2ETXA

Crystal structure of mdc1 tandem brct domains
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
194
structure length
194
Chain Sequence
APKVLFTGVVDARGERAVLALGGSLAGSAAEASHLVTDRIRRTVKFLCALGRGIPILSLDWLHQSRKAGFFLPPDEYVVTDPEQEKNFGFSLQDALSRARERRLLEGYEIYVTPGVQPPPPQMGEIISCCGGTYLPSMPRSYKPQRVVITCPQDFPHCSIPLRVGLPLLSPEFLLTGVLKQEAKPEAFVLSPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Basis for the Association of Microcephalin (MCPH1) Protein with the Cell Division Cycle Protein 27 (Cdc27) Subunit of the Anaphase-promoting Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Mediator of DNA damage checkpoint protein 1
total genus 59
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 2etxA01
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 2etxA02
1L0BA 1Z56C 3SQDA 4BMCA 2E2WA 2COKA 3KTFA 2DUNA 2COEA 3K15A 3K0KA 3PA6A 3PC6A 4ID3A 1JNXX 3PC7A 2ETXA 2XNKA 1N5OX 4JLUA 3II6X 4IFIA 4Y18A 3OLCX 3SHTA 3QVGB 2D8MA 4XQ0A 2VXBA 3SZMA 3PXEA 1WF6A 2VXCA 3QVGA 1L7BA 3JVEA 1T29A 2WT8A 3COJA 2AZMA 2XNHA 3UENA 4U4AA 3L41A 2EP8A 3T7JA 2L42A 3FA2A 2HTFA 3T7KA 3L46A 4IGKA 3T7IA 3PD7A 1CDZA 3K0HA 1T2UA 3T1NA 3UEOA 2ADOA 2M2IA 2INGX 3EF1A 1IN1A 4XPZA 2COUA 1KZYC 3L40A 4OFBA 2K6GA 2JW5A 4Y2GA 1GZHB 1T15A 2EBWA 3PXCX 3SHVA 3PXAA 3PXBA 4BU0A 4N40A 3EF0A 1OQAA 5ECGC 3PC8C 3AL2A 2K7FA 3HUEA 4BMDA 3PXDA 2R1ZA 3K16A 3I0NA 3U3ZA 1Y98A 3I0MA 2LE0A 1T2VA 1IMOA 3PC8A 4BU1A 3HUFA 2EBUA 2NTEA 3AL3A 3K05A
chains in the Genus database with same CATH superfamily
1DBWA 3UK7A 2J85A 3C5CA 3N59A 5CK5A 4QOGA 4EQZA 2VJOA 1K3UB 1T2DA 2K7ZA 3EGDA 4L07A 4V0QA 4EFNA 3B3JA 1ZGHA 5E95A 1IG0A 1IVYA 5JZMA 1XOIA 5M5BA 2IXAA 1ENYA 4ENQA 2XXBA 1QLWA 4XM0A 5LQUA 4KGZA 3K15A 5D7BA 3IKLA 5A5EA 3IS3A 1DC6A 4GOXA 3QNMA 3MLBA 3A6HA 3UXHA 1YU9A 2C2ZA 3CNQS 1GGNA 1V1RA 4LJSA 4D9CA 2EZ4A 1KHTA 1RQLA 4JUDX 4LF7B 1IULA 1NMXA 2FZ4A 2CBGA 1LDBA 4M1EA 3EXAA 2HT6A 2W2LA 5E7IA 1O5IA 1BMFD 1W4LA 4M9UA 1IOLA 1UAYA 2ZLBA 3UT5B 3DWGA 3R7WA 1WF6A 3QXHA 4CV1A 3MJRA 4EY4A 4RA9A 6CHYA 4YBRA 2C7OA 3JYPA 2QRQA 1JR3E 4HWGA 4JNCA 1JALA 2B37A 2PANA 1EVLA 4FFWA 1WMBA 1RHQA 3FWKA 4F9FA 4UEOA 5K8CA 4HBGA 2FV8A 3GJ0A 4BIIA 4KMMA 4NZPA 4TMKA 4KR0A 5E9WA 3BB1A 3IDAA 2GPSA 3HN6A 3AY3A 3F4KA 1WB9A 1VKRA 3JQPA 4B17A 3I4LA 3ABRB 2JLYA 2I7XA 3EIEA 5AOAA 3PFNA 2JF0A 3PBKA 3EA5A 2VA9A 1JIQA 1Y9AA 5IVPA 1J2RA 2YFHA 4BO2A 2F67A 1CDEA 1G1AA 3IURA 5FQNA 5B6JA 2Y2UA 4B35A 2AG0A 4IYJA 3T3DA 4C0QC 2IP1A 3W6NA 1JFLA 3F4LA 1MTOA 1UBGA 5CK4A 2QRPA 1JE0A 3FG9A 3GPIA 4NNPA 1NOKA 3OLXA 2XYGA 1MC4A 2HF2A 3E9MA 3H5RA 3L4SO 3QMMA 1T0UA 5A3SA 1MAVA 5E7MA 1BAPA 1E1QD 1IHDA 3E3AA 3WNCA 5H4HA 3WKEA 3LHKA 4LRTB 5SZIA 1PWZA 3OX2A 3STUA 3GJ8A 1HLDA 1M76A 4NENB 4ZREA 3ZS8A 1E7SA 2R8RA 1NW9B 3AG6A 1IUOA 3ZQJA 1FYDA 4LNUA 7AT1A 2OYSA 4BKRA 2X0NA 1IMJA 3LC2O 1KDOA 3KIPA 1FU4A 2NV2B 4JI3B 5IF3A 1LGYA 3GOQA 1DIBA 5GJCA 1G60A 1KOJA 3MS2A 1VLQA 4G65A 5FBQB 3ZVKA 1U7TA 2HSEA 4CCWA 4BQEA 5JFOA 1LRKA 1U90A 1JKJB 2ZI4A 5T67A 4YHHB 4LDZA 3FJ1A 5IUKC 1NVBA 1AKRA 2ENWA 1ECBA 2R6HA 3KQPA 2CNOA 2V96A 4PBRA 3ZGOA 2OGWA 1Q0LA 1RLJA 2Q0XA 1OFIA 3DDNA 4K28A 4L8YA 1Y1KE 3RK1A 4M0EA 3TOSA 4E2XA 5J2TB 3GFOA 4IV5A 4OQZA 4P4UA 3AEYA 1WM1A 2XNDA 2ZT7A 5KDOA 3H0EA 4LDNA 4HX2A 1Q0HA 3SZGA 3WIBA 1KJYA 4GLJA 3D6MA 1OI3A 4GT1A 1L5VA 2MMCA 4RULA 1W73A 3OQIA 3KWFA 1OROA 1CQPA 4NTZA 3N75A 3G1TA 5IBQA 2RAFA 1CUSA 1L4EA 3IEMA 2ZM5A 1JFFA 3JD4A 4RA6B 2QPAA 1SHTX 4OJNA 4DLXA 4PC3A 1HL3A 1T8UA 4DUGD 3MA0A 1UDXA 1NPTO 2XHEA 2WYHA 1A4UA 4J49A 5F78A 2X7HA 3PQFA 3NIBA 4EX6A 2O52A 5DNUA 1WBDA 2GBGA 5F5LA 3U81A 1S1MA 5JH7A 5F9MA 1ZPDA 1JU3A 4BUJA 3DO5A 4M60A 1AXRA 2AK3A 2YV4A 1PV4A 1FDTA 4YC7A 2PYIA 3QKWA 4G0MA 4RJJA 3ZEIA 3SM3A 5LJIA 2GLXA 1BU5A 1YI0A 1OA1A 1G18A 3EG5A 4BBPA 4CW7A 3QVGB 4FQ8A 3IO5A 1XRSB 3JRNA 2I9PA 2ORVA 1RFLA 3QQ5A 3U31A 1P1KA 4TV9A 4DQDA 3NDJA 5FWNA 4Q7EA 1RWXA 1WPGA 1WSBA 2GSDA 3QBVA 4EMUA 1ZOSA 3LLVA 1JAZA 4DBZA 2CNLA 3HP4A 4DPKA 1RR6A 1EWRA 3G0IA 4CKCB 3KRTA 4PQFA 3THYA 1KS2A 3RHTA 2OILA 1QTRA 5K1ZA 1ZH4A 1O6CA 1P6XA 1LPPA 1QDUA 2EYUA 1NJ2A 3NWBA 1D5WA 4KQ1A 2CUTA 4EGCB 1HOXA 2L2QA 3TB4A 2Y93A 3FTEA 2ZVPX 4QVIA 1HDOA 2C07A 4OQLA 4CODB 1KKMA 1GSHA 4QXRA 3VO2A 5GINE 3KPYA 1LLCA 1CBUA 2YOGA 3EOAI 4I4TA 3SBOA 2PN1A 4OLAA 1LTQA 1PQYA 4TMVA 2E87A 4YIKA 5T64A 2JI8A 3TZHA 4HPWA 2WNSA 5FV7A 2RGDA 3ORSA 3GEGA 1J9GA 3VR6D 4DQXA 3F78A 4GICA 4OBBA 3WHIA 4D25A 3OA0A 3ZDDA 1E4EA 1WP4A 2WABA 4JP2A 5J4LA 3CW9A 3NHAA 3FB4A 4MNTA 3K0FA 1DBRA 4OFWA 5AWFC 4YR7A 3KLNA 1VPLA 4EHBA 2JATA 3NV9A 3PUJA 3T5DA 2GKOA 1PR3A 3U17A 3DT9A 1E3SA 1A27A 2X2PA 1OYWA 2NUBA 1QIFA 2IHTA 5BQPA 1QZZA 2G5PA 2JLVA 3IGFA 5JH7F 4LVNA 1ESDA 4R2XA 4BNHA 4RMNA 1KR5A 2B30A 4QEZA 3T7AA 4RADA 3PQEA 3K1YA 1FQJA 4MUNA 1SRQA 2GFHA 4ZAVA 2IIBA 3S3TA 2F6RA 1XKQA 2CHUA 3G1UA 5EA2A 4YT4A 4JLKA 5ICMA 3G0CA 1RXIA 2D6FA 5DNWA 5ER9A 3UJ7A 2HLDD 4B32A 3H5LA 1C1DB 4GYJA 1S7CA 1NI5A 2XJ4A 1LWOA 3B1VA 1UJMA 4CT5A 3N2GA 3IE2A 4ZT3A 1T1JA 4NOLA 4YCLA 1MQ8B 5JYEA 4IOKA 4ARSA 1Z2OX 2QSUA 3IUEA 2P2ZA 1ES9A 2DVMA 3HY3A 2XYHA 4IQ4A 2GBIA 3PG5A 2VAXA 3D2BA 4J2TA 1QG4A 