2WD7A

Pteridine reductase 1 (ptr1) from trypanosoma brucei in complex with nadp and ddd00066750
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
267
structure length
249
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE
publication title One Scaffold, Three Binding Modes: Novel and Selective Pteridine Reductase 1 Inhibitors Derived from Fragment Hits Discovered by Virtual Screening.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
total genus 92
structure length 249
sequence length 267
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2wd7A00
3H9QA 1DC6A 2BI7A 2VUTA 4Z9FA 3VZSA 1GADO 2R00A 4GI2A 3F1LA 4UUOA 3GGOA 5TSDA 4C4OA 4L9RA 5BNTA 3AM3A 1OMOA 2C5EA 3SJUA 3N58A 4EZBA 4ND3A 4OSPA 1LSOA 3JQ7B 1B2LA 4BO1A 4DA9A 1Q0QA 3RFVA 3KHUA 3T7EA 5JLAA 2HLPA 3HZZA 5JW6A 4INAA 2I67A 1VJ0A 1E3WB 4P4NA 2FMUA 2O7SA 5L40A 2NU6A 5ITVA 2DKNA 5IXSA 5KJEA 3KSDO 3OICA 4NR0A 3ZWAA 2BRUA 2QRKA 1BW9A 3Q2KA 5K9ZA 1WXDA 4FB5A 3S55A 3ZV4A 1TVEA 2P4HX 4DQVA 2D59A 2JCVA 3OETA 1WZEA 3WB9A 3IL2A 1Z75A 2VNAA 2ZQYA 4QXMA 2HRZA 2GN4A 1VKNA 4NFYA 5COAA 1U7TA 3K9QO 3V2HA 4PLFA 4YAKA 3W8FA 1MFPA 3X2FA 4GQAA 3BTUA 4GSLA 2PLAA 5KJ6A 1Z7BA 1PQWA 3JSAA 1FF9A 5DBGA 4IZHA 3K8ZA 3LC7O 2EXXA 5C37A 4RPHA 9LDTA 3SC4A 3B20A 5I9LA 1GD1O 1YQDA 4LISA 1YB1A 1GYRA 3F1KA 5IDXA 5TT1A 5KTKA 2WE7A 1TI7A 3EMKA 4HFRA 2P5YA 3PQDA 4DUPA 2IRWA 1QYVA 3GEGA 4N5LA 4DIBA 1ULUA 3I5MA 3IQDB 3ZV6A 4CUZA 4GWKA 4XA8A 1WDMA 4AJLA 4PG4A 4NJMB 3PJGA 1DC5A 3NJ8A 1XQ6A 4CL3A 2AHRA 4AJKA 5IF3A 1R4NA 5FI5A 1N9GB 5DF1A 1P1HA 1P1RA 1ISIA 2DLDA 3BMCB 4KTVE 1PZGA 3EHEA 5CEEA 3DHEA 5JS6A 1OI7A 4DQXA 1Y8RA 3C7AA 2HRBA 5JE8A 5TNXA 5I7EA 4I9NA 1E3JA 3ITDA 4R3NA 1UXIA 4NBTA 4J3FA 4FJ1A 4XGIA 3M2PA 4M87A 3OHSX 3OIFA 4BNZA 1Y5RA 3L77A 2DQ4A 3GVPA 3U0BA 5AXAA 1UXGA 2ZIZA 2E48A 3BZUA 3GRPA 1A27A 1T4BA 1ZZEA 2BI8A 4OSOA 4PRKA 4IY1A 4J1NA 4TRJA 1IY8A 3JD2A 4BNLA 4Z0PA 1HSOA 3PVZA 3VTFA 2VWPA 1IHXA 1MXFA 1UXJA 3QSGA 2H1SA 2O23A 4R69A 2Z1MA 1K6IA 2IZZA 2OFPA 4XX0A 1B0AA 1J4AA 5IDQA 1G1AA 4LCJA 1NXQA 1PGJA 1VPDA 5ILGA 5ICMA 2RH8A 1YJ8A 2W2LD 3OP4A 1V9LA 2FSSA 4BV9A 2IYOA 1GV1A 2RHCA 4FJ0A 3IUPA 2EW8A 4ND1A 4A73A 2B4QA 2HU2A 4A7PA 4JCOA 2WE8A 3NYWA 4IJUA 4OAQA 1GDHA 3ZHXA 2JL1A 4YQYA 1E1LA 3F47A 1YWGO 4L76A 2Q1UA 1C1XA 1HRDA 3SBOA 1YB5A 4WLVA 4NU5A 4BNVA 3ETGA 2Q99A 2BHLA 1N8KA 2NLOA 2PD3A 4GMGA 4NBVA 4ONEA 4WOJA 3PHIA 1NWCA 4BO5A 2G0TA 3WLFA 4AJOA 2Y1FA 3DMTC 1J49A 1X13A 3LQFA 1ONPA 2FP4A 5K6AC 5L7YA 5JCJA 1UXKA 2HMTA 4WLOA 4NH4A 5TS3A 2W2KA 1U4OA 2ZCVA 3FR8A 3KB6A 1QV6A 4LSMA 1BVUA 4QX6A 1Y9AA 2JFHA 1UAGA 1YOVA 2JD2A 3E9NA 3F4BA 1R4MB 2IXBA 5A04A 4WCFC 3GEMA 1AUPA 3SJ7A 1HDZA 4GVXA 4AJHA 2B36A 3LYLA 2VYND 3D0OA 3GR6A 1YBMA 4Q3NA 3CE6A 4XQ9A 2NTVA 4ZU3A 1CF2O 3EVNA 3BTSA 4BNGA 3EDMA 4AJIA 1PL6A 3DZGA 3MJTA 4PG7A 4RORA 1PS8A 3HWRA 4K6FA 4EEZA 2I5PO 1ADCA 3ENKA 4R4JA 1ZSVA 3DMTA 4TKMA 3Q1LA 5KJCA 3OFSA 4PLTA 3QQPA 4NPCA 5K6AA 4RLHA 4EBFA 3PHGA 3G1UA 4MDHA 2G76A 3T4XA 1NVGA 4FW8A 4Q3BA 3S2IA 4E30A 4BNIA 3ADOA 5LDHA 2VNSA 5G4KA 2ZTLA 3D4PA 2WMDA 5TJHA 1T2DA 1B8VA 1KYQA 3RUFA 1E0DA 2CMDA 2Q3EA 3GZNB 3PWZA 1BWSA 1CYDA 4NBUA 1YS4A 1YE3A 4WCFA 4L8VA 4ND5A 5TF4A 1T1RA 1P0FA 3WGHA 3GDOA 4M1QA 5BNFA 9LDBA 3Q6IA 4MPDA 4BGUA 1LRKA 1Q0LA 2C07A 4YJHB 4RPJA 2X9GA 1GUZA 3Q9NA 1LBEA 3UCFA 4BUCA 2OBNA 3HDJA 3DXFA 3DTYA 4YTEA 4CM3A 1LDNA 4G65A 1VL8A 3PWKA 3GF4A 4U7WA 3IAHA 4OMUA 1LDBA 3TWOA 5KKCA 3UHAA 4MOWA 3JQ7A 4ESOA 4IDAA 2NU9A 5I8ZA 4WUVA 1PZHA 3LT0A 1O8CA 3ANNA 3JQ8B 1GY8A 5JNLA 1XR3A 1U9JA 1E3WA 1JW9B 5HA5A 5THKA 2Y1DA 4JGBA 5A9TA 4EDFA 3P2OA 5I7FA 1YJQA 3BMNB 5F1KA 3OM9A 2GZ3A 5EESA 1GZ4A 2A35A 3DHNA 1JKJA 3GT0A 4RCVA 4RF5A 3DZJA 4NZ9A 8LDHA 4LCEA 4BKOA 4E2ZA 5K0ZA 3TN7A 2VTDA 3PZRA 4QQRA 4OOFA 1RYDA 4XIJA 3ANLA 5A05A 4YT5A 3BXXA 1Q1NA 1ENPA 1RJWA 3DBHB 4PLGA 3DZIA 3UCXA 2OL4A 4FR5A 4J2HA 5KJ1A 2C20A 2CDAA 3L4BC 3ROPA 4JK3A 3E5RA 3KSUA 1NPYA 3BMQB 2OP1A 3HG7A 1ZXBA 4H16A 1EFLA 5IN4A 1NX6A 4UREA 4IINA 4ZQFA 1DO8A 2WD7A 5ER9A 2FRDA 4M55A 2Q50A 1FMCA 3E1KA 3HE3A 2IE0A 1P9LA 1ZSNA 1U7HA 4OXNA 4AG3A 1A4IA 1M2WA 4DPLA 3H3FA 4BO4A 1P1KA 1ZJYA 3LT2A 2DAPA 4B79A 3VOSA 4HFJA 3PGJA 4BKRA 3BMOB 3JYLA 3NGXA 3NKLA 1U8FO 3UF0A 3EYWA 2W8ZA 2DU8A 4XB2A 4BNJA 2NTJA 3HUDA 1MB4A 2VQ3A 3NV9A 3PYLA 4HNHA 5F5NA 4MIYA 1U5AA 3WNVA 2ZK7A 2I66A 4JBGA 3FI9A 4HWKA 3BMCA 3I9KA 1XELA 2IXAA 5MDHA 1QYCA 1JWAB 4CQMA 2WTBA 1P44A 1MA0A 4HBGA 2AG5A 5IFLA 3C24A 4GX2A 1E6EA 1NQAO 4IXWA 1Y5MA 1ZVMA 2GN8A 3ZU5A 4CLRB 5EQFA 3MEQA 4CPDA 2X58A 3L4BA 2IEDA 4NI5A 2Y0EA 3H4VA 3U4DA 4KUEA 5C3MA 5J23A 1TEHA 3B1JA 1B14A 2OOSA 4A5OA 3ON5A 1JVSA 2GN9A 3JQAA 1NR7A 5C7OO 2J5QA 3GPIA 1YRLA 4RLSA 2JD1A 2F00A 5JSFA 4DLLA 5TT0A 3WLEA 1HF3A 5JO9A 4MP6A 3TSCA 2PWZA 2X5OA 5IZ4A 3WWZA 1QYXA 3ZWXA 3GDGA 5JAQA 4A03A 4TRRA 3H9JA 5HS6A 2G17A 2DVMA 2TMGA 1Y8QB 2GPTA 1UZMA 4UVIA 2JHFA 4W9NC 4K6CA 1B15A 2VCYA 3V1TC 1PJLA 1NFQA 3GOHA 4BB5A 3I9LA 1NAIA 5AOVA 3KYBA 1Y6JA 1I33A 2Y1GA 3RFXA 3U5TA 4G2NA 4DIOA 1XGKA 2EIHA 2GD1O 2HJSA 2R6JA 4OOEA 4NFHA 3ZHZA 1X7DA 2IZ1A 4TQGA 2AQIA 4KDFA 7ADHA 