2ETXA

Crystal structure of mdc1 tandem brct domains
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
194
structure length
194
Chain Sequence
APKVLFTGVVDARGERAVLALGGSLAGSAAEASHLVTDRIRRTVKFLCALGRGIPILSLDWLHQSRKAGFFLPPDEYVVTDPEQEKNFGFSLQDALSRARERRLLEGYEIYVTPGVQPPPPQMGEIISCCGGTYLPSMPRSYKPQRVVITCPQDFPHCSIPLRVGLPLLSPEFLLTGVLKQEAKPEAFVLSPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Mediator of DNA damage checkpoint protein 1
publication title Molecular Basis for the Association of Microcephalin (MCPH1) Protein with the Cell Division Cycle Protein 27 (Cdc27) Subunit of the Anaphase-promoting Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 59
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 2etxA01
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 2etxA02
1WF6A 2NTEA 1N5OX 3I0NA 2EBWA 2EBUA 3EF1A 2L42A 4OFBA 1T2VA 3T7JA 1Y98A 3T1NA 3U3ZA 1CDZA 2COKA 2M2IA 1JNXX 4XPZA 3FA2A 3PD7A 3SHTA 3AL2A 2ADOA 1T29A 3QVGB 3SHVA 4BU1A 1L7BA 1L0BA 4BMCA 3UENA 3L41A 3UEOA 4ID3A 2AZMA 2COUA 3OLCX 2ETXA 4BU0A 1IMOA 3HUEA 3K15A 1T2UA 3PXDA 1OQAA 3II6X 2WT8A 3T7IA 3QVGA 2JW5A 2XNKA 2K7FA 3AL3A 3PXBA 4BMDA 3PC8A 3K0KA 4N40A 3COJA 2HTFA 4U4AA 1T15A 3JVEA 3K16A 3PXCX 3L46A 3SQDA 2EP8A 4IGKA 2COEA 3EF0A 5ECGC 3HUFA 3PC7A 3K0HA 2E2WA 2VXCA 2K6GA 4XQ0A 1KZYC 3SZMA 2D8MA 3PC8C 3PXEA 3T7KA 3K05A 3PXAA 1Z56C 4IFIA 2LE0A 3KTFA 4JLUA 3I0MA 2INGX 2R1ZA 2XNHA 3L40A 4Y2GA 1IN1A 3PC6A 2VXBA 2DUNA 4Y18A 3PA6A 1GZHB
chains in the Genus database with same CATH superfamily
5DNDA 4YTEA 1SHKA 4ND6A 4CNQA 2PZ8A 2QR2A 3VH2A 4E51A 1B74A 4FFLA 4PZZA 1LPMA 1TUIA 2V03A 3LZCA 3L5KA 3MRXA 5E1DA 1ZW1A 4LNUA 1P9RA 2R48A 1BEZA 2EWVA 3GEGA 4OL0A 4PYQA 4Y2SA 3LWNA 3ZXSA 1HYQA 2CMKA 2JAHA 4V0ME 1KDPA 4J91A 4A8JA 3TXYA 5J43A 3E9RA 3UMMA 3HBLA 4PX3A 4AKHA 4KGXA 4IQFA 4PCVA 1E6MA 1BXKA 1ZOSA 2EV9A 3IP7A 1ZIOA 2NO7A 3AJRA 2YWRA 5I01A 2BI7A 1JTVA 1T2AA 2PT9A 4RQAA 4X92A 4B74A 3BUSA 1OSNA 2BHSA 4D9HA 3LQ1A 1J0AA 1YS1X 3R75A 1JQ3A 5BSEA 2L17A 3C87A 4A23A 2VAMA 4XYBA 1P77A 1WW3A 4YP6A 2FTKE 4ZVKA 4BMOB 2JFXA 2QU8A 2ZB7A 3EGDA 1WABA 4MP6A 4NAHA 3D8HA 4HHEA 2IWRA 3CRVA 1JR3A 4H9GA 1XWIA 3IYLW 4MGHA 2QTNA 4YCDA 3CG4A 4YR7A 3FJ1A 2ASEA 3E82A 5CLGA 1E6CA 3AF0A 2Z3VA 1UBHS 1VMAA 3KTDA 3Q85A 4KN9S 1EM8B 1J8FA 1QAQA 1UKYA 1XA4A 2RH9B 2X1LA 2IPAB 3DOIA 3N1UA 2CSXA 1QZTA 5DNWA 4S0ZA 3DEYX 4KFUA 2OG2A 4AYXA 5FULA 3DVSX 2CLOB 1I5RA 2HN9A 3ODGA 4KQHA 4LZOA 4DPKA 5IHXA 1W4ZA 1B6SA 5ERYA 2M6SA 3X2EA 2Q5OA 1YGYA 3LPLA 1Y1RA 4PNZA 2HA6A 1PE0A 3NS7A 4IAOA 3AHIA 4KXXA 4MK4A 1G8KA 2ZDGA 4BQPA 3FMGA 4L9AA 4Q1AA 1BDHA 1C8LA 4JXKA 3AV3A 5CVDA 5PNTA 2BF7A 2W0SA 1R8SA 2A94A 4DV3B 1QNLA 2CLKB 1DRJA 2X2OA 2PUGA 3ADDA 1ZUNB 3GW8A 3ABQB 3MMPA 1GGMA 4BX9A 1SB8A 3AESB 1ZD3A 1IY2A 2W6ID 2MJLA 4MQEA 5DBEX 5F2OA 3T3IA 1I7PA 1E1LA 3K1AA 1GCUA 1F5SA 3PHLA 1J2RA 2Y1XA 1J99A 2XKAA 3EVGA 4LRWA 1J7JA 1CU1A 1V5WA 3HLTA 5H4HA 5JUWA 4IUDS 3TLKA 2FW9A 3EQ6A 3ID6C 5EMKA 1WBDA 2VQDA 2ZCUA 5IMSA 1KAQA 3UAXA 2BR3A 2EGUA 3N0TA 3WS7A 1LTKA 5EINA 1GAQA 3KKPA 3HTXA 4OATA 2NVWA 3FM9A 1JEYA 2XUKA 4AKEA 1Y3BE 1C9DB 2BC9A 3PEEA 1J07A 4MUXA 2V1UA 4EPXA 3AVXA 3KAKA 2QUAA 1YACA 1ZJ5A 4HLDA 3WSTA 5KTRA 1VFPA 3AUAA 3R7WA 3I72A 2O59A 4NDNE 3BFVA 3IQWA 1ULAA 5LDHA 3PFBA 5BR4A 3W5VA 2KM1A 2YL2A 1U0TA 3MUNA 1O3YA 3HA5A 2XCRB 3REQB 5INTA 3DE3X 3O2SB 1OU0A 4KZPA 1HT1E 3BBLA 1WMBA 3DFKA 1K7SN 1IZZA 3FWZA 4I3FA 1PI3A 4KK4A 4L50A 1RWVA 3KT6A 4WSOA 5EUBA 3B36A 3URKA 1SEVA 1GTG1 3KFXA 3KL2A 4ZCTA 2VP6A 3W5BA 2C7RA 1E2PA 1NG9A 3N6XA 3RYFB 1MF7A 3ZE8A 1BG6A 2HSJA 5H68A 3DYBA 1NKVA 5K05A 3FMVA 2CMHA 4AIRA 4JY7A 4Z6KA 2NP7A 4FDTA 1IPHA 4IVPA 5KOYA 4DT1B 2IBSA 2JFBA 2VDRB 4ZEOA 3P4YA 2I99A 3THWB 4FMBB 1C1HA 4JS0A 1KEZA 4HNHA 4E0BA 5LYJB 2YJ3A 3AM4A 3CLSD 4LTMA 1ISHA 3PX3A 2GOYA 2VDNB 4MVJE 4MI3A 5DX8A 4F97A 3JARB 3UVEA 4FEAA 4EFKA 2R62A 2I8CA 3Q8WA 5F5LA 4XTCS 2L82A 1SCKA 3L04A 4FCCA 4Q4CA 2BTQB 4R4JA 5G2OA 3PE4A 1KPIA 3P9CA 2V4UA 2X0JA 3AXTA 3WQQA 1U2QA 1WD5A 1Y3IA 2I1QA 1SJ9A 3IO5A 5K0FA 3U7EB 5BSHA 2D2IA 2HJSA 4Q1FA 1P0FA 3LPMA 1F48A 3OQIB 3INYA 4KN5A 3UHFA 4YV7A 4IXDA 1Q3TA 3PQEA 1EFPA 4JKIA 2YV1A 2VJOA 4BHTA 4OJYA 5IPFA 3S3TA 3EUFA 1NI4A 3LBNA 2K2QB 4UEJA 1N1DA 4UNNA 3A4NA 1Q12A 3D7KA 2CUNA 2G9ZA 4HX5A 3RTDA 2J3IA 4EMTA 3W5DA 2WFLB 4EPRA 4JGGA 1UBNA 2ZEJA 3T4XA 4M7RA 2F6RA 2IU3A 1Z34A 2XUDA 1RLIA 3GQBB 1FU4A 4XJSA 2ZCJA 3F5MA 3LCJA 4FLFA 4HWPA 1BJKA 2A88A 1YDHA 2IX9A 4ND7A 1C4XA 2WWWA 2PRYA 4QJ5A 3WSWA 2ZR0A 2WZQA 2LV8A 4EQ6A 4YAUA 4CFYA 2D0OB 1MQAA 3ETCA 1PSWA 3GJSA 2Z6QA 2XNDD 2XXJA 4TN5A 2OBYA 3X1WA 4EA7A 4UHJA 4UTRA 4JZKA 2PK3A 3K30A 3GYBA 4RORA 4IGAA 1P31A 1SCAA 4QVKA 3NT5A 5H59A 3WR5A 1DBVO 3PICA 2A78A 1MZVA 2A33A 2XRFA 2WVGA 1DL5A 1QDUA 1JKIA 2JGIA 1ODCA 3RAPR 1VSUA 4QECA 3A1VA 1BCSA 4RULA 2AXQA 2B2NA 1DQNA 1JZSA 3HFJA 3LX5A 5HF9A 2CEKA 1KAMA 2QAGB 4YQZA 4RFSA 3GEHA 2IPXA 2XQGA 1M67A 5JNUA 2FJPA 2RBKA 5EJIA 3L4BC 3LDUA 1ECLA 1YUNA 1QO0A 1SHTX 3NHKA 3OF2A 4G1MB 5FL7D 4N03A 5CA0F 2J0QA 1KS2A 3DT6A 4GEKA 4LFCB 3AIKA 1A8QA 1L8LA 2DPHA 3A0RB 1IQPA 3STVA 4TRRA 2CLSA 2EKBA 2GN2A 1RP7A 