3M83A 1YV9A 3DT6A 1JSCA 3FRJA 4QPPA 3E8XA 3SZLA 2PIAA 1WZ2A 4XAQA 4NE9A 1OKKA 3GELA 1M3SA 3BSSA 4LRQA 1ZKDA 1UJBA 4URYR 2DTDA 3OFSA 4CEHB 2VJPA 2W9XA 4ZU6X 1F0NA 3OE1A 4C76A 1DV1A 1I1QB 2QVXX 3LWNA 4MQEB 1SG9A 4EH1A 1CY1A 4HNTA 3OZTA 4RZ2A 1Q0QA 4JC4A 1PEYA 1G0OA 4DN6A 3ETNA 4ZFNA 3PQ8A 3VI3B 4DAEA 1Y5LA 4IZIA 5KYVA 3UIEA 4IXDA 5BQOA 1CF9A 1R5OA 2JFPA 5JH7B 1QQ5A 5AJYA 4ZZ0A 1PJSA 2WWYA 5DYNA 4BKUA 5GPBA 1XHEA 3V8MA 2QBYB 1EFAA 3NOXA 1RTTA 3LZDA 1BXGB 3L8GA 5TQ2B 1JYSA 4DSOA 4Y2YA 2OP0A 2X0RA 3RRZA 2Q1WA 5INTA 1A4IA 2VP0A 3EMVA 4IQ8A 4PLPA 4RANA 1J09A 5ETJA 3TL2A 3DBOB 2RH5A 2ZI7A 3PQ3A 5AT1A 1FJHA 4BL5A 4R7TA 4H7HA 2XT6A 2Z2ZA 3KJQA 1U81A 5KQSA 3PT9A 1GQQA 1W75A 3LLMA 1N3LA 2QYSA 2W4IA 4YJHB 3O26A 3QLTA 1RYZA 2OOSA 5HSGA 3PUWA 4PYRA 9GPBA 2PGXA 1G7CA 5CIQA 4UOZA 2C0CA 2A9QA 4OQPA 1RRCA 2ZRMA 1DEAA 3DKRA 1XZIA 4DARA 1YBVA 3RTDA 2JJ1A 3SX2A 2O0HA 1U7HA 5CB0A 3ZVMA 1Y48E 3K9QO 2OHHA 4X95A 4E2FA 5HM8A 2VDQB 3LC1O 1GTRA 1N6NA 2CB9A 2YYAA 1YK0A 3CFYA 5FBKA 1P73A 1QV7A 1SVNA 4L3VA 1DO2A 2YZGA 4QXQA 4RKQA 1TNDA 4DF3A 4DMUB 1FXUA 1BXGA 4FZ3A 3FPKA 5TQ2A 3ZE2B 1KEVA 3DOEA 5LJLA 1KL7A 3V7UA 5BWNA 3CVWA 1UBOS 4L9AA 3WG9A 3HKDB 1FP4B 4MW0A 3OBIA 1JEYB 3BF7A 3UMYA 1N32B 3F7TA 5GJBA 4M4SA 2NUPB 4F4IA 3VAAA 2E5FA 3H7AA 4G25A 5AVSA 4KOEC 3CJTA 1TMYA 4CF3A 1WMAA 3SDSA 5FO0A 2VRNA 1HI9A 1FXWA 4CV0A 4NMMA 4MA0A 2XECA 1Z17A 3S55A 2RKOA 3SYLA 2H1WA 2ASVA 3DDCA 4QOJA 4HFRA 4DPMA 4CVNA 2H3EA 1RI4A 3W6PA 3K09A 3ABOB 3SF8A 1JDVA 2LD4A 3H5VA 3EF3A 4NNJA 3H17A 2DULA 2OFXA 2X0IA 4GOMD 4YT8A 2B3DA 3P9RA 5A7GA 1F4PA 1SKBA 1NUSA 2DLDA 2IE8A 2ZW9A 4X44A 5AKIA 3DQPA 3ITNA 5GZ1A 1G5QA 5KOJB 1VYUA 3TW4A 2BI7A 3SLRA 1BCRA 2VF4X 3HJNA 3AFOA 4YV7A 3KR2A 3TIXB 1EZZA 3EIQA 5JXWA 4EHIA 2V3VA 5F3WB 3ICQB 4UU0A 2FRXA 4GXRA 2BZSA 4FSXA 4IL5A 2W11A 4WBXC 3TZEA 3KAPA 1PEAA 3QUSA 1FDWA 3ICEA 4UPEA 2J3QA 3ANLA 3NGMA 1P0PA 1VLHA 3AK4A 3IAXA 4W6ZA 3S1AA 4A82A 2P6MA 5J47A 1O3YA 3JWGA 1DQSA 4AUMA 2G28A 1ULUA 3U7RA 5DNAA 2GUGA 1SQ6A 4XWKA 1U9ZA 4L0MA 2Q45A 3U0VA 1I36A 4L5IA 1HZZC 5ERYA 3GMDA 3RF6A 1E8DA 2ZB4A 2E4VA 1TW3A 4YAFA 3T3MB 2WW8A 5A3VA 2ZIXA 4RPCA 4DQ0A 2OHOA 1X6VA 3HB9A 4FGLA 3I04M 2G8NA 1SUWA 3K0FB 4IDGA 2Z5VA 3V7YA 2EJBA 2PRSA 2O9JA 1FQOA 1PR5A 2FW9A 4B6EA 3PVCA 4RK4A 3JXEA 3HA3A 1F1BA 4I99A 1FTGA 1ITZA 4I8XA 4WXMA 4AU1A 4C0WA 4NR0A 1ZESA 2IELA 4KDCA 2XRZA 4QQNA 1F0KA 1BXKA 4B6FA 1VIDA 2EKQA 3CE6A 3FTNA 3KHKA 1VLMA 5CM2Z 1W5TA 4P3XA 3SLGA 3QFTA 2BFBA 1H9BA 1UPUA 4GZMA 4HDCA 4AM8A 5FUBA 4ZTZB 5B1DA 3B1WA 1E89A 5HF8A 3LY8A 2W7TA 4PPFA 3URMA 1W49A 4ZO9A 1HYGA 3AHIA 4ZO8A 1WDMA 1AUXA 4B84A 4BVHA 1XA4A 2XTMA 2PBFA 2Y1OA 1W85A 2ZBPA 4GR5A 1CYDA 5CDYA 5LDDC 2HTFA 4GFDA 1Y3CE 5A6SB 4E21A 4EY6A 3AESA 2P75A 2QLJA 4CHGA 2JG3A 1NTRA 4D8UA 1EFPA 4BECA 3UH0A 1WIWA 4B6PA 2B4KA 4S05A 4RDXA 5HIMA 3N8DA 3ULKA 2P4SA 5DSTA 5CFMA 1QBGA 4I9HA 2C7QA 1XRRA 2XCLA 3V2IA 1AA6A 2AN3A 3WGZA 4F3KA 3O90A 4QRHA 3EFOB 3JASA 4X8MA 5A9TA 3T3HA 1U6IA 4TWBA 3FPCA 4N0QA 2X9NA 2YTZA 4DA0A 3WLOA 4UTRA 1V8ZA 1WY7A 2JJYA 3DLIA 2PLNA 2WM9B 3LHSA 4EZBA 1BWPA 1JX6A 4CI0B 1GGJA 5D5PA 3RKUA 2IY7A 2X40A 1GGVA 1PJ4A 3GN2A 1JV2B 4J94A 4Q48A 2IOHA 4XA8A 4ZQCB 3WYCA 3C1TA 1W36B 4AJIA 2QTFA 2D1YA 5FPYA 1H2FA 4ZDWA 4ECAA 1U0OC 1Y3HA 1KI4A 2BEWA 1DS6A 1OC2A 2CWDA 3PRKE 4BO7A 1TGYA 2EQ5A 3ONDA 3Q3JB 5AYVA 1MX5A 1G3RA 5H5JA 5DIZA 4EB0A 3REOA 2XDQB 4IDQA 4W8GA 4AP5A 2OAEA 3IOCA 2PJUA 4TMXA 3U1BA 5C52B 2ZS9A 2BZ1A 2ID4A 4MIOA 3LI2A 3SC2A 2Q8PA 1NPDA 1Y89A 2GT1A 2ROQA 3RUEA 1SG0A 2OM2A 5FOUA 4BVJA 4H4CA 4G8CA 1WXDA 2A33A 1HUQA 3ZI0A 1E61A 1N8TA 4CG1A 2CL0X 3INNA 5JMPA 4ZCTA 2DHQA 5CB6A 2YMLA 2JFQA 4IDDA 2HF8A 1F38A 4N8DA 1EK1A 1U3GA 1GUDA 2VJMB 3JVIA 4F5YA 2PGIA 1GPNA 1RAAA 1ZH0A 2HCTA 3R3SA 4LXGA 1YJXA 3LCRA 3LF1A 1NVEA 4DA9A 2F3RA 4TMZA 4UD2A 1L4FA 4B48A 4XWWA 1YGPA 1WTCA 4ZAWA 1Z0FA 2J3EA 2VH1A 2FZWA 1XBTA 4CT0A 2MT9A 2BV3A 2XUKA 3C3EA 2IEZA 4D8VA 4H7IA 1U7WA 4ZAFA 1TK3A 3CPHA 1XELA 4BNDB 4XVUA 2R6ZA 2NAPA 4LZAA 4MR7B 4F1JA 1QCDA 1WXXA 2FWPA 2XXJA 5IXJA 3ND6A 1ETHA 5FFMA 4YCAA 2FSHA 4MV8A 3UGQA 2J32A 4HGOA 4L5BA 2CXSA 3QPAA 4G5QA 2YWHA 5THKA 1ZVJA 3ZU4A 1SA0A 3ZK7A 2B2NA 3K6RA 4ID9A 1X19A 2JJMA 3SHQA 3JVVA 4J29A 2G6TA 5KOJA 3V2HA 3HB4X 2WK1A 2ZYSA 3O83A 2NLOA 4IVQA 4JMPA 1G55A 1MD9A 4IH9A 1N1GA 4FHEA 4FDAA 3KWLA 1UDRA 2BGTA 1EFUA 3UATA 3CUWA 1HFJA 3EY4A 1YQUA 3IQGX 3QVMA 3W5VA 3DTVA 1QLHA 3O21A 4IV0A 4UQPA 2QIPA 1NP7A 4B74A 4BO0A 3D3QA 2QNRA 4CLDA 3FOZA 3QTBA 3VR5A 4QO7A 4REOA 3RU2A 3HSYA 4X92A 3BHMA 2ZRKA 2E18A 1DKNA 1RWNA 1TFRA 2AYXA 3IO3A 1X86B 5B6IA 2C5FA 2Z8YM 1REQB 1WKVA 2OCPA 1JU9A 4MV1A 4TWIA 4BXOA 3VH4A 5FAKA 4MYHA 4OAOA 2BWJA 1R4AA 1ZMTA 2CBZA 4I8DA 2IZOA 4WTOA 2WSSA 4EHDA 4QYIA 3TDNA 3UMSA 1XCJA 5KYNA 3PR3A 1QAMA 2DRIA 2IYUA 2OO7A 3GLHB 4US2R 4PTZA 2PTHA 3P2MA 3C6MA 4KO1S 2VT7A 2ZSUA 5DB4A 1U7DA 3RJMA 3W0LB 3W5IA 2P1ZA 5ILGA 4B3IA 4C89A 1WUKS 3EQ2A 2VT3A 3QUCA 5HZGA 1V1MB 4MCHA 3JYLA 4J43A 1JNYA 4O4HF 2PRZA 3LK7A 1FRZA 1GILA 1SOMA 5HUJA 1L7VC 3AXTA 2WMDA 3KUCA 4UCXA 3TBKA 3PDHA 3NKFA 3ES9A 4L75A 4LDPA 4YT5A 5HPYB 1IRXA 3EGDB 1I3KA 4BJ3A 2PFGA 2PUHA 4P0TA 