ROSA 3SN6A 1BCSB 3U40A 1P91A 1Q7CA 2D5AA 1H8HD 1TQDA 1XF1A 2FOIA 2VH5R 3BZWA 3MG9A 4AYWA 2VA9A 4UBKA 4BFSA 4FOTA 3CRW1 1XVLA 3IQGX 4MUFA 2HA5A 1I3CA 5ALZA 2JD1A 2WV9A 4W9NC 6ADHA 1BD4A 5BORA 4BEJA 4LJSA 2CFCA 1NBIA 2ZWVA 3C3KA 1GGFA 1PV4A 1DUSA 2DPYA 5LQSA 4E21A 5FPQA 3ZJVA 1ECJA 4KG7A 3FTQA 4EGSA 4LOAA 2PSDA 4FDUA 4FBGA 3W9YA 3X2EA 2XA9A 2QYTA 3MJSA 3OBBA 2WPDD 3T7EA 3SQOA 3VTFA 4UULA 3BXPA 3L49A 4DDMA 3FGNA 2H0AA 4C0KA 2BHRA 3AB3A 2M98A 2GCOB 4NCKA 3DVQX 5JAOA 3Q15C 3G2MA 2Q0QA 3WYDA 4R2KA 4UE2A 4G4JA 2BV3A 1JKJB 1R5JA 2E1RA 2H7XA 4ZJUA 1YUBA 2DKNA 3HU2A 2QTBA 2GTIA 4V39A 5L3SA 3VPBA 2PX3A 1ESDA 2EG9A 5AK3A 1U0BB 1DDOA 1KKUA 1K4KA 3OD5A 3W05A 4QYWA 3RVLA 2R6R1 3EY9A 4JU8A 1VSQA 2D0OB 4K9MA 1P5RA 1ZJYA 5WRFA 4KMMA 4EKYA 4OSPA 3A4LA 4A6PA 3E3MA 5A5DA 4OLAA 1PZNA 1AGYA 3HCDA 3AJ8A 5AUOB 3IS3A 3WMEA 1CRWG 3KD2A 1WLYA 4GZMA 2VFAA 4MJXA 3SDSA 2RK6A 3T35A 1MRSA 4AQDA 2C5BA 2ZRJA 3NYQA 4NCHA 4EP1A 1GUDA 1CD5A 1Z6GA 3NANA 4UTOA 5D01A 4PLZA 4YA6A 4F8EA 4B3SB 3K9FC 1XZCA 1B7GO 1XDGA 3EBPA 1JW9B 5JY1A 3UM9A 1F51E 3BJIC 4ZANA 1GAQA 2GS9A 3BWXA 3FVWA 3HB9A 1P4AA 3FHOA 5B4TA 4YRZA 1PUJA 4N47A 4JLUA 2QNIA 4C0HA 2J5BA 4AXXA 1CJMA 1JG6A 4J1NA 3AVQA 1M1UA 1X1RA 3VRHA 3EGOA 3E3LA 3TX2A 1TZKA 3JVUA 2O1EA 1CY0A 2W2KB 2B20A 4K9OA 2Y1CA 1AS2A 5FF9A 5IAEA 1DQNA 1PZGA 4JT4A 3REFA 3UW1A 5J43A 5EP1A 1YR1A 4EGJA 2UXDB 1SVOA 4D46A 4OBWA 1V39A 5FAKA 4Z0PA 1LSSA 2QIPA 3I01A 1SUAA 3ILSA 2ZJ6A 2QT9A 4AX8A 2VDNB 4HNVA 2AXNA 1CF2O 4QJ4A 3SEFA 4PLPA 3H0KA 2C4TA 4IMRA 2YNMA 4C2AA 3PQ3A 2Z58A 3GZJA 3JYOA 4NDZA 5G1PA 2C99A 2DFPA 1BDJA 1JAIA 1JBKA 1JB1A 4QA9A 5I5GA 2BTQB 4CL8A 1Y9JA 5DYTA 3RVOA 5E2AA 4URHA 1E99A 1FNSA 1N3IA 4TKZA 4KVGA 4F3YA 4ZYZA 3EGIA 5LYJB 3HA3A 1H8ED 3WB1A 4G1EB 4RJIA 5DVZA 4GIBA 4N3BA 3QLJA 4E4YA 3JAKA 3IR6A 4CM5A 3KQUA 1DJLA 1HNZB 4KE6A 1MKYA 3WRYA 3IULA 2J4FA 2HA4A 3IUJA 1T8UA 1VG9B 3A9TA 3OBIA 4ZO6A 5AM5A 3A6JA 2HLPA 2XWJI 3KJQA 2DOKA 