3FRHA 3K0BA 4ZOCA 3ZWVA 3HSYA 1D4ZA 1IWOA 2ZUDA 4KTVE 3UUGA 4ID9A 3KETA 2EKDA 1A2BA 1GL9B 1BFKA 4QICA 3WBFA 4C0QC 1HR0B 5EAIA 1QP0A 5L4SA 4J2TA 4NCIA 2VEDA 3SF0A 5MF6A 4JLOA 2GSDA 1ZIYA 2P6PA 4NG5A 1RCTE 3H2SA 5AW9A 4EHFA 2GXSA 5HF6A 1GSIA 3WRYC 1V37A 2UUCB 3G2MA 2R8OA 4KO2S 4C05A 2OGUA 2QX6A 1E60A 2HT1A 1UADA 4ZPXA 1TXGA 1J8QA 2I3BA 1QC5B 1U81A 1Z6XA 3MW8A 2OHHA 3X1MA 2OV4A 4YAWA 1HEIA 2YH2A 1V71A 4MKGA 1E0SA 3CCCA 3RS5A 2QRJA 3AEUA 5JSYA 5I3CA 3P0EA 4Q18A 4ETMA 3W9UA 4XGNA 2HQSA 4RBNA 5JHGB 3CUWA 1XQWA 2VNIA 4B7XA 5DBHX 4TS1A 2IDZA 2WV9A 3FYSA 3W90A 2PKRA 3IJPA 3A9WA 2WWVD 4LHSA 3WLMA 4F71A 2AZDA 1JLSA 1UBFA 3PXUA 2FPIA 4J3NA 4GBGA 2XRMA 3FFBA 4KX5A 4NS4A 4QG7A 5DM60 1KWGA 2DGDA 4MR9B 1YKGA 5TRTA 4RPKA 1X94A 4ALMA 4U7HA 4ZGWA 4JYMA 3OQNA 1F0YA 3K15A 3PLRA 4X20A 5DX0A 5F35A 3L3BA 4EECA 1H6BA 1U3CA 4DQVA 1FS5A 1M2NA 1NMSA 1UT6A 2O2GA 3D7SA 1AGNA 3KZXA 3KOOA 4H6XA 1S2LA 1WP4A 3SVZA 1G291 4KWIA 4DA7A 2A8YA 2QPOA 3RRXA 1R4AA 3VAYA 1X19A 2PX8A 3NVKI 2FETA 3GEMA 3M4NA 1YR7A 1PAUA 4RPCA 3MCVA 3ZDQA 1N9GA 1SK9A 4OAPA 1TJPB 2NMVA 1A9PA 5GZ3A 3EIHA 2JAUA 4Z9AA 1YHZA 5I48A 4PRKA 4B3IA 2BFMA 4W7IA 3STXA 1PVOA 1ZYUA 4CNBA 3ND5A 5F4BA 1MT0A 2P8JA 4QUKA 1YAHA 3A9VA 2ISSD 2Y1CA 3PGVA 4RF5A 5FOSA 5TGZA 3GVPA 2BFEA 3I9MA 1M8PA 3DF7A 4N8SA 4GKKB 3LOQA 3T41A 2IYRA 3G85A 1QG6A 1T36B 2GNAA 1J24A 3F74A 3L9WA 1XCOA 1TB4A 4PXYA 1RDFA 2YMLA 1FBNA 3NC4A 1AX9A 5CLFA 2A0WA 4NP6A 4UQLA 3SS8A 3SC4A 1P4AA 4C9BA 4MV3A 3C4JA 4E3ZA 1S0UA 3QUAA 5JCXA 2K6GA 4DLBA 1A1VA 2QRZA 4I5GA 1YZTA 3MOSA 3WRYA 2VP3A 4U2CA 2I0FA 3PJFA 2OCGA 4IRUB 1DC4A 1E18A 4Y2QA 4WV3A 3A04A 4MV1A 2G70A 4JJKA 1TJ3A 4Q9DA 5GIPE 3AUJB 3U9TA 1HA3A 3HXPA 1P7CA 2QRQA 3V6MA 2P9ZA 5FPTA 3AUXA 3OCVA 1EFDN 4TUYA 2LCFA 3EFHA 1VBFA 3IMGA 3UWPA 5LP6B 2JGFA 1XEWX 3AXSA 3H6HA 1YJAA 5DMXA 2H1VA 2JJQA 3U3JA 5D6NA 1XMPA 1TOAA 3F73A 3PT9A 4ZT5A 3IAXA 5EJEA 1GM5A 5JIBA 4KJZA 2VL7A 2XBUA 2C54A 4DIMA 3RFVA 8ABPA 2POCA 1X9IA 1N6IA 3JVUA 4LI0A 3KUDA 3EAGA 4CG2A 2EIXA 1NBIA 2VSYA 3QEJA 3S2FA 2KW5A 4HUTA 1YOBA 3I2HA 2RGCA 3KOUA 3NFYA 3OBBA 4M0MA 4XVRA 4D99A 4CIWA 2I80A 2VR1A 3G8AA 2QGFA 4G23A 2I6XA 3CNOA 4K40A 5F77A 4F2DA 5BV7A 1ZGAA 1ULHA 4FYIA 2BGLA 3RSLA 3ZHZA 1EUQA 4XSHA 4RCVA 4EJ6A 1PV4A 2ZIAA 3ZKWA 4FU0A 3H4TA 2CXXA 1AKMA 4I8DA 2C99A 5F7ZA 1VPWA 4MV4A 4MJ7A 3R23A 4P9NA 2C2XA 4YCJA 4LRSB 2C2KA 4KOEC 2ZJAA 3OLXA 1P2TA 2O6HA 1TC1A 4B6FA 1R4ZA 5KAPA 1QHIA 1R8YA 1T29A 1DV1A 2E4WA 4CV3A 4DC9A 3KWLA 3MAAC 3VHRA 5CLQA 2PD6A 5MN4A 1ENYA 4MITA 1G4HA 4X3OA 4RKFA 4QE3A 3WLSA 1XDDA 4BNIA 2UUAB 1X13A 1A5ZA 1PNTA 4NCHA 4YRGA 1VMKA 1G17A 2O6LA 1ACMA 2C9YA 1WE2A 2OHXA 2FPXA 2Y0BA 4OK6A 4BWVA 4D8TA 1Q0SA 5IVPA 1VCHA 3ETJA 1HDXA 3GCWA 3CO5A 4OM8A 4B34A 3TBFA 4AU1A 1A50B 1AH2A 1VG0B 2XUQA 4LRXA 1VKNA 4RJLA 2AG8A 1ADFA 4FVTA 2PVSA 4RZSA 2YWJA 4RHTA 4F3YA 4U9IS 5K2MA 1B6GA 2R1TA 4IGIA 1ZJYA 3JPYA 1PBNA 3B1FA 4G1FA 2JLRA 3HSKA 1BMTA 1NZDA 3R41A 4H6WA 3N8KA 3D9QX 4UFNA 4OQMA 2FFQA 1SKMA 3SGLA 1RAGA 1ZQ1A 3TUIC 5E6UB 1YR2A 2BL4A 4PX9A 3O3CA 4PCLA 2O2SA 2HRQA 1QDLB 2K87A 4LF6B 4XDZA 2D0IA 1RQGA 4ZCLA 3GARA 3NC1C 5D5HA 3DE0X 3HDYA 4HUQA 3VHXB 2X9VA 4D44A 1J33A 1FJHA 1TL7C 5IJZA 3HUFA 1Q74A 4X0EA 1EFHA 3NGMA 1I10A 2WT9A 2H2WA 2I4LA 4QDTA 5A5EA 2GN9A 4WA8A 4INJA 4HAYA 2WF7A 5FFNA 1G9TA 4P6VF 1VA4A 4OHOA 4V24A 4YWJA 2ZVQX 4NAVA 2R1VA 4X62B 2X5NA 4FDLA 5IKEA 1O95D 2FZ4A 2PZKA 5JECA 1QCDA 4KR6A 2WZCA 2B9EA 1UKZA 1VE6A 1E6EA 4GRAA 3WRXC 3JRXA 2D7CA 1GUDA 2LBPA 4R7GA 4M0PA 1QANA 4BN5A 3T35A 4ITUA 4Q4JB 4B84A 2NU7A 2HR1A 3DBHB 4BE4A 4RWZA 5JT1A 4ZC1A 1V41E 3NCTA 2ZUBA 3PWZA 4NBLA 1SM4A 4UVGA 2X4DA 2ZWAA 4IQ0A 3ZH2A 4WBSA 3FZNA 1OFUX 2PGLA 3THXB 4UBJA 2JVKA 4DJDC 4GWKA 4LBWA 4E07A 2E6UX 4M7PA 1U9IA 1KOJA 3K31A 3U40A 1UBKS 5DPMA 3ICEA 1ZEJA 2W2VA 3CG0A 4BKUA 2WAAA 1X9HA 3OF5A 1WMSA 1UZLA 3SEQA 1NY5A 5JASA 3MOGA 3NHFA 3P9IA 4W5RA 5JDCC 2O20A 1D5CA 1RI4A 3CM0A 3Q0IA 3QXGA 4EM6A 4F1WA 1XL1A 1CY1A 1SQFA 4POOA 5D01A 1QFJA 1NXQA 3X43A 1DEOA 3Q7PA 1Y8RA 4HEA6 2XZTA 3E9EA 1OJ7A 1BE0A 3MWFA 3P4UA 1ZD8A 4JB0A 4PNEA 4MCIA 4W5TA 1EX1A 3SEAA 4MV9A 3TB4A 4MGEA 2GTHA 4JUBA 1USVA 4MUAA 1BDIA 5DO9A 4TS4A 1Z0DA 4Q1VA 2W5UA 5KNBH 2JAXA 1HE4A 5LDDC 3L6EA 1GCAA 3GB9A 4ZVSA 3R9KA 3W3AH 1KRWA 3IKTA 4PLHA 1XX6A 3A4VA 5I8ZA 1QQ5A 5P8WA 2QX9A 4NZNA 1N25A 3D5TA 1U5CA 3EGXB 2J9FB 2QMUA 2E9SA 3RRJA 4XB1A 5CXXA 1R10A 4HPWA 5G3YA 2HUNA 5T7BA 5EHIA 2AZMA 4YBZA 1E3EA 1KO1A 1XALA 5GV8A 1KH1A 2AI2A 2FWRA 3IL2A 3W6ZA 1YB5A 2EGGA 4MAMA 3TCNA 3UO8B 3F6EX 2QTFA 3TRFA 4ZYTA 3R5TA 1MRZA 1MU0A 1N8TA 1TAQA 2BDTA 1X1TA 1XKXA 3CIFA 2WF6A 3F2IA 3P9RA 2OYRA 2ISQA 1L7PA 3Q1LA 4FFMA 4NJEB 2UZ3A 1A4IA 1E79D 2LPMA 4K8RB 2RK3A 4OBWA 5SZKB 4LXXA 3E2IA 2OGTA 3EWNA 1J0EA 4RQTA 1GT6A 3B48A 5I5GA 3DKRA 4YMLA 1OD6A 4I1OA 1KZGB 3JVVA 2ZBUA 1QH1A 2PRZA 2WC1A 3OETA 4KODA 2G3YA 3GOHA 3AEQB 3IGFA 4E03A 3SC6A 1EZ4A 4OIMA 3I34X 1DJQA 3N8NA 3B1JA 3WRXA 1UZMA 2Z95A 5HIJA 4ENPA 3KU1A 4PSKA 3IOCA 3S1AB 3U0VA 5FOVA 4EDHA 2J5QA 3AM1A 2XD9A 4C4RA 4JQYA 1RWNA 3GMIA 1PT7A 3O73A 2PCLA 5DASA 3OFND 1F4VA 3E9YA 1I9GA 5AIBA 3FGZA 4ASUD 4DV6B 2V6JA 1Y33E 4PVCA 3MBKA 