2UU9B 1E3TA 1JSXA 4Q21A 2FFHA 2QZSA 3QV1A 4J16A 4N3NA 5LZ8A 3TLGB 3W2EA 5JVDF 4GEKA 2H2HA 1OI7A 4UFOA 2Q6TA 2UVPA 5FOWA 3WLQA 4M0PA 4R8RA 3ZUPA 3HFGA 4P3OA 4FZVA 2JH8A 4QYIB 4UOQA 2VAVA 4DLBA 3PFBA 3IELA 1E98A 2YMQA 3F47A 1ZJZA 2XV1A 3GOHA 1HBJA 1RMTA 1XLVA 3NWOA 1J2YA 5AOVA 4BYGA 5K8VA 3T1OA 3TAHA 4ITRC 2IC5A 1GYPA 4JJKA 4MVJP 4PM4A 3UMRA 4J3FA 4PFSA 1Q0UA 3P4UA 1P31A 3VR6A 3D1JA 1RM0A 3B1YA 5FD8A 1M83A 4DREA 1XFDA 3WZLA 2WQ6A 2FUEA 1U4OA 4XGKA 2NTJA 2RBEA 4HB4A 4B6QA 3DSRA 1IUNA 3JD2A 1Q6YA 2IEIA 4NE2A 2YWFA 4RWEA 5JCJD 3AX6A 2RSLA 3HO8A 2EV9A 5T4FA 3O3OB 3KAQA 4FUTA 5EZ6B 1FVXA 5A6VA 1AQJA 3C8MA 3JTEA 1LDMA 1L8OA 4KG7A 4KGDA 3HBFA 4XJVA 3AQ4A 4NU0A 1FDUA 2WIJA 1HOTA 2OQVA 3UT0A 1CE8B 4FZJA 1KEEA 3QPUA 1JI3A 3DBLA 1TU3A 1RYDA 3L4BC 2JFWA 4EVRA 3KYDB 4BWFB 3TTWA 5A05A 4IKEA 2HMTA 2BPOA 1SUBA 4OHCA 4XR4A 4IJWA 4Q9LA 2YJGA 3ISVA 3LLUA 4EPVA 3EHDA 1E2IA 3R5TA 4WXRA 4UDOA 3M89A 5BOSA 4KQ2A 1GL7A 2B83A 1R18A 4HQNA 1NURA 1WZIA 2EERA 3FHLA 3O7WA 3RIHA 3QLJA 1G3UA 4V1CB 3F6SA 3QU5A 2IUFA 2WUVA 3RS0A 4C0LA 4Y8VA 3WAGA 1SCJA 5K3SA 5FI3A 1VLLA 3CNEA 1U2SA 3KYBA 1XYVA 1K86A 4I19A 4E12A 1ISRA 1WQ3A 1USVA 2REQB 4QGHA 4EJFA 6REQA 2WB4A 3D6TB 2BBOA 5JMOA 4TQAA 3P9IA 2MWMA 2I1VB 2JGLA 3JZFA 4MVCA 2Q9BA 3HCOA 3HXLA 1BA3A 4U02A 3DQQA 4ZOAA 2OCAA 2QF7A 2HQ1A 2J87A 3VTFA 3EGOA 5HKKD 3QH4A 4DQKA 5EMHA 5JDIC 2QROA 3TOCA 2QD3A 2E5WA 4LZLA 5IHXA 4FX5A 2MSWA 1G7SA 3BWXA 4MI1A 2WMOB 4L5AA 4CIWA 1C1YA 2BHTA 1JS1X 3D8BA 2C5AA 1RRMA 4C3VA 1Z6AA 1MXHA 4E5MA 5DXFA 1HQKA 5J1SB 4O33A 2AI3A 5C81A 4NV3A 2RGCA 3VO1A 4TWAA 1G16A 4ZAXA 1ZK1A 2XUOA 2XWQA 2ZP1A 3HCFA 1ZA1A 3Q85A 3H8SA 4OUDB 5LQMA 3BXPA 4YFVA 4ZQGA 4XOIA 4IJVA 4JUFA 2PT6A 3ELUA 3EBOA 1YXMA 2RI6A 3BJRA 4BVFA 2PJZA 4WZAE 2UZIR 3CBQA 1ZMBA 1KZ1A 1N7JA 3FBGA 3FCUB 5I4KA 5K0CA 3P32A 2CVOA 3QF7A 1C2YA 4XGQA 1UINA 1KZYC 2CV0A 3Q3EA 2WIAA 3KJEA 4FNAA 3KZCA 5E38A 3FSRA 3T7TA 3UJPA 4X64B 2ZCVA 1YZYA 3H8JA 1MPXA 1NYRA 3MT7A 3ZNQA 2GHRA 3PZBA 3BTOA 3OD1A 3ZVLA 5JBIA 4HAIA 1DGQA 2ZUTA 3HXPA 4TM7A 2VKTA 3HJGA 5CCBA 1DARA 4KE9A 5AI0A 2G9NA 3Q7QA 4OXXA 4RVCA 4Y2UA 4NK5A 3ZJYA 2VHJA 1TO2E 1FVHA 3QX8A 1WHSA 4FR2A 4LNHA 3L43A 1MO5A 3ENZA 4REQA 4D42A 4ZYYA 4BN0A 4M87A 5TQVA 4F1KA 2UXCB 1KO5A 5HOQA 4INOA 4XGNA 1G8YA 2ISSD 4ZQFA 1UL1X 5ALKA 3GD7A 4R41A 3AQIA 3FHJA 4I1OA 1J8YF 2VJDA 3NAGA 4CMKA 2YBEA 1G2OA 4IR7A 2CJWB 3B9BA 3OF2A 5C8ZA 4MUMA 2Z5GA 3RVRA 3NYWA 3BBPA 4WD3A 4AF8A 4WJZA 1RXCA 1VMDA 2VJAA 1EFKA 2DUNA 3EEFA 4GE0A 3SSNA 1VB5A 2WM3A 3ED5A 2VATA 4WV3A 4MQLA 2P9GA 2ZB8A 3SZUA 2Y76A 3B7PA 4DV1B 2C61A 3L8YA 1JU4A 3Q87B 5DNYB 1CERA 3B2QA 1ZCBA 4X6UA 1MC1A 2R44A 1XFAA 3CO0S 4LFCB 3PX7A 1YASA 1XRMA 4I9UA 1T5DX 4ESOA 2NT3A 3M3DA 1XYYA 5IT9A 3W1VA 5A9SA 2K4MA 5BNTA 5REQA 1AVTA 3EUWA 1P2SA 4TLLB 3O8OB 3TH5A 1OXXK 2HEIA 1TUBA 5TJ9A 4MKHA 1XCBA 5KQLA 2DETA 4CG0A 4BB9A 1V7QA 4GKKB 3B9PA 2IYNA 3OECA 3WGLA 4LHWA 3JWIA 3SJZA 1XN1A 2PGOA 2VPTA 3ZI7A 4A15A 2V3WA 1SD1A 3BD8A 4NENA 2O3SA 5BSRA 3SXUA 3RE1A 1YVDA 4HT3B 1BIFA 1CP3A 4YAGA 4RS4A 1FX0A 1LBTA 1Z2AA 2Q5EA 2YJ5A 1X7WB 4XX0B 3WRWA 1N2CA 1OLSB 3KS9A 5K01A 3NT5A 2O8NA 4E4RA 3USZA 5BVHB 4OHWA 1KK3A 1YKSA 5HE9A 3E35A 4D3YA 3B6KA 3PITA 3GLHA 3HWX1 3NHLA 4KK3A 3KV1A 4U2CA 1ZRHA 2BW0A 2Z2YA 4G2NA 3EOZA 1SO8A 1SVLA 1QLJA 3OHSX 1MOQA 2BLLA 4DQLA 5CFPA 5IZ4A 4ARCA 3GV0A 4FFMA 5AVYA 3IHKA 1NATA 3A04A 3QEJA 1W2HA 3CE9A 1SOWA 2VS1A 3A36A 1WRBA 1Y4SA 3M6UA 3GT0A 3JTMA 3OIFA 4V02A 2BGMA 5CIYA 4CXMA 4BNFA 4YV2A 1EE9A 2IPMA 3PYXA 4NG4A 4GC9A 2EIXA 4E3WA 3MIIA 2AR7A 3DCIA 4V38A 5E4YA 4BNLA 2EZ9A 1J25A 4GNKA 4CU2A 1NXXA 1BDBA 3PFCA 3N1UA 1IPEA 2C9BA 5K05A 1UFOA 2OCIA 3T6KA 1E64A 3GUVA 3OEHA 2YS6A 4UUMA 2HQRA 3BE8A 4LCEA 3KD3A 5FFNA 4OL0A 4B3XA 2I62A 2XMPA 2C5EA 3CX7A 1VI6A 3QMWA 5JEEA 1ZJ5A 4LX0A 4CMEC 2GBLC 1GR1A 2IU4A 2VPPA 5A3QA 3K8OE 4PNPA 3M33A 1F9EA 3MJCA 1CJVC 3KKNA 4GXNA 1Z07A 4U7DA 3O9ZA 1Q3TA 2UZ0A 1Z4JA 2GF9A 4B2YA 1CY8A 5AJHA 2H00A 4TKVB 3AFIA 4HUJA 4INAA 4MEAA 2CFIA 4UNSA 2HK6A 3LYAA 5JCOC 1A88A 2DBVO 2BLNA 3SP1A 5K6TA 3D64A 1J4AA 5B1IA 5CLFA 1NF9A 2WJGA 4KK4A 1DKPA 4G0QA 5ALHA 5DNVA 2IYYA 3VR6H 5LBUA 4CDRA 8OHMA 4N5HX 5HXAA 1F6DA 2J6BA 5IBPA 2HW8A 1H4SA 4FT2A 2I1QA 3B60A 3AKCA 1GQOA 4KXXA 5B2ZA 2BKAA 4JXZA 3DLAA 3ESCA 1DWUA 3LA6A 4QXMA 4UNNA 4Z0HO 5C8YF 2A78A 5L3VA 1OI4A 2WWWA 3OM9A 4ZT2A 1K9SA 1OILA 1J5PA 4RQUA 4RVUA 4U5QA 1CZRA 4HX9A 1V6SA 1AE1A 1ZZEA 3NRJA 5KWJA 2FQYA 3WYFA 1P39A 1IEWA 3RT9A 5I01A 2XUFA 2GD0A 3E05A 3GDFA 4TS3A 2HA3A 2G4VA 4GLFA 1Q20A 5AKEA 4Q1AA 1JEOA 4BLTA 3ZIAD 3VV2A 2XHZA 2V1XA 3NH6A 3T5AA 4CR8A 3M81A 2AEFA 1GOTA 1PKXA 2IYXA 3E1GA 1UKCA 3ZWXA 1AB5A 2V03A 3WDMA 2Z5FA 2EFJA 2H7VA 4XEUA 5EIWA 3VZCA 1DJQA 4R8LA 4LCJA 4NP6A 3TRIA 1T4MA 4OP2A 4DA6A 1PTJA 1SCUB 4RACA 5A0VA 1CZLA 4D99A 2FXVA 3F5MA 4QUHA 3JQ9A 4D0GA 3K6JA 3UMMA 4O4IB 2YRXA 1UKBA 4GMKA 3GCXA 1XZ8A 2M6RA 4F8EA 1JJVA 1JHUA 1H2RS 4GVLA 3TUJC 1NQTA 4TLBA 2WD7B 2PRKA 4XYBA 1VHJA 4UREA 5FL3A 1HYBA 3DAYA 3VDMA 1LPSA 3W5UA 4IJQA 5AHKA 3UB3A 1EJ0A 1QK4A 2VPQA 5JVDA 1S3GA 2C8LA 4WFIA 2GM4A 3INGA 2AUTA 1SVIA 4POOA 1ZLYA 1RC8A 4JLWA 2RCYA 2DQYA 2GYUA 