2GAFA

Crystal structure of the vaccinia polyadenylate polymerase heterodimer (apo form)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
297
structure length
286
Chain Sequence
MDVVSLDKPFMYFEEIDNELDYEPESKKLPYQGQLKLLLGELFFLSKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVASPSTADLLSNYALQNVMISILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDYPNQEYDYFHMYFMLRTVYCNKTFPTTKAKVLFLQQSIFRFLNIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase
publication title Crystal structures of the vaccinia virus polyadenylate polymerase heterodimer: insights into ATP selectivity and processivity.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Transferase
total genus 93
structure length 286
sequence length 297
ec nomenclature
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01358 PARP_regulatory Poly A polymerase regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2gafA00
4RTMA 5LQNA 1KYZA 3SX0A 3BZBA 2Z6QA 1IXKA 1I1NA 5DM2A 1TPYA 2V74B 4X41A 3UBTA 4YMGA 1IM8A 2N47A 1YZHA 4LWOA 2ZCJA 2IFTA 3KPVA 4MHTA 2ERCA 2NYUA 4RVHA 2YTZA 4HTFB 4ZTBA 2P7IA 4BLUA 1I9GA 5EIWA 5EMMA 5CVUA 2BH2A 5FQNA 5H02A 4PYLA 1KPHA 4FS8A 1JR4A 3EVEA 3NWEA 4F85A 4YMHA 3KQOA 2OPBA 3HCFA 5DTRA 2P7HA 2IIPA 3UJDA 5ERGB 3CC8A 1VLMA 2YXEA 1G6Q1 3KQQA 1QZZA 3M6UA 5FQOA 4HGYA 5GP1A 5BXYA 4OBXA 3EGIA 1B42A 5CVJA 4E2XA 3BGVA 3O31A 2KW5A 3KKZA 3UFBA 1RJDA 4C07A 1RJEA 1YB2A 2OBFA 1D2CA 4MQ4A 4OQEA 2BR4A 3P9CA 4DQ0A 5K09A 1YFLA 1RI4A 3IEIA 3EVGA 2AVDA 3MERA 1M0EA 3LL7A 5K0CA 3FPGA 3M6WA 3B3JA 1H1DA 3HCDA 4PYNA 3TLJA 4AZWA 4FGZA 3ER8A 3HA7A 1KPIA 4XUCA 1M6EX 1WY7A 2HR1A 5EC8A 3HVJA 1JQ3A 2PJDA 4R8RA 3GRZA 3KQTA 2Y1XA 1KXZA 3NDIA 3PS9A 5DX8A 3V8VA 1WZNA 2P8JA 2ZFUA 3FTEA 4EKGA 3T7TA 2DULA 3OFKA 10MHA 2P40A 3I58A 5C9ZA 4QVGA 3NW9A 2CL5A 3TRKA 3DLIA 4BLWA 2UZ4A 2QY6A 2JHAA 2CMHA 3LHDA 3HM2A 2GA9A 4P7KA 5LQAA 1JSXA 3EVZA 4PYOA 3M70A 4R8SA 1SUSA 3FUTA 3HCEA 1NW6A 3ID6C 3PFHA 4Y30A 4KVZA 4FZVA 5DRTA 4AZTA 3LCUA 3NWBA 4E70A 2AN4A 2AOXA 2PY6A 3LPMA 1KR5A 1QYRA 2YX1A 1UWVA 2YXDA 2PSSA 3KQWA 4R6WA 1DCTA 2UYHA 4QTTB 5DSTA 2AOUA 1F3LA 1XJ5A 3B3GA 1VPTA 3RODA 5C1IA 3G2OA 2WA2A 2NP7A 5K03A 2GLUA 3BWMA 4FP9A 5CVVA 5G02A 4QDKA 4AUKA 3KR0A 2IBSA 2ONYA 3ERCA 4B17A 3G89A 5EVJA 5CCBA 2P3LA 5E1DA 4HG2A 2HTEA 3C3YA 1XDUA 2XYQA 3B89A 3NTVA 3BT7A 1Q0TA 5DTQA 4DA4A 3FRHA 5E9QA 3NVMB 3TR6A 4LECA 2EX4A 2Q41A 9MHTA 1L1EA 2OY0A 3AJDA 4GQBA 4OX9Y 3OZRA 2P3QA 3QOWA 2PKWA 5F2NA 4CTJA 4EKIA 3FTCA 3EGEA 3FYDA 3QV2A 2BM8A 2VZ9A 