1R66A 1IUKA 2CDBA 2HQ1A 3QVTA 2GERA 3JQ6A 4DLAA 1KERA 3TZHA 5KCZA 3RQSA 5A03A 4R1UA 2ET6A 4NBWA 2R2GA 2O4CA 2DUWA 3TFOA 1F14A 3NTQA 4FSHA 5CG1A 1H2HA 3L6DA 2YZ7A 2Q1SA 3QWBA 4MIEA 4RF3A 2BGLA 2YV2A 1VKOA 3NGLA 4U8GA 5JCXA 2GYYA 1R4MA 2NNLD 4CMAA 4WCDA 1F8FA 3QWAA 4BIIA 4PG6A 2P9EA 3DTTA 3TF5A 1IHYA 4MVJE 3H9EO 3RUIA 4W9NA 2X5KO 4XDYA 1PJQA 1K6JA 2DTXA 1ONOA 4WEQA 2YV1A 4Y6SA 3PP8A 2RIRA 1T1SA 4UUMA 1C1DB 2VYNA 3VPFA 4B8WA 1F12A 1H6CA 4BGVA 1QRRA 4J43A 4QO7A 2JFGA 4BKUA 3DONA 2PH5A 2FPIA 1R0SA 1ZKMA 1C0PA 3DOOA 1IE3A 1LSSA 1P33A 5DCYA 5BT9A 4D3SA 4GH5A 5I7SA 1HDXA 5LDGA 1RM4A 3KYDA 1BXGB 4HFNA 4OO3A 1LXCA 3KXDA 5A06A 4DWVA 3KO8A 2EJWA 3LK7A 3IMFA 3FHLA 3AW9A 4FC7A 1B3RA 2B4RO 3L6EA 1SB8A 3QE3A 2OZPA 3FR7A 3OJLA 4TRNA 2RH4A 4YAJA 3GZNA 3NTOA 4MO2A 4MP8A 4Z6KA 1QLHA 5DBIA 2QRJA 1SOWA 1KVTA 4CODB 2X0RA 1J6UA 4CV1A 2I76A 5KVCA 5MGBA 2DTDA 3JQEA 3NUGA 1YKFA 6ADHA 4TKLA 4BKQA 5T67A 3D64A 2X0NA 5KNLA 4U5QA 3RI3A 1JKFA 3GGGA 4Y6PA 2FN7A 4AJ1A 4AJPA 3N74A 4DYVA 3MTGA 1Z82A 4OL9A 2OP0A 3Q2IA 3I9OA 5C5IA 1E3LA 1KEWA 6LDHA 5CEFA 3ZWCA 1V3UA 2AE1A 2PV7A 3LT1A 3O03A 2X0IA 2JHGA 1U3WA 2VZ0A 1A4UA 1E7QA 3JQ8A 2PGLA 4RVGA 1DJQA 2YY7A 2P68A 2Y68A 3PJEA 1WZIA 5L4LA 1T2CA 2QIOA 4GSKA 3BMNA 4OH1A 3I23A 3LDHA 1AGNA 4PLPA 5EIOA 1DSSG 4MVJF 1OAAA 5T8KC 4RQUA 3TZ6A 4D44A 3KEOA 5JDCC 3ZWVA 3OIGA 1MC5A 4B7CA 1H6BA 5GMOA 3GN1A 3WDSA 3OA0A 2H9IA 3OECA 1PGOA 1PWXA 2E82A 3AOEA 3JQGB 2J6IA 3F4LA 4BVAA 1LDYA 2WYVA 2Q49A 4D0RA 4UVEA 3V1YA 3NTRA 5JAIA 1JDJA 1KEUA 3DBHA 4R01A 4G5HA 3JYNA 4CLDA 3R3SA 1DAPA 4IGEA 5GZ3A 4PCVA 2PZMA 1MP0A 1NQTA 4CQLB 1GFSA 1IZ0A 1HWYA 2AQHA 4W7HA 3FF4A 2AW5A 1D1SA 1D8AA 1PQUA 4E31A 1D3AA 3AY7A 4MIOA 1SC6A 4GBJA 2Y1CA 3BHIA 4FOSA 4JX8A 5CAEA 1HDGO 1EUCA 3MZ0A 1C14A 4B4VA 1BGVA 1CQJA 3S8MA 1U1IA 4CJXA 4IMPA 4GWGA 1MG0A 2EGHA 3BMOA 4JQCA 4GX1A 4IDFA 5T8KA 2W90A 2UUOA 2Y93A 1B7GO 3G3EA 3DHYA 1KVRA 1DDOA 2GASA 4OYRA 1CEQA 4KQXA 3PYMA 3WMWA 2HMWA 3VH4A 1PIWA 2HUNA 4A0SA 3EK2A 3ZWMA 5DBFA 1XEAA 4FFOA 3A28A 4ZQGA 4BNXA 1DFIA 3NRCA 4ZN6A 4XYMA 1Q0HA 5CDGA 2O2SA 2XF8A 3AI3A 4CLHA 4PVDA 4CLRA 5FF9A 2HJRA 5GZ1A 2JCXA 3E82A 1PJCA 2VOEA 3INGA 3U62A 4E2WA 4KWIA 2C0CA 2XPCA 4B4UA 5DN9A 2ZYDA 3TL2A 5BSHA 2LDXA 3EY4A 3MWEB 3QRWA 4OHUA 4FN4A 2HMSA 1SO8A 2CFCA 4PRLA 4RVFA 5L3ZA 3WGYA 1DIRA 3ICCA 4IDEA 4Y67A 3WBFA 4CM8B 1XDWA 5A3JA 3TL3A 3PHLA 3GVIA 2FR1A 3U4IA 1X1TA 3P5SA 5F1PA 3VKVA 2VWHA 3BHJA 4BHTA 1UDAA 3O9ZA 1Q2XA 2Y99A 3M1AA 3VHRA 3HB4X 4A10A 4BNKA 4YB8A 1GCOA 5HS4A 3I3OA 1X0VA 4RZHA 4RO0A 3JQDA 1Y8QA 5HRUA 1AXEA 2PY6A 3IS3A 4NFSA 3P19A 3RUHA 3AFMA 3RFTA 4XGKA 3GHHA 2GZ2A 4GGOA 4Y9DA 4NU6A 1PSDA 3HDHA 4DMMA 3WNQA 3PQEA 2B35A 1ZBQA 1TXGA 3C8MA 4J90A 4CV3A 4GLLA 1ZUD1 1ZK2A 2CY0A 3QJ5A 4AICA 3C7DB 2X22A 4YACA 4IDBA 1LDEA 5A5EA 3I9MA 4DQUA 1V0JA 4OM8A 1ENYA 4IZIA 2YHUA 1UP4A 2B69A 2E49A 3AI1A 1BDMA 3I6QA 2I6TA 4WE3A 2NQ8A 1GL3A 1M75A 1YL6A 2HMUA 4D3DA 1QORA 5I9NA 1F17A 1Y81A 4B3IA 3QA9A 4ZVVA 4E5PA 2D0IA 5DCWA 2PGDA 1UJMA 3TDKA 1VLLA 2ZCUA 4YT8A 3D4OA 3NJ4A 4P38A 5AXBA 1EZ4A 3ZCXA 1CRWG 2EERA 2ZYGA 2EG9A 4QTZA 1F06A 5TLSA 1G0NA 1NVTA 1L1FA 4K1LA 1TA4A 1VC2A 1JAYA 1U3UA 4O63O 5H82A 2PH3A 1GYPA 3JD0A 1QR6A 3PHJA 4LVCA 3LC2O 2AQKA 2Z1NA 4ZHSA 4GPD1 2FY8A 5DZSA 3O26A 3R3JA 4WNIA 1IULA 3DZFA 2PD4A 1RWBA 4B4WA 4K26A 1ZH8A 1C1DA 3OJOA 1KETA 3OQ1A 3V5NA 3GK3A 4BGIA 1ZK3A 4C7KA 3WQSB 3FRJA 4FIZA 1RM5A 1IYZA 1W0CA 2PR2A 4P4GA 1I10A 2NV6A 5AXCA 5THQA 2PKQO 2WM3A 3VPXA 5KKAA 4B4OA 1BXGA 3GA0A 3GAFA 3NEPX 2WYWA 2X1HA 3EZLA 4E33A 1LU9A 3L6OO 3V2UA 1K2WA 4CLEA 3L0DA 3D5QA 1SOVA 4HP8A 3ZNNA 2C2XA 3O8QB 4JJFA 1IPEA 2V65A 1HT0A 2X86A 4YEDA 1HL3A 1UR5A 4PFJA 4QUKA 4CR8A 3I52A 1HETA 1YQGA 3JD1A 1TB4A 1HDOA 5FFFA 2J3IA 4CMBA 3ZV5A 4LGVA 1DAOA 5JXWA 2AEJA 3ICPA 1O89A 3RIHA 1LQUA 4LMRA 4JXKA 5F21A 5B1YA 2FWMX 1JA9A 2J3KA 2IZ0A 2DPGA 2O7QA 1GV0A 3I6IA 2H5LA 3KUXA 4XR4A 1KC3A 3I83A 3CINA 3NDJA 2O3UA 5KWEA 3ZN2A 4XYBA 4OJNA 1YL7A 5JBIA 4AJJA 2O3JA 4FOOA 5BR7A 3KM0A 3AUTA 4Z0HO 1O94A 4J16A 4RVDA 2P4QA 3QIVA 4YJGB 4UULA 1G6KA 1U8XX 3NT5A 3ORFA 3QVSA 3W8DA 4M8SA 1H94A 1HTBA 1O5IA 3ZNPA 1LRJA 3UAGA 3FBGA 1H0KA 2B83A 3CZRA 3JQGA 2V6MA 3IOYA 1JU9A 2PKQP 5CP8A 3OJEA 5KOIA 1OBFO 4PLCA 1PS0A 2ZB8A 1H2BA 3IP3A 2XOXA 4II2A 3GDFA 5A9RA 1A7KA 3GVCA 4JJIA 4CQLA 4L75A 4EITA 1LI4A 2X9VA 3DO5A 1QSGA 4QT0A 4A26A 4ALNA 2C59A 1ZK1A 3MJ4A 2O48X 3VKUA 1GPDG 1I32A 1Q7BA 3AK4A 3HNPA 2OUIA 2HAEA 1NVMB 3PGXA 3GNSA 5G0TA 5TGDA 4CM9D 4XDZA 2J3HA 3LZ6A 2P91A 3K96A 1EK5A 3WQRA 2QZ9A 1S6YA 4J7CA 2E4AA 1CERA 2I65A 4I9HA 1MC4A 3RU9A 2EEZA 3GMDA 4HV4A 2YV3A 3CZMA 3H5NA 5IAAA 4IS2A 4XZ3A 1HSZA 4Z3DA 1SPXA 1X14A 5L4SA 1AHIA 1VL6A 2HO5A 1YH3A 4YAIA 1ULSA 5COQA 4TMFA 4JJGA 2PNFA 4HNGA 1AN9A 1XU9A 3VTZA 3T7CA 4RF4A 2DT5A 5BSGA 4N5MA 1T2EA 2Y0DA 3IKTA 1E1KA 4GX0A 4CR7A 4GGPA 2PK3A 4RPKA 5KVVA 3RKRA 2VYVD 4CUJA 5JY6A 4BS9A 3ITKA 4GMFA 4CV0A 1ZIDA 1EUDA 3QWHA 4KDEA 2IYPA 4P22A 4R9RA 4CM5A 1H9AA 1EDOA 1TT5B 1E7WA 1XYGA 1X7GA 2QYTA 1NNUA 4YRBA 3WXBA 1CDOA 2Y67A 4CMIA 2HMVA 4WLUA 3GFBA 4ZGWA 1P3DA 1ZCJA 3RUEA 2LDBA 3D1LA 