5FUMA 3N6RA 1U8XX 1NG9A 3SDBA 2P9FA 1ULSA 3F5FA 3KOUA 1RQPA 2I4OA 4FD2A 1IBCA 3HM2A 5B37A 5TR9A 4RTMA 5I9TA 3EIHA 4HATA 4P2GA 1EUZA 3DOCA 3OOEA 3FKJA 1KMHA 3OTIA 5DWDA 3GZTB 4JFRA 3ZWAA 2VRCD 5B4UA 4FZ5A 2H5JA 4A36A 4IJKA 2I03A 2AW5A 2C54A 1NKVA 3QXSA 4MQBA 3CLHA 2X14A 3NGXA 1NTOA 3BK2A 3ONWA 3TTYA 2VJCA 3JS5A 3W2FA 1AO0A 4QWWA 5FWDA 1KDVA 2Q21A 3CGWA 3R5SA 2VP5A 2QRVA 1M1UA 2KLBA 1OV6A 5JROA 3TL3A 5EPEA 1FSSA 1YJ8A 2YOFA 1N6RA 4DM3A 3WJAA 1ZHFA 4HMOA 1S2OA 3RRXA 2ERYA 4P4TA 1USIA 4EG1A 2BM9A 4TYWA 2JZCA 3TRDA 4Q1FA 1KJJA 1XSEA 4X7RA 2HMSA 3FNQA 4QJIA 3FPJA 1JGTA 1HKUA 4C5AA 3I64A 1V7CA 4AF7A 5G41A 4W6QA 2OCXA 1DC7A 1UFKA 2DPHA 3X2SA 1LVUA 4DCVA 1I4EB 3L5OA 521PA 3DPIA 3P19A 3R3HA 1SQ0A 4D1YA 1DTWA 3IJPA 4TL8A 2FYTA 1E6CA 3E84A 2N9UA 4KQJA 3RYIB 4IOLA 3WP1B 1KJIA 1ECPA 5HIJA 3JQAB 3WWOA 5IDQA 1BCSA 4KFRA 1RZUA 2ZIGA 4Y2JA 1GDDA 1H5QA 3HR7A 3LQ1A 4RXUA 2AJDA 1IBRA 4IZOA 2OOKA 3AU8A 1FLAA 3CEHA 3N8IA 4WASA 1KEUA 1MRSA 4KXYA 1XEFA 1HEYA 2VDWB 1IH8A 2V9CA 4UQOA 4HDAA 1K6MA 2X9QA 3GLKA 4I14A 4A0GA 1A2BA 2VQSA 3BD7A 4HNVA 4LTNA 3G9XA 4MGKR 4YRJA 2IGBA 3HB5X 4R1NA 2KS6A 1ND5A 1NXTA 3K0KA 3OQHA 1XMJA 4FMBB 5J9FA 4L57A 3QI2A 1JLHA 2REBA 4EATA 4HN2A 1SG6A 3ON5A 5ALLA 2DPMA 3ADCA 3JATA 3NKLA 3R4CA 4EYGA 3IAUA 2AMYA 3RQIA 5HCIA 2C92A 1UC5B 4K81B 1CX9B 3AR8A 4AK9A 3ZLJA 1BX0A 3JVUA 1ACMA 1FBTA 3DMPA 3U39A 4CKWB 3G13A 3OTHA 4E7PA 1NVWQ 2OHJA 1WNFA 5EWLB 1VL8A 4ZI7A 3RUDA 1U8CB 5KTKA 3LRXA 1Z47A 1Q0TA 2OCGA 1ZVMA 1A8PA 2IIPA 4WY5A 3I72A 1ODKA 5EE9A 3LFHA 3PLAE 3IVMA 3GRUA 1X80A 4NV1A 3COYA 4DJFC 3HZOA 5CYGA 3QLUC 4U00A 4B7AA 1YBFA 2ZJ1A 3BD9A 4OYLA 3ZCPA 1RJDA 1RYEA 5CB4A 4TKVA 4PSAA 2QZ4A 3A26A 4Q7LA 4AYTA 2B34A 3A70A 3L8HA 4K86A 3SQNA 3OIWA 2XYQA 4R01A 1CRPA 1Z06A 4K9SA 4LRSB 2J07A 3UWSA 5LL6P 1L3BA 1K7SN 4FMDF 1J70A 4I08A 3OZBA 1IB6A 4CIYA 1HDXA 1DJOA 2ZR7A 2ZZKA 3FYUB 4BZWA 3IR6A 1G8SA 2B94A 1SVWA 4OCZA 3TZ6A 4QVKA 2NO6A 1UMBA 2C4UA 2ZSKA 2UYQA 5ES3A 4TXNA 3Q5DA 4YJKA 3YASA 1PSDA 4M1TA 2VPWA 4ETIA 5JOQA 1HG1A 3I76A 2F00A 1WKCA 4LHYA 1A4RA 2FUNB 4RGYA 3CUKA 3EG9A 3HYCA 1UK6A 5FNZA 3KEGA 3ROTA 4XX1A 4DC0A 1I94B 1K7EB 1XLTA 2G07A 1UMKA 4JBYA 1C3LA 1IONA 2XE7A 3NWJA 4PZEA 1VYHA 3FCAA 5AOCA 4MUEA 3NBYC 4LNAA 4R1SA 1NBMD 1BYIA 1ICEA 2PM8A 4F56A 3G02A 3SCZA 3WKDA 1NAHA 3DXZA 3PRJA 2J7PA 3KKOA 3L6RA 4R0MA 3RC3A 2JVJA 2Q1TA 1BXZA 4MYCA 3EJ6A 4PX3A 2CXRA 4QNMA 3H9GA 4B34A 1X1SA 5K0ZA 4FUQA 3EC2A 2G9VA 1ZCAA 2RAVA 1YB2A 1OLOA 1TZMA 1EGHA 1JG2A 1LDNA 1TUEA 3QKRA 1DWQA 4AUEA 3VMFA 1U0EA 1T2NA 1OQAA 1ZXLA 4WNIA 9ATCA 5LM3A 1S2MA 2ZRJA 2Q27A 4G4SO 1IZ9A 1I6KA 2EJTA 3C5EA 4TN1A 3HDTA 1FYWA 1NA5A 2HRBA 3N5CA 4WFJA 3DFMA 5DMXA 4M54A 2TMYA 1UEXC 3LQRA 4H35A 2G09A 4QGBA 1U4NA 1UKAA 2HIGA 1USGA 4L9WA 2M6LA 2VYNA 5E4JA 1ZKMA 2OBBA 3ZXUB 2JBAB 3L06A 1XVLA 4LRYA 1SC1A 4ZEVA 3A2MA 4FDLA 4ILEA 4KDRA 3HNRA 4MHSA 2B7BA 4QWMA 4B73A 3RSSA 4EG5A 3S8YA 2YICA 4M89A 5JAQA 2HHJA 1VCHA 4TS9A 3HV0A 3WRVA 4DLLA 4B3GA 2ZK7A 2CHEA 4BO9A 2AUMA 1U1GA 1B93A 3DC2A 2H59A 2OO5C 1XMXA 1JQLB 2NU6A 4PZPA 2UUOA 1JHOA 3O3CA 4AQ7A 3AYXB 3U9TA 2XMRA 4RFSB 4IMRA 2IKQA 5I51A 3OPYB 4NZNA 1PR0A 1DBVO 3O4VA 5FPHA 1WUTA 1G42A 1V25A 2OWEA 3EZ6A 3KSDO 2H85A 3E53A 2AOVA 4I5FA 4PC7A 3HJRA 4WW0A 4YLGA 4DDHA 2EWMA 1QX4A 2YYYA 4FXOA 2CJWA 4NF2A 4KIUA 4UMEA 4ZXPA 3RFUA 3NHMA 3SHOA 3W7AA 2GM5A 5CVDA 4F8JA 1BDHA 1KERA 1Y9JA 2IH2A 1ZINA 3CEAA 4ON9A 4GOLD 3H5OA 1GFSA 3BRWA 2WM2A 5FLYA 1IJEA 3MRSA 5GY7A 1DG9A 4YAJA 1TI7A 2GEFA 2Z43A 2QM0A 3VZPA 2C5BA 5BSHA 3I62A 1WX1A 4AQDA 3HBNA 1VKHA 5CNMA 5HGXA 3Q11A 4R8MA 2VYCA 3IIIA 1F0YA 4TN5A 1A5SB 2WKQA 3E3OA 3IAHA 4GP6A 4P7FA 3E18A 8GPBA 2WBLC 1Z5ZA 4JUBA 1BQ3A 3K0CC 1SUEA 2XUDA 3FA2A 3NBFA 3QENA 1OXSC 2G5TA 4L27A 4GU5A 4UBJA 4QLAA 3SE0A 2PBRA 4JBHA 2DHDA 3TCXB 1W0JD 2EWVA 2JFHA 5BSEA 2R00C 3SG0A 5JD6A 4EJSC 3NC0C 2Q7OE 2VK4A 1KFJB 3C3KA 3SQLA 1H1DA 5DM70 4P6VF 1EEHA 4TVKA 2EATA 4I5GA 1SEVA 2HXYA 3DKIA 3RYFA 1SCNE 2A3RA 3RW9A 3HE3A 4U0JA 3GBPA 5AW0A 4XWTA 1YI8A 3UWKA 5LP6B 2A9RA 1EMDA 4E03A 3MGAA 2JFGA 3WS7A 4LRXA 2XBUA 4Y6SA 3U4QA 2YHIB 3DTTA 4JT2A 4D43A 4RBNA 4XEHA 1D0IA 4LRUA 5E3JA 4C0HA 1JHAA 1NW3A 4M1KA 1QMPA 2EOAA 3CLSC 4WADA 2B1QA 3ZGLA 4PWZA 4JY7A 3VQTA 5LQCA 1U02A 4IWYA 3CH6A 4WGGA 5B53A 4P58A 2OK7A 2ODNA 4FQ5A 2X6TA 4ZI2A 1TVKB 1HORA 3IERA 3M6LA 4DDKA 1G19A 3FUWA 2IK8A 5LUAA 1P7ZA 2W4MA 4YUAA 1AK9A 7ABPA 4CKBB 1L9KA 3RJTA 3O0TA 5C5CA 3CF6R 2IKSA 1K6XA 2V6JA 4KWTA 4ZVVA 4C7MA 2QD5A 4NI5A 3H1TA 1QF6A 3E9DA 1KBQA 1CY6A 3Q5EA 5HFJA 3Q8WA 1QP8A 3VJRA 1MO3A 2I67A 3I0MA 4LK2A 3ZXYA 3ETCA 4P84A 4HXFB 3BB3A 4O63O 5EWJB 5A2QA 3OEWA 3V9PA 2CMKA 4FOPA 1CRQA 5FOXA 5FTWA 2W2MA 5KNBD 1EAMA 3UCFA 2FLKA 1QIJA 2CL6X 1ZD3A 3QKUA 2Q2OA 4ZU3A 1W29A 2P4UA 3R3VA 4GMHA 4IMJB 4WGFA 1GDTA 1T9BA 1J0EA 3GLRA 4XDHA 5BO5A 5LP6F 1ZH2A 2JFZA 4JI6B 5L3ZA 2C2BA 1D2MA 4JI8B 4BO3A 3UUEA 5DOVA 3B9RA 3QEBZ 1RIFA 3O93A 1COWA 4HNQA 4X91A 4YRLA 3V1TC 4LYYA 5EERA 5KTNA 3HDHA 3R8CA 3DV2A 5EKXA 3WGOA 1CEXA 3IHLA 2PNJA 3UA4A 4JYAB 4YS6A 4R81A 2P90A 3HQ4O 5AKJA 4MGZR 2WJJA 1HE8B 1QR2A 4Y18A 5EIBD 2BEUB 4L4XA 2UYCA 3ZHTA 4WKCA 4Y2SA 2AFIE 3T0IA 