2WD7A

Pteridine reductase 1 (ptr1) from trypanosoma brucei in complex with nadp and ddd00066750
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
267
structure length
249
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE
publication title One Scaffold, Three Binding Modes: Novel and Selective Pteridine Reductase 1 Inhibitors Derived from Fragment Hits Discovered by Virtual Screening.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 92
structure length 249
sequence length 267
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2wd7A00
3ETGA 2F00A 2QHXA 1ZH8A 1N7HA 1M6HA 4TRNA 1U4SA 3R0IA 1H9BA 4NK5A 2GZ1A 3G49A 3WNQA 1X7DA 3B20A 1G0OA 3QA9A 3NUGA 5FWNA 3ZI0A 4XQGA 5EQDA 2I65A 2BFAA 1TA4A 1LLDA 3O4RA 3QJ5A 4GBJA 4J3FA 3NGXA 2CVQA 2Q1SA 4CM6A 1HDOA 2V6GA 2I3GA 2P9CA 3PP8A 3KYCA 1HF3A 3GH3A 4E33A 3DONA 5TRTA 1UR5A 2FSVA 2VWPA 2Q4BA 2VYNA 3PHLA 1R4MA 2WJPA 1I3NA 1OC4A 3DBLB 4YBZA 3ORFA 3TF5A 3OICA 1QXSA 4NG5A 5IF3A 3VH4A 1Y5RA 1DXYA 3N7UA 2H1SA 5JCJA 5C3MA 5JBIA 3KSDO 4BMSA 3K92A 2I3AA 4BNHA 1VLLA 1ZK1A 4FD3A 3BHJA 2HRZA 3H2SA 4LISA 4HXYA 5EPOA 3UCFA 1LJ8A 3AY3A 2ZCVA 1PL7A 3WOHA 2Y1GA 4RPGA 1E92A 5IZCA 5L9AA 3ZWOA 5KVSA 4D3SA 3AUAA 3M6IA 4K6CA 1HRDA 4OKNA 3PWSA 4YWJA 3VZRA 4HV4A 1U7HA 2BMAA 1UH5A 1VM6A 2ET6A 1VPDA 2DC1A 4ZQFA 2C0CA 1YBAA 3KYDA 3QP9A 4FFNA 4ND3A 1I01A 4XB2A 1Z6ZA 3KRTA 5JYDA 4KUHA 5GMOA 3U62A 2NQTA 1NWHA 4FOOA 1LEHA 2Y0CA 3PGJA 4YT2A 2VUTA 1GDHA 1EUCA 1ADBA 3PJEA 1WMBA 1KEPA 5BR7A 3HUDA 4NJMB 1KVTA 4ZJUA 2NTJA 5ER6A 4YQZA 1F8FA 3DB2A 3DBRB 5AQ1A 1BGVA 1F0YA 3CEAA 1JKFA 3WWZA 1IOLA 3JCZA 4R54A 3KXDA 4IQ0A 1P1RA 2OO5A 4UULA 4OAQA 1T1SA 1W4ZA 4E5MA 3ZN2A 3V5NA 3UFXA 4RZHA 2GPTA 2P2SA 3HN7A 5JYEA 4CR7A 4CLOA 3BIOA 3UN1A 4BL5A 5GZ1A 2Q2VA 1BHSA 4EYEA 4P4LA 2Q3EA 1XG5A 5DDIP 4TRRA 5FEUA 5DBFA 3F1LA 3U4HA 1SAYA 5JDCA 1GAEO 1GADO 3WXBA 1EVJA 4ID9A 3C3XA 4I8XA 3AW9A 3FCOA 3ZWNA 3SJUA 4S1VA 1AXGA 1BXGA 3B1FA 1JTVA 3PFFA 3O8QA 3R3JA 4Z3KA 1LSJA 5CDYA 5JO0A 3DHYA 4CV0A 3FNEA 4XX0A 3WQQA 1MXHA 3CSDA 3LT1A 3R1IA 3G0OA 1I2ZA 5DNAA 4TQGA 4D42A 1UP7A 4CM5A 2ZTVA 5JSFA 3LSYA 1LI4A 3GFGA 4MVJH 1T24A 3GDGA 3S1LA 4YCAA 4CQLA 4TWRA 4GPD1 1O5IA 3FNGA 4FDAA 1JKIA 3OM9A 2UYYA 1AHIA 4UVHA 4DVJA 2VHXA 4M49A 4P38A 2I5PO 3I9KA 2O3TA 4OIMA 4CLEA 3OECA 4FS3A 4JXKA 2X22A 4NJOA 2YV2A 3ETEA 4J91A 1D1TA 4BB5A 3RI3A 2RH4A 1PSDA 2VQ3A 3HN2A 5G4KA 1Y5MA 3F5SA 3IUPA 1JWBB 2X0RA 2GUGA 4KQXA 4WECA 2ZYGA 4A73A 2JFHA 3JQ9C 3KEOA 3RU9A 3SC4A 4EDFA 2VT3A 3LC1O 1DIRA 4RF4A 1NFRA 5JNLA 2CVZA 2WMDA 2PLAA 1ZSYA 5I7SA 3OBBA 4Q3BA 1ISJA 3M2TA 4Y67A 1ID1A 4UEOA 1NTOA 5L4NA 4IXWA 3W4JA 3GNSA 4XDYA 5A1TA 2A92A 4YT8A 3TQHA 3QWFA 2B5WA 2LDXA 1E3SA 2EERA 3HDQA 3NTQA 1RYEA 2VNAA 3ABIA 2Q49A 1K0UA 1MUUA 3F9IA 1FK8A 2GASA 1WMAA 3GA0A 4W9NA 4IY1A 1LSOA 4NZ9A 5A06A 1ISHA 1A4UA 2X7HA 2YV3A 3PI7A 4DBZA 3RFTA 2VWQA 4PCVA 3PHJA 4CQMD 3GRPA 3ETDA 4J1NA 4RPKA 1FDWA 4N7RA 3O26A 3WICA 3GGGA 2IZZA 2VHWA 1VL8A 5BQFA 1HDXA 1P74A 1TT7A 3NJ4A 1D4FA 2DUWA 1L7EA 5A9RA 2C5AA 5A4DA 5F1KA 5AXDA 3PXXA 4JLWA 3PVZA 4HWKA 4NBRA 1SCUA 4F6CA 3VOSA 5CPBA 4YB8A 3H4VA 2OP1A 2X9VA 2NV6A 3WDSA 4R5HA 3SLKA 4J6FA 4BNGA 2IZ1A 3HNPA 3IKTA 4EI2A 3OHSX 3PJDA 5CDTA 3Q11A 5CG1A 2GN8A 2QYTA 2IE0A 3HDYA 4ND2A 3STHA 3PYLA 3B1JA 1NVMB 4O0LA 1DJQA 1YL5A 1X0VA 2VHYA 3RCBA 3INGA 1YWGO 4ESOA 2D1YA 4N5NA 2O7SA 2G5CA 4TRJA 2DM6A 1B26A 4GSLA 3H5AA 3OA2A 5AXCA 1FDSA 3LC7O 5HM8A 2YHIA 6LDHA 4BO1A 3CH6A 3GMDA 4CM8B 3FN4A 1EUZA 4GWKA 1PQPA 5DP2A 4DMLA 1K2WA 3ANNA 4TKMA 1R37A 1T2EA 1PJ3A 1Q7BA 4Z9XA 1HL3A 2EHDA 3HWRA 3BMQA 1HYGA 3DDNA 1T2FA 3JQBA 4A2CA 1X1EA 1XCBA 2ZB8A 4PLYA 1NHGA 1ZXBA 3PK0A 3E6AA 4WKGA 4PZDA 1PGPA 1QG6A 3KSZO 5JAIA 3GHYA 1EDZA 3JV7A 1Z7BA 4Q3CA 3QWBA 2J5RA 1MXFA 2DBQA 3IDSA 1PJQA 4IZIA 4Z9FA 1FXSA 4BQRA 1YDWA 4M86A 1GZ4A 3TN7A 3W6UA 3PTZA 3PEFA 2AQHA 1UDBA 1ONPA 3JQDA 4ZQGA 5TT0A 3MWDB 3EVNA 1Y8RB 3WGQA 4L0QA 3L6DA 4XQ9A 2W2KB 2RCYA 1U8FO 4JP2A 5TX7A 3F46A 3O9ZA 3WTCA 1TB4A 3RBXA 1PJSA 3QWIA 2YFHA 2JHFA 4WLVA 5GY7A 4FQ8A 5L51A 2P5YA 2AMFA 3UUWA 4L4XA 3ZU3A 1UZLA 1O0SA 3E9NA 4DYDA 3V1YA 1DB3A 4EBFA 5KVVA 3HSKA 3LZ6A 4KMSA 4NU6A 3SVTA 3E82A 3BHIA 2O48X 2POQX 1G0NA 1ADFA 3I1JA 4RPHA 1GV1A 2R2GA 1A4IA 5HS6A 2IODA 2CMDA 1DJNA 1HETA 2AQ8A 4OYRA 4CMKA 1ADCA 1A27A 1LSUA 4NBTA 5LDHA 3TZQA 1UDAA 5DCYA 2CD9A 4DXHA 3OJOA 4OSPA 3RKRA 1SBYA 1LDEA 2PNFA 3NDJA 3RJ5A 1XKQA 3G3EA 3TDKA 1ISMA 4E2YA 5HS4A 1V3VA 2C59A 4KUGA 3VAZA 5CDSA 1YOVA 4RQUA 3FD8A 3KV3O 4IDAA 4N54A 5IG2A 3FBGA 3KTDA 1DC6A 1EEHA 1K89A 1WDKA 4U8GA 4XIYA 2BD0A 2PGJA 4IMPA 3NTRA 1BTOA 5TIIA 4ZVVA 1PIWA 3KM0A 4WEOA 1QYWA 4GX5A 2WDZA 4YA6A 2GYYA 1SZJG 4PLGA 4AFNA 1N9GA 1T4DA 4P4NA 4NIMA 3GNTA 4QXMA 2I6TA 4TSKA 1H2BA 1QP8A 3CIFA 4UVEA 3KBOA 1BDMA 3MCVA 5DF1A 4RLSA 4UAGA 1C0KA 4PLCA 4XJTA 1NFFA 4WOJA 3WIEA 3NKLA 3SJ7A 1LDYA 7ADHA 3K2EA 3EY4A 4N5MA 4IPTA 2Y99A 3Q9UA 1MV8A 4AJJA 4U6SA 3QSGA 2OBNA 5JW6A 1N8KA 1QYCA 1QYXA 5H82A 2WTBA 3V2UA 3D7LA 4AJNA 1QYDA 3F4LA 4BNNA 4ONEA 4JROA 1MFPA 5JMWA 4BO3A 1Y9AA 4IIVA 3TZHA 5JY6A 3LF2A 1NWCA 1IZ0A 4L74A 2V6BA 1Y8QB 