2WD7A

Pteridine reductase 1 (ptr1) from trypanosoma brucei in complex with nadp and ddd00066750
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
267
structure length
249
Chain Sequence
b'EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE
molecule tags Oxidoreductase
source organism Trypanosoma brucei brucei
publication title One Scaffold, Three Binding Modes: Novel and Selective Pteridine Reductase 1 Inhibitors Derived from Fragment Hits Discovered by Virtual Screening.
pubmed doi rcsb
total genus 92
structure length 249
sequence length 267
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2wd7A00
4FS3A 3C3XA 4K26A 5CDTA 3PK0A 1V35A 1ADBA 1H93A 2EKPA 4F46A 1GD1O 1RWBA 4GSLA 1AHIA 1X7HA 3F46A 4R9SA 3SLKA 4DIOA 3FRJA 4GX2A 4MP6A 3K73O 4M89A 3GN2A 2E6UX 4NPCA 4UVEA 3BHMA 1KEVA 1E6UA 3EK2A 3OJ0A 4WPGA 5KOIA 4RZHA 3SC4A 1ZK3A 4W9NC 5DOZA 2AQHA 5KVQA 3HN7A 3ZV4A 1EFKA 3K96A 1I2CA 3OJFA 3DZBA 4HNGA 4I08A 4J7XA 3GVIA 4ND3A 3QV1A 1QMGA 4Y98A 4HXYA 2GD1O 2RAFA 3I52A 3WWZA 3C7DB 3G1TA 5C3MA 3DHNA 1I32A 2Y1OA 3ANNA 2E37A 3G17A 4YJFB 3DONA 3JQ6A 5A1TA 2J3HA 4LSWA 2X6TA 4AJOA 1A9YA 1DIRA 1PJBA 2Q1TA 3TL3A 2CY0A 4EEXA 5A4DA 1Q1NA 2H6EA 3QVOA 4EUEA 5L51A 4Z0HO 1A71A 1O89A 2CSUA 5I8ZA 2EGGA 3TJRA 5BSEA 3OFSA 2IYOA 1LEHA 2EERA 5AVOA 4FOSA 1B15A 4ID9A 4H15A 1O95A 3DOCA 2FN7A 4J49A 1YB4A 3HFGA 1ONPA 4MINA 1UP7A 3IAHA 1X7GA 1PJ4A 4A73A 4K6FA 3LF1A 1LSJA 5A9RA 2X0NA 3DAGA 4CMBA 4DUPA 5BSGA 1LDGA 2DQ4A 3M1LA 1E77A 3JQCA 4CR6A 2O50A 4LVUA 4YPOA 3WLFA 2A94A 4BKPA 3FNEA 1EMDA 4DPLA 2Y1CA 1MG0A 4QSMA 4AVYA 3AI3A 1U3WA 4XD2A 5CEJA 4IDBA 1EUDA 3RBVA 2C07A 2VUSA 3AY3A 1E1NA 3VAZA 1XQ1A 2E82A 2EGHA 3AUTA 1PGJA 3OIDA 2Q99A 3RWBA 2X9NA 4J0EA 4HADA 3AI1A 3ENNA 5A5EA 2TMDA 2OHXA 3UXYA 3SVTA 1WNTA 2JD2A 5L9AA 1ISGA 4BOYA 3UICA 3PQDA 3H6KA 1YBAA 1ISHA 3KYDB 5JYDA 3RJ9A 2FWMX 4CV3A 5JDCA 1HDXA 3ZGYA 2JCVA 1O94A 4BNWA 3VKUA 4CMEA 1C0KA 1CDOA 1XHLA 1N92A 1P0FA 2NV6A 3UW3A 3AOEC 6LDHA 4GGPA 1NXQA 2PD6A 3NDRA 4BIIA 5JCXA 5T64A 4D3FA 2AEFA 3IKTA 3TSCA 5GZ1A 3RROA 5HTOA 2UDPA 3E82A 4JK3A 3CE6A 4B3IA 3FR7A 3GC6A 4PRLA 4A5OA 2NWQA 3JQGA 4B4UA 3NDIA 1AN9A 2C20A 4RF3A 1XEAA 4PIVA 4B8WA 3JSAA 5JDIA 1DHTA 3RI3A 2H5LA 4IGEA 2YV2A 3VDRA 4JLWA 5I7VA 3I1JA 4E6PA 4RVUA 1E3LA 1PGQA 4CMHA 4B3HA 2FPPA 9LDBA 4BNTA 1PL7A 2DTEA 3V2HA 4NFYA 2NUAA 1GL3A 4E5PA 1BVUA 1FDTA 3VPSA 3ZWWA 3TF5A 4FIZA 3FF4A 3Q3CA 2X5KO 3LQFA 2O3UA 3ZHXA 3LT1A 2C29D 3WQSB 5CDGA 3DBLB 3HE3A 4IXTA 1KY4A 3PIIA 3PYMA 4BNIA 4XGKA 4BO7A 2WE8A 3Q2IA 4KDFA 2O7QA 3DC2A 2RBEA 4CQMA 1T4DA 2IYPA 4IDAA 3ETEA 1NHGA 2HK9A 2DC1A 2DLDA 2Z1MA 2FHSA 3LU1A 3VH1A 1CIVA 1CQJA 4XCVA 1EQ2A 4CLRB 4DMMA 1DRVA 1GCUA 1Y9AA 4FFRA 5MGBA 2X4GA 2Y0CA 1QYVA 2ZB7A 1VE9A 4XA8A 5G4KB 1ZIDA 1ID1A 4YRDA 5U9CA 1DEHA 1XA0A 4WEOA 4EBFA 2VUUA 3FR8A 1DRWA 1C0IA 1UZMA 3F1KA 5LC1A 2I9PA 1WDMA 1YOVB 4CMJA 5KVSA 3QLJA 4TQGA 1UAYA 2OOSA 2J5QA 3ZNNA 1QG6A 4RQUA 1NVMB 5L3ZA 1BGVA 1UDAA 4MO2A 4CLOA 2Y0DA 4OH1A 1ZNQO 1Y9EA 2J8ZA 4YR9A 3RC1A 3VH3A 4KUEA 3ON5A 4J1QA 1VKOA 4LRTB 4OXNA 4J7CA 3U4DA 4GAEA 4DL9A 1A4IA 3R1IA 5TT0A 2YZ7A 4PZCA 3E48A 3WX0A 3BMOB 1UP6A 4XRRA 5CG2A 1PX0A 4FD3A 1AE1A 1I3KA 1DO8A 1PJ3A 1MFZA 3L6EA 4J4TA 4AL4A 4AJIA 2IZZA 2W8ZA 3PHIA 1R66A 2YV1A 3DB2A 1SB8A 1JW9B 3KVOA 3U4HA 4R3NA 1I5RA 4TROA 1QYDA 1BHSA 2FPGA 2QRJA 3QQPA 1PIWA 5IDQA 2PKQP 3DXFA 3ZI0A 3ZHBA 2ZYGA 5T8KC 3T7CA 2AXQA 5ILOA 1YJQA 1E3WA 1GUFA 3PGJA 3QRWA 3GHYA 1DHRA 2YFQA 2HKIA 3S8MA 4FB5A 3DTYA 4CQMB 4PLYA 1CERA 5I7SA 5FWNA 4NZ9A 3ZHZA 4NU5A 3RBZA 2FMUA 1N7GA 5DT9A 1IHXA 2IZ0A 3K2EA 1DC6A 2HMWA 4E2XA 4ZA2A 1T26A 4NBRA 1J49A 4CLRA 3G79A 1UXGA 4IGFA 1LSOA 4E4YA 1LLUA 4HV4A 3K92A 3A4VA 4J1TA 1H2BA 5JDCC 4BNMA 4LCEA 3GGPA 1MX3A 1LI4A 1PS8A 3GDOA 3GH3A 5IDYA 1GY8A 1P33A 5CEFA 1DBVO 1XGKA 3V2UA 1ZBQA 4AJJA 1JAXA 3H5NA 4E32A 2OFPA 1LNQA 3BMQB 4U6SA 1Y81A 4ND2A 4YQZA 1Z82A 2TMGA 2B5VA 3EZYA 2A9FA 2NTNA 4FFNA 5EQDA 3MTJA 4XB2A 4YEDA 2EF1A 3I6IA 2CVQA 4D41A 1KEPA 3UF0A 1VJ1A 4WK6A 3PJDA 4N54A 5JCJA 3JCZA 3KBOA 4BVAA 4AJHA 5L7WA 2Z95A 5I9LA 1H9AA 1W4ZA 1Q0QA 1V6AA 4CMKA 5BNTA 3GNQA 3HB5X 3IMFA 3ADPA 1BTOA 3PJFA 1HEUA 4RVFA 4RPKA 1U8FO 2O7SA 4CM9A 5DP2A 4I5EA 3KV3O 3UVEA 4MVJA 4R3WA 1LDYA 3GDFA 4GMGA 4CV2A 4E2YA 1CF2O 1FF9A 4OJNA 1T2FA 2RIRA 4BV9A 4ALJA 4HNHA 1X1TA 2PR2A 5IF3A 4IS2A 5EINA 5JAQA 1ZXLA 3OBBA 3OP4A 2NU9A 1Y8RB 3WJ7A 1E7YA 4LMRA 2X9VA 5G2OA 5TC4A 3OHSX 3VH4A 5KVCA 3INGA 3ZV5A 4WKGA 2H1SA 5JSFA 1NASA 2BI8A 4GPD1 3EGOA 3GT0A 4K9DA 2C82A 1Y8QB 1JKIA 4D0RA 1HF3A 1OFGA 3CMCO 4GX5A 4KUHA 4CLOB 4KMSA 1PEDA 4OO3A 4HY3A 3IUSA 4YT4A 2BD0A 3F5QA 3MOGA 4GSKA 4Q3EA 2W2LA 4NBVA 3FBGA 4MOWA 1ISFA 2P9EA 2XOXA 1UXJA 3AK4A 1YO6A 3IP3A 3RKUA 3OJOA 2WJPA 3U62A 3GZ4A 4R41A 1HZJA 4LGVA 4J9VA 2ZB4A 3WSWA 4EUFA 4AJEA 2P2SA 2Q46A 4B3JA 2HMVA 3GN1A 1EDOA 3OA2A 2CD9A 2GZ1A 2POQX 2CVZA 4EJMA 1LBEA 4MVJP 1K89A 1YQDA 4Y6PA 5JNLA 5TLSA 4OQYA 4XYLA 5CFZA 4UUNA 4RDIA 4CM6A 1UUFA 3GG9A 2DTDA 1HE3A 5EPOA 1E6EA 3PHGA 2GSDA 2Q1UA 1DIHA 1TVEA 1ARZA 5F21A 4GLLA 5KKAA 3GVPA 1EVYA 1I36A 2CFCA 3RQSA 3COSA 1T1RA 2GN9A 