4BLPA 2PMEA 4EPXA 5FOTA 1FZTA 3L6DA 1RADA 1TYEB 4N6NA 3BTUA 2SICE 4C2AA 1S8AA 3RSLA 4H16A 1TCUA 4YECA 1VKNA 1V4VA 1U0NA 2TMKA 3GXBA 3IIKA 4X63A 3QTTA 4RM3A 4FM9A 4KV9A 3RSFA 4IS2A 1OIWA 1E2HA 1P7WA 1UOOA 3GEPA 2NO4A 1GNTA 1MC8A 1FLDA 2ZBFA 3MN1A 3G2JA 4CQMD 2WMYA 3RFCA 4JBGA 1M8FA 2EEPA 1Y3DE 5LQRA 4YASA 1KNQA 3PGKA 4TWZA 1OF1A 3T7EA 3GCZA 3ISJA 3PJGA 3A1NA 4KH0A 2UZ3A 3AP1A 4NV0A 3FDZA 4CUJA 2HZ7A 3KAJA 4WOCA 1Z08A 1D6SA 3R6LA 3WJ1A 3D7KA 1U2EA 3PGVA 3TSAA 5JZ9A 1T8PA 4KAJA 1OLUB 3WV4A 3L6BA 2CHVA 1ML4A 4CIXA 4Z4GA 1N2IA 3OZAA 1YB7A 1NNUA 2OAQ1 3MJTA 1Z5UA 1PGNA 4FGKA 3SBEA 3O1JC 3K9GA 3UO8B 4BB6A 1UAAA 4F85A 2JI6A 1ZSVA 5CFRA 1LBHA 1UZNA 4RL6A 3C7KA 3L77A 3MZ0A 4Z3OA 4RCVA 1DDGA 3T4EA 2FRDC 3ABQB 2Z8YA 2Y71A 3U37A 4LTMA 2W98A 4V2UA 3CZPA 1GKUB 4K9PA 4EUEA 2O4UX 4L8GA 2A5GA 1JIUA 3AY6A 3DZCA 1F1JA 1Z34A 1ZCZA 4KSBA 2VT6A 3LUAA 1VZ2A 1AH2A 4P2BA 4M3NA 3I6ZA 1LLUA 4UMDA 3TMAA 3Q6IA 4IZ6A 2FK7A 1U1CA 3USCS 3HP1A 1OXBB 3E4DA 4KQIA 2ONZA 5G40A 2G1JA 2I2DA 1WAMA 4REQB 1YFKA 1Z29A 3MILA 4C0BA 1N36B 3EA4A 4UUAA 2R1ZA 4CMIB 1JEDA 3KB2A 1BDMA 1IZZA 4RHXA 3TLZA 2E4UA 1HK7A 2CLDX 1EXNA 2JCBA 3AY7A 2WA1A 3PHJA 3V4PB 3HADA 4Q16A 2PMDA 5K8TA 3FTFA 4BU1A 2WA2A 2JC3A 2Q28A 3MMXA 2WIKA 4K2HA 2Q8NA 1NWCA 2JD1A 4RZHA 4U63A 3TZLA 1UM9A 3ROZA 4JFAA 1Z4NA 5IJXA 1DCMA 3FOBA 3IP5A 3LT4A 3RRJA 5DT2A 1DAIA 4PN3A 1YRQA 2XBLA 4G1UC 3LA8A 3B53X 4GMFA 4KZKA 1GJRA 3H4TA 2XUHA 3E70C 2ZJ5A 2D3TA 4D9IA 2I33A 1MJHA 5CCEA 1XK6A 3OG9A 5DM4A 1U4SA 3WIEA 3ZXXA 3DZFA 3FPHA 1ZN9A 4J76A 4ZP1A 3EZGA 1JA9A 3QKTA 4NYIQ 4NL4H 3D6UA 4Z9BA 4FYWA 1B8OA 3CWCA 4KR3A 1YIAA 5JLJA 5CVTA 3W5AA 1ODLA 4BMVA 1MJGA 1L7OA 2LPMA 3CZAA 3L4EA 5EFZA 1F17A 1GZVA 1RHUA 1YRBA 2IHKA 2OWDA 2YNMA 4Q1DA 1GRVA 3HRKA 1ZOPA 3MBOA 5DTJA 3KYCB 1JH8A 5IH7A 1VB3A 1MEOA 1YI1A 2HQOA 2OD2A 1Q7GA 2F1JA 3ED1A 3FF1A 3M6MD 2O4CA 3T9BA 4EHHA 1Q14A 3MINB 4HDRB 4J6EA 3ZHUA 2WT8A 4PG6A 3H2ZA 1TFUA 3UFXB 4UHHA 3BIXA 2A4KA 3GAFA 1QANA 5K8IA 2CKMA 1G5TA 1SXPA 5FTMA 3PF9A 2C42A 2YBDA 5AW9A 4JSYA 5A6SA 2GKSA 1QDEA 4CEIA 1VGRA 5FWYA 2AE2A 2NSYA 2CB0A 2NXNA 1GGEA 4TXHA 4TYPA 2QX9A 1JT2A 1KO4A 3F96A 3O94A 3PSHA 4QJ5A 4Q05A 4W7HA 4PO8A 3OT1A 4AY6A 1JDUA 1MBZA 1NLYA 3QIVA 1UFQA 3R7DA 2PQMA 4DLYA 2YJ3A 1JEEA 3OI7A 3PDIB 3KT6A 4KB5A 4ZI3A 3I23A 2VDLB 4DLKA 1JWAB 4N3BA 1NBIA 3UEOA 2GJAA 1AKTA 4Y6QA 3N5KA 2P27A 2ZXEA 4X6LA 3OQPA 1BDJA 4MV7A 1Y42X 2IU3A 4D4GA 3KBOA 2NUAA 2EQBA 3WGTA 5LU8A 5GM2A 1VSVA 2AGVA 1OU0A 2A5YB 3FZEA 1M8GA 5DRTA 2CNNA 3VOAA 1W2WB 2G5CA 5DLEA 2QUHA 3VR4H 1FLNA 4J75A 2A0YA 2YXBA 1TLFA 5THQA 9ABPA 1E66A 1ZJYA 2H4JA 3R6DA 2VKQA 5DDIP 1SIOA 5F7OA 2OV6A 3JAWA 4YXWD 2F3UA 4W5JA 2OO5A 2YQ4A 3N2KA 4J0JA 2DAPA 2CJFA 2R6AA 2ZDGA 3F9CA 3WMFA 1IM2A 2X15A 2ZQZA 3QSGA 3RPEA 1W48A 3KE8A 1WNTA 1C7JA 5DK6A 5LVAA 1AX9A 1TTHA 1TKCA 3IYLW 3MOIA 1YQWA 4ZI5A 3CONA 4NZMA 5EWMB 3H6GA 5A7HA 1U65A 1NVTA 2AG5A 3OQ6A 3RC7A 4H6PA 5E6SB 1D4OA 3PC8A 4Q4JB 3VNQA 3A31A 3WYAA 3Q9SA 3KSBC 3FLMA 5C8VA 3X2EA 2HHHB 4ITVA 4DR7B 4YJ2A 1NW7A 2OKCA 1D2HA 1XTVA 2P30A 2OQIA 1LB1B 1YQTA 2QMYA 1D03A 1D6MA 4FGZA 4NCJA 2PX4A 3C1AA 3W8RA 4AJJA 4DCCA 6GPBA 1Q95A 2AZ4A 2CXOA 3REQB 1S02A 4C22A 3CINA 1HXHA 1G7RA 4J0DA 5IAOA 2Q6OA 3TTSA 1C9YA 1SBZA 4CM9D 3TG8A 4YRBA 2WDPA 1PS0A 1FVFA 5K0EA 3DPSA 1IPFA 4S12A 1K98A 4EGJA 4KPUB 3FR8A 4NU8X 2C83A 2VOEA 3WGHA 5JT1A 5MN5A 3RTBA 2WSLA 2EF1A 4JLNA 3AVWA 4MWZA 1E2MA 1A7KA 2XCTB 2WKPA 3ORHA 2VVTA 3TMKA 3ZC3A 1C3XA 5FAXA 4RLSA 3TYXA 4PLFA 3SMQA 3CH7A 4WT7A 1ZGGA 4OK5A 1XCPA 1XQXA 1YOVA 3FNRA 5EMJA 3M4NA 1YUMA 4ZCLA 1EWQA 2C3PA 4GYWA 5GWXA 1WLSA 1VBMA 3PKZA 3OPQA 3DOUA 4JEUA 1UCFA 2G80A 2J0EA 2W2OA 5ARCA 4BLSA 4BN4A 2YJ4A 3UQZA 2WTEA 3GP8A 1AV6A 4U39A 3Q4GA 4Q1BA 2GVDC 3NHKA 5TQ0B 1T25A 1UBCA 4D3SA 4JV5B 1H3NA 1KAEA 3DL2A 3PFWO 4K2AA 1NONA 1XHLA 4FYKA 1FNDA 1T1SA 3UUGA 4LFBB 3IUYA 3JQ7B 5BN5B 1H9AA 1EK0A 3EPLA 4UEKA 3FI0A 1SUFA 1VFNA 3RU7A 5BYKA 1QE5A 1U7UA 1BE8A 2C3MA 3U0BA 4IGKA 3LO8A 1N75A 4V0KA 1R5NA 2B8WA 2P6NA 5I9LA 4C6TA 2XLCA 1AQUA 3IPAA 5DGDA 4CL8A 1L4BA 1E4YA 3KUDA 1J7JA 1M67A 1HM5A 4GGOA 5ALIA 2VUIB 5DSXA 1EJ2A 5IEBA 4LDAA 4R1MA 2EDAA 4J2OA 3OJOA 4OXQA 5GVRA 4AF6A 1YQ9A 3BL6A 4BBJA 4DSZA 2A88A 3AH8A 4N3CA 4G6ZA 3HU1A 3GUHA 1B0UA 5TIIA 4RETA 1U5BA 1L1EA 3DEHA 1ZK3A 1JTEA 1RLUA 3X1ZA 4OB7A 3LCUA 3FNGA 3F6PA 3N70A 1UWVA 1AM4D 3MJSA 5DGXA 3VSDA 5BSGA 3C6YA 3W5DA 4JYBA 4F3NA 2QB5A 3P9QA 1ZN7A 1ULAA 3MTEA 3LUJA 5KJCA 3N58A 1EM6A 1XAGA 2HWUA 3OM0A 2NACA 4AWXA 3ZCSA 3FTDA 1Z6GA 2QEQA 3C4QA 3WSVA 1MR3F 1U5BB 1I3CA 1HZJA 5IEJA 2VTDA 4KXNA 3SYMA 1E6LA 1I32A 1KK1A 5F1YA 4RJTA 1E0AA 1WMFA 4QC2A 3W8DA 5LOVA 3EHEA 1RYBA 4FLEA 5JS6A 1RRFA 3CR3C 4YO7A 2OZEA 3T0FA 4F96A 5JC8A 2AHRA 5J40A 4A8JC 4HRYA 5IXYA 2FMHA 5ALEA 1W4RA 4A0FA 4RD0A 3QELB 1SKMA 4ZD6A 4TT3A 1G4UR 1CUJA 1WJGA 1PG0A 4OQYA 4TMTA 1NYTA 4GGMX 1Y8QB 3EULA 4IBOA 5G1NA 3WLRA 3AB7A 3GRYA 2VHEA 3O8OA 1EG7A 1L5HA 1MEEA 2D0OB 3R7NA 1ZRMA 3B48A 1PJZA 3TB6A 4M1WA 4JLOA 3QVJA 4S2EA 2HA0A 3U6KA 1GRNA 1QZXA 4DEXA 4RDCA 1JXQA 1V8PA 1XWWA 3DZDA 3MIZA 2I3BA 4JU9A 4J4HA 4R31A 5ALDA 4HVLA 2D2XA 4N1AA 2OHVA 4LHXA 3KX2A 