4QQKA 5D1NA 2IBTA 5FA5A 4A6DA 2VP3A 2V7EA 3CCFA 3P2KA 5EMLA 2G71A 1DL5A 2AOTA 1JTFA 4Z2YA 1SG9A 3DP7A 1NBIA 4BLVA 3AXTA 4OBWA 3BKWA 3T7RA 3LBFA 5KYGA 2EJTA 1R18A 4PIPA 3UJAA 2O07A 2PXXA 4PYKA 1NT2A 1QAMA 3BWBA 3PVCA 4BP3A 2I7CA 5K8VA 2NXJA 3LDUA 3KQYA 3UJBA 3SSNA 2FRXA 3SGLA 5E8RA 2FHPA 5K0GA 3MCTA 1R00A 5EZSA 5BW5A 4IV8A 3EVFA 2ZZKA 4PIMA 5KQRA 1UIRA 5DXJA 4MTLA 2B78A 4UOEA 2G1PA 2QRVB 4WXHA 1EQAA 1EG2A 2EG5A 2OZVA 5GM1A 3GU3A 3PB3A 3SSOA 4GUAA 2AVNA 4HSGA 2GH1A 4PCLA 5IH3A 4Y2HA 3JWIA 3UJ9A 4DZRA 4U7TB 1Y8CA 3DMHA 5EIFA 3THSA 2JG3A 5T64A 5LSAA 5T67A 1RI1A 3G7UA 3OU7A 1WS6A 3G88A 1NE2A 2JJQA 2NXCA 3BKXA 3L8DA 4GC5A 4CKEA 5CVDA 5GOZA 3HCBA 5T6BA 3LCVB 5LQRA 2BR5A 2ZBPA 4KIFA 1G8AA 3EMBA 1EIZA 1Q0SA 5HOQA 2Z6AA 4OQDA 4C04A 2FYTA 1ZG3A 2H1RA 5GIOE 3IHTA 2YVLA 2GB4A 2AOUB 3DXZA 3GRRA 3LDGA 3MQ2A 3Q87B 2UYCA 4KRGA 2P35A 3DLCA 3IV6A 3M6VA 4YV1A 2NNWB 3TQSA 3C6KA 3D2LA 3I9FA 4ER0A 1G55A 5DLYA 2C7QA 5FTWA 5FWDA 5DSXA 4EVIA 2LD4A 5KVAA 4GEKA 2JHCA 4M38A 4X1OA 1G60A 4P7GA 2IH5A 1I4WA 5EMKA 3R9XB 1RJFA 2F8LA 2AOVA 4PGHA 3E8SA 5E2AA 2PT9A 4PYQA 5LQCA 5JR3A 3KPJA 2PV0A 1QANA 4POOA 5BW4A 5CCXA 3E23A 4U7PB 1IY9A 2OKCA 1TW3A 2PT6A 2DPMA 3EVCA 1EJ6A 4DMGA 3PLAE 1FP1D 1M6YA 1XDSA 3NVKI 3ELYA 3FUVA 3OZSA 2YXLA 4PONA 3FTFA 1FPQA 1AQIA 1SQFA 1ORHA 1JG2A 2QE6A 3HVHA 3KPWA 1WG8A 2HNKA 5FWAA 2AOTB 5CD1A 4PYJA 3UA4A 5JUWA 2QRVA 1KHHA 5E2BA 2IP2A 4PNEA 5CIYA 3BWCA 3CJTA 1F38A 1P1BA 2CKDA 3DMFA 3OPNA 3SR4A 4OA8A 4DCGA 2VDVE 2ADMA 3KQVA 1XCJA 1NW3A 4P7FA 3CJRA 3ANXA 5ICEA 3TFWA 4OA5A 2HV9A 5HIKA 3KR2A 2ZSUA 3FYCA 3HA5A 3R6TA 5DM0A 1JG3A 4RTPA 1BHJA 2GPYA 5E9WA 2ZLBA 4XUEA 3PTAA 4CTKA 3I64A 3KQMA 4MWZA 4RX1A 5B1SA 3OU2A 1NW7A 4KW7A 3WSTA 3DUWA 3FPHA 3PFGA 4DF3A 1P1CA 2O05A 4BY9E 2I62A 4YV2A 3I5UA 2OB2A 3P9IA 3TM4A 3GRVA 3JWGA 4JXJA 2NXEA 1ZKDA 3NDJA 1L9KA 4V0QA 3GRYA 5E1MA 1NKVA 3K6RA 3UA3A 2ZWAA 3CGGA 5KQSA 2IDJA 2IGTA 3O7WA 4ER3A 2B2CA 3OZTA 3TOSA 4C03A 5EKXA 3FZGA 3HNRA 3CBGA 1VBFA 5DRYA 2AS0A 4KIGA 3UWPA 1U2ZA 4RTJA 3IYLW 2PX5A 3PT9A 2ZZNA 2OXTA 1VP3A 4YUZA 4X61A 4IKPA 4E30A 3G2PA 1R8YA 2Z6UA 2O0LA 5ICCA 4CKBA 3KPYA 4QDJA 1X19A 2IH2A 1VQ1A 2ESRA 1FBNA 4HRAA 1ZGJA 4RVFA 1YF3A 2YUIA 3C6MA 3FPEA 2AOWA 1QAOA 2P41A 1MJFA 4FR0A 5EG5A 1ZQ9A 3OU6A 4DKJA 1O54A 3ELUA 5K01A 5IKMA 1XXLA 3MB5A 3BWYA 4QTUB 2I9KA 3GIWA 4XCXA 1VE3A 4FT4A 1RI2A 3NMUF 1X1CA 2O06A 3ELWA 1R8XA 3LDFA 3M33A 2BM9A 4RVGA 1DUSA 3G2MA 3LGAA 3TKYA 3UJ7A 3LX6A 4GOLD 1XVAA 3EVAA 3GO4A 2PWPA 2ZIGA 5EMJA 3U81A 2E5WA 2XVAA 2FK7A 