3H2JA 1CZKA 1CY7A 2CJWA 2J7KA 4EVIA 3WKEA 4CCYB 1KI9A 2OFWA 2PE5A 5LB2A 1TM4E 2C7QA 1FQJA 1VFPA 3DHEA 5TC4A 4HB4A 1YB7A 1PJZA 3NHSA 5B2EA 5F12A 4G9BA 2W4QA 3CO5A 4CF5A 1WR8A 3AF3A 1ZOPA 3IT2A 3DCJA 1EJ6A 2DM6A 2X1HA 4LQCA 3E3NA 4M9RA 3CLTD 1JLRA 2QW0X 5I7AA 4AXBA 1TQHA 1QIEA 3P9CA 1K06A 1MD9A 1FTSA 3ZH9B 3GUYA 4A0RA 4LTMA 1K7FB 4YRDA 4DAEA 1ONOA 4KIWA 2QVBA 3NWJA 4JT9A 4UREA 1WY5A 4B7ZA 1QV6A 5I4KA 2C5FA 3PDHA 1JPJA 4MYTA 1FPQA 3DW3X 4LRXA 1QF6A 1OI7A 5JS7A 2QHXA 3G0OA 3V9PA 1XU9A 2N42A 1MFPA 1YONA 2WQZA 1Q74A 2J3EA 3FFTA 3AVTA 1PR4A 3BXEA 3I6ZA 4PCAA 2YOHA 3NM4A 3W8NA 1KWKA 3GEHA 3NNNA 2HJGA 4BEWA 5FLXA 1O3YA 4UDYX 1FXWA 3D7SA 1TOAA 3FKJA 1DARA 1XRLA 2VPYA 3HSSA 4R4JA 3RJ9A 5LIRA 3U5ZB 2HA2A 4DFDA 2Y0CA 2ZBVA 4JYPA 1JQ5A 3AKEA 2FW8A 4IVQA 4CXMA 1VA5A 3GEIA 1T9AA 3PDIB 4YRBA 2FQWA 3Q11A 1AUPA 2DPGA 1ZITA 1F4LA 3JVIA 1C8LA 2X14A 1HWYA 4U7TB 5F9HA 3UZUA 2P2GA 2YOFA 1TT7A 2V9CA 3FETA 3U19A 3HVRA 2EFDB 3GG9A 1TAUA 1X92A 1VMEA 3IAFA 1TJYA 3VPXA 2IE8A 2CMDA 5ER9A 4CKEA 2I4NA 2FEWB 4AF7A 1M2HA 3D7RA 1E1DA 3R2JA 2Q2WA 3JU3A 4KQWA 2IV2X 3IHTA 2PD4A 4LJKA 3O8OA 5FWXB 2FCAA 3K0BA 4LKOA 2FJUA 3RBVA 4YJFB 3QSGA 1FE8A 5LOVA 3M6AA 3COJA 1XZPA 2YFKA 2YX1A 4Q82A 5AKLA 4B0OA 1PQWA 5IBQA 3VKUA 4LRSB 1UBFA 3TG8A 2V4UA 1MQSA 1SVWA 3HUUA 5ILQA 3KB2A 3RRZA 3CUKA 4B5LA 3VPDA 3VJRA 4CLOA 2XI4A 3P4YA 4PFQA 4IW3B 3UG6A 4MDFA 3DOFA 2I2BA 4D4LA 4E5SA 4AKGA 5E7QA 2Z2JA 3NG1A 2BFFA 1M66A 1KYWA 3VZSA 1F2DA 3M9LA 5FX2A 4L8YA 4Y0AA 3RANA 1PL0A 1ID8A 1WTCA 2V7UA 4FOPA 1LPPA 3QELB 4IDPA 4QREA 2BIFA 2IIBA 1F2TA 1SOAA 1NW4A 3F78A 4XYEA 5GIPE 1IC6A 4RE5A 4QSHA 4Q9LA 2X0EA 3PX3A 2B5WA 1IL0A 1T9BA 3A1FA 5BRNA 4JJEA 3OHMA 1K6EA 3GDOA 5FWNA 1KVRA 2E18A 2WFLB 1XNJA 3BGSA 3SE7A 1Y33E 1NR5A 2I0FA 2D74A 3MEQA 4BQIA 1IBLB 1K5HA 4PRZA 1M0EA 3BZUA 1XDUA 2WW8A 3KPVA 3BD8A 3F49S 3NHPA 3TR0A 5BQOA 3ZXUB 4QBGB 4G0ZA 4HS9A 2D06A 4U5XA 3T3MB 1U28A 5BYKA 3DC2A 3V4LA 1E2HA 2HH9A 