2WD7A

Pteridine reductase 1 (ptr1) from trypanosoma brucei in complex with nadp and ddd00066750
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
267
structure length
249
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title One Scaffold, Three Binding Modes: Novel and Selective Pteridine Reductase 1 Inhibitors Derived from Fragment Hits Discovered by Virtual Screening.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE
total genus 92
structure length 249
sequence length 267
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2wd7A00
4M86A 4BGIA 4CLOB 3BMCA 3PJEA 4ID9A 5IDXA 1NASA 1I3MA 1T2CA 3H9JA 5ICSA 3VZRA 1E3EA 2J3KA 3D1LA 2P91A 1VJTA 5G4KA 1QR6A 3WNQA 1PSDA 1TB4A 2GGSA 2PR2A 1WAMA 1WMBA 2TMGA 1E7YA 3IJPA 2Y0CA 3R3SA 4AJNA 1R66A 2GN8A 4I1IA 1QXSA 3FWZA 1NVTA 1ZSNA 3KEOA 4ZQHA 4JBHA 3B1KA 4XCVA 2DT5A 3KSZO 1TT5A 3KYDA 3BZUA 4XQGA 1LNQA 3ZWMA 3D4NA 4MP8A 4AJ2A 5B4VA 4G65A 1N8KA 4W7IA 3B20A 3L4BC 4K28A 2CUKA 3L77A 3CEAA 5LDHA 1JKJA 2CDCA 1MC4A 1VJ0A 1T25A 4NK4A 2PGDA 4KDFA 1E3JA 5COAA 3IP3A 4ZN6A 2ZATA 1VE9A 1I30A 1I5RA 5GZ1A 4CMEA 1EVJA 1Y9AA 2D59A 3H2ZA 3NDRA 3M1LA 4QX6A 1TA4A 1BXKA 1DXYA 1MG0A 3E5RA 4G5HA 3R3JA 3ZWAA 2W90A 2B5VA 4NFSA 3E18A 3PGJA 3OIDA 5JO0A 4QO8A 1U9JA 4AJJA 2ZTMA 4UREA 4BIIA 3ZCXA 2YV1A 2WJPA 1YWGO 2J3IA 4WPGA 3JYOA 4XWYA 4WLVA 2O4UX 3ANNA 2QHXA 3AY3A 3F5SA 4OHUA 4CL3A 1K3TA 4XRRA 2G76A 2HMSA 1G6KA 4MPDA 3NJ8A 1PEDA 2EHDA 4WLEA 3B6ZA 4BS9A 5I9MA 1WXDA 1DLJA 4NH4A 1HLDA 4AJKA 1J49A 1T2DA 3IP1A 1QSGA 3ZWNA 3LZ6A 1LSJA 2B4TO 2JHFA 3ZU3A 1P31A 5T64A 5BSEA 3V5NA 4EBFA 1GYQA 1MB4A 2GRAA 5A5FA 5G4LA 1JU9A 5JFOA 5L7TA 4RPJA 3AI1A 3WYEA 1HXHA 3A1NA 4WLFA 5ITWA 1GQYA 1X0VA 3COSA 4BNGA 4CMJA 1Q7GA 3WSVA 2J5KA 4K1LA 1GV1A 4E2XA 3PPIA 4D46A 1K6JA 1IE3A 3PHHA 3C1AA 3E9NA 4EEZA 2Y1FA 3C1TA 3X2EA 2NACA 5GZ3A 3QRWA 1T1SA 4J91A 2RIRA 4BO0A 2NTVA 3EVTA 3GEMA 4CQMA 1MXHA 1PX0A 1ZH8A 4Q3DA 4DIBA 5CDTA 2YV3A 1HWYA 3AM3A 1Q7CA 3PWKA 1ADFA 4FFNA 3B1JA 2AEMA 2DM6A 5EPOA 3GPIA 3DTYA 4B79A 2CFCA 2PZMA 1A71A 3RCBA 4KTVE 2BGKA 4CMIA 5TF4A 3U09A 2DUUA 4D0SA 4LRTB 3DFZA 2VYVD 5CDGA 3INRA 4Y8VA 2EG9A 2VUSA 2CY0A 1JKIA 1U7TA 2C07A 2FZWA 4IMPA 4CLXA 5IDYA 1IPEA 5JMWA 5KVCA 1WW8A 5ER6A 4E5YA 3K96A 4KUGA 1PR9A 4WNCA 3OA0A 2Q2WA 1Y5RA 3QHAA 1PJ3A 3GAFA 4O5OA 4YRDA 3IUSA 2WWRA 2NTJA 4OXNA 2GZ3A 3E6AA 2DFDA 2NWQA 4ALNA 1ZKMA 3K31A 3AK4A 4TROA 4CV0A 3NV9A 1A7AA 1DFHA 4CM4A 3ZV6A 2PGLA 1XELA 4TRRA 3DBHA 4R1SA 3I52A 5EESA 3H3JA 4ALIA 4WJZA 3QWFA 5B4TA 3GHHA 4WGGA 1K0UA 2EP7A 2GDZA 4RZHA 5AYVA 3CPSA 5KJFA 4H15A 4M1QA 3TL2A 1LDMA 4ND4A 1YE3A 4EYEA 1YDWA 1U7HA 3ON5A 3DBRB 2RHRA 3HN2A 2VN8A 3QVSA 1H5QA 3OIGA 2XXJA 3DBVO 3FNHA 4BMNA 2DAPA 4D3DA 2JFHA 5KTKA 3RJ5A 4MVJM 1WDKA 5I7VA 4LCJA 3VHRA 4EUEA 3NDJA 4E5PA 4ALLA 3H8VA 3L4SO 3STHA 3OEWA 4TZTA 3WGGA 2G0TA 2YY7A 1D7OA 1NVMB 2QQ5A 2GCGA 4FS3A 2JD0A 1HSOA 1XYGA 3RKRA 4XD2A 5KKCA 1NPDA 3ICPA 1KIFA 1D1TA 1MV8A 1UXHA 3DO5A 3JV7A 5JY1A 4KMSA 4OYRA 3JTMA 3BMQA 1N7HA 3ZV3A 3ROPA 4IZIA 1R0SA 2ZB3A 4WLUA 3OECA 2PA3A 3R6DA 4R4JA 2HJSA 1PJ4A 4YDRA 1A9ZA 3W4KA 2J5QA 3WLEA 3FTNA 1DHRA 1ZXBA 1A7KA 4NMHA 4PVDA 3C3XA 2HLPA 3PLRA 4R3WA 4RQUA 2BGLA 4ALJA 4ZRMA 1O95A 4CM7A 4Z9XA 1EDZA 4XRGA 4U6SA 5MGBA 1FDVA 1H9AA 4YAEA 1LC0A 1ZJYA 2HMWA 2DKNA 3SLKA 3QSGA 5COBA 3DWFA 5CEJA 2AEJA 3IC5A 2GLXA 5HM8A 1ZK0A 2LDXA 1E3SA 3M6IA 3JSAA 1HDXA 4O1MA 4RLSA 5JYDA 4PG6A 3RVDA 5BSGA 1B14A 4BO2A 2C0CA 3K2EA 4FCCA 2Y1GA 4YT5A 3VKUA 4AJHA 4WASA 3WFJA 3DZJA 4FB5A 1ZK2A 5JYEA 4W99A 4YQZA 5IDQA 4WCDA 4ZQEA 3GEGA 2OHXA 3UFXA 3ETEA 1WWKA 3KUXA 4BQPA 1QLJA 2JKVA 3OQBA 2H5LA 3ROQA 3EW7A 4ZGWA 3GDFA 2ZYAA 4DYDA 4NIMA 4B3IA 4DBVO 4G81A 5AXBA 1PU2A 5T6BA 4BV8A 4FJ1A 3RC7A 2IODA 2VHZA 4MVJA 1XCBA 4M87A 2Q45A 4J90A 1JQBA 5KJCA 3JYLA 3MTJA 4BNJA 2C5AA 4WLNA 4AJLA 5HTOA 3DZGA 4BNKA 2HJRA 3RBXA 3I9LA 3GFGA 2V6MA 3UH1A 1B2LA 3LLVA 2VWPA 1Q0LA 2FZEA 5KVVA 3I6IA 3I9NA 1E1KA 1EEHA 3BMNB 3PHJA 4ALKA 2E48A 3ZU2A 4R01A 1KEWA 5IN4A 2B5WA 2VRCA 3D4PA 3HB4X 1DRUA 1UR5A 3VPXA 4A73A 3DAGA 4Z3KA 2YFHA 5CP8A 3CSDA 4ZRNA 2R2GA 1SMKA 3AJRA 3GR6A 4QEDA 4RDHA 3V2GA 1I3KA 1M2WA 5JDCA 4O59O 4MDHA 1ISFA 3DHYA 3H5AA 1MA0A 5JSFA 1AHHA 3GVHA 3DMTC 1BGVA 1KS9A 3UUWA 3MJTA 4J7CA 1VPDA 4KWHA 1LLUA 4P22A 5CPBA 5EMHA 4B4OA 5K9ZA 3CXRA 3H65A 4Z0PA 3JQAB 1E1LA 3ZZNA 2P9EA 1U3WA 4RO0A 2JAPA 4BOYA 2VRCD 4XJTA 4LRSB 4UVEA 3WFIA 4DWVA 3D7LA 2W2LD 3GG2A 3RASA 4NJMB 1XWFA 5JCXA 2ZKLA 1SEPA 3G17A 4ITUA 4B4UA 1KC3A 5DBIA 3MOGA 1LLDA 4RLHA 3WQSB 4HFJA 5DCWA 1U2GA 2Q2QA 3A06A 5BQFA 5L53A 3WIDA 1DJNA 1ZJZA 4BL5A 4RCVA 1K6XA 2Q4BA 4YT4A 1R12A 2ZTLA 1P74A 4FOSA 4CMKA 3BTUA 2Z95A 5CEEA 4QXMA 1LRJA 2HKIA 1MP0A 1PGQA 2QG4A 2VHYA 4JROA 4EZBA 2FR1A 3BHMA 1NX6A 1SOWA 2JL1A 4BGVA 1LRLA 1B15A 2HQ1A 1JWBB 5EINA 2I76A 1O6ZA 5CAEA 2I66A 6ADHA 3VDRA 2W2LA 4RPLA 4XGNA 4I9UA 5JC1A 1YQGA 4GX0A 3TZKA 2OP0A 3OBBA 2NVWA 4GLLA 1DSSG 3PLNA 3Q9NA 4P4LA 2HAEA 3I4FA 3RWBA 5EN4A 4C7KA 4CUJA 3HDJA 4FIZA 4E12A 3DFUA 4IDEA 4GGPA 2QRLA 4K26A 4RF4A 3ZHBA 1R6DA 3WGIA 3FCOA 4P38A 2X4GA 2GD1O 1DLIA 4MP3A 5DP1A 2QX7A 