2ONZA 3FRIA 3R24A 5DXAA 1AV6A 3JWJA 2B9EA 4IV0A 1NV9A 3E05A 2XVMA 3DXXA 4KWCA 3EVBA 4GOOD 5DM4A 3G5LA 3TKAA 4CKCA 4ER6A 2G8NA 3CKKA 3ELDA 1SUIA 4HGZA 4F86A 3GXOA 3B3FA 2PX4A 3DXYA 3P2IA 3QOXA 1QAQA 1N7IA 1KIAA 3VC1A 3X0DA 2R6ZA 5K0JA 2FK8A 5EQJB 3E7PA 5E9JA 5CM2Z 3C0KA 2P3OA 3BUSA 3KPUA 3GCZA 3M6XA 5EZQA 5MHTA 4RTQA 1ORIA 4HC4A 3HCCA 4RWZA 2C7PA 2ZZMA 3H2BA 3ER9A 2ZVJA 2OYRA 3BXOA 3P97A 5C0OE 2ZIEA 4P58A 4RSRA 1MHTA 1Z3CA 1R74A 4RTKA 4PWYA 4GF5A 1R6AA 5GM2A 2B25A 4DM3A 1FP2A 2PLWA 3NJRA 3P8ZA 2PXCA 2P1DA 4E33A 2EJUA 2K4MA 3T0IA 4DCMA 4RTSA 4WVLA 2EFJA 1G38A 3ORHA 5K0FA 4QPPA 4RTOA 1NW5A 1D2GA 3LCCA 2JH9A 3HEMA 1NW8A 3HTXA 3FTDA 3GRUA 5DTMA 3DOUA 2GAFA 3UJ8A 2UYQA 5ICFA 2YQZA 1INLA 2JH8A 2FPOA 3AY0A 3DTNA 3G5TA 3I53A 3PX2A 2WK1A 3KQSA 2FCAA 3Q7EA 4X60A 2B3TA 3SM3A 4YUYA 5K0BA 1NBHA 3B7PA 5E1OA 2I6GA 3RW9A 1UFKA 5K05A 2PWYA 2IPXA 2CWWA 3FPFA 3HP7A 2BR3A 2HWKA 3A7DA 3VSEA 4AZVA 4A6EA 3A25A 1JSZA 4L7VA 3TM5A 3KHKA 3UJCA 2ORED 2UYOA 2PVCA 1FJXA 3P9KA 5EPEA 1O9GA 5ICGA 4C06A 2QYOA 2IDKA 4M36A 1AQJA 1VIDA 4EMSA 4R05A 2G72A 3FUXA 3LBYA 1N2XA 3FUUA 4MIKA 1XTPA 4RTNA 1L3IA 2XYRA 5DT2A 4M37A 2BZGA 3P9NA 1SQGA 2A14A 3BGDA 5M5BA 1T43A 3CVOA 5FULA 4KDRA 1JG4A 3R0QA 4NECA 2PX2A 5K0LA 2ZBRA 3OFJA 4FT2A 1X1BA 4EK9A 1SKMA 3G2QA 5FADA 1KPGA 4RV9A 2ZIFA 4EQZA 4KDCA 2JHPA 3DR5A 5FHQA 3AXSA 3HCAA 5GINE 4E32A 4E2YA 3MAGA 5CUQA 3REOA 3BGIA 4LWPA 4ISCA 4XUDA 5HIMA 3V97A 2XYVA 4YUVA 1XDZA 4CXMA 2YR0A 3DMGA 3LSTA 5CVEA 4C08A 3GNLA 4C4AA 4F84A 3VYWA 1O9HA 4E2WA 4K6MA 3O4FA 4O29A 2PX8A 3G8AA 3MGGA 1YZ3A 5F2OA 5FA8A 3SMQA 5FHRA 5P8WA 4ER7A 5HIIA 3K0BA 5GIPE 5E8JA 3OE5A 1WXWA 1EAMA 5HIJA 4M7RA 1L3CA 5HZMA 4PYIA 5HILA 4PGGA 3P2EA 5D1HA 3S68A 3CJQA 3TMAA 3MHTA 3LKDA 1SVUA 4YUWA 4FSDA 4HTFA 7MHTA 4R6XA 2WA1A 3FPJA 5LQKA 2VDUE 3A4TA 3MTEA 4G56A 2O57A 4ATNA 3JWHA 1V39A 4YV0A 1JQEA 1RI5A 5U4XA 2AR0A 2ZULA 3G8BA 3P71T 3A26A 4GOND 2C7OA 1TW2A 3MTIA 3KQPA 5DX0A 2C7RA 2OB1A 4HH4A 1PRYA 2PBFA 3DH0A 4RYLA 1WXXA 2ZWVA 3AWIA 3LECA 1HNNA 4E2ZA 5KS2A 5K0EA 1KP9A 1EJ0A 4QVKA 4QQNA 3B5IA 5HEKA 1RI3A 4V0RA 2AN3A 3A27A 4GBED 4X63A 5DPMA 4RTLA 1PJZA 3R3HA 3C3PA 5K0NA 3GDHA 2H11A 5EEHA 3UZUA 1P39A 1RJGA 4AZSA 1XCLA 3OCJA 3RIEA 2ZW9A 3SXJA 1JQDA 2HMYB 5HFJA 5GWXA 5FCDA 5DWQA 1BKYA 3LKZA 5FUBA 1KYWA 2XBMA 3EEYA 2QM3A 3FUWA 5EHGA 2R3SA 3EPPA 4YUXA 1D2HA 5LQJA 1OR8A 1YUBA 3TPZA 2VS1A 3PX3A 4BP1A 2NXNA 2GS9A 2ZTHA 4IWNA 1HMYA 4QPNA 5EOVA 2IH4A 3ME5A 2Y1WA 1BC5A 2ZBQA 4ER5A 4H0NA 5EEGA 1YFJA 3HVKA 4LG1A 2OO3A 3DULA 3SVZA 