4JUBA 5J63A 2P9JA 2ZIAA 3NTQA 1B15A 1HTTA 4R1OA 4QQ8A 4ZYXA 5AVRA 3ZHZA 2D1QA 3WGZA 4UAJA 4P0TA 4A6EA 5C51B 2PSHA 3O8LA 2ZWAA 3AP2A 2CSXA 5A0TA 1SQ0A 1RCUA 2QS9A 2ZR0A 2E2WA 3KLOA 4Q4HA 1TGVA 3ESAA 2W2NA 4MWSA 5AI6A 2XSZD 1O0CA 2P78A 5A4IS 1FCJA 4WL0A 1GYRA 1OILA 3DOOA 3WR5A 3OCWA 4TMYA 4QLBA 1XYVA 1US8B 3UKDA 1RI2A 3WL5A 3QY9A 4ER3A 4TLAA 5SY6A 2ZJAA 2OGZA 3VR1A 2AOTA 4QAJA 3DZGA 4HVAA 1MU0A 4RIEA 4AY5A 4BU1A 1K6JA 2F64A 2B99A 4RJLA 3VYRB 3KX2A 2Q3CA 2QRUA 2EKZA 2P6RA 3NVKI 1VJCA 1ZGGA 5IHPA 4KI0A 1X7DA 3PNBA 4WCVA 5CVVA 3J80A 1ESCA 3ABIA 1NMEA 3WLKX 2HOQA 1Y7TA 2QMYA 5GIOE 4BLUA 4OUDB 3MJ4A 3IQXA 4FFBB 4LOIA 4UVIA 3ZCVA 1QE0A 2QU7A 3E3AA 1R4AA 2Q4BA 2EQBA 4GRDA 4GPZA 3U26A 4CR8A 4Z1MD 2OO3A 1VPDA 2I8AA 3AUTA 2EDCA 2IZ5A 2B83A 3FXAA 4D9HA 2IS2A 4KSBA 1Y1TA 5EMHA 4NE9A 3HJFA 5C2JB 1F7VA 4GYWA 1MJGM 5FNVB 1H6BA 5F2NA 1FTWA 3DTVA 3CO0S 3Q2OA 1XEWX 2WAYA 3HGMA 1EM8A 1ZINA 2VT2A 4V0SA 4LTNA 5K3AA 3VTZA 2LR0A 1UBRS 1UBCA 1MB2A 1TEXA 1TEHA 2EKDA 2WOOA 3FLEA 3G2KA 4MA5A 4E5UA 4NWIA 4AS3A 4EB8A 1ONBA 4G84A 3AUUA 1PQUA 3JZIA 1VL0A 1WL8A 5JPDA 5IYZA 4QG7A 1MB9A 1QYRA 1MAAA 4QUJA 4PZ9A 4WOBA 1H1TA 2J33A 2PXXA 3B2NA 3CB2A 3F6PA 2HM7A 1Y6ZA 1TKRA 3FFAA 1YDGA 5DN9A 3STYA 2W6NA 3MWKA 1BCRB 1NQUA 1YV9A 3R7SA 1W1WA 1RHKA 1BN6A 1C9JA 3TMKA 3IUNA 3VR6A 3L8CA 1X13A 1VHQA 3FUXA 4BHTA 4RADA 1IYZA 4JI7B 4E3WA 1VRVA 5FJJA 3GXOA 4X65B 3AILA 3VJLA 3PQ6A 4ZDJA 1FSZA 1KJZA 4LV5B 2DZDA 5I01A 2XDAA 2ACEA 1R0XA 2CLCX 4AC9A 1LPOA 4BNZA 1TAGA 1QE5A 2OZEA 1M2GA 1W5TA 1DSSG 2BZ1A 4KWTA 4BV8A 1Z6ZA 2OG1A 2V58A 3FNQA 4I9GA 4RVNA 3KV3O 5FCDA 4XVCA 4IJVA 4ADSG 4YRIA 3OQIB 3WLPA 3WV5A 4RPKA 4GYJA 3KQPA 4BFVA 2GPJA 1W2HA 2I2DA 4XGIA 3REQB 3RHFA 2UXBB 3A6LA 1J8YF 2Y0PA 3V4ZA 1GDHA 4B6OA 5CA1A 3ZKWB 3ZVNA 3THXA 3EWIA 1W5FA 1WW8A 1H2XA 4U2FA 2M6LA 3IEXA 2LDBA 1JXAA 3O74A 4U2EA 1EWYA 1OWPA 2A8YA 4H6WA 1ECPA 4FMCF 2X0FA 1Z34A 3SYKA 5T8KC 4Z7JA 2VRNA 2X6TA 1TE2A 1ECFA 