1X7GA 3S2GA 3IL2A 1C1DA 1RM0A 2G82A 2GN4A 2JAHA 5AXBA 3RBZA 3PZRA 3SBOA 1W73A 1DHRA 4DMMA 4BKUA 2VYVD 5CDUA 3PHGA 3PFWO 4PLVA 1IULA 3E5MA 1NAIA 3CUKA 3D1LA 3PWKA 1CERA 3PYXA 4IDGA 3X2EA 5BSFA 3ZWXA 1K5HA 3O38A 3WLFA 2Y1DA 3D3WA 4CMHA 3DFZA 3ICCA 4GSKA 3HHPA 1E6UA 5I9MA 5JXWA 3TNLA 1SEVA 4HBGA 1GZ3A 1T2AA 5K6AA 5DBGA 3EZLA 4J4HA 4BNXA 5CHEA 3UF0A 5B4TA 2YYYA 4R1SA 4XQEA 3K73O 5K0ZA 1CF2O 1Z74A 1E1MA 3IP3A 3JQGB 5I7EA 1R4NB 4PG6A 3ASUA 4CR8A 3W8FA 3HDHA 4BIIA 5C37A 1YXMA 4XYEA 3RKUA 2A35A 4XYBA 3RD5A 4LN1A 1DSSG 3FRJA 7MDHA 3MJEA 1P31A 2YDYA 3ROQA 4CM4B 3PGXA 4RDHA 4R9RA 3UXYA 2C7VA 3DO5A 4E2ZA 2E48A 4PRLA 5EESA 5KVQA 4OXKA 1JU9A 2PFGA 2H9IA 1PX0A 4RVFA 3DHEA 1BXZA 3JD0A 2JFFA 1J4AA 4EEXA 3FWZA 2VZ9A 2O50A 4KWIA 5C7IO 1JWAB 5L53A 2PWZA 3GN1A 3GR6A 5F5NA 4GH5A 2FPGA 4RF5A 4YACA 2J3KA 3D5QA 4FFLA 1M2WA 2H6EA 2HLPA 4F45A 3C7CB 5CEFA 4EJ6A 4L73A 4W82A 1I2BA 1ML3A 3I5MA 3SC6A 1AUPA 3WMXA 3WGIA 5EN4A 1PQWA 1ZMOA 3ZWVA 4QFDA 3Q0EA 1YQGA 2EGGA 4A10A 1Z73A 1J6UA 3OIFA 2RBEA 1OFGA 4NBUA 3FPLA 4K26A 1NQAO 3AOEA 4BO5A 3IKVA 4YQYA 3WJ7A 5I9NA 3OJLA 5KIAA 5HA5A 3ZU4A 3MZ0A 5DCWA 5ITWA 3F47A 2X86A 5B4VA 1WZEA 3MJVA 3F6YA 1DC5A 3GVIA 1XHLA 4G2NA 4J90A 4MVJE 4XZ3A 3D0OA 2CSUA 1M67A 1T25A 2C7GA 2X5JO 2Q4EA 2VWHA 1A7KA 2DFVA 3WIDA 3DHNA 3DMTC 3DZIA 4X54A 5G2OA 1BW9A 1DRUA 1PS9A 3QW2A 3JQ7A 1BMDA 1H6DA 2NM0A 2Y67A 3EMKA 3H9QA 1A9YA 3QVWA 4R69A 1PGNA 4DIOA 1A9ZA 5B37A 1PJBA 4I08A 4E12A 4PN3A 5L4LA 3ZU2A 5EQFA 2ZTMA 3VKUA 2DQ4A 1IPEA 1GUFA 4YJGB 4MPDA 1QR6A 1SPXA 1TI7A 2NADA 3ENNA 4FGWA 4MKRA 2CVOA 4KP7A 3WB9A 5ILGA 1LUAA 4XD2A 3FNFA 1LBEA 2HJRA 2G1UA 4WCDA 3T4XA 3AY6A 3AUSA 4RVSA 4CM9D 1DIGA 5G0UA 3E18A 3EGOA 3I52A 4TZKA 9LDBA 3ADOA 2DUUA 1V0JA 4YJFB 3DOOA 3RFXA 3IC5A 1RYDA 2W4QA 3HDJA 3AU8A 5KWEA 5JDIC 1A5ZA 2Y1FA 3U4IA 5G4LA 4JBGA 4YXFA 3VPFA 4IIUA 3BMOB 5COAA 4MVJF 2ZB4A 2FN7A 3U4DA 3JQ6A 1UAYA 5TT1A 1D1SA 1XELA 3L77A 1VSUA 4RVHA 4PG5A 4O59O 2NU6A 4RVGA 1PZGA 1I3KA 4MVJM 1EE9A 1SOWA 4CLXA 3EAGA 4LMPA 1BRMA 3EYWA 4ND1A 1W8DA 2FP4A 4BO6A 4ZHSA 4J1TA 1HDGO 3PDUA 4DWVA 1ZK4A 3OJ0A 4E13A 4IINA 3E5RA 4J2OA 1SNYA 2OBYA 2RAFA 4TROA 2GNAA 3T7CA 4CMIB 1JLLA 1DHTA 4KWHA 5IAAA 2C5EA 3GFBA 1KC3A 4IM7A 3F1KA 5HTOA 2E82A 3UOGA 2VYND 1HE3A 3GG2A 1LTHR 2D4AA 4GMFA 4CUKA 1A71A 1EMDA 3ROPA 1GYPA 3C85A 4RQTA 1U3WA 4UREA 3QVOA 1WW8A 3RASA 4YRBA 4ZRNA 4BNIA 4KZPA 1YO6A 4ND5A 4WCFB 3H65A 5JCJD 5THKA 2P4QA 5TJ9A 1E7WA 1I3MA 1UUFA 4YVFA 3ADPA 3AM5A 4MVJA 3I9JA 4DA9A 3ONFA 2X5KO 3C7DB 1RWBA 4M8SA 5COQA 2PD3A 4CMCA 5JC8A 1D3AA 5F1PA 5THQA 4BNFA 1LLQA 5DCUA 3GVXA 1UDCA 2ZYAA 1JVBA 1EUDA 3H2ZA 5G0WA 2J8ZA 4RVDA 4FN4A 5CDGA 2C20A 3VZQA 2DAPA 4FOSA 2AQIA 4D79A 2FRDA 1YB1A 2ZCUA 4CQMB 8LDHA 1VKOA 1RM4A 4KQWA 4BHTA 3N74A 1LU9A 4Z9YA 3JYOA 1LA2A 1K6XA 1HLDA 1S6YA 1J0XO 1Q1NA 3K30A 4P22A 4CODB 4MIEA 3ZWYA 3T7EA 2PKRA 5IZ4A 1NXQA 3ZW8A 4YJDA 4CR6A 2VNSA 3P2YA 4CL8A 2C07A 4J2HA 3RROA 3NT5A 3QVTA 2ZB7A 4IDCA 5T67A 1NP3A 2BI8A 5IN4A 3Q3CA 3RFVA 4IQ8A 1DRVA 3Q2IA 2NVUB 2CFCA 2J5KA 5B12A 2GN9A 1V3TA 4AJPA 3I9OA 3JQGA 5JLAA 4GMGA 2W2LA 1KVUA 3ZWAA 1ZEMA 3WJAA 5ICMA 3JQFA 2HDHA 4QFCA 5BSEA 2BGKA 1IHXA 2E6UX 3LLVA 2JCYA 5A3JA 2ZYDA 3RUIA 1NR7A 2CDCA 4YR9A 4CMEA 3OP4A 3SXPA 2RH8A 1B8UA 4Y8VA 4K28A 5AYVA 2O4UX 4FJ0A 1WWKA 2WSBA 2PGLA 3GAFA 4OH1A 4QO8A 1GQ2A 2Q45A 2IZ0A 3OFSA 4ALJA 3GEDA 2UV8A 1XU9A 1HTBA 1Q0LA 1ZJZA 1YB5A 3K6JA 3KUXA 5B1YA 4OO3A 3E9QA 3RUCA 5EL0A 5IJZA 3MJSA 4CLHA 1P33A 3AJRA 2B4TO 4GAEA 2JD0A 4M1QA 4BNWA 4D44A 3HQ4O 2NQ8A 3JQEA 2O3SA 2OHXA 2BI7A 3JTMA 3JYQA 3NYWA 5AOVA 4TRMA 1K3TA 2YQ5A 1LDNA 1VJ1A 1EVZA 1TVEA 1MGOA 2P5UA 2RHRA 4BGVA 2B5VA 4CLDA 3ENKA 3JQAA 2I66A 2IXBA 4Z3DA 5IDQA 5JY1A 4LSWA 1Q7GA 2O2SA 4R51A 1E5LA 1ZXLA 1HSZA 1E7RA 1HDCA 4XCVA 5AXAA 1QLJA 2PV7A 1I0ZA 3CZRA 5TNXA 4MIYA 5KJFA 4BQPA 3PJGA 1XYGA 2VTDA 1PWZA 3H7AA 2C2YA 1LQTA 2PD6A 2PZJA 3OQ1A 1O9BA 4UEJA 1NHWA 2IXAA 2QRJA 3TPCA 4BNTA 3GZNB 4WLUA 3JQCA 3OEWA 1XGKA 3DZBA 4WPGA 1K6IA 3ZCXA 4A5OA 4AJIA 1E7SA 2NTVA 1YH3A 1N1EA 2Q1UA 2DTEA 1QMGA 3GMSA 2FR1A 1QRRA 1XA0A 4O5OA 4E2XA 2HO5A 3V1TC 1VKNA 2HMSA 1VSVA 4WOKA 4LCJA 1KEUA 3E9MA 2QRLA 3KSUA 3M1LA 1M75A 4R68A 1E3WB 5DN9A 1YDEA 2AG8A 4XA8A 4AJ1A 4BNJA 1P77A 4Z0TA 1O8CA 2IYPA 3INTA 3IJPA 3S2IA 4U5QA 4DUPA 4PZCA 4E3ZA 3LT0A 1B2LA 4I9NA 3DAGA 2EP7A 1IPFA 1E3JA 3L07A 2NU8A 1GPDG 2R00C 3RC7A 2HJSA 5A9SB 1F8GA 1JQBA 3GVPA 1EVIA 3ON5A 1F12A 1WXDA 4H15A 4NDNE 1R66A 3VTZA 4O6VA 1DLIA 1XQ6A 2AEMA 1ORRA 2JD2A 3W4IA 4FFMA 1Z45A 4ITUA 3PLNA 4YAJA 1YVEI 1HXHA 4YTEA 4RL6A 1L7DA 1RPNA 1GV0A 2O2YA 4D0SA 5TC4A 4NBWA 1PJCA 1E7QA 4IXTA 1OI7A 4BO4A 2HAEA 3BTUA 4GVLA 4R1UA 1P44A 1R15A 3C1TA 4D3FA 3DZFA 1U2DA 5CAEA 1DAPA 3D4OA 3RJ9A 1ZK3A 3EVTA 1EK5A 1PZFA 2AG5A 3PYMA 2BRUA 3EHEA 4MO2A 3BMCB 1P1KA 2JKVA 4UVGA 5ER9A 1E77A 1ZO8A 3WQSB 3P7MA 3VPXA 1X0XA 4BMNA 4CMIA 5H81A 3A06A 5T8KA 2OL4A 1QV7A 2VUUA 4WK6A 1YKFA 2RIRA 3FBTA 1SC6A 1U3UA 3ST7A 3GRKA 2GRAA 3ZWWA 3ROMA 1HDRA 3ANLA 3DEYX 4DIBA 1LC0A 3ZW9A 4FBGA 4O1MA 5JAMA 3P2OA 2JCVA 2SCUA 1BDBA 1DC4A 4JBIA 4NR0A 1DOHA 4J1QA 5ES3A 4A0SA 4WCFA 