5A9RA 2BFMA 3ZWBA 4EJ6A 4I5FA 2O3UA 1DDOA 4NI5A 2VHVA 2BMAA 2VZ0A 3EHEA 3ZHZA 1CQJA 1ZCJA 1FK8A 2RH4A 1H2HA 3KYBA 1PS8A 3OH8A 5KKAA 2Q50A 1DEHA 1Y81A 1YBAA 4YVFA 1RKXA 4QUKA 3W6ZA 1EUDA 3HJAA 4MVJE 2ZYGA 2D1YA 2PD3A 4YJGB 3TZQA 2YHIA 4FFPA 4ZVVA 2UAGA 3HZZA 1LLCA 4PG8A 3PVZA 1QV7A 4IQ8A 1Y8RB 1L7EA 4LW8A 2VZ9A 4D45A 4OOEA 4LMPA 4IIVA 2F1KA 3W8FA 3WYBA 4D43A 4CV3A 4CMAA 2WM3A 3I6QA 3Q0EA 2BFOA 4FD3A 3UF0A 4CQLA 3JCZA 4BKQA 4GX2A 3D5TA 3VPGA 1O94A 1P1IA 2PZJA 3BIOA 2JHGA 4MO2A 1EQUA 1ORRA 3LSYA 4D79A 4E2ZA 3AY6A 4GLOA 2CVQA 2JD2A 5COQA 5JAQA 2O7QA 1HZJA 1ZEMA 3V1TC 3QVWA 2AQIA 1KETA 2AQKA 3HN7A 3OQ1A 4IDBA 4MVJF 3FR7A 4BUCA 4CMIB 3GK3A 4O6VA 1M6WA 1CERA 1MGOA 8ADHA 3Q2IA 2BI8A 1GD1O 3WJ7A 1K6IA 4PLGA 5DBGA 4FSHA 4BO1A 5IXSA 1HYHA 1QP8A 3JQ7A 3O8QA 2EKLA 2NU8A 3HDQA 2X5OA 5A3VA 1E77A 1AXEA 3IL2A 4YB8A 3N74A 1DC3A 4CQMB 4D0RA 5JE8A 3VH4A 1OC4A 2ZIZA 4EUHA 4B7CA 3H6KA 1P1HA 4ZD6A 3DC2A 3V8BA 2Q1UA 1PZGA 3GLQA 3PJDA 2WMDA 5L45A 3BTVA 3ZNOA 3RFXA 1N7GA 4YR9A 2HUNA 5B4UA 1H93A 4OXYA 1SO8A 3WSWA 1I32A 2Q3EA 5ILOA 1DB3A 3GRPA 4FR5A 2OFPA 2WD8A 1YO6A 5ENDA 1GAEO 3CE6A 1EK5A 3RUCA 1I3NA 2GZ2A 3JYNA 4BHTA 1G0NA 2HK9A 3ONDA 1TLTA 5I9NA 3PFFA 1V3VA 4HNHA 3U0BA 1ADCA 1N92A 4XR9A 1I36A 3N58A 4N7RA 4JJGA 4FC6A 4YRBA 3ZWXA 2IZ0A 5A02A 3HHPA 2IXBA 2WSBA 3NUGA 3CZRA 5JAIA 3G1TA 3HWRA 4WNIA 3NJ4A 1YRLA 5JC8A 3JQBA 3V2UA 4OAQA 1ZW1A 1ISGA 3TZHA 1LDBA 4BKUA 1X14A 1ULSA 1BTOA 1U5CA 5HBRA 3JYPA 4PN3A 4LSMA 1G1AA 1ZMOA 1U3VA 1I3LA 3GVCA 4A5OA 1PJSA 3F1KA 4J2OA 1UZLA 1EUZA 4RJTA 4TKLA 4O63O 2O3SA 1GFSA 1RWBA 2O50A 4ZQGA 4CV1A 2DUWA 3OJ0A 3I9MA 2NV6A 3MJSA 3JQ7B 4ONEA 5A9SA 2H6EA 4RVGA 2B36A 2YJZA 4B3HA 4YT2A 1EFLA 1D4FA 2VTEA 1M67A 4XYLA 4II3A 2CF6A 2AMFA 1JW9B 5I7EA 3WMWA 2RH8A 4YTEA 1HE5A 1LTHR 5HWSA 1HYGA 2W2KA 4HWKA 2Y0DA 3G1UA 3DB2A 5TS3A 3WQQA 3DDNA 1F12A 4L4SA 2NU9A 4LISA 1WVGA 1YL5A 1Z7BA 2C2XA 3TNLA 4WLOA 2HU2A 4WECA 4YJFA 1BDMA 3PQFA 4MKXA 4E0BA 2ZB8A 4AJEA 3GF4A 1I01A 5F1PA 1SCUA 2PD6A 5JPIA 3K73O 5J23A 2FR0A 2NNLD 3R0IA 3FPCA 4Q3NA 4F6LA 1LC3A 3ZH2A 3QP9A 4R5HA 2Q1TA 4UAGA 4A27A 4YJHB 4AJOA 1Y7TA 4FW8A 5G4KB 1VSVA 1KVQA 1CRWG 1LU9A 1E1NA 2FPIA 1T2AA 1UZNA 1PS0A 5H83A 1KEVA 2FPGA 3RUIA 4NBUA 4FN4A 5TLSA 1ADGA 3ZHXA 2RBEA 1PWXA 4BKRA 4DQXA 3RU7A 3OA2A 1QORA 1U3TA 3VVBA 3EVNA 3GFBA 3KV3O 1T4BA 3RI3A 1CWUA 4XJSA 4TKMA 1E7RA 2HRBA 2WTBA 1YVEI 3OF2A 4GBJA 4D3SA 4DLAA 4UUNA 4EJ0A 3OJFA 3ZWWA 4N18A 1NAIA 1W73A 2HRZA 4RVHA 3PYXA 4D7AA 1HE3A 1UAGA 2C7GA 2A35A 3WGHA 4CR6A 3D5QA 1T2FA 2I67A 3ABIA 1NPYA 1RPNA 3T4EA 4E6PA 2YHIB 3OMLA 4YAGA 4JIGA 2EWMA 3UAGA 1GEEA 4PLCA 4J7UA 5EJ2A 1EQ2A 4JXKA 2Q49A 5F5NA 1U4SA 5KJEA 5A4DA 2O23A 5JO9A 4BGEA 3I4CA 3PK0A 2E6UX 1P1JA 1XG5A 3DHNA 4M89A 3JQFA 1V9LA 1C0LA 2GR9A 2B4RO 4CMHA 3IJRA 4M55A 3PZRA 4LVCA 4E5KA 2QW8A 5TGDA 1GZ3A 3NTQA 4TRNA 2WYUA 4NU6A 3I23A 3PJGA 3RU9A 4YAIA 3GEDA 3MJCA 4Z3DA 1XA0A 1PJQA 4KUHA 4JGBA 4TRJA 4R16A 2GF2A 2QRKA 3C7AA 3QWBA 4RV9A 5DN9A 3RUHA 5B1YA 2GPTA 3JQGB 2DPHA 3BAZA 1EVYA 3IS3A 1AN9A 1FXSA 4J16A 3KBOA 1PQPA 2Y93A 1EZ4A 2DPGA 4Q9NA 2YZ7A 5U9CA 2PKRA 5JCJA 4B8ZA 1UJMA 1ENPA 1HDZA 4DMMA 1V0JA 1JA9A 1UH5A 2OO5A 2WYWA 5JS6A 4E3ZA 4HY3A 4I8XA 2NU6A 4YACA 4MVJP 1X7GA 1GDHA 2ZQZA 2Q99A 4Q3CA 1UAYA 3KSDO 2EERA 3M1AA 1C1XA 3NEPX 4PLWA 4CQLB 1UXIA 1U3UA 3F3SA 1FJHA 2FRDA 1PJ2A 3RFVA 4NK5A 3SC6A 3FD8A 4XGIA 2DVMA 4J43A 3I9OA 3C24A 2ZTVA 1W6UA 1X0XA 1GU7A 5JDCC 1ZK3A 4DA9A 1E5QA 2PY6A 2VWGA 4B4WA 5IF3A 1E7SA 1BRMA 5DDIP 4A2CA 4Z6KA 2VCYA 4J4TA 4L75A 3BMNA 4BNUA 4BNNA 2RAFA 1PL8A 1VI2A 4IINA 2CDBA 3NDIA 4MJLA 3P2OA 3DZFA 1B3RA 1HT0A 3MJEA 4ZQBA 1H6DA 3ICCA 3ORFA 1QYVA 2X0NA 3TOZA 3DZBA 4DQUA 4JLWA 4I5EA 4JNKA 3ZWCA 1XU9A 4WOKA 3AUUA 1Z74A 3D3WA 3LF2A 3WYCA 1DIGA 1D8AA 3EDMA 3E82A 3CTMA 2FP4A 3TSCA 5IJZA 3EZYA 3P19A 3TZCA 1I2ZA 4E33A 4HX5A 1NTOA 3L6OO 4K9DA 1GPJA 3W4JA 4GL4A 5TT1A 3V1UA 1JTVA 3U4IA 3ZI0A 1NHGA 3NT5A 2TMDA 1NM5A 2QYTA 4R1TA 3RSHA 1GCUA 5G0TA 3H9EO 4WKGA 4FJ0A 1GUYA 4QT0A 2V6GA 1NR1A 3S1LA 1U8XX 1OBFO 3PHGA 2DFVA 2NLOA 2RCYA 4KQXA 5JNLA 2X5JO 3K5PA 4AL4A 1DC4A 3CKYA 3BTSA 3WTCA 1NFRA 3RAJA 4BV9A 2J3JA 4A0SA 1HRDA 3NX4A 4U6QA 3DZHA 3NGXA 3PIDA 3AFNA 3WQRA 3ZNNA 1NWCA 3INTA 4CV2A 4Y6SA 4KDEA 1XKQA 3NRCA 4BMSA 4DRYA 2SCUA 2NADA 1AGNA 3AUTA 1ARZA 3QW2A 3AWDA 4J6FA 1IYZA 3LF1A 4NQZA 1JVBA 4AJ4A 2PH5A 3UHAA 5DZSA 1M75A 4UEJA 3G49A 2YFQA 1UDCA 4TRMA 4NNJA 4BO4A 1A72A 4IY1A 2X5KO 3AI3A 5F21A 5AXDA 2R00C 1GZ4A 4L4RA 2JAHA 1YOVA 3CH6A 2LDBA 2EW8A 2VWHA 4Y67A 4AFNA 4UVGA 2ET6A 1RM5A 1SZJG 3ZV4A 3AI2A 1ZNQO 4J4BA 3B70A 3GZ4A 4E2YA 2Q1SA 1EFKA 1P0FA 4JJFA 4IQGA 3H9UA 2GNAA 3QQPA 1Z73A 3CINA 4A03A 3F4LA 1V3UA 2ZYDA 1BW9A 2Y0EA 3WLFA 1YXMA 1X1EA 2OBYA 4Q3EA 5KVQA 2GASA 5I8ZA 2DBQA 3JD4A 3WGZA 3JD3A 3LC7O 4YJHA 1PGNA 3BA1A 5KWEA 2P2SA 4GSLA 3HNPA 5FYDA 2VTDA 1Q1NA 1DIAA 2EXXA 1ID1A 3IAHA 2D3TA 1R4MB 4JN6B 1NFFA 1GQ2A 3IQDB 9LDBA 3WBBA 3U62A 4RF5A 4UVIA 4XYGA 1ISJA 5L4SA 2PZLA 2EKPA 1N1EA 2PV7A 1SPXA 1QMGA 3GRKA 4XIJA 5DULA 1C0IA 4J1QA 4NHEA 3H4VA 3DBHB 3SJ7A 4NJOA 2YQ4A 3Q6IA 3ZDFA 4OXKA 3B1FA 3E48A 2BHLA 