1E5LA 1LTHR 1XIVA 5EINA 4TVBA 4TVOA 4B7XA 4HFMA 4I08A 1ID1A 5AQ1A 3GG9A 1LSUA 4MVJH 4EUEA 2B4TO 2NTNA 3G0OA 1AE1A 3E8XA 1TT7A 3F5QA 3DZHA 5L51A 1NBOA 1N5DA 4DBZA 4W4TA 3C85A 3S1LA 2XXBA 1M67A 2OGUA 3CIFA 4FFPA 4RV9A 2B5VA 1E1NA 3WR5A 2FR0A 4PG5A 3CXRA 1J5PA 3GY0A 4WLEA 4RZIA 1FK8A 1PGPA 2PD6A 1XHLA 1PQPA 5JDIC 1A71A 1WVGA 1PWZA 1U5CA 2VHYA 3FN4A 4XYLA 3HDQA 4XQCA 2VOJA 3GRKA 5A9SB 3H3JA 3H2ZA 3ROQA 2C82A 2DFVA 3ZHBA 1P1FA 4LN1A 2E6UX 3ZWWA 3F46A 3M6IA 4MVJI 1DEHA 1I24A 2ZTMA 4LRSB 3A06A 2VHVA 3GGPA 4OGWA 4D7AA 3CKYA 2QW8A 1G0OA 3W4KA 1E3SA 3E5MA 3RKUA 3UH1A 3H6KA 4IBOA 1DC4A 2CZCA 3R6DA 4XWYA 4NK5A 1FDWA 2Q1TA 1BDBA 2QG4A 1PJSA 3LF1A 2EKLA 4CM4B 3DOCA 4K28A 3PK0A 3WMXA 5EMHA 2O3RA 4FFLA 2GDZA 4MVJP 4Q3DA 3UICA 4ZD6A 4IIVA 4PZDA 3HQ4O 3FBTA 4NJMA 4WKGA 1NQOA 5CPFA 3ZNQA 2GGSA 3WX0A 2JKVA 4CM6A 1O0SA 1ONNA 1R16A 1ZMOA 3ZWNA 3DBRB 4ZQHA 3SEFA 1GPJA 1N9GA 5CFZA 1PJ4A 2D2IA 4CMEC 5C7LO 1WW8A 1E7MA 3C1TA 3MJVA 4NJOA 1GR0A 1IB6A 1PJ3A 2CF6A 4R68A 2VZ9A 3WJAA 1I3MA 1PL7A 3M1LA 2D8AA 3D4NA 4WPGA 1QV7A 1QKIA 3QWIA 5L7TA 4GX5A 3K2BA 2FPPA 1XQ1A 4MJLA 1E3IA 2RHRA 4R5HA 4Q3AA 4ZICA 1E7YA 3LU1A 1KOLA 1I2BA 3L4SO 1WLYA 3GVHA 3DMYA 4FFMA 5AYVA 2OO5A 3UFXA 5A1TA 4DMLA 3VH1A 3DEYX 2CVZA 2JAHA 3U3XA 4DTIA 3G17A 1M6HA 3BA1A 4J4HA 3X2EA 1NP3A 2VHXA 4O59O 3SC6A 4J49A 5JAZA 3WSVA 3VZRA 1BXZA 1NQ5A 3E9QA 5I9MA 3PJFA 4YXFA 3CH6A 4DBVO 3RVDA 1WDKA 4OKIA 4Q9NA 1U2GA 1WNTA 2GSDA 3GFGA 4XRRA 1KY4A 3CMCO 3F9IA 4TZTA 3PYXA 4HX5A 1P31A 4AJ4A 4D79A 4BOYA 4M54A 1Q7GA 3KBOA 3H2SA 4ID9A 4IMRA 1YO6A 1X15A 2NADA 2W2LA 1DLIA 4QO8A 2AE2A 4F3YA 1I3LA 2Y1OA 3TNLA 4I5FA 4Y8VA 3RUDA 4Y98A 3RSHA 3PEFA 2JFFA 1NFFA 2DUUA 3DL2A 3Q0EA 5DOZA 4LW8A 2V6BA 3C3XA 1YBVA 4EW6A 2AA3A 4R1TA 4YYZA 3PWSA 2NACA 5DP2A 4R16A 1N7GA 2YUTA 2Y05A 3PZBA 1NPTO 1F0YA 4XYGA 5DCUA 3W4JA 1RPNA 3PDUA 1K3TA 4BO7A 2CVQA 2BLLA 4HADA 2D4AA 4I1IA 2F1KA 2G1UA 2NQTA 5JFOA 5LCXA 3STHA 1QYWA 1LLQA 3HN7A 4PVCA 1KVSA 3EZYA 4HUJA 4MKXA 4XYEA 2DBQA 4BL5A 5LC1A 4YAGA 2DBVO 3UW3A 3VVCA 4RPGA 3AUUA 1O6ZA 3OJ0A 3PDJA 3D3WB 4WLFA 3RU7A 2JAPA 4CM9A 1HDRA 1K5HA 4U6SA 3GH3A 5TIIA 3G79A 2ZATA 5G0UA 1GEGA 1MV8A 1BMDA 4AFNA 3KETA 5IZCC 1D4FA 1GQYA 5CDYA 1GUFA 4Q39A 3VDRA 1FDTA 2ZB7A 4J1SA 1A72A 1C0LA 4KMSA 3JQ9C 1OFGA 1LC3A 1QYDA 2WEKA 4KZPA 2YQ4A 4G81A 4BNNA 4O1MA 3IDSA 1N1EA 2I99A 3R0IA 4J1TA 4ND4A 3WBBA 3ADPA 3C1AA 1N7HA 1OC2A 1H6AA 1T25A 1Z45A 3EGOA 3KYCB 3MJSA 1GZ3A 1N1GA 4XKJA 2VYVA 3IJRA 1J0XO 2D5CA 4P4LA 4E13A 1HE3A 4EJ6A 3E03A 3LVFO 2CDCA 4XRGA 5U4QA 3FSRA 2J5KA 2P9GA 3AJRA 3JQBC 3HSKA 4ZJUA 1DJNA 2GNAA 3ASVA 3GNTA 3W4IA 4CMGA 3ASUA 4WEOA 3RAJA 1LJ8A 1GU7A 1UZLA 4KOAA 4YJHA 5JAMA 3RBZA 3WGGA 5IZCA 3U4CA 1U3VA 4GLOA 4H15A 5I8WA 4IJWA 3DB2A 4NNJA 1R4NB 3RBVA 1F8GA 4B7UA 3RUAA 4YR9A 2EWMA 1D1TA 2QZZA 4E6PA 3QW2A 4MVJM 1Y8RB 3JD4A 2O50A 2I3AA 1ADGA 3WWYA 3IC5A 2UUPA 4J0FA 3JCZA 5DNAA 4DLBA 3F6YA 2SCUA 1EVYA 2Q46A 5IN5A 3KLPX 1VL0A 5A9SA 1LA2A 4IQGA 2W4QA 1H9BA 1E77A 3DR3A 5AVOA 1FJHA 3ONFA 1EBUA 3WYBA 3K6JA 3JQBA 3NDRA 3GG2A 3UCEA 1A7AA 1PGNA 4E5NA 5CHEA 5HWSA 1R0KA 4URFA 1KEPA 3BHMA 3A9WA 4J6FA 3DOJA 1MFZA 1LSJA 2Q1WA 3O4RA 1ORRA 4PLZA 2UDPA 3CUKA 4CMJA 4CM1A 3H7AA 1K0UA 3H9UA 2C5AA 3V8BA 3OEYA 3VDQA 4P8RA 2EHDA 4ZRMA 3BMQA 5F5LA 2GCGA 1ZMTA 1ISFA 2B37A 2BELA 4ZRNA 5G0WA 4BNUA 3ZV3A 4XJTA 4BGEA 4CM4A 4MVJD 1VE9A 4TRMA 3OJFA 4N5NA 4II3A 1R6DA 3BTOA 3MOGA 1U28A 4A2CA 5JCJD 1EVJA 4JNKA 5IG2A 3NAQA 1IOLA 3I1JA 1VM6A 2Y0CA 4B3JA 2FR8A 2G82A 1Z6ZA 1V8BA 4ZQEA 1DFGA 2GZ1A 5JDCA 1E7SA 2I3GA 1X1EA 1NHWA 1M6WA 3UKOA 4PZCA 4EYEA 3DBRA 3I9NA 1QG6A 4YJFB 2W2KB 2B0JA 5B12A 1KIFA 1VJ1A 4RVSA 1NTOA 1ENZA 1LDGA 1BRMA 4KUGA 4I8XA 1VJTA 3DZBA 4PZEA 4Z0TA 3ONEA 1HYGA 1W6UA 3EC7A 3TPCA 3AM4A 2DC1A 4BNTA 2BGKA 1YQXA 1R0LA 2YDYA 4I9UA 3OBBA 2O3SA 2FPGA 3RASA 3RUCA 2QX7A 4J4TA 2NUAA 3RC7A 4BO9A 4UEJA 1HLPA 4BO3A 4CMCA 3OA2A 5B37A 3GPDG 1PGQA 4BNFA 2GUGA 2YDXA 1ZXLA 4NK4A 1DFHA 4R54A 3QLJA 3AOGA 4S1VA 3JQFC 1VI2A 4R3WA 3QV1A 2VT3A 4M86A 2PTGA 3AUSA 3VAZA 5F3RA 3HADA 1PJTA 3OF2A 2WWRA 3QVXA 4PGFA 3VPSA 4IQ0A 5T57A 2AXQA 1JLLA 5G4KB 5B4UA 2ZQZA 1JQBA 1B8PA 3F3SA 2FSVA 2D5AA 3JTMA 2EF1A 5ITWA 1KBZA 2DFDA 1DC3A 5AXDA 4DYDA 3A4VA 3KOUA 3NX4A 1T24A 3RC1A 2QRLA 4D45A 5H83A 5G4LA 2J5RA 1LLCA 3WSWA 4F45A 3AFNA 3AU9A 4GKBA 5GY7A 5JY1A 4D0SA 1E3EA 3RCBA 5BNIA 4F6CA 1SMKA 5ES3A 4B8ZA 4WK6A 2VHZA 5TC4A 3ZGYA 5G2OA 1H93A 1NR1A 2QQ5A 3FNFA 3ANMA 3G49A 3LC1O 2CVOA 3NT2A 3PIDA 3WYEA 1I2ZA 1DIHA 2NSDA 3JQFA 4FGSA 4NBRA 2DTEA 4FCCA 2WJPA 1QMGA 2CSUA 4BNHA 4IJKA 4MINA 4R1SA 3D3WA 4IS3A 1WWKA 2JJYA 1HXHA 3E48A 2VN8A 5T6BA 1ZEJA 1PZEA 3GUYA 4CMHA 5JMPA 4CM7A 1X7HA 1EVZA 4ILKA 1RM0A 4UVDA 2Q4BA 2EV9A 1EUZA 3BAZA 3OIDA 2BKAA 3DAPA 2AQ8A 4W99A 3ZW8A 3RBXA 2PGJA 1DBVO 1SNYA 5IDYA 1SEVA 3PLRA 1OC4A 4PLVA 3SVTA 2GR9A 3FCOA 1P77A 3IJPA 2CUKA 5IJZA 4N7RA 4CL8A 4ROSA 1W73A 4YA6A 3KLMX 3DBVO 2RBEA 3B70A 3GNQA 3INRA 4S3MA 3JYQA 2J3JA 4Z9XA 4MKZA 3SXPA 2BD0A 4CLOB 2J8ZA 3HB5X 1Q7CA 4RDHA 3H9GA 4J0EA 3KYCA 2NVWA 3JD3A 5L7WA 3Q3CA 3QVOA 3ZU3A 4DC0A 3ROMA 1MG5A 3HJAA 4WLNA 3VZPA 1IZ9A 