4MVJF 5IDWA 1G4UR 1Z8HA 5DWQA 1YE8A 1X7YA 3SFZA 3PNVA 1KO4A 3TRJA 4JBWA 1CJCA 5FT9A 5BYJA 5FWDA 4ZODA 3GEDA 2XV1A 5D1NA 2I54A 4YASA 3O4RA 1PX2A 1T1SA 2A3RA 2QAGC 1I3NA 3BL6A 2H2AA 3UAZA 5E3HA 5JECA 5GVSA 2HA0A 1U0SY 2R6HA 2OMKA 5FBRB 4Z4GA 4XPIB 3O4GA 2JFBA 3BMCB 1EFDN 1GOTA 3I23A 2O2EA 4TSKA 2Y71A 1DXYA 1PZMA 1H22A 3A0RB 3BMXA 1UXJA 3CF4A 3JX9A 1E89A 4IV0A 4YFVA 3VH1A 4DWOA 4NCAA 2GJSA 2ZB7A 4D4IA 3FUVA 2QZSA 2A67A 1W34A 1Z4KA 3Q5EA 1R6XA 1X8XA 3O4VA 4U0JA 1SFRA 4MWBA 5CB0A 4ETMA 3U56A 2IPLA 2OUKA 3HKBA 2PZ8A 3TD6A 3V2UA 4EB6B 5L95A 1OLXB 1EU1A 2VH2A 1GZSA 2A4MA 1J21A 1JQ3A 4KU4A 4X54A 1X8LA 3D4IA 1CRZA 1TLLA 2X86A 1N2CA 3LW8A 1FFGA 3MC1A 3QNUA 4BDSA 4JP5A 2JKZA 3AX6A 4B3XA 4EUHA 2WYUA 1FP1D 2GPBA 5ALEA 2VZ0A 4W9NA 2QD3A 3N8DA 5FV7A 2ZVPX 5K8TA 3OJFA 3BTOA 4OP3A 3UHOA 4KR6A 3A1SA 2GI4A 5DPMA 3U4CA 3NAMA 4I4IA 1Q1QA 3WRXC 5EJEA 4JROA 2CZCA 2OOKA 4S12A 2YMQA 2XCRB 5TY0A 1V2GA 3DFFA 3FOWA 4B32A 4C4YA 3HM9A 3CRMA 2R7LA 5JRZA 3KQYA 3QEAZ 4XWTA 5BVGB 3L7YA 1NPTO 3C3BA 3DZIA 5KVVA 4TVOA 3T6KA 2IV3A 1JYSA 3TRHA 1TW3A 2O48X 2ZBDA 3A36A 1UDRA 1GR1A 4K26A 4XJVA 1ZK3A 3C43A 4AJJA 3P9YA 3KWFA 4FFRA 3Q0IA 3K3PA 3TAUA 2E21A 4F3RA 4F71A 3D3JA 3OIUA 4HMPA 3RFUA 3KJIA 1ZN2A 4PPGA 2RKBA 3PNQA 1JALA 1QK3A 4OU5A 4WOJA 4PSAA 4FKMA 3VHXB 3AJ9A 1Z13A 3X1JA 2P40A 3GZ4A 2WTEA 5BQ5A 1OF1A 2I9KA 4NZOA 5E0KB 1C2YA 2XMQA 5EE5B 1V35A 3N0WA 4DLPA 4N7JA 1RAFA 2JVJA 4UQOA 5K4HA 4AY6A 3HZHA 4EATA 3GRPA 2CHUA 4UBNA 1KQ3A 1ISSA 2ZI3A 1QQTA 1IOZA 2BFPA 3P9IA 4DIBA 3KQNA 3DF7A 1SWWA 2IXFA 1TM2A 2V3CC 1IJFA 1RC0A 5EIOA 3RK1A 1Y80A 2OD2A 2O8BA 5ISMA 2GK6A 4QGHA 2QRZA 3B12A 1LVHA 3VZQA 1Q77A 5LYYA 2OKGA 3H4MA 4HNAA 5LLSA 2NAPA 4HATA 3LQ1A 4OAPA 4RK0A 5EA2A 4JBNA 1TUBA 3KVNA 5DX8A 2JGEA 2W6JA 1VG1A 3OJ0A 5CXSA 3WJ7A 3GLIA 1VYTA 3I12A 3OZGA 5E3JA 3QKRA 4ZDWA 1PL7A 2FPPA 1TU4A 4YQZA 3TECE 1XQYA 4FSHA 1HE1C 4JB0A 3MQFA 5DCLA 2BGWA 1COZA 3D0RA 4UPDA 2FN9A 3AESA 