3QJYA 3R0QA 4RHUA 3OE5A 4YHBA 3WHPA 4LEIA 4URXR 2PT6A 3PNMA 1C9KA 2IUEA 2JBWA 2FSSA 3NWPA 3A1SA 1E3IA 1YQUA 2ZR9A 1O6CA 4JBGA 4MWTA 1ZVKA 1EUYA 2BFWA 1TUBA 3FKJA 4C4ZA 4HDKA 3F97A 2ZIUB 5JDCA 3KEQA 5LP6F 2I9KA 3AEKA 4HLUC 4V0QA 1FQJA 4DZTA 3V2HA 2PUAA 1YKSA 1GL7A 4JU8A 5DB4A 1PQUA 3A1EA 2QP3A 3A11A 5FNVA 2JD1A 4H3VA 2O8EB 2ONZA 5DH9A 2G1JA 1WU8A 3HQ4O 3J7TA 3N2KA 4O63O 2P7IA 4BL5A 3SFVA 5BUZA 5JRJA 5TQ2A 2BBTA 1W1IA 2JLQA 2HJRA 3AVQA 3KAPA 3P97A 4JXJA 4YRPA 1S7GA 3SHWA 3W4IA 2P9YA 1PR4A 4IH9A 2X5JO 1GGEA 1KP3A 4GWLA 3V80A 1HDGO 1I0ZA 3EA4A 3DP7A 4YVFA 3T4UA 4UTVA 5JMTA 2X76A 3GFBA 1C7IA 1V1RA 4O0LA 3VHLB 2JCXA 4F3TA 1EXMA 4L4XA 3OQPA 1P1HA 1UC8A 4UEOA 2V1XA 3SYLA 3WLLA 4AJHA 1ZNXA 3SZOA 3O21A 4K9OA 2FZWA 3I8OA 3MERA 4XAQA 3AI2A 3MTDA 1SVUA 3OI7A 3QLEA 4QBTA 1D9ZA 4IINA 2XAAA 4I9NA 1PLLA 2Q0HA 5DHUA 4YRCA 3H18A 3DMRA 1GUBA 3EQ9A 4OY3A 5CK5A 3ZCVA 4DRZA 4X97A 1Z45A 2ORED 1E7MA 1UIRA 3TLYA 2PSJA 4XFJA 3KXPA 2ZI9A 2CCGA 2DRIA 3M70A 4FE7A 5DNUA 4D0SA 4AWAA 2F9FA 1PW5A 2FFBA 1VQ1A 1N36B 4P38A 5CG1A 1DP4A 4O4LF 5A03A 2O06A 5FH9A 4K28A 2BMJA 2RH5A 3FPAA 4WUTA 1WXHA 5FBKA 5A5FA 4GZLA 4FXOA 4QULA 4PICA 1EBBA 3N2NA 2QL7A 1AE1A 3IKMB 5ERXA 3P0IA 1QZUA 4HKTA 4BU0A 1FUYB 1UT8A 1JIQA 3H04A 3PTZA 2R6ZA 2WJYA 3CEHA 2G8LA 1OT3A 1TD9A 4BP1A 2MDTA 4ITVA 4ABYA 1C3XA 3MBIA 3BCUA 1RQ7A 3ENZA 1ODLA 5D1NA 3V1TC 1P1CA 1A3CA 3K35A 5ES4B 4KGVA 3DHYA 1C7EA 1GFSA 4FDUA 3VOAA 5KIAA 3IELA 3ZLUA 1OXTA 4M1KA 3S8EA 1QFXA 4Q3OA 5IJ9B 5CT4A 1RPZA 1OC2A 3UXYA 2IU6A 4QT0A 3ZWYA 3ZI7A 3A2KA 1UDCA 2WKQA 3S68A 1WEKA 2GXUA 1P9NA 1Q57A 1M1YB 4G56A 1RI1A 4HLUA 1P0QA 3LUPA 3O6VA 1UWKA 2J3LA 3EXFA 3LC2O 2Q9UA 5D3MA 2PMBA 2X2PA 2V5VA 4AO8A 3WMGA 3LS2A 1ULSA 2FFRA 4M1ZA 1W52X 3C16C 4Z1MD 5JLAA 2CHEA 2H54A 2C1ZA 3ZOKA 2D54A 5LD2C 3U7HB 1UBSB 4IV0A 2XMBA 3TZHA 2SKDA 4IDOA 3ZX4A 1ZFNA 4O0MA 1VECA 1W36D 3RS8A 2X8LA 3IPLA 1BMFA 3WQRA 5A6SA 2EU8A 1RHUA 3QBDA 1EJ6A 4G07A 4O4HA 3WGOA 4XWTA 4J6FA 3DZGA 3C8DA 4AZ3B 5DLPA 5KKNB 4ZO8A 3ZDDA 2TMKA 4NH0A 4R2JA 1GG2A 1JDBB 1G7TA 3DMPA 3GC6A 4M7WA 5EMMA 1E7RA 3GAAA 3MRVA 3BREA 3PU6A 1I2AA 2IHKA 2QG9A 2XVYA 3FBTA 4MVJI 3N7AA 1JDZA 2UV8A 5B37A 5A06A 4XVQA 1Q92A 2H9AA 2BY4A 3OO1A 2I3AA 2RGWA 3CNHA 3MJVA 2I6UA 5JMWA 2BEWB 4BJHB 2JS7A 1SU7A 3C7DB 3I0ZA 5EE5B 1XZ8A 3R7BA 3FPSA 1EHIA 1YUBA 4WLUA 3U39A 3VDQA 1V9LA 4KGDA 3WLEA 4LJSA 3QVSA 5A7FA 2QMHA 3WWCA 3U5ZB 3VTKA 3HE3A 3QNUA 3AJ8A 3MWEA 1YRHA 3IDAA 5DEOA 5CDGA 2AZ4A 3EW9A 2WIDA 3R3WA 1GQQA 2XCOA 1JG4A 1D6NA 5I4BA 3RHFA 4ZT4A 3D7RA 5KOHA 2I22A 4DSTA 4EYKA 3E7PA 1CERA 3K70D 4DGQA 4RTSA 4MUKA 3A9TA 4GI7A 2EZUA 1RBMA 3ZZUA 4EFMA 2R85A 2XE6A 4WJKB 1Y1LA 4UTPA 2ET6A 1VCNA 3EWIA 1OXVA 4DMLA 5DTMA 3R76A 4QODA 1ZH8A 3ZWAA 3Q5EA 1I1OA 1AV7A 3HYNA 1XKQA 4GYWA 4AZWA 1FS4A 3H11A 2VDUE 3GL9A 2WB4A 2XH8A 4P3YA 2NN3C 4PRYA 1TGYA 4Y7DA 1Y48E 1UCFA 4D74A 4D0GA 2IYSA 1D07A 4M38A 5IEBA 5E4YA 1GZ6A 2P1ZA 4NENB 4R2IA 2L18A 4TXMA 4ZRDA 2NXNA 1NOJA 2W11A 4DIEA 4EEXA 1X8KA 2XWQA 4R9NA 1UPFA 5KQPA 3QEAZ 3T52A 1AKRA 3VH3A 5BXYA 1UZAA 3D4IA 1I3OA 1IG3A 1PS8A 1IEQA 3QX7A 1AO0A 2FEWB 3FD8A 1DOHA 1HZZC 2ILVA 3B5IA 3PFNA 4GECA 3DLBA 3KJIA 4LDNA 2RKBA 1JH8A 2WD8A 5CLLA 2PY6A 4HEHA 5SY4A 1QGYA 4QEDA 1U7UA 3X0DA 3IHWA 2V7GA 2N47A 3L8CA 1MNAA 2PSSA 4TKUB 1BW9B 3I8SA 5IJWA 5KDOA 4EPWA 1RHKA 5DNAA 3AY7A 4A9AA 3IQEA 2BRUC 5KJ6A 5ILQA 1HBJA 2OPBA 4A0SA 2H1FA 1M8GA 4P0QB 2P35A 3UPTA 3L0PA 3EPRA 3TE6A 1CHNA 3HCWA 1O77A 1R6XA 3CGWA 3AGPA 3DZDA 3Q5GA 4XIJA 1ZMRA 3UHPA 4F9GA 3K6SA 4P4GA 2Q9BA 3U31A 2J4FA 4R1MA 5M7EA 5ABPA 1XMOB 3A3NA 1KQFA 2QV0A 2V6GA 2FN4A 4UZSA 1WQ3A 5M34A 2FUKA 2AMVA 1KMMA 2I4OA 3PC7A 3DHNA 4B2LA 1GYRA 1U5BA 2FSGA 3AV0B 3EG9B 3D6JA 1DCTA 2ZXFA 3G9ZA 3T1HB 5KEIA 2JBAA 3B1ZA 4HZUA 3TQRA 4R6WA 4HY3A 2A9RA 4O1HA 4KN8A 3VBCA 3TG8A 4F8YA 2R6AA 4BRSA 1XAIA 4NE7A 3O8OA 2P62A 5CM8B 1NFFA 2WJWA 2O7SA 3PL5A 4OQEA 1S89A 4NNJA 3OOHA 4DSUA 3O90A 4BB6A 1UJ2A 3HMKA 4OHZA 3WC4A 2P67A 3I9NA 1OBHA 3NUZA 4U3JB 5F5XA 4N47A 3OJLA 1EFCA 3HM9A 3W5UA 2JJYA 3QVWA 5KBYA 1G5HA 4ROTA 2GRJA 3D3WB 4WY2A 2R25B 4OTZA 3SPXA 2X41A 4OLJA 4RTNA 2FJUA 2WJ6A 1ZSYA 3CTPA 3B2QA 3UTCA 2WP0A 3VOSA 3R9XA 1G6KA 5KNCH 4QPPA 3OMWA 3RC8A 1ISSA 1IY1A 1CQZA 2HNKA 1Y98A 3G02A 2VQSA 3IPYA 4HXYA 4DMFA 3AGQA 4X54A 5EXXA 1M2OA 3IHKA 2QE6A 4JVMA 2F1RA 4BB0A 4FZ3A 5BMVB 1J9EA 5LZ9A 3A2LA 4F86A 2AOUA 3BSWA 1PGOA 4RACA 3C7TA 3D1JA 3UW1A 3G5TA 5IAKA 1DT3A 1VB5A 1Z0JA 3C3KA 4E5UA 4DYVA 2PKEA 4LWOA 4A0RA 3QLVC 1M0TA 1C3LA 3T3GA 4Q66C 3ZU5A 4JLNA 3UAVA 3DL2A 3KQLA 4C7OB 1UIMA 2BRUA 3TW8B 4V38A 3ZHTA 2G9NA 3KR1A 4L0DA 1NXSA 3UUWA 4WX2B 2VCHA 3RI3A 4MQBA 3O83A 1JN0A 4YJ3A 1OBVA 2C4TA 2LD4A 1U7OA 2Q8QA 3OLQA 2ZUFA 1NT4A 3THYB 1ZGZA 3Q15C 2Q07A 2XSZA 2A9VA 3IP1A 1PGNA 3HL0A 3PC3A 3HA7A 3ZCXA 1C0IA 2AWOA 3GP3A 4OUDB 1JQBA 5FB3A 4CQLA 1FVOA 2WIJA 5JNVA 1G5RA 3OJEA 2HYIC 1E5QA 2JIMA 1PX2A 2QL6A 2QSJA 1S8FA 2Q6KA 2QRPA 4LE0A 3I6ZA 2WK1A 5A3JA 1SRRA 2QRVB 1WXXA 4F11A 3WMRA 3CUKA 1FXWF 1GZVA 2FKNA 1STOA 5AI4A 2C2GA 4AMBA 1JA0A 4C29A 1P9WA 4DXHA 3SC2A 5K1ZA 1X38A 3ZVMA 5IKOA 2J0UA 3ZCQA 5BUCA 2WZBA 5HK9A 2G9UA 3KXIA 3J81k 5HKKD 