1VL5A 3A7EA 4AX8A 4FSXA 5EHIA 3KR9A 5EKUA 4C05A 3EEOA 1JTEA 2CMGA 2PGXA 3EVDA 4RTRA 8MHTA 4E31A 1ZHFA 3EMDA 1BOOA 4PCAA 2NP6A 5DX1A 3SSMA 1N7JA 1X1AA 3THRA 3GGDA 1G8SA 3F4KA 3OE4A 4P7JA 4PINA 4CWAA 5LR6A 3GJYA 3EGVA 4GOMD 1P91A 3HVIA 1X1DA 4PYMA 4GC9A 2AZTA 5E1BA 2PXAA 3HA3A 5LQUA 2G70A 2H00A 3KU1A 3MCZA 1L3BA 1NV8A 1VP9A 3T7SA 2AN5A 4RVDA 5DM1A 5BP7A 1AF7A 5F2KA 2VDWA 3UJ6A 1JG1A 5EGSA 1ZGAA 3VC2A 3GWZA 3KR1A 3M4XA
chains in the Genus database with same CATH superfamily
1HDCA 3DO6A 2BGRA 4HP8A 3RVKA 1O87A 3N2LA 5JHGB 1C9JA 1H2YA 2DSNA 2HIGA 2OEPA 3AHFA 5D85A 3LE8A 4US1R 5JT1A 1K4YA 3E18A 3OFVA 1PJ3A 2ZS7A 1ZM7A 3BMCB 2ACWA 3L4EA 3RNLA 2YFQA 4DV5B 4A36A 1VG8A 2BFDA 4JK3A 2BLLA 1P0PA 4XYLA 4PRKA 2X15A 2DUWA 4D82A 2B98A 3BRWA 2NUPB 2YKGA 4I9GA 1PWXA 1B4DA 4HV4A 4KREA 5SZIA 2IXDA 3KLBA 4O4LA 1PDWA 3ZJVA 1I9CA 2QD3A 3EXFB 3HB0A 3THYA 1VDZA 2JATA 4YMHA 4ZREA 3B13B 3HCFA 3DD5A 5KHOC 4LOHA 1D4AA 5DN6D 1OH8A 1J33A 4KI7A 3HN6A 4EO7A 5BXYA 2H4ZA 1EQ2A 2XUPA 3Q10A 2FLKA 1OGIA 1TO6A 1V8OA 1W59A 1U02A 2D4AA 4FYMA 4GICA 4WLNA 4JUDX 3X1WA 3EWIA 4KX5A 3T9DA 5EUQB 2OBFA 3R7LA 3VKUA 2NSDA 2XWQA 5CR9A 1XQ6A 4IJQA 1XU4A 4OQLA 4OQEA 4ZQCB 2ZR9A 4GVPA 2ZPAA 4E0BA 821PA 3THXA 2CWDA 4JB3A 2H5LA 3MTBA 3PEVA 5BSEA 1D09A 2XF2A 2XYHA 3QW2A 4PYNA 4EUEA 1FW6A 2HJGA 4EYQA 3T61A 3HA7A 2EQBA 4NAHA 2C77A 2V4UA 4ETIA 3KTFA 4IVQA 5ELXA 4P5DA 1X1RA 4MAFA 2OXCA 1UWLA 2XW6A 3V8VA 5DN9A 1JWBB 4Z54A 1CNMA 2GBIA 3AV0B 5G3YA 1XTJA 5J47A 4NBVA 1M2VA 1MX9A 3STXA 3JAMA 1BE8A 3TRKA 1IEQA 3VR3D 2P67A 2Z9DA 3MS2A 5CH8A 2ISCA 1H6DA 1ZOSA 2XTNA 5F1PA 4ZVOA 5HE9A 1LVUA 5KYKA 3CVWA 4JSYA 3LQKA 4WZBE 3OT5A 1X0VA 1E5XA 1GZ6A 2ZWIA 2DTEA 2PJUA 2ZATA 3LPMA 4AJNA 1XPRA 4DLTA 4BEVA 1LA2A 5GAJA 1SXJC 3QA9A 1YZGA 4CTOA 1T2DA 4EPYA 2RHGB 1IHPA 1JEDA 3A6KA 4KPEC 1K9VF 5C8YF 5D5QA 1G4AE 2GPJA 4ZT5A 4C2UA 1D07A 4QJ4A 5FAXA 1N9ZA 5C8ZA 1UZMA 3L8GA 4HYTA 4OXXA 2NP7A 3G6KA 2J5QA 4LNHA 2BJHA 3H7AA 5H3HA 4M2LA 2X2FA 3EFEA 3V3KA 1DARA 1NATA 1R6BX 1LBTA 3QKSB 4Q24A 2DY1A 3O3OB 1GILA 3MAAC 5LLTA 4MI9A 4HG2A 4DLXA 3T0GA 3C3YA 1K86A 1SWWA 2LWIA 3AESB 1C3JA 2WICA 2BM1A 2WZDA 4P3PA 3UW1A 3U61B 2IHKA 1O0BA 4X3OA 1KKLA 1JU9A 1KNXA 1HDXA 4I3HA 4YNBA 1DDGA 4R2XA 5INTA 5F2NA 2JD1A 3UGJA 5GJWC 3O5AA 1MQ9A 1Y1PA 4QQRA 1PZHA 1F8UA 5FNVB 5JSKA 2CBGA 4DJTA 5BMVA 3O47A 1QCDA 3LVRE 2IF0A 4LKOA 5AIAA 2G0AA 2PRYA 4MUKA 5E6UB 2QEQA 4BUZA 4ZGWA 1X74A 4I55F 1Y82A 3OKAA 2VNAA 4RZSA 4G0ZA 4RSGA 3BJIC 2WMDA 4ZO9A 1LBIA 4EIWA 4ZI7A 9ATCA 5LDDC 2NVBA 3LNCA 