2O3RA 1MXFA 4FFOA 4IGFA 5C5IA 3S55A 4ZHSA 4OH1A 3I3OA 3C85A 2Y1EA 1YB5A 4L76A 1E3WB 1EBUA 4XR4A 4WCFB 1DFIA 4U0JA 5C37A 3PFWO 3QVTA 5FF9A 1EBFA 1L1FA 3PI7A 2NU7A 1UDAA 3WNVA 5JDIC 5DCUA 1B8VA 5EQDA 1GYPA 5BR7A 3QA9A 4GX5A 4RDIA 4J1NA 4YBZA 3AUSA 2OL4A 3FNGA 1C14A 4XQ9A 2BFPA 4U7WA 4Y98A 1MUUA 4DPMA 2G5CA 2AG8A 3H9GA 1VLLA 4JQCA 1PJLA 3P2YA 1OOEA 2O48X 2D8AA 3GH3A 4BVAA 1HL3A 5GY7A 2VUUA 1H94A 2B4QA 3EUWA 3GHYA 1RM3A 4Z9FA 3C1OA 2D5CA 5TSDA 2C82A 4J4HA 4R54A 4U8GA 3L9XA 5L51A 4RVUA 1EUCA 4NR0A 3ZGYA 3D4OA 1FDUA 4DPKA 5DT9A 4FDAA 1KEUA 3CMMA 1LDGA 3F9IA 3G79A 1YDEA 4L73A 1PGOA 2FOIA 4BNWA 2I3GA 1QYCA 3D3EA 5HRUA 2AA3A 1E3WA 5LC1A 4JBGA 3PQEA 1SOVA 1KYQA 4NU5A 3FN4A 2IZ1A 1D3AA 3C8MA 2PD4A 1VL6A 3KO8A 3LVFO 4BNXA 3GNSA 3S2IA 4IZHA 4IDCA 4UUMA 3F47A 1J4AA 3NYWA 2D4AA 3NGLA 5G0WA 1V35A 3BMQB 2V6FA 2ZCUA 3GMDA 1NAHA 2JFGA 3OSUA 4CPDA 4GSKA 4H3VA 2NUAA 2A4KA 4KOAA 1YH3A 4BQRA 3TDKA 3SJUA 2EKQA 2GN4A 4OKNA 4CL8A 2AE1A 4YEDA 4CMEC 3U4HA 2NVBA 1IHYA 2G17A 1EVZA 3HDYA 3PWZA 1VJ1A 3KYCA 8LDHA 1R0LA 5T8KA 4P4GA 1QYXA 2IZZA 3L07A 2X9GA 1O89A 3MZ0A 2VHXA 2JCYA 3DBRA 4BNTA 3WMXA 3ANLA 3F6YA 4IM7A 5CHEA 4J1SA 1BWSA 4YA6A 1B8UA 3DZKA 3RUEA 3K9QO 4QSMA 4XYMA 3WJAA 2YDXA 1WZEA 3JQCA 4QQRA 5T5QA 3FR8A 3PDJA 3VPHA 2CVOA 4ND5A 3KM0A 5FWNA 2CVZA 2E37A 2C2YA 4BO3A 4QECA 3VZQA 2IEBA 4UVDA 4E30A 4HFRA 2DTDA 4NZ9A 3L0DA 2PGJA 3HB5X 5K6AC 3TFOA 1CIVA 2CDAA 5ICMA 3JQFC 3WS7A 3CUKA 4CUKA 1G0OA 4L8VA 5DF1A 1NVGA 7ADHA 3F5QA 3JYQA 1O0SA 1WDMA 4CODB 5L4NA 2POQX 1E0DA 4YJGA 5A05A 1PL7A 4J0EA 1U2DA 3K6JA 2DU8A 3ASVA 2AQ8A 1AXGA 3QVXA 2Z5LA 5L95A 4KP7A 1M66A 5CDYA 5FFFA 1YL7A 3JD2A 5TNXA 5ADHA 3DBLA 4UVHA 1DC6A 1XR3A 3KEQA 3KSUA 3MOIA 1LJ8A 1M76A 5C7LO 4P4NA 2BI7A 1R4MA 3EY4A 4R3NA 1ZO8A 3A28A 2QYSA 5ER9A 3WICA 1DHTA 1OFGA 1T2EA 1DIRA 3WX0A 5JDIA 3QWAA 4IJWA 3VPFA 3O03A 4TVOA 2A92A 3X2FA 3GGGA 1DC5A 3AFMA 1JWAB 3H9QA 3O8QB 4RGBA 3AM4A 3S2EA 4C7JA 3F46A 3NTRA 4EJMA 1WZIA 3KHUA 1WNTA 4PG5A 4RZIA 2Q1WA 1HDCA 5JAMA 4GVXA 2VNSA 1C1XB 1TVEA 2FN7A 3FSRA 4GMGA 3ZNQA 4ZJUA 2X0RA 4G2NA 4DGSA 1O9BA 5GZ6A 4BB6A 4DC0A 1R16A 4CM8B 1W4ZA 2P5YA 4RORA 5A9TA 1NPTO 1U8FO 1DAOA 2VWQA 3GN1A 1E3LA 4PFJA 3VOSA 1PL6A 5C7IO 3JQAA 4Z0TA 4B7XA 4OSPA 3JQ8B 4CM9D 3JQGA 4GWGA 3VH1A 1QKIA 1YOVB 4MOWA 2P9CA 3Q1LA 2NQ8A 3FPLA 2I5PO 2EIHA 1TEHA 1YB4A 2HK7A 2X9VA 4CUZA 1ISHA 5TQVA 3S8MA 2I6TA 3OM9A 2A94A 2WE8A 2NSDA 4IS2A 1CDOA 3KZVA 3AUAA 4IS3A 1EE9A 2Q46A 3BXXA 2FPPA 4MVJD 2V65A 3VH3A 3WGOA 1H6BA 1J0XO 1DAPA 5JMPA 2H63A 3LT2A 2W8ZA 1GY8A 3DMYA 3JQ8A 3P5SA 4BO7A 4NJMA 3MJVA 1YQXA 4LVUA 3RUAA 4CLOA 3PGXA 4FC7A 2X6TA 3GNQA 1DPGA 5IFLA 4IJVA 3TQHA 1VL8A 1XLTA 1SB8A 5T8KC 2X0IA 3GDGA 2AE2A 1J6UA 2H9IA 4DBZA 2I99A 3INGA 2CNBA 1BG6A 1K89A 4CM9A 3FHLA 3U4CA 3HFSA 3G0OA 2AG5A 1GV0A 1B8PA 3ETGA 5EQFA 4I9NA 3T7CA 1S7CA 3D0OA 2V7PA 4RPGA 5TC4A 1UXGA 4MVJG 1HYEA 5IAAA 3D3WB 2JJYA 4IMRA 1NFQA 4GQAA 5ENVA 3WGYA 2O3QA 3PHIA 5CEFA 2HK8A 3OJEA 1PJTA 3EK2A 3FBGA 1GR0A 3OQ6A 4W9NA 1IY8A 1Y8QA 4OSOA 1RYDA 2JFFA 3O4RA 3ZV5A 3ZN2A 4B7UA 4AJ1A 3KYDB 1RJWA 4AICA 2OUIA 2NTNA 5I7FA 2J8ZA 1E92A 1X7DA 5AXCA 3WBFA 3DR3A 3EC7A 1PGJA 4F45A 3DONA 5F1OA 3O26A 4ZA2A 4BNLA 2OORA 2UYYA 3ZU5A 4GAEA 1Y6JA 3NKLA 3MWDB 2EP5A 5JY6A 2O2SA 1Z7EA 2FWMX 4JBIA 2Q2VA 4QTZA 2ILTA 1LEHA 1R0KA 1XQ6A 4YJFB 2C59A 3BHIA 4R68A 3BMCB 4S3MA 3RQSA 1N2SA 2YW9A 4XIYA 4IXWA 1ZVMA 1LI4A 2GSDA 5DOZA 2O3TA 4OJNA 3E1KA 2GYYA 1O5IA 2C29D 3UW3A 4RF2A 2WEKA 3I83A 3GNTA 4GI2A 4RF3A 3VC7A 3QIVA 3CZMA 3H3FA 1IZ0A 3WWYA 1NQTA 6LDHA 1H9BA 2IDZA 3VPSA 4IPTA 3GMSA 2O7SA 3UXYA 4HV4A 2PWZA 5I8WA 3DAFA 1VRWA 3BHJA 1DIHA 5C3MA 5KCZA 1F14A 3WIEA 4CMGA 1QLHA 1I10A 4ZQFA 2DBVO 4XYEA 3MCVA 3RC1A 4OQZA 3V1YA 1IHXA 3C7DB 1CYDA 1LBEA 3KYCB 4CM3A 3GGOA 7MDHA 4PG7A 3E5MA 5DCYA 5JCJD 2X86A 3LT4A 4ILKA 4BNFA 4EDFA 4KTTE 1KC1A 2ZB7A 1PWZA 2IYPA 4HBGA 2Z1NA 3UGKA 1P1RA 5JBIA 3RFTA 1TXGA 2DQ4A 3LT1A 2Y99A 3VDQA 1Z75A 3I5MA 2AEFA 4CLRB 3V2HA 1EMDA 2VRBA 1KBZA 4R9RA 4HP8A 4WEQA 4JP3A 1YL6A 2W98A 1VSUA 1E6UA 2AXQA 4E21A 3W8DA 1WP4A 3Q2KA 5B37A 1D1SA 4OL9A 3IOYA 3OICA 5KVSA 3RD5A 3F1LA 3WWZA 2DLDA 2YUTA 4DUPA 2WDZA 5CG2A 4MVJH 3GGPA 3DMTA 3QWIA 4PLTA 2UUPA 3RJ9A 3KTDA 1CJCA 4NFHA 4D41A 2X23A 1AHIA 1BVUA 2OMEA 4YPOA 1NQAO 3SBOA 2EF1A 5I7SA 1V6AA 1JDJA 1PQUA 3NT2A 1ENYA 4J9VA 3G3EA 1DO8A 1LRKA 1NBOA 3RKUA 3RBVA 1J5PA 2GERA 2XPCA 1F0YA 2EJWA 2A9FA 2OZPA 3PTZA 4GMFA 4W6ZA 1YB1A 2ZJ1A 2Y1CA 4BO8A 3PDUA 1KY5A 4UUOA 4FOOA 2PH3A 5IXYA 5KJ1A 2VUTA 4CJXA 2EGHA 1ZSYA 4J3FA 3TOXA 1NYTA 1Y1PA 4UUPA 1LSUA 3LYLA 1I24A 2GO1A 4Q39A 1XQ1A 2Y05A 4J0FA 4QFDA 1GTMA 1XDWA 1GYRA 3IIEA 4PG4A 3ZWOA 1JAYA 3L9WA 3S2GA 4K6FA 1ZFNA 2BFAA 1P77A 5ES3A 1E7QA 3LDHA 4XZ3A 1R15A 4S1VA 1NQ5A 4CR8A 4Z0HO 4M54A 5AOVA 3ULKA 4ESOA 5HA5A 1KEPA 3WG9A 2G1UA 4XGKA 4R5MA 2HMTA 3R1IA 1OC2A 4HXYA 2P4HX 4J2HA 4WUVA 3GQVA 2Y68A 5HS4A 3JQ9C 2EW2A 1P3DA 3EAGA 3CMCO 4WK6A 3WR5A 2DTXA 1YJ8A 5B12A 5HS6A 2CD9A 3LC2O 1OMOA 2BGMA 4EEXA 4FPXA 4MIYA 1T1RA 5TT0A 3PJFA 5LCXA 1I0ZA 2HMUA 4J9UE 1BHSA 2C20A 4N5NA 4W9NC 2OXIA 3UCXA 3I9KA 1KVTA 4XKJA 1C1DB 