3KSUA 3LYLA 2YW9A 4ZZIA 4I9NA 4JXXA 1PFWA 3IT3A 4FOOA 5BR8B 2C20A 5K3FB 5JJBA 2YHBA 1FPMA 2NSLA 4UCFA 3V5NA 2WIDA 2XUZA 5C1IA 4ER3A 3VTKA 4C03A 1AUPA 1R4MA 3FYDA 1A9QA 2E21A 1PG5A 1GT91 1UEIA 1A5ZA 2X23A 5CIWA 4JQZA 3S7ZA 1NM5A 3TIFA 2DQZA 3P9YA 3MTGA 4L9RA 1UPXA 3K1JA 5AJZA 3U49A 4HXYA 3U1TA 5J3JA 3OQMA 5A1TA 1W96A 1RHMA 2BTQB 2LV8A 1OWOA 4YCJA 1VGQA 4YRRA 4B6SA 1SC9A 1ZCFA 2ZANA 1AK2A 1N7GA 3DFZA 3M5WA 4QGAA 4RK7A 5DVZA 4JGGA 5KKAA 3AW8A 4YUZA 3B20A 4EPWA 2WPNA 2HK8A 4EQ6A 4RWZA 2I91A 2ZBEA 4BMZA 1NXOA 2PX3A 3LPLA 4YJ2F 3WHPA 3TKAA 4B81A 2EXXA 1KWKA 3EIOA 3R5KA 1LDGA 4YP6A 3JYQA 1G0NA 1Q91A 4JC0A 3UFBA 4EKEA 5LOVF 1KZ9A 2NSHA 1BDIA 3VR3D 5ITSA 4F2HA 2O8VA 4KCGA 1L7PA 1RBZA 3A7EA 3TBFA 1W1IA 3N0VA 5LYYA 2CFRA 2VSOA 4IW3B 4MO2A 4MAMA 4PCUA 4DILA 3JCZA 2Y92A 4J1TA 2PWYA 1Z74A 1KDRA 4QEKA 4JLSA 1ZNWA 3PHLA 4BLWA 1GL6A 1EVQA 4LC1A 1NW8A 4TLDA 4B7ZA 2VQ3A 2OPHA 4WRRA 1T91A 1XZPA 4L8LA 5D3KA 3R75A 4HRVA 1GO2A 3REFA 5C35A 1YVRA 3F8SA 1KF0A 1R4ZA 4EA7A 1M2FA 2KM1A 3T1NA 2GPWA 1AS0A 2IP2A 5U4QA 5IW8A 2ZBVA 1P5ZB 1BSVA 1UMBB 1EK2A 3LPCA 4HNGA 3P2KA 3Q15C 2QLMA 3K5HA 1P2GA 5FR2A 4NQRA 2AXPA 4UAVA 4BNMA 3L7LA 3NORA 1P62B 2KE5A 1YJBA 5DV9A 1T1GA 3BDVA 4XIIA 3VDRA 2YXLA 1SK9A 3CQ9A 2ZTVA 3ZLVA 3RVNA 4CIVA 2AC7A 3EODA 2VDKB 3H11B 2FX3A 2EBHX 4HYTA 1YIDA 3ZHXA 3HNOA 1E1DA 4WQMA 2FGKA 1ZD9A 1YR6A 3IP7A 1QFYA 3LXRA 2HEGA 3DPUA 2FEKA 2YQZA 3ND7A 4OFXA 3AHEA 4ESVA 1UC4B 2AF4C 3WBKA 1X7ZA 1J56A 1XXHA 1PU2A 4TYYA 2GS9A 2I3DA 2ZBRA 1EDZA 1AQYA 3ZTTA 3RC9A 1Z0IA 4XQ0A 5IAKA 3TXYA 5ALXA 1NNLA 4U3JA 3T95A 4B83A 4FU0A 1E96A 2ODBA 3CJRA 4H1TA 3U7QB 5KX5B 1CD5A 4B79A 1VRCA 1OCEA 1DQYA 2XW6A 3EEYA 1JWBB 4LV5B 1W19A 5DMHA 2A8YA 3Q7TA 4Y0VA 3R7LA 5HBGA 2AXNA 1GPWB 2W2PA 1I2DA 4EW6A 1FUEA 1HO3A 2HRZA 1EVEA 1SUPA 3B5JA 5H81A 2WFMA 4QL3A 2RI0A 2B0CA 1USWA 1PWXA 2YN0A 2YWRA 3MQFA 4YUVA 1FJ2A 2QTVA 3VYVA 3QU7A 3VKFA 3Q88A 2ZIVB 5DF1A 4D9BA 1OJ7A 2FFQA 2CDNA 4LJ7A 5JDCC 4NCXA 4COKA 1WR8A 4M7RA 4HPXB 3WGNA 1DTWB 2XZTA 4PAWA 4PZZA 1CY4A 3QOFA 1GZDA 3C7TA 5D1HA 2HDOA 4B85A 2C98A 3OMXA 4L73A 1ZN8A 4QBHA 4QUIA 3KL4A 3VDXA 1E4EB 3B2NA 1UBJS 4YP9A 3QKRB 2DPYA 2QPTA 5K2MA 5IKPA 3M7IA 5JSQA 1Y4ZA 1LNSA 4B3FX 4L51A 3TQFA 4ALNA 1L7BA 3KVOA 1GKKA 2Z3VA 3TAXA 1XQ9A 4F45A 3GJXC 4CE6A 5CFLA 1X92A 4OJYA 5HQJA 3VU9B 3WHLA 1TA9A 3SQWA 3F71A 3OP4A 1FUKA 1OXMA 3IJ5A 3FSGA 4EI9A 1OR8A 1NE2A 1Y6ZA 3O38A 4Q6WA 4IQFA 1Y0BA 1F2UB 4HLQB 1KORA 1U8YA 4DVGA 2IPXA 1LX7A 4FW8A 2IWHA 4YRKA 4NBTA 1BMDA 5EYPA 1E2GA 3CH4B 1B0ZA 3BWBA 1DG3A 1BD4A 3X3HA 1TEZA 4PQGA 5DASA 2WWTA 4BNGA 2FZVA 4FB4A 3NT2A 1ZK2A 5FI5A 1RFGE 1EESA 3OU2A 4FINA 2HO5A 1ZM9A 5D5QA 2DBYA 3UJDA 4DUPA 3N39C 1R8XA 4O0LA 3P94A 4JCOA 4K03A 4NICA 3K2EA 3ZDQA 1Y8RB 3M34A 3OPVA 4CKEA 3E9CA 2GI4A 1NJ5A 3OCCA 5A4AA 4DJDC 3T12A 1FL9A 4XIFA 1RJEA 1N2SA 2YCLA 3PICA 2ECKA 5LBIA 4ACAA 3UV7A 5IWCA 2QY6A 2QN3A 5G0TA 4D92A 5CA1A 2C7GA 4WZBA 1TZBA 2XLBA 3GRCA 4L4RA 4J0FA 2NU8A 4HGPA 2B2XA 1H2AS 2DKFA 4HGQA 4XJSA 1EA5A 3I42A 2FEAA 1E6EA 5I48A 1X1TA 1I5EA 1VZ3A 1BHJA 1M1NA 2IPAB 3INYA 5EVJA 1I80A 2DX7A 5K3FA 3S2EA 3MCVA 4RZ3A 4KODA 3WGMA 1ADCA 1A9XA 4L8WB 3ZGVA 1NZJA 1QZTA 2IITA 4PIVA 1PWEA 3KR0A 4Q66C 4R8KA 4MYSA 5ITZB 5F98A 1E6UA 3T9AA 2HH9A 1P2TA 1QIEA 4GI3A 4MR8B 1DEOA 2D3WA 2HOQA 4CQJA 5LIRA 2NXCA 4GXTA 5K8LA 2P2YA 5KVCA 1ZR2A 1MGPA 4OM7A 2D2IA 4QTXA 4YRFA 2OMKA 3FIUA 3Q72A 3B8EA 2IXDA 3GJYA 2H31A 3BMNB 4MZXA 2PWBA 2VQ6A 4JB8A 2MR6A 4UPVA 3HUFA 5C8YB 2ZWIA 3U7GA 3ZNNA 4MVJF 1PJCA 4WXPA 4KOAA 5BV0A 4MDYA 3WKAA 4ENTA 3K7EA 2FMUA 3G5UA 5LQNA 1O4VA 5SYAA 4CLHA 3BS4A 4LY3A 3JQ8B 3LO5A 2JFOA 1JJIA 2NVUA 4ZRMA 4DVJA 3BL8A 1GTVA 1LSUA 1N2EA 1IXZA 1CR0A 1RWWA 3OU7A 4TGLA 3ESBA 3LS2A 4MR9B 3NH9A 3I8XA 3IBCA 1ZMOA 4IY1A 4LXIA 4RK5A 5A2GA 2VHTA 1L2TA 3KQUA 2GA9A 1O58A 3HVJA 4GOKA 4HAOA 5C3MA 3BFVA 1SHKA 3FPLA 4V03A 1IY9A 1IHUA 2I4TA 3SJ7A 3AINA 1B6TA 3B78A 3ITEA 3FR7A 2JGMA 5CVVA 3HZRA 1ADFA 1FTQA 3E0XA 4LQCA 1N77A 2IV2X 4BP9A 1V5EA 2OAP1 1TYDE 2ZAYA 3NG1A 1V35A 4K6MA 4MR9A 4MICA 2W6CX 4ZKEA 3WB2A 5ANRB 1BWRA 2V5VA 2NADA 3P2EA 3OUTA 5JNWA 5K0GA 4KQEA 2O3JA 4CM1A 1L4HA 1LJ8A 2AOWA 2RB4A 3E9EA 2PU5A 3T94A 5KQMA 3HCAA 4OHXA 1ORDA 1SXJD 1HT3A 1MVOA 3R0VA 4QVGA 1Z6PA 2Q6VA 3BCUA 1PFVA 2EFDB 2H2WA 5A02A 3R0QA 3LUBA 3SBDA 5J2UA 1XA0A 4NWIA 3PC3A 4OTZA 2AI2A 4GBGA 4MYDA 1YZ3A 3AFNA 4MQFB 1LBEA 4R3UC 4D02A 5CYOA 1A0OA 3BKXA 1N4DA 2W5UA 1KOGA 2R7AA 1M2VB 1KZ6A 2PL1A 4MPPA 4RJ2A 3VUEA 5AVQA 4KO3S 1YB1A 1YZQA 2R0QC 1UPCA 2PKQP 2CDBA 5AJUA 5CD9A 5CXXA 3ZWPA 4NNOA 2C2KA 3O4IA 2A0WA 2UYOA 5HHTA 5A5VA 3U4IA 1IB0A 4EUNA 4FCVA 3H1BA 3RREA 5L7WA 1PR6A 5CBPB 4WHMA 3G5TA 3NLLA 5ESXA 4DCJA 1KEKA 2QN8A 4TX1A 1RCUA 2I6TA 3NYQA 3Q2KA 3LX6A 1OB5A 1EM8A 3LBNA 4NDNE 4AYWA 5PGMA 4YMGA 1Q5PA 4I2VA 4XIGS 4YVFA 4GWLA 4PG8A 4TRRA 1XTQA 3DYBA 3NCHA 4QYXA 1ENPA 3LKVA 1XZKA 4DR3B 1H69A 1NRJB 4WFQA 2ATCA 1L4YA 1KMIY 1UWLA 3HH8A 2EL7A 4LDJA 2G7MC 2YZKA 4P36A 4HJRA 1Z6YA 2Q5IA 3DDOA 1F5NA 2H8KA 3E8SA 3UAXA 3O1HB 3UOAB 4X54A 4B46A 2Y2VA 2AMVA 3CLUC 3PR2B 1ZVKA 2CXHA 2EKZA 2QY9A 3CUSA 2PMFA 1D2EA 1NVVR 1SJ9A 1WSAA 2XGSA 3QK7A 3RC1A 1PK7A 