3I6ZA 1WMFA 2HRRA 4OFZA 3UGQA 4ENWA 4JFRA 4OQXA 4BYMA 4FQ7A 4TVSA 3ES9A 4TYWA 2VYFA 1DX9A 3CG0A 1Q22A 5DMXA 1ZGCA 4DB4A 4HBZA 3EAQA 4LJSA 1E1LA 2B36A 1Z6XA 3NXKA 3PG5A 2VP6A 4QPDA 1L1FA 4DXHA 1I5RA 3MJVA 3X1DA 2PKCA 1GD1O 1I36A 3TRIA 3D3KA 1ADFA 1IK6A 1TMGE 2DKNA 2JGRA 1FOEB 5ALRA 3AERA 5BW6B 1T8RA 4RKFA 3WLAA 1U9JA 2PIAA 3UUGA 4DMKA 4DHEA 2JI7A 4MITA 3LK7A 5SZHB 3ASYA 4FW9A 5AHRA 1ABBA 1WQ4A 1SVNA 1UKBA 3ZIUA 4G5YA 5A4AA 4C0JA 4CDGA 4ISBA 3LHIA 3TEFA 4CEJB 1Z5VA 4HKTA 3L04A 1F2VA 2R7NA 4WFIA 1DXHA 1RI1A 2EZ8A 1Z47A 2AJ8A 3KHUA 3L07A 1GZVA 3GZNA 5GMOA 4C3ZA 3RRYA 1DZIA 2BGJA 3KVNA 3LCVB 2PYIA 4Q7EA 2RH4A 3M89A 2QX7A 3QWBA 4V0ME 1EIZA 1W49A 3WO0A 1PZMA 4D8VA 5BSWA 1QQTA 1XBTA 1GNTA 2ZEJA 2C7GA 3DCJA 3IVRA 4RY2A 1PQPA 2VSNA 4BVGA 3CZ5A 5IYZF 5AW9A 5IJ9B 1ZVQA 2AFRA 4GLLA 4MR9A 1LGYA 2F3PA 2YDXA 4KX3A 4X1YA 3ZDXB 4HT3B 3PA6A 3HBLA 3W4JA 5D84A 2A5JA 4HYQA 1YDHA 3GPDG 3DAGA 4JSTA 1UQRA 4Z5XA 4WXEA 5E2AA 2HT1A 1QH1A 3JQAB 4XGNA 3H18A 3ZZMA 2R47A 2ZJ2A 3I4FA 4QBFA 1WHSB 4CIBA 1RLIA 4PXSA 5JZBA 1C0PA 2HMVA 2OG1A 3LCRA 2H51A 2E4UA 2Q3HA 1E4VA 4YRGA 1TTHA 3M0EA 4AZ0A 1FP1D 4Q3DA 4XPZA 2O8CB 4I3FA 4LRSB 3QVUA 2J3IA 4EGJA 3JASA 4E15A 4CKWB 1Z0AA 4ERXA 2C9YA 3ZHXA 3GZJA 3W3AH 3U9LA 4IO1A 4B34A 4F4FA 3S2GA 4M0EA 3VKHA 2ZTVA 4LMBA 4LE2A 2ARKA 4D6XA 1S3FA 2E4VA 3SC3A 3W6UA 3OZXA 8ATCA 5AVOA 3GCGA 1OXSC 4MUJA 4YMLA 3UKJA 1P9RA 2ZYHA 4LOLA 1GTJ1 3OHSX 1VI5A 1E20A 3KQVA 5I48A 1M1UA 3I6QA 3SN6A 1YIAA 4R5MA 4RACA 3QXSA 5CDHA 5JS8A 3IEMA 1WA5A 5DBFA 2A5DA 1FQKA 1GFZA 5HIKA 4E7OA 3HEBA 4N6OA 5KNCA 1SHZA 2FWNA 3LHKA 3J81k 1I51A 1I4OA 4LY6A 3IDOA 4N6GA 1MEJA 2NMVA 5CH3A 5F5XA 1ECCA 1TJ3A 2J0UA 1Z8HA 2PANA 3BB4A 3LCMA 3P2JA 3WDSA 2ZSBA 3S6JA 5NULA 1TYDE 5EIHA 1G63A 3BL5A 1FNDA 4B2YA 3O9ZA 1YDFA 3H9QA 1K7EB 3NV9A 5AK4A 1JW9B 4DMFA 4ZTUB 1L4BA 3W5BA 4XOIA 4KUGA 4FOPA 4NY1A 4ZCLA 1UPUA 3UA3A 3NGXA 3VU3A 2FMUA 4CIVA 5EKXA 4BEWA 1GZSA 4A8TA 4G85A 4FFLA 4CM3A 1VYVA 4C88A 1EXWA 2G4CA 4RDHA 5CM9C 1X7XB 1WTAA 4HAXA 4W82A 1ZCJA 5DN6A 2Q6TA 4CV1A 4DV1B 1E5TA 1GUZA 2I4RA 5KQGA 2WT9A 4NK5A 4KLRA 4NMHA 1A1SA 4DUGD 3EIFA 3FCAA 1VHWA 2BDUA 2ZAMA 3K30A 2RG1A 3N8KA 3SYTA 3KB1A 2IHUA 4YDHB 4AF8A 5K6RA 5ILOA 3SE0A 4WCFC 4PXYA 1H9AA 3GB9A 1JEEA 2H7XA 4I3GA 2Q6OA 3HLTA 4R9SA 4XCQA 2ZJAA 1CUHA 4E4TA 4Q9DA 2DTXA 4NULA 2IDZA 1U9IA 3SFZA 1JHMA 1Q1EA 1UFRA 2B5OA 2EF0A 2EWMA 4V3BA 3BEOA 4PLVA 1NFRA 1XXLA 1MIOA 5ALSA 3VNVA 3W9SA 1QDUA 1VE3A 4GPTA 2GLTA 2M32A 2MWMA 3UK0A 1DRWA 1KVQA 1Y5RA 4IGAA 3D8HA 5GY7A 4GOLD 2QXYA 