1KBZA 4CMGA 3U4CA 1LLCA 2ZQZA 3BZUA 3E03A 4II2A 2Q1WA 1P1FA 4HFMA 3W8EA 4NI5A 2JCXA 3GG9A 2V6FA 1BSVA 2HMVA 4L4SA 3RSHA 2EW8A 1JAXA 2VZ0A 4IZHA 3RU7A 4IDFA 1T4BA 5G0VA 4YDRA 1YS4A 2O7QA 3F5QA 1PJTA 2DKNA 3TFOA 1HZJA 1DRWA 3C1AA 3HJAA 4FB5A 5CG2A 3TZ6A 2ZJ0A 2X6TA 3DBLA 4G81A 4LSMA 3WTBA 3RIHA 3NX4A 1NM5A 5BNFA 1SEPA 5A5EA 1H6AA 1YB4A 1LQUA 1UP6A 2ZK7A 4UUOA 2WYWA 1YRLA 1P0CA 1YBMA 2AW5A 3IP1A 3PQFA 4QX6A 2WWRA 4XWYA 4A27A 4DPKA 2W90A 2J3IA 3CXRA 2I99A 4ZRMA 1FDVA 2WD7B 4EUHA 4QSMA 5IZCC 2Z1NA 1MC4A 2NLOA 2GZ3A 1WDLA 1P1IA 2UAGA 4R3WA 4G5HA 2P9GA 4GQAA 1M6WA 1NAHA 2HK9A 4EUFA 1YL6A 2ZQYA 4YPOA 4IJWA 5TLSA 2WYVA 3A4VA 3JQ8B 4YEDA 4J7CA 4C4OA 1EFLA 5CEJA 4FFPA 4YAIA 4RV9A 3RUHA 4IJKA 2CF6A 3I6IA 5J23A 2PKQP 1ZSNA 2IEBA 3UGKA 3P19A 1LDGA 1OBFO 2VRCD 1EDOA 4BMVA 3UCEA 1ULUA 3L4BA 4M54A 3U5TA 3PJFA 1B8VA 4DGSA 4NJMA 2GGSA 1O95A 1DFIA 3MJTA 3NT4A 8ADHA 1SB9A 3LU1A 3DBRA 2DBVO 2DFDA 4GX1A 2JL1A 2QYSA 3CINA 4C7KA 2FZWA 1J5PA 1HE2A 3DBVO 3ZNPA 2PH3A 3F3SA 4OSOA 1C3VA 4DBVO 4LK3A 1NFQA 4CUZA 3MTGA 2G17A 5L7WA 4FIZA 3WYCA 1EQUA 1YJQA 1SB8A 1PZHA 3QWAA 4FW8A 3FWNA 4EW6A 2DT5A 1X7HA 2VRCA 5COBA 5JDCC 1PL8A 1ZCJA 2EKLA 1E7MA 2EJWA 5IXYA 3R6DA 2JJYA 1NQOA 5U1PA 4BNYA 1LDBA 3PLRA 2VN8A 2OMEA 2VHZA 4UVDA 4JX8A 1PS0A 2VRBA 3DXFA 1HT0A 1P3DA 1MP0A 1PU2A 3FPCA 3GY0A 2XXJA 3CE6A 1Z75A 3Q2KA 3OEYA 1CIVA 1HE4A 4BNZA 1PR3A 1PJLA 4J7UA 3ZNOA 1KERA 1RKXA 2OZPA 1T26A 2B35A 3G1TA 3PHIA 2WE7A 2Y1EA 3DOCA 5EINA 2Y1CA 5ICSA 4HADA 2X8LA 3WBBA 1GYQA 5G0SA 4Y9DA 3OJFA 4CV1A 4J16A 2FWMX 3H9UA 1SMKA 2NNLD 5EERA 1I3LA 5T57A 4BO2A 3WYBA 1I30A 3ROKA 5ADHA 1E1NA 1LX6A 3CPSA 4MINA 5DBIA 3VZPA 4DTIA 2NWQA 4D0RA 4YAKA 3TL2A 4XRGA 4FFRA 1PR9A 1LXCA 2DBRA 3PQDA 4OXNA 3WX0A 4BO0A 3QIVA 2BFMA 1I32A 2HMWA 3I9LA 1DO8A 3DBHB 3WR5A 4B3JA 2NVBA 5KOIA 3KLMX 4WASA 4RZIA 4BKRA 5KTKA 1KYQA 1UZNA 4NMHA 3JD3A 3VTFA 3QVXA 5L40A 3GOHA 3R3SA 1VI2A 2W98A 2O23A 5JCXA 2ILTA 3E48A 3EW7A 3E1KA 2EXXA 2X58A 1E1LA 3AY7A 4RF3A 3BYZA 3LYLA 4FC7A 1FMCA 2WM3A 3VPSA 3PIIA 4RDIA 3NJ8A 3CMMA 4RCVA 3C1OA 2PGDA 3MTJA 4LW8A 4CM7A 4PRKA 1HYHA 3WFJA 1G1AA 2D3TA 3GNQA 4BNLA 2QG4A 3DOJA 2Z95A 3QQPA 3KOUA 1PEDA 1NR1A 2GERA 4GWGA 4FPXA 3SLGA 1T2DA 4MVJI 3LVFO 4W9NC 3SX2A 2AE2A 5BNIA 3KZVA 4IBOA 1UXKA 3KYCB 5F3RA 1XDWA 5A02A 3GT0A 3AUUA 3QV1A 1N92A 4AJLA 3S8MA 1ZZEA 5A03A 1XQ1A 2X0JA 1HSOA 1HDYA 1I8TA 1ZMTA 3AK4A 3BMCA 3IJRA 4I5DA 4E21A 4HFRA 3S2EA 1Y1PA 3GHHA 1CJCA 3BMNB 1E1KA 3I4CA 1ISIA 4J0FA 4RLHA 1PL6A 3PRJA 4FJ1A 3ZNNA 3ITKA 3EZYA 1KY4A 1GU7A 2X5OA 3ONDA 3ZU5A 2C54A 1NBOA 2BLLA 1QYVA 4ZQEA 4W4TA 2LDBA 2X0IA 1C1XB 2Y66A 3BTSA 3PDJA 1OAAA 4NHEA 3A14A 3UKOA 2FMUA 5A3VA 3VH2A 1P1HA 1MG5A 3D4PA 1GY8A 1ISFA 1M76A 1V9LA 1VJ0A 3AFMA 3NT2A 5JAQA 5LC1A 3ZGYA 4E2WA 1H6CA 4AJKA 3ZH2A 1C14A 2E4AA 2EIHA 2OXIA 1B3BA 1H93A 3HFSA 4DQXA 4I5EA 2V6MA 3TZCA 1E7YA 3H3JA 2BKAA 1XLTA 4DREA 4CM1A 4Q3EA 2D2IA 1GCUA 4INAA 4ZQHA 3U0BA 1TXGA 1WP4A 1GFSA 4HNGA 1RM3A 1ZKMA 4F6LA 5CFZA 4AJEA 2JAPA 4YRAA 1AE1A 4RORA 1XIVA 1LC3A 4KOAA 3OA0A 2F1KA 3DL2A 4WLOA 4YJHB 4W6ZA 3GDOA 1CYDA 3FHLA 2DTXA 1NQTA 4B8ZA 3JQBC 1NASA 2UVDA 2EEZA 2WD7A 1WVGA 1IZ9A 1QORA 2EGHA 1HEUA 3H5RA 2V65A 4MVJG 4J9VA 3AUTA 1I24A 3OF2A 4R1NA 4Y98A 4Q9NA 2QW8A 3OH8A 3UW3A 2CNBA 1KIFA 3GQVA 3VH1A 4CL3A 5DULA 2NTNA 2C82A 5FFFA 5ENVA 2X23A 3BTVA 2DVMA 4OQZA 4QQRA 1BXGB 1HWYA 4II3A 1Y8RA 1ONOA 2DPHA 2Q46A 3RUFA 2W2KA 1AN9A 5MGBA 2I9PA 3QE3A 4OQYA 4U0KA 1ULSA 2GR9A 2I67A 5HBRA 2PZKA 4Y6PA 5KKCA 3I4FA 5JAZA 4ALKA 3H8VA 5L95A 3RVDA 4R01A 3COSA 1KEWA 4ILKA 3LDHA 4MP3A 1GUYA 4CQLB 1XR3A 3QY9A 4PVDA 3QHAA 4A7PA 1CRWG 1RM5A 1GEGA 5DT9A 5KJ1A 3VH3A 5TGDA 1AHHA 1P0FA 1IB6A 2H63A 1PGOA 4HFJA 2YZ7A 2P4HX 4BKPA 2H5LA 3BAZA 3ZHXA 1MX3A 2WYUA 5ITVA 3L6OO 4R9SA 2VUSA 4WE3A 5TQVA 4O63O 2DU8A 3K96A 4U0JA 1R6DA 4OOFA 4BB6A 1MB4A 4K1LA 5DOVA 2VOJA 4DLLA 4YT5A 4XGNA 1MLDA 4A03A 1NVTA 1DPGA 3JD4A 3JQ9A 1X15A 3ITDA 3G17A 4GX2A 1VL6A 1CEQA 3INRA 3VZSA 4KTTE 1T1RA 2J3HA 3G79A 4B4VA 2O3UA 2AQKA 2CZCA 1E3EA 4ZQBA 3WBFA 3GGPA 4RF2A 1V35A 4J1SA 1VE9A 5ENDA 5JPIA 3V2HA 4E6PA 5BSGA 3UVEA 2GZ2A 4MVJD 1NX6A 3DZGA 4J7XA 3Q9NA 4Q39A 4UUMA 4B7CA 4WGGA 5LDGA 2J5QA 1W6UA 2HCTA 1KOLA 2AEFA 2HKIA 3WGYA 4B7UA 3U09A 3FTPA 3ANMA 4GLOA 1KVRA 4DLBA 1GZ6A 2IRWA 3WGGA 4ZA2A 1B0AA 1XU7A 1EK6A 2B4QA 2J6IA 2QIOA 2GF2A 1UAGA 3MEQA 4M89A 4OJNA 4PLHA 4A26A 5C7OO 1PJ4A 3DAFA 1CWUA 1PZEA 3GPIA 3NDRA 4BO7A 4RO0A 3BXXA 2OORA 3A1NA 4NU5A 4K6FA 1MFZA 2VWGA 4XEHA 1EE2A 4TMFA 2HRBA 1Y8QA 1E3IA 4LRTB 1E0DA 2W2LD 3BA1A 4MOWA 4OXYA 4MKXA 1VC2A 3WGTA 5JO9A 1U8XX 2ZB3A 4HP8A 3JYPA 4FCCA 1QV6A 1FDUA 2D59A 2OUIA 4LRSB 1DLJA 1KC1A 3DMYA 5I9LA 2VOEA 1U3VA 3MJCA 4MVJP 2VZ8A 3GUCA 3VVBA 3Q1LA 4I5GA 1U1IA 5K6AC 1UXIA 1ZW1A 2Q1TA 2HQ1A 4PLWA 2YHIB 1ZJYA 4ALIA 4DYVA 3N58A 3P5SA 4GL4A 4I5FA 5JS6A 3ZWMA 2QRKA 3BMNA 5KJCA 1OZAA 3A9WA 1EVYA 1BVRA 2PH5A 2FY8A 1R4NA 1H2HA 1FDTA 2HK7A 1O94A 3JYLA 3UH1A 4BVAA 4CV2A 3D5TA 4PLTA 2CUKA 4FFOA 2GCGA 5BNTA 1BVUA 3TZKA 5C7LO 1B3RA 1NPDA 2BGLA 3DQPA 4KDEA 3BMQB 1C1XA 1PGJA 2E37A 2UDPA 1B14A 4Q3NA 3K31A 3ZHYA 5IDWA 