2IEDA 2ZK7A 1EE2A 3PEFA 1A5ZA 4DIOA 4E32A 4GWKA 4PIVA 3UOGA 2X7HA 1LXCA 2VYVA 4LCEA 3PQDA 4DLBA 1SNYA 4PLZA 4P8RA 5FI3A 1VC2A 1VL0A 1TT7A 4BNHA 3I9JA 2XF8A 4OKIA 2YYYA 4UEOA 4HFNA 1I33A 1IB6A 4KZPA 4PLHA 4B8WA 1VKNA 2BF7A 4MKZA 4UEKA 4RVFA 3KETA 1IUKA 1N1GA 2I9PA 2PKQO 4BGUA 4CM4B 2J6IA 4DMLA 3PIIA 5FI5A 4NG5A 4PGFA 2FMUA 3GVXA 5C7OO 1QG6A 5U1PA 5CG1A 4ROSA 3KLMX 5F5LA 1MG5A 2ZB4A 1YQDA 2YV2A 4F3YA 1UZMA 3JQEA 3NT4A 5L7YA 1QRRA 1OZAA 3VZPA 4XB1A 4DVJA 1Q0HA 4KWIA 4YQYA 2J5RA 1CETA 4R1NA 1K2WA 1SAYA 1GUZA 1BVRA 1JN0A 4DLLA 4E5MA 1KVRA 3ZWYA 4GPD1 2OGUA 3PHLA 4CLRA 3TZ6A 2BD0A 5GMOA 4CM6A 4DL9A 3RUDA 2DTEA 5A5EA 1VKOA 1JLLA 1R37A 4GX1A 1N9GA 4AJPA 4MINA 5JXWA 1AUPA 2VOJA 2GUGA 4OOFA 1EK6A 4TSKA 4YCAA 1F8FA 1HTBA 3DAPA 4DREA 1ZK1A 3A14A 4I5DA 1ZK4A 2QRJA 2WYVA 4BO5A 3MWEB 4UULA 1NHWA 4FFRA 3U9LA 3KOUA 1UP4A 1T4DA 1XGKA 2ZCVA 4CLDA 4EI2A 3PRJA 1BSVA 3HFGA 3ADPA 3GPDG 4HNGA 1UXJA 1F8GA 4TQGA 3U4DA 3ASUA 4XB2A 1NXQA 4IXTA 4JCOA 1HEUA 3EMKA 2QZ9A 2EJVA 1ML3A 5CPFA 1PJCA 1YBMA 3DOJA 3VKVA 2P5UA 4A26A 3D64A 1RM4A 2CF5A 4M49A 3W8EA 4DTIA 2X0JA 2PZKA 1ADBA 4IDFA 4PLFA 3H7AA 3IDSA 3S2FA 3CIFA 2C5EA 1C0KA 2JCXA 2RHCA 3E9MA 3JQ9A 1R4NA 3Q11A 5F3RA 2IE0A 2NVUB 2NM0A 4MP6A 2O4CA 3H2SA 4XA8A 3TWOA 4J49A 3M2TA 1NP3A 1R4NB 2R00A 5MDHA 1DOHA 4NBWA 1RM0A 5BNIA 1Q7BA 2AQHA 1PZFA 1LQTA 2V6BA 2BELA 1Y5MA 4PLVA 3DOCA 1U4OA 5IZCC 1JVSA 1FDWA 1XSEA 1PIWA 5DNAA 1LA2A 5H81A 5TRTA 1WMAA 4R51A 2VYND 1MC5A 2J3HA 3BYZA 2IRWA 1HKUA 2IYOA 3WGTA 4CM8A 2VT3A 3PYMA 4IJKA 4QO7A 1I8TA 5KJ6A 3ITKA 2X1HA 1WDLA 3KXDA 4LSWA 5CDUA 4Y9DA 3GC6A 3QWHA 3PZBA 3JQAD 2VNAA 4IBOA 3TL3A 3ZNPA 3LT0A 4MIOA 3KVOA 1QYWA 3E8XA 3L6DA 4NBTA 4W7HA 3ZW8A 4BKOA 2C54A 3O38A 3W4IA 3FF4A 1E7MA 3FBTA 4OIMA 4LK3A 1ZBQA 2VHWA 1ZUD1 2DBZA 4RVDA 1QYDA 1UXKA 4EUFA 1YBVA 3ETDA 3FTPA 3SC4A 3SVTA 3P7MA 3HSKA 3L6EA 3LQFA 1E1MA 1LSOA 2XXBA 3NTOA 1N9GB 3DBLB 4FGSA 4I9HA 1Z45A 4FFMA 5TIIA 3JQ6A 1Y8QB 4W82A 1PQWA 3WGQA 3IKVA 4XX0A 5DBFA 2C7VA 2X58A 2VOEA 1ISMA 1E6WA 1Z6ZA 4HUJA 4RL6A 2X22A 4MVJI 1V3TA 1LQUA 5F1KA 2E49A 4YT8A 5K0ZA 3IMFA 1HDGO 4B3JA 5KNLA 3AOGA 3TRIA 5H82A 1L7DA 1IL0A 1B26A 2NVUA 4Z9YA 3RROA 5IG2A 2VZ8A 1V8BA 1HDOA 1F06A 3DHEA 4Y6PA 2AHRA 2JCVA 5AVOA 4WOJA 1Z82A 3UVEA 3VH2A 5A06A 1HDRA 2B83A 3QJ5A 3TF5A 4CR7A 4E5NA 1H6CA 5IZ4A 3AOEC 3ANMA 4YWJA 3LU1A 1DRVA 3ZU4A 1KERA 1XU7A 4EW6A 1IOLA 1X7HA 3UKOA 3VZSA 4ZICA 2BLLA 3K2BA 4BNMA 3GUYA 3ENNA 1BXGA 3HDHA 1IPFA 5T67A 4YJDA 3BMOB 2UUOA 4BNYA 3QY9A 2YDYA 1GQQA 3FRJA 5THKA 5G0SA 3DEYX 1E6EA 1SEVA 4ND2A 4OO3A 3WXBA 1WLYA 4TWRA 4YAKA 5EL0A 1LDYA 3BTOA 1KVSA 2GN6A 5JLAA 4DQVA 2P68A 3SLGA 1ZIDA 5G2OA 2CZCA 1TI7A 1CEQA 5AQ1A 3LK7A 3W6UA 1T24A 4I5GA 5L9AA 4WCFC 3PYLA 1P0CA 5G0VA 3HUDA 3FWNA 3ZW9A 2VQ3A 3RC2A 3AOEA 3RIHA 5G0UA 3AY7A 3IUPA 2FSVA 3T7EA 1K5HA 1KY4A 4MKRA 4A10A 1Q2XA 5ITVA 4IDAA 3GVIA 4JK3A 4A7PA 4PCVA 4DPLA 4PVCA 4IIUA 1YONA 2IXAA 1U5AA 1XHLA 4ND3A 4FJ2A 5T57A 2W4QA 3GG9A 5BT9A 3WDSA 2UV8A 3GY0A 1FMCA 3I1JA 1JKFA 2D2IA 3KB6A 2B69A 3GA0A 3TPCA 1SB9A 2WD7A 4Q3AA 1LDEA 4RQTA 1YJQA 4QFCA 1F17A 4IDGA 3H5RA 5TX7A 1CF2O 1LLQA 3ENKA 4NBRA 2OP1A 1ZZEA 2CMDA 3DL2A 3DQPA 2HMVA 3UCFA 5EIOA 1XIVA 4XYBA 1KVUA 1LSSA 1P33A 1IULA 2PNFA 3AM5A 3ITDA 2JD1A 1UUFA 5L4LA 5FEUA 3SXPA 3K8ZA 1GZ6A 4H7PA 4PZDA 1E7WA 1XEAA 3GUCA 3JQBC 3TFQA 1X13A 3HE3A 1HDYA 3PXXA 1P44A 2P4QA 4L74A 4PLPA 1PJBA 2OBNA 4L0QA 4XQCA 2WD7B 3OHSX 1GEGA 1HE4A 5TJHA 4D42A 4L4XA 5L3ZA 2CSUA 3RUFA 3OETA 5A1TA 1P1FA 3ONFA 4BB5A 5A04A 5DOVA 1LUAA 4X54A 4GH5A 3ZHYA 3VVCA 3O9ZA 1X15A 4E4YA 1ZEJA 5I9LA 2EGGA 4R69A 1LX6A 4KQWA 1WPQA 1ONPA 2D0IA 4TZKA 5A03A 2W2KB 2X9NA 4FGWA 1PS9A 1YS4A 5TJ9A 1ULUA 2UVDA 2X8LA 3KRTA 4B4VA 1KOLA 3UCEA 2O2YA 3HQ4O 4KUEA 4M8SA 4N5LA 2XOXA 4O0LA 4W4TA 3M2PA 3OFSA 5JW6A 2G82A 3MTGA 1HETA 4CM1A 2FR8A 5A9SB 3E03A 1U28A 4OMUA 4CMCA 4HADA 2H1SA 4XEHA 1DRWA 4WEOA 1EVIA 2EEZA 2YHUA 3Q9UA 3WB9A 4E31A 3RBZA 2BRUA 5LDGA 1BDBA 3ROKA 2GZ1A 3UN1A 4YAJA 1GPDG 4ND1A 4BMVA 1ONOA 3Q3CA 3GN2A 1ISIA 3BMOA 4IUYA 1FF9A 2OOSA 4BNIA 4PZCA 4MIEA 4BNZA 1PZEA 4YXFA 3GDOA 3ONEA 1UP6A 2P9GA 2NQTA 3AU9A 5BSFA 3EYWA 2ZTUA 3WTBA 2PTGA 4DIFA 4H16A 4AVYA 1AE1A 1HE2A 1H2BA 2Z1MA 4EGFA 2GN9A 3OP4A 1MX3A 4TMFA 1B16A 1DJQA 3FI9A 1O8CA 3SEFA 1H0KA 1PGPA 2EV9A 3TN7A 1GL3A 1IZ9A 4IJUA 1GUFA 1I2BA 3DZIA 3K92A 2HCTA 4J1TA 2R6JA 1ZSVA 4BKPA 4YRAA 3HADA 3A9WA 1E3IA 1P45A 3ADOA 4GVLA 4I08A 4LN1A 2F00A 3WOHA 1CQIA 1A4UA 2BKAA 3GAZA 4PZEA 4BO6A 9LDTA 4AG3A 4C4OA 2HO5A 4CLHA 1NQOA 2HDHA 2Y1OA 3ZWPA 3A4VA 4DC1A 1RYEA 3EGOA 4RPKA 1M6HA 4D3FA 4NPCA 1HZZA 4WE3A 2I65A 2PKQP 4LGVA 3DTTA 1PZHA 4N5MA 1JAXA 3VTFA 1UDBA 2BH9A 4II2A 3L4BA 2I3AA 1C1DA 4BNVA 1X1TA 1YKFA 3OJOA 1BMDA 4WCFA 2UDPA 1P1KA 1Y9EA 3HG7A 3U49A 3W1VA 2Y67A 1HF3A 4JJIA 3PP8A 4ZU3A 1DBVO 4EITA 5BNTA 4R9SA 4J7XA 1C0PA 4FQ8A 2PK3A 3IKTA 1LDNA 3QVOA 1BW9B 1B0AA 4L9RA 1OAAA 4PRLA 1QV6A 4Y6RA 1ZXLA 3GOHA 3H5NA 4E13A 3LC1O 3AU8A 2QIOA 2PLAA 5L40A 2ZQYA 4RPHA 3FNEA 5L7WA 3N7UA 4OGWA 1N5DA 1A4IA 1SBYA 1ONNA 2B35A 5IZCA 1FDSA 4JP2A 4E2WA 2DBRA 4CLEA 2B37A 4F6CA 3AW9A 2DC1A 