2WD7B 3DBLB 3WTCA 4CR6A 5L45A 4XR9A 2OBYA 4E5KA 2YFQA 2C54A 3GQVA 1R15A 1X0XA 1OOEA 4TZKA 5CG2A 1C0KA 5DULA 2O3QA 2NVUB 2YW9A 3AI2A 4RL6A 3OQ6A 1A5ZA 3U49A 2GRAA 2NWQA 3LF2A 3S2FA 1SCUA 7MDHA 1LRLA 4E0BA 4CQMD 3JQCA 3RC9A 3TOXA 1FDUA 2CD9A 3WGIA 3FPCA 3H65A 1GQ2A 4XGNA 1DHTA 1EQUA 2D1YA 4WGGA 4BQRA 3F5SA 1DRWA 1EEHA 4BO8A 1A9YA 3CEAA 4BMNA 4CQMB 2QHXA 4YQZA 3D3EA 3CSDA 2A92A 1PX0A 3FD8A 1FDSA 4J7UA 4RVHA 4J1QA 5U1PA 3JQAD 2EP5A 1HYEA 1WMAA 1DHRA 2FZWA 3L07A 3ETEA 2CNBA 3H8VA 4YWJA 4YJDA 2OXIA 3WGOA 1XSEA 1HDYA 1C3VA 3GN2A 3WIEA 4FDAA 3TFQA 1BVRA 3PJDA 2A9FA 2X5JO 2V6GA 1YDWA 3H5AA 4HXYA 4FPXA 3JQAB 3TOZA 1HKUA 1HZJA 1U2DA 1RM3A 1PS9A 1Z7EA 4BO0A 2A94A 3FNGA 4YCAA 2IODA 4WASA 1T26A 4D43A 3ZWYA 4ZA2A 4RQTA 3U09A 1DIGA 3PLNA 1K6XA 3R1IA 2AMFA 4DIFA 3U9LA 5ER6A 2NM0A 3DFZA 1BTOA 2ZKLA 5EL0A 4QEDA 2BFOA 3LT4A 3B1FA 4IJVA 4PLHA 3LSYA 4O0LA 1EE2A 1GEEA 4BNMA 2X4GA 3GVXA 5CDSA 4XQGA 5FEUA 1CWUA 1JTVA 2Z95A 4TWRA 3I4FA 3WFJA 4CUKA 1XCBA 1PZFA 2UAGA 3BIOA 2P9CA 4MVJA 4LK3A 3L9XA 1LC0A 1EDZA 1UP7A 4LMPA 3DAGA 3UUWA 4EJMA 5TQVA 1I8TA 5TRTA 4Z9YA 1I2CA 5GZ6A 1PU2A 1S7CA 3P2YA 4JLWA 1B3BA 4YJFA 4TSKA 1GCUA 4UEKA 2GLXA 2CF5A 4XIYA 1M76A 4I5GA 4UVHA 3UVEA 3WG9A 5A5FA 1ZJZA 4BMVA 1ENOA 4KP7A 5T64A 1LNQA 2VHWA 4E2YA 4N18A 1N2SA 2HK9A 1Z73A 2X8LA 1V3VA 4RJTA 1SZJG 3WGTA 1NFRA 1PJBA 4RPLA 3MOIA 1W8DA 4D42A 4UVGA 2POQX 2HKIA 4DPKA 5B4TA 2NU8A 4UAGA 3WTBA 1DPGA 3FPLA 4CM8A 3DAFA 2NU7A 1I5RA 2WD8A 3T4EA 1NAHA 1XLTA 3QVWA 3INTA 1JWBB 5L95A 3ABIA 4O6VA 1LQTA 3IIEA 3GC6A 3OMLA 2FOIA 2GN6A 2UV8A 2G5CA 1U4SA 3V1UA 5IDWA 3B1KA 1A9ZA 3DFUA 4LSWA 3KYDB 3BYZA 3TZCA 1VRWA 1YB4A 1LUAA 5A3VA 1WDLA 1HZZA 1VSVA 3K92A 4M49A 2BF7A 4EEXA 3NDIA 1DOHA 3HFSA 2UVDA 1E1MA 3RJ5A 4ZQBA 4M89A 5I7VA 3KSZO 1PR9A 3K73O 2PZLA 1DRVA 3FTNA 2ZJ1A 3PPIA 4JIGA 1HEUA 4DGSA 2PFGA 1YL5A 1ISMA 1P1JA 2BH9A 3E9MA 4E4YA 4CMKA 1UP6A 3AU8A 3PXXA 3RC2A 3N7UA 3DZKA 1AXGA 2HCTA 2O3TA 4JP2A 4EUHA 1DXYA 3PFFA 4PG8A 1P0CA 4XD2A 1CIVA 5JYDA 5JYEA 3W6ZA 1HE4A 2ZYAA 4IPTA 4KTTE 5F1OA 5ENDA 2O2YA 1I36A 3ZNOA 4HY3A 1ISJA 1V6AA 4YRDA 1YBAA 3MJEA 1I3NA 4QECA 2VWGA 4DREA 1MX3A 2DBRA 1SEPA 2DBZA 3W6UA 3PIIA 3UOGA 4E5MA 2AG8A 3RWBA 1CQIA 4BO2A 4E32A 4UUNA 3ZZNA 1P45A 4YAEA 3GLQA 3ST7A 4EUFA 5KIAA 3WOHA 1UH5A 4XB1A 4E3ZA 3CMMA 5JDIA 1O9BA 5DDIP 4BO6A 1DLJA 4PLWA 2V6FA 2VRBA 1QXSA 3KRTA 1U3TA 4MP3A 4JP3A 1PEDA 4IDGA 3L9WA 4CLOA 4UUPA 8ADHA 3MCVA 4LVUA 5U9CA 2XAAA 3HDYA 3TJRA 3PI7A 3TQHA 1YGYA 3UXYA 3DBLA 4D41A 3O8QA 4AL4A 3AM5A 3VPHA 2PZKA 2VUUA 4FD3A 3ZDFA 2IDZA 4RGBA 3VPGA 2AEMA 4XJSA 2VRCD 2NVUA 4A27A 4ALIA 4K9DA 4NQZA 3M2TA 4Z3KA 1SBYA 2IEBA 2X23A 4J2OA 4NMHA 2WDZA 4ALJA 3W1VA 1VSUA 3WICA 4EJ0A 4U6QA 4BKPA 2X6TA 1MLDA 4QFCA 5JO0A 1B16A 1WAMA 5KJFA 2ZB4A 3KVOA 4IDCA 1KS9A 4YVFA 4IUYA 1M66A 4E2XA 3E18A 1ZFNA 2TMDA 3AUAA 1XU7A 4NIMA 4BNWA 2HK7A 1MUUA 3SX2A 4GL4A 3WS7A 1UDBA 3B6ZA 5CEJA 4R9SA 3VC7A 4PLYA 5BQFA 3QHAA 5CPBA 1JAXA 1NM5A 2HK8A 3K2EA 4YJGA 4N54A 5HTOA 1NPDA 2W98A 3IP1A 5G0SA 1BHSA 3NT4A 4CMEA 5HM8A 5L53A 4J7XA 3IKVA 5ILOA 4NG5A 3ZHYA 2Y1EA 2Q2QA 3EW7A 4CLXA 3ZWOA 4PN3A 1BG6A 2YHIB 4W6ZA 2HDHA 3ROKA 1HYHA 1ZO8A 4RF2A 4OKNA 2JD0A 1T2AA 3WQQA 1E5QA 2WYUA 2DM6A 4R51A 1HE2A 1ML3A 2BFAA 2VZ8A 2ZJ0A 5T5QA 5B4VA 1DB3A 4O5OA 4ALMA 5FWNA 3G1TA 3K30A 1ZW1A 4I5EA 4IGFA 2XXJA 1ADFA 3WJ7A 2PKRA 1R37A 1E6UA 1XKQA 2ZB3A 4U0JA 1CETA 4R1NA 2QYSA 5JMWA 1PJ2A 3TRIA 1EFKA 2I9PA 1WPQA 2JCYA 3C1OA 4IQ8A 1ZSYA 4NDNE 3SLKA 1CJCA 4YDRA 1B8UA 3E6AA 4OXYA 4RVUA 5BSEA 2YYYA 4FBGA 4OQZA 3Q9UA 4WNCA 1I01A 3GHYA 1KEVA 3JV7A 1YXMA 2EW2A 3LLSA 4BB6A 5ICSA 4I5DA 4MVJG 3FNHA 1I3KA 4QSMA 1BW9B 1TLTA 4L4RA 4DXHA 4IXTA 3MJCA 1ZK0A 3MWDB 1UAYA 3IUSA 4J9UE 3DWFA 4MKRA 4D46A 4F6LA 1I0ZA 5DP1A 1LLDA 4KWHA 3PTZA 4ALLA 4KQWA 3OSUA 2GF2A 4J4BA 2C29D 2FHSA 5JPIA 2EKPA 2VWQA 1HE5A 1ZK4A 3JYOA 4DRYA 5DT9A 3OQBA 3S2EA 4BNYA 3EAGA 4JBHA 1UZNA 1NHGA 2VTEA 1LLUA 2YJZA 3WGQA 1YVEI 3A14A 2D3TA 2Q45A 3ULKA 3QWFA 3U4HA 2DPHA 4YT2A 1ZNQO 2X7HA 1TT5A 4XCVA 4WECA 5CDTA 1Y9EA 2H63A 1LEHA 1EE9A 3PHHA 4NHEA 2BFMA 3KZVA 1L7EA 5EN4A 1SAYA 4W82A 4EI2A 4Q3CA 4L4XA 1V35A 1V3TA 2OMEA 1E7RA 2YQ5A 5TX7A 3VH3A 3LLVA 2FZEA 4FJ2A 5CDUA 2UYYA 1ISGA 1K89A 1N92A 3GUCA 2BFPA 2BMAA 2PZJA 1HDCA 4AJNA 4D3FA 3JYPA 5IXYA 3HFGA 1UXHA 1AHHA 4IDDA 1H6DA 5JC8A 1XG5A 5KVSA 1EBFA 3JQ9A 4C7JA 4DL9A 2ZTUA 3ZU4A 4FGWA 4J91A 2X9NA 2YFHA 3AOEC 1EK6A 1KVQA 4OQYA 1GTMA 5A4DA 3DDNA 4WJZA 1HLDA 5TJ9A 4FFNA 1YDEA 2H6EA 4WOKA 1E6WA 3HHPA 3ZWPA 3ONDA 4R41A 3WGZA 4JROA 1QLJA 4L73A 2ZTVA 1GYQA 2AEFA 4AJ2A 1E92A 3DQPA 2NVBA 1NYTA 1FDVA 1P1IA 2VT2A 2OHXA 4RDIA 1LX6A 5COBA 2WSBA 4FFRA 3ETDA 4EGFA 2GO1A 3AWDA 3DC2A 3I4CA 2E37A 4LRTB 3GEDA 4X54A 3ZW9A 4OXKA 5G0VA 1GZ6A 3O38A 3PFWO 3EVTA 4AJEA 1UDCA 1ZEMA 5FI3A 2BGMA 4E12A 3TZKA 1FXSA 1DIBA 1H5QA 1PTJA 4W7IA 3CTMA 4OIMA 4AVYA 3TZQA 3W8EA 5DOVA 4KUHA 1D7OA 1KY5A 4YRAA 1MXHA 1SB9A 4E5YA 1IPFA 4TROA 4U0KA 4ND2A 1GUYA 5KVQA 2EJVA 4ITUA 1ISHA 1JN0A 4UEOA 3K31A 3ZU2A 3ZI0A 1BXKA 1C1XB 1C0IA 1BSVA 3QP9A 3KTDA 5L4NA 3I9JA 3S2GA 4H3VA 3P7MA 1IL0A 1KC1A 1XA0A 4JBIA 