1GQQA 1DFGA 4ZD6A 4CM4A 5L7YA 4AL4A 2XAAA 5DZSA 3L9WA 1ZSVA 4FC6A 4XYGA 1B16A 4PZEA 2EF1A 2OFPA 2OOSA 2VCYA 5HRUA 4B8WA 3X2FA 3JQAD 3KYBA 2EP5A 3CZMA 4L8VA 4W7HA 1E6WA 4R4JA 5A04A 1I33A 1F06A 2E49A 4J4BA 4P4GA 4PLPA 2Q50A 3PIDA 3WFIA 5BSHA 4ALMA 4GI2A 4UUPA 1PS8A 4QTZA 3V2GA 3WYEA 1ZNQO 2QQ5A 3GPDG 4Q3AA 5A05A 5L3ZA 3RC9A 5I8WA 3S2FA 4ZN6A 4XR4A 4XYLA 4ROSA 4CPDA 4MP6A 4XYMA 1R0LA 3C8MA 1F17A 2EV9A 2GO1A 2ZATA 4NFHA 3RC1A 3ZHZA 2D5CA 4KTVE 4S3MA 1EBUA 1DIAA 4XKJA 4YJHA 4RGBA 4IS3A 1HE5A 1QSGA 3AOEC 3TWOA 5H83A 2VHVA 3JD2A 4DLAA 4D43A 2BFPA 2B83A 2Y1OA 1SOVA 5IDYA 4Q3DA 1NPYA 3D3EA 2YDXA 4JN6B 3EUWA 4BNKA 5U9CA 4J43A 4BS9A 4WNIA 3WGOA 4PG4A 1HZZA 2AHRA 2CY0A 1KS9A 3ASVA 2FZEA 4TVBA 3M1AA 3RBVA 2ZJ1A 4E30A 2P9EA 3ZV5A 4J9UE 3FF4A 2D5AA 3IAHA 4JK3A 1JA9A 1PJ2A 3HG7A 5F5LA 3I9NA 5B4UA 1U5CA 1Q0QA 3VPHA 1YOVB 2ZTLA 2FHSA 4GGPA 2B36A 4QECA 3NEPX 3W6ZA 1N7GA 4D46A 3GEMA 1X13A 2ZIZA 5GZ6A 1WAMA 3WLEA 1EFKA 1PWXA 2EG9A 2AE1A 4EGFA 2FOIA 3ZNQA 1PQUA 1LRKA 1H0KA 2AEJA 1YGYA 3I23A 4JJIA 3L6EA 3OMLA 4YJGA 3MJ4A 3VC7A 3DZHA 2Y0DA 4PG7A 5A9TA 4CV3A 4LGVA 1I2CA 4NFYA 1IY8A 1UXGA 4QT0A 1N9GB 1FJHA 9LDTA 4B4OA 4AJ4A 1LRJA 4GKVA 3KETA 3I83A 5GZ3A 2PTGA 3O03A 1U3TA 4YJFA 1CQJA 3QWHA 4DPLA 2YV1A 2P68A 3TJRA 1Q0HA 2X1HA 3KB6A 1CETA 3BMOA 4JGBA 3Q6IA 1YQXA 4HFNA 1DEHA 3QVSA 5K9ZA 2WD8A 1UJMA 2AA3A 3W1VA 3GN2A 1QLHA 2YY7A 3GDFA 2DTDA 3WQRA 4MJLA 2FPIA 3ZWPA 2HK8A 4ALNA 3OQ6A 4ZU3A 4D3DA 2Y0EA 3C7AA 3IUSA 3I3OA 2NU9A 4IJVA 2A4KA 1ADGA 2B37A 2D0IA 2TMGA 5IXSA 1E6EA 3TOXA 3T4EA 2XOXA 5FYDA 1YJ8A 2JD1A 1C1DB 2WE8A 1WPQA 4GKBA 2BHLA 4EJ0A 2O3RA 4L4RA 1DDOA 3ZV6A 2EKQA 1C0LA 3AI3A 3DZKA 1EQ2A 1XSEA 1GL3A 4JJGA 2TMDA 1IE3A 3GGOA 4OKIA 3D3WB 1DAOA 3U9LA 3AI2A 1U2GA 1Y9EA 3W4KA 2FR8A 1S7CA 3DTYA 4MP8A 4M55A 3CTMA 1AXEA 5FF9A 1LRLA 4DC1A 5L4SA 2HSDA 1ENYA 3PPIA 4BOYA 5KCZA 1ENPA 3BHMA 4EZBA 3JD1A 3K8ZA 4BUCA 3IS3A 2V7PA 3VKVA 1H9AA 4J0EA 4R5MA 3B70A 4TKLA 5F21A 1XWFA 2JHGA 5T6BA 3LQFA 2GD1O 1PTJA 5U4QA 2FSSA 2NSDA 4TZTA 2NVWA 1WNTA 2PZLA 2X4GA 2RHCA 4IUYA 5EIOA 4CQMA 3NDIA 3H3FA 1O6ZA 3WGZA 3RC2A 3LT2A 3IMFA 3ZDFA 2QZ9A 4MIOA 4MDHA 1LDMA 1WZIA 5MDHA 4J4TA 3MOGA 4LVCA 1IL0A 3RUEA 4R41A 2Y93A 1HKUA 4JIGA 1YONA 1ZFNA 4UEKA 3UCXA 2C2XA 1ISGA 3DC2A 3S55A 2BF7A 1QKIA 2NU7A 2O3QA 2GLXA 2NVUA 4IDEA 3E8XA 1ENZA 4YAEA 3WNVA 4KUEA 1F14A 4NBVA 4L75A 2EKPA 4I9UA 4MKZA 1NQ5A 4GLLA 2EWMA 1GYRA 4JBHA 4DPMA 2HMUA 3LLSA 3JQFC 3AU9A 2YQ4A 1NPTO 1P45A 3OIGA 1CDOA 4AJOA 4B3IA 3JYNA 2PD4A 3HADA 2IDZA 2PK3A 4GVXA 5TSDA 4CMEC 3IOYA 5L45A 2I76A 4IS2A 1B7GO 3FNHA 1U7TA 4P8RA 4BKQA 4WNCA 1TEHA 2YFQA 2Z1MA 4F3YA 1KY5A 3CKYA 5L7TA 1HLPA 4JNKA 1DC3A 2A9FA 1I10A 2VTEA 2X0NA 3GZ4A 4I1IA 1V6AA 4OMUA 1BW9B 1ZIDA 1G6KA 5ILOA 3GK3A 3DMTA 3GUYA 1AGNA 3JQ7B 4BNMA 3WGHA 4Z0PA 1X14A 3GLQA 1GCOA 4BGIA 4RPLA 2IEDA 5DOZA 3FI9A 4PFJA 1H5QA 1ZBQA 1JAYA 2BGMA 4XRRA 5IFLA 3M2PA 1ZK0A 4NNJA 2QX7A 4EJMA 4RPJA 3VHRA 1IHYA 1ENOA 1YL7A 4LVUA 3DR3A 3OIDA 1N5DA 1EZ4A 1Q2XA 4F46A 3PZBA 5JE8A 4XQCA 2W8ZA 2BELA 4IGEA 3ZHBA 4XGIA 1I5RA 1UZMA 1Y7TA 3AM4A 4DC0A 1TT5B 1P1JA 4CUJA 3KEQA 3AOGA 4E5PA 5JDIA 3GAZA 1D7OA 3AI1A 2NACA 2R6JA 4IDBA 1D8AA 2XPCA 4CLRB 2NUAA 3GZNA 3TFQA 4K9DA 4CMBA 1R12A 3WS7A 1Y81A 3WG9A 4E32A 4ALLA 1B15A 3SEFA 3DFUA 5CP8A 1MA0A 3VPGA 2DLDA 2YHUA 2ZTUA 1UXHA 3AFNA 5HWSA 3GC6A 3A28A 1R0SA 4H3VA 1C0PA 1NYTA 4HX5A 1E5QA 4YRDA 2BFOA 5C5IA 2OP0A 2EW2A 4HNHA 1GD1O 3F4BA 1R0KA 2Q99A 4RJTA 1E3WA 3QLJA 3K5PA 1U5AA 4NFSA 4IJUA 3JSAA 4BV9A 1U28A 3MWEB 3H6KA 3K2BA 3L4SO 1CQIA 1JKJA 3WWYA 4PIVA 2XXBA 6ADHA 1KEVA 3HZZA 1YE3A 4BV8A 3QRWA 5A9SA 1GR0A 4YT4A 5JFOA 3NGLA 1SO8A 4RVUA 1WDMA 4KDFA 3ULKA 4BGUA 1LNQA 2UUPA 4AJHA 3OJEA 2Y68A 5KNLA 1DFHA 1KETA 3K9QO 3RWBA 4HY3A 1TLTA 3EDMA 3NRCA 4XGKA 4PLFA 5FI5A 5EJ2A 2FR0A 3AM3A 4Y6SA 4CM8A 4H16A 3UAGA 1Y6JA 2PZMA 4U6QA 4AG3A 2Y05A 3OSUA 2O4CA 3IIEA 3ZWCA 1VRWA 2CDAA 1JDJA 5CPFA 1KVQA 5TJHA 1I36A 1T2CA 4WLEA 3U49A 1R4MB 3KVOA 1NNUA 3ICPA 3KHUA 2PKQO 1DIHA 3PHHA 1BWSA 1MG0A 3D64A 3HB5X 5F1OA 1PGQA 4Z6KA 3VDRA 1V8BA 3EC7A 4ZGWA 4OHUA 5T8KC 3FTNA 1DIBA 3D4NA 1N1GA 4HKTA 4B7XA 2DPGA 2JFGA 1ONNA 3C24A 4JJFA 4DQUA 3GEGA 4EEZA 1GPJA 4JCOA 4W99A 1IYZA 1ZK2A 1UP4A 3OQBA 1XEAA 3UICA 1U4OA 4IDDA 4URFA 4WCFC 3H9JA 3LT4A 5TF4A 4EUEA 4Y6RA 4C7JA 1RJWA 4L9RA 4E5NA 4IQGA 4L76A 1B8PA 1J49A 2P91A 4CMAA 1LSSA 3UHAA 1HDZA 4B4WA 4FGSA 4WJZA 3RUDA 4HUJA 3GF4A 3KYDB 4WEQA 3DAPA 2VYVA 2HMTA 2D8AA 2ZKLA 2UUOA 3CMCO 4FJ2A 4ND4A 5DP1A 4PLZA 1M66A 1X1TA 1OC2A 2A94A 3HB4X 4LMRA 4BNVA 4G65A 3V1UA 3DTTA 2FPPA 3I9MA 4AICA 4B4UA 4DQVA 4YYZA 2IYOA 1VJTA 2Z5LA 2DBZA 1C0IA 4D7AA 4E31A 3FR8A 4FR5A 3BTOA 4R16A 4OL9A 3NV9A 1GUZA 3TL3A 1UXJA 4B3HA 4IMRA 4WLNA 4OGWA 4CLOB 4B79A 1ARZA 1ZVMA 4BO8A 4N18A 1P9LA 2AXQA 4CM3A 4E4YA 4GX0A 4N5LA 4R1TA 3JQ8A 2GDZA 4NQZA 2X9GA 1HYEA 1VL0A 1W0CA 3KLPX 3KO8A 4JP3A 4XDZA 1A7AA 1GTMA 3WMWA 3NTOA 3H5NA 1ZEJA 4WLFA 2WEKA 4XJSA 5AVOA 2QZZA 2YJZA 3JQAB 4I9HA 4PG8A 1DBVO 3ZWBA 4PVCA 3TOZA 3EK2A 3TSCA 3L4BC 3ONEA 3O8QB 4OM8A 3L9XA 3WSVA 3H9EO 3OETA 2PY6A 3L0DA 1OMOA 4QUKA 4H7PA 4LCEA 