1DIBA 2Y66A 2O3JA 5ILGA 5BSHA 3SX2A 1NNUA 2B0JA 1OI7A 4D44A 1S6YA 3VTZA 1Y8RA 1ENZA 2Y1DA 3PWSA 5BNFA 3T4XA 4PRKA 1B7GO 1GADO 1MFPA 1U1IA 1W0CA 4XDZA 5KOIA 3OIFA 4FFLA 2D5AA 1MFZA 1A9YA 1GCOA 4CQMD 4OM8A 3FNFA 3GZNB 2Q4EA 3JD0A 4GKBA 1C3VA 3KLPX 4U5QA 3GT0A 5DP2A 5K6AA 3LLSA 3RC9A 1E5LA 3UICA 3TJRA 2VYNA 4HKTA 3MJ4A 5A3JA 3U3XA 3QV1A 5EERA 5U4QA 4JX8A 5THQA 4TVBA 1FDTA 2E82A 2YQ5A 3NAQA 3VAZA 1B3BA 2FHSA 1VM6A 1MLDA 1SC6A 4R1UA 4K6CA 2XAAA 5KIAA 4R41A 3ST7A 2FSSA 5CFZA 3QE3A 3E9QA 4N54A 4NDNE 1Q0QA 3QLJA 1HSZA 1BXZA 5AXAA 4XDYA 4PLYA 1DFGA 3DOOA 3ROMA 4IGEA 2PFGA 2VT2A 2QZZA 4AJIA 1PTJA 5IN5A 1I2CA 4CM5A 3K30A 1A27A 2WE7A 4NBVA 1P9LA 3EZLA 3GZNA 3DXFA 4BO9A 1UP7A 3JD1A 4HFMA 4INAA 4IQ0A 4ALMA 3OEYA 1TT5B 4Q3BA 2ZJ0A 4GGOA 1ZMTA 2HSDA 3U5TA 2AW5A 3C7CB 1NR7A 2FY8A 4XQEA 2E4AA 4NFYA 1NWHA 1ENOA 4DYVA 4YYZA 1EDOA 4URFA 4CMBA 4DXHA 4FBGA 3GVPA 1T26A 3F4BA 4U0KA 1HLPA 3OJLA 1H6AA 4GKVA 1PR3A 4LMRA 4OQYA 5JAZA 1BXGB 4F46A 5IDWA 3JQDA 3ZWVA 4IDDA 4RVSA 3MEQA 5CDSA 1YGYA 1W8DA
chains in the Genus database with same CATH superfamily
2ZRCA 5B3JC 4NONA 3EVZA 5FUVA 4DA0A 2C9DA 4JDPA 4QRHA 1JMKC 5JYCA 1NVVR 4LDAA 1NMQA 3ZHRA 5JAPA 3UJ6A 4DCNA 4YK7A 3KSRA 1T2CA 3RYFA 2E89A 4I6GA 3QPVA 2JGIA 1LNZA 4E46A 2ZIVB 3BWCA 3KIPA 1DQRA 4QREA 3T5AA 1WMBA 1E7YA 2WJZB 3GGSA 4KB5A 4QJIA 5JS2A 1WABA 4AJNA 1FYFA 3BE8A 4X8LA 2XY4A 4BMOB 2REQB 1TW3A 4P98A 3FWZA 2Q0HA 1DAFA 4ZQHA 4WT7A 4HNUA 2W6ID 4JBHA 4XCVA 3S5UA 4BLVA 1W5TA 4EPTA 2GB4A 2VJMA 4WDQA 3ZE9A 2HC9A 1Y8CA 2WDPA 3KYDA 1P75A 1T8TA 1LNQA 4RV5A 2FG6C 3EULA 4BVKA 1N8KA 2QW1A 5AI5A 3N59A 1X92A 2DBYA 5A4AA 2XCRB 1P9NA 3P94A 5AVUA 1XKTA 3TOSA 4X63A 2R6HA 1XVTA 3EPPA 5LWQA 5B1SA 3B8EA 2ZDGA 5JNVA 2CDCA 1Z4MA 2NTYC 3ITEA 2IY9A 6REQB 2PGDA 3IP3A 1XDZA 2AI2A 1X38A 3AB8A 4JJZA 4MB0A 5E7IA 4D9GA 5JPCA 1IN7A 1SK8A 4Z9AA 4PR3A 1EVJA 1Z33A 2D59A 3CA8A 3LM8A 4PFSA 3G2OA 3LP5A 3R74A 3ONWA 4WKBA 1R0CA 3M1LA 1YRBA 2IIQA 4QX6A 2D74A 1MG0A 3LCJA 4RFSA 5EWMB 4BFZA 3I61A 1JZQA 1XROA 3F6EX 5LQSA 2W90A 1PR1A 3OOEA 3GBPA 1M6NA 3CW9A 4NFSA 3DEKA 4MVXA 4HJXA 2I2BA 3PGJA 3ZQUA 4JDUA 3OIDA 2P67A 1T9CA 4FD2A 2V5VA 5T4EA 3ZIDA 1NP7A 1Y80A 1VBKA 4QO8A 2F1RA 1S89A 4HDQB 2JLYA 2YVKA 5CYFA 3TGWA 5ARBA 1U9JA 3BUSA 4HQOA 3AF5A 2RAPA 2BEUA 2P8SA 3V9PA 1SBZA 3ZU6A 3RU3A 2FZ4A 2YV1A 1G3MA 5HR5A 2LGJA 1EGVB 3ED1A 5MN5A 1L7BA 4WPGA 5EIAA 221PA 4XWYA 5THXA 2JIZA 2O4UX 1MCZA 2O2ZA 4JLNA 4QM7A 3RFFA 3W6NA 1K3TA 1XZNA 4MPDA 2HMSA 4XRRA 1DG1G 2BFEB 4I6EA 4CQNA 4LXYA 1XZDA 1DZIA 2G1AA 3GZTB 4BZXA 4E5VA 8OHMA 4BS9A 1W35A 3GLVA 4DJFC 3TUZC 1XZGA 3H11A 1H0HA 1YDHA 3BZBA 1CVIA 4TLCA 1DLJA 5DLDA 1OUMA 1HLDA 3UJ3X 1J49A 3IP1A 4HLCA 4AJ9A 4R1QA 1NM5C 1H1LB 3NFRA 5EA2A 1EFRA 1NLMA 2CEAA 4QT4A 3GP3A 4P81A 4BVHA 5KSZA 1VFNA 5CFQA 3EWAA 4DJ5X 1SR8A 1GYQA 4HZUA 5A5FA 1PK9A 5JFOA 3U3KA 3PNQA 1Q2UA 2GA9A 1GIAA 3WYEA 2EDAA 4DR2B 1H0SA 2DYKA 5KWJA 2FXVA 1CY2A 2PWYA 1X0VA 2JGDB 2YWJA 2YRFA 3COSA 4QZVA 1P6QA 4HS9A 4OREX 4BQIA 3WRXC 3Q3GE 3WNCA 4DUGA 2J5KA 2JI7A 2OAGA 2W6JD 2K4MA 1KZ4A 2WV9A 3PPIA 5U4XA 1Z4JA 3CURA 3O6VA 1IE3A 3PHHA 3VJMA 3A1TA 2LCFA 3QKTA 4BMXA 3GEEA 3EF1A 3R3VA 3IEUA 3UM9A 5HUQA 4O3MA 2NACA 2ORYA 5HZKA 4AO6A 3PR2B 3QRWA 1T1SA 3C45A 4GO1A 2ZYWX 2RIRA 4N9QA 1DJOA 1KAMA 2GRUA 1M2OA 1YZTA 3G7NA 2BF4A 3JZAA 4LJ8A 2YS7A 3GEMA 1QS0B 1MXHA 2OLEA 3AFGA 1FFWA 4MUJA 3I9V1 4YGYA 3SPXA 5K0GA 3OX3A 3KLOA 5CDTA 3E22B 3CVVA 1WBJB 1XTVA 1ADFA 1W6RA 3U6KA 4UC0A 3WGUA 4DM3A 1UBMS 1QB8A 2DR3A 4AYTA 3G5LA 3MWFA 3KQSA 4OHMA 1JG6A 4TM7A 1T8UA 1UWLA 2RI0A 2Q5CA 1JMYA 2PZMA 2QMYA 3BF7A 1CUAA 2JI9A 1PT9A 4QYTA 5TF4A 1YIOA 4NQRA 3EB9A 4XWAA 2XWBF 4ZARA 5KUTA 1UOQA 4AS2A 2G07A 3DFZA 2VYVD 4BAGA 5CDGA 4ZYYA 5KQSA 4LDQA 2F48A 1WUIS 2Z8XA 3DNPA 1BFDA 2FZWA 2GBLC 4HEA1 4QSHA 5EP3A 4B5KA 5JI3E 4RTRA 2BKEA 5JMWA 5L6LB 1O97D 2JIBA 4KWEA 4CT5A 4KUGA 2V5UA 1OI3A 3T5TA 3TIVA 2FFQA 4PC7A 1HR0B 4UNIA 4DLYA 5SYAA 3QKIA 1Y5RA 4ENVA 1KP2A 1NNI1 3WV5A 2H4YA 1PJ3A 2FJPA 2WWIA 1Q6ZA 3ER6A 1SA0B 4UE3S 3GAFA 2QTTA 3S68A 3IUSA 1B00A 1IEXA 2NTJA 2GZ3A 1IH8A 2XV1A 2NWQA 4ALNA 3REQA 3K31A 2O8EA 2VTVA 4C30A 4BBZA 2YOHA 4G84A 2D7CA 1OH8A 1LFDB 3IEPA 2MINB 1KI1A 3O4HA 4CM4A 3ZV6A 2QLLA 5CFPA 5ECGC 5CGZA 3H3JA 3UWDA 1T9GS 1HDIA 1X7YB 4G2TA 3S2UA 1ICEA 2W2NA 3EZFA 1UBRS 2R8BA 3B52X 4RZHA 2XUDA 3CPSA 1F6WA 4R05A 1RLJA 2OV1A 4HDKA 4ND4A 1TTTA 3D2LA 1XVIA 5AKJA 4CKEA 1YE3A 3ZDZB 3HJFA 1U7HA 2ZSDA 4FDTA 2GFQA 3NASA 5EHGA 5I3ZA 4ZO7A 3EG5A 2VT6A 5H4GA 1JE1A 4WFIA 1HRKA 2J1LA 4ZOLA 4G6ZA 2O5EA 5LKRA 1BGWA 3KWMA 4BMNA 3VAYA 4D3DA 5KTKA 1S1CA 1OWNA 1SUFA 3A4NA 1PVOA 1BWRA 3E15A 1TIPA 4GZ5A 1IM8A 4EUEA 3W5AA 3L4KA 2QY9A 5EP2A 4MHOA 4D9KA 5AVQA 1N6OA 1G8MA 1NVMB 1ZA1A 2G71A 3QW4B 2GCGA 4FS3A 1NZFA 1GJRA 1HORA 2Z6AA 1XEXA 4X1KA 2V4UA 3MA0A 5FPPA 4EYKA 4CTJA 2HIAA 2OBXA 2VEOA 3KQWA 4GGMX 4HF7A 5KKCA 2OAQ1 4AY6A 1DBPA 4MYTA 1D1TA 4JT8A 1A1SA 3MINA 1OX4B 4WXYB 2HLDD 2NSHA 3MTIA 4KMSA 2AUTA 4Q9JA 5JTTA 5IWAB 1IN1A 5IU6A 3ZV3A 5J2UA 1HQKA 2AIRA 2YCLA 5HCUA 1J9ZA 1IZYA 4W63A 2E0IA 4QXRA 1Q44A 2VXOA 4WLUA 3KVYA 3WIBA 3GJSA 