1QH8A 4RW0A 2Z3WA 1RT9A 3DT9A 1NW8A 3DMGA 3OZBA 1JSRA 3R5HA 4F6CA 5A62A 2YFYA 5DYIA 1UDXA 1HE5A 1GNVA 1Z29A 4NCXA 3R6WA 4OKSA 3PGMA 1A8PA 3MAGA 16PKA 3T3NA 5ICSA 4PYMA 3OTHA 3DYIA 3VX4A 3E58A 3E3OA 1NI3A 4JEHA 3WB9A 1QF9A 1RM4A 2IYOA 3WADA 4CI0B 1KZ6A 5JFOA 4KQJA 3OZSA 1X3LA 4AS3A 1Q2XA 4BMVA 4EIWA 2C1EA 4JT4A 2FVXA 3NNNA 5A5DA 3LH5A 1W29A 1QLWA 3PNPA 4KAXA 2B0CA 2ZWOA 3HZOA 5EESA 3BGVA 3ZYZA 5B4VA 5JXJA 5KYWA 1PTJC 5CD1A 1QS0A 2XYGA 4TV8B 3PVSA 2CL7X 3K20A 3TAUA 1DWPA 1GG9A 2QXYA 1V8DA 3QKSB 4C30A 4BLPA 4ZGGA 4NK5A 3EUAA 1HX7A 3OWHA 3GLFE 2JBHA 5HIKA 4TSRA 1T0UA 3NHRA 4JSRA 1V7QA 2FV8A 3B12A 1W5AA 4A26A 3KQSA 1P2FA 1UOOA 1DAOA 4FT2A 1GGKA 3NAQA 4UXHA 1OHHA 1U8EA 1UXGA 4JA0A 3WFIA 3TX2A 1K86A 2ARKA 2ORYA 5BQ5A 1S2GA 2O1EA 1KBQA 3QLVA 4Q03A 2Q2QA 4W63A 1DC8A 4E2ZA 3ZGYA 3ZZ0A 1IN1A 1CV2A 1GRNA 4RK0A 1SC9A 2HHLA 2NU9B 5I4IA 1YA6A 2YIMA 4XLZA 2NO9A 3RUAA 3D4NA 2C5HA 4BFZA 1GTVA 3KQPA 1R18A 1R6BX 3IAHA 4XQ9A 3DKKA 5DEIA 5IDQA 5GMOA 2R96A 3VR5A 4A0QA 4IWXA 5BYJA 1JH9A 1CQJB 2Z6UA 3UMVA 1HE3A 2ZWVA 3DE6X 3PUIA 5J4YA 1CVRA 2VJMA 3KQNA 4WUVA 2VT2A 2CHVA 3AERA 4BKRA 4CM6A 4E5SA 2C9DA 1F2TA 2HIHA 3KJEA 4HPXB 2GO1A 1NNEA 3RIMA 4TQAA 3CH7A 1R37A 2HRRA 1MNQA 3QG5A 3NT2A 1PX0A 4GNKA 4MWZA 4RU1A 1Y8QB 2B5VA 3SI7A 4YWHA 4D42A 3CPHA 4J0JA 3RVPA 1FMCA 4MWEA 2H7YA 1AF4A 1SMKA 2FW7A 1OXBB 3GD5A 4IIXA 3EEQA 3DEFA 4UOQA 3RH0A 1EUZA 4NABA 4J1QA 3EMBA 3VTFA 4ZCIA 1JZQA 5BWOA 4C4TA 1GPNA 2FPOA 1L5FA 3QXHA 3LNCA 4GM0A 5DHPA 3TH5A 1Q0ZA 3PSHA 3BN3A 5LKAA 5ECDA 5H8WA 1Y5RA 3BXFA 2FUCA 3A36A 3DZ8A 3MLEA 2GXQA 3H1AA 1AUPA 3CVVA 5BPHA 3TCKA 1GNSA 3DWEX 3KYCB 4LHWA 2WJ4A 3GEIA 4TWAA 5MN6A 1MZPA 4WZ6A 1LSSA 3LGXA 3Q41A 1KY5A 1LC0A 1HDOA 1TRKA 4MW9A 1HUQA 4KRGA 3SP1A 1JJAA 3Q2KA 2UYQA 2N46A 4LDAA 4OCZA 4P5EA 4QGFA 5EHQA 5IJ0B 1JKJB 2CT8A 3C48A 3IP8A 3H2KA 3U49A 2ZU0C 3WLHA 1EFAA 3PX2A 2FUEA 1SCBA 1V47A 2JW5A 2R65A 4NECA 1EP2B 1NPDA 4NXMB 5E7IA 1PTJA 4QDKA 4RF4A 3LECA 3FPKA 1GT91 3EVBA 5F5NA 1CZNA 4AMZA 2GEVA 4ENSA 1BD4A 3LV8A 3QLTA 4JUFA 4TSKA 2Q3CA 2QRKA 4CM3A 1SUDA 2PX4A 2VWQA 2RHHA 3GN2A 3QE4A 4YP1A 2H06A 4QA9A 4V02A 4EL5A 2MYTA 3C5WP 3FUUA 2ZJBA 1QF7A 4TQUS 2A5JA 5E1OA 5ALPA 3EYWA 1Y7PA 1DC5A 2CGEA 3OEED 1F8GA 3Q12A 4HGQA 4R1UA 1KVUA 4UEKA 4X5OA 5IBPA 3WNDA 3ANYB 4X1KA 3D5QA 4KC0A 1DG9A 4KO3S 4L76A 3CEMA 3QE0A 5EYPA 4KIWA 3U9SA 1EWVA 1U1EA 4W1RA 3K9BA 5JSFA 1X39A 1Q6ZA 4Q21A 2XDYA 5CVUA 4PZDA 1I8TA 2P68A 1JFTA 2W90A 3CB2A 1CZHA 1E5TA 5HMLA 1GWNA 2WE8A 2E4XA 3HKDA 4P35A 4E5YA 1MB4A 2KLHA 1A7KA 3PHJA 4HDAA 1ZRNA 2NO4A 4C01A 2QLLA 2W2XA 1ZKMA 1GU0A 3D54D 3NDJA 3GVCA 1IY9A 3VV3A 1CXZA 1ZESA 2IEYA 2NIPA 4IX9A 5JRDS 1M1UA 5H3LA 1FP2A 3B78A 3RR2A 5KCZA 2F43B 1BMDA 2HJHA 2Q7DA 4MI1A 5K0NA 4WNAA 1Q7CA 4Z4EA 4JZYA 2P4HX 4H1HA 2IKQA 3IP3A 1LBEA 1JI3A 3DKIA 3KKKA 5JOQA 4HL6A 1EHCA 3QLUC 3BB4A 3VZCA 3BZBA 2NT3A 4HLNA 4FFRA 2R2GA 1WR8A 1Y8ZA 2SHKA 4DYHA 1E32A 3A7EA 5BMVF 2P41A 1ZAYA 3D4OA 2LVBA 4UU0A 3KYDB 3QELA 4C3ZA 3UOAB 1PG0A 2RGEA 4F85A 3C8MA 1G4AE 4EG3A 1HEYA 1G20A 5CIWA 1S9DA 3O1LA 3ZCPA 4YRIA 3HO8A 5GAJA 5KNCD 4J0IA 1MQSA 2VHWA 4P22A 4W5JA 3WO0A 2OBFA 1ZH4A 3D3NA 2FMTA 4RGBA 4N0MA 1K7YA 1WRBA 1ZU5A 2AGVA 3FLEA 1TLFA 3H2ZA 3KOZA 4L1KA 5E2BA 4M53A 3FNBA 2XUJA 3X2SA 1SXIA 4U63A 4RIFA 2A84A 2V55B 1GAWA 4K88A 3LE8A 3KPVA 2PJZA 3F6BX 3JAKB 1AZTA 4CKZA 2P2SA 1HEUA 1KFBB 4RKRA 4WGGA 5BVGB 4FS8A 2ENWA 3UJBA 1MV5A 3LIIA 2HCFA 3N8IA 3SR4A 4DDMA 4QHSA 4PLZA 4YRKA 1YE3A 5HUJA 1PTKA 1QBGA 1J8VA 3HU5A 4OA8A 2O7NA 4PWYA 2CN1A 1CUIA 1OUMA 5JS6A 3REFA 5AVJA 1JIXA 4OLHA 2FSPA 3U5TA 2QRHA 3W0LB 4FYJA 5JSHA 3R8FA 2IYYA 3IIMA 2BFBB 2QV7A 1FK8A 5ESDA 2OXIA 1U8TA 1ZMOA 2ECFA 2QP9X 1PJBA 3OIFA 3IDOA 2I4TA 4OREX 1K5DA 3IS3A 1MJ5A 2YWFA 5JYDA 1EQUA 4JB3A 3T12A 1KTIA 1ULUA 3QY9A 4NZZA 2CJYA 4L5BA 1XZMA 3GIWA 1WZCA 4Y8VA 4X6YA 3GRFA 2EHDA 4JR0A 2JCYA 2O8CB 3GN1A 3R6TA 3TF5A 4PGFA 1KJJA 2QN8A 3T1VA 1CE8A 3JQDA 5FOQA 1CZLA 4PQRA 1EXVA 5JD3A 4U4AA 5CGZA 5K0ZA 1SG6A 1BCRB 1SBCA 3M3DA 3UJCA 2Z1DA 3JQBA 4YGYA 3VNAA 2PWAA 4LKOA 3TIGA 4QYMA 3ADKA 2V5UA 4E7PA 5K51A 4TYYA 3GMSA 2H5IA 4ARBA 2ZZNA 3GIDA 1DKPA 5G4LA 1KR5A 3WXBA 2VHQA 4EFNA 3C5HA 3QLUA 3EC2A 4OJNA 2E4UA 2WTNA 1NG1A 4CODB 1IOZA 4LXUA 2JZOA 3RBZA 4DXAA 3FZYA 4D82A 1QCZA 1Y5NA 1IDN1 2AF4C 1DO2A 5ADHA 1W6RA 3WKCA 1VBNA 3KR0A 1JV2B 3GXBA 4HWOA 5CBKA 1KETA 1U1FA 5CCDA 3UMYA 2AQIA 2GZHA 5K0GA 1V8OA 3FF1A 2IUTA 3K05A 5EXEA 3O82A 5CYOA 1I32A 4XLTA 4DJAA 4FYVA 4PW0A 1PSZA 1KHTA 1QHNA 3U60B 4AJPA 5ICEA 5L9AA 3CN7A 2J5BA 3E81A 1HDEA 2RB4A 5L45A 4RM3A 4MUHA 3JQ8B 2PD4A 1P8JA 3L7LA 2PXCA 2GD2A 4ZMSA 1QGUB 1N6HA 4X1IA 4NNOA 2NADA 421PA 4BQRA 1RM0A 2XIQA 2IYAA 2P6NA 2ZB4A 3K4QA 3RIYA 1IH8A 3X1JA 4NLLA 2RH8A 1WF6A 2Q0SA 1M73E 2AA3A 5I9TA 4KE6A 5FRDA 3KQUA 1H8EA 3AG6A 3UOWA 3VI3B 5CB4A 4FKMA 3T3DA 2AQKA 2HV9A 2OMKA 3QUQA 3LKVA 4JC4A 4WOKA 3RDPA 1A88A 3T9CA 2OP1A 5KAMA 1JU3A 2Z1MA 1JQJC 5CEEA 1P5FA 4LJ6A 5JAMA 1IPFA 4DNOA 3E8XA 1YZYA 3QQ5A 4OM7A 3VKVA 1EIWA 2V97A 1EFRD 1KO7A 1RLUA 3ZLTA 4AN0A 4L0MA 4EY7A 2XT0A 2ZRLA 4YDSA 2C8JA 1XPJA 4FEGA 1U28C 1PFQA 2ZJ7A 4BRUA 5HBGA 4MMYB 4F93B 1KE2A 1AB6A 5AM5A 