5MDHA 4KR7A 3P4UA 3FUTA 5DFAA 3AB7A 3GLVA 2X7HA 2ZRNA 2V7GA 2YS7A 3TIGA 1EJ0A 1T3LA 4BGIA 1MN6A 3ZU3A 1W4LA 2AF4C 4NBLA 4ZQHA 3EPRA 2CWDA 2WWRA 3EAGA 4QYSA 4RMHA 4YYZA 1U94A 2WJWA 4JASB 1M6HA 4LISA 4YALA 4AYXA 3EOAI 3HY3A 4ZYUA 2YV2A 4G2NA 4I4NA 3WWCA 1SKYE 3OZXA 2WYHA 3VNSA 1FMLA 1QP8A 1J8DA 3FZQA 1TCVA 2WU3A 4OKIA 3SLKA 2EDAA 3EOZA 3DVAB 3LUKA 2FN7A 4YJ3A 3WZMA 2NLOA 1WSDA 2R8ZA 3B1XA 3IVXA 2F3TA 5B7QA 1N6OA 2B82A 3AI7A 3EVGA 4NJMA 5M34A 1O54A 3PTZA 1R0RE 3TTXA 1IDOA 2OWDA 1NBOA 2P65A 5DM60 2AD5A 3V1TC 4NC9A 2VJYA 4OFXA 2W6ID 3BGDA 2REXB 3PT5A 3P32A 4IQGA 3UHAA 1SD2A 3HCNA 2VAPA 4DR1B 1CY6A 1YK1A 2R68A 4LJLA 1KE2A 4DEYA 4RL6A 3R7LA 3QTLA 4OGFA 1J97A 2AE1A 3SZUA 3HACA 5TPZA 3S40A 3CXRA 3ECAA 4K9NA 3IV6A 2EQAA 3N7AA 3TDKA 2BM0A 1C8KA 1C3OA 1KYIA 5FUVA 4YHHB 1DJMA 3CE9A 4OATA 4QOHA 5A03A 1VBNA 4YQEA 2GLUA 2I6FA 1ZM9A 1YUMA 2QL6A 2OBNA 2QRGA 3CG0A 3OE7A 4TV8F 4TYPA 1RJDA 5CMLA 4X3OA 4YX9A 4HZUA 3KEMA 1LZLA 1G0NA 1OT3A 2GUWA 4GLJA 4Q4AA 4RF2A 1TK2A 4JC8A 4KQ1A 2CUTA 2GJ9A 3GU3A 1XZMA 3F5SA 1OIVA 3VV2A 4EA9A 5KSPA 3OOSA 4HXGA 1K27A 1JQJC 3IHWA 4WNIA 1LBEA 4BY9E 2V7QA 4IHJB 1X7XB 4QDJA 4FNGA 3UV7A 2D4AA 4BIIA 5DH9A 1YZYA 5T4EA 1P77A 3Q3IA 1GIAA 1E7RA 2ZBRA 3I64A 2OB2A 4ND5A 2HSDA 3BE8A 1Q1AA 4PWZA 4XIFA 5EWLB 3EPHA 3Q6MA 4UHFA 4NK4A 5BWBA 3MTBA 3K8QA 2F4VB 3OJLA 2WBLC 2WSLA 1IPHA 5BW6B 4BTEA 3V00A 1ZCZA 2R6ZA 3PPXA 3VC3A 1VHDA 2A0FA 2H3HA 3DAOA 5GP1A 3SF8B 4XFKA 3TIFA 4EVSA 1A3CA 1DC5A 4NS1A 3VDMA 4RK7A 1P33A 1WZUA 3AOGA 2A3NA 2IA5A 4GNKA 5CEEA 1T0UA 3GGCA 2OR3A 5HQ3B 3WV4A 3S68A 4N76A 3BORA 3PYMA 5T4HA 1G17A 2ONZA 1I0IA 4KPUB 5D51S 5ESWA 2FQQA 3DMGA 3IBCA 4OIMA 4AJOA 3HPQA 4MR7A 3VV3A 4IYJA 5JC8A 4WKCA 1VI2A 3HXQA 4PTLA 1E5XA 3R40A 2FZ5A 8LDHA 2OWEA 1RS0A 3QFSA 3N2KB 4HYYA 3M9XA 2PHZA 2A86A 4F5ZA 3JQFC 3JR7A 4HTFA 3VQTA 2Z2ZA 2FFBA 4LWZA 4HDNB 2IOHA 4Q9IA 5CB4B 1II8A 2AMVA 1P4RA 4JVOA 2J6CA 1E3SA 3RO7A 2WDZA 3RIEA 3DVSX 3RUHA 