3JQAD 1QLJA 1ZXBA 2IDZA 3D0OA 2PGLA 4CMGA 1V3UA 2AMFA 3STHA 1P1FA 1WPQA 5CAEA 1T4BA 4MDHA 2H63A 1RM0A 1M66A 3AM5A 1HSZA 1ENOA 1U3TA 1VL8A 4W99A 4WLOA 5G0VA 5JAZA 3BTSA 3CSDA 4BNNA 3I4CA 1U3VA 3TRIA 4URFA 1N2SA 3D5QA 2B36A 4L4XA 1WVGA 2P4HX 4B4OA 1KVUA 1I3MA 1C0LA 1E3WB 1PS0A 2F1KA 4TVOA 2R2GA 2YHUA 5F1PA 4AJ2A 4E2ZA 1LTHR 2PKRA 3LC1O 4EI2A 5A3VA 4GBJA 1PQUA 3ZCXA 4WLNA 1ONNA 1HYHA 4MKRA 1WAMA 4ND5A 4Z9FA 4YT8A 4BO2A 3CXRA 1H2HA 4RO0A 3GNTA 5BSHA 1KEWA 1Q0HA 5BSFA 3BHIA 1U5CA 2O2SA 1J4AA 1A7KA 4ZRNA 5B12A 2EW2A 2BMAA 3NT2A 1GZ4A 4UREA 3GLQA 1C1DA 4PLZA 3NV9A 2ZATA 4PG7A 1HDOA 5F1OA 2XXBA 2Q2QA 1EQUA 2AHRA 4J3FA 5TF4A 3K30A 3K6JA 1O9BA 4OKNA 4AFNA 1U28A 4FFPA 1YL6A 3G1UA 3OIFA 5F3RA 4AJKA 4BL5A 2HQ1A 1TB4A 4NK5A 2WMDA 3P19A 3GNSA 1VC2A 1ZK0A 4KZPA 1GUYA 3OM9A 1RM4A 2NU6A 4RGBA 3TFQA 3S55A 3WS7A 5ER6A 1NP3A 5CP8A 1LRJA 4A7PA 5B4TA 3IJRA 2EEZA 4I5GA 2PA3A 2ILTA 1H6CA 2NSDA 4Z0PA 2OXIA 3UFXA 4AJNA 3SX2A 4LK3A 1Y6JA 1WMBA 4GVLA 1EEHA 3RC7A 4IZIA 4YJGA 4QT0A 1QV7A 3U4IA 2I5PO 2X7HA 4KDEA 2VZ8A 2JD1A 5H82A 4IXWA 1PGOA 4LRSB 3DZHA 1P9LA 1RPNA 3IP1A 3NTQA 4NH4A 4WCFC 1D4FA 4EEZA 4NHEA 1NNUA 3I83A 4L76A 3W8EA 3E03A 4PLCA 3GEMA 4BKRA 5L53A 2P68A 1PS9A 3G3EA 5JBIA 2GR9A 2QRLA 3JQ9C 2EP5A 4AG3A 2B4RO 5FFFA 2VT2A 2ZCVA 2PKQO 2EWMA 3HZZA 3H9JA 3JTMA 3M2TA 4GLOA 3KM0A 3U09A 1HYEA 1R16A 1VL0A 4OYRA 3UCXA 5CPFA 1XKQA 2BFMA 4R4JA 2LDXA 1X7DA 3SC6A 2VHWA 2P5UA 4JXKA 5G4LA 3QE3A 1PWZA 4YRAA 3KLMX 4Z3DA 4BGVA 5GY7A 2V65A 2ZIZA 3U0BA 2V6GA 2HCTA 2B37A 3GZNA 4RF5A 3DBVO 4FDAA 3CINA 4BKUA 3DO5A 2B5WA 3U5TA 3PXXA 2C0CA 3VOSA 4NU6A 5CPBA 3FPCA 4J6FA 3O8QA 1NPTO 4ITUA 2DVMA 4BV8A 4KP7A 3OIGA 3D4OA 3HDJA 3BTUA 2GCGA 5T8KA 3AUAA 4WASA 2VWHA 4MIOA 4CLDA 4O0LA 3IQDB 1I0ZA 1I8TA 3H8VA 1D1SA 3OA0A 1LDBA 3PI7A 3Q0EA 4UVDA 4W82A 4DVJA 4I9HA 1HLPA 1Y7TA 1KC1A 3ETDA 3ZU4A 4Z3KA 3E5MA 4J43A 1RM5A 1B3BA 4LCJA 4WCDA 3LYLA 3M6IA 4PLVA 4QEDA 4MP3A 2PZKA 4Q39A 2GF2A 4P4LA 1CETA 4BKQA 2G76A 2VZ0A 5G0SA 1QXSA 2WD7A 4WCFA 1P74A 1P1HA 2QRKA 4IS3A 1VSUA 5CG1A 4FJ2A 2Y0EA 5I7EA 4JIGA 2BFPA 3ZWBA 3QVWA 5JC1A 3DTTA 2RCYA 1GFSA 1LUAA 1JA9A 5K0ZA 1T2AA 7ADHA 3ONDA 2X58A 3E18A 5DNAA 3VDQA 4CJXA 1XR3A 1XQ6A 3G49A 1RYEA 4CQLB 1KERA 4GKVA 3D7LA 1C14A 1F06A 4N18A 2W98A 3IOYA 4DYDA 1BXGB 4NIMA 3DBRB 5IDXA 2BHLA 3VH2A 4RORA 4E0BA 3MJEA 2EKLA 3DZKA 3MJTA 4XZ3A 1PZHA 4M1QA 3HDQA 1EVIA 2BGLA 1B7GO 1H0KA 1WP4A 1N1EA 1W73A 2ZK7A 2DFVA 3EY4A 4R9RA 4R68A 2B35A 3CZRA 1BMDA 4YT2A 1GCOA 3TN7A 4BO9A 4E2WA 4DYVA 1BW9B 4ZICA 1RJWA 1C1DB 1MV8A 1K0UA 1UXKA 3BMCB 3HADA 3I9OA 4FPXA 1WXDA 4TSKA 5DBFA 1YBVA 2OGUA 3ADOA 5G0TA 2HU2A 2DBRA 3AUSA 4FC7A 4DC1A 1HZZA 3WGQA 4PLFA 1U7HA 5ICSA 1E92A 3GFGA 1O0SA 2JCYA 4UVIA 4E31A 3RFTA 3OQ6A 2X0RA 4UUPA 4RF2A 2UYYA 4M55A 4WECA 4YB8A 1JN0A 1HXHA 1YRLA 2GZ2A 3HDYA 3TOZA 1NWCA 1YDEA 3H9GA 3EMKA 1BXZA 4PLTA 5DN9A 3AWDA 4I9NA 4ALKA 2VCYA 5T67A 1YL7A 1R15A 1E1LA 4A10A 4F6LA 5KJEA 4JCOA 3I4FA 4PG5A 1F17A 5LCXA 4WJZA 4AJ1A 3TZKA 4OMUA 1FDWA 3DR3A 4YT5A 5C5IA 1UJMA 3ZNOA 5ITVA 4N7RA 4TKLA 1QP8A 2O3QA 1DAOA 2DBVO 4G81A 3IC5A 3KB6A 2V6FA 3CEAA 5T57A 3D3WA 2W2LD 5AXDA 1V3VA 2A4KA 1U3UA 1PSDA 2NVWA 1X14A 3FD8A 4DPMA 5ITWA 1N1GA 3SJ7A 2XPCA 1IPEA 2NTVA 1BXKA 3H9EO 3AOEA 3P7MA 3O4RA 1NVTA 1T2CA 1PU2A 1KEUA 2O3RA 5JO9A 1ZEMA 3NX4A 3SEFA 1PQPA 2O48X 3UOGA 4CMEC 2EG9A 3KOUA 2OP0A 4OQZA 3VKVA 2AEMA 2QQ5A 3DMTC 2AG8A 2YDYA 3U4CA 3VPGA 4HUJA 8LDHA 2P4QA 3S2FA 3EYWA 1KIFA 1CYDA 1M67A 1V3TA 3DHYA 2BGMA 3ROKA 5IDWA 3UGKA 3W6ZA 4RL6A 1IZ0A 3B20A 3L6DA 1OBFO 3T4EA 5BR7A 1ZUD1 1IOLA 5HWSA 5JPIA 1IY8A 1UXHA 3E5RA 4YBZA 3RBXA 5ICMA 4WCFB 1HE5A 5AXBA 4K6CA 3I3OA 3QSGA 4MVJF 1A5ZA 2D0IA 3ZWOA 3QWBA 1D7OA 3CMMA 3QWAA 4BHTA 2ZJ1A 1QKIA 1NQOA 3WB9A 2Q2VA 3KYBA 4WLVA 4M8SA 3ZN2A 4C4OA 3VZSA 1IYZA 1MGOA 5KJCA 2HMUA 3H5AA 4L74A 4Y6SA 3TWOA 4DGSA 1OOEA 3QW2A 4OIMA 1YVEI 2FOIA 1GAEO 4LN1A 2ZYDA 1HL3A 1FXSA 1PQWA 4I8XA 1DLIA 3TDKA 5KJ6A 2IEBA 3V1TC 1PGNA 1LRKA 1SZJG 3LF2A 4CMIB 1TT7A 1XDWA 3DMYA 2BLLA 3CUKA 2CUKA 3WWYA 3H2SA 1V9LA 2OO5A 5EQFA 3TZ6A 1VL6A 5T6BA 1JTVA 5CEEA 3ETGA 3JQEA 2PTGA 2I99A 4R51A 1LRLA 3BXXA 1QRRA 3JV7A 2X1HA 1KC3A 1GYPA 5I8WA 2X0JA 2IODA 3R0IA 2AEJA 4B7CA 5IZ4A 3VZPA 1EE9A 3ROQA 3ZDFA 1Z75A 3D64A 1XELA 1J0XO 4CM8B 3PYXA 2JFHA 3GVHA 5EERA 2DUWA 3NGXA 2W2KB 2G82A 3E6AA 5T5QA 3D4PA 2FR1A 2EJVA 1ISJA 2QG4A 3DL2A 2J6IA 3FNGA 3VZQA 3D5TA 5JFOA 2A92A 4CM3A 2NACA 3RU7A 4RQTA 2VOEA 4BNGA 2CF5A 2VYVA 1JVSA 1VLLA 2NU7A 1VJTA 3MJCA 4CL8A 4DQXA 1ZSVA 3X2FA 1BRMA 1E6WA 3LZ6A 5DBIA 5CDSA 1R4NB 1S6YA 1B8UA 2VRCD 4J91A 5TS3A 4CQMD 1E3JA 1K6XA 5MDHA 3KRTA 4DWVA 3W8DA 5THQA 3RCBA 2GLXA 3HNPA 5BNFA 1H94A 1YE3A 3MJVA 3RKRA 3ZV3A 4EW6A 3W4KA 5L4NA 1Z7EA 1IZ9A 3FNFA 4HFJA 3I9KA 1KYQA 2WEKA 2CDBA 2Y93A 1XYGA 1R12A 4TVBA 2HSDA 3WBBA 1ONOA 1TLTA 2PWZA 2ZTVA 3KO8A 3LVFO 2C7VA 4BGIA 3UUWA 4YJFA 3NKLA 2CZCA 3V1UA 3JD3A 4ONEA 3B70A 3WR5A 1SB9A 2AE2A 3BZUA 3SJUA 5C7OO 4MKXA 4NJMB 2O3TA 4YJHB 1QLHA 4FGSA 4U8GA 1LDNA 1E5LA 3LC2O 4EZBA 4Z0TA 2AW5A 3GAFA 3E1KA 3WOHA 4CM4B 1PZFA 2Z5LA 3ITKA 3H4VA 1U1IA 3AFMA 3I9JA 4JP2A 2J3KA 4EDFA 