1XZAA 2NVOA 5HOQA 1T6NA 3NQ41 5AVVA 3C3YA 3UT5B 3M6VA 3TZEA 2X58A 3M1LA 3BIJA 4BMCA 4OHCA 2A7XA 3UV3A 1UBRS 4ZT7A 3TRDA 5GONF 3CYFA 4MR7B 5FBLB 1CUSA 3EF3A 4DA4A 2YXBA 1GL6A 1HDCA 2JIPA 1J00A 2P4UA 1MOZA 4BQNA 1ZW6A 4Z0HO 4KL8S 2R5WA 4Y6SA 4D98A 3ZJVA 3PXDA 1SU8A 3ZGVA 2HYDA 4K6CA 4KPFC 1TKCA 3CTMA 2RAFA 2V7BA 3BHMA 1CY6A 4LYFA 4V0KA 5THXA 3TM5A 1X7WA 3DLPX 3W7VA 2VYND 4AY6A 1J06A 3GGSA 4ZI5A 3L0CA 3LMKA 1Z38A 4OBXA 5BVHA 5KZMB 4ZAZA 1VCMA 3CH6A 2JFYA 3ZS9A 2QRNA 3LUGA 2GJ8A 2ZUTA 1IOVA 2NV0A 2HTEA 4V3CA 3C97A 5M29A 3P9XA 2R60A 1Y37A 4EUEA 5C37A 2ZT6A 5DNEA 3HFGA 2DJ5A 2DWOA 1KQ3A 5D5PA 4M1YA 4WKCA 4XQGA 1BDJA 2ZWMA 1RYBA 2WWTA 2NTJA 1YQ9A 5ED0A 5B5SA 2RBGA 1N5DA 4QU8A 3RROA 4KO8A 3PQ2A 3KDSE 4G24A 5HEKA 2VDJA 1T1JA 3DR5A 1NDHA 2A5YB 5AKXA 3T5BA 1U7WA 2QY6A 2R6FA 4LCJA 5CFZA 5I51A 2PUFA 4E22A 3T5AA 1Z2DA 2R79A 2ZYRA 3DOCA 3N8GA 4LMBA 3ROMA 3UXHA 3WAKA 4D8VA 4BECA 4OXIA 3HDJA 2G08A 4YLEA 2WKRA 1F2UB 5AHXA 3KNZA 5ENDA 2PZFA 4ZO7A 4C2TA 3K73O 2CXTA 1IHXA 5JS2A 1TT5B 4PQFA 1EUCB 5G4KB 3EQ2A 4HEQA 4OSEA 2RHOA 4ISCA 3VPSA 1NE2A 1UFVA 3N2EA 4PTYA 3MBOA 4QD3A 4XYEA 2XJ9A 3R44A 3VNBA 1CRQA 1AF7A 4EATA 1ID8A 3KSUA 5F98A 2V98A 2R5NA 2VBGA 4LZJA 5EKXA 2MOKA 2NZYA 3DTTA 4FMCB 2IZZA 2YR0A 4OAOA 3RC2A 4IIJB 2IP4A 4WNCA 3EZNA 3QPUA 4O02B 4Y6PA 5DDIP 2ATCA 1VPLA 4J90A 4DV1B 2OCXA 4WE3A 4H31A 1E92A 1EVZA 2WIBA 1UM9A 4LIPD 4Z4CA 4D92A 1U28A 3RVQA 2W42A 4LGYA 4JL5A 1TAUA 3EDQA 1FDIA 1IQRA 3I64A 1JHUA 3VR6H 4EP1A 4QPZA 2EEPA 2B4TO 3FOBA 1AXRA 2CVHA 3IT2A 4UHHA 4GLFA 4JI0B 1PF7E 3BMOA 1NVXQ 3QP9A 1MB0A 2B98A 1V7CA 3NV7A 4LDJA 4TVBA 1ZXLA 4CHTA 4UHCA 4HGPA 2Q3MA 3VU9A 1GKIA 4DR2B 2AG0A 4B71A 1A5TA 2C83A 5HFNA 4IV5A 4ZQEA 2F9LA 2HW8A 2H9IA 4MLZA 1XAJA 2R8ZA 2Z2JA 4NQZA 4B7ZA 2GBIA 2BGWA 1DPGA 4R2XA 5J47A 2UU9B 5DM0A 4WZAE 1ONBA 4AQ7A 1WXGA 2DKFA 1D2GA 5HCNA 2ZDHA 2YWGA 1E89A 1QQAA 1I33A 2D1SA 1GKLA 1C8KA 3I2KA 3QYFA 3NIWA 2WTBA 4WWHA 4CCAA 1LNZA 4A36A 2PANA 4BQQA 5BYAA 1J4AA 4ZO9A 1X15A 4JI1B 5HX7A 3PJRA 4DM4A 2O0JA 2OQRA 4FP9A 3ENQA 1VI2A 3MLBA 2Q8PA 4JVNA 3ZNQA 3KHUA 4YMWA 1DQRA 2GZAA 4FOLA 3PKJA 4IICA 2AMFA 4XDHA 3NTQA 1XYVA 3ZJYA 1DJLA 1VJRA 4MWBA 3TVDA 4ZU1X 3WDLA 4C2AA 1HQDA 1F0KA 1RKUA 1SKUA 2YJTD 1JLHA 1GGVA 1RQRA 1W4CA 1QJ4A 4B3SB 4D9KA 4RZQA 5AXBA 4XOUA 2FN8A 4Q15A 3GT4A 1RFGE 3HCEA 3HABA 4QUGA 3WE7A 5EWLA 1TYBE 3U17A 1GEGA 3UK7A 1G6HA 5K3BA 1AS0A 2ZUVA 4Q4HB 3T5CA 2WT4A 4ZVRA 5DYNA 4JP3A 3KSRA 2GAOA 4JBNA 4IUCS 5DF1A 5UKDA 5A4MS 1P81A 2GRAA 3TIIA 3AP2A 5KOJB 4LY6A 3ONFA 1T8PA 3FXAA 4MAAA 3GEDA 2CJPA 3VZBA 4XYLA 3ZVLA 1W4RA 2JAWA 4RSMA 3LXUX 4Q9JA 3SQDA 2WICA 3WI7A 3WYCA 3DD1A 4IJQA 3RREA 1QP8A 4X93A 3C7KA 3HGTA 2Q1SA 1IJBA 5ICGA 2C4MA 3BF7A 4FNMA 3DTNA 1WLYA 2AFIE 1Z5OA 1L7DA 3KUXA 2O0KA 1BS2A 1H65A 2UVPB 3TOXA 1KMNA 3ER6A 5G0UA 2G28A 3C8ZA 5LZ2A 2GMWA 4B33A 4XKJA 3EPHA 1TVKA 1BN7A 1CUWA 2XVZA 3A26A 2QORA 3DA8A 3LDGA 4OI4A 3X1XA 4YPVA 3CJTA 4MMZB 3N2YA 1I1HA 2YVAA 4X1YA 4Y9DA 5D85A 4ZTBA 2X0NA 3HC7A 3OBIA 1XRPA 1FDVA 3QOXA 3FWHA 4C21A 2RARA 5AVTA 1J25A 2CNDA 5AVZA 4Q3DA 5J4KA 1EZZA 4J9UE 5J63A 1BE6A 3VZSA 2BFPA 1UK8A 3PGA1 3GLRA 1P6XA 3DL0A 1WSWA 3JPWA 3VR2D 2FWPA 3B1XA 1JSZA 3CPJB 1Z6PA 3FSRA 1E1QA 2C4HA 2R84A 4N5NA 4YIKA 5DMHA 3X1ZA 4TPKA 4B32A 4CIBA 1KU6A 4JKOA 4L5JA 5L3ZA 3V4PB 3BFJA 2CK3D 1EVIA 3WK5A 1AMOA 2ZAGA 4EJSB 4CEIB 1OAKA 5SICE 1FX0A 1X86B 4M2LA 1PZEA 4US0R 2QYHA 3BB1A 1N5IA 1SOWA 3BHJA 3TEJA 2GPNA 3IQHX 4GIBA 4HTAA 3G82C 3HCPA 3ZV4A 6YASA 4MKFA 1USIA 1EFVA 2CWWA 1BXRA 2IPMA 4KWEA 3CZCA 1NDUA 1YU9A 3I53A 4GR9A 5ITSA 4D46A 5IT5A 3ITEA 4ZVLA 1A98A 4CMEC 3H9UA 2ZK7A 4B35A 1ZU4A 1WMFA 1BRTA 2AIRA 4S1PA 3U6KA 4EKDA 2Z43A 3EEBA 1C7ZA 5H4GA 3B8EA 2OK7A 3IAAA 3QJ5A 3EXHC 4L6AA 3EXEB 4LF7B 2IHBA 3EDMA 3L4JA 1QPZA 4MDFA 4JQSA 1R5OA 4JHLA 2Y0DA 3T9DA 1VIAA 2XB4A 2V9ZA 4UUBA 3VR4H 5C5DA 1SVOA 2YNMC 4CT0A 3TSOA 5H5JA 4EG5A 1U9YA 3BGIA 4TT8A 5EIHA 4BZXA 5LXTA 1E3WB 1VA5A 5DCUA 1G21A 4CMHA 4WZZA 3QM1A 2NXJA 4FTWA 1WQ4A 3PUYA 2RDMA 4UASA 4JWKA 4MTLA 1JYEA 3ZD9A 1E6UA 2B5WA 3BIXA 3WZMA 1M7GA 3OM9A 4WAUA 4D3SA 2EKPA 4IEFB 5DM4A 1JHOA 3RBVA 1K3UB 1KFKB 1Z9BA 2Q5IA 4D79A 2K7FA 2FZVA 2FK7A 3BQ9A 2ZR8A 3W77A 3FOZA 3SF8B 5TQVA 1LV7A 1U3FA 3K9LA 4TV9B 1CIPA 5CT6A 3VPHA 3FI9A 4NMMA 3QU4A 4ZKEA 1CB7A 1FTGA 3G79A 5KYUB 4DTIA 1RWXA 5NULA 1B6TA 1CJCA 2C07A 4I9HA 4N3NA 4O4IB 5FIUA 3WLTA 4A6DA 5C7LO 4PAGA 4J3FA 1HPLA 2B4KA 2EQ5A 1HFKA 2L2QA 5LQUA 3ZDBA 1A96A 3FDJA 3QFTA 4GBMA 2ZZKA 1QF6A 4M0UA 4I1RA 4JFRA 2VJLA 3X1KA 1AK9A 1G41A 3E03A 3T9EA 3HA2A 5CFLA 4GX1A 2RGNC 3H5OA 2WIFA 3OAAD 5AUPB 4Y2RA 1D4FA 1X8XA 2Q1TA 2VXCA 1X7GA 5KKCA 2BJVA 4M6WA 1UZUA 3PK0A 3D2CA 2KX7A 2A5GA 4FMCF 3UV6A 3O9ZA 4FGSA 4CUKA 3AF3A 2BE7A 3I1IA 1ORRA 4GYJA 1FYWA 2GCOB 1RJGA 4R9UC 2OFOA 5G53C 4TSFD 1VJTA 5C8VA 2PV0A 2XB9A 1E64A 4QYWA 1DIHA 3T8YA 2VHZA 4NOLA 4Q3LA 2XTAA 4CBVA 1I7NA 4KQEA 1H2HA 4CMEA 2YJZA 1G3MA 3DCIA 3P5SA 3WHIA 2GPJA 3I3SR 3ZE6A 5KTKA 1A8IA 4RCYA 4IV8A 1JQEA 3QVTA 3EIWA 1D2NA 1JU4A 2FDXA 3OTGA 1FVHA 2DFNA 2VYQA 1PD0A 3G1WA 3WJAA 4HH1A 2VJAA 2JH3A 3EXHA 1MGOA 2QYTA 2B1QA 4MPJA 1PGPA 3PPYA 3V3KA 2B1IA 3J80A 1QYVA 