3A1NA 4F46A 3FTPA 2Q2WA 3SLGA 4IM7A 1JKIA 4FS3A 2HSDA 3FNEA 5H81A 1WMBA 3RROA 3BTVA 1I30A 4BMSA 4YT4A 5EERA 3C7CB 1NWHA 1O95A 3AY3A 4Y6RA 1ARZA 4GKVA 3H5RA 1QP8A 1KVUA 1P74A 2X0JA 2P2SA 5ENVA 2Z5LA 3UN1A 3ZH2A 1T4DA 4YBZA 3D7LA 3KEQA 4L0QA 4IIUA 2C2YA 2B5WA 1DIAA 2A4KA 2Q4EA 3D5TA 3WIDA 1YOVB 4L4SA 4QFDA 4FQ8A 5EQDA 3ZWBA 4BQPA 3PRJA 1LDMA 3RJ9A 3FWNA 4GVLA 3Q11A 2O4UX 4XQEA 5A02A 4YPOA 2VRCA 3VZQA 3KV3O 2EKQA 2Q2VA 4BV8A 1UUFA 2VUSA 1Z74A 4FC6A 4GAEA 2C7VA 5EPOA 1PL8A 4L74A 1XWFA 2R00C 3OH8A 4DVJA 3K5PA 1EVIA 3GMSA 2C7GA 3VVBA 2V7PA 3CPSA 4CV2A 1EQ2A 1YONA 4HKTA 1ADBA 2EP7A 5L9AA 1JVBA 4JN6B 1W4ZA 1PR3A 3VH2A 5BSFA 1B26A 2RAFA 1EMDA 5ADHA 3COSA 1GQQA 1RKXA 1WP4A 1MGOA 2Y66A 3OEWA 4DC1A 5EJ2A 4ALKA 1OZAA 5HBRA 4R5MA 3QY9A 3PQFA 4XEHA 1NASA 2EGGA 2P5UA 4E21A 5C7IO 4Q3EA 2YHIA 2OORA 3EUWA 1Y1PA 1RYEA 1Y7TA 1DRUA 3UGKA 3AY6A 4J9VA 4H7PA 3RD5A 4PIVA 4CMIB 4DPMA 5JC1A 3ENNA 3WFIA 4WCFB 4B3HA 3MTJA 2RCYA 3GAZA 3FWZA 3HN2A 2ILTA 2PA3A 1L7DA 1R12A 3GZ4A 3V2GA 1T2FA 5FYDA 1GAEO 3WYCA
chains in the Genus database with same CATH superfamily
3VZSA 2BI7A 2ST1A 3ICEA 2RGBA 4JMLA 2J48A 5DO9A 5JLJA 2R00A 2VXCA 2QM0A 2I91A 4DABA 2VRNA 3HWX1 4RA9A 2F62A 2D8MA 4HYQA 4IR7A 2ERYA 5ELMA 2EX1A 4MYTA 5B1DA 4KI0A 2JIQA 5BNTA 1OMOA 4WRRA 5AOAA 1EGAA 5SYMA 3IAAA 3QUBA 1QH1A 2ISSD 1SVIA 4MQ4A 3SS7X 1Z0JA 1AG9A 5H0IA 3RFVA 5K01A 3KHUA 3I01M 5JW6A 3SPXA 1NDHA 2ZJ5A 1THTA 2PLWA 2GILA 2G5GX 2H2GA 2X2FA 4KLNA 5I7RA 1Z33A 4HWOA 3A8TA 2FMUA 2XOKA 1UKYA 1GPBA 5JMOA 2WUDA 2DH5A 4YHBA 4NR0A 1CF4A 2JAWA 2BRUA 1KJ8A 1ZC3A 2QRKA 4M76B 1BW9A 1Y9JA 3O0DA 2W2OA 5EWJB 5JSYA 4DCSA 3AR5A 5K9ZA 1KDTA 1Z15A 1NXXA 2XKJE 2A8YA 1AKTA 3P9SA 2JCVA 3OETA 1USGA 2QPTA 5M7EA 5CA0F 1PK7A 1QAOA 1K92A 3ROZA 4NFYA 3V2HA 3E0XA 1DI0A 2QRVA 4G4SO 5E6UB 2Z83A 2AJDA 1E96A 1QPBA 2OZLA 3LBHA 3W8FA 2BDUA 4YAKA 4OHXA 4KFUA 3WNDA 1A50B 4BFLA 4RHYA 2WM9B 5KO2A 2NP7A 5KJ6A 4JL6A 1G2QA 5KSZA 1PBNA 1YU6A 3D4BA 1IQPA 1D8TA 1JQEA 3A6LA 3K8ZA 5E95A 3LX4A 4PS0A 3FYCA 1MIHA 4UM8B 1FS5A 2ZRGA 1M8GA 3QU2A 3ROEA 2UYOA 1YB1A 1GYRA 1MW9X 4D8YA 4R2XA 1H3FA 3P96A 1WL8A 2XY4A 1J00A 2WE7A 3QGMA 3UAVA 5D3MA 4HFRA 2P5YA 4E03A 5HJEA 1LBTA 2P9JA 1GNLA 4DIBA 3OQJA 5DGTA 1YZQA 2W11A 3ZV6A 3M4YA 2LP4Y 4GWKA 4M1KA 4XA8A 1WDMA 3ZJUA 2CN1A 3UO8B 3W2TA 3PJGA 1O8BA 3OF5A 3CRQA 2F2TA 4MULA 4RK1A 4YFVA 3ACDA 5C80A 2VP9A 3EGIA 4EEKA 3HXKA 1N6KA 1CZOA 3MLEA 2MWMA 4HWSA 4QNRA 5GJCA 3K6SA 3MGCA 3RFUA 3ZDYB 1NLZA 5IF3A 4P84A 1SD1A 3KYIB 2HA7A 3BMCB 2DLDA 1PJ8A 2H4ZA 4REQA 3WBJA 1PZGA 1GDTA 4JMPA 2OA0A 1GNQA 4TV8A 1FQOA 5CEEA 2A6PA 1BX3A 3C7AA 5JE8A 4JOQA 4LBWA 1NKVA 3B48A 1FMJA 4B3RB 1UXIA 1XXHA 4KCGA 4FDUA 1GZ7A 4JITA 4J3FA 4BFXA 2J9YB 1DARA 2GO7A 1I4WA 2AHOA 2ZRKA 4HAWA 3ZY2A 1EZZA 1BKYA 3AVTA 4ESEA 3QKWA 1GLGA 1Y5RA 3TMYA 2QTFA 2DQ4A 3DDCA 3PICA 3UANA 4RK5A 3VO1A 1RPTA 2ZIZA 4RETA 1GDDA 2E48A 2E1RA 1SOMA 1Z63A 2ZYWX 3GRPA 1XZJA 1IJFA 3ETNA 1PSWA 4PRKA 4TRJA 5AKEA 4WXMA 1IY8A 3JD2A 1AQNA 1HSOA 1QC5A 2QL7A 1GCAA 3PVZA 3L8EA 3QKRA 3CNLA 4JB2A 1PUXA 2H1SA 4M22A 1KOJA 4CBVA 2WTAA 4B5LA 4XX0A 1AX9A 4FQ5A 3WWDA 4DUGA 1CUWA 3N0XA 3CBQA 5ICMA 3COPA 1YJ8A 4PV7A 3A11A 3ZGVA 2X9QA 3A9VA 3IUPA 2EW8A 2JGDB 2WAXA 2PPLA 2A5YB 3B1ZA 4NEGA 2JGEA 4GM0A 1AUQA 2QQ0A 1HK7A 3IMGA 2FEOA 1ZA1A 2H52A 4OAQA 3ZHXA 3S28A 2XLBA 4Q9JA 4F04A 5JPDA 1UPUA 4HK4A 3L7AA 4LTNA 2OILA 1EFPA 4L76A 3D3JA 4J03A 5BOSA 4K3UA 1C1XA 1ESCA 1HRDA 1ZAYA 3U7HB 3TB6A 2BZ0A 4BNVA 1EK1A 1W4AA 1L4NA 1CQXA 4GMGA 5LB2A 3QI7A 4BO5A 1NWCA 4KR6A 3JWGA 5DHPA 5K99A 2YJ5A 1Y6RA 3V4LA 1J49A 1ONPA 1XI2A 2ZT5A 5K6AC 4S2EA 5JCJA 4PQFA 2APJA 1R2QA 2YXDA 3F4KA 4KSYA 4NH4A 4NHOA 4RS3A 4V2IA 2FWRA 4WLOA 2J85A 2I6QA 3AIKA 1NSFA 4DCVA 3V1NA 3MN1A 4IHJB 2NUPB 4YJ3F 2X2PA 1QNFA 4X1YA 1U0HC 2EWVA 3GGJA 1QV6A 4AURA 1BVUA 1TZCA 4QX6A 5DE3A 1Y9AA 3MAAC 3HFJA 2G67A 2JFHA 3D59A 5IBQA 1KYIA 1XD8A 4FT2A 5FAKA 2JD2A 2XQGA 3QELB 1IN1A 1NUTA 2QTAA 3UB4A 3X2SA 5ALJA 2DWQA 1XRRA 5CM2Z 3SJ7A 4KR9A 2XNJA 3NZEA 5M29A 4RD6A 1PDWA 1AV6A 2VYND 4ETMA 3KC2A 1LNSA 3D0OA 3GR6A 1N2IA 2XZTA 3CE6A 3JAKB 5F4ZA 3Q98A 8OHMA 3F3YA 3OP1A 1CF2O 1NI4B 1W36C 2KPOA 4BNGA 3T5PA 2ZXEA 1R9GA 5D2CA 3TLBA 2F9MA 1PL6A 3DZGA 3MJTA 3Q3EA 2GZHA 1PS8A 2XVMA 4QUJA 5DLEA 3K0FB 2WMNB 3S6JA 4TYYA 3NDBB 3AHJA 1WUHS 3FMOB 2AN5A 1JG7A 1NMXA 1RXCA 1F48A 2WWTA 3IAS6 3O4GA 1MD9A 1CNEA 3OFSA 3AHDA 3QQPA 4CGYA 4YX9A 2FPIB 3VR5A 1G41A 3F98A 5K8CA 4EHLA 1N2GA 2BEKA 4PYIA 3G1UA 2G76A 1KU0A 4R7GA 4B3CA 5KOJA 1YFJA 4FI3C 5E9QA 1LS1A 1C7IA 3L0SA 3OQPA 4FW8A 4E30A 1TUBB 3K9HA 2RGNA 3ADOA 4JBLA 1CHNA 4KG7A 4B3DA 3EOZA 1YRAA 3HACA 4JGIA 1YR7A 4D96A 5TJHA 2WMDA 4X97A 1T2DA 3AJ8A 1KYQA 1NBAA 1FYEA 1E0DA 1KJNA 2P6UA 2Q3EA 4GC5A 3DGFC 4JIMA 2UYCA 5BVGB 4L8VA 3N59A 3DE2X 1RYZA 2R751 4ND5A 2E6KA 5FYDA 1EUQA 4NU0A 4Z4HA 3OT4A 2VJLA 2CFTA 2ZJ6A 4CKEA 4FMBB 4O4IB 5FA5A 3EGDA 9LDBA 5IYZB 4BGUA 2DJ5A 2ZIXB 2V0CA 1II8A 3OKFA 5I9BA 3C39A 2YR0A 3D7SA 3H2IA 2IS1A 1Q0LA 2C07A 1JG1A 2HRCA 4PFQA 4YJHB 5FIUA 2X9GA 4J3NA 2O20A 3KWLA 3AVWA 1C4WA 1ZNXA 3F6CA 3HDJA 4DT1B 2EJTA 4LHVA 1RYYA 1LDNA 