4PNHA 1A9ZA 3WLEA 1JJAA 3IUYA 2OCYC 1G20A 4O4JA 4ND7A 3C3XA 4PVDA 3T7SA 3ZYZA 4CKYA 4ZRMA 4G5QA 1WV1A 4C1BA 4CM7A 5ULLA 4BQEA 1N2CA 3CPEA 2H11A 3BXZA 1FDVA 1H9AA 3KQHA 3M5WA 2A5LA 5ED0A 3RV3A 3HK2A 2DKNA 3ORSA 2UZ1B 3DMFA 5CEJA 3DWFA 2AEJA 2Y1XA 2QD3A 4HG2A 5AVVA 3JAMA 3LYHA 3VC2A 2J45A 4H6WA 4BE9A 1Z18A 2LDXA 3M6IA 1M2VA 2XT0A 1L5SA 4HRYA 4CHGA 3DO6A 5LU9A 3D6AA 3OD1A 3JALB 3PX2A 4LJ5A 5BSGA 4YP1A 4MRRA 4IKPA 3SS8A 4BY9E 3IVRA 3G23A 4IOJA 1OSNA 2Y1GA 4MS4A 1N77A 4IRXA 4HGRA 5JYEA 1NG1A 3GA5A 3UOWA 5FI0B 5JH7F 5LOVF 1E64A 4BMYA 1K68A 2DHCA 1LF5A 4BQPA 1AKVA 4XCQA 3ROQA 3GJZA 3M4JA 1FQJA 1T2NA 4I4CA 1H05A 4MQMA 2XCTB 1LBHA 2ZYAA 4TLEA 2XRYA 3T5CA 1VPWA 2G9ZA 3MVEA 2HHAA 4DGQA 1NC1A 2GPBA 5ICGA 1U8YA 2GZRA 5DLEA 3RC7A 2A9RA 2GLUA 3LHDA 2IODA 2VHZA 4MVJA 4DNXA 3O1LA 3PJRA 3D6MA 1Q12A 3L06A 1O6CA 2GM3A 2EYQA 3BB3A 3JYLA 5D5PA 3RGGA 4BNJA 1TYBE 4FB4A 2C5AA 2AOUB 2Z2ZA 3UKJA 5KKNB 1WEKA 1E59A 2R68A 3UJ9A 2CYBA 4ZHQB 1EKXA 2CBGA 4OU4A 2R5FA 2VWPA 4GG1A 1Q0LA 3UWSA 4EL5A 5KVVA 1ORTA 2G0AA 2FR8C 2OV3A 4Y2TA 4FW9A 1DOAA 1NOKA 4DCOA 2ZANA 3AVQA 4LJSA 1E1KA 3T1TA 1QFZA 3PHJA 4YUZA 2E48A 1MDBA 3ZU2A 1QH9A 1WXXA 5IN4A 1B4DA 5BV8A 4G8BA 2FWJA 3D4PA 1RPAA 1VDZA 4JQSA 1VHQA 1RZ3A 3UPUA 2FX3A 3Q0TA 1IEQA 2IZ7A 2ZVJA 3QMMA 4D99A 4FFSA 3CSDA 4OQMA 5CP8A 3VSDA 1SMKA 3NR2A 4EA7A 4O2AA 4QEDA 3P0EA 3V2GA 2WPDD 4GR5A 3GRYA 1TUIA 1GZVA 3QU9A 3CR3C 1ISFA 1PLJA 1U0LA 4MDHA 2W2OA 4DCCA 4MWSA 2CLIB 2UKDA 3DVSX 4YV1A 3DHYA 4BV2A 3U16A 4X00A 1Z13A 2E87A 1WKCA 1TADA 1F4VA 1PNOA 2AN9A 5JSFA 3E7FA 4G9BA 1BGVA 3CLTD 3S1SA 5CTAA 2DRIA 3UUWA 1E20A 1P2TA 2JGKA 1USGA 1HYQA 4LOJA 4PXYA 2R85A 3A27A 1JLKA 1SBQA 5AK5A 4YMLA 4GL2A 4Q34A 3VR4D 3RWOA 3GEHA 1PL0A 4QQ8A 2G06A 4Z0PA 3QF4B 3X1XA 3GLGA 4KPFC 1LB1B 2P9EA 3F74A 4EY6A 1BEUB 1U3FA 2C83A 5TE9A 1XUOA 2WZDA 3K2QA 4OJMX 2IYAA 1A97A 2Q3LA 4H35A 5DHRA 1RYFA 2CYCA 2JLAA 2ZR8A 3K9LA 3TR6A 4Z4FA 3EVFA 3VI4B 2HJHA 4MRMA 2C2WA 4K8OA 4JEHA 2DQSA 4KDRA 4TV8B 3G2LA 3ND8A 1ZL0A 4IJ6A 2DP4E 3FTQA 4KMMA 4NS4A 1P4RA 4NU8X 2D0OB 2NN3C 4TWAA 1TTQB 4B4UA 4ZMBA 1KC3A 1UADA 4ZYUA 5I6DA 3STUA 4EY8A 3RM3A 2OCBA 2Q2QA 1KOJA 2XHZA 1I7PA 1K75A 4RFVA 3IPYA 1BKDR 4L85A 5M5BA 3VR6A 5LMUB 1E2LA 3GRCA 3F7MA 1K3FA 5JAUA 4JUAA 1JPUA 2IW1A 2QTGA 2H07A 3NIWA 2FZGA 2IKSA 5EGNA 1NLYA 1OQAA 1X7ZA 3PVSA 2F2TA 5D87A 4I55B 1AZWA 4D2IA 5IUKC 2QUJA 2XWPA 3LH5A 2G08A 2Z95A 2A9JA 4QXMA 2QG4A 3QITA 5HKBA 3DHWC 5JIBA 4QHTA 1PAUA 1MC8A 1SC1A 1W49A 1JDBB 1JU4A 2XDQB 4LXQA 1K8YB 2HB6A 4FXOA 5J2UB 1SOWA 5H8WA 4PINA 3AB3A 5DGTA 1B15A 2HQ1A 4G0WA 5CAEA 4Q3OA 4RPLA 5E1MA 1JA0A 4CKWB 1J56A 3EDQA 1UFVA 1H85A 1YQGA 3CRZA 1NF8A 2A1TS 3OBBA 3Q5DA 4YREA 4S2EA 3PLNA 3Q9NA 4QUJA 3FI0A 2MR6A 3B5IA 1E2IA 4LNUB 1J8FA 1YR8A 1CJMA 3HCNA 3I4FA 3IR5A 2COEA 3HDJA 1Y4UA 2ZAOA 4K6MA 3T9EA 4CUJA 3LNTA 4W1RA 5IANA 3ZHBA 1YS6A 3OLCX 1X1BA 5DPMA 3FYTA 3K6RA 4ZOLB 2QUKA 1WETA 1P80A 3PF8A 3ZOZA 1MEOA 4MS1A 1YDMA 3UMGA 2BFMA 2IU4A 4C4AA 4ZCMA 4EJ6A 2JBHA 5ICCA 5JJKA 3RT7A 1DDOA 2PA0A 4A92A 3WGVA 2BMAA 4GLBA 2X2OA 1E1QD 4O4JF 4L0CA 3ZYCA 1CQJA 2RH4A 2R5NA 3CX8A 3L49A 4O4HF 3ZK8A 3UB4A 3OH8A 2RD2A 2Q50A 3U1BA 2ZXUA 1TKCA 2JIQA 4UMEA 5FHQA 4QUKA 3A1WA 1XAIA 4UUBA 1CP3A 1EUDA 1OI4A 4GUAA 3HJAA 3OCUA 2AFIE 2GXAA 5CBKA 2O8FA 1CS0A 1GSAA 2WWHA 1EB9A 5HRCA 4UHFA 1F6DA 3IBFA 1KRXA 4ZT7A 3HKBB 3D9QX 1II9A 1QV7A 3PVZA 1NJ2A 1JEOA 1UC9A 2HHJA 1BD4A 2WTEA 3C3CA 1DXHA 3JZDA 4LW8A 1P7WA 3RF7A 3OE7D 1KDTA 4OK3A 2XKJE 3PQ8A 2JGRA 4IIVA 4D43A 4EJSC 5ALOA 2WM3A 4O1IA 4FD3A 2B4YA 2GILA 4HMOA 5FX2A 2Z6UA 3CF2A 5CT6A 3RPEA 1J99A 5JNUA 3PE3A 4L8WB 4ZCRA 3GFOA 4W9MC 3BIOA 2JHGA 4Z4IA 5WRFA 1TAUA 3KYIB 2VAPA 5FTMA 3UHFA 4E14A 4E2ZA 2HYIC 3AY6A 1I1NA 3LECA 1WBDA 2CVQA 4J76A 1Y6QA 5IJXA 3UFXB 2O7QA 4X62B 3MMZA 3L5OA 3DQZA 1HZJA 2BFCA 3OPQA 4A8JB 4MRNA 3BZWA 3DTVD 1N8TA 4F91B 1P8AA 3TLXA 3DP9A 3NTLA 3FR7A 2C3UA 3GK3A 1XXHE 1ZICA 2O2DA 1CERA 5M29A 5B2EA 4YQEA 4DMCA 1GD1O 3HDVA 4TQAA 3EQ7A 1W9HA 1XZJA 1HYHA 1QP8A 2B8NA 2O6HA 1MEJA 1M8PA 3O8QA 3RK0A 3HNRA 3WJ1A 4LYDA 3E9ZA 2O8CA 1QGUB 2WFLB 1H2YA 1K9SA 2AYXA 2L17A 4V38A 4NYJQ 3IL2A 4LF4B 2O0JA 4HEQA 2CDRA 1DC3A 2ZJAA 5ECWA 4D0RA 1QGAA 1T5OA 1UT8A 3OLVA 2FPRA 3V46A 4ARIA 2UU9B 2VTBA 4EP1A 2R9VA 3E2MA 4CNBA 1UKBA 4PPNA 4B7CA 3H6KA 1PQYA 1BMFD 4QE3A 3DC2A 2PCJA 2Q1UA 3I73A 1BKSB 1XBTA 4F3TA 1P6UA 1N7GA 4P7BA 5HVNA 3CUUA 3MTDA 2HUNA 4PAGA 1TCAA 5LBIA 2Q0SA 1QH1A 2JJ2A 1IK4A 5ILOA 1WCWA 1DB3A 2NYVA 4FR5A 2OFPA 3UJCA 1YO6A 4MHSA 2XMGA 4L8FA 1EK5A 4MWOA 3KT3A 4M1WA 1QPZA 1I3NA 4TTTS 3K1TA 3BXHA 2QLFA 3ONDA 3IEMA 4EG8A 1C3XA 1KIAA 3S4YA 1E8NA 2QT1A 2GWHA 3LUJA 3S5JA 3U0BA 5CBPB 1POWA 4XR9A 5AW9A 4YC7A 1C29B 3VDMA 3AZPA 4P7GA 4RACA 5DBOA 5FBWB 3Q2OA 1AB5A 1Z6QA 4FC6A 4YRBA 2C2ZA 2IZ0A 3K35A 3NUGA 3CZRA 4GXQA 2HWKA 2DWUA 4NAHA 4C43A 5KYXA 3NJ4A 3LA6A 1OIWA 1E9RA 4DOMA 2TECE 2Q9BA 1SD5A 2ZJOA 4PZLA 4J0KA 3TZLA 4UBKA 1Q1EA 4PPFA 4FS8A 1LDBA 1EINA 1KS2A 1ZOSA 1NW7A 1RRPA 4JXJA 1U5CA 2WSLA 3DPUA 3HJNA 3KAKA 1MABB 2IS4A 1QFMA 2BEUB 2F1IA 3OFKA 4O4LB 3S0JA 2WF5A 4PN3A 1MPTA 1R5NA 3ZXIA 4ZJZA 