3MPUA 1LVHA 1N2BA 4KYUA 2FVYA 2H1LA 4IIFA 3ILXA 3ZHSA 5BNZA 5FEUA 2QX4A 3F8WA 4GP9A 3VR6D 4Z49A 2YNMA 1K1EA 2YJ6A 5ES3A 1ZUHA 3ONDA 1L4HA 2Z9BA 2A0KA 1B1CA 1R00A 4ZOAA 2PTHA 2Y3IA 3NBZC 4RABA 3H1TA 1UPBA 4X60A 5IH7A 3KQTA 1Y3AA 3WLAA 4EELA 3N0VA 1Z74A 1ECBA 3CLUC 4EQZA 4UPDA 5MN5A 1I0IA 2IVFA 1N4DA 3PVZA 4M1QA 4TLCA 3ZD8A 3FPEA 4BUCA 2X9GA 1TK2A 4NSNA 2DPYA 2YZNA 3B5EA 2DPLA 4R8KA 3ROTA 2Y9PB 3EIEA 3CLTD 4ZYYA 4JBWA 1N32B 4X8MA 2V54A 3R5KA 5E6RA 3OZRA 5GY7A 3EEYA 3COYA 4RL6A 2XWBF 2XDWA 2VP4A 1R6TA 2DPMA 3N7UA 2YWXA 4OI0A 2QLMA 3VYUB 4D4GA 1CR4A 1ZRHA 2FUG6 1UAYA 2FR0A 3IQZA 2D7DA 4TRNA 2QBYB 1RPAA 4WL0A 5HUQA 4UUQA 2OB2A 1Q1EA 3GFGA 1OR8A 2ZRQA 1G20E 3WLJA 2B8JA 3MK31 3UAOA 5JQGA 1FP1D 2CMDA 2X9LA 3L77A 1NN1A 1EK2A 4XH9B 5EFOA 5HCIA 5HQ3B 4R6XA 3V8PA 4X9XA 1X1RA 2BKLA 3NHSA 3VYRB 5CPBA 1DUSA 2RGNA 1VRVA 4R41A 2EFDB 5JY1A 1TQ2A 3T15A 4P98A 5THKA 3RFFA 4BKOA 5GGXA 2O0LA 2ZYDA 3T3EA 5KJFA 3RIGA 3FOFC 2ZIXB 3PXBA 3K4HA 2Z56A 2LKCA 3QU5A 1ULZA 1DRUA 2J30A 3GWGA 2GH1A 4G84A 4J0KA 4RADA 3W2GA 2GN1A 2KHZA 2FP4A 4M99A 4I81A 4ANFA 2WAYA 2R9VA 3DFZA 4M8SA 5FWYA 1YBHA 3D4PA 5EPEA 4CDNA 4DY4A 2IRWA 4ZI7F 2PUDA 1E1NA 1EEXB 1NATA 3K6JA 3QGMA 1WSBA 1JEJA 3QZUA 5A9TA 1QH9A 4KLZA 4M37A 4ENQA 1XD8A 1YRQA 3MUOA 5FD8A 2ZM5A 1TZCA 3B20A 1SU6A 4D6PA 5E4FA 4U6NA 4P83A 2YRXA 4ESEA 4QNMA 3CJQA 3B13B 1N77A 1NUQA 3I39X 3SJ7A 2D2XA 5L7YA 3GGCA 3I58A 2LXNA 3K0HA 4HTFA 5EI5A 1QP4A 2PMCA 1ZRSA 2XAUA 4X7PA 1HKUA 2DPGA 4XQ0A 3NBXX 4R0MA 1SD1A 4MAFA 1UKCA 1ZVJA 5E4TA 4AX8A 4L8FA 1KBOA 1DCFA 3DSRA 4TQ9A 5EJ4A 4BNVA 4B3GA 1JHPA 2E7ZA 3G0HA 1X3SA 1C8BA 3VUFA 4LNUB 4ALNA 4J29A 4Z3OA 2GFIA 3WB1A 4G0OA 4A8JB 3MT0A 2Q2OA 1II9A 4OVKA 4CMCA 4I19A 1RXUA 1V45E 4NMHA 2WWYA 4CM1A 1BS9A 5P21A 9ATCA 1ZL0A 1TYAE 4OU4A 4YCMA 1PWZA 3FRIA 3G7UA 3KXLA 3M2PA 4R1TA 4RTJA 3BJIC 3S1LA 2IXFA 2IYQA 3GA0A 2IWHA 3C1TA 3E1KA 5HS6A 2ZUWA 3TNYA 5H3CA 4U7PB 1V11A 3ZV6A 2TMGA 3BD6A 1WX1A 3WHLA 3AFIA 1U8ZA 1K7CA 4F21A 3COZA 3S2ZA 1D2RA 1SC4A 1KAHA 4L4RA 3UTDA 2D5LA 4S1VA 2X2FA 2WYIA 3JXEA 3U3ZA 2XMDA 3WV4A 1WPXA 2HF8A 3CR3C 5D51S 2X42A 3CH5A 4DT1A 2R47A 3DBVO 4QUJA 4EJFA 2JLUA 2O52A 1UWLA 3TBHA 3L8EA 5LQAA 1ZICA 4Z2AA 3PNBA 1JHDA 3N05A 4CUJA 2WTAA 3F7OA 3FCCA 3JAWA 3WL3A 3G59A 3UMRA 3HUUA 3QPWA 4R1QA 3B53X 2O2ZA 3KQKA 2C9ZA 2HKIA 2C2WA 2C3UA 2NVBA 3GVXA 4TKZA 3AL2A 1IHOA 1M33A 4M8NE 1KP2A 4R3WA 4WNIA 1KDYA 3GFVA 4ZV7A 4G36A 1S2MA 3D59A 1A8HA 2LKDA 3GJYA 1MX1A 4EYOA 1NBMA 1C4OA 3ITDA 4B80A 1Z8NA 5B6JA 1DBIA 4QQFA 1Q7BA 2OBMA 3VPDA 2OO3A 3UEOA 1F7VA 2X15A 2NPOA 1R6AA 2RGDA 5ER9A 1VP9A 1RJFA 5JSUA 1Y0BA 4R5MA 3RTBA 4KBFA 1LBTA 5E2AA 4JHXA 1APBA 1KVTA 2I9PA 3GT3A 1SXQA 4TTPA 2VT7A 3DHWC 1UK7A 4WY8A 4XDGA 1N75A 1H2RS 1NBOA 3WRVA 1EK6A 2GZ1A 4D3XA 1VDZA 3VR4D 1SFRA 2AW5A 1L5OA 2OCDA 3IIJA 5JS8A 3BXHA 1SBQA 1UJNA 4PS0A 2UUPA 4A27A 4BGUA 1ZR4A 1L7RA 5EIWA 4CPDA 1PN3A 4G0XA 4DSZA 4XWWA 2D7JA 1NE7A 5DJ5A 4MQEB 1SA0A 1C3JA 3KJGA 3U7RA 2Q6IA 1J8MF 3K1AB 5DLQC 1PNRA 4CGZA 3PENA 4QBHA 1LPAB 1EXDA 1FLDA 1P44A 2AD1A 2QROA 2B4RO 3DOUA 3HZHA 3A6GA 1YONA 3PQ6A 4H2DA 3ZBQA 2OCPA 3VTAA 2I6FA 1IZ7A 2ZSUA 4RSRA 4ZVUA 1N2HA 1Y7TA 4KACA 3FOCA 3GQVA 5IVIA 3OZDA 3P2OA 4LDQA 4X85A 2Z8YA 1K6MA 1VMEA 2GR9A 2HU8A 4LBVA 2IKSA 1CDOA 2H9YA 1HT3A 3NBMA 3RVLA 4DV2B 1JEYB 2FDCA 3BWEA 3FBGA 3KEMA 1RPNA 3HXOA 1TU4A 4XGKA 4OB8A 4OLFA 4RH0A 1JWBB 3IV7A 4ZAFA 1QYCA 3UWMA 2SCUA 3R7WB 4ZHSA 4IJ6A 3EZ9A 3O26A 2FPPA 2EDAA 3HJNA 2WAXA 3HHPA 4C1NA 5JVDA 3I2FA 1ZHHA 4RHEA 4NXNB 4BUJA 2Q21A 2PWYA 2IZOA 5EMJA 5I7VA 1B2LA 3JQ6A 1P39A 2FZ5A 2YIVX 3IDFA 1FFHA 2GZSA 2I2DA 3KR9A 3ZR4B 2J48A 4PLWA 5BOSB 3GFQA 1JJ7A 3D2BA 4Z7NB 4J7AA 3DL7A 5H81A 1CFZA 3NV9A 5ITVA 1ZJWA 3WWEA 4IFBA 3OE1A 2FU5C 4MVCA 4CCYA 2C7QA 1U1GA 4B85A 5EJ2A 4IDEA 1I6LA 2WR8A 2P78A 3CX4A 4DMRA 3FTEA 2WV7A 2C42A 3NMUF 2DUMA 1KEEA 4OMFG 4DIBA 2VPXA 2Q3BA 4RK4A 2DKOA 1XTBA 3ENNA 2BJWA 2MINA 1KYXA 4AJ9A 1QE3A 4JXXA 1ST3A 4DQDA 1VGRA 4CM8A 4BLOA 3O84A 3P9NA 2NP6A 1JYSA 2DH6A 2I78A 4DLPA 4TKVA 2A0UA 2HLHA 1V39A 1KQPA 3ZHUA 3P0RA 3VSEA 3SVTA 3IEIA 4XYMA 4E31A 4ZI2A 2B6NA 4OYLA 2NSJA 2Z8YM 3EN0A 1JUDA 3HG7A 3K72B 4LJ8A 4QGBA 4DUYB 1SIBE 1V96A 3A4YA 4Q7LA 4YGXB 1XWFA 1JDSA 3B82A 2CEAA 2FGKA 3G89A 4PO3X 4KYTA 1RXEA 4FI3F 3AIOA 5F9FA 1WNFA 5CDFA 4CQJA 3CMMA 3W4KA 1EFPB 2HNBA 3HFRA 4NBNA 3DYVA 1JXOA 3QIVA 4B3DA 1XD9A 1HGXA 2TS1A 1FBTA 3LG2A 4N8DA 4ALLA 1B16A 4D6YA 3GNLA 4DMUB 1U0BB 3WMEA 4R9SA 1SXJD 1NI4B 2YYAA 5KYYA 4MVJH 1XDSA 3TI7A 1QAOA 2PFKA 3OP1A 5AVUA 3PGKA 2O8VA 1WCYA 3ZE9A 1FVXA 3NBKA 3EHEA 1PNVA 2MSWA 2A4MA 2XCQA 4G0PA 1KVQA 4KVAA 4W1SA 5ECWA 3T95A 1V6CA 3VU3A 1TM2A 4EH1A 4JUAA 2V3VA 3IVRA 5BRJA 2IYNA 3L7OA 2RHMA 1XTTA 2VUIB 3H2JA 4BZZA 5IEJA 3Q2OA 4DEYA 4MR9A 4I1SA 2C7PA 2B8EA 2YOHA 2FN9A 1Q1GA 3G7SA 4ML3A 4GI1A 4LMPA 3WQSB 1CS0A 3QH4A 2WUFA 1WHSA 3AU8A 4M0CA 1KKMA 4FPXA 1RC8A 2GK7A 4GD3Q 1LLCA 1Y3CE 4L7QA 4ZC8A 5JJLA 4HFNA 1L8AA 3D8UA 3JQAA 4D5GA 2MSLA 2NXEA 3MTQA 4YI3A 1T6BY 2WINI 3PCRB 4FYWA 4PSCA 5CH5A 3TSWA 4AS2A 1L4FA 3LX8A 4MRSA 5CTAA 5AI6A 5FO0A 4DCCA 3SDBA 1Y5MA 3L6OO 3HK2A 1W2GA 1YULA 4IG4A 4B3RB 4JP1A 1LH0A 2XWPA 