6PFKA 2AFIA 3BE4A 1U0GA 2AS0A 3DUFB 1G5RA 3I76A 2ORIA 3TEJA 1T29A 4FINA 1TGYA 4LE1A 1OWOA 2GF2A 5ELMA 1BO6A 4BKRA 4DR2B 1RBZA 1T4MA 1U6KA 2D1YA 3FSJX 2JH8A 1AC5A 1IJBA 1E3DA 3AFMA 1UBLS 3QGMA 5DHAA 1Y3IA 1Y3BE 1IOWA 3O8QA 2P77A 4QUGA 5C1PA 4KO8A 1ORIA 3RT9A 4EX7A 3QVVA 5EJ4A 4ZVVA 1F17A 3LBIA 4Z51A 1U5AA 4UUMA 2GEDA 2GN0A 3X1WA 1UZUA 5A7FA 1QVAA 1JT2A 1XAJA 3KEOA 2VYVD 2IP4A 1FZQA 1GSOA 3FFBA 3Q5GA 1G6HA 3D31A 1R0YA 2N1MA 1BOFA 2NPIA 3WGGA 3AU8A 3SWWA 2Z5LA 1USVA 3MTIA 1AXEA 1W7AA 1ZUWA 2AJLI 3TE7A 1E4EB 1W4BA 2ZM5A 2FPLA 4EG1A 1B0AA 4FGKA 3RASA 4A1OA 4JT8A 3WYFA 1EIZA 5K3DA 3ZCTA 3OY2A 3ZKAA 2H17A 3HJAA 3FCAA 3PJFA 3AEYA 4C20A 3S5JA 3TOVA 1KZGB 1Q6ZA 1RXCA 2I4MA 2Q4RA 3ZIDA 2O2DA 4LXHA 3PEVA 3R6GA 1SURA 2CUNA 3IV7A 1ZZGA 1Z0JA 2HZ7A 4WLNA 3EQZA 4BFZA 5CFOA 2GK4A 1XA4A 4PLYA 4OJMX 4LRUA 5BSMA 821PA 3ISJA 4WN9A 3CLSC 5C4IA 3N59A 4NJEA 3ZWQA 4HQ0A 1A77A 1AKEA 2JI9A 3OLVA 1XP5A 3UTDA 3WDMA 3QOFA 3ZS8A 5A05A 2ZXUA 3HVIA 3OP4A 1Y1RA 3AT1A 4MR9A 1W88B 1RVDA 5GJWC 3JQPA 3K96A 3VMMA 1RYYA 4KQCA 4NF2A 4OI1A 1DIGA 2FW1A 2WDPA 5EMLA 2X7XA 1IN4A 3AEUA 3GLQA 3KFXA 4G4SO 4KQ9A 1N1EA 2XT6A 5FOUA 4F97A 3R7DA 1E61A 2R4UA 1T2CA 1PE0A 4HI0E 3RWBA 5EAIA 2IXGA 3T7CA 2PH7A 2VWPA 1PU2A 3SD7A 2P0EA 3R1IA 4FYPA 1OYYA 4R1UA 4AJ1A 1Q11A 2BMVA 1K8YB 2JBAA 4KXVA 1AQYA 5FNZA 5GGYA 1RRPA 7MHTA 4JLMA 1MABA 1W4RA 4JJGA 4M60A 4G5RA 4EUKA 1ULHA 1J07A 1A50B 2Z09A 1PNQA 1MLDA 5THXA 1DU4A 2XA1A 1C3EA 2EBWA 2IS6A 2A1UB 2FWRA 4C4XA 1NZFA 2X1MA 1P3Y1 1UM8A 2ZAMA 3Q8MA 4W1SA 3G49A 5FBQB 4BMYA 4P38A 2ETXA 3D54D 4PM4A 1QIDA 3C6BA 3ETCA 3UOGA 2A1TR 2QUBA 4HVTA 4KV9A 4OLBA 2DB3A 3G9ZA 1FUYB 1II9A 1WUTA 2BSAA 4XLZA 5JZSA 5FBZA 1B42A 3D3QA 4JNCA 1EEXB 2EW1A 3MWEB 2JANA 3B7PA 3ZLTA 5IVKA 4FPXA 1ZWKA 4EEKA 3EDMA 1IZ0A 1KJIA 4RTRA 5EZYB 4E22A 5LUAA 1EUQA 3L92A 2D5CA 2OV8A 2ZAGA 6REQA 4HN4B 2Q2VA 2QN8A 3G79A 2JIQA 1VTKA 2ZXFA 2IHKA 4JY7A 4IMPA 1X9GA 1NC3A 2NO9A 4QTTB 4UM7A 