5JMPA 3NAQA 4NPCA 1WLYA 2VT2A 2EJVA 2GSDA 4PGFA 1KVSA 3W8DA 5KVCA 1YQDA 4ZICA 2G0TA 4EITA 1GQYA 3AWDA 4Z0HO 1BG6A 4WUVA 3LK7A 5G0TA 2O3JA 4YAGA 5KKAA 2BH9A 5CEEA 1JN0A 4J49A 4E5YA 4UUNA 3HE3A 5T5QA 3U3XA 2HUNA 3DZJA 4AJ2A 4NH4A 5T64A 3HFGA 1K6JA 3ZZNA 5KJ6A 5EMHA 3FSRA 2C29D 1ZUD1 3B1KA 2Q2QA 3LC2O 4JQCA 4D41A 4GGOA 4DIFA 2XF8A 4D45A 3GVCA 3GVHA 4OOEA 5G4KB 3V8BA 4BKOA 2YW9A 1L1FA 3I6QA 4FSHA 4W7IA 1MC5A 4NK4A 1JVSA 3IQDB 4R3NA 5KJEA 2G76A 1FF9A 5IN5A 1R16A 4DRYA 3FR7A 1GEEA 3LF1A 2Q2WA 3ZV4A 2B4RO 1IUKA 3H9GA 2B0JA 4XR9A 2PR2A 3WSWA 1EBFA 1TT5A 5I7FA 1Z7EA 4BGEA 2R00A 2PA3A 3VDQA 5BT9A 5IDXA 1U9JA 4UVIA 3RAJA 5JC1A 3PWZA 1E3LA 1H94A 3RUAA 5I8ZA 4CLRA 2CF5A 3G1UA 1Q7CA 4IGFA 4DL9A 1V3UA 2B69A 3PQEA 4BO9A 4CMJA 3TRIA 4BNUA 5I7VA 5FI3A 3MOIA 3VVCA 1O89A 4U7WA 5TS3A 3ZV3A 4CM9A 1Z82A 2GN6A 1H6BA 5LCXA 3DWFA 1BXKA 3RQSA 5A5FA 4XB1A 1LLUA 2OGUA 4XIJA 1N2SA 3DBHA 2CDBA 4CJXA 4E0BA 3B6ZA 2YUTA 4E5KA 1NVGA 4QO7A 1JW9B 2HU2A 2J3JA 1A72A 2X9NA 4AVYA 1OOEA 4M87A 4TVOA 4QEDA 1YBVA
chains in the Genus database with same CATH superfamily
4JIMA 3ETGA 3M6WA 3ND5A 2F00A 4QOJA 4YS6A 1N7HA 1M6HA 2V7EA 2X77A 1ZHOA 2X3UA 3GRZA 4FHGA 1WUJS 1JDSA 2Z8XA 4NRDA 2CB9A 1X7DA 1L7AA 1G0OA 2F7SA 3NUGA 3KZXA 1S3SA 2JLBA 4S05A 1O94D 4CGYA 5EXSA 1USGA 3A9TA 3FJOA 2PS1A 5DWDA 4N5DA 3VR5A 3WMEA 3QJ5A 4GBJA 1DWOA 5ARDA 4D9MA 1II0A 2CVQA 1QPZA 1HDOA 4MRMA 1ULTA 4I1VA 1IJEA 3GLSA 3K1AB 2CN1A 4Q1CA 3EARA 3WI7A 5A4MS 3Q88A 1IBMB 2Q9AA 1GPKA 1QTQA 2II6A 3GLGA 2WSSD 3H9BA 3MGGA 3PHLA 5F52A 2MOKA 2LCQA 1ODTC 2WJPA 2X5XA 3C3KA 4I50A 1Q77A 1Q92A 1I3NA 2B3DA 4LZAA 4YBZA 2ZCJA 4JB0A 4M37A 3QOWA 3HUFA 5IF3A 1LZLA 1GXSA 1DXYA 2IH5A 5EPEA 3N7UA 2H1SA 3WWDA 2IJGX 3JAKA 5JBIA 4NCBA 3V4ZA 1Z2DA 2ZSJA 3HKBA 1VLLA 2W6JD 3VU3A 2E4VA 1C9EA 2RARA 4DAOA 1W1UA 2ZYRA 2XH8A 3U1BA 1RZRA 1J97A 1SURA 3OSZA 3Q3GE 1RU3A 2I33A 5IZCA 3WP1B 4F2WA 2H07A 4D3SA 4G24A 2BFBA 3M6IA 4K6CA 4MS4A 4N65A 1EFHA 4OKNA 3ZHOA 2K2WA 5EJ6A 1NONA 1V26A 4HV4A 2BMAA 4NCJA 1N2CA 3Q7QA 5HTKA 4MRRA 3EEOA 3ONNA 5IP5A 3DE1X 1VPDA 1F7UA 1L8OA 4ND3A 1YBAA 3QP9A 4BNDA 4C43A 2JIOA 4QBHA 3VBEA 2OCDA 5JYDA 3E84A 4DMHA 4FOOA 1LEHA 5H8WA 2VSYA 4TT3D 4F91B 3DVQX 4B3JA 3HSSA 2VDWB 1PG0A 2EQBA 2O8NA 4WSOA 2NSYA 1GDHA 4KX5A 2FPKA 4WKBA 4IUDS 3ZHTA 5ER6A 4YQZA 3DB2A 5AQ1A 2YW2A 1F0YA 3CEAA 1JKFA 2J6HA 2RSLA 2Z8YM 4TTTS 5AKHA 1KI9A 1Y0BA 3ZE7A 4R54A 4DA4A 2IYUA 3BQMB 4P4SB 2VXBA 2YXPX 1EFDN 1Z5ZA 2V7BA 4CEJB 1HFWA 1T1SA 3C6BA 2ODQA 2Y9MB 3F0TA 3AHGA 3JVVA 4FOPA 4HHEA 5ALGA 4RZHA 1T8TA 2GPTA 5LMNB 5DK6A 4BJ5A 2WHXA 4OGFA 3TB4A 5BUCA 3A1TA 1LPNA 3GMTA 2Q2VA 2XNHA 1EXNA 3UJPA 4TWBA 4P4LA 5EYPB 4DNXA 2O2GA 5DTRA 3V80A 3A8TA 1K06A 3M1YA 5FEUA 5DBFA 3F1LA 3M49A 5KVAA 4YV1A 4RUKA 3AR9A 1NW5A 3RNOA 2HT1A 1D0VA 2NZXA 5B64A 5ES4B 1RTTA 4TXNA 3INNA 4KKVA 3PQ7A 4GI7A 2X5NA 2HF2A 4OK5A 4Z5XA 2VNIA 1TMKA 3GB9A 4F3TA 1AXGA 4Y9SA 3B1FA 3H4IA 3PNKA 3LXMA 4L7QA 4QNNA 4ZREA 4CKXA 3UAYA 4CQJA 1J22A 2J45A 2QDKA 4I6JA 3C4VA 5K3CA 5AICA 3IV6A 3CO5A 4D74A 4YNBA 3C16C 1OILA 5CDYA 3DHYA 1X7WA 4X6LA 4CV0A 1MJGA 5SYAA 2M6LA 2CDRA 4N40A 2FUCA 3NVDA 3SYNA 4EDHA 4EMBA 5CFNA 2XRMA 3O8OB 4D42A 1CDEA 3LSYA 1XTVA 1F4PA 3V3TA 1DUIA 1UJNA 3AJDA 1I5OA 1HLFA 1T24A 3M9LA 2LE0A 5E4TA 2FW0A 4K05A 4D6YA 3L5KA 2OV2A 2Q4TA 2FG6C 3ZWQA 4RZSA 2LVBA 4CQLA 4EMUA 3IVXA 1B93A 5ALIA 3FNGA 4BECA 2NT4A 1MDBA 2EJBA 1GAWA 1HM5A 1NXTA 2LRHA 2OO3A 2P3LA 2VK4A 4XCQA 4Y9TA 3U0VA 4UVHA 4NJEB 3NETA 4G0ZA 4HTFB 1GCGA 4E4TA 4CLEA 4HH0A 5LIPA 2YV2A 3ETEA 3OMWA 2PBZA 4J91A 1D1TA 1XMJA 7REQB 1T9GR 1R9JA 4YRTA 4V1CA 3RI3A 2RH4A 3WNZA 2B94A 4Y2XA 4ZXFA 2ZAYA 2VQ3A 1NUUA 3T95A 3IUPA 1L8AA 2X0RA 3B1WA 3V42A 4NMMA 2B34A 4NZPA 1EWRA 4M7PA 3CJTA 5TMEA 2DY1A 4A73A 4AX4A 3U4AA 4EDFA 3SR4A 1TZMA 3LC1O 4AZ0A 4RF4A 1NFRA 2A7QA 3JZMA 4KQGA 4CKEA 1JHOA 1N5LA 2FDXA 3OPQA 4C6SA 1NTRA 4TYWA 1MJFA 3SJCA 3GNSA 2QVLA 2BBWA 3HY3A 4XDYA 2XCIA 5IAGA 1QCCA 1RD4A 3K09A 3QWFA 4QRDA 2NN3C 4WUTA 4BFYA 1PLKA 3WIOA 1SHJA 3A9UA 3D2AA 3L2OB 3U3JA 4R84A 1OZGA 1T8UA 2GYUA 1HDEA 4O2BB 4PPNA 3DFKA 1JEQA 5JXJA 4HDSA 1PT7A 4G07A 3U2QA 5ALUA 2JBHA 1YV9A 2GK4A 3IT3A 4MHOA 2VHJA 4UM9D 2GASA 1N6IA 2FB9A 4DNQA 1H4SA 3DPUA 1QBGA 2W2TA 3UT0A 1OFUA 4I3HA 4H7KA 1XROA 2X7HA 2X2PA 1QPGA 3SSNA 2OYCA 4PXAA 2VWQA 4IZOA 5FWYA 1UANA 4QOGA 1U7XA 4CQMD 3LBIA 1ID8A 3ETDA 3NHFA 3DEJA 3DS8A 3PNOA 2HNAA 1BYIA 4J1NA 2CMKA 1FDWA 4JJKA 5JQGB 2OORC 2OK7A 4C6TB 4ZCIA 3E7DA 3D1JA 2X2OA 1CF4A 3W5IA 1NBME 4Z7NB 2Y9PB 2YH2A 1PV2A 4CTKA 2JKYA 3C3YA 2C1XA 1TT7A 5CA1A 4EPTA 1D4FA 2DUWA 5CX4A 1KAEA 3ZTYA 4MQ4A 2C5AA 2GCPA 2HA4A 1WXGA 1GA4A 1CJMA 3IIMA 4REMA 4TYYA 5AXDA 3PXXA 4YV2A 4M1KA 1VHDA 1Z88A 1JHZA 4W9RA 1UFQA 3HGQA 3H4VA 4YB8A 3WL8A 2NV6A 3WDSA 3AB3A 5KSZA 3AKZA 4R5HA 2OV6A 3SLKA 2QZSA 4JT8A 1B43A 3OHSX 5CDTA 3GLIA 3Q11A 3AEQB 3HDYA 1E0AA 3PYLA 1NVMB 2QGNA 4G67A 1T8SA 1GZUA 4B34A 2VAXA 5A62A 1DV2A 1QH0A 1X0VA 3RCBA 2GWRA 1RZ3A 4ESOA 4ZYVA 1V11B 4N5NA 3UJ7A 2O7SA 1F2UA 1A2KC 2V4UA 4F4JA 1ZIXA 3H5AA 3AKYA 4GSLA 4JYPA 1V6SA 2Q3DA 5DWVA 5AXCA 1FDSA 1RKQA 3TG8A 6LDHA 3EN0A 