1Q7TA 3D8SA 3O4IA 4YTEA 4DYHA 2XF2A 4RUKA 2A59A 3AR6A 1ZCBA 4YUZA 3MSXA 4HQ0A 4OMUA 1LDBA 4ZXPA 3TWOA 1I3OA 3GPBA 3UHAA 5KKCA 3PFCA 2AJLI 2I7CA 4ESOA 4IDAA 4I4TA 4MW5A 5I8ZA 4WUVA 1OIVA 1VIMA 3IOEA 3LT0A 2XNDD 3JQ8B 4B1FA 3C97A 4YAFA 1GY8A 3IOCA 3HVKA 1E79D 1JW9B 3PX3A 3UJCA 5HA5A 3HKBB 4JGBA 5A9TA 5THKA 1DMSA 1Y4DE 5I7FA 2HXYA 3JALB 4ZCRA 2IXDA 4W9RA 1YJQA 3HCDA 1E4VA 3KAQA 4PY2A 2IEYA 5EESA 4ND8B 4GXRA 5EWJA 3PD1A 5GV7A 3GT0A 1M0SA 2DWPA 2PUGA 1WJGA 1Y80A 3LQYA 2PX4A 3JASB 2WSMA 3BULA 1RT9A 3D8UA 3SAJA 2QYOA 2Q3FA 8LDHA 1KOFA 2NTEA 4BKOA 4MGHA 4KFRA 4WFQA 2VTDA 4CHGA 3WHLA 4HQLA 4QQRA 1GUBA 3HKCB 1H2FA 1RYDA 4FUTA 1T9HA 4YT5A 1EFAA 3L0BA 3W7VA 4P93A 5GVSA 3AUYA 1RJWA 2RGUA 1LVGA 3SX4A 3FMVA 3QEKA 1HOXA 3H19A 1E9CA 2OL4A 3K9GA 4J7AA 4AQ7A 3DW3X 2IYAA 2GJAA 3KSUA 5H9VA 4P5DA 1A4XA 1SUWA 2WC1A 1YJCA 1RYMA 4YXWA 4CIDA 1GFZA 3GCGA 5IN4A 1NX6A 5JROA 1D2CA 1T13A 3A6HA 4ZQFA 1YZHA 2XSZD 3PVSA 5ER9A 4YY3B 4M55A 2Q50A 4PEVA 1LVUA 2REXB 1T5HX 4G0UA 3A3PA 5DYYA 4ENUA 3HE3A 5IW8A 2P9ZA 3JATB 4M7RA 3F3MA 4OXNA 1M2WA 4DPLA 1SKBA 3LOPA 3WHPA 1H05A 1MPXA 1OGIA 1P1KA 4EHJA 1EKXA 1P6UA 3GELA 4HFJA 3JYLA 3NGXA 4DV3B 3AX6A 1MKYA 1U1FA 1EB8A 4WOPA 2R87A 2DU8A 2OAQ1 2OGZA 3HUDA 4BNJA 1ES9A 4L8GA 4PNZA 5LQJA 1U2GC 1L4MA 5B7NA 1HA3A 2C77A 2CXQA 1WCIB 1K8ZB 3E3NA 3NPAA 4JBGA 1CLUA 3NIBA 3TOVA 1LD3A 5IKEA 3BMCA 3I9KA 1C9JA 3KR9A 2IXAA 2VH5R 2O8CB 1P6XA 4JKOA 4YRPA 2WTBA 5A2QA 4HBGA 3ERCA 4B75A 1QGAA 4PCAA 4BRUA 3W5HA 2CNWA 3FLAA 2XQIA 1VBFA 3MERA 5EQFA 2X58A 3CV3A 4NTZA 5CYGA 4UCWA 5EYPB 5EJ4A 5K20A 4FMCB 2VPWA 3H4VA 3DT6A 4MJ7A 1QFJA 3K7EA 4M1SA 4UU0A 5J23A 1Y1SA 2JLQA 2GETA 4CF3A 3KWJA 3B1JA 4HTFB 2OOSA 2PUTA 3BB1A 3EBLA 1CJUC 4JT2A 4QTUB 1JVSA 2NUAB 2ZPAA 3WV4A 4BXOB 1MQ9A 4C06A 4B43A 2KHZA 2H8GA 2J5QA 4OYYA 5F7OA 4JLNA 2OYCA 3V34A 2D2XA 4DLLA 3G2QA 4RE5A 3AY0A 3TSCA 1RMYA 2PWZA 4M9CA 3WLSA 1E9SA 1IMOA 4G5YA 5B7GA 1L3CA 1VHLA 1YACA 2UXBB 1GTVA 1QDUA 3U3MA 4UM9D 4DG8A 4MR8A 3DR5A 1RWVA 3BGVA 2Q5LA 1ZVKA 2R96A 1PT7A 1YA4A 2G17A 1P0PA 4R81A 1QFZA 2IBMA 4NOMA 3DE3X 3RYTC 3TLAA 4RYLA 1UZMA 2JHFA 1NNLA 3T7SA 2HQOA 1FNDA 2EWWA 4FZVA 1V2HE 2KBEA 3TKYA 5E1OA 1EDDA 2DHEA 4LRQA 4CCYA 2IVZA 2XTNA 2K2QB 4QFMA 1YJBA 3JARB 4HXGA 4IWXA 1SXGA 4HDSB 2FZGA 3U5TA 2RG1A 1YFZA 1DBWA 2EZ4A 3AVYA 2HJSA 5ALIA 4OOEA 1SCAA 3B85A 1DEKA 2IZ1A 3IHKA 4WOCA 1I6LA 1SCKA 3E15A 3TE6A 4D8WA 4LF6B 2AQIA 2QJFA 3L8ZA 1IUKA 3KPUA 3ZVLA 3PPYA 3K70D 1K6EA 2QP4A 2ZG6A 1KERA 3RQSA 1XT6A 3VDXA 4B6SA 4FYWA 4UU8A 4ZDWA 1FU7A 1YCDA 1F4PA 1YCGA 2DUWA 2O4CA 4P54A 4IHJA 3R7NA 1AKYA 2NUPA 3CKLA 3Q8XB 2AR7A 4POAA 4W1QA 4QGHA 3TNYA 3H1AA 3PRKE 1O2DA 2BKVA 3D8RA 3OTGA 1QM5A 2XMBA 2XIQA 3ESZA 3LX8A 3NGLA 4N7BA 5ALTA 5HRCA 4FHEA 3KR0A 4MWZA 5JCXA 1E3QA 3C41J 3UGJA 1YS7A 1O6GA 4CMAA 3HHEA 1PI3A 2P9EA 2ZSFA 1U65A 1IHYA 4YECA 1ONSA 2X5KO 2Y8EA 4W9NA 4XDYA 2ROQA 4EI9A 3M83A 1QCZA 4JR1A 3ZDXB 5BSWA 2DTXA 1L0BA 1ONOA 3G2NA 3JAKA 4L5YA 4KMMA 5EQJB 1RLOA 1G16A 1X1BA 2RKBA 1NI4A 1L3BA 1Y33E 3MUFA 4UARA 4BV3A 1T1SA 3HDVA 4PNEA 3OC6A 4FMPA 4G86A 5HW0A 3K0FA 3OZBA 1NRWA 4FSXA 4URWR 2CEAA 4JGGA 4BGVA 4J43A 2P4SA 3FAKA 2PH5A 1U0LA 2FPIA 1ZICA 1C0PA 2YYAA 3NIDB 1LSSA 1O4WA 4XM1A 5BT9A 4OYLA 5I7SA 1F60A 3HUTA 1HDXA 4MZXA 4U7DA 3I3SR 2YJ6A 4JXJA 4HFNA 4TTRA 2R8YA 3IAM6 5BW6B 3MWKA 1TUBA 1LXCA 3KXDA 4NAUA 4CL2A 5CB6A 2W6ID 1FRVA 3QW4B 3LK7A 4QULA 2RARA 2QVXX 2XECA 3HMQA 3IMFA 3JQPA 1ZM4A 4J07A 1NT4A 3ZDBA 3L6EA 1C9YA 2OZPA 4X7RA 3NTOA 2VF8A 3IR7A 5EJ5A 3GI1A 2X9LA 2OHOA 2YVKA 3B51X 2VAXA 3QFCA 1QLHA 3QXXA 4JU8A 5DWDA 3H2BA 2BONA 1SKYB 3OIYA 5EUCA 5I7WA 1KVTA 1UK6A 1HUQA 4L3OA 2XTAA 3THXB 3OO1A 1RWMA 1WCYA 4O4IA 4CV1A 4I46A 2HC9A 1TJPB 2ZIXA 5MGBA 3JQEA 3HSSA 4OMDA 1LW6E 2PVCA 1Z0IA 3OEHA 1SBTA 4OLFA 1SCUB 4MA0A 4NCKA 4P80A 3ZG6A 5I4CA 2VTBB 4DT1A 4H59A 1SUDA 2ACEA 1JKFA 4F9GA 2YHBA 3ZBUA 3CVYA 4PSAA 1NT2A 1Z82A 2DQZA 4G0XA 3ZJ4A 3C16C 5GP1A 3AUJB 4EW3A 1GG9A 1OREA 5C5IA 1G4UR 1GNVA 4MRMA 1ZPDA 2PV7A 2R9VA 5BN5B 5LYYA 2X0IA 2OXTA 3T61A 3ZCPA 4C1NA 5IUKC 2Q2NA 3SJCA 5HR5A 1A4UA 4MB0A 1TD9A 3JQ8A 2PGLA 5KDDA 3KD2A 2P68A 3N8DA 5JNSA 1MQAA 1S8OA 4TL8A 3HKBA 1IZYA 1H1TA 3IUMA 2A0UA 3JALA 2FQQA 4JQZA 3FOBA 5A5VA 5H9WA 2JA2A 5JZOA 3FSEA 5AR1A 4ZJPA 2HA0A 2GBIA 1XCJA 2E4WA 2UZIR 4ND8A 3U1TA 5CLGA 3EDRA 1DSSG 2BV3A 3IE0A 1OAAA 5EY5B 3QJYA 3SI7A 2CHEA 3QE4A 3WYGA 2ZSAA 3JASA 4B7CA 9ATCA 2JIRA 2G6TA 4JOSA 1C9KA 1U1EA 3K9LA 4NWIA 5GMOA 5KSYA 3WDSA 3OA0A 3IVAA 1AKQA 1PGOA 3OECA 4MPJA 4Q7JB 3JQGB 4A9AA 1CJBA 2CKDA 3HKCA 4KSCA 4EHNA 5EHZA 3LLCA 2PS1A 4MEJA 4YMLA 3NO4A 3V1YA 4R8SA 2X3YA 4CZ2A 1T9DA 2JH8A 2WQ7A 4Q9LA 3VPDA 1JYEA 2GJKA 3ROFA 1K7EB 3LT5A 4IGEA 4IIJF 5GZ3A 1SIOA 1Y4AE 3W5AA 2Z6AA 1O3YA 4EGJA 1CEXA 1NQTA 1KDYA 1GFSA 3O73A 2AQHA 3CBGA 2I33A 4W5WA 3FF4A 3ZGOA 1PQUA 2PMBA 2Y1CA 5JEDA 3COZA 4PFSA 2BKLA 1U6IA 3BX1A 1O87A 4WUTA 4CNQA 2GZSA 1C14A 1QV9A 1VLMA 2B61A 2JIOA 2JCGA 4NOLA 1GAWA 4B4VA 1MV5A 4X95A 1VJRA 1IONA 3KZ1E 5FTLA 1CQPA 1XCOA 3KSAC 4GWGA 4PYNA 3LV8A 3ORSA 2EGHA 1JS1X 4R6WA 4WJKB 4XSVA 5DLYA 5FEMA 1KI4A 2A0WA 2HRQA 1P2TA 4KBFA 