2OQRA 3GT7A 4F5ZA 2FAXA 4J2OA 3PXGA 1G8YA 1X9IA 1UZLA 2BBTA 4RJTA 1QYIA 1RWBA 3EVAA 3C7KA 2A57A 1SHJA 3I9MA 1ND6A 3OJ0A 3CZCA 3JQ7B 4D5GA 4ONEA 5A9SA 1GWNA 4C4XA 5KWSA 4RVGA 4RFSB 2B36A 2Z3WA 1CU1A 2W22A 2IY8A 1RWWA 5EWMA 4B3HA 5K8LA 4YT2A 1EFLA 2H08A 1O08A 1ODTC 4MUEA 4MW1A 2VTEA 2GXQA 2H7XA 5L3RA 1QVRA 2KI5A 5JTUA 4QOIA 2VF2A 4XYLA 3RV4A 2ECKA 4II3A 4CDNA 3ZE7A 3N07A 5FAKA 2P78A 3ASZA 4NLLA 4RXMA 5SYMA 3RR2A 4OGKA 4MV6A 3AV0B 1ZX1A 4AKEA 2W2KA 3OOHA 2HCRA 2Y0DA 3G1UA 2C5LA 3DB2A 3MWYW 3WIVA 3WQQA 4KE6A 4KO3S 4GNKA 1QG4A 5DNDA 2A0FA 4U02A 1Z68A 4WLOA 2HU2A 4UTZA 3R24A 4C29A 4AJEA 1I01A 2WU1A 1W94A 1F3OA 2K2WA 2PSDA 5EMMA 5J5AA 1LY1A 2IFTA 3NW9A 1M6EX 5JPIA 1NY6A 3T7IA 3PS9A 1ATZA 3WL3A 5J23A 2NNLD 2BVNA 1XZ8A 3OCWA 4Q3NA 1PFVA 2CFTA 1AMNA 3ZH2A 2KB0A 4NBNA 3IAUA 2W2PA 4D26A 1V6SA 4I66A 4A27A 4O2LA 1VKHA 1CJTC 3L7JA 4FW8A 4I9GA 1Z4QA 2RE8A 3VVMA 4H59A 2Z5VA 2PQ0A 2ZJ2A 3TRKA 3RYFB 1LU9A 1S8AA 4OP2A 1E1NA 1PZXA 3ELBA 5ESWA 5T4BA 3WLAA 4S2UA 4C1NA 3OQOA 2FPGA 4M0DA 3CNHA 4NBUA 1L1RA 1FVXA 3HDGA 1CHNA 2BWJA 5EZ6B 3WWPA 3ZHXA 1PWXA 3MLBA 2XD4A 1JEQB 2XBUA 5DGHA 5IK2A 5DIZA 2H4HA 2J5XA 4FHCA 3UG6A 1E1DA 3RI3A 3SSMA 4P35A 4WK0B 3UUEA 1W88A 3R6WA 1ZR2A 2XA1A 4CCWA 3SIXA 1ZVKA 2IIPA 2WTBA 5A3SA 3ZGVA 2JRCA 2MYUA 1C9MA 1KJ9A 1NAIA 3DDZX 2XD9A 3G9QA 4RVHA 1WTCA 4OEHA 3SY8A 4IQFA 2QTVB 3TLBA 3WGHA 2HO4A 4CR6A 1KHTA 5LPNA 3RJTA 2JB9A 1RYHA 1T2FA 4DLWA 3R77A 3ABIA 1NPYA 1RPNA 3BN3A 4Q7KA 4XM0A 3AGQA 1IEWA 4A8JC 5KOHA 2EWMA 3R41A 1J0DA 3UAGA 1UFKA 1GEEA 1RHMA 5ALFA 2HA3A 3SOPA 3WMFA 3CLRC 3KKMA 3OFNA 1EQ2A 5HDBB 1XA3A 2A5GA 3P96A 4AM8A 2A84A 3DNFA 1QV9A 5A4DA 4C14A 1WCIB 3I4CA 3NHBA 2E6UX 3ED5A 2CB0A 3TE7A 4KAXA 4XWTA 1P9WA 1GPUA 2B4RO 4A2WA 4CMHA 2Y27A 3COZA 1ZOLA 1E66A 3PZRA 4FM9A 3IKLA 2ES4A 3OU7A 1I80A 3I01M 3ANTA 3CT6A 4TRNA 3C8ZA 2X8AA 4BPRA 4IGIA 3PJGA 3G82C 4D25A 3GEDA 4Z3DA 3RRZA 1XA0A 1AUXA 5I45A 2YZKA 2C4NA 3RRXA 3BC1A 1WHTA 1PUIA 2GF2A 2IUEA 3C7AA 3QWBA 4R16A 5DN9A 1NXOA 3RUHA 4RJ2A 5B1YA 1RYBA 3KXKA 2PPVA 3BAZA 4WN3A 3IS3A 4K9MA 5FLXA 1MJFA 2OG1A 1PQPA 1TDJA 2J31A 1YQQA 1JR4A 4Q9NA 3U80A 3KZXA 1FL9A 3HXLA 5LD2C 1LVUA 3P2EA 3I62A 1ENPA 2G72A 1ECCA 3DDWA 3QPUA 4DMMA 3CUTA 4V0NA 1XQVA 4IX1A 4E3ZA 4HY3A 4NICA 4MMYB 5FHRA 3CUSA 3D0QA 4DJEC 1M2EA 2I8LA 9GPBA 4W1PA 1GO2A 3I09A 1T8RA 1WXWA 4FYPA 1UXIA 3DLTA 4G8CA 3F3SA 1A77A 1FJHA 1T0IA 2Q6KA 4OJYA 4W5HA 3LX6A 3GFVA 3QENA 4HBZA 3ZCQA 4BCBA 4F9GA 1APBA 3SC6A 4QBFA 1KZ1A 3QVLA 1TAHA 3KALA 3I9OA 3QI7A 3QU4A 1DQYA 4UZSA 5L8VA 2DKFA 1ZK3A 3EDOA 4KREA 3GELA 1E5QA 2PY6A 2VWGA 4KE9A 5IF3A 1BZYA 3HKCA 1QPGA 5DDIP 2B8WA 5FOXA 2B8TA 3R0QA 3BMNA 2BFNA 3I2FA 2P3QA 2Q4DA 3CO5A 5I8PA 2CDBA 5I7RA 1KOFA 3TAXA 3P2OA 3NQ41 5CXXA 4KNWA 2P9FA 3VKVA 3ICCA 3TOZA 3I2GA 4RK6A 1XRQA 4DQUA 4JLWA 2ZM5A 4JI2B 3PTLA 2WT9A 3WLTA 2XSZD 1XU9A 1JDTA 2XUAA 3MMNA 4WOKA 4ZV9A 4E6EA 2ZI4A 3SQXA 3UJPA 1Z12A 4HNQA 3BK2A 3PCXA 2RGNC 2BZSA 3TKLA 4DCGA 1SKUA 3SR4A 1NKVA 2ZWIA 1I4LD 3CQ9A 4EY5A 1K0FA 4GL4A 3G7SA 2WUGA 4HL6A 1L7PA 1FQOA 2FGKA 2HCBA 2VXYA 3HJGA 4RXUA 3DJFA 4JUBA 3R9KA 1R0WA 3T06B 4E15A 2EQBA 2QMEA 4P36A 5DGXA 4B3DA 2ODBA 4EF4A 3H9EO 5FOTA 4A2PA 2OR3A 4KG7A 5EYPA 3M6MD 4H3SA 4QT0A 3V1KA 1NR1A 5GONA 3S1LA 4DLUA 1OBFO 4KQXA 1L8OA 2BUBA 1JIIA 4AL4A 3WO1A 1CUDA 2OQ2A 3BD7A 3BTSA 2WFAA 3S29A 2RONA 4KYTA 1WZCA 1JAHA 1NFRA 1BVYF 1Q0RA 1QDLB 1GQSA 2V7WA 4IX9A 5BW8A 3NLLA 3ZPXA 2HPZA 2QLJA 1UPXA 3CEHA 1OXTA 2Y1KA 3MIZA 4CV2A 1NWCA 4X95A 6CHYA 2NADA 1AGNA 5AHRA 3SHTA 4OB7A 1K1EA 3PEYA 4NQZA 5D51S 1JVBA 2AZMA 2H1FA 5LXTF 1COWD 3I9FA 5KYXB 2PH5A 2P1ZA 5DZSA 3UHAA 3IP7A 1V2GA 4KITB 2RMKA 4UEJA 3TQRA 3UXHA 3QVVA 1S8NA 4FU0A 4EA6A 3FB1A 1PDOA 4NNJA 5A7GA 4JU9A 1ECGA 2Z8YA 3EGVA 3HCPA 3SIRA 1GTL1 1SXGA 2BI4A 2ILVA 2GBFA 1RAIA 4KIGA 3M6LA 1YOVA 5JHGB 1ZIYA 2VWHA 4AFNA 3UMSA 1URPA 5C5EA 2ET6A 4AF6A 3AI2A 5FUYA 3RVRA 3B70A 3GZ4A 4KXQA 4XGRA 2Q1SA 1E3DA 3T0IA 3WE7A 5D7BA 5CFOA 4MPRA 2FNAA 2PZBA 4QUBA 3L40A 4S1NA 4KR3A 4JJFA 3KTAA 1XD9A 3G9ZA 3G0CA 1G2QA 4I4TA 3C39A 5IJ0A 2F1OA 1AGRA 1KJJA 3R7BA 3IUJA 4HEJA 4HZIA 1BW9A 2J3MA 5FWXA 2X9LA 3JWJA 3LS2A 2ZKIA 1KYIA 3AVOA 4UUQA 1UJ6A 3BGVA 4HDSB 4OFBA 4WA7A 5I8ZA 1R3DA 3ELYA 3JD4A 4X1OA 4B6GA 3JD3A 3DLBA 1PGNA 5AP9A 5EOVA 2FFAA 4ZVPA 3BA1A 5KWEA 1WB5A 2OSBA 2P2SA 1C4OA 2VATA 3WZLA 1L4LA 4PTLA 2I3DA 5EJFA 1T2VA 1PVDA 2GBIA 4U9IS 4C4PA 2VTDA 1Q1NA 1IY1A 4B4DA 4NF2A 1YRHA 3ELDA 3ZI4A 1OLUB 2BCEA 1AKUA 4JN6B 3IQDB 4K6KA 3ZQ6A 2VYCA 2ATEA 2Z58A 4OPMA 3EEOA 4UVIA 3G9UA 1ISJA 3FRHA 3GJQA 2X19A 4FXPA 4S35A 1N1EA 3A9UA 4N8EA 4ZHQF 1SPXA 3SXUB 2HIMA 1G20E 3QFRA 2BRUC 3VO2A 1HH4A 3CZ4A 3R7WB 3EXHA 3OTQA 3DBHB 2PLRA 4BLRA 4ITRC 5AKYA 2G6TA 2VXCA 4FKMA 4JVLA 3N0VA 4Q7LA 1B2RA 3MUFA 5KHAA 3ZDFA 4UM5A 1GTRA 1XI2A 3DB1A 1AOXA 4U2DA 1CUHA 4ZQIA 1JH9A 4DXAA 5EJ5A 2JVKA 2O3RA 3GQBA 2QTVA 4FFOA 3O91A 4IGFA 2SHKA 5IUJC 4QUGA 3BA6A 1KDZA 3BM5A 3AR5A 2JRLA 1T43A 1DEXA 3DZCA 3OIUA 3KR0A 4GF5A 1YB5A 3QTLA 4L76A 4LZOA 2VLIA 5BMVF 4WCFB 1DFIA 3KLBA 5C37A 3QVTA 3Q5EA 3W2FA 3ES9A 1L1FA 4HAUA 2NU7A 1UDAA 3WNVA 2C58A 5JDIC 4Q9KA 