3PGKA 2GK7A 1ZLYA 4Z6KA 3O2JA 2EF1A 3R4VA 2C4NA 3CNHA 4GE0A 4RK0A 3DEYX 5CDGA 5BN4B 5KEIA 4KHPB 2FK7A 4UNNA 3R24A 1P2TA 4JODA 4LX8A 5T5QA 4BJ1A 4C5AA 5L7YA 1GG9A 3DXXA 3GUVA 3GPLA 4KWCA 2G5TA 3IP9A 4GOOD 1SOWA 3L4BC 2H4XA 3U7HB 3FVVA 5EWLB 5AUQA 5FV4A 1YMQA 1EFPB 2ZRJA 2HEIA 2XCTB 1EWTA 1GUYA 4XR4A 3UB3A 3EEQA 3VC1A 3QLVC 1XSEA 2FW9A 3F46A 3GJ8A 3RS9A 4F2DA 1L5NA 2PUWA 3AVUA 3KJQA 2B99A 1KS9A 3PE4A 1P5JA 4L5IA 3HB1A 3FCOA 1DO0A 5AK6A 3VDNB 1AE1A 4MICA 4U39A 1T8YA 4A0QA 4BE7B 4Q7QA 2GHIA 2Q2VA 3B1VA 3N75A 3C7DB 1WDTA 3KLMX 3MLAA 5TQVA 1E79D 2ZB3A 3M4JA 4Q6BA 1G4UR 1RM0A 3ZDFA 5AVRA 5FULA 1XA3A 2ZYVX 1E4OA 5TMPA 4Y67A 2QAJA 1ECJA 1G66A 1XXHE 4JBWA 4M0KA 2ZPTX 4WVLA 3C45A 3ZWPA 4IIJF 2WWRA 4ZCRA 2JH9A 1NVTA 2XE4A 3PEUA 3EGDB 2HKIA 3GLHB 2TRSB 2X14A 2G7ZA 4E5UA 4D79A 4DUYB 2XMQA 3WRWA 2I1WA 4DPKA 3WC4A 3GLFA 5D6OA 4DHWA 4M6WB 5BSUA 2J1LA 1MC5A 2GVDC 1AUPA 3NT2A 4BQIA 3PRYA 3VZPA 5I4KA 3HDHA 1G20A 2ZQZA 5KINB 5AOVA 3G0GA 4F3CA 1HDIA 4RY9A 3HU3A 4RADA 1JSZA 4UEKA 2AL7A 4OI2A 2DB3A 4LZWA 4AI6A 3DZJA 2V7WA 4M36A 1OAKA 5IF3A 1K2WA 4RPIA 4CQNA 2AK3A 3CYFA 4EL0A 3PFKA 1N2XA 1E0JA 2HA6A 1ZGBA 4N49A 5DT2A 1OAOC 4YY3B 1U1GA 1ML3A 2E1RA 4BMCA 2MSNA 1JG4A 2MJLA 3BQMB 3E2MA 4PZPA 4YALA 5KWVA 5IHPA 4OHXA 1RQ7A 1YB4A 3HJBA 1ISSA 4LAFA 3ZWNA 4N5NA 1SXJA 4NE2A 4P2GA 3HCAA 4CF5A 3I4LA 2UUOA 2Z98A 5HIMA 1WKVA 1C3VA 3EXEB 5HA5A 5BNIA 3PNYA 4LC0A 4D9BA 2ZXUA 3LSTA 5FPHA 1OASA 1WDMA 1XYGA 2IOFA 1TO2E 4HLDA 5CT8A 4GR9A 3VDQA 1Y42X 4JQSA 1XWFA 4FYKA 1GO2A 1YZ3A 1RVDA 3CEAA 2P4SA 4BRSA 3K0BA 1XQ9A 2Z5FA 3D3WA 5ERYA 3X3HA 5CDYA 4ZHQF 1R5BA 2RGDA 2D62A 2VUUA 4AMGA 5KSOA 3RSSA 2WWGA 4ZZ0A 4YBRA 4HGOA 1TT5A 2WA1A 3E2PA 4PNPA 1XZMA 3BH6A 3TOXA 3PU6A 2HU7A 4V24A 1ENOA 3GGJA 3BJMA 3FR8A 1EWVA 1RI5A 3VH2A 4YXWA 4ACAA 2AE2A 3DCYA 2ZRNA 3SBEA 4GL4A 2HHJA 3TJMA 3MTIA 4BUJA 5AXBA 2QX9A 2C7RA 1CRQA 1O4VA 3DBIA 3N3AC 4BNFA 4PIVA 2FZKA 1DUIA 4Q21A 3CSUA 2H9AA 1SCIA 1X1QA 2ZUBA 5ESDA 4A0GA 3NBZC 1TB4A 4GBED 4WBNA 1YXMA 2ZIWB 5BVHA 4DSZA 5LLDA 4BX0A 1KMNA 4UNRA 1XVIA 4KR6A 2XNJA 3TQHA 1AZWA 4RQUA 1PQ4A 1HFWA 2ZW9A 3QKUA 4LX0A 1KAQA 4Y2GA 5HFJA 2CLHB 1W36B 4KV7A 4XVRA 1AA6A 1RXIA 2WHEA 1W93A 2A94A 3OP1A 4K9LA 3RHSA 5HNKA 1D2HA 1A0OA 3PCTA 1LF0A 3PX3A 5KX5B 1LDGA 1Z2PX 1VMKA 4CT5A 2YMPA 1S7CA 4H0NA 4ZD6A 1XZFA 2P2CA 5SY4A 4KBGA 1VC2A 5B7QA 5MN5A 3E5RA 2MIIA 3LKBA 4H6WA 3QFSA 1M2OB 1NXPA 2CE7A 5DNUA 2UKDA 3EVDA 1KQFA 1LD3A 4E4YA 4M9CA 4U7FA 3TD9A 3OQHA 2BEVA 3IQWA 3IUPA 1N7JA 4JSRA 2H1VA 3D02A 4OJTA 1R4AA 