2ACEA 3U5ZB 4D96A 3J80A 2XUKA 3SQMA 3GJ8A 4QODA 1OGYA 3O3OB 1VI6A 3FN4A 3HDTA 1O94C 3KJGA 1SKYB 3Q7PA 5DP2A 4IHJF 4XTRA 2FSGA 4JJAA 5I45A 2R6DA 1K2WA 4LNUA 5FOWA 2Q29A 2P65A 3K0AA 3MCAA 5D3MA 4MR8B 1S3IA 4M60A 3TIIA 3TPFA 4NWIA 2E4UA 1WOYA 2KMLA 5DT2A 1H2YA 1Z12A 3JQBA 5B3JC 4KE7A 3ER9A 1OTYA 1VGRA 3AKCA 3L7IA 1NXXA 3PK0A 4QIHA 3E6AA 5C1BA 2HEIA 5JVDA 3WADA 4PZDA 3VPAA 2WA2A 2ZRHA 1ZCBA 1IY1A 3AVQA 3GHYA 3HLYA 3MLBA 4L6CA 3AZQA 3JV7A 1BEEA 3QWBA 2J5RA 3G82C 1MXFA 3A6DA 1FQKA 1VPWA 2BI4A 1PZNA 3MIZA 1FXSA 5HKKD 2P35A 5JSYA 1T8RA 4RS4A 3WO0A 1A8IA 2D4HA 3PEFA 1FW6A 3MC1A 4UCWA 5JALA 4HB4A 2ESRA 4MSUA 4QTUB 3OO1A 3R6LA 2DE0X 4ZQGA 1E2GA 4FKZA 1Y8RB 3BBPA 3C7KA 3MFYA 1G41A 1T0UA 3WB2A 4MAFA 3L6DA 4MV0A 3ZVNA 2W2KB 1U8FO 2FWPA 3F46A 5LP6C 3B2NA 3HCEA 3O9ZA 1IOVA 4NAVA 5I7AA 4MW7A 3NIDB 5HK9A 3ADBA 1WBBA 3EOBI 2H2WA 4OREX 2JHFA 1WDWB 3KZOA 5L51A 4OYHA 2IL1A 4TZ0A 3C5EA 1LX7A 2ZUDA 4DCUA 1RQRA 5AJZA 5DX8A 1T2VA 5F73A 4KIJA 4DYDA 5IKMA 3IUYA 4ND7A 1DB3A 1X7XA 1NIPA 4B3CA 4TWIA 5KVVA 1XZIA 1C29B 121PA 4DFDA 3LQKA 4NU6A 5AW4A 2MYTA 2O05A 4D8TA 1QGAA 1K1EA 1WCIA 2O48X 1ZQ1A 1RFGE 4DIUA 1GV1A 3R74A 3I64A 1KU0A 1N4DA 2REBA 1A4IA 2Q3BA 2BC9A 2CMDA 2EBHX 2IODA 2LW7A 2VJBA 3GUVA 4L4ZA 2D2EA 3AEKA 4CMKA 4TKUA 1KZGB 2HEGA 2HU8A 5LDHA 1MRZA 1B23P 2R1TA 1AO3A 5JS2A 3V33A 4ZWNA 4E94A 2W7TA 4CCAA 1SBYA 2Q5OA 2BJWA 2I71A 3B85A 3FTQA 5HF5A 4KPUA 3RJ5A 2XXAA 3F96A 1FDIA 1XKQA 2CJFA 1E4VA 3G3EA 3REFA 4C4PA 3WLRA 4KUGA 5CDSA 2J33A 4RD4A 5FH9A 4RQUA 4TLDA 3CEHA 2WG1A 3T0FA 5IG2A 5JEEA 1W2GA 1KARA 1T1EA 2VFAA 4LOKA 1WDKA 1AURA 1K5DA 2QOEA 2RHHA 2BD0A 2JRLA 2PGJA 4IMPA 3K4PA 1E3TA 1U9CA 2FP4B 2VJQA 1KO4A 4LYHA 1UT8A 1JDPA 2HRCA 2WZCA 4R1LA 3E7FA 4TWJA 2I4LA 4O2BF 1ISPA 2XUOA 4YUZA 2NZVG 4GX5A 3WA6A 4IP0A 3PDIB 4PLGA 2HJVA 1X3LA 4NIMA 3PI6A 2VK2A 4QXMA 2J6BA 1KQNA 3IAFA 3OFJA 1H2BA 1QP8A 4TSKA 3BH0A 4M21A 3VO8A 4HB0A 4KSCA 2I6SA 2IDMA 2SKDA 2F1HA 4FDLA 5DF1A 4A16A 4LWPA 5U4XA 4RCYA 4UAGA 1C0KA 1AA9A 4IUCS 1YDMA 4IOKA 1OF1A 2BTQA 4PLCA 1ZR4A 2RGBA 1IBRA 4J0CA 4K8RB 2YMMA 2WVAA 2HHLA 3NKLA 7ADHA 5AVYA 1UM8A 5JZVA 1ONBA 1ZDMA 4XSGA 5ALTA 2XMQA 4RA9B 5SYNA 3T5BA 2R6CA 3IQWA 4UZEA 3CS3A 1YKSA 1MV8A 3LQRA 4M0EA 5BWCA 1G7TA 1WF3A 2O6HA 2OBNA 2ZYHA 1Y5IA 4MMYB 1LBTA 1QYCA 1QFMA 3IEKA 4L4YA 4AZWA 3FYTA 4JLSA 3U7EB 3JWEA 5KKNB 1XNQB 1L8LA 4AJNA 1G3RA 5A3SA 3AVVA 2QVBA 4ZVNA 3WYDA 2Z8ZA 1QFXA 4NABA 2ZWOA 1T0HB 4Q37A 3L7MA 4XVCA 6Q21A 2P9QA 1Y9AA 1QVZA 3EC2A 4IIVA 4GICA 5M34A 1NC3A 4Q7LA 1VJGA 3LF2A 5MN6A 3V55A 1OBOA 4JQSA 1YRWA 1ZJJA 2ATCA 1Y8QB 3L8MA 2HCFA 1J2RA 4N3AA 5EIAA 4BMCA 4QTYA 2IUSA 3UJBA 1IC6A 4RIGA 3LUKA 4YBRA 1AXRA 2G9VA 1JAIA 3DHWC 2RDMA 4DMMA 4LFBB 2F8MA 3AFHA 3ROTA 4DMGA 3FOZA 1IUPA 3FPHA 3FMGA 4D9NA 3BREA 1V39A 4P7FA 5HK8A 4OI4A 1Y89A 2RGNA 1QIGA 3PWKA 2HT6A 3W3AH 1JZSA 4MQFB 3M6MD 4ZDJA 3DFZA 4TTAA 2FR8C 4KPGA 3RNLA 3IBGA 1TAGA 4HBGA 4MR9B 1T2AA 1US8B 4H0FA 5K6AA 5DBGA 3EZLA 2W6ZA 3ACBA 2Q5QA 1E8DA 4GPZA 4OYLA 4IV0A 4R1SA 5DM2A 1OZHA 3UT5B 3ZLBA 1CF2O 4DMCA 3PUXA 4LIPD 1M5TA 4FHCA 5DIFA 5JD4A 3D4IA 3U4GA 1W96A 3N2YA 4WBNA 1K4KA 1C9KA 1G6OA 1I2MA 4PQEA 4QTXA 4XYEA 2I78A 5AUPB 1DSSG 5I5EA 2V5AA 4KW7A 1QTNA 4B3XA 2YDYA 2E5FA 3PGXA 1YZYA 3MB8A 2C5GA 5CD1A 4YLGA 3RYCA 2WVJA 4WK4B 1BKSB 2P4SA 2YVKA 1FYFA 1TZBA 2H2FA 3D3QA 3DE0X 4XH9B 1JU9A 2PBLA 2H9IA 1JJVA 5G1PA 4NOJA 2XMBA 4RDXA 3JD0A 3WYAA 2O50A 5LA6A 5L53A 3M4XA 3T3DA 4YHHB 3IPYA 5T4BA 1IEVA 1RWKA 3GN1A 4GH5A 4JLPA 4YACA 4YC7A 3ENQA 4EB8A 4FFLA 3AJAA 4N5IX 4PTLA 3TX6A 1U0SY 3L0ZA 5DMXA 5CEFA 3RADC 4KRYA 2ZDHA 3ZDQA 4L73A 1TYCA 3P5BA 1BCRA 2DQSA 4E6EA 4HWOA 4WGFA 5D6NA 4HX2A 1MKYA 3QNWA 1SC9A 5EN4A 5GVRA 3RIGA 3ZWVA 4PFQA 4N0DA 3Q0EA 4RMIA 4RK5A 2ZBEA 4RYLA 3OP1A 4C03A 2EGGA 4EY5A 3S3TA 3AT1A 3UH0A 1TVCA 3QKRA 1VB5A 3AP2A 3JX9A 4DUZB 5KNBA 3FPLA 3G2HA 4XJVA 2A9RA 5D7NA 2BJVA 1DX9A 2F3QA 4F1KA 1J9ZA 4B6FA 3IKVA 2A14A 3DA8A 5I9NA 2HA2A 2HMYB 2V98A 1GGNA 3O8LA 4V0LA 5HA5A 2Q62A 2O06A 3K2QA 2O59A 1B8NA 1K3UB 1Y9JA 2QZJA 2RCNA 2PMDA 3F47A 1IY9A 2WYIA 4MEBA 1VJRA 1LFAA 2QUJA 1BZYA 2X4DA 1D2RA 3ENWA 4INOA 2AXPA 4YAUA 1WZEA 1QGDA 3HBAA 3R5SA 2ANBA 4DADA 4L57A 4J90A 5AP9A 1C2TA 1ZONA 3L0CA 4QDTA 4A15A 1ZM7A 2VK8A 2FH5B 4Y1FA 1T25A 3OT1B 4YALA 4ZYWA 3L8DA 1UQRA 1T1JA 4OQ4A 4EKIA 5AI0A 1CBUA 2ZZMA 3DHNA 3DMTC 1DGQA 4MH0R 5JNWA 3IALA 1DRUA 3DV2A 1BMDA 2WWXA 1EFPB 3QJGA 4P93A 5I8PA 3LUDA 1A9ZA 1L7NA 1MOQA 4H08A 2O6LA 1DDIA 1PJBA 3OURA 4JUAA 3DP7A 5B37A 3UC5A 4I08A 4II7A 3SC2A 5ELXA 5K5EA 3ZU2A 4QU0A 2PGIA 2HDNB 4MYHA 4MYCA 1M2VA 3RSFA 3Q7EA 3L1UA 2R7AA 1GT6A 3OEEA 1IPEA 4PC3A 4LRXA 5BUQA 3WB9A 2B4KA 1JQAA 4KP7A 1Z2CA 4LI0A 2BPOA 4WA7A 3X1YA 2P6RA 3FNFA 4Y6LA 5DRYA 3PTAA 2G1UA 4WCDA 4JLMA 1SH7A 4G0XA 1XZJA 4X64B 2YZ2A 1MV5A 4ER3A 4NU0A 4NICA 3WV4A 5F7JA 5TQJA 4D92A 2OM6A 3WYGA 3SYKA 4BFXA 4ZDIA 4AULA 3QYJA 1CDZA 5DYWA 1RRVA 3NKVA 5BV1A 3I52A 3NHPA 4IIXA 5ITZA 1G21A 1OHHD 3UAZA 1IDN1 2W4QA 3HWSA 4OMFG 1F8UA 5KWEA 3OFKA 4Q15A 1XMVA 2W8BB 2WFMA 5KHAA 3UA4A 4MICA 2ENWA 4MV5A 4J6EA 1Z15A 4JBGA 3VKHA 4C0LA 2F9MA 4KI0A 5HIAA 