5A7GA 3ZZTA 4CFYA 1X14A 2E4AA 1RYMA 3OPYI 4R69A 3V33A 1AZTA 2JLCA 3FB4A 2IOYA 1Q2XA 2DBVO 3P4XA 1H1LA 2GEFA 5H9VA 2HW8A 2YWFA 1EFRA 5CLGA 1VRCA 4RZ3A 3CW9A 3JD1A 3KDAA 3PI7A 4WEQA 4EF6A 4UUBA 3IEPA 5G3ZA 2FPGA 2OBLA 1KS9A 5G0TA 5T3UA 4DE5A 4F2HA 3DEIA 1IPEA 1FP6A 1NR7A 4A10A 3ECSA 3A4TA 4PF1A 2C9OA 2EWVA 2GZDA 4UVDA 3U4AA 4DYHA 4BLQA 5BN4A 3F73A 1CV2A 1DHRA 1GL9B 3OZTA 3MCTA 2EHJA 4PRYA 3PG5A 1U4SA 5EIFA 1HLFA 5FI5A 3RU3A 4CEJA 1QH8B 2BFEB 1FC0A 2N46A 2OBBA 4CKCB 1I8TA 5B7PA 3FSRA 3D4PA 3PSHA 3PQ4A 1PYGA 1W59A 4UBIA 4WBNF 2EVWX 4YWJA 1P3DA 3IE2A 1RYFA 4R68A 3VZPA 1CRLA 1TEZA 1CP2A 2C2BA 5J5CA 4W5TA 1N5MA 1E3JA 3WZLA 5EMKA 4AROA 2YYYA 1G8AA 3ZHXA 3R9KA 2OZPA 2Q8QA 1QIFA 2N1BA 1L2TA 1RI1A 4H08A 3RJZA 4DVJA 3TVYA 1VPLA 2OY0A 5T8KA 4X94A 2JCVA 1XMPA 4IKEA 3DXYA 1KRHA 1XHLA 3WBFA 1BDHA 4RHFA 2HK6A 1WXEA 2CLSA 4JS0A 5I3ZA 1CNEA 4G9GA 4DDVA 3TZKA 4LVUA 4MS1B 4BGEA 1NMQA 3TJZA 1DKPA 3R7WB 3IJ5A 4QNNA 5EJAA 2QAGA 1J20A 1JYEA 4TYQA 4XVQA 3SVLA 1EK2A 1G9SA 3HO6A 3I58A 3UFBA 3UMRA 5JQGF 4CKXA 4IRXA 4C7KA 5EEGA 1I4DD 3BXXA 4O4JA 4BJ3A 4OP1A 3O82A 4A8PA 4JMLA 1MENA 2C4NA 2JNWA 1KMCA 3A4VA 4TWBA 3VKWA 2VP3A 2I8LA 4YCSA 1V7QA 5JTTA 3DFMA 3W1WA 2HWWA 3E9RA 4LIPD 2C5HA 1HSZA 3LZDA 2HJVA 3ZLJA 3ELUA 2I29A 2YICA 2GDZA 1FBNA 1OBFO 1XEFA 4ZQCB 2ZITA 3IIIA 1FTNA 4MRMA 3MB5A 2POCA 4C7OB 1QO7A 1EP3B 4CETA 3TKAA 4RK5A 2ZVJA 3I9OA 5F7ZA 5L4LA 4B09A 4XWOA 2AF3C 3ZUPA 4TWIA 4GR9A 2SKEA 2PUAA 4LWOA 1Y8QB 1B8PA 3C6KA 3HR8A 4MLCA 4C3OB 4OTZA 5AJHA 1QXSA 4RM3A 1WXXA 5EHZA 3OQ1A 3I04A 4BNVA 4N5LA 1H2BA 2OHGA 3KG2A 4U9IS 5TQ0B 3V2IA 4ZZ3A 1YVPA 2QW1A 2OCIA 3FYUC 3WRXA 4PANA 4QYMA 1EWTA 1XXHB 1NI3A 1Q0LA 1TLTA 2X5NA 3FRHA 1QFMA 2EFHB 1XC7A 4BRUA 4OAOA 4HGNA 3FPAA 2ODWA 5EOVA 1M6YA 4JOCA 2O8NA 2WVAA 1V8PA 2ZRFA 4NZPA 5L6LB 1FDSA 1P5FA 2C92A 3PRYA 5CT4A 4DOMA 4HUTA 1FF9A 3KFLA 3SU8A 1MX1A 5C80A 4GXNA 5U9CA 2AA3A 2XQJA 3PC8C 3WNBA 3DWIA 2R84A 2V0GA 4Q1VA 4AN0A 