3C85A 1TXGA 1E3EA 3MWDB 1GPJA 4UULA 4XGIA 3WTBA 1FDVA 5COBA 1QYCA 3QJ5A 3KYDA 1YJ8A 4OXKA 4BNYA 2QZZA 4HFMA 3S2GA 3C24A 3GF4A 3I9MA 3NEPX 3PWKA 3QVTA 4G2NA 1E7SA 1SPXA 1IPFA 1WZIA 4PRKA 1NTOA 4CUKA 4J4BA 4Z9XA 1GZ6A 4J2HA 4XIYA 1DC5A 1NWHA 3A06A 4HX5A 4J16A 3HDHA 3ZU5A 1PJCA 4BNKA 1KY5A 4WNCA 3O26A 5HBRA 3KEQA 2QZ9A 2W2KA 4RF4A 3EHEA 4W7HA 3ULKA 4AJ4A 5JAIA 1JLLA 2AQKA 3KLPX 3FHLA 2VYVD 1YONA 3GQVA 5BNIA 4D43A 4L8VA 3ROPA 3F47A 2E4AA 2OBYA 3NT4A 4PG6A 3Q11A 2Z1NA 2Y1DA 4M86A 3DZIA 3FSRA 4ZVVA 1U4OA 1PR9A 4HFRA 4BS9A 1FJHA 5TX7A 3JYNA 2J5RA 2GO1A 3PGXA 2WYVA 3ZH2A 4BMSA 2W4QA 2PV7A 4ZQEA 7MDHA 1TEHA 1UP4A 1E7MA 2JHFA 3A14A 3AM4A 1EVJA 2Q49A 2ZYAA 4TZTA 4D46A 1LJ8A 3SLGA 1EVZA 1YOVA 3GVXA 5KVVA 3WSVA 2DM6A 4BO3A 3GGGA 4BGUA 2FP4A 4WLEA 3GDGA 4XQ9A 2Q4EA 1Z6ZA 4H7PA 3PYLA 2DPHA 4S1VA 1UDBA 3C1AA 4YJHA 4CM5A 4CV1A 3NT5A 4NJMA 3HSKA 3KHUA 3N74A 1YKFA 4RVDA 1I33A 1VPDA 3E8XA 2HMSA 3ZZNA 5JXWA 4Y67A 2QHXA 2I67A 1GPDG 4J7UA 2VUTA 2FSSA 4PG4A 4Q3NA 5A02A 1N5DA 4QTZA 3QP9A 4QECA 5F1KA 5JE8A 4DC0A 1L1FA 3AM3A 3ZW9A 5L7TA 2PZJA 4K1LA 1PL8A 1M75A 3B6ZA 1LDMA 2C2XA 2FZWA 4RJTA 1YS4A 4RDHA 4YXFA 2VNAA 2DAPA 2VZ9A 5DP1A 3PDUA 3DBLA 1Y8RA 5L40A 1UAGA 1UZLA 5KNLA 3ZV6A 2JAPA 5JDIC 3TNLA 3PQEA 2GGSA 2Y68A 3Q9NA 4UEOA 4A27A 1BWSA 3QIVA 4BNVA 1D1TA 4DLLA 4YAIA 1U9JA 1YB1A 1OC4A 4RLHA 4DREA 4DLBA 3NJ8A 1K6IA 4LVCA 2VRBA 3RUEA 1HLDA 3GG2A 3Q6IA 2OP1A 1LSUA 1ZFNA 2FSVA 3WYEA 4D42A 4B4VA 4MJLA 1ZJYA 4NMHA 3P2YA 1IE3A 2DBQA 5GMOA 4DXHA 3LLSA 2CVOA 4PLGA 3RC9A 3A28A 4UVGA 5KTKA 1DDOA 4E3ZA 3LC7O 4NBWA 2Q3EA 3KSZO 2EP7A 3BMQA 4IJVA 3JYOA 1NAIA 4RVGA 1FDSA 1NM5A 5CDYA 1MP0A 5KJFA 1YDWA 3IS3A 1DFIA 1DXYA 5EIOA 1SO8A 3R3SA 1P1KA 3DZJA 2EJWA 3WNQA 3NUGA 4Z6KA 5IG2A 1YGYA 4XJTA 4Q3CA 3ITDA 3HN2A 5EESA 1L7EA 3AY6A 4DA9A 4BKOA 3ASUA 4MVJM 1JDJA 3CPSA 1HT0A 5G0WA 5HS6A 5A05A 1Q7BA 3JQAA 4GGOA 4JJGA 1DPGA 3LDHA 4CM1A 1KETA 5JY6A 1GEGA 3SXPA 1E7RA 4NG5A 2GASA 3F6YA 2VYNA 3VPHA 3P5SA 2O4UX 4E30A 4MKZA 1WWKA 3DOOA 4YYZA 1EBFA 4WLUA 4XWYA 2DTXA 3V5NA 5IXSA 1U8XX 5TNXA 1F14A 5HRUA 1SOVA 2OBNA 2NTJA 1XWFA 1NQTA 3EZLA 4BMVA 3E9NA 1V0JA 3H9QA 3PPIA 2YYYA 5DULA 1HDCA 2DKNA 1J6UA 3JD4A 4M54A 1P1JA 1M2WA 1I2BA 4NDNE 4O6VA 2FZEA 1Q2XA 2FY8A 1ZK4A 3LK7A 4IQ8A 3R6DA 1GUZA 3HJAA 2IXAA 1GV1A 4ZRMA 3RFVA 2FR8A 4XDYA 2VWQA 1I3LA 3H2ZA 3GEGA 3WICA 1Z74A 1EZ4A 3LT4A 4E5YA 1Q0LA 4BQRA 3D3EA 3FI9A 1F8FA 3UH1A 4U7WA 2XAAA 4R5HA 4OOFA 2ZB8A 1ZSYA 4R1NA 3O9ZA 4BNZA 3JQ8B 3GMSA 4CM4A 3RFXA 3MOIA 2FPIA 4XYBA 3WMWA 5AQ1A 1EUZA 1MB4A 2BKAA 3EVNA 4BUCA 2NADA 4PZDA 4BO0A 2HDHA 4KUGA 3H3JA 5DOVA 1CJCA 4E33A 3ZNPA 2X9GA 1A9ZA 4PLWA 1XCBA 3TZHA 1AXEA 3JQBA 1ZKMA 5A03A 5G0UA 1NVGA 1HETA 5JS6A 3KTDA 3BYZA 3SBOA 2X5OA 4OXYA 3ZU3A 4Y9DA 2JHGA 4YRBA 1YBMA 2YQ5A 5ES3A 1OI7A 1ZCJA 1I10A 2C2YA 2PK3A 3OSUA 5B4VA 1TT5B 2QIOA 2DUUA 1U7TA 3EC7A 1QORA 3F4BA 4CM8A 3PFWO 2G1UA 2PH5A 5KCZA 1Y1PA 4L75A 3EVTA 1PTJA 5CDUA 5LDHA 2EHDA 1BVRA 3GAZA 1ULSA 3VPXA 2WE7A 2PNFA 2JD0A 1X1EA 4GI2A 1E1KA 1DRUA 1PGPA 1P0CA 1ENZA 1QR6A 3JQGB 4ALMA 1FMCA 3OH8A 5JO0A 3HQ4O 4YJDA 2PGDA 3BTOA 4J0FA 3S1LA 4JN6B 2VHZA 1UH5A 4Q3DA 3V1YA 3CIFA 5DCUA 1DJQA 2UVDA 3EAGA 2JL1A 4KTTE 1Q7GA 2P5YA 5I9MA 2I3AA 1HTBA 4KTVE 2X0IA 2OMEA 3GGOA 4U0JA 4DLAA 4JROA 4QX6A 4EGFA 2PD4A 1ORRA 4ZGWA 2VQ3A 5JW6A 3ZWMA 1JWAB 3FCOA 3OEWA 4C7JA 5JYEA 3JD2A 1YWGO 3HB4X 5JLAA 1DIGA 4E13A 3GPDG 5C37A 5A3JA 2X22A 3WFIA 4BNLA 4NNJA 3ZWAA 2ZCUA 1AUPA 3MTGA 5TSDA 2VN8A 5EJ2A 3BMOA 5C7LO 4YACA 1PJQA 3AY7A 4XB1A 2GDZA 4WUVA 5ENDA 3U49A 2VTEA 1WW8A 1YH3A 3LT0A 4QQRA 5AXCA 3WIDA 3DDNA 1ZZEA 1XSEA 2FRDA 3RU9A 5B37A 1U2GA 5H81A 3ROMA 5TQVA 2J3JA 3VVBA 5L95A 2PZLA 2GN8A 1IUKA 1X0VA 2AQIA 1TA4A 1FK8A 3E9QA 3ICCA 4IBOA 3JD1A 1I3NA 4JQCA 4UVHA 2Y67A 1YB5A 4Q9NA 4R16A 3IUPA 4L0QA 3QY9A 1TT5A 3DFZA 3I9NA 2PLAA 4NR0A 1I30A 3DFUA 4NBTA 1DB3A 3JQAB 1I01A 5L4LA 4MVJH 1B8PA 2OL4A 3DAFA 3DAPA 3KETA 1SEVA 4NQZA 4BMNA 5KKCA 1P77A 1OMOA 4XDZA 3ICPA 4FSHA 4R1SA 2D2IA 2YHIA 4C7KA 2I6TA 4I5DA 4IDFA 5G4KA 4IMRA 3ZNQA 3PJGA 4MIYA 3U9LA 1ZO8A 2BGKA 1QYXA 1D8AA 3OETA 2B4QA 5COQA 1E3IA 1VRWA 4R1UA 1P1IA 5COAA 4R1TA 4IJWA 4ALNA 3PQFA 2C54A 3F9IA 3RUDA 4CLXA 2R00A 3FNHA 4FFLA 1ULUA 4XYGA 4FOOA 1HDZA 2D1YA 1ADFA 4D3SA 3AU9A 3O03A 3C1TA 4YAEA 2NVUB 4YDRA 3U3XA 1MFPA 2NVUA 5K6AA 2Q1SA 2DU8A 1B3RA 1DJNA 1ZJZA 2C7GA 1ADGA 4D0SA 4BB6A 1HDYA 1AXGA 5IZCA 1GQ2A 4J9UE 3RD5A 3HUDA 4N5LA 4J4HA 4BO1A 1M6HA 2HUNA 4WE3A 1U2DA 1LQTA 1NBOA 3P2OA 1GU7A 3RJ5A 2ET6A 1GZ3A 2VHYA 4I1IA 1SEPA 3NYWA 4BO6A 1JKFA 4ILKA 4DIBA 4BNFA 3ZWXA 3ANLA 1MXHA 3F1LA 3ONEA 4CR7A 4JJIA 4CMCA 2HRZA 4YQYA 4QFDA 3DZGA 4N5NA 1P31A 4IJKA 3GA0A 1ZMOA 3IIEA 3OJEA 2UV8A 3INRA 1QYWA 2YFHA 5AOVA 4E5NA 1G6KA 1LU9A 1LDEA 3RUCA 3V8BA 4BO5A 4X54A 4FN4A 3LSYA 4GVXA 1GYRA 4GQAA 2LDBA 1P44A 3F4LA 1KVQA 2D4AA 4TRJA 3H3FA 4EUHA 4XKJA 2Q2WA 2O2YA 2GPTA 1R0LA 4FJ0A 5IZCC 1K6JA 2YHIB 1UR5A 1C0PA 3H7AA 4ZQBA 1Z45A 3UKOA 5K6AC 1OAAA 3KSDO 1X13A 4JBIA 4F3YA 1QV6A 2HJRA 3KSUA 1HRDA 3PRJA 4NJOA 4P4NA 5LDGA 3JQDA 4WLFA 5THKA 3JD0A 5L7YA 2DT5A 1ML3A 4O1MA 1KS9A 4BO4A 3PIDA 