3U48A 5BNWA 1JB9A 4JYBA 1Z25A 3OE4A 3M4NA 4PINA 4GOXA 3GJYA 4UNQA 2YC4C 3VVMA 5HQJA 4WDRA 1N5IA 2J46A 2MOKA 3K8QA 1MA3A 4S1NA 1TM5E 1E7QA 4QEDA 5JTUA 1XRRA 1NG9A 1FX0B 4G5FA 4PBTA 2IP4A 4B6QA 1AO0A 3DZCA 4HZGA 4PQRA 4MQFB 1AZTA 4UJ3A 2CT8A 3ED1A 2FG7C 3KJZA 3VYUB 3COVA 3KEOA 1ISPA 4V0NA 1MC8A 3A0UA 1MO2A 3R0XA 3UJHA 2VT6A 2XGJA 1TQ6A 3WL3A 1H3NA 4NYJQ 1NC3A 3JAKB 3HYRA 3VGJA 3MT0A 2PQ2A 4UZFA 3HZOA 1Y6ZA 4GS5A 1XKLA 4DUGA 5AHXA 1DBRA 4LWOA 3LZDA 1BJTA 2ERCA 1TMOA 1OFTA 2V58A 4LDNA 4A8HA 1DDOA 2MYUA 4MVJD 3OQOA 4F3TA 3GFRA 4JQYA 4MVJH 4PAOA 2HU8A 4H1WA 2R4TA 1J8YF 5AM5A 2FF7A 2JCYA 3O93A 1Z36A 2AA3A 3OZDA 4J2HA 4ZOLF 1DEOA 3VH1A 4RZUA 1R16A 2ACVA 4DANA 4LXGA 3RQSA 4BIIA 3QHAA 5FI1B 4BPRA 1RR6A 3AL2A 1J90A 3UWSA 4HI0E 1N2EA 2D59A 3NGLA 2QRJA 4TXJA 5SICE 1RP1A 3HWX1 2VRBA 3VR4A 4L73A 5IZCA 2O20A 1A8SA 1O95C 3QWIA 2KW5A 1KMMA 1RJDA 1P81A 1PR6A 1W88A 2JGJA 3CSSA 4UTZA 4CCAA 4WKNA 5JWOA 1M1YA 3SHTA 2YUTA 3D6HA 1GHTA 1EE9A 3L6CA 3LVFO 1U2DC 1A5BB 2OV6A 1KERA 1O6BA 3EXAA 4QLAA 3W5JA 2A33A 4DDKA 2POQX 4HR7A 1PVOA 3UW3A 4YASA 3M6WA 4ZAFA 4I14A 2V9ZA 1NN1A 1IPEA 1QK3A 4TV8A 2RB5A 4BFZA 1QNFA 4TUYA 1Z4OA 4HXGA 3I8XA 2ID4A 2Q6IA 2VNSA 1XHEA 3BE5A 1LF5A 3P0HA 4I8XA 3A4IA 4DNPA 4Q1DA 1LH0A 3R4CA 3MWDB 2YN2A 4MZDA 4CIXA 1I7QB 2C94A 3T7TA 2XB6A 4G0YA 2WUGA 5DK6A 3SHVA 2CHGA 5H81A 1XX6A 4JP8A 2A0UA 5JXGA 5GZ3A 1SNYA 2F4NA 2DVMA 1U3CA 1E79A 5LQAA 1JPJA 1CZNA 4REQA 4JLKA 5MFPA 4LHSA 5B2EA 2AN1A 1RT9A 1RZ3A 3ESBA 3FJYA 4M98A 4OF4A 4YR9A 3I62A 1JG6A 1Z9BA 3C5CA 1PNOA 3GJ7A 3IVGA 3NEJA 3TAUA 1QFZA 2XBUA 2YXDA 4Q9AA 5CEEA 4MRAA 1Y81A 3IV7A 3ZU6A 4WCFA 5DXFA 1F3LA 3Q7PA 1E1KA 1ND5A 2CL0X 1U9YA 4G4SO 2ZRCA 1E9SA 3A1DA 1K5GA 3H5IA 3WOVA 1T8SA 3BH7A 4QICA 621PA 4PFKA 2C99A 4GWGA 1X13A 3IXQA 3QV1A 2ONYA 4MV6A 2QR5A 4Q47A 5EVJA 2XQIA 2SBTA 3DEFA 3E9QA 2GCNA 4UAVA 3UQZA 1L5VA 1MVOA 1P0CA 3VPBA 2E87A 2Y2VA 3NBAA 1T8WA 1VG1A 1XRJA 2BFDB 2DBVO 3X1MA 1R4MA 3NTVA 3TB6A 3VKFA 3T1YB 1O95D 4LECA 1OI4A 2QNBA 2FDCA 2FXVA 3IPCA 3D64A 4PR0A 2BH9A 4D0RA 4HXYA 4QOHA 4ZYTA 4CCYA 4ZOAA 4DQXA 2HMSA 4XJXA 2IBTA 5FA5A 5CCEA 1NUTA 1D0IA 3L4BA 5EMLA 2ECPA 4ZQFA 5LU9A 2EKDA 2FCRA 2LXNA 2FJUA 2WMOB 3F8WA 4UARA 4B7XA 2KLHA 3BDIA 3DT8A 4HH1A 2HNBA 3EQZA 3ZCPA 3KB2A 3QKRA 4I4TF 3QLVA 3NHRA 3T7RA 4M1OA 2Q1YA 4F5EA 2BKLA 5JO0A 2ZSJA 5TLSA 3GLKA 3EY9A 5FRDA 1J0BA 3UC9A 4B6FA 1DKLA 2WSLA 1EP2B 3HY6A 3ENWA 4MQUA 4MVXA 2P30A 1QP8A 1V7PC 3RYFA 3THXB 3PUKA 4EPRA 2CLCX 2OHXA 4JLMA 3QJYA 1PGQA 2C20A 3HS3A 1R00A 2FN9A 3FR7A 2R8ZA 