5TVKA 4LF5B 2HNBA 1JDNA 4JP8A 3TGWA 3IRUA 3OD5A 3WGKA 1DB3A 5JRZA 3UGKA 2H2AA 4KPUA 1ID8A 2O23A 3DV0A 1XCOA 4FSHA 3NC1C 1R0ZA 4GYKA 2AD1A 3R6TA 5K51A 1BMQA 2R8OA 1QCYA 4AS2A 3BIJA 1P77A 3HA5A 4JXJA 2VLBA 2P35A 1SXJA 2RKWA 4H6XA 5AKHA 3TNJA 4HNSA 1PKEA 2BGLA 3D8RA 4JJ4A 5KYKA 5ICCA 1M8KA 3D0QA 3S29A 5GZ3A 1DJLA 2ISCA 2VAWA 2RGUA 4S1PA 4UVHA 4PTLA 5DHSA 4URUR 1S2LA 4NKRA 1NU6A 3OFJA 3Q9UA 1M6YA 4O0MA 3T0GA 3I32A 3K05A 2AFRA 2P3LA 4N6GA 5IYZB 1RXUA 2QLFA 2QSYA 2IYQA 4TV9F 5EE3A 1CJCA 2CDCA 4H4DA 2QRKA 3UUFA 4RKYA 1FXSA 2HMWA 5DLYA 4YRPA 1I7DA 1W9MA 2NXEA 2PZFA 4U6QA 1XAHA 2X5KO 1XALA 1XEXA 2DG2A 2P9TA 4KKVA 5HMLA 3NNSA 2MYTA 5FBVB 4Z4QA 1FW6A 4Q1EA 3KETA 3IUMA 3OQOA 5G53C 3BZUA 3AZPA 1OT3A 2Y1DA 3U4CA 4C4XA 2O1WA 1CQIA 1S0UA 4GGPA 4DCMA 4F8YA 1N5DA 1PWYE 4QQKA 3PL5A 3W06A 4C7JA 4F97A 4XSGA 1LI5A 3ZGNA 3L9XA 3JAMA 2J3JA 4JLMA 4IGEA 3KJIA 3VOBA 1XJ0A 3P0IA 5F77A 5BV8A 4M1SA 1BCRB 4MUXA 4D8WA 4MEJA 4HZUB 3U62A 4QFBA 3OT5A 1UKZA 1M8JA 4F6RA 5K03A 1TAGA 3P2YA 3T35A 3SSMA 1RACA 3U61B 2I7TA 4DS3A 1PLJA 3MTDA 2QRNA 3GAZA 4ZAYA 3H75A 1S3SA 3DBHA 4RGQA 3TZKA 1I6LA 4LJ6A 5CDSA 4BV2A 3VV3A 4LJ8A 5DHRA 1T9GS 2P6OA 3EQZA 3LWZA 3QWBA 1NXQA 1ESZA 1RLOA 3B82A 5HX7A 4BNXA 4GLOA 1HSZA 2HMAA 3H83A 2V98A 5JZOA 5LQDA 1DJNA 1OFGA 2XCOA 3W5JA 2CF6A 4BHTA 5DN6D 1ND6A 2A3NA 2WU4A 1D1QA 1XLTC 3I6QA 4GSLA 3HO1A 4NOKA 4B2IA 3SNHA 4BBZA 2CLEB 4WBNB 3L1VA 1RKUA 3F1KA 3ZJTA 1QV6A 3K73O 3TFWA 3H2HA 2EL9A 5DBHX 1SBQA 6ABPA 4F84A 3NM4A 2I54A 3BWDD 1XZJA 3VTAA 2WWGA 1L4KA 3LBIA 1KQ3A 4JL5A 1EHCA 2W6NA 2BJWA 3IC5A 3CC8A 3J7TA 3HXTA 4K8RB 1VKZA 2GB4A 3PYMA 4OHMA 4W9NA 4C3UA 3ZDCA 3KJXA 3OKCA 4ADSG 4OLJA 1UBUS 3O47A 1PL7A 1F4LA 1SHUX 2V7XA 4V0OA 1Z5OA 3OEEA 4AZ0A 2B9EA 4PZ0A 4D80A 4D9FA 2OV3A 3VHXA 2I66A 1ELOA 1XMOB 5BQXA 3KYCA 3IA2A 1MNQA 3IILA 2IEBA 3NCTA 3GPBA 3E82A 3KB1A 1H4VB 3VBCA 2GLUA 4IHJB 1HLFA 4DMMA 3NVKI 2REQA 1E63A 1R0KA 3HU2A 3WE7A 1NMSA 4GQAA 4K9LA 3R3UA 2X2EA 2WFAA 1TQ4A 3A6FA 3L18A 5TMEA 2WR8A 4HMPA 1QC5A 5COAA 4BFYA 4O29A 2AJCA 1U2TA 1YCGA 2XODA 2W90A 2IYZA 5KNCD 2CHGA 2F1RA 1H0SA 5CDHA 3I9JA 4RO0A 1T34A 1V2GA 1XDUA 1JQAA 3NNDA 5LB2A 3H05A 3DE1X 3D5QA 4R83A 1QVWA 4M8SA 1OY1A 3R0ZA 4TXJA 5A3RA 1K6IA 4IOMA 5IK2A 2IGTA 2QS9A 1BG6A 3RUFA 2QIOA 2GQ0A 3BH7A 3C45A 2VDJA 3GGCA 1PRYA 1UP6A 5KYYA 4O4JA 1I6MA 2HCRA 2G04A 4PPNA 2WNHA 1VSTA 4DLAA 1RAGA 1NUUA 4Q5IA 4QUAA 3FYSA 5T6BA 4JITA 1D07A 3DAHA 2W93A 3CSUA 2X1LA 1KRHA 2WAXA 4MRPA 4YDRA 4UHKA 2PUWA 3UK0A 1A9OA 3QRWA 3UJBA 5E3HA 3I5XA 4JZYA 4PSVA 3TLBA 1T3TA 2BFEA 4EI2A 2WHQA 4HHEA 1QH1A 1C30B 2BC9A 3A6ZA 3CISA 3N3AC 2ZRIA 4GX0A 2LBPA 4HUQB 4TTRA 3IAEA 4F5WA 3ZKWA 3I1FA 1DAGA 2JLAA 4H6VA 1U1DA 4HOYA 2VXBA 4ND6A 4RMHA 5CDFE 3ZDYB 4A73A 2FEPA 2R6FA 1ZMRA 3I6BA 4K9QA 4OXYA 4NK4A 4E32A 5GTDA 4J0CA 1X9GA 4NYJQ 3ST7A 2ZOSA 2NPIA 4PPQA 2OXCA 3SJBA 4RENA 2FP4B 3E48A 3P97A 2YDYA 4ZEXA 1FMCA 3AOEC 3LRTA 3TEMA 5TS3A 3K9FC 2JS7A 1H1TA 3WWZA 4KO2S 4B6JA 4E13A 5CXUA 4ZHSA 1HE1C 3C3XA 3DONA 2FPSA 3QBEA 2O7NA 5K9ZA 2OB1A 4JENA 3ADKA 1NMQA 4OAQA 1J1UA 1WSDA 1XZNA 4Y2HA 1D2CA 2LTAA 4RFLA 2M1ZA 1R0YA 1YULA 2O0LA 5G1OA 2ZUFA 3CG0A 1U99A 2ZSBA 3KYIB 5JYBA 2QL7A 4OQEA 4Z1OA 1X1QA 2C29D 4G3XA 1MOSA 2Z98A 4JJ6A 3CPJB 2DGDA 1MG5A 2WJVA 1KC3A 3I3OA 1VLZA 3HP7A 3LMKA 4H59A 5CYPA 4ZEWA 3TM4A 4MWEA 3R3XA 1KDPA 2E6KA 1YB6A 1R0LA 1KIAA 1QFJA 1R8QA 2GJKA 2X3UA 3IVRA 3O0DA 4L72A 4Q18A 1NDHA 4RM2A 4BTEA 4O2RA 4JR2A 2PKEA 2YYZA 3CTPA 3KJFA 4KITB 4Z4CA 2FZCA 2QG4A 4XUEA 5DM0A 5JRJA 3SC2B 1PGPA 1Q0ZA 5DP1A 4RX1A 2QE7D 5F33A 4CETA 5JAOA 4AN0A 4U7PB 4ZPJA 2IBTA 3KAKA 5C18A 2X9LA 4Y9RA 3T5BA 4LKRA 4R71A 1QYXA 3VR3A 5LYJF 1EUCA 1R4NB 3DCJA 4AI6A 2G70A 2P67A 3HKEB 3WLKX 4ENPA 3O8RA 1ZNQO 3B6ZA 3KQQA 2HJWA 1QQ7A 13PKA 3KOOA 3WMGA 3L0DA 4KPFC 3DMGA 3A3PA 5ADUS 1N2JA 1ZW1A 2DSNA 2ZI6A 2B82A 4XVRA 2DR3A 4YNBA 5J5AA 5B2FA 1P44A 5K0JA 1SA0B 3O8NA 3SVZA 1T3GA 1H8HD 3GLTA 3Q7SA 3AI7A 5GOTA 2I76A 4DC1A 3KQOA 5G02A 1HNNA 3L05A 1MVNA 3HHEA 4TSFD 2CNBA 4LQLA 4CKZA 1L7NA 4WOKA 4RHTA 4JUIA 4LS3A 2AJ8A 4DG5A 5KSYA 2YOHA 3W9UA 4MDHA 4R69A 1GRQA 2HPAA 1XEXB 1PFKA 2IHYA 3FJOA 4N5IX 2VP9A 1AS3A 3VKHA 2XGOA 1N34B 2ZUEA 2ZROA 2GWRA 2RAUA 4OHFA 5AHWA 4B71A 2PNFA 4GSKA 2SKCA 4RKEA 1S9HA 3WQSB 5KOYA 4LRWA 1BVHA 2WG0A 3WQBA 3DHNA 1RM3A 2P2CA 5EJEA 1FW8A 4F6LA 1APBA 1DAOA 4ZU1X 2XMQA 3ZX4A 1CHNA 3ITDA 1LF5A 4DV6B 1NJ1A 1ZNZA 4JBLA 1ZGBA 2JAQA 3QXGA 4WNYA 1KH2A 2PVCA 3WMWA 2J9FA 4X97A 3ACDA 3EQ7A 1AKYA 3RK0A 2H51A 5CAEA 3I2YX 3A9UA 4JA2A 3T3GA 3QEAZ 4QTUB 1LKZA 4BQOA 1OBCA 2B4RO 1JG3A 4QGGA 3A6EA 4R98A 3IKJA 5CJ2A 2ZSFA 3NATA 3M9XA 4TWJA 1SQGA 3JZDA 1A71A 4PBTA 3U6BA 4RU1A 4LHVA 3GMSA 4MLDA 3SR3A 1CJUC 2E6UX 2XNDD 5L53A 1AC5A 1SUAA 3MS7A 3BWYA 3PXCX 3OJXA 5ECDA 4KC0A 1CVRA 2OHXA 4LJ4A 3PJFA 4TLMB 5ALOA 4BE7B 4DABA 1UDWA 1WUYA 1EFRA 1IK6A 1I01A 1LF0A 3C15C 4S1VA 4W5HA 1Q0SA 2QMQA 2QN1A 1CJMA 2ZR0A 4JVLA 4O2BB 5FWXB 4O1HA 5E1BA 4KDEA 1ZA2A 4BAZA 1CRWG 3Q5GA 1W5FA 1FDOA 2J9FB 2FEOA 2SHKA 4O2AF 5E7QA 1X9HA 3BWEA 1DU4A 1YAJA 4B3MB 5CTAA 3OLQA 4L78A 4O4LF 2YH2A 3D2AA 3Q7EA 4GI5A 3M9WA 3ENQA 3O8LA 4ZO4A 4BJHB 2DLCX 1GA6A 