4CUZA 4UUOA 1NPDA 4FR5A 2ZTMA 3JQFC 2Y99A 4A0SA 4O63O 1XU7A 4JJFA 1S7CA 3K2BA 1WDKA 1GEEA 4GMFA 3DWFA 1B26A 4WOJA 5A9SB 4OHUA 4RCVA 3WIEA 3PWSA 4MVJI 1XU9A 3PDJA 1HE4A 3KXDA 5L4SA 2QYSA 3ZWVA 3G0OA 4IJUA 3BIOA 2EV9A 1SBYA 2G0TA 2PGJA 3KYCA 4GX0A 2B4TO 4F6CA 1F0YA 4AJPA 2FR0A 2RHRA 4R54A 3WFJA 5FYDA 4IDGA 3NAQA 1EDZA 4HBGA 4LSMA 4XR4A 2BRUA 4ZQFA 3UN1A 4A03A 4YAGA 2I3GA 2IEDA 3M2PA 3IL2A 1YXMA 3TQHA 2QW8A 2DBZA 4P8RA 1HDRA 3C8MA 3K5PA 4PG8A 1DOHA 3VTFA 4P4GA 1E5QA 2JFFA 4H16A 4QXMA 3JQFA 5DZSA 3H9UA 4ALIA 3LT2A 1MXFA 1YQGA 1BSVA 1DC4A 4II3A 3GVCA 3I6QA 2EIHA 3PWZA 1Y5RA 3T7EA 4W4TA 2Q1WA 3A9WA 1DLJA 3ASVA 1Y8QA 4IMPA 3PHHA 4XQEA 4OSPA 4Y8VA 3GMDA 2GYYA 5A04A 5BQFA 4G65A 4UUMA 1PR3A 1DIAA 2UUPA 2CNBA 1B8VA 5AXAA 1VKNA 2ZTUA 3OF2A 1ZMTA 3W6UA 3RVDA 4N5MA 3HG7A 4BO8A 1ISIA 4IUYA 3ZWYA 4GX1A 3MJ4A 4XR9A 2WTBA 4L73A 3AUUA 1Z7BA 4QO7A 3BA1A 3RUAA 1MC5A 3WDSA 1AHHA 1FDUA 2P9CA 2GN4A 3PFFA 3ZW8A 2V7PA 2RH8A 4UAGA 1E7QA 3OICA 4II2A 3RUIA 4BNXA 3L9WA 4E5MA 1T1SA 4LISA 1IL0A 3TPCA 4YWJA 2DPGA 2CF6A 4OKIA 1CRWG 5ILGA 3K31A 2JFGA 2BFAA 4TWRA 1Q7CA 3L4BC 4YVFA 1LX6A 2R6JA 2BF7A 1DSSG 1E7WA 2Y1GA 4JBHA 4GL4A 4D79A 4DPKA 1T2DA 1I2ZA 3AW9A 2GN6A 4XRGA 3AFNA 3L77A 3KYCB 1EUCA 3D1LA 4NFSA 4XGNA 1EBUA 3BMNB 2RH4A 1IHYA 2VRCA 1MA0A 4RLSA 3W8FA 1P3DA 2UUOA 2CMDA 4HKTA 4R01A 4B4WA 5IAAA 1B16A 4PZEA 1VSVA 2YW9A 3BHJA 2Y1FA 4PGFA 5A06A 3K9QO 1NFQA 1PJTA 4KQWA 2JJYA 4ZD6A 4KWHA 1PJ2A 3JQBC 2R00C 3LLVA 4W6ZA 1NR1A 3RAJA 4BGEA 1WZEA 2D5CA 2C59A 3QVXA 2OZPA 4RPHA 3KUXA 5CHEA 5JMWA 3NTOA 5I9NA 1X0XA 3WGGA 2PY6A 2RHCA 8ADHA 2HK7A 1BDMA 3O38A 2EXXA 4ND1A 1VI2A 2VTDA 4O59O 5IN4A 1EE2A 1R6DA 3ST7A 2NU8A 1M6WA 3IDSA 2XXJA 2AA3A 5EL0A 2CDAA 4ESOA 1B0AA 3VPFA 5JAMA 1MUUA 1BW9A 4JGBA 4E5KA 6ADHA 1NYTA 1AGNA 1DFGA 4MVJG 4PCVA 4WEQA 1OZAA 5L45A 4LMPA 3BMNA 3ZWCA 4Q3AA 1X15A 1N9GA 2J5KA 1E1MA 2HMTA 2G5CA 3WG9A 1VJ0A 4JX8A 3WXBA 4RVHA 4JBGA 1A72A 4ZQGA 2YV3A 4J1NA 3FPLA 4OM8A 5F5NA 4OOEA 3WTCA 2VHVA 3TOXA 3W1VA 4CV0A 5TRTA 4E12A 3NTRA 4PVDA 5DCWA 3TZQA 3QWFA 2VOJA 3A1NA 3IKVA 1ZVMA 3ENKA 1BDBA 4RV9A 1LC3A 2WD7B 3GRKA 3DHEA 3ONFA 1HWYA 5KJ1A 2WYWA 1Y5MA 2YJZA 4DIFA 1G1AA 3PLRA 4XYMA 2IXBA 4FQ8A 4TMFA 4EYEA 4L9RA 5B4UA 4FC6A 3CH6A 3B1KA 4TZKA 2Q45A 4ALLA 1EFLA 4DTIA 3QWHA 1ENYA 3NDJA 5EMHA 1B2LA 5ER9A 4CQLA 1VM6A 4P22A 1PWXA 4EJ6A 2IRWA 1NR7A 1NHWA 3MCVA 3DMTA 3MZ0A 4IQ0A 3KEOA 3PTZA 1BXGA 1NFFA 1SCUA 2NM0A 5A5FA 3N7UA 4IDCA 3QA9A 1V8BA 1UZNA 3L07A 1ZK1A 2E49A 2JKVA 4M87A 5KWEA 2SCUA 4RPGA 4L4RA 4YA6A 4MP8A 1ZW1A 1CQIA 4GKBA 4OL9A 5HA5A 4S3MA 5EN4A 1KVRA 1RM3A 2UAGA 2B69A 3RIHA 3D4NA 4QUKA 3W4IA 3VHRA 4MPDA 4RPJA 4D3DA 1YQXA 2VWGA 5DCYA 1K2WA 2X5JO 4OAQA 2D8AA 1LA2A 4NI5A 1G0NA 2C5AA 2V6BA 4XJSA 1C3VA 3PVZA 3WYBA 2WWRA 3B1JA 5IXYA 4MVJE 4PLHA 4BNHA 4IDEA 2Y05A 1SAYA 4R5MA 4DMLA 4AJLA 3W4JA 3PLNA 3L0DA 1GTMA 1A4UA 3WGOA 1H5QA 3WQQA 4CR8A 1R0KA 4ZHSA 1KBZA 1Z73A 2X86A 4Y6RA 3JQ7B 3QVSA 1MC4A 2NQ8A 3INTA 3TFOA 3NRCA 4GH5A 5IJZA 1PJLA 3TZCA 1EK6A 3PEFA 1T24A 1JKJA 4CPDA 4E21A 1N7HA 3WNVA 3WGIA 2VHXA 4XYEA 3AU8A 1GQQA 5KIAA 5F5LA 2CDCA 3I9LA 3GUCA 4YJGB 3UAGA 5HM8A 2O4CA 5A9TA 3HWRA 3VTZA 1O6ZA 2GNAA 1F12A 1PZGA 3F3SA 5DDIP 3ZWNA 2X8LA 4B7XA 2YDXA 4G5HA 4RZIA 5AYVA 3GK3A 3CZMA 3GEDA 2QYTA 2J3IA 3CTMA 3O8QB 4DBZA 4O5OA 1ENPA 2JAHA 3GFBA 3M1AA 4KOAA 1RYDA 3WGYA 5HS4A 4DQUA 4KWIA 1XLTA 2P91A 4MIEA 5H83A 4ZQHA 3KZVA 4L4SA 1JWBB 4OSOA 1H6DA 4CL3A 2WDZA 2EW8A 5TGDA 5TJ9A 4CMAA 1PZEA 2BH9A 2O3JA 1LQUA 4JP3A 3ZU2A 2V6MA 3C7AA 4DBVO 4ZN6A 1TI7A 2EKQA 4WNIA 1I24A 1UXIA 5C7IO 1CWUA 3ORFA 1B14A 5A9SA 3WLEA 1N8KA 4YAJA 4AICA 4IINA 3GZNB 4CUJA 1M76A 3FWZA 4FJ1A 3PP8A 2OUIA 1WLYA 2E48A 4DRYA 4F45A 3FWNA 3AOGA 2WYUA 4IDDA 4M49A 2A35A 3GUYA 3WGHA 3WBFA 3ANMA 4J90A 3BMCA 4UEKA 3TL2A 4CODB 2BELA 3WJAA 2X23A 1GR0A 1KVSA 2VNSA 1O5IA 2B0JA 2WSBA 3UCFA 4ROSA 1EK5A 1A27A 2W90A 3GR6A 1H6BA 1ZK2A 5JMPA 1E3SA 3JQ7A 4IIVA 1JU9A 4W9NA 1QSGA 4CLEA 1R4MB 1W0CA 4PVCA 2AE1A 2I76A 3L4SO 2GRAA 2YQ4A 4U6QA 2GUGA 3OEYA 4TRRA 1LLQA 2D3TA 5DF1A 4KQXA 2G17A 4K28A 1DFHA 3PHJA 3PJEA 1P1RA 4H3VA 1DIBA 5IFLA 1R0SA 2HLPA 4MVJD 2PH3A 3RASA 3JQ8A 1IULA 4IQGA 4IPTA 3QHAA 4Z9YA 2PD3A 4XX0A 4A26A 5FI5A 3Q1LA 4IIUA 2VT3A 2ZQYA 4TRMA 1BG6A 5J23A 3OQBA 1H9BA 3FTNA 3F5SA 4Q3BA 3WYCA 1UDCA 2NLOA 5JCJD 3H65A 2VYND 3OJLA 3RUFA 3L6OO 1SOWA 4FBGA 3WGZA 3OQ1A 1U5AA 3IJPA 4FGWA 1GQYA 4HFNA 1J5PA 2PZMA 2HAEA 1G0OA 1CEQA 4QFCA 4FW8A 1C1XA 4CM7A 1E0DA 4NK4A 4WOKA 4BQPA 5TJHA 3MJSA 2ZB3A 4YCAA 3C7CB 3RUHA 4CM9D 5FEUA 2ZTLA 4U5QA 3C1OA 2Q50A 2O23A 3OMLA 1N9GB 4XQGA 3R3JA 5JC8A 1R37A 2NNLD 1XG5A 4B8ZA 4FCCA 3T4XA 1H6AA 1LSSA 2NQTA 1HE2A 1O8CA 3JQ9A 2QX7A 3Q2KA 4YTEA 2IZ1A 2HRBA 1HYGA 1U4SA 4RPLA 2Y1EA 5FF9A 4BNUA 2P9GA 2WD8A 3WGTA 3NGLA 1DC3A 2GERA 1KOLA 2D59A 4ZU3A 4WGGA 1W6UA 4INAA 4OGWA 4D44A 2F00A 1HKUA 3HFSA 3JYLA 4P38A 1HDGO 1IB6A 1WMAA 3GOHA 3AJRA 3QWIA 4UEJA 4NFHA 4J2OA 4HWKA 5K9ZA 4U0KA 2NVBA 3EDMA 4IY1A 4B79A 4GWKA 2OORA 1JAYA 1LXCA 3D3WB 1MLDA 3BTVA 4I5FA 2O3SA 4QO8A 1R4MA 1RKXA 1NQ5A 3RC2A 3DBHB 4A2CA 4EITA 4PFJA 3V2GA 3ZHYA 1HSOA 3S2IA 3JYQA 