3RC8A 3O3CA 1E94E 3RNLA 1Z8DA 3G5UA 4KRXA 1XCBA 1YVRA 3KV1A 4JR1A 3WSTA 4EF5A 4MWOA 4FIDA 4RENA 4XYMA 1MVNA 3QVUA 3EXEA 2B5OA 2CLDX 4YBRA 1RRMA 2XAAA 4DMHA 2EWMA 2XWPA 3AI3A 4I1UA 4CKBB 3LUAA 3R3UA 5B5SA 2PTGA 4BQQA 1FX1A 1SELA 4HDKB 3F97A 4X93A 2QSUA 1UH5A 3CWZA 2VBGA 4HSEA 2VJLA 2EFEB 3DC7A 5G02A 1E1QA 1WABA 5C46F 1KI2A 4IX9A 4ZAYA 5HTOA 1WCIA 1XTQA 1SHUX 3WK8A 1NX6A 2BGUA 2RI1A 2J32A 2X3UA 2ZYRA 5CNIA 1HH4A 3RODA 4HNGA 3U7IA 3AMVA 5DU2A 1JR3A 4DIEA 1V2HE 1V11A 2YHUA 2RGWA 3QSYA 1TD1A 2KPOA 2NOAA 4HD8A 1D7AA 5TJHA 5GJVC 2QVGA 4P5EA 2P75A 2RFLA 3DXZA 4L6AA 1QYCA 1LK7A 2VLIA 4RLSA 3CLRC 3MWFA 1EE9A 4QBFA 5EMNA 1N57A 4C2UA 2B1IA 3KJXA 1AS3A 3E5NA 3IXLA 2XDYA 4CLRB 4FDAA 4HEA1 3T7KA 3EXAA 2HF9A 2LE0A 3P20A 2AZMA 3U3RA 3W5SA 5FWAA 3GY0A 2ATEA 1Z3CA 2Q7XA 3ZI4A 2H2GA 9LDTA 1Z35A 2VHQA 3U4IA 3L77A 1IULA 4B9AA 1Z0SA 2G83A 4QU0A 3UGQA 4IS3A 3SSNA 5A4DA 3H6HA 2B0JA 3PICA 4JGGA 4O5OA 4RIIA 4YUYA 3F7MA 3PR2B 3VVBA 1X3LA 1RPJA 1W30A 2AYXA 2ZSBA 5AK5A 1EFAA 4ZC8A 3VKFA 4Z9FA 2PV0A 4CIAA 4HQFA 4BNDB 1UZNA 3SZLA 3WQRA 3SSOA 1E1YA 2XOEA 3GT4A 3WGMA 4TYMA 5JXGA 2WJIA 3BTVA 2M2IA 4OM7A 2I22A 2FB9A 2VSNA 3F2IA 5KTKA 1F1BA 4P3OA 2J30A 5EHGA 1OXUA 3G8AA 4CG0A 13PKA 2R62A 3A32A 3B6JA 1WXHA 4GFDA 2I3BA 3TUJC 3UJCA 3WLEA 2NACA 2COUA 2VK4A 1DDGA 1IMJA 1Z83A 5JRDS 3EEQA 4L9AA 5AM1A 1GPJA 2H16A 4Z9BA 3IOCA 2YDXA 4KV7A 3HBAA 2Y3IA 2HU8A 2R751 2FWMX 3H0CA 3QA3E 2JGJA 4R05A 1V3QE 1L4UA 1RZRA 3HUFA 1MOSA 3T61A 1FNCA 4P2BA 4J07A 1QK5A 3RIMA 1XPJA 4TL6A 3IH5A 3UK6A 1CUZA 5JCJA 3E7PA 2H5JA 2P6OA 3HWSA 4BVHA 3BEOA 4YT4A 3H5RA 2JLZA 1E6WA 4NQZA 1AN0A 1W36D 1ADCA 5A6SA 5EHIA 1WZCA 3QJ5A 4KO3S 5EKXA 5H02A 4B1FA 2VJBA 4BNFA 2I66A 4V1CI 3SIXA 3VZDA 1Q84A 2XJ4A 3HFGA 4GX5A 4P80A 4U7JA 4K46A 2W8BB 4LXTA 2V65A 3HYCA 4GD3Q 2PZKA 1E8NA 3PT9A 4GWKA 4M7RA 3GNSA 5LA6A 2ACVA 3RBZA 2QV0A 3UFXB 1SUDA 1XTRA 5BO5A 4BO7A 1X94A 2RHOA 3D4OA 2ZXEA 3SG0A 1HDGO 1WNTA 2ZSDA 2X0RA