3BILA 3PUVA 1D7AA 2FEXA 4RH3A 1B7GO 4UTXA 3WMWA 4HRVA 3QLUC 1SC4A 5EKTA 1XTIA 2GM9A 1A4RA 1WCIA 5FI0B 5DBFA 2JZOA 3UBMA 4BNXA 4GUAA 5GTDA 4OLAA 1V1RB 1HG1A 4KBGA 5DNYB 4XYMA 1Q0HA 1GG5A 1XJWA 2O2SA 2XF8A 4R9NA 5EWLB 3A58B 3EMVA 5B1EA 4TYMA 4J76A 1Q0PA 2P77A 3UMSA 2Q9UA 2ODBA 4B17A 1SKQA 5C8ZA 3G82C 4M46A 2GEKA 5EYPA 2FFQA 2CUNA 3RG2A 5GZ1A 4FK8A 3GFOA 1PJCA 1XJCA 1XTUA 3IUYA 3INGA 3SHVA 2AFIA 1CVIA 2BEWB 3TIIA 3V4PB 4HTFA 2XPCA 1OHHA 4I55F 1E2HA 2ZE5A 2A1UB 1COWD 2LKCA 4ISBA 5DN9A 1ZCFA 5BSHA 1E98A 3D81A 1Y6FA 4BXOA 3A70A 4OHUA 4RVFA 2CFCA 4PRLA 1EUDB 3WGYA 4V0RA 4DLSA 2II6A 2FJ0A 2PWAA 5D3QA 1ZIOA 2FR1A 3H1GA 4AYTA 1X1TA 3Q7TA 2FUG6 3EDQA 4BLOA 4ZGBA 2QXTA 4FKMA 2CMFA 2FYTA 5F1PA 1ONBA 3NHJA 2DERA 3VKVA 1R8YA 4BHTA 1QLWA 1C9DB 2OT3B 3FLMA 4W5RA 1QNLA 2MDTA 5A4FS 6GPBA 3ZGXA 1O08A 3BK1A 2O52A 2I1QA 1QQAA 1X0VA 3L02A 2IZ7A 1N2HA 4WZAE 1XLVA 5HRUA 1AXEA 1KJQA 3RUHA 3P19A 1Z12A 3EWSA 3FSGD 4PU0A 4A2PA 1VIAA 4GGOA 4MCAA 4O3FA 4NU6A 4JB8A 4Y9DA 5FADA 3TD2A 4DMMA 4LV8B 3IBGA 3KKKA 1ZBQA 3EGEA 3MD9A 2Z5FA 3JARA 3QM1A 2XHZA 2QD4A 4GLLA 1ZUD1 3R0QA 4BQOA 4HDSA 4YIKA 4AICA 3FTDA 4RIGA 3C7DB 1DIOB 5SICE 3TBFA 1USVA 4Q1DA 2YASA 3HO6A 3PNPA 4IDBA 4UBOA 1U2QA 2H4HA 4QOSA 2WD9A 1IBKB 2YHUA 5CT6A 1A8UA 2B69A 3STXA 4BX3A 3DDUA 2PMEA 2XOEA 2P0EA 2NQ8A 1RBZA 1YL6A 2AUTA 2PRYA 4V0LA 5I9NA 2VSFA 5FB3A 2D62A 2PEZA 2D6FA 2QTZA 1ECLA 3QA9A 4ZVVA 4E5PA 1M8JA 2BJHA 4YT8A 2WWVD 1BA3A 1R50A 3BWEA 3AFHA 3D4OA 2VYCA 1MT3A 3WQHA 3D6UA 4YK7A 4EABA 2FPUA 3EUEA 3JWPA 3H1PA 3GBVA 1CG6A 1M1YE 3WLPA 4QVKA 3RRMA 5LMZA 2ZYGA 3WLOA 2EG9A 5I4IA 3BUSA 1F06A 2PRIA 3IQXA 3QXSA 1TYAE 1G0NA 3UM9A 1JHVA 1L4BA 1NVTA 4BTVA 5HOQA 1VC2A 1JAYA 1U3UA 4O63O 1CUAA 1NJSA 1EXWA 5H82A 1VHQA 3HVIA 1GYPA 2POCA 3KVVA 1WUYA 4KE8A 3PHJA 1O5TA 5IBPA 4AUNA 1L5ZA 1JZTA 2JI4A 2VSNA 3U4QA 1AJEA 5KYVA 3HXMA 4F72A 1D0SA 2C4KA 3OQ1A 1Y4SA 3B82A 1YVDA 2PO7A 3GK3A 1BQEA 4BGIA 4ZEOA 1ZK3A 1UC8A 4NPHA 4FU0A 3B6IA 5KOHA 3EAFA 4FIZA 4GPBA 2C8VA 2JJMA 2QTRA 2PR2A 3C8HA 3I5YA 1Z06A 3H11B 3Q8KA 2PKQO 1XKXA 2A84A 4N6NA 5TMDA 1CP3A 2ESRA 1SUBA 3ZOKA 1MJGM 1T6BY 1S2GA 4URUR 3V1MA 3VPBA 1NUUA 1O94C 3ZJYA 3NAMA 1KBQA 3D5QA 2B2XA 1EGHA 3I64A 4H35A 1OXVA 2RGEA 3EA5A 3ZY6A 1J0AA 4JJFA 3IIJA 4QRDA 1FUIA 2VS1A 3DXZA 5FR2A 1HT0A 3OPNA 2X86A 4YEDA 1YI1A 4CQJA 3EXHB 2G5TA 5TEWA 3THXA 2OV1A 3BJIC 1HETA 3JD1A 1SIBE 5FFFA 4KITB 2J3IA 1EE1A 1XEWX 1GRNA 3LXUX 1DAOA 2WU0A 1THGA 2XA1A 3ESYA 3F9RA 3ICPA 3RIHA 1LQUA 2QNIA 5SY4A 5CBPB 3O8DA 3RYIB 4DGQA 4ZCIA 4RSGA 3K6RA 1HO3A 2Q07A 1JA9A 2W6MA 1Z2AA 5BUSA 2DPGA 1QHEA 4EGQA 2BKUA 1GV0A 1U0FA 3HZHA 1K8QA 5DH9A 3EXG2 4YGXB 1IK4A 3GJQA 1UK8A 4NARA 1TEZA 2BGRA 1KC3A 4PZ9A 2R6GA 4DY4A 3I83A 3CINA 4ZKDA 4B3FX 1JE1A 1J0EA 1MGPA 2O3UA 3ZN2A 3W9BA 3SFTA 1YL7A 3AG6A 1IZ8A 5ALLA 4C0BA 4D8UA 1Z0AA 5BR7A 3I6ZA 5C32A 1MH1A 2GCOA 2PRZA 4QJ5A 4Z0HO 4J16A 5IAEA 3GUUA 1GPUA 1N2CE 4UTVA 1QQTA 1U8XX 3NT5A 3ORFA 4OP3A 1E9DA 1NN3A 4RK7A 4EGSA 3CUYA 3G7UA 3PUYA 3QX3A 3TG2A 3ZNPA 3UAGA 4YMIA 5ESDA 1YC5A 4N8DA 2B83A 1V48A 1Z26A 3JQGA 1OA0A 2CNDA 3P5BA 2X19A 3IOYA 2WNHA 3TVYA 4DS3A 1JU9A 1EA7A 4NS1A 3V48A 4EB0A 3QKSB 2YTZA 1XD9A 1XALA 3BS4A 5DYIA 4E1AA 4ZDJA 1WD7A 7REQB 4JL5A 2Z09A 4HB2A 2EGUA 1PLJA 2GLUA 4LFBB 4MI1A 3ZBQA 1J2YA 3ROTA 2ZRIA 3GT3A 2A5FA 2OR3A 2RC6A 2OQRA 3HWWA 4QTXA 1QFSA 4L75A 4EITA 3N8GA 4F9FA 5JQGB 3Q87B 4HX9A 1H3EA 2H4YA 3OSZA 3VHXB 3DO5A 1QSGA 2COEA 4HNAA 3R40A 4RTQA 4QT0A 1SBHA 4HPJB 4YO8A 2C59A 3EARA 3WGLA 4O4HB 4C4SA 2J9XB 4J0IA 1GPDG 1H8EA 3HNPA 1Q7BA 4G4GA 2Y76A 4F60A 1NVMB 1W1WA 1F20A 3G85A 5G0TA 4BVKA 3AXSA 2HJGA 2J3HA 3LOQA 1DQPA 1T29A 4N5HX 1GZSA 1EK5A 1PBTA 1YUNA 1NVAA 2QZ9A 4IF6A 4RYDA 3T5GA 2I65A 5CITA 2EEZA 5K03A 1O9HA 2Q1XA 4GSYA 4O8ZA 5BSUA 4ACBA 5IAAA 1Y8AA 2BGGA 3RNLA 1YDGA 3RJMA 1QYIA 4IIEA 4Z3DA 5IF9A 4YNBA 1C3JA 3BH6A 1C41A 1KZYC 4WADA 4BX0A 5DMXA 2RH9B 4DLTA 3RSGA 4YAIA 3VR4H 1J1ZA 5E4FA 4DMFA 3BXFA 5EWLA 1G7SA 2ZYIA 3TSZA 4BATA 4JJGA 3MFYA 1AN9A 1XU9A 3VTZA 2Q41A 3V8NA 1CT9A 1AURA 1RWQA 2GFHA 4EAAA 4EDHA 1CB7A 4LXYA 5BSGA 3BDAA 5DTIA 3C6YA 5LXTF 1WETA 2BEWA 4GX0A 2ZJ7A 2PBZA 3KALA 4FEYA 4QEZA 5BRNA 1ICIA 2FLWA 1NN1A 1ZL2A 2VYVD 2ZAYA 1TTTA 2IS6A 3VDMA 4YJ3B 5L6LB 2ZYRA 3PEYA 1YB6A 1EUDA 3H4TA 2X41A 1NBMA 3QWHA 5JJLA 1I4LD 2AG0A 4N48A 1RFLA 4P22A 3UTDA 1EESA 3WB1A 1EDOA 4CN8A 3E7FA 3PUXA 1NL3A 5BUZA 3PTAA 3RNOA 1X7GA 3RREA 2QYTA 1NNUA 1CDOA 2QRNA 2Y67A 2HMVA 4WLUA 3RK1A 2MSDB 4AZWA 4Z5XA 4ZGWA 2WKSA 4B3TB 1LTHR 3M82A 2MOKA 3OESA 5F51A 5LLSA 3U2QA 4E1VA 1X87A 4B7XA 3T5DA 4EVIA 2C57A 4MXDA 3LRPA 1AE1A 3AEKB 4RKEA 2VPTA 1T0UA 2X4DA 2I4RA 4O1HA 4DDVA 5ALSA 4QPPA 2CHFA 4DBZA 2XCLA 1LX7A 4W4TA 4ZDIA 3N2NA 3C85A 5A3SA 4QDOA 4MDYA 4MV6A 2I78A 2Z1DA 1PR1A 3BKWA 3WJ1A 4DCJA 1YU9A 1M67A 4OB6A 4FFPA 3MXOA 5JWRA 1GPKA 2DWOA 3ZE2B 2AXPA 4PGAA 5C18A 1I80A 3OPYA 1DAIA 2ZVPX 1LPPA 3C3KA 4PG5A 3CXRA 3QYAA 5LYJF 1NR5A 1RP7A 1J5PA 5J59A 4MGIR 5KU7A 1PGPA 5G3ZA 4J94A 1PQPA 2H54A 5A5GA 5K2OA 3AR9A 4URHA 2GM5A 1E8NA 1A71A 1W5SA 2V4ZA 1UWKA 4EPRA 3FN4A 3F5FA 2SCUB 3HPRA 3B6MA 3TI9A 5A9SB 