5I7FA 2I65A 3ABIA 4RVSA 2ZJ0A 2AG5A 5GZ3A 1DAPA 3DBRA 2C5EA 1OC2A 5ENVA 4CMIA 2H9IA 3JYPA 3FBTA 2ZKLA 4D45A 3PHLA 3Q9UA 3VVCA 4FFOA 1YL5A 5U1PA 5B1YA 2WM3A 1LLCA 1PL6A 2D5AA 2Y66A 1ZH8A 4PN3A 1GADO 2BI7A 1GDHA 1PJSA 4IM7A 5TIIA 4DQVA 3WMXA 1MG5A 4FFMA 5GZ6A 4B7UA 3PZBA 1C1XB 1KVTA 4EJ0A 3ZWPA 3I23A 4YAKA 3DQPA 3DOJA 1GV0A 1A7AA 1GYQA 2BFOA 3X2EA 1T25A 2JCXA 3NJ4A 2VWPA 3AI2A 3HHPA 2ZQZA 4JNKA 1ZSNA 4IZHA 3I5MA 1W8DA 1P45A 3FTPA 3RSHA 1JQBA 4XEHA 3K8ZA 5ADHA 3DZFA 3GY0A 2B83A 3EW7A 3MWEB 3PZRA 4NBUA 4HP8A 3EUWA 4LW8A 2YY7A 1SC6A 1NX6A 4J1SA 4W7IA 1ADCA 3N58A 1LLDA 4XIJA 3S2EA 3OECA 3L9XA 4GWGA 3GHHA 1R4NA 5IN5A 2HJSA 1JVBA 1K5HA 2AQ8A 3H5RA 5BT9A 1SNYA 1WDLA 1XIVA 2IE0A 3CKYA 4TKMA 4XQCA 3FN4A 4CLHA 1ZEJA 2HK8A 5TT1A 5U4QA 2YUTA 1NAHA 3UHAA 4BNJA 4D7AA 9LDTA 1NFRA 3MEQA 4TRNA 5DBGA 1SMKA 1ISMA 2HO5A 3WQRA 4ND4A 2I66A 2PFGA 1D3AA 3DBHA 1NPYA 2XF8A 3VZRA 4R69A 3VC7A 5JY1A 2Q4BA 4PLPA 2GZ3A 3L4BA 3GPIA 3DEYX 3B1FA 3UCEA 3BAZA 3E9MA 1K3TA 1NQAO 1F8GA 4BB5A 1T2EA 2DFDA 1L7DA 3GRPA 4I9UA 4ZJUA 1LC0A 5FI3A
chains in the Genus database with same CATH superfamily
4KYUA 1GNVA 4IW3B 1N6NA 4K26A 3PK0A 4KCGA 1ADBA 1H93A 2EKPA 3WZLA 1N0HA 1GD1O 3M6MD 5BYJA 3CXUA 4B0PA 2GETA 4DIOA 6YASA 1B76A 4DABA 3FRJA 4GX2A 4MB0A 4Z0NA 1FYEA 5JJ5A 2HBZA 3GN2A 4M89A 4NPCA 1T9HA 2XQKA 1VJ5A 3BHMA 1KEVA 4U8HA 2EJUA 2NO5A 5J2TB 3NBXX 2VATA 1PWHA 1WE2A 1UZAA 2P6MA 2YV5A 1VB5A 1D8TA 1MQSA 4WPGA 4W9NC 2QBYA 3K9LA 1TZCA 4MV8A 1Y3AA 5KVQA 3I2GA 4XPIA 2IV7A 3L6CA 1OXXK 2PSJA 3K96A 1CUDA 3AEUA 3DOFA 2WDPA 1JFFB 1VE1A 4RV4A 3ZDDA 2IP1A 4ND3A 5EUCA 3QV1A 3SBEA 4O2RA 4GRDA 3IV7A 4Y98A 1JEYB 4KR7A 3W5JA 1M33A 2RAFA 4OLFA 1E6CA 1KFCB 3G1TA 4EF5A 5C3MA 7AT1A 5EEGA 1GKIA 1YS7A 1I32A 5E38A 3BQNB 4DT1A 5DEOA 5H8WA 2GAJA 2E37A 2JCSA 2WQ7A 4IILA 3ZDAA 1SOMA 3FY4A 5KHLB 2YWDA 1KO7A 1NQXA 2R8XA 4REQB 3EDYA 1JJBA 3I6BA 2F8MA 1HNZB 1A9YA 4MRMA 1AKUA 4LC9A 1HA3A 1R9GA 4N3BA 3BZWA 3QVOA 4OLJA 2HPAA 3HN6A 3NB0A 3DD1A 5L51A 1O89A 3TSWA 1DADA 5E6SB 4JI8B 1QGDA 4S2EA 2CKDA 3TJRA 2CEKA 3K8QA 5BSEA 3HJBA 2FX3A 3JASB 1QU2A 4FOSA 1PV2A 1KP3A 2G5PA 1CUJA 4UPDA 3DOCA 1KAOA 1N7JA 1GCIA 2FN7A 3NEAA 3OE7A 4B3BA 4ZYYA 4MICA 4N5HX 2O8CA 5IHPA 4U7PB 1TL7C 1UP7A 3IOMA 3U7JA 5KC9A 5TMPA 1PJ4A 4A73A 4DUGA 4K6FA 3LF1A 4DCSA 5EJFA 3ZXYA 4H6XA 1SXQA 2IP2A 1E2QA 2HF9A 4F6RB 4HZUB 1Q1QA 2P9ZA 2DQ4A 3QVJA 5CTAA 5DMHA 4MW6A 4JB3A 5AM0A 4Q3KA 1FNBA 1DTEA 3HI4A 2JFWA 3Q8WA 2A94A 2BJVA 2R11A 3RTCA 1GUBA 1EMDA 2IPMA 1BD3A 3MTDA 1UWKA 3UT6A 1MG0A 2RGNA 1ID8A 2QNRA 4S1PA 1U3WA 5ESRA 4XD2A 3W79A 2OAGA 4UBKA 2R7MA 3RBVA 2HC9A 3FPKA 4D9IA 2C07A 1YVRA 3KT0A 1U9CA 3ND9A 3LGAA 4L4UA 5DI3B 5LMZA 2AGVA 2VXYA 4JIMA 1Z0ZA 4PQYA 5FA8A 1H1LA 4J0EA 1E0AA 4HADA 2ZBEA 3KPWA 4HEHA 3I45A 4GPBA 3TIGA 5JMTA 5L9AA 4BOYA 5KDDA 3PQDA 1N2OA 4KLZA 1VBMA 3MIIA 3COZA 3RJ9A 1GPUA 2FWMX 2B25A 4OFBA 5I8PA 3KVVA 2RGXA 3LCUA 4WK0B 3VKUA 1C0KA 5NLLA 2RGBA 1CDOA 1DQYA 5LWHA 1NKTA 1RQPA 4MW7A 4Q15A 4HRYA 3ZE6A 1KQGA 2NV6A 3FCAA 1YRBA 3A9CA 3DE1X 5AI5A 6LDHA 3A6PC 3R0XA 2CDNA 3NDRA 4DHEA 5DM70 3DF7A 4WOBA 1KQNA 5T64A 1EFVB 2Q3CA 3ETCA 1G291 3DFFA 3HGTA 4KQ1A 4C30A 1V5IA 5E2IA 4I1OA 1T4CB 2AOUA 2UDPA 2AK3A 2D1RA 2REBA 2Q29A 1Q15A 3LDAA 3QHPA 4JK3A 3CVWA 3ZJTA 4DILA 4B3IA 3ASZA 3FR7A 4G37A 2W6NA 4KRYA 1MR3F 2NWQA 5H80A 5FBLB 2FRXA 2L42A 3AR7A 4LRWA 5AI6A 1G6OA 1NVBA 1SELA 2LVBA 4OLHA 1YDGA 4PIVA 4RF3A 3WA7A 3IURA 1DHTA 3OE7D 3RI3A 4M9CA 2YV2A 4JLWA 3R3WA 2FUG6 2VXOA 2WF6A 1J5XA 1DP4A 3DDWA 3C4JA 1JPVA 4RKYA 1GQSA 1NI4B 4QUAA 1D0SA 3ZHVA 1PGQA 4DA6A 3HJFA 3ANXA 4F2HA 1LPOA 4V03A 4BNTA 9LDBA 3RIXA 3TK1A 1NQWA 1FDTA 2HA2A 2I3ZA 2ZROA 3CPEA 1TQDA 4JU9A 4KR0A 4JUAA 3VAYA 1WMEA 1U0EA 3FF4A 1N6IA 3KD2A 4C6TA 4BGDA 3IIKA 4BE4A 2UZ1B 3LT1A 2YJ5A 1ZW6A 3NNNA 4W1SA 2FHPA 2VPXA 4C07A 4IXTA 4KQFA 1JEAA 1NUHA 3T0GA 4C04A 3EEFA 3T06B 1V16B 3BS4A 2FWNA 4FDVA 5LA6A 2VDQB 4PU0A 4XGKA 1M1ZA 2A5FA 1AZLA 4KQ2A 4IXDA 2WE8A 3L6BA 2OTCA 5FTNA 1J90A 3HMQA 3VVMA 3BRQA 1QG2A 3B5EA 3UTCA 2IYPA 4NCXA 4ZC1A 3ETEA 2LPMA 4C0AC 1ELOA 1YIAA 2Z2ZA 3MAJA 2HK9A 2IDMA 4IV0A 2PQ0A 2FHSA 3LU1A 4EVQA 3VH1A 4IFBA 1CIVA 1CQJA 2MSNA 4XCVA 3N76A 3CG4A 1EQ2A 3TRHA 1GGFA 2HF8A 3A11A 3K20A 4ZPXA 4EY7A 3BGVA 4DMMA 4W5WA 2IBTA 4FMCF 1WKVA 3TTXA 2DPMA 2JRLA 2VZEA 5ALYA 1JIQA 4AMBA 4HNUA 2X4GA 4F4CA 1H4QA 3G13A 2I55A 2Y0CA 1V1RB 2ZB7A 3E61A 3LXXA 1VL5A 4YYEA 1RI3A 2YWRA 5U9CA 4M0FA 2FSHA 3HSSA 4NOMA 4P7KA 4M1YA 3RK4A 4EBFA 1GPAA 3FR8A 2RGYA 4TMYA 3NS7A 3QY0A 3U81A 3M70A 3WL7A 3AIMA 3F1KA 3LKZA 3QKTA 4Z4CA 3M6VA 4BCBA 1JIXA 4HQRA 2NX2A 3KWLA 1WDMA 1YOVB 1ZIYA 4JLBA 4CMJA 4DLZA 1X1DA 3QLJA 1LPAB 3W2EA 2OOSA 1J2TA 1V48A 4YP9A 3CN9A 2H06A 1ST3A 4MO2A 3I2HA 1XXHA 2Y0DA 1OT3A 4CLOA 1FJGB 2O2IA 1WCWA 4P08A 1AVTA 3FGPA 2GPSA 4JA0A 4J0DA 5CT9A 1HYQA 2RCNA 3PC4A 6REQB 4YWHA 1K68A 2ANBA 2A2ZA 2VH2A 3LVBA 1FFDA 1T91A 4G4IA 3HCCA 2DQZA 3ESCA 3OCVA 4J7CA 2Z2XA 3PNSA 4WOCA 5SZJA 3VOAA 1U5BA 2VTKA 4E32A 2YZ7A 2C97A 4PZCA 3E48A 1REQA 3O1JC 4B87A 4B5LA 5FO1A 5LYJB 4NNPA 1JQDA 1G8JA 2D7JA 1XTPA 4FD3A 1AE1A 3SHTA 4OL0A 2OYRA 5AJWA 