2AXQA 4GD3Q 2PVSA 4ENRA 2AB0A 4NJOA 2A30A 3OBBA 4BO5A 2ZSAA 3ZZUA 4CRWB 2JBHA 3DFFA 2JIOA 2FUG1 3A37A 3H4MA 1YTUA 3EDOA 4IGFA 2XKBA 1OPXA 3WGJA 1VG9B 1NVMB 1TU4A 4OI1A 1U3WA 1H4TA 4HFMA 4DR1B 2ZE8A 4P31A 3VHLB 1E5LA 3W4IA 1JRLA 2J4DA 4YAOA 4B4KA 1I4DD 1N7IA 2JD0A 4HH3C 1MIOB 4ND5A 1X3LA 1X70A 1P60A 2IXFA 3UNXA 2Y99A 4ETMA 1QH9A 1Z62A 3D2CA 3DZ8A 3L8FA 4IIJB 3UK1A 2KYRA 5EL0A 2BP7B 3PCRB 5HWSA 1IBKB 2Z6UA 1WULS 2Y4OA 4LHEA 2AN4A 2NU9A 3HA7A 2Y9MB 1XZBA 3CMMA 4NX2A 4R84A 2XJ9A 2W43A 2HA6A 1QWOA 2RHDA 3KCQA 4ARAA 4G0UA 2UVQA 2BI8A 5AVTA 3OLZA 2DECA 2CT8A 1KDTA 3AP3A 4TQUS 4BC1A 1M6VB 1RVDA 5CHEA 4ZK6A 4LV6A 3MAJA 1XT6A 1YDWA 2Z8XA 1XZHA 3HJFA 4CLXA 3DXYA 1PR4A 4BKOA 1AZSC 1NVVQ 2C3OA 2H7YA 3LZ6A 1D1SA 4QUBA 4X24A 5LP6C 3ABSB 4BIMA 3NP9A 3TLYA 4AD8A 4R3WA 1CUVA 2PSSA 4NZYA 3CZMA 1DX9A 2Q2VA 1ZD1A 1UJ5A 2W2LD 5TNXA 2YMMA 3OSZA 2J6CA 5KYUA 3K0AB 4PO1A 1KY2A 4EI7A 3ZW9A 2G71A 4U2DA 3R76A 4TXLA 2BTEA 3UB4A 2VYVD 3DT8A 2J3IA 2V8OA 3N74A 4KLNA 4PHTA 2BMFA 1CZOA 1OAAA 1AY0A 4X20A 1KAHA 5J5CA 3VPHA 2ZT5A 2RG7A 4CM9A 1J07A 1IE3A 2QPLA 4IIHA 4QRIA 3VR2D 4YCCA 1R00A 2HJHA 3DVLA 5BT8A 2A9JA 4DJEC 5B1YA 2OHFA 5F1KA 4BFZA 3DGFC 4HH1A 3UC9A 3RYCA 3F8WA 4FE7A 1TUBB 1RS0A 1NSTA 1CEEA 1V5FA 3KKQA 4HADA 4NBNA 2X9VA 3BGWA 5IRCD 1EZ4A 4QGSA 4YEDA 3W9SA 4Q3KA 3ESRA 3ZZNA 2CFOA 3P2IA 4IINA 3CURA 3K8QA 3ZDXB 4EVIA 4RTKA 2CUZA 1ZS9A 2TRSB 2PU7A 1WA5A 3C16C 1KYIA 3OCWA 2DUUA 2Y8EA 3WDLA 1G8MA 3FGPA 4KPYA 3EIUA 1JKXA 5SICE 2FB9A 4BRWA 1Y1QA 3S44A 4HLCA 5HRAA 2QQGA 5JD4A 1RBQA 2RBGA 5ALTA 4ZHQB 4G5RA 1YC2A 3SF8B 4Q9KA 4CUZA 3SVLA 2CVQA 4ZMBA 1E2KA 2PBLA 3HC7A 3U9LA 3ZQ6A 2HQBA 1BW9A 4BMSA 3BQNB 5KKCA 1XD9A 4EJMA 4HEQA 1C7EA 1TCAA 1DV2A 2F64A 4NULA 4CTOA 3UHFA 1AGPA 2ACEA 2APJA 2X8AA 4FI3F 2VJBA 4KRGA 4L5JA 3BCRA 4CKEB 3U7FB 1GAJA 1Y8RA 2BGKA 1DQZA 1SXGA 4L2IB 1UWCA 2A1UB 5JPDA 3LYUA 4MV9A 1P2UA 4A6XA 1TLTA 1WXWA 1I0IA 4HXGA 5KQRA 3KQNA 2A4MA 3IB3A 2GTPA 4US1R 5I8PA 5JD3A 2IHBA 4J1SA 4D82A 2VJYA 1XI2A 2GEJA 3HYTA 4JD5A 4KLAA 3I8OA 1VHQA 4C4AA 1PD1A 2I34A 2ZYIA 3HYSA 2BTOA 2EJUA 4AS3A 3THXA 1NFFA 4TUYA 4AIRA 1H65A 4BMXA 2NIPA 2AMLA 3L7DA 2HPHA 3NBZC 1YA4A 4GH5A 2IPLA 3BHJA 2H1HA 2DBRA 3UN1A 3K20A 3GRFA 2MHCA 3GZNA 3B52X 1WXHA 4QNNA 4UE2A 3UMVA 3FVVA 3AKEA 4K8OA 5HK9A 1I13A 5GAJA 1JZQA 3C8DA 2ZCJA 2QTMA 4UJ5A 3LX4A 1GY8A 3S8MA 3UM9A 5CFQA 1EIWA 4FONA 2EJWA 3TPFA 4F3TA 3CY6A 4YRQA 2PMKA 3G9UA 3EJWA 4URFA 3RIXA 1WABA 2V45A 3OTOB 2XQKA 3DEAA 2FPMA 2PKXA 4MRNA 1NIPA 4BX0A 2O2SA 1VJ5A 3N0WA 2OPBA 3HCDA 1ZRNA 3GLQA 4KI0A 3AHDA 4JHXA 2WD9A 4W9RA 4ZGGA 3VTZA 5D6NA 1EUDB 2DWQA 1ATZA 5DN9A 1TF2A 5BN4B 1OFHA 1RABA 2I6GA 2LXNA 2FZEA 3CEJA 3WFZA 4CTMA 5FR1A 3MGCA 3W5CA 3AHCA 2HTEA 5HOEA 5BWMA 1R16A 1S3FA 2FPIB 2ZEJA 1JQJC 2OBFA 2YNMD 2E49A 2YWDA 2ZYGA 3HKCA 1G6OA 1FE8A 3UV3A 3IP8A 1QH0A 1E2EA 3JAWB 5DYYA 2BISA 4PS1A 3G1WA 1AKWA 2HX1A 2PSJA 1EWVA 2W6JD 2OORA 3BORA 3VKUA 1GAQA 3GB9A 3MWDA 5DBOA 2UAGA 4BNKA 4FCCA 1QNLA 2GNPA 2RK6A 4AROA 3MAAC 1BS2A 3ZE7A 3NAQA 5EGSA 2QMZA 4JLUA 2PZKA 4K88A 2M98A 1HPLA 3ZU5A 4GE3A 5KQPA 1JJ7A 1KE1A 1ZGZA 4WVLA 4CNQA 1L7RA 4OGFA 3TLAA 3UC5A 2PQ6A 4X65B 2AVDA 4WESB 4KI7A 5JY6A 3RBAA 3VPSA 3SGLA 1Q77A 4XH9B 5CG1A 1GUYA 4P33A 3WLLA 3TG2A 4H3VA 4QT4A 3ZCQA 3EFOA 4RV4A 3GNSA 4NJEB 1ISGA 2C9MA 4E70A 5K7SA 3QVGA 1TJPB 1MB4A 4MS1A 4DCNA 2HCFA 2P1DA 1K8YB 1QH1B 2BY4A 2KW5A 2NNLD 1LUAA 1V8BA 2XEDA 3SVTA 3O84A 1NW4A 5T57A 3FPEA 3TS1A 4EL0A 4HTFA 1AMOA 2EIHA 2XX3A 2ZSIA 3RF7A 1T0BA 3ZDAA 3KELA 1X7ZB 4JHLA 2IEGA 2PY6A 3KYDA 1U9IC 4GMGA 1WHTB 4QLOA 1R6AA 1N9ZA 3A3KA 3FXAA 3QY0A 4H3SA 3RKRA 4FI3C 1KY5A 3GT7A 4XRRA 1YZLA 1HMPA 3PL1A 4MP3A 1F06A 1XF1A 2DQSA 2GTHA 1EVJA 2HK7A 3F67A 1VE7A 2YN4A 2ZYAA 3HPRA 1PSZA 4HFJA 4PONA 3GG9A 2JIDA 1AS2A 2NW6A 3FRHA 5H9VA 1T5SA 3ANYB 5E0OA 2H1OA 2O5EA 1ZRSA 4QFCA 1PNTA 3L82B 4BNTA 3TCKA 3WYGA 1UQUA 1Y1SA 3G0DA 4GL2A 3E7FA 3D8UA 1N0HA 4EPYA 1QIHA 3D6AA 5EP3A 3S5UA 1C7ZA 3AVQA 2BONA 4X45A 4HWSA 2ZREA 2GYYA 1K8ZB 3EASA 2COUA 3G59A 3R8FA 1XP5A 4OFBA 4RF5A 1P75A 1W88B 4B31A 1MORA 2AVNA 4KPGA 5BR1A 2EJVA 5EN4A 5JASA 3ADBA 3PXGA 4BO1A 1Q1NA 1EWKA 2JARA 1Q2XA 2VPIA 1SVMA 1VG0B 2AJBA 2ZUDA 2UV8A 2HA4A 4GPZA 3ZZMA 4AUKA 4KMSA 4CL3A 1SKAA 2O3UA 1K2VN 3U44A 4MVJM 4D2IA 2PDAA 4CLRB 4PNZA 1IY1A 1OX4B 4WOBA 3MCWA 1BFKA 3PENA 5YASA 5DLDA 4B3SB 1TEHA 4TQ9A 2QP9X 1S5PA 1A8QA 1THMA 2EKPA 5I8ZA 5BWLA 1T3LA 2FOIA 3INRA 2O2YA 3URKA 2IIVA 3N87A 4EEKA 5KYUB 3AVVA 4CM4B 2R1TA 1YL5A 1V41E 5KWSA 2NU7B 4ZQIA 3STHA 5F73A 4PGHA 1ZGCA 3RUIA 1M0WA 4NOMA 3TLJA 4R51A 3D4OA 3C3WA 4FMDB 4PSDA 2ZDQA 4JKOA 5E1DA 3I09A 5FJJA 3E7XA 4D5GA 1XJ5A 1G59A 5JE8A 4C7OA 1C81A 4NATA 5JSUA 3OOYA 5LDGA 3HDJA 4RKRA 1WW8A 4BMCA 2PZGA 2HRRA 1XVTA 2QE6A 3KK0A 2UDPA 2KX7A 4J7AA 1PFYA 3BF8A 3IBYA 4QYMA 1ZLXA 1DC8A 3A10A 4DUGA 2QTTA 1QM5A 3NTUA 4EMBA 4EIWA 1Y1RA 4IPTA 1YQGA 1EQ2A 3IT2A 1KMNA 5ENDA 4DIKA 5T6MA 1XX6A 3NOVA 3L6CA 4PRYA 3CVXA 3WP0A 4MX8A 4QULA 3H2IA 3QVLA 4K9RA 1G5HA 4MRAA 5H02A 1Z2DA 4Y0NA 1PVOA 2IDMA 5FP0A 4F4JA 1ONBA 2BL4A 5DULA 3SC6A 1FEZA 3QBDA 3ZX5A 5D5HA 2GZHA 1CTQA 3LLCA 1SVOA 4FBGA 1A9ZA 3CW2A 1M34E 4HJXA