2IXDA 2KLHA 3V7NA 2BMWA 1RLJA 3I04M 4NENB 5TT1A 1Z5VA 5DLPA 1BFUA 4IIJA 2XCLA 4PHGA 4AAYA 2GTIA 4TN1A 1HEYA 1L5LA 4W5JA 1OLSB 2JGRA 4JVLA 4PG5A 1H0HA 2AVNA 1I3KA 3ESRA 1EYZA 1G2QA 3A32A 1EE9A 3X1WA 3EAGA 3G8DA 1NKTA 4LMPA 2NU9B 1W8DA 2FPOA 3DL7A 4QM6A 3AF1A 1NYLA 3B8EA 4H3HB 2QN3A 4MKFA 1CS4C 1HDGO 3MUFA 4QXQA 3UAWA 4AURA 1KIMA 4MAMA 1M2OB 4UCFA 1XKXA 3OJ0A 4OXRA 5EC8A 1CEXA 1DO2A 2QTBA 2R96A 4N12A 3ZYZA 3E22A 3ZCUA 2D0OB 1EWKA 3TTXA 2OBYA 3FGOA 3Q87B 2RAFA 3MAGA 4UW9A 4Y18A 3IILA 3J7TA 5C8YA 3ZDXB 4M8IA 1QH1B 3ML1A 1FFDA 3CZ4A 4FE3A 3HWX1 2JLYA 4MB0A 2Y1LA 1JLLA 1O03A 4J3JA 1WBJB 3GFBA 1KC3A 4IM7A 3F1KA 3FVTA 2E82A 1PT9A 3EA5A 4JL5A 4JYCA 3GG2A 2D4AA 4EJFA 5KBYA 2WHEA 2YWXA 3KKNA 3PU6A 4CUKA 3AB7A 1XCMA 1KZ7B 2AFHA 2XUAA 4ZOAA 3ROPA 4B6SA 5A2GA 3C85A 3PUIA 3VU0A 1U3WA 3JVIA 4EL5A 1KYYA 2E2WA 4BLWA 2X8WA 2RHWA 5LQMA 2BGJA 1JR3A 2ONKA 5JFTA 1RVDA 1FFGA 1RP1A 5K3OA 2AKEA 4J7AA 5FBWB 1NMXA 4I6GA 5GM1A 1GSIA 2R1VA 1Z4QA 1YS9A 3G2LA 3ADPA 3K72B 4MVJA 5L3VA 2JHAA 3H1BA 3KTAB 3ONFA 4TUYB 2AR7A 2OOKA 2X5KO 1Y4ZA 3IA2A 3LE8A 5HIMA 5COQA 5A4JA 2J6CA 4OIFA 3UO8B 1GCAA 3BE4A 3L0BA 1A8QA 1D3AA 3IAEA 1QKKA 3PUHA 4DLWA 4GKKB 5INTA 2I6GA 1FNMA 5DCUA 3FWHA 1CLUA 3GVXA 1Z7YA 1RXUA 3IRUA 5DKFA 1EJ6A 4JR2A 3DE2X 1RRMA 2J4DA 1ZGBA 4A4DA 2HFJA 3I5AA 1A9XB 4RFVA 4RVDA 7AT1A 2C20A 3IMCA 4FOSA 2PO7A 2KB0A 1VKOA 3MLAA 1RM4A 4KQWA 3F9CA 4WWHA 4BWFB 2XMRA 1TDJA 2XWSA 2RG1A 3K70B 3N74A 3TO5A 1ODJA 4YR7A 1K6XA 2IXFA 3K30A 1EU1A 1Q1NA 4WZAE 3TDNA 1WNFA 4MIEA 1M2EA 3ZKWB 4HWRA 2PKRA 4PAGA 4HYEA 1NXQA 4KXUA 4FFVA 3Q1KA 3Q3VA 4YJDA 4CR6A 1I6KA 1R74A 3P2YA 4CL8A 4FN5A 2A0FA 3NHBA 1W0KD 3NT5A 4AMZA 4ZCRA 2ZSHA 2BI8A 4GBGA 1O2DA 3JPYA 4GF5A 3RFVA 1XCLA 1ZJ5A 2IEYA 4QVIA 4QNMA 3FHJA 2X8BA 1UPTA 1SVLA 2GN9A 2LUOA 3GD7A 1MVLA 4K81B 1W19A 3JQGA 3K1ZA 5JLAA 3SSOA 1VYTA 3VBCA 3TBHA 1WU7A 5HX7A 4CDGA 2UUAB 1Y1TA 4BZWA 2GXAA 4XW2A 1R64A 4H3SA 1T9CA 5C18A 1WMSA 3WJAA 1O1YA 3L0OA 2C2HA 3I5UA 3JQFA 4KZKA 2HDHA 2ZRGA 3LWNA 5D87A 1PJZA 4TN5A 5EIEA 3GGDA 2E6UX 3BERA 4ETIA 1Y9DA 2KI5A 2MSDB 5A3JA 5A7FA 4YR9A 2ZREA 4ZIRA 5CLJA 2RH8A 2OQIA 4KR2A 4Q1FA 2OGWA 1B8UA 4IW3B 4K28A 2BGGA 3SXUB 2QMEA 4ZCQA 2O4UX 4FJ0A 3NONA 2QWXA 5KHOC 4RQBA 4G9EA 4IDPA 1FQOA 2AR9A 2QT1A 1B4DA 1RJFA 2PGLA 3KFVA 4AD8A 2D0PB 4QO8A 1CVIA 1R7RA 5K0EA 1QHSA 4ALJA 1RWXA 1CUYA 2R0QC 2CBZA 2C2ZA 4QVKA 5AW0A 3QW4B 5BOVA 3T5PA 5IJAA 1SGWA 3CR8A 3NGMA 4LV8B 3MJSA 5CB4A 2IYNA 1P9NA 2WHQA 4R2WA 4PINA 4GAEA 2JD0A 3N76A 2R4UA 4I1YA 5T4FA 2CFSA 4JB8A 4BNWA 2BI7A 4ZJZA 4MGIR 1XMOB 4TRMA 5IABA 1O0CA 4LDPA 3VOTA 5D6OA 3V8QA 3HYSA 4AQYB 3O90A 1SVSA 1EVZA 2RHRA 4EG6A 13PKA 3AJEA 5I7FA 2P9FA 3QBTA 3JQAA 5IDQA 5DNYB 1CYEA 3ZS9A 3ES9A 3WK7A 1XTRA 5C32A 4JYZA 1BX3A 3LFHA 2AZMA 1V5WA 1Q7GA 1X1RA 3OE7A 1IOWA 1ZXLA 4L07A 3CX6A 1CUDA 2BUCA 4XDHA 1KYIA 5AK4A 1YA6A 1HDCA 1EFCA 3HCOA 4J94A 4YXWD 2Z8YA 1QLJA 2PV7A 4O2AA 5CX1B 4FWTA 3FRIA 4G41A 2D1TA 4R05A 1CHDA 3FNRA 3PJGA 5A6SB 4MQEB 5CNMA 3NXKA 1XYGA 5EXXA 5BV7A 3VNRA 3BGOS 2IYWA 3TVTA 1SU4A 3RF7A 3H1FA 4M8LA 4M6WA 5J2TB 2PD6A 2C61A 2OD9A 1NN1A 2W48A 2IKSA 4IILA 1EB8A 4UEJA 1E1DA 2GMWA 2C00A 2JJ2D 3TPCA 2WWWA 3PR1A 3BJIC 4YMVA 1OXTA 3WL4A 1M1NB 1OJLA 1WUYA 3BXZA 4NVRA 2QYHA 3K9GA 1E64A 2BEVB 3MWYW 2XT9A 1XCJA 1J1ZA 3OEWA 1H4QA 2WY2D 1FPMA 1K6IA 2GBCA 3UPUA 5KO2A 1E7SA 1YH3A 4O0MA 2Q28A 1TC1A 2FR1A 3DE4X 1MORA 3VPBA 4A36A 1BOOA 3DL0A 3SMQA 2YWRA 4B6EA 1RWNA 3A4MA 2PIDA 2X0DA 4AU1A 2GYWA 3ZBTA 2BEUB 1VSVA 4ZZ3A 1W49A 2NTYC 1PFKA 3WLLA 4DGSA 2WFLA 2CNKA 4AJ1A 1ZCZA 4QGAA 3GV0A 4WDRA 2UUBB 3TMAA 1BU8A 4OU5A 4Z0TA 4F5YA 2IYPA 4DRXA 1QZXA 2CL7X 2I7DA 5LZ9A 4EJ6A 3HRIA 3G88A 4PBTA 10MHA 1ZM9A 1B2LA 2HF7A 4WN9B 5CYPA 1JKJB 1OAOC 2QE6A 3DAGA 4OHVA 2XGOA 5D5QA 3W2EA 4KOEC 4QA9A 1CY4A 3KUUA 4ZOLA 2AMVA 4U7DA 3ZE1B 2Q5EA 1WXDA 4H15A 1U1GA 1QAMA 3RBAA 3SQDA 1PHRA 4L0MA 4MWCA 2JD2A 1H22A 3C8UA 4MWTA 1E1RD 1UPBA 3WWOA 3HA3A 4YH1A 4TMWA 1YVEI 4YTEA 3WLAA 4D0SA 4ML3A 2QJTA 3GP3A 1EP2B 2GRUA 4UXIA 3H11B 1KYVA 4BO4A 2HAEA 2C9OA 3BAFA 4O4LF 1DAPA 1YCGA 2E87A 5BN3A 1SIWA 1ZK3A 4M46A 1KJ9A 5CR9A 4QGBA 1M34A 2QYOA 4J2TA 3AMVA 3KPWA 2F55A 5ER9A 5A4AA 4GMXA 5DBEX 4EY8A 2QPTA 1FNCA 1X1BA 4BMNA 3EWIA 1TZJA 4QAQA 5H81A 4CMIA 4F56A 4E07A 2VUUA 1TAUA 5CJJA 2VATA 1DJPA 5D85A 4DDWA 1QFSA 5J9FA 1NDHA 2GRAA 3V4SA 5KWIA 5ED4A 2Y2UA 1HDRA 1ECGA 3DEYX 1P5JA 1LC0A 4FDTA 4V2UA 5LLDA 1U1EA 3U61B 2JLWA 1EIWA 3RIMA 4C06A 4ZAXA 2QTFA 3ZD7A 1JB1A 4NR0A 1QRSA 2BM8A 4J1QA 5IU6A 1OWLA 2YJ6A 3LRPA 5ALVA 4A0SA 1IJFA 1KBZA 4CMGA 3U3ZA 3U4CA 1Y4SA 4UZFA 1WW3A 1UKCA 3W8EA 3GG9A 5FI0B 2B2NA 2HMVA 3B36A 5K03A 2WZBA 4Q3KA 3RU7A 1QAOA 1J7JA 4UBLA 4A8TA 2YZGA 4EKGA 1YS4A 3R5HA 4L27A 3F5QA 2P7IA 4PCUA 2VH2A 4OP2A 3KUKA 3WRVA 4F86A 5M2QA 4KWTA 3UMBA 1HYBA 3IDFA 4BJHB 1R5JA 2R1ZA 3NHYA 2JGLA 3HC7A 4OAPA 3SS8A 2WINI 1SEPA 1X8LA 3K3PA 3Q41A 3SFZA 5AM3A 4ER0A 1AU9A 3BS4A 4AB1A 1E2LA 4UUOA 3ZUPA 5HGXA 2X2EA 3CO0S 2AW5A 1RLUA 2I4RA 2UZ1A 2XE7A 3ISVA 1SD1A 2CUTA 2PX2A 4IX9A 2DHQA 2FPMA 2OG2A 1DV1A 2UVPB 1KI4A 2F3SA 3IDZA 4UASA 4YV0A 1UQTA 4QSMA 4PO1A 4JLNA 