1P7WA 2IZZA 3BDVA 1RW4A 5B1HA 2RK3A 3ANTA 3WOVA 4L5YA 4D4MA 2CWWA 3AWIA 1SB8A 1VHQA 4GQIA 3KVOA 4NAVA 4M9UA 3U4HA 2OD7A 1PFGA 3U16A 3IVAA 1K75A 3M6WA 2GBPA 2QRJA 3RKSA 4ZCMA 3QQPA 1MDBA 2ZVJA 2Y77A 3K7EA 4JB0A 4MWOA 2PKQP 1VMAA 4EB3A 1XRNA 3MWGA 1T8YA 3GAAA 3T7CA 1QBKC 2AXQA 2BEJA 1YJQA 1A7UA 1HX7A 5E8RA 1VG0B 3TNJA 2XR1A 1GUFA 1K06A 2CEAA 3IGFA 3PGJA 4FB5A 5JECA 2HKIA 3S8MA 1P4GA 1DKNA 1PG0A 1QF9A 3DTYA 3ID6C 3IT1A 1X9IA 3PQ4A 1GARA 3G0HA 4PLYA 4YAKA 4JT2A 4R8LA 4TV8F 3OHPA 5CXSA 4NZNA 4DBLE 1THTA 2ZUSA 3DLTA 4N6NA 2CV0A 4NU5A 3EVAA 2QZJA 1CUWA 1IHXA 2IZ0A 1GT6A 5TPZD 4DYDA 1G4AE 3CGWA 4JJ4A 4E2XA 1EX1A 2IYYA 2CXUA 4Q9IA 1T26A 2C5BA 5GVRA 5B6PA 4CLRA 3PNVA 3UUEA 1UXGA 4IGFA 3TSYA 4HV4A 5I7RA 1V8PA 5CUQA 4ZOLF 3A4VA 4MGYR 5JDCC 4QTYA 4A3SA 1JB1A 3V7FA 5DLEA 1UPAA 1MX3A 2CLEB 3KALA 3AC0A 3N8HA 3OIUA 2DX7A 1FVHA 3L7AA 3GRFA 1GLGA 1RRPA 1GY8A 3GH3A 4MUYA 5IDYA 1RYBA 2RHJA 3G2NA 3WDMA 1Y6QA 1YS2X 2VRNA 5KYKA 1LQ2A 4Q47A 1ZUWA 1A9RA 1Z82A 3HCDA 4DLKA 1D9XA 4YUWA 4I3FA 1N5RA 2G9RA 1U0RA 2A9FA 1TVKA 3AGQA 1K66A 3EZYA 3OURA 3A58B 4NZZA 1T2UA 3C6ZA 4XB2A 5DYGA 1M6NA 1W29A 1WD5A 1O0CA 5I9TA 2CVQA 3USCS 3WGMA 4AXBA 3HVJA 1BU5A 4BJ3A 1CQIB 5B58T 4G1UC 3HK2A 3KBOA 2A0YA 5BR8B 1DJPA 2Z95A 3MWYW 3ZOKA 1H9AA 4OA8A 5BNTA 2B20A 3K0SA 1L5HB 1NIPA 3HB5X 5AUPB 2ETVA 1BTOA 3F67A 4MA0A 1HEUA 1LPPA 2ZRNA 3WP0A 4RVFA 1KTIA 4LOJA 4FCTA 5DP2A 5ESWA 2MSCB 2HBYA 1V5WA 1Z39A 2Q6LA 3OOYA 4O33A 3ZZ1A 1D07A 1KRXA 1FF9A 4OJNA 1R0CA 3IR6A 2RBKA 2W70A 1ZD3A 1UPFA 2JB9A 1E9BA 4LGYA 4GZLA 4HNHA 4JHXA 2PR2A 5EPEA 3WLLA 4DR6B 3P94A 4QDOA 4MH0R 5EINA 5JAQA 5IEJA 1YKGA 1ZXLA 2QDXA 4RQAA 5KWIA 1S0UA 2R97A 3TIIA 1ULTA 3S29A 4DDTA 2XNJA 1E7YA 2OMKA 4F92B 2P77A 3CYFA 4DKJA 1DINA 1GZ5A 2PN1A 1YI1A 1Z15A 2FPRA 3HS3A 4WKGA 3QVKA 4A8JB 1XN4A 1ZU5A 2HLNA 3W5IA 5FOSA 5CURA 1E9SA 2JS7A 5C32A 4GPD1 2HREA 3GLFA 1QIIA 3NEYA 4WACA 1AS0A 4D0RA 1JKIA 1HF3A 5E4YA 4UNSA 1BROA 4GX5A 4MLDA 4AO7A 5K09A 4C3OB 3E7FA 4WRRA 3UK7A 3AF2A 3MWLA 1DV2A 5I7AA 5K05A 5EI5A 5DHPA 2VJMA 4BZWA 1QC5B 3MRSA 4HNQA 4YT4A 2BD0A 3F5QA 3IAM1 4LG1A 3A0UA 5TQ0B 2QMYA 1NLMA 4NBVA 1HMYA 1FXWF 2V74B 3OD1A 5FTJA 4AKIA 2ATIA 3IP3A 1TYBE 1GNTA 2H11A 2SKDA 3EY9A 3OJOA 3U62A 3ZTTA 3JASA 3IEPA 4NU8X 3S2YA 2QVGA 2WI8A 1HZJA 4LGVA 1F1JA 2JHAA 5JZVA 1BMFA 3SP1A 3SYLA 4XIFA 4JT9A 1ORHA 1IY1A 3LGXA 2P2SA 2Q46A 3CNQS 1AKMA 4XDGA 4BCDA 5F78A 2WSLA 4F3NA 3C3AA 2AXNA 2GH1A 3GN1A 3KSMA 2VJAA 4R1MA 1L7OA 3OA2A 2IH5A 2CD9A 2GZ1A 1NBIA 2PSFA 3MTIA 4ENSA 4EJMA 1LBEA 1N32B 2PZAA 2AN1A 3OX4A 4MVJP 4MRSA 3SJCA 5ALVA 4TV8A 4Z86A 1TO6A 4LYHA 4YRRA 5TLSA 4XYLA 2OHOA 1CNMA 3A1DA 3ZH9B 3GG9A 2DTDA 1HE3A 1PDWA 1YCGA 2REQA 3MMXA 3PHGA 3PFBA 5H9WA 1N78A 3LTNC 3KAKA 3DLBA 1ZUNA 1KEEA 1VBNA 2Z2IA 4X8LA 3V8EA 3FIJA 1V6CA 1T1RA 4LZPA 4Z49A 1QLJA 4X61A 1KJNA 3O8LA 2WU4A 3QQ5A 2V96A 3D0OA 4QU9A 3G8YA 3PIRA 3STHA 1XNRB 5DT2A 2WU3A 4H1VA 1CQJB 2BFBA 3H86A 2HXGA 4MDHA 2H63A 1RM0A 4LDNA 2O7RA 1ENOA 1VL8A 1Z0KA 4CE6A 5G0VA 5JAZA 3KQHA 5IVKA 3BTSA 2OLEA 3CSDA 3OBIA 3RARA 3TFWA 4G86A 3KFLA 4JQOA 3TRIA 1T3TA 2ZRBA 3BJMA 1VSQA 4GXRA 1VE6A 1V2HE 1N2SA 3D5QA 4URFA 4W9RA 2FPUA 1G59A 3WZ2A 3EMDA 2B36A 4L4XA 4MDYA 2O7NA 1Z0AA 4JYBA 2F1KA 4TPKA 2RJ3A 1ZCAA 2R2GA 2GRJA 2YHUA 3D2BA 4K40A 4LQCA 5CXXA 2E4UA 5I7OA 3D3KA 1TEZA 1WOMA 1ZBDA 1T4MA 2YZNA 4GGMX 4GI3A 3MQ4A 1P75A 1SQ6A 3HBFA 3M4XA 2EFHB 4DDHA 4WLNA 1QGUA 4E94A 4ENUA 4RJ2A 2P9BA 4L8GA 3M1IA 2V9PA 4P0PB 2IS6A 4Z9FA 1B41A 3SYMA 1D2EA 4E03A 2PA0A 4R2HA 1GNPA 5HFJA 4RO0A 3SC2A 5BSHA 3RWOA 1Q0HA 2H2DA 5BSFA 1ZESA 2B34A 1NJFA 1CR6A 1TJ4A 3L41A 5K3CA 4I5IA 1SD2A 2J0UB 1A7KA 4ZRNA 4EFDA 2PWAA 4JMLA 5J43A 1WHSB 1XDUA 1G5QA 1QAOA 1TNDA 1U5BB 3GPBA 3NT2A 3QXSA 4NYMQ 2VL7A 1NBWB 2C9MA 2GCOA 3WGKA 5FBVB 1MW8X 2PWYA 3CJRA 4G9EA 4CKCB 4PLZA 1Y1TA 2VHCA 4FMCB 1BHJA 4MYUA 2WHPA 2ZATA 1J2YA 3B13B 4YAWA 3TD2A 3MTBA 4PG7A 3M9XA 2Q2QA 2H2IA 2AHRA 3DP9A 4FYKA 4TT3A 5F2EA 1IN4A 1JAIA 1SK9A 3H5TA 3RO7A 2W6IA 4OKNA 1LGYA 4TTPA 1E94E 3TR6A 3GP3A 5KWSA 1N5JA 3PE3A 4U7TB 2IPNA 4AJKA 1RYHA 1VKJA 2WMDA 4KZPA 1GGKA 1GUYA 1U6JA 3OM9A 4CBVA 4QDXA 3NKFA 2QP4A 3S55A 2ZYSA 3MJHA 5BRAA 2EQAA 3FYHA 4F2PA 5BN3B 4OXRA 1Z4MA 4EA9A 1T9GR 4EPTA 4K0RA 2PA3A 3E35A 3S8YA 3PKZA 1TRKA 3IQXA 3JWGA 1H6CA 4KJXA 3CKLA 5AVTA 4DEXA 1MORA 1S3SA 2E5WA 1WMBA 3TKLA 1EEHA 3D9QX 4LBYA 4IZIA 3OZVA 4RM3A 4XM1A 3OZ7A 1Q20A 4YJGA 2JGNA 4ZV9A 4W5OA 4I8IA 2XCUA 1YZGA 2GWRA 2X7HA 3UC9A 5AUOB 2ECPA 1JHXA 2JD1A 2VZ8A 3PDIB 4ND8A 1E8MA 1PGOA 5H82A 1RC8A 1UQTA 2UZ4A 2P9FA 1CJSA 1RPNA 1D4FA 3CKMA 3LUHA 3K0AA 2PLWA 2A0KA 3I83A 8AT1A 3TLJA 4BDTA 2O1SA 3E03A 1DKMA 2OFXA 4H2DA 3MCZA 1WSAA 5TR9A 2QL6A 4BKRA 5L53A 3D7KA 1PV4A 3FLAA 2P68A 1PS9A 3H05A 4ZFNA 2EL9A 3HSYA 4XIGS 2Q5CA 3C3MA 2ZT7A 5EC8A 4Z7OB 3THYB 3K72B 2EP5A 1XWWA 3P45A 3G8DA 1EBBA 2NZWA 3DHVA 2VT2A 2NPOA 2YVLA 5CX1B 3WL8A 5HP4A 4MUJA 4MV1A 3TQIA 1HYEA 1EGAA 1R16A 3H42B 3UCXA 4EFLA 2XSZD 4YLGA 2D13A 4KR3A 5J2TF 1YR3A 1AQIA 2FFAA 2LDXA 2Y4NA 3B3GA 3QEKA 1MQAA 4F8YA 4E5VA 1DXHA 1PHPA 4N39A 4QOJA 3HWSA 4BGVA 4IG4A 5GY7A 2V65A 3STVA 1XTJA 3PQCA 