1BCSB 3DZHA 3RWMB 1J2EA 1EGAA 4PU0A 2P9BA 2PRSA 3N2ZB 4FSXA 4B82A 5C9ZA 2NUBA 4YAFA 2OLEA 4RFSB 4X64B 2O54A 1IL0A 2ETVA 3C6BA 4TVKA 9MHTA 4UARA 4N40A 5U4QA 1XAHA 2NXWA 5E9QA 1VHJA 2AS0A 2C9OA 4PIVA 2HMVA 2AC4A 2GM5A 5KVAA 1O9BA 3CIOA 3JALA 4IHJF 1T36A 1EIZA 3PXCX 3KT3A 1OZ0A 2XGOA 4PX5A 3ZS8A 4J8PA 5I4KA 2GERA 4F38A 4CL2A 1HYHA 1OIVA 2H31A 2YS6A 4XGRA 1M76A 4GBED 4BWYA 3USZA 3MGGA 1GQOA 1ZLYA 1ZONA 4IG9A 2X8JA 1R5JA 4OJQA 1BE1A 4ECAA 3RVOA 1RXIA 4G41A 2HRDA 1FZQA 3TKLA 3AJDA 3ZZNA 4K1LA 4JT9A 4H7EA 4PHFA 2E87A 3TPFA 3B6ZA 5I3ZA 1L7QA 3MMXA 4O2RA 2IHYA 2F2TA 2D8MA 3I09A 3KB8A 3OKCA 2FXVA 3GA7A 3BWVA 4X24A 3EJWA 5LM3A 1SG0A 1DOAA 5TQ0B 3OMLA 3W7AA 5AM3A 3ACCA 6GPBA 1O87A 4ABTA 3MTBA 3HEBA 4P4LA 2PG3A 3H2IA 4KITB 1LLDA 4RGQA 1Q21A 2ZIWB 1YHNA 4GLJA 4RV9A 3T1TA 4UXJA 3ECCA 1YSCA 4A15A 1IWPB 2VK4A 3AEUB 1IHPA 4MUEA 1JB9A 1KH3A 1OGJA 2CFSA 2DHQA 3AVVA 1V1MA 4H6VA 1TO2E 4IJWA 2W6ZA 1GZHB 4C3VA 4YPOA 1IZ9A 3DW3X 4RXUA 1MAHA 2XHZA 1BD3A 3WWPA 3KO8A 3QPBA 1H94A 5DLEA 3CHYA 2FPIB 4HB0A 5FTKA 3LY5A 2ON6A 3BJRA 5DW3A 1NYRA 2GD1O 3EY9A 3P9YA 2FCRA 4HNRA 4TYMA 5KQSA 3L1VA 5IVKA 4LJKA 5K3FA 4DIDA 3FVWA 4Z54A 4X20B 2YXEA 4RD2A 5C5IA 4UM7A 5JISA 4QPDA 3GVIA 5DSTA 4DQXA 2W00A 4LBZA 5DN9A 4GKJB 2JLYA 3TL6A 3ROXA 3O1JC 5JFTA 4DDUA 1XNQB 2P3SA 2P9JA 4NYIQ 2J59A 3V1UA 4D9CA 4GWGA 4MO2A 4UOEA 3UAGA 4DL9A 3I2YX 3SHVA 1A9RA 4I08A 2QR5A 3BGDA 5HKLA 4X8HA 4D9MA 4JT2A 2W2OA 4KDRA 1UMDA 2GEJA 1JVNA 4Y30A 5J2TA 1MIHA 4O4LA 1KKUA 1A8UA 1NW5A 1AKNA 3C4VA 4ODIA 2KJQA 2AWNA 2OPHA 2BFEB 2IEGA 5F3WB 1T2UA 3CEPB 4JYCA 3U19A 4G0WA 3RHZA 4BV2A 1OZFA 3LDHA 1NYLA 1AV6A 4YH1A 2WY2D 5DXAA 1DRVA 2VP9A 5KQMA 1OTHA 3MJHA 4AKSA 1TA0A 1C30A 3UM9A 4AKIA 2QX8A 1B41A 1W8DA 3GFTA 1T9ZA 3MELA 3NTUA 1PS0A 2FE4A 4GZ6A 4M21A 5KHAA 3ROGA 4CMJA 1RADA 4LTNA 3MS7A 4ZN6A 2OVBA 5H1YA 4BUZA 5JW6A 1T3ZA 1WCWA 4BFCA 3HKBA 4FS3A 2H1HA 1HORA 1YB2A 5JE8A 2NYVA 3VKGA 3CLVA 4EUKA 1A82A 5E7JA 1ZGJA 4IIEA 4TUYB 721PA 3WKDA 4E1BA 5I7EA 1ZJ6A 4MKRA 4Q47A 1G21E 2AN9A 4N9WA 3Q5DA 4UKDA 2PGJA 2XQKA 1RMQA 1XL0A 1H3FA 3I28A 5CH3A 3SAJA 4OGFA 5LQNA 4ZQIA 1OB2A 1RXYA 4MWOA 1LDYA 2DUJA 2EHJA 2FNAA 3H1EA 2WJHA 4M4SA 2N0SA 3UGQA 5BN1A 3VA7A 3P2YA 3FTPA 4GZMA 4IMJB 4WZBA 2VS1A 2Q2WA 4FCTA 3RF7A 2EZTA 3QKWA 3ZWPA 3M6WA 4UHFA 3TMAA 3LKZA 3SC3A 2B3TA 2TECE 1K4MA 3OTIA 4LXIA 3QENA 5GM1A 1XVIA 4RK5A 4KQ1A 3BBPA 3H9BA 3T7DA 4L2IA 4KOAA 1O5OA 3AZQA 1UFRA 3MQFA 3AY0A 1R8JA 4N12A 3BC1A 1WXFA 4WLVA 1QB7A 5T4BA 5CM9C 1VLZA 3LWZA 2J67A 1UKEA 1XP5A 1ZQ9A 2F8MA 2F64A 2O23A 3B52X 3ITKA 2VO1A 1TQHA 3MRSA 4V0OA 5FJIA 1L6RA 1NA5A 3OQBA 4B6RA 4YMVA 3ZKWB 3EHDA 2JAOA 3TRKA 1JWAB 4EI7A 5U1PA 1L5LA 5FAKA 1WPQA 3EZXA 3W9YA 6CHYA 4B4VA 2VZ0A 3LXXA 1ACJA 1J2YA 2MSDB 5KO2A 1K6IA 3TZLA 4ZT3A 1BVHA 2P5YA 3NH6A 4FQ5A 4E7OA 3S4YA 1FSFA 5JI2E 4DR1B 3QHAA 1J2JA 1D2CA 3F7TA 2ZANA 4W1PA 4NCKA 2E55A 2PR7A 1LGYA 1MB9A 4AFNA 2ICAA 3L84A 5TLSA 3SSNA 1C3EA 3K9CA 4MV6A 1B6RA 3QRWA 5HCUA 3RJ5A 1CDZA 3ABRB 3L18A 1YO6A 2PV7A 4OLBA 1GN9A 2VRWA 3X44A 3IESA 1FXUA 1Z3CA 1HC7A 3UKJA 4X41A 4YP7A 3QOYA 1IFXA 2PBLA 2XPCA 1O1YA 4YECA 3V00A 3KUKA 4JMPA 1Y1KE 2HBQA 1BHSA 2R8PA 2VFAA 4HX9A 2ZJ4A 4WFKA 2J85A 4GUDA 2JFNA 1YC2A 5ANRB 3GAZA 3D5EA 1THTA 2J08A 2R1TB 4MVJD 4PS1A 5LQJA 1RXVA 4HOYA 2WP8J 1QE5A 1L4KA 2Y77A 5FPHA 4PAWA 1Z0ZA 3AUTA 4XD7D 4DJTA 2YXLA 4GOLD 3A6ZA 3OTWA 4UFOA 4G4SP 3A1DA 3K96A 4YPFA 5DWVA 3EGVA 3HJAA 2WHRA 4D4HA 3I01M 1ACLA 2REQA 3K1TA 4JSTA 5D2CA 2H52A 4MDEA 4HGRA 3KQVA 2FEKA 1NC3A 1F4LA 4G2TA 4L8VA 1X1QA 1ZK3A 3OCYA 4HUQB 4IEEA 4RH1A 5KSPA 3JZAA 3IOMA 1QWOA 5CTJA 4FFNA 3JWEA 1HURA 2WWHA 1GHTA 2Q49A 3F5SA 3J81A 5ALOA 3MGAA 1SUSA 4HZGA 2R8YA 4E5PA 4YXWA 4F4CA 3RSSA 4M9CA 2GXAA 3OU7A 2R1VB 1G16A 2RGRA 2E49A 4DM7A 2EJVA 3B1KA 3QWHA 2I4NA 1MJNA 3HB9A 1QYWA 2EJUA 4LZAA 4WI1A 4B4UA 2VXOA 3DEKA 4L95C 3WGIA 2DG2A 4K6MA 2CE7A 4MKZA 4YUYA 1OBFO 4M49A 3ZK7A 3PEVA 4BFVA 1WB6A 3TFWA 4DBLE 4Z3DA 4UMEA 3L06A 2XUAA 1CWUA 3RS9A 3RUFA 1PZFA 3D4BA 4F5WA 4JYAB 2NU7B 4YRJA 4PAQA 3GDFA 5FLXA 3HJFA 3U4IA 2VUUA 2P11A 3JQCA 4P92A 1NMQA 3RASA 2J6CA 5ALKA 4B5LA 5BN5A 1TK3A 3H8VA 1ZUD1 4OI2A 3H83A 3QEOA 4BOYA 3NAMA 4HADA 2H11A 3PDUA 2IY7A 1JJVA 3H7IA 1H5NA 2GCPA 3CBGA 5GQSA 4MARA 3ESBA 3AFNA 4GP6A 4JEUA 3HV2A 4ETIA 2MYNA 4ILEA 3LQKA 1VPVA 3AYZB 3SHOA 4B2YA 1E8DA 1Z56C 4DQ0A 5C7OO 1RRVA 1UJ5A 3G2OA 4MJLA 1Y8RB 2CVQA 3TOCA 1YA4A 1ZO8A 2G88A 5HKOA 1CY2A 1Z08A 3RJMA 4FFPA 4OSOA 4YV0A 5K3OA 3STTA 4LC9A 5DHSA 1TTQB 3UC9A 4DUGD 5B58T 1YMUA 3BX1A 2FMKA 2YN2A 2JIRA 5DLDA 2HSZA 4FB4A 4HQLA 5AD1A 5TPWA 2NTVA 5ETJA 1RIIA 3EY4A 1LRLA 4EFDA 3FUTA 4FLMA 5DZSA 4R31A 2HPAA 3HKCB 4EF6A 3DQPA 3L43A 5AW2A 3KJHA 4XFKA 3S7ZA 1T35A 1C0LA 4H15A 3RVKA 2IXEA 3S6JA 1XJ5A 1ESMA 4Y0VA 3RVNA 4QGHA 4RD3A 1QE0A 1XLTC 3R6GA 1I80A 1U7PA 4GPBA 3T7JA 1MGPA 4DEVA 2RC5A 1WZ2A 5FUWA 1BXGA 1NQTA 1H1TA 2JIZA 4N39A 4H0FA 4HYEA 4H17A 2C2MA 3HVKA 2QPLA 4MTCA 5L7WA 1GGJA 1DBQA 5AK4A 1FIUA 3BQNB 2GWHA 3OLVA 1WV1A 4B0PA 1CUEA 2I7TA 4II2A 3OZWA 4N8EA 3BAFA 1YJ5A 1ORWA 3SIPA 1Z5PA 3C5EA 4EB3A 4DR6B 4RZXA 2JJ1A 2IIQA 4BTLA 1U94A 2VDVE 3RWBA 1CQIA 1T34A 4K03A 4O29A 