3H3JA 2X15A 5D7NA 3ROQA 3ZHBA 4LN1A 4WT7A 1TYEB 3BWYA 3T95A 4RFLA 3DW1X 3OZIA 1ZGZA 5FBLB 1RTTA 3DT9A 3QY0A 4YQFA 1DEHA 1B0ZA 1I24A 1KPIA 2ETVA 3PEUA 4N7MA 4QPDA 5ULLA 5LD2C 1WY7A 3VZBA 1JEJA 3AF6A 4OFXA 4RSRA 1IK6A 2QW8A 2H2HA 4OM7A 2BWJA 3JPYA 3W4KA 4ZQCB 4H7DA 2GEJA 1E3SA 1KFBB 4LNHA 5FTKA 2J9ZB 4DV1B 3DOEA 3R6DA 4CFSA 1QS0B 2HF7A 3GEBA 4QJBA 4NK5A 1FDWA 2Q1TA 2TS1A 1BDBA 1M2JA 1XZHA 1G18A 3CJTA 3O8BA 1U90A 3HU5A 1NDQA 4X7MA 5CLJA 3VYWA 5CT4A 2NO0A 2YWBA 3KKEA 3PUWA 4C6TA 1EUYA 2R65A 4FFLA 4HGQA 1NF9A 2WJYA 3TZLA 3G8AA 3UICA 2RHLA 1ZRMA 3BWVA 3Q3JB 4YREA 4EI8A 4DJDC 3I5XA 2EG5A 3G8DA 2Q0SA 3HQ4O 3AG5A 3H11A 3FBTA 2BEJA 1A2OA 4IYJA 5CPFA 3ZNQA 2PUBA 3TCXB 1MORA 3WX0A 1DPFA 4JWKA 3QUQA 4PONA 5CA0A 2ZWPA 2NN3C 2OD9A 2HA4A 3KQKA 1YTLA 3HRIA 1HURA 1G3RA 3ZWNA 3GGCA 3A1FA 2ANBA 4GR5A 4P86A 1V5EA 4B76A 2WG2A 3OLYA 4F4CA 3V4RA 1Y4ZA 2XMZA 5EEGA 2IUFA 3CZAA 1E1QD 3EXHA 1FYXA 3E7WA 3MJVA 3JS5A 1GQSA 4FB4A 4NJOA 1G5QA 4LF8B 3VNBA 5IANA 2QXYA 3U40A 1Z22A 1PL7A 2SECE 2D8AA 3IDOA 3RVSA 4Q3KA 3QWIA 4EUSA 2L69A 4GX5A 1FFHA 4MS3B 3BT7A 2NAPA 3OM0A 4R5HA 3RYIA 4ZICA 2ECFA 3C1UA 3T0FA 3Q0TA 4WVLA 4S35A 4JAVC 4D0GA 2XYVA 1YSCA 3DTNA 4E22A 3SQMA 4Q7QA 3PKZA 4Y2GA 2GZRA 2QLNA 3ZIAA 1BEZA 4FEAA 3VH1A 5EJ8A 1MO2A 2QXUA 1MO6A 1MEEA 2VDVE 3BA1A 5BSKA 3G9ZA 3G8CA 4CF4A 2XCSB 2G88A 3H83A 3N9IA 4J4HA 3JSXA 1EJ2A 1I0LA 1R9JA 4Q9HA 5EGSA 3WSVA 4KXMA 3OO0A 4I99A 2I2XB 1BXZA 3P9ZA 4NBSA 1NQ5A 3E9QA 4OHOA 1IQUA 4ZARA 3P2EA 4UEQA 4WIAA 3PFBA 3OE5A 3P0JA 4YXFA 3H05A 2WQ6A 1U2GA 5DTJA 2GSDA 2YYZA 2H4WA 4CTKA 1BU8A 1FRQA 2QSJA 4PAWA 4X62B 2H1FA 4AJ4A 2W4MA 4KJZA 1MZVA 3CCCA 3KBOA 4M54A 4UTRA 2W2LA 4TMKA 4P7BA 1C7EA 2QSZA 3G6WA 2HHCA 3L2OB 3RSHA 3NP9A 1D1PA 3RUDA 4I4IA 4GDMA 2QQGA 1CZNA 2OZVA 3DL2A 4Q00A 7REQA 1PHPA 1V7CA 3DPIA 4FE3A 2DR2A 2AA3A 4LFCB 4EOGA 3EUAA 2QN1A 2FWAA 4YYZA 1KZ6A 1EX9A 2OC4A 1YVRA 1UDXA 1N7GA 1MNQA 2C2WA 1ZW6A 1N5MA 2Y05A 2XDAA 3HJBA 121PA 1P5ZB 4HQ6A 3SDZA 3NVAA 3EH1A 1WHTB 4B80A 4HADA 2D4AA 3D7MA 2F1KA 4D4KA 1PD1A 3EYAA 1PVOA 5JCOA 5JFOA 4O4HA 3STHA 2R5WA 3DDHA 4BBPA 1KVSA 5K3DA 1XZ8A 1AUXA 3A3KA 4OQLA 4XYEA 1Z2CA 1M1NB 2AUMA 1HNZB 5LC1A 4DE5A 4YAGA 4FFBB 5DEIA 2I8LA 5KPJA 3BH7A 1AMNA 1G20E 2WWIA 2GHQA 3K2IA 3IHWA 1O6ZA 4JDPA 4EB3A 3D3WB 1L1RA 3K0EA 4KHZA 2JAPA 5AM4A 3QZUA 1DQZA 3F5DA 1R9NA 4CM9A 1HDRA 4KQ9A 3EAQA 4Q3LA 2D1TA 4U6SA 1UMDB 1Z0ZA 3G79A 3A6FA 3S99A 1XF9A 2BGIA 4QICA 4RQBA 5KAMA 1ZH6A 5B6PA 3L7CA 1NVVR 1WZNA 3ESRA 3S5JA 3PCXA 4QGGA 3MLBA 1UWLA 5G0UA 3Q7IA 2YKGA 4QRIA 2P2YA 7ABPA 4AY4A 3CCFA 4IIGA 3AFOA 4BGDA 3FPGA 3LRTA 2IDKA 1C2TA 3SKXA 1EGMB 4IOMA 3AJAA 2AZ4A 2CXUA 3JY6A 1W5FA 1FJXA 4M0UA 2JLCA 3N5CA 4Q39A 2ZRDA 3ESAA 4KMSA 2IY9A 2ZP1A 4ZTZB 4CKWB 1OFGA 2DFPA 4BE4A 2WEKA 4ZT3A 2OCIA 2YQ4A 3WRXC 1PFGA 2CB9A 1YI0A 4G26A 4O1MA 4K0KB 3LUHA 2PFSA 3DMHA 1OROA 3IDSA 2P3QA 3GUHA 3IBSA 3ZY3A 3L0PA 4L9SA 4YJ3A 4NXMB 2XB2A 4DHWA 2I99A 2SKDA 3R0IA 4ND4A 2X6RA 3WBBA 3C1AA 2ATCA 2HLHA 3U37A 1K7YA 4TMXA 1OC2A 7MHTA 2DFTA 3MJSA 4ZZ3A 2RHDA 1VXRA 3H8WA 2XVAA 4XKJA 5B7PA 1J0XO 2QZJA 3ZCSA 2QE6A 4XFDA 1VE7A 5EIFA 3LVFO 3KZKA 4CKZA 4P82A 4CG0A 3BG5A 1Q1AA 4XRGA 5AM2A 2J5KA 3C6KA 3QHQA 4ZJUA 2GNAA 3ASVA 3KDSE 5TVGA 2JFUA 3W4IA 5A5DA 1F6DA 1OZFA 3LCRA 1MJNA 5JAMA 2EJBA 4OREX 1T4GA 5JPCA 3U4CA 2FJPA 5AJYA 1U11A 2NG1A 4IJWA 1RKVA 4EFKA 4NNJA 3R5TA 1JJ7A 3JRWA 3RS0A 2H18A 1F8GA 1EG2A 2H1VA 4LECA 4X00A 3IHTA 1SOAA 3RUAA 2E4ZA 2QAIA 3B7PA 3COWA 5FXMA 4RTNA 4RTKA 3QW2A 4MVJM 4RSMA 1UFOA 1SC3A 3H2KA 1DCMA 1FFYA 2C2ZA 2QT0A 4LWQA 1A9QA 3CUUA 3N28A 2ZUBA 5CK5A 3RVOA 2FF7A 3FVRA 2UUPA 2WJWA 3PFNA 3FNBA 4V0ME 1Y3CE 1PK8A 2GMWA 2YWEA 3K8YA 4JI1B 4ZT2A 4PPFA 1OH6A 3IO5A 4ZMBA 2SCUA 3MGGA 5IN5A 4RTLA 5A9SA 1UJBA 3AEUB 1JEQB 1FYWA 1M7BA 2EATA 3A1VA 3D1VA 4LYGA 1OVMA 5JBQA 3WKDA 3ONFA 1NXSA 2ABWA 4NMLA 4YRCA 4A8JB 1YS2X 3JQBA 1XZQA 5GJVC 2J7PA 4EM6A 4LSZA 5L6MB 1IEXA 1GPYA 1P7WA 3NPMA 2V7QD 4FZ5A 1YIAA 4IV5A 4Q4DA 3IXLA 3I6YA 4Z9BA 3WOVA 3WV5A 4AY3A 3I12A 4KACA 3DOJA 2FSFA 1MFZA 4QTYA 5KHLB 1VTKA 1ORRA 3F7MA 2ZBEA 2DPLA 3V3TA 3CUKA 1TZBA 3TR6A 5KTOA 4V0SA 1MMFB 2YNMA 3H7AA 2UVPA 5SY9A 3WO1A 2W6JA 2R8EA 3N86A 4ROTA 3V8BA 2J09A 2ODNA 1QS0A 4ZRMA 3BMQA 1U3FA 2RGRA 4P7JA 1ZLXA 1ISFA 1ZMTA 2BELA 4ZRNA 5G0WA 5KTNA 2VDNB 4RTPA 3ZV3A 4MVJD 3ONWA 4TRMA 3EDOA 3NHPA 1CZKA 4RD0A 1M0TA 4JBNA 1XZLA 1KA9H 5DX8A 2CVFA 3GJSA 3MD0A 1YKGA 3RVPA 1U28A 3PQCA 4HUTA 3DMDA 1I7SB 1JIUA 2FPMA 2MSCB 4I4NA 1IOLA 1COZA 1VM6A 2Y0CA 2BW0A 4LY6A 2FR8A 3PNMA 1N6IA 3UK1A 2VCHA 1IAQA 1L7MA 4ZQEA 4I50F 5I7AA 5E7JA 4N5DA 2QW1A 3SF8B 1M6WA 3LXMA 2FVXA 3CRW1 2BJWA 3FCUB 5LZ4A 1D04A 2B0JA 5IC5A 3QXJA 5B12A 1VJGA 2G06A 3EH2A 1EWQA 1FC0A 1SU6A 4RVSA 5AW7A 1NTOA 1I1OA 1V26A 4ML3A 1ENZA 1XCLA 2RMKA 4KUGA 1R7RA 1T8TA 4LOJA 2IFTA 3PKIA 1M6EX 1G5TA 3ONEA 1HYGA 3T7EA 4HLDA 3WIBA 3BORA 4RMGA 4QXOA 2A2ZA 3AM4A 2OWEA 9MHTA 1R0LA 2VR1A 1SHKA 2YDYA 3OBBA 2FPGA 3AB3A 4I6GA 1VYHA 3HK2A 2QY6A 2QP3A 4DLKA 2HZ7A 5LPNA 3RC7A 4J4TA 3EZ9A 3CJRA 5EE0A 5CDFA 3TYXA 2XQJA 2O2JA 3TVTA 4L2IB 3X1XA 5TMEA 1XPJA 4MW0A 4L08A 2FMHA 2VJMB