2HCTA 2B37A 3PF9A 4PQEA 1XCPA 3DBVO 4FDAA 1USIA 4X84A 1EJ2A 4LTMA 1W93A 5LQRA 3MTQA 3PXXA 5LD2B 1BAPA 3O4FA 4JP5A 5MN5A 2O2HA 4YRSA 3P0RA 1IN1A 4FMDF 1UC8A 1UODA 2PRJA 4IX1A 1KYIA 4EARA 4ITUA 4FYPA 2DVMA 4BV8A 2YWJA 2Z8YA 3LP6A 2WG2A 9GPBA 1KRWA 4EYSA 3C3YA 2JI6A 3D4OA 3BGOS 3HDJA 3EOBI 2FEMA 3AYXB 2GCGA 4KLNA 4CLDA 1I0ZA 3OA0A 2JGRA 4ZOQI 5EMLA 4DVJA 1GXSB 2IIPA 3A04A 3JZIA 3HXTA 2B82A 3TXAA 3ZU4A 1KC1A 4IIDA 4JC8A 4OJKA 1JG3A 3G5LA 4EGJA 1EE1A 3RVBA 5CCXA 1JLKA 1B3BA 3AF4A 3QKUA 4LCJA 4WCDA 4F1WA 2VPTA 2ASVA 4M1MA 1WM1A 4QEDA 4MP3A 4PGHA 5BN4A 4Q39A 2EFDB 3BWEA 1R5NA 3W90A 1E6LA 5BV2P 3EQZA 1CETA 1GTSA 3Q6MA 2EHJA 4KQJA 1NZFA 5FULA 3AB3A 1OV4A 4G0PA 4RIGA 2VZ0A 2XUGA 4YMTA 1GU0A 2CNOA 2ZJBA 1QXSA 3IRVA 5DM4A 2WB2A 3ZJUA 1GTVA 3F9RA 1NMXA 1W35A 2IZ6A 5HRCA 4W5RA 5AJXA 3K9FC 1U8ZA 3BWCA 3MPOA 5CG1A 3HCWA 4JIGA 1B6TA 4NHOA 2B2NA 4FUQA 4K03A 1BX3A 4R9UC 2XNKA 1ISRA 5K0ZA 5IPFA 4WAUA 2QS9A 1YQTA 2BI4A 2X58A 3FWPA 3ONDA 4L4ZA 4EHFA 1OX4B 2QR3A 2YHSA 2IV2X 5AVUA 2NO0A 2CD7A 3ESDA 1C9KA 2X2EA 3QM1A 5BSRA 1KERA 1R88A 4GKVA 3LVQE 3ES9A 4FYYA 4NS1A 2QW1A 3U19A 1OI4A 1U1CA 1F06A 4N18A 1KORA 2C1XA 3GNLA 1BXGB 1YQEA 4KVFA 4NIMA 3PSHA 4ZCPA 3WLKX 1HORA 2PX4A 3VH2A 3BXZA 3GV0A 3MJEA 1QFMA 2EKLA 1FYWA 2Z1DA 4QKQA 1N5KA 2BEVB 2IXTA 4M1QA 1EVIA 4MS1A 3FB1A 1MH1A 2I22A 3Q8LA 3QUQA 5J4VA 3NUQA 4DIDA 1H0KA 3UC5A 2PLFA 1DKOA 1CJTC 3WBJA 4OQNA 1WP4A 3SXUA 1W73A 2QSJA 2HTEA 1E4YA 2G83A 4NECA 2AMVA 2XUHA 2MCFA 4NJEB 3CZRA 1BMDA 4CYMA 4BO9A 3R8FA 2BGWA 1GGEA 1KEEB 2EGUA 3H2GA 4GOKA 4IFIA 1XZLA 2G7ZA 4TXNA 3E2PA 3G6WA 1UXKA 1MV8A 3BMCB 3I9OA 3QK7A 4HYTA 3VSDA 3V80A 5BW4A 4YCDA 3ZUPA 2DBRA 4FZJA 5CM2Z 1Z2AA 3ESAA 1EFPB 4EA7A 1KDRA 2E9SA 1CE8A 5AW7A 1FQOA 2H7YA 4FXOA 3M4YA 3G2HA 1C9YA 4N5DA 4UE6A 4UHHA 1ZMXA 2OILA 2GS9A 1O0SA 2JCYA 3HJUA 4W8OA 5FLEX 5B3AA 3ZCUA 1GQOA 2F9LA 4B85A 4C4XA 4C2AA 3P2KA 4XLLA 3RFTA 1XVTA 2F1HA 2X0RA 1NDHA 4UUPA 3V9AA 2V98A 1L7RA 2Q5HA 2Q9UA 2Y27A 3GEEA 4WECA 4YB8A 3BWDD 5CLGA 1HXHA 4F5DA 1BMQA 2VDWA 1YDEA 4UATA 3VMMA 5IC4A 2WF7A 4LBWA 2HRDA 3TCKA 1UCFA 5EYPA 1X7ZB 3ROXA 3I4FA 3IO5A 1F17A 4N0PA 1KFBB 4AJ1A 4YT5A 1EAYA 2ID7A 1VBKA 4EO4A 2HPVA 4HT3B 1AD2A 5JD3A 4QJ3A 1R2QA 3ZY4A 2FG6C 5F76A 1OAOA 3E58A 2ENUA 2O3QA 2XA9A 1U1FA 2DBVO 5EIBD 2Z6UA 2YXPX 2ZOSA 4GOJA 2NU8B 1E58A 1A8HA 1NC3A 4YAUA 3TUJC 2V6FA 4DAOA 3CEAA 1BKYA 2VPZA 1FCJA 1HRKA 5T57A 4D2IA 1T36A 5AXDA 2DLCX 2A4KA 3L8EA 1U3UA 3ZJYA 4TXHA 1ODLA 1E60A 4FW9A 4XOIA 4B46A 2X6RA 3FD8A 4BFTA 4DPMA 1NNEA 1N1GA 3SJ7A 2PUGA 1K27A 3IESA 1LV8A 1N5MA 1IPEA 5E6RB 4RZUA 3C5WP 3IT0A 1BXKA 2VQDA 5FWDA 4PPFA 1TGYA 2XWQA 3SS7X 1KR2A 3AOEA 3R6LA 1VL2A 4TXJA 4KOEC 1NVTA 1HC7A 4HJRA 5CX4A 1PU2A 5JVDB 3QUCA 4YRZA 1WXWA 2YMPA 5FTMA 5AW5A 1LF0A 3F6BX 4JQYA 1PQPA 3UOGA 1G8YA 2YNMA 2FQYA 5J9FA 2EG9A 4C0XA 4X7BA 2AEMA 2O57A 7REQB 1IHDA 3AEQB 3O91A 2BTEA 4LNUA 1NP7A 2AG8A 3N05A 3U4CA 1Z8FA 4H1TA 1HTWA 1RXIA 4HUJA 4PWYA 4HPXB 1ADJA 1UDWA 3A8TA 3CC8A 5JH7A 4M0DA 4BQIA 5HILA 2WIDA 1Q3HA 1MO2A 2BGNA 4W5HA 4YK7A 2CVFA 1CYDA 4NYIQ 5AM4A 4L2IB 1V3TA 3DHYA 1ZUNB 4PHFA 3RG8A 3AP3A 3VDXA 1H4SA 1IHUA 1X7ZA 4JT8A 3WGJA 4G8CA 2BMVA 1Z38A 2HGZA 4ZVLA 1AZWA 2GZSA 1IZ0A 5JJIA 1TE2A 3T4EA 3SVZA 4HVCA 3OPNA 3W0LB 1CUCA 4ZV4A 2D1QA 1IOLA 4JSTA 5BR7A 5HWSA 4FVTA 1Y3FE 1IY8A 1H5UA 1JXOA 1K97A 3HA7A 5F52A 1XMXA 1JYFA 2C2WA 3RBXA 3T7JA 1LTKA 2PS0A 5AXBA 4K6CA 5MFZA 5AVSA 4MVJF 1A5ZA 1I6MA 4HNVA 5LQAA 1UL1X 1F2DA 1KPIA 4Z9AA 3QWAA 1QKIA 1N9KA 1WLSA 2NW6A 3KYBA 4IJ6A 2I1LA 5FPHA 2XNSA 4E46A 3ZVLA 1VECA 2HSZA 1U0BB 2CNDA 1IIBA 1QUFA 5JXJA 3TWOA 1FA9A 1X94A 4ZAGA 3U80A 4DGSA 1OOEA 4FX5A 4CI0B 9ABPA 3QW2A 3KQMA 4F93B 2G1PA 4LN1A 4D57A 4N48A 1H9CA 1KZYC 1FXSA 1BIFA 1OKKD 2Q8QA 4ABTA 2D54A 4HGYA 5B64A 5BN4B 2QJWA 3V1TC 1UANA 1PGNA 2QRHA 2JK0A 1E2IA 5JJKA 5B1DA 1ZGCA 1IOVA 1O94D 4HDNA 2ZRKA 5AHOA 5AOCA 1Q0ZA 1XDWA 1Z47A 3DMYA 3SHQA 4ZYXA 7REQA 3WWYA 4TKUA 5B30A 2OO5A 1DV1A 3X0DA 1VL6A 2FR8C 2C03A 4DY6A 4YCLA 5ELMA 1KE1A 1OH7A 3GLGB 3QE0A 4PPQA 1IXRC 2PTGA 2PGXA 3B3QA 1Y1QA 4L0CA 2BCEA 3F97A 4FTWA 5I8WA 1QR2A 1VHLA 4MULA 1AMNA 1ULZA 5B2EA 1OX4A 3WHLA 1ZXXA 2EKDA 3AQIA 5TVGA 3O3MB 3GJ3A 4LZOA 1ZN9A 1EE9A 2WHPB 5EAIA 5CFRA 4BQNA 4F5ZA 1J0XO 1OLXA 4MYDA 1M2KA 1Q1BA 4RSMA 2JFHA 5EERA 2OBBA 1JEYA 3ZZTA 1JSCA 1K0FA 1RWQA 5ALZA 3IKMB 3SSMA 3D4PA 4OAPA 3TPFA 5LIPA 4URUR 2QG4A 1YIDA 4MUNA 2J6IA 3TLCA 4LJRA 2WM2A 4UU0A 1O57A 5TPWB 4PBRA 4CM3A 2NACA 3DV9A 1NRJB 5LLTA 1I7NA 4YRGA 1JE0A 3SZRA 2CF5A 4EY8A 1VLLA 3GRAA 2H7VA 5ALDA 4DQXA 1W59A 2XODA 1NMEA 3C39A 2GEFA 1RLJA 3LZ6A 4GOLD 4GT1A 4IKPA 1QPBA 4U2GA 5DBIA 4IF4A 4AJ2A 4BIMA 4JC5A 4RETA 4LHZA 4LRXA 1WCV1 3KEMA 5THQA 2WWVD 4MB6A 1YE3A 4YV2A 4NONA 3RKRA 4EW6A 3VXKA 4ZHQA 2PCLA 1IZ9A 3A6KA 2XXAB 4PZLA 3M81A 1LVHA 1Y1SA 2CDBA 1XPJA 1XYGA 2GYWA 4GIBA 1V96A 3WHKA 1T35A 1ONOA 3LVFO 4UTRA 1YU6A 1ZC3A 2GNOA 4F6RA 3UUWA 3BXHA 4YJFA 4DDKA 3NKLA 1GAWA 3UYLA 3V1UA 4ONEA 5KYVA 1NBMA 4FMPA 2V4UA 2H54A 3QEOA 1XD2A 2DBYA 2OK7A 3AHFA 3FSJX 4BFVA 4EDHA 4WBNB 1VLMA 4YJHB 4R83A 5EXDA 1ORDA 1S8FA 4RLFA 1LDNA 2X6QA 1X2EA 