4ER7A 5AR1A 1Z4KA 1SKQA 3M1AA 3GZTB 1RAEA 4HXGA 4FFOA 1QH1B 4KWHA 5AKZA 2YX1A 2ZRHA 3BMCA 3F71A 3GUUA 3MS2A 1DC3A 4OXNA 4Z8YA 3IBTA 3PPIA 1XSEA 1E4EA 2IU4A 4LVUA 5EZYA 1UBMS 3I9LA 1ODFA 1IYZA 1UQUA 4IQGA 3SLGA 3KVYA 5EY5B 2OAQ1 1SXHA 1XQ6A 1O8BA 2JI8A 4IZ6A 2C59A 3PLAE 3V8EA 4N3BA 4KLRA 1ZA2A 1LTQA 4GC9A 1HDYA 8AT1A 1E59A 1QHHB 1Z17A 2EFHB 3AONB 3B9PA 4IX1A 2BTEA 2Y1EA 1H4SA 4B4KA 3RKSA 4AUEA 3OUUA 5EGNA 2NAFA 3V1NA 5LSAA 4ZYVA 1HRDA 2VAVA 3BSYA 2F8SA 3M4ZA 4EHNA 4B0OA 3AI7A 3CSSA 3MT7A 1FP7A 1RTTA 5J1TB 1NBME 1TUBB 3DZIA 3IVMA 4TUYF 4HDKB 4X71A 3H42B 4BVAA 4CLHA 3MIZA 4K3UA 2ZJFA 1LRKA 3N70A 3AEKB 4D81A 2BMFA 3CZ4A 2FE1A 2XW6A 4UTNA 2XNDA 9LDBA 1RYMA 1G0OA 3PWTA 4PYOA 3BIFA 3SYKA 1HETA 3K16A 3PNVA 5FNVB 7MHTA 4D2IA 1FQWA 2P6OA 4R1LA 1GAJA 3N2KB 5BYBA 4S04A 4QELA 1DQYA 4TTRA 4CTMA 3GUYA 1P4SA 3EVTA 4AJNA 5TQ2B 5DV9A 4Q34A 2PL3A 3NB0A 2H16A 1QHYA 3VU1A 5ITZB 3DO5A 4ZARA 2E21A 3FR8A 4HYTA 1YK1A 1TCAA 4IDCA 2HA0A 1PWXA 4U7JA 4YACA 5ALLA 3DAOA 1U7DA 1RYEA 1V1RB 2CYBA 3O7MA 3K8ZA 1FP6A 1XLTA 3C15C 2G0NA 4LHEA 5F1OA 4JITA 3K5IA 2BGMA 4BNGA 5K20A 2A5FA 3EX7C 1MDBA 3F47A 1F14A 5K8CA 1DQZA 3GELA 4LMAA 2A9QA 1MXFA 4JSYA 4C20A 2Q7OE 2G40A 4XX0A 3KTFA 3FVQA 1NN5A 3AQIA 4WKOA 4IEIA 4C6HA 2NGRA 1NW6A 1N2SA 2Q6OA 4Z2YA 8ATCA 4MS1A 3PQ4A 2WPDA 3AHGA 3DD5A 2GZMA 3KQWA 2PQ2A 3JW8A 2CYAA 4OQNA 4WRRA 5E0OA 4P4SA 4WFQA 5GJVC 3T9AA 1X70A 2NTNA 1XJCA 3WGMA 2HBYA 3ZLBA 1P72A 3RUDA 2Z9DA 3S8YA 1P8AA 2WA1A 1I30A 1RQLA 1B4DA 3U62A 1BQ4A 1ZBQA 2QW8A 3Q8LA 1LEHA 1D5WA 1E2GA 2IXTA 4OHMA 4RKYA 4DCMA 1XLUA 4BMXA 2E0IA 4OFBA 2ZWPA 1SC6A 2UVQA 4NOKA 3VSBA 1IZ8A 3O75A 3IUQA 2WF5A 2WG0A 5JBNA 4DBLC 1J9ZA 1RHQA 5F1KA 4M9XA 3NI2A 4R16A 4OLAA 2COKA 4YRSA 4I5DA 1V5FA 3I73A 4MO9A 4F3KA 1DFHA 5BORA 2JZCA 3CE6A 1JBKA 1W85A 1JG1A 1QFZA 1NR5A 1XDGA 2JGLA 2WAMA 3P26A 2ZUCA 4G5YA 4G5GA 4G81A 1CF9A 1D4OA 1DIOB 1XZDA 2OFWA 2VHXA 3D8SA 4Y0NA 2M6KA 4PIMA 4JQZA 4WINA 1CR0A 4UCXA 3SM9A 4HN4B 3ZVRA 1LDMA 2H7XA 2HSEA 2O2EA 3HLKA 3JD3A 1H05A 3OWOA 4MINA 4ZVOA 1JWLA 4AL4A 3NUGA 5M3BA 4CIAA 4C0BA 3EXFB 5AI9A 5D3MB 1DO8A 2RGUA 5KX5F 1LW7A 4V0LA 4K2AA 2A0YA 4HGZA 4AECA 1AZLA 3C6MA 5TB5A 4Z4HA 1Z4OA 1X1CA 2VBFA 1NVWQ 3QOFA 3RUEA 5CDFE 5IF3A 1VKZA 3PNQA 4P0TA 1OU4A 4H1UA 5BNWA 4JNKA 4MUIA 2X4GA 4EUFA 4EA8A 2F90A 2WG1A 4BVBA 1AKYA 1RWBA 4B6JA 1U99A 2HA2A 3TTTA 4IYJA 1R0ZA 4NI5A 3IMCA 3L7MA 4YV1A 4IKEA 2IYLD 2OXRA 3HYTA 2NYRA 5A6SB 4BV3A 4EB8A 1TZBA 3ETEA 2VDWA 3UB2A 4EVIA 1KJ8A 4R71A 4BGDA 3LC1O 4O4HB 1JJFA 1N6NA 3DGEC 5DHTA 4I99A 1XTIA 1CPYA 3VVBA 4E13A 1PNQA 3K0KA 3JQGA 4EZBA 3TLMA 4FYKA 3W7BA 5A3RA 4C6RA 5EVCA 2LNDA 1QK3A 2Y4OA 1TU0A 5DSXA 2BIFA 2PFGA 2GAJA 5CD9A 4UZFA 4DIOA 1OXKB 1T1IA 2VSNA 1CG6A 5EHNA 4J94A 4XE5A 2WHQA 3HCRA 3LUHA 3SXJA 1JECA 2FR1A 2X6TA 2Y6VA 1KEUA 1S8NA 1MO3A 2QVBA 3I4FA 3NH9A 4LPSA 1QV6A 2XD4A 4YUXA 1DINA 2B1JA 3S1SA 2OLJA 3FNFA 1N2IA 5AJVB 4IXWA 3EG9A 1LCIA 1AB5A 5DULA 4EGQA 2I3ZA 1J7KA 1E6LA 4QGGA 8OHMA 3AR9A 5IWAB 3RNOA 4EY5A 1J23A 1Z2OX 2E2WA 2AFHA 3V4ZA 4Y2YA 1OPXA 1MX5A 1TZJA 3WWYA 3ADPA 3H97A 3CF0A 1W49A 4M0EA 2ERXA 4UM9B 2C31A 1SUEA 1XK7A 1L7EA 3MWEB 1OVGA 3Q9UA 4GQBA 2JH8A 4RZ3A 5LA6A 2RI1A 2WD7A 3T7KA 3GH3A 1NFQA 3EUWA 4CM4A 4B6GA 3KRTA 4ZANA 1T3HA 4F1JA 5ALVA 5KOHB 1E5DA 1C9JA 1XR3A 3FN4A 1ENPA 2FX5A 4JJFA 2HDOA 3QWAA 5E8RA 4YRAA 4N48A 4MMXB 2QX7A 4MKHA 3NTOA 4FYMA 2IC5A 3ZG6A 2DR3A 3NPMA 3A1FA 5IDXA 4YA6A 3AW8A 5K8JB 4RZ2A 3L0YA 5LMUB 1ML4A 1L5RA 1AUOA 3AR3A 4QEKA 5A7GA 3E61A 3H11B 2B6HA 5BWMA 3U37A 3H13A 4A4DA 2M1ZA 3IIIA 4X66B 1P61B 2SKEA 3QEKA 1NUTA 2P9FA 2PX5A 4X91A 4S05A 5B57C 4GDFA 2HWXA 5AVXA 2G4LA 1O95C 3R7FA 4MS3B 3FSGA 2CVPA 3RVRA 1EGVB 4LHVA 3TD6A 4DMMA 1Z5ZA 5LD2B 4PLYA 5LQMA 3LX6A 1T5LA 3DOJA 4MVWA 3LLMA 4BLWA 1RZUA 3D02A 1HTBA 1TIBA 1O57A 5DHRA 2C94A 4JI2B 5FA6A 1Q91A 1DBRA 3SG0A 3SX4A 5LNK1 4TM8A 3KAJA 4RHFA 2R8RA 1U8CB 1YOVA 3F3MA 4FDMA 2BHRA 5FXMA 3QUTA 3USES 3CF2A 3W1VA 4C7XA 5GTDA 1IY0A 5A5GA 1KWKA 4WKBA 1WDLA 4U5XA 2A1TR 2AEEA 4WLFA 4JYBA 1DKQA 3BICA 4B76A 4C4YA 2JLZA 1E4OA 2F1OA 3ZQJA 3TG2A 4KNYA 3STWA 1IRXA 4P4UA 3TDNA 1UKVY 5HM8A 3NOXA 2XUGA 3B6JA 5JH7A 3H3JA 3ZIUA 4AZTA 1YBFA 3GLVA 1NNLA 2IITA 1OAOC 4ZCMA 4NV1A 3B85A 2YRWA 5BV8A 3B70A 3VGPA 3EE6A 4L07A 4LGVA 4H1TA 4LG1A 4BRZA 5DYWA 3IAUA 4ZJZA 4OK3A 1K88A 4ZCRA 3VPXA 1SQ6A 2DT5A 2Q62A 2UYHA 1U5BB 3U61B 3N76A 3OHSX 1F8YA 3ANSA 3MZ0A 4C4AA 1H1DA 1NXPA 1N7JA 2JBAB 3OEWA 4HZUB 3M6FA 4MKIA 3K94A 3UJ8A 4LNAA 5LQSA 4X7RA 4GOKA 4CG0A 1V5EA 4PGAA 5FI3A 3U81A 3ZTWA 3O8OB 2RG1A 3NJRA 1T8TA 4CV2A 1LJUA 5CMLA 3DZCA 1BFDA 1VLQA 2AR0A 2C7GA 1H6CA 4WXMA 5ALZA 3AFHA 1ZIXA 4NZ9A 3WRWA 3PJGA 1E4VA 3VPCA 1I2ZA 5AOCA 3UAYA 3WK6A 4BDSA 2OOKA 4O1IA 4EAAA 2PUCA 1D03A 1P1BA 3EF0A 2C8LA 3IAM1 4W8GA 2XF8A 3MSCA 4L28A 2G76A 3TMKA 3PWKA 4E1AA 3C1OA 4ZZ3A 1ODSA 4DDHA 3CVUA 1TTTA 3QA9A 3ZU3A 3OJCA 1C1DA 3IERA 2ZQYA 3NT4A 1P60A 2YWBA 5I7WA 2IZ7A 1JS1X 4QM7A 1KJYA 3G0GA 3KOMA 2PLRA 2H08A 4JLSA 3RRYA 4D4JA 3IEUA 4TZKA 1TEZA 1O95A 4G8BA 3H7AA 2OM2A 4PE5B 3C8HA 2W8ZA 3R9XB 5REQA 3EA5A 2B92A 6PFKA 1TKBA 2QIOA 2ENUA 4G0QA 3PHHA 4OB7A 1HT0A 4S1TA 3SKYA 2AJ8A