5BR7A 2ADMA 3HYRA 1GAQA 2JIOA 2D00A 4ZCQA 4DXDA 2OL4A 1D2RA 3FNGA 3TRDA 4U7WA 1CLUA 4DPMA 5KOYA 2AVNA 1GN9A 3C7TA 4B34A 2FMFA 2ID4A 3NI2A 4KQHA 2O48X 3PRKE 3T15A 5EUMA 4BEJA 2IPXA 4BVAA 3NHLA 2A5FA 1G5QA 2R96A 2WWWA 1UBEA 3RWMB 4C0HA 5JWRA 2EARA 1CQJB 1M8FA 2AN4A 5AK4A 2NO7A 1L7OA 4NULA 5BWBA 2D5CA 3V7FA 4BMZA 2G8NA 1R8YA 4J4HA 4LYJA 4R54A 4E94A 1ZOPA 5L51A 2EX4A 4LOHA 4RVUA 2VH5R 5AKGA 4E11A 1QGOA 4JLUA 4PSAA 3SZOA 1SXHA 3QXHA 5I9BA 5IC6A 1DDGA 5DKFA 1EGAA 1L6RA 1LDGA 2B2CA 2FUKA 1UBSB 1B0PA 1HQCA 1R5JA 2FK7A 2FOIA 2P9HA 3B60A 1UBFA 1QYCA 1RAFA 5HRUA 2AA3A 3BERA 3RTBA 3OJXA 1E3WA 3KJNA 1FUIA 4JVOA 1TZKA 3EXAA 1D3AA 1CQWA 1T0BA 4LYGA 1RAGA 1VL6A 1JYFA 2BFBB 3KO8A 4OHCA 3RT1A 3S2IA 4IZHA 3AVVA 5B64A 3F47A 4K3VA 5LWHA 1BHJA 2D4AA 3NYWA 2ZI7A 2F3PA 2IZ5A 3A9TA 3USES 2WVHA 1QIFA 3M6AA 4RC9A 3BMQB 5DHAA 2FEKA 5CU7A 4DABA 2ZR7A 4Q4LA 4GYJA 3GMDA 3AL0C 3A6ZA 1IUNA 3H1AA 3OSUA 4TVKA 4CGYA 4Y2YA 4MUXA 2RHMA 4HGPA 3U37A 3WJ2A 1KAGA 2D2XA 3HY3A 2Q3JA 3JATB 2BSXA 4EG0A 4ZFNA 2CHEA 5TMPA 5HILA 4CL8A 1D9ZA 1VDMA 1E2EA 2ZPUA 4CVNA 1ZH4A 2I71A 3UJHA 3FX2A 3H13A 2OHOA 2HPHA 2NVBA 1X9HA 3QSYA 5A3RA 1VJ1A 3KYCA 3H19A 1N36B 3TYXA 3KVVA 3ZDAA 2IUFA 4P4GA 1QYXA 1HE1C 1VBMA 2A7QA 1O89A 2FPKA 3MZ0A 2WAAA 1GXSB 1SUIA 2QE7A 1DUVG 1XDGA 4J1SA 1BWSA 1B8UA 3C70A 1YZ3A 4J29A 5D6NA 2IPAB 4D57A 6PFKA 3LY5A 2P3OA 4QSMA 2A5JA 4RVOA 2YNMC 3W5CA 5CVVA 3GDWA 2XQIA 3DTVB 4GZMA 5CH8A 3E84A 5GAJA 3TIXB 4ODIA 4TT3A 4A16A 3FR8A 2PO5A 4J0GA 4C5CA 1RRMA 2AZXA 3KM0A 3D3KA 2UZ3A 3K8OE 2OECA 4K9QA 5HMMA 2C7BA 5LZ5A 4Z53A 2E37A 2OCPA 3WGLA 4R1PA 4ZREA 4F3CA 2VZEA 3VZQA 4ZZ2A 1A96A 4PCUA 3O0TA 4ZO9A 4MDEA 2OGTA 2QI9C 4Q4AA 2HWWA 4TXMA 5K6AC 3TFOA 1C7QA 2NYUA 3P8ZA 4JJAA 4MW7A 2CDAA 3LBYA 1C9YA 1Q74A 3EIXA 1IMJA 3FCEA 4Y30A 1L4MA 2GDJA 1TPYA 4GXTA 4CUKA 3V7WA 3RIMA 3LJKA 1IC6A 4M76B 1KQGA 2EJUA 1ZRMA 1I1QB 4AQ7A 2BZ1A 3SR0A 3NDPA 5L4NA 1GKLA 1EM6A 1HDEA 2QJRA 2ZJFA 3RS9A 1QP7A 1TJ4A 4RFLA 1ODLA 5E1DA 3OPYA 5ALEA 3U44B 3W1EA 1NMSA 1G4UR 5E95A 5AW0A 3OCXA 4HLUA 4TV9F 2ALJA 5F1YA 4OI0A 5CDYA 3DSRA 2H65A 2LRHA 1VG0B 3RYIB 3DQQA 1J07A 2IYXA 4RBNA 3DBLA 5TNXA 3ROEA 1XR3A 3U81A 4BJ6A 1Z0DA 4EB6B 5ADHA 5IM4A 3KSUA 4REMA 4Q1CA 5C7LO 4RKYA 3A28A 3I64A 4G3XA 1CY1A 1T2EA 4LZPA 4JLBA 2I1LA 4EM6A 5EIEA 2LIPA 3O03A 4ND6A 4MEBA 3W06A 4GM4A 4B09A 2I34A 4YRJA 3GGGA 3AFMA 1JWAB 1ZGGA 1VJCA 3C87A 3H9QA 3O8QB 4NEHB 4BDSA 4C7JA 3NTRA 1K8XB 4AZVA 3MAJA 4PG5A 1WNTA 2YTZA 4DLVA 2Q1WA 1HDCA 4GVXA 3TGPA 4U00A 1X3LA 2B1IA 3PRHA 4KIUA 3ZLVA 4G2NA 4ZJUA 4TTAA 5CIYA 3F96A 2CXOA 3RSQA 2AJ8A 2XNDA 3EIUA 3GARA 3P9NA 1KZGB 5C4MA 1KHHA 2HEIA 5DEIA 2ID7A 4CM8B 1MO4A 3WDMA 4QNMA 1W4ZA 3F6PA 4LGMA 1UJNA 1DCMA 1KAEA 2DFTA 4DR3B 3GP5A 3NWPA 5DTEA 5REQB 1E3LA 4B40A 4ZZ0A 1PL6A 4DNQA 2JEYA 3JQAA 4Z0TA 2PRYA 4QJBA 1VYHA 5DO9A 1QIGA 3A1FA 4CM9D 3JQGA 1BWPA 3N0RA 2FFJA 2BLNA 5K5EA 3ANXA 4BE7B 3FHCB 3IMEA 2O8VA 1E2FA 2MMCA 3VR3D 3D7RA 2PUWA 3DV0A 3FPLA 3HRKA 3KG2A 4KE7A 2IOFA 4Q03A 2I78A 1EI9A 1JBQA 1RP7A 3EQ9A 3DE1X 4NBLA 3AHCA 5FPKA 1ISHA 1MDFA 3S8MA 1W52X 2I6TA 4RK1A 5HKKA 1GZUA 2CLMB 2WE8A 2QN3A 1ODIA 3AUAA 4IS3A 4QQNA 5KTMA 1KU6A 1YUMA 3FMIA 1RWNA 3HVKA 3LDUA 3BXXA 1ZESA 4MVJD 4DIKA 3ZGXA 2B34A 2FQYA 5JMPA 3AUJB 3BK1A 3OFND 4H1TA 3LT2A 2CJWA 3DMYA 4KMOA 4WHMA 3FYDA 4NJMA 3MJVA 2K7FA 4Z54A 1YQXA 1ZM9A 1V6CA 3JRWA 4RA9B 1I2AA 5F2NA 3CO0S 1G59A 2W6CX 4WFQA 5A62A 4Q4CA 1W0JA 4M1TA 3TQHA 2ZS8A 1JZTA 1L4NA 3C3JA 1SB8A 3ZBPA 5LYJB 2AE2A 1NULA 3PEUA 3DFKA 3TTXA 2IOFK 4FE3A 5BR4A 5FTLA 2HU7A 1L4BA 3BBLA 3ZIUA 4JJ4A 3ZWDA 3HO1A 4F71A 4L95C 3PX7A 1W2WB 5EQFA 1B8PA 5JU6A 1WUHS 3ND6A 2KMLA 4EZIA 3LQ1A 3JPWA 4KEAA 1P17A 1S7CA 1VZ2A 2HI0A 3CF6R 2P30A 3D0OA 4G67A 1C41A 4RPGA 1EGMB 4W7SA 1ZUHA 5TC4A 4U2KA 3DULA 1UXGA 4MVJG 4EVQA 5MN4A 1HYEA 5K8CA 1EA5A 4W5QA 1W1WA 3LOUA 4OQFA 5LJIA 4HSGA 4IMRA 1NFQA 2YJNA 4GQAA 3ZDRA 1RADA 3KKLA 3WGYA 2A30A 3WK5A 4EX7A 3OJEA 1E8MA 5CLIA 1UBNA 5LN1A 4EVSA 2XMSA 4C0QC 3J80A 2QVBA 1Y8QA 1J8DA 1ISPA 4V0MA 4MQ5A 2G1PA 1UZUA 2M6KA 5EHIA 3B9QA 4WSOA 3RHFA 4A23A 4EPWA 3PQ3A 2CWDA 1TX4B 1GA1A 2O1WA 4C7VA 2I6GA 4AICA 4A5SA 3ZUPA 2J8ZA 4E03A 1I5EA 1M0SA 2IUYA 3B1ZA 3DR3A 4LTMA 5AXCA 4DUZB 2UXBB 3PA6A 1KJ8A 1Y8AA 5H9WA 4NZYA 3QVGB 4E2FA 4IGAA 5KX5F 3L4JA 4DEXA 2OORA 2UYYA 2EIXA 4QOSA 1UQUA 3DE5X 1LWOA 1UBGA 3OQJA 4XOUA 4JB8A 3N3AC 5E6SA 4W1QA 3LUPA 4H7FA 3K53A 3ILXA 1Z7EA 1TEVA 4MYDA 3BE6A 4H0CA 4FDVA 1L5KA 1PR2A 1J90A 5GPBA 5IABA 1XQ6A 3U7IA 5K6RA 2CHGA 4WWHA 4W5TA 2RHDA 2BM1A 3GROA 2N75A 1RVV1 1K7CA 4D74A 5E6RA 4I2NA 2YW9A 3TDMA 3UK2A 1RFGE 3QLVC 5DOZA 1NGSA 2B1QA 3O90A 3WKBA 3NM4A 1NYQA 5IM5A 1C81A 1TW2A 2C29D 2Q8QA 1SUPA 2VAVA 2YWEA 3RODA 2WEKA 3UW3A 4DR5B 4ARCA 1VLHA 1KA9H 3VC7A 1K92A 3CZMA 4HDMB 2DPMA 4QTYA 1MAWA 3QJGA 1NQTA 1SVWA 4KPUA 1SY7A 1H9BA 5E2BA 3TDNA 1DAKA 1OH7A 4MR8B 1UKCA 3GMSA 5I8WA 1FYXA 3JASA 4MGYR 1JDUA 1FTNA 1VRWA 5AHWA 3K8YA 3B82A 3BHJA 1DIHA 1E99A 3ISVA 3LIIA 1U2TA 3M9XA 5ALSA 1QIMA 4WBNB 1TM7E 1XNQB 1I10A 1EM8B 3HU3A 4XYEA 1E8DA 5AJHA 1O5TA 2Q5LA 4HEHA 4OQZA 5I7HA 4RULA 3GGOA 2IS2A 5DCYA