4UM7A 5IBCA 1TX4B 5IX8A 2UAGA 4GI3A 3CW9A 4IMJB 1IVSA 4RZQA 3C3DA 1RRPA 1EAYA 4YMIA 2F67A 3IPRA 5BSVA 4MDYA 5CCDA 1QQAA 3WWZA 1E59A 2FX2A 2JGEA 2PL3A 1JF8A 3BWYA 4YEDA 5IVDA 4EG3A 1EHYA 5ISMA 4FFPA 1S2GA 2B1QA 2ZR9A 2ZGVA 3IJ5A 5C1PA 1IFXA 4TQUS 5J23A 1ZSNA 3MQFA 3VSEA 3IA7A 1NBMD 1CZNA 3P9RA 4ZEXA 4EFKA 5ALSA 1LDGA 2R3SA 1QRUA 3OCYA 1A5AB 1J5XA 3UCEA 1ATZA 3BK2A 5DTJA 1B8VA 1TUBA 4Q9LA 2KLBA 1F2TB 4NJMA 2J3LA 1Z2OX 3OU7A 1K9SA 1PT8A 4LVNA 3CX7A 4TOIA 1U94A 3E9DA 1EA7A 1Z0UA 2QYSA 2Q3HA 1W9MA 3H1AA 3CINA 4C7KA 1D03A 3DM5A 3ADCA 1RE0A 5J2TF 1CY7A 2J0UA 3DGEC 3F3SA 4WZBE 2QD4A 4QLBA 3KFLA 5B6IA 4LK3A 4CUZA 1OWPA 2P2NA 3HR7A 3UJHA 3P0FA 2MDTA 3RR2A 4FIZA 4D1YA 3WYCA 2A9JA 5TQ0B 3SX4A 4Q82A 3MINA 2FOLA 3MTQA 5LQCA 3UQZA 3WLTA 1NBEA 4CF4A 1IVNA 1DT5A 3VA7A 1SELA 3GZJA 5JDCC 1YVRA 1H65A 1NNI1 3VR6A 1RTKA 2GJAA 2JJYA 1B6SA 4G5OA 4YQEA 5U1PA 2GO7A 1X7ZA 2VN8A 4JX8A 1PS0A 2GZHA 4MWGA 2G88A 5JD5A 3W5JA 2VRBA 2P2DA 3LUPA 5LSAA 4BFCA 4BBPA 1HT0A 1XL0A 1P3DA 3LHFA 1C4WA 5NLLA 3E3MA 4DA8A 5K8UA 1PU2A 1AT1A 3B12A 2CBGA 1DQNA 1HNNA 2CDNA 2LCFA 2RGCA 2V55B 3MRXA 4KLZA 3C43A 1FUUA 2VDVE 3KJQA 5B7NA 4BEWA 2XECA 3ZVLA 3TQFA 1CB7A 1CIVA 1MX1A 2P9HA 3LS2A 5I9BA 4B5LA 4YX9A 1I7QB 3WQHA 3NVMB 4J7UA 3KCQA 2C2WA 4Q4JA 1IN6A 2R85A 4UHHA 2DLNA 3PDCA 3SU8A 4MUAA 4X6YA 4IGIA 2YZNA 4YUWA 2V7UA 2WE7A 2Y1EA 3B38A 2Z2IA 3TZEA 2DOKA 4HADA 4EVRA 5ICSA 1T8PA 3GBPA 5G0SA 2CMGA 3UW3A 4C5CA 3OJFA 3CY6A 3IT1A 4I4CA 1I51A 3QU5A 4J16A 5DBHX 3BH7A 5JNSA 1SMKA 3QFFA 3BCHA 3FPEA 1OPXA 1KDVA 3OIUA 1WXFA 4QC2A 2XYRA 5EERA 1ZD3A 1AKNA 2PEZA 3K7EA 2MSWA 3AW8A 1N2GA 2XGGA 3NHSA 1I30A 4MW5A 3A0UA 3VSBA 3CR7A 3ROKA 3I42A 5ADHA 3CPSA 4I4TB 4U2FA 1RLMA 3EDYA 1SKYE 1U3FA 3WGMA 2NPOA 3P4XA 2EFHB 2DBRA 3QKSA 4HDRA 4BO0A 2FEKA 2DR3A 4YMGA 1I32A 2VF5X 3ANTA 3I9LA 1GGEA 4DEYA 4G6ZA 1DO8A 1T1GA 2G28A 2L18A 1GTSA 2I1QA 4RAOA 3HJBA 3IBCA 4JX9A 4D9JA 2PXAA 4W1QA 4JUCA 3UPTA 4I9GA 3R44A 4NMHA 3NW9A 2XEDA 3IR6A 3QVXA 4DAEA 3CF6R 2BP7B 3R3SA 4X24A 3D2BA 1D2MA 3KUDA 4WH0A 3MUOA 3E48A 2HSJA 5FHRA 5HGJA 2IXGA 5T3YA 4UE3S 1RWWA 3FZYA 3Q7SA 4RDIA 3C6XA 1B1AA 1MQSA 4RCVA 1EJ0A 4HQRA 2PGDA 4LW8A 3ZZUA 4CM7A 1V8ZA 2FKNA 1HYHA 1YUBA 1UBJS 1COWA 2G8NA 3GLIB 1B2RA 1KKLA 2H4YA 3GNQA 3KPVA 3SDSA 1FEZA 3AXTA 4IIYA 2BR3A 3DV9A 2QW1A 3VV3A 1VL5A 2H5JA 1XEWY 3GFQA 1JILA 2VYCA 4FPXA 2NUPA 2AE2A 4KIFA 1TUGA 4IBOA 1UXKA 5F3RA 3CU5A 1N8SA 1N3YA 1R00A 5K4GA 1EGMB 1W4CA 4EVQA 1SQ6A 2VTBB 1TECE 2FFHA 4AJLA 3KLBA 2C03A 4FX2A 3S8MA 5A03A 3D8NA 1RI5A 3NHRA 1XQ1A 1CJSA 4DCCA 1I8TA 1ZMTA 1JEYA 1R9MA 3IJRA 4QRHA 1Y1PA 3VU1A 3R09A 1JEDA 3BMNB 3I4CA 3T3HA 2VPTA 3KKKA 1XQYA 2QRVB 5FV4A 3O0TA 3N2GA 3NHUA 3ITKA 1RJEA 1PNQA 1XZLA 4R9UC 4G97A 1KEEA 1EP9A 3ONDA 4C0HA 2ZT5A 1JS1X 2C54A 4JT4A 4UDOA 4F1WA 3QEKA 1DARA 4HK4A 4W8HA 2XTZA 3O1JC 1G2IA 2IPAB 1YA8A 2L82A 3A14A 3RS8A 4Q21A 1R50A 1MB3A 3BCRA 4DLYA 4PZLA 3RYHA 1CHNA 1CUVA 4RJIA 1OX4A 3AFMA 1VJ0A 1THGA 4Q93A 1H6CA 2EX4A 5J5CA 2EIHA 2OXIA 2BEKA 1H93A 1D6MA 1JSRA 3T3EA 4DQXA 5EE0A 4DA7A 1F0KA 1E7YA 2QENA 4IICA 2JDID 3G9QA 5JNUA 4Q3EA 4XUCA 1BROA 1TKBA 1TXGA 2OFOA 4Z1MA 3NBUA 2ZRJA 4YJ3A 3S2YA 1RM3A 1CZUA 2WUDA 3L05A 4ZI3A 3W2FA 1L5NA 1Z5UA 2B8TA 2Q41A 1LPAB 1O97C 1Z3IX 3OKFA 4Q5IA 4RORA 3V4LA 2GXUA 4NCKA 1ZKDA 1GO2A 1FNBA 1TOAA 1JXQA 1JSLA 3F49S 4FSDA 1JHRA 3KDPA 4G23A 4E11A 1ACMA 3DNFA 3VSCA 4HGNA 1IEQA 1XA3A 3ESDA 2OBMA 3FHLA 2DTXA 1NQTA 3LC0A 3MTIA 2J48A 4FGUA 2XA1A 1JKXA 2EEZA 3VUFA 1E6CA 1JDBB 1WVGA 2WD7A 1QORA 2EGHA 2HLDA 2H1RA 3UNXA 1Z62A 1JH8A 4OQNA 1Z9BA 2ZAGA 4OQPA 3H5RA 3QU2A 4ZJPA 3H5TA 1FE8A 1J90A 1OI4A 3AUTA 4G1CA 5KYXA 4Y98A 4B44A 2ZPTX 1RSZA 1PR1A 1QGZA 2I4MA 4U3JB 2ONYA 3MBOA 3CLUD 1E5TA 4KAJA 3MT9A 4QPPA 1PE0A 4NATA 2VPIA 2OHVA 4X93A 1EINA 1T1IA 1Z5PA 3L1KA 1X38A 4PIPA 4L8LA 3U17A 3O8CA 5MN4A 2AJTA 3HYLA 1UZAA 4GXRA 5K1ZA 4EO7A 5KAMA 3C4JA 1X1DA 3KPUA 2RGDA 2JLCA 1QIHA 5LDDC 3TSWA 1JG3A 1UKBA 3W77A 1ATIA 4MPJA 3HJCA 4ZT4A 1VYUA 1RJDA 1WB4A 3IVGA 4II3A 1CTQA 1J8MF 1Z39A 4YUYA 4BKMA 2FZ5A 4WNAA 3RC3A 1J99A 1FTWA 3NHLA 1QQTA 2YVUA 2ZRFA 3B9QA 4OQLA 5LD2C 5MGBA 1DMRA 2HWYA 4D8VA 1N1DA 1IM2A 1OXMA 1ZOLA 2I67A 3O4HA 2F3RA 5G53C 5AW8A 1C7ZA 2AOXA 1MHTA 3KNZA 2D7DA 2OHHA 1TCBA 1Z38A 3H6GA 4R01A 1Y7LA 1KEWA 4ILKA 3LDHA 1GUYA 1EVLA 1XR3A 2WMYA 3QHAA 3QY9A 1UJ4A 4REQA 4CG3A 3EXIA 5C5EA 2V4MA 3EXHB 1GFWA 2X19A 4UNNA 1K6MA 5KC8A 2H63A 3CVOA 4HFJA 4I4TF 5KTRA 4RS3A 2H5LA 1FSZA 5CLHA 4GM1A 3GLFB 4LJSA 3ZHXA 5BYKA 2WYUA 4X9XA 4MVCA 1LPSA 5ITVA 3QLUC 5KX5A 1GZ7A 3BGWA 4WE3A 3AEUA 1EGHA 4KPYA 4MQ5A 4ESVA 5HDQA 4B6JA 5GJVC 1R6DA 2HM7A 4G1FA 4RV4A 4H60A 1F5SA 3JZAA 4YT5A 5AKZA 1MLDA 1DPGA 3JD4A 2CVPA 5B1HA 3DDCA 3PSHA 3G17A 3DE6X 2R2AA 3M6UA 4A8HA 4KQJA 1VL6A 2C77A 2PGNA 1ZRMA 1F2DA 3NS7A 2I1VB 4I99A 2WAYA 3T0IA 1PWHA 3G79A 3H8WA 4B6GA 3UWOA 2FJPA 2O3UA 2C58A 1R8SA 3BMXA 3PC2A 1YC2A 1V41E 1Z07A 1XDGA 1XAGA 1II8A 1WCWA 4RK0A 1N2CE 4L3WA 1BDJA 3OZFA 4C30A 4L2IB 5JPIA 3V2HA 2BYTA 3T61A 4B3DA 5CLFA 5KMGB 2VQFB 1E5DA 2OENG 3UVEA 2WWYA 2BKUA 2EGUA 3DZGA 5C5CA 4UDNA 3Q9NA 4Q39A 3WGLA 5FAKA