3TVYA 1JGTA 3RS9A 1KMCA 1XA3A 1IUPA 1RVDA 2PGOA 5FJJA 2X41A 5A4IS 4OHBA 2AW5A 5JNWA 3IXQA 4RD2A 4LXHA 4WCVA 5DKFA 2QPTA 4Y2GA 1U80A 4B3TB 2QTWB 3TG2A 1K4KA 4MKGA 3GWGA 4LHYA 3MT9A 4PF1A 3FIUA 3KQLA 1E2NA 1OWNA 2HZBA 2HT1A 3C85A 5JSUA 1TXGA 5T6MA 2IE8A 5ICFA 1LK7A 1WR8A 3URKA 1H2FA 1VPTA 2QN1A 5ALPA 4LPKA 2VTBA 2UVPA 2IY9A 4BNYA 4ISBA 4HFMA 3C14C 3LHKA 2DRIA 2XUQA 3QLUA 4RJJA 1GLVA 5LP6A 3GA5A 4G2NA 1Y63A 3GZTB 5DU2A 3U3ZA 2FZKA 3OLQA 1JDPA 4YP6A 1IPFA 4CUKA 4OQDA 2HW8A 2QMHA 4J4BA 3USES 4I1RA 3A06A 3DAYA 1KY3A 1RHRA 2A58A 3KVNA 3HDHA 4J16A 4U2DA 5BSUA 5IX8A 1ECPA 3KAQA 1PJCA 1Z2PX 1N75A 4UUQA 4WA7A 5FHQA 4PO9A 3O26A 1M2EA 1OVGA 3EHEA 4EL0A 2IYVA 3MQFA 4AJ4A 2PMWB 1JLLA 4TWZA 3KLPX 3FHLA 1YONA 3Q40A 1NKVA 4JYAB 2GX6A 4QODA 5IC6A 3N7TA 3BXPA 4L8VA 1LB1B 5A7GA 1M2FA 2C61A 2OBYA 2JLAA 3CF6R 4NESA 3ZHZA 2FN9A 3OPMA 1B1AA 1PR9A 4AURA 5TX7A 3H5IA 4MS3A 4JAVC 4ROTA 3IAXA 2W0SA 4NYMR 4BMSA 2PV7A 4ZQEA 4YV7A 1U0OC 4WXYB 1P5JA 2JHFA 1FTYA 1K7EB 1Z2NX 3VR6D 4TZTA 2WWFA 2GNPA 2PFSA 3CEJA 1QG0A 3T7KA 1FMJA 4TTIA 4AP6A 3U3KA 1IBLB 4M0UA 3TNDA 1QHIA 5H16A 5KOJA 1NY6A 1UBHS 1GTZA 2XX3A 4FGLA 4QXRA 1GL6A 3WDKA 4A1OA 1QB8A 1XHEA 3KXKA 4BGUA 1ULHA 5BV8A 4QVIA 5D5HA 1JVNA 1C8VB 3FI0A 3GDGA 1TCBA 4Z2YA 1Z6ZA 3PYLA 2WWIA 1NN0A 1T1EA 1RPJA 2YVAA 2H2GA 1LI7A 3VR2A 2Y76A 3BL8A 3CZQA 2BVNA 3ZWQA 3CX3A 4YMSA 2JF0A 1F4PA 1Q92A 2DXIA 1RFGE 1CR1A 4M9XA 1NJ8A 2YIJA 3IMKA 2PPLA 1G4UR 3NEJA 1Q57A 2Y0PA 4JLVA 3NHRA 3PT5A 5K2MA 1YZHA 3CH5A 3LDUA 2X77A 3HCOA 2I67A 4J7UA 4KHZA 4QYWA 4V0OA 4YUZA 5A02A 2OENG 5F1KA 2RDMA 2XH8A 3DYIA 3ZY2A 5D5PA 2ZUFA 3AM3A 3T95A 3KG2A 4EW2A 1PL8A 4O4IB 1LDMA 2AFIB 2C2XA 2FZWA 3A7DA 2COEA 1T15A 1T1GA 3E3LA 3H1PA 4RDHA 1Y5NA 4NOJA 4RC9A 2VZ9A 5DP1A 3PQ3A 1KZ7B 3WC4A 3DBLA 1Y8RA 1TF7A 2JLUA 1AGXA 4IYRA 5AKYA 3VI3B 1LK0A 1PF7E 2BSXA 3EIEA 1OX6A 4LMAA 1UZLA 1V4NA 4PC3A 5CM8B 2JIZA 1Q11A 2RFLA 3R6WA 3IP6A 3QEAZ 3EZFA 1COWA 2GJSA 4GL2A 2A0XA 4YJ2F 3GELA 2I7CA 2Q0QA 1K2VN 4UEOA 3CWCA 2I8LA 3JZDA 3OPVA 3VNSA 1C9EA 1OC4A 3BK1A 1SQGA 1K6IA 2C31A 3OE5A 4WXPA 1WS6A 2AX4A 1EM6A 3AEXA 3QLUC 1PO7A 4DMUB 1EWVA 2JK1A 1H1DA 2X42A 3OX3A 5HKKA 5HOQA 3DG9A 4Q9JA 3WMEA 1HNNA 4MKIA 2DR3A 2HHJA 3E9EA 4OHFA 3OCUA 4NENA 2R6DA 3UAZA 2C8LA 3GW8A 4DV0B 3KQWA 4B4VA 2XJ4A 3FPAA 3P9KA 1ZJYA 2P2YA 3QKSB 2ZXFA 3P2YA 3Q88A 4NMHA 1FNCA 3QENA 4RA6B 4A1FA 3FX2A 4AS2A 4DXHA 1KO1A 3TBHA 4IJQA 4OK6A 2QLNA 1P6XA 1XMVA 1TM3E 4HS4A 4X7PA 3TIFA 4ZDKA 4ISCA 4OH7A 1CC1S 3EN0A 4TS9A 2AEEA 3EHDA 3SY8A 5FBKA 3UJ6A 1ZP6A 4FONA 1I13A 2FZ5A 3BMQA 4IJVA 5CBPA 4EECA 3SQWA 1BCRA 1I1NA 4KIWA 1UJCA 1C1HA 4L9AA 4QOGA 1RQGA 5KOYA 4Q3OA 2NUAB 1FDSA 1U2DC 2GXQA 2O05A 3GH1A 3OLXA 1KI2A 5JMOA 2NAPA 4PNEA 2PJRA 4AZSA 3O90A 1SO8A 2UVPB 2PQ2A 3EODA 3PU6A 1G5HA 3W5DA 5A4KA 2ZYRA 3BBPA 3A3KA 2YN0A 4Y2RA 4XJTA 1UFQA 2FPWA 5LP6B 1OB5A 3V32A 4FP9A 2ZI3A 3AY6A 2RKWA 3HBLA 4YALA 3GLFB 4BU1A 3ZDZB 4KB5A 1R6AA 5TV2A 3B7GA 3ILHA 3JRWA 3EIQA 3GUVA 2J09A 2VTVA 1FTNA 3MFYA 4IIFA 4GGOA 5HS6A 1E98A 3K1JA 1NUTA 3ADDA 5JY6A 3WNBA 4S2UA 2C2GA 4NG5A 2E89A 3AV0B 1K7CA 1XXLA 2GOYA 2W0MA 3LP5A 4MV4A 2Z8YM 4QAJA 2H3EA 2PXXA 2R1UA 5DISB 4QNNA 4MCAA 5BSTA 3CNBA 1USKA 4DANA 5C53B 5IXSA 4UQOA 2M98A 4Z2AA 4OLBA 2VF7A 2WVGA 5E2AA 1UPUA 3Q2OA 3QFHA 2PVSA 1GPBA 1F14A 1MJHA 2ECFA 2QU8A 3ZWDA 2V9CA 1SXJE 3EF3A 1XWFA 1NQTA 4PC7A 2BSAA 4DA7A 2X0EA 4XVRA 5FL3A 3PPIA 1UKVY 1EB8A 2H1CA 1NYLA 4EA8A 2AUTA 4ATNA 1J6UA 2R5NA 3ANSA 3KUDA 5EOVA 5FR2A 5AESA 4L8WB 4MQBA 5AWFC 1IHPA 2V0GA 1U0FA 2FZEA 1OSNA 1KZ6A 3LK7A 5D3ZA 3R6DA 3IPLA 4O4LA 3HJAA 1FFCA 3SHVA 3JATA 3W6NA 2VZLA 2WLTA 2N1BA 1UK6A 3Q0TA 3EVBA 2QNIA 4ZODA 1LBTA 2O2DA 2YIDA 3FI9A 2QA5A 2R66A 1L5HA 1OWOA 4B3RB 4OOFA 4O0MA 3MBIA 4RE6A 5HCUA 1E1QA 3CWZA 1TK2A 4LWOA 4LJKA 2FRDC 4ACBA 3DCJA 3ZIAA 1V3QE 2IOQA 5LQCA 1TYAE 3RFXA 1C3OB 5AQ1A 1Y5IA 3U48A 3L82B 2EFYA 4GBGA 4RW0A 4KYTA 4OI1A 1K5GA 2HDHA 4KUGA 3RLFA 3W1WA 5DOVA 1CJCA 3E4DA 5AJTA 5AI0A 1Q0SA 1VI6A 4E33A 2ZUEA 1YK1A 2X9GA 1A9ZA 1SR8A 4HDKB 4IHAA 4UAUA 2WTXA 3RFUA 2Q0SA 5K6TA 3OCCA 1XKXA 1HETA 5JS6A 3KTDA 1OCEA 3FRHA 3SF0A 3O1LA 4FHGA 4G36A 4YRBA 1RD4A 5ES3A 1ZCJA 4K6MA 4AMUA 4YMUA 2FW6A 4U9HS 5JAOA 4A36A 1YS1X 1TT5B 1RYFA 1REQB 3F4BA 3PITA 4CM8A 4R7GA 4IICA 4WBXC 4JNCA 3PFWO 4PHGA 2FI1A 1BE0A 4UBLA 2AF4C 4HPJB 5F12A 2DEUA 4L75A 1M2NA 3V1NA 4CG1A 1H1LB 4IVRA 1LZLA 1OLOA 5CK5A 4D80A 1UC9A 5CDUA 2CFOA 4Z4IA 1CSEE 1BVRA 2Q62A 3GAZA 4EAAA 5JSQA 4OQ4A 2QMQA 1DU4A 1EFRA 1W2GA 2O14A 3ZGLA 4BU0A 2FN8A 2JD0A 4QJ4A 4BJHB 5CNKA 1RMQA 1L4MA 1QR6A 2QORA 3D2AA 3JQGB 3MJFA 3V42A 2W6ID 4ALMA 3HQ4O 5KNBH 1I9GA 1EUYA 3ZXUB 1UBLS 1CUIA 2HD4A 3UJNA 3BM5A 3O1IC 1H8EA 1H2XA 2AMLA 3OO0A 4TMXA 4DLVA 3ENVA 1SUEA 1UH5A 4Q3DA 1R9JA 3CIFA 5DI9A 1JTFA 4GS5A 3SJAA 4JDPA 4X64B 1PE0A 1UEIA 1CS0A 2JL1A 4KSCA 1QFXA 3KX2A 4YIKA 1KK1A 5B7PA 1TF2A 4QZVA 3AIOA 1XXHE 1Q7GA 4WHMA 3KT3A 3UHPA 4J29A 2VDKB 4JJEA 1K3UB 2P5YA 2KLBA 3ZK8A 4D8TA 2CMKA 1XL1A 5I4CA 2X0IA 2OMEA 4DLAA 5AT1A 2XUAA 1B73A 5JLJA 4YO7A 2QG6A 2VQ3A 5JW6A 4NOLA 3W5UA 2CNKA 1JWAB 3OEWA 2JGMA 4Y2TA 2G5TA 3D4LA 4WNYA 5D84A