5JSYA 3V7FA 5KTTA 5I7AA 1EUCA 1M7BA 5LP6B 4UMFA 4QGAA 4BKPA 1GCGA 5KWSA 3EIHA 2HQSA 2HRQA 4HUJA 1KYXA 1XTUA 3NYQA 2WSBA 4B79A 2QVLA 4UOEA 1RE1A 1CUYA 2VT7A 3B6MA 3DV0A 3C3MA 4BUCA 3FZEA 1N32B 1M2VB 1AIPA 1GCOA 3TOVA 1UMDB 3I0NA 2DWOA 4PX3A 4WV3A 5IH3A 2PMDA 5KYWB 3HXMA 1SOUA 1FDUA 2CW5A 3QNWA 4H7HA 3W05A 2B94A 4F8EA 1DP4A 3QPAA 1ZD1A 1SVKA 4M1TA 2B3DA 5BN5A 3UMBA 3BN3A 1NVXQ 1TYEB 3A58B 5IZ4A 2J3HA 5TY0A 1KQOA 1QIIA 2IJGX 1ULSA 3QUCA 1OUMA 1PFVA 3Q3HA 1HDZA 1KEUA 4OHMA 4XYBA 4BN0A 1PL0A 2XXAB 1CY1A 1U1DA 1DC7A 5IKOA 5JQGB 5LVAA 1BE1A 1DQRA 2FGKA 3CWZA 4HDSB 5DBHX 1EFDN 3SOZA 4X20B 1OBHA 3I2GA 4M21A 3AL3A 1LPMA 4MJ7A 1SELA 4R16A 2VAMA 1DI0A 3I37X 2PPLA 3L6RA 2HXYA 3AYZB 1A27A 2IDMA 2N46A 2ROQA 2XNHA 4IZIA 4ZOQI 2IH5A 4BE9A 1JGTA 1ILEA 1HQYE 4DV2B 4MI1A 2XAUA 2P3SA 4L50A 1MZPA 4BIMA 1U6IA 3ETDA 5C5IA 3EHDA 3KUKA 5CPFA 1ZD3A 2PV0A 3QE9Y 4ZAVA 1HLFA 1UANA 2OZKA 4UASA 3PQ2A 1VL6A 4M0CA 2HF2A 3DNMA 3TSYA 2CLMB 4F4JA 2DXIA 3KVOA 2YWBA 1M67A 3PI6A 3GZ4A 2FR1A 2Z2XA 4MRSA 2HHHB 2YXLA 3AUKA 3Q41A 1FPQA 4I2VA 3X1XA 5JNVA 3RRZA 2QE6A 1OT5A 2UXDB 5BMVB 1PV1A 1WG8A 2I6SA 3IQEA 4PLHA 4XYGA 5B5SA 1UZNA 2WZCA 3CTMA 1R0SA 4BB6A 2P9BA 1WMAA 3NYIA 3DMRA 1ULBA 2NG1A 3JRXA 4AROA 2Y1FA 5G4KA 3L7OA 1W4CA 4CM1A 3PFIA 3SR4A 3SVTA 3FPKA 1WR8A 3GF4A 4OA8A 4QATA 4ETNA 1O5OA 5ALJA 1GZUA 3M5WA 1IZ7A 4RHYA 5B3KA 4HSEA 5DISB 5CFLA 4DB2A 3LQYA 5GQSA 3SR0A 3RM3A 3PUHA 4N54A 1H22A 1SQSA 5I51A 4L0QA 4MV5A 3K0AA 4YP0A 1EQUA 4R8VA 2O7QA 3RAGA 1WXEA 1CF9A 2J6IA 1EX6A 3FKSD 3KZXA 2H4HA 1Q1NA 1HEYA 4XM2A 2ES4A 1MRZA 3H75A 3I64A 3KQMA 1MB9A 2EKBA 4M1KA 4PHGA 5BOVA 3SLRA 1H2RS 4HDAA 4F56A 5C1BA 1FFGA 4BY9E 3WBFA 3E1SA 3V6MA 2QGNA 4GMFA 4MUGA 4RVSA 4CKCB 4JP2A 1B8VA 4D4LA 1ZKDA 4EHJA 3H1EA 4ZZIA 2ZI4A 2W6IA 5IVHA 1AUXA 1EBUA 2C9BA 4UM9B 1A9ZA 1LQTA 3GVXA 1G19A 1OZFA 3O7WA 4PG4A 4E5YA 1KVSA 3TOSA 2HQBA 4C03A 3NKFA 2ZYIA 1J0CA 1LJUA 2IGBA 2V7TA 1B6TA 16PKA 1VBFA 3JATB 5EIBC 1Q95A 4UBLA 1KZ1A 3PZBA 5AVKA 4B31A 4ENVA 5EJ5A 5LWHA 2Q3FA 1X80A 2PX5A 3ETEA 4FEEA 3UK6A 1Z45A 2CVZA 2H57A 2D00A 2EKPA 3MD9A 1VMIA 1W87A 4MIEA 5ALUA 2PZLA 3ZWWA 1NBAA 3A4LA 4CR8A 2GEJA 4XM1A 3BXPA 3TW0A 1H2BA 5EJ8A 4DNQA 5B1HA 4JNKA 5TJHA 4CIWA 3CKLA 3D6AA 1G5PA 3ZS9A 2JLWA 5AK3A 1Z5WA 4TTSA 4XOUA 3X1JA 1DTWA 3C6MA 1JIQA 1QAOA 4X1YB 2WMYA 4EW6A 5LZ7A 1HDOA 4UM5A 4A03A 3ICPA 5A04A 1O54A 2MSDB 1R9JA 3D2CA 1A7AA 3BMNA 4NH0A 4DN6A 3BFXA 1L5MA 2B35A 3BXZA 1YS2X 1H5NA 1PVDA 2XADA 1QH1B 3B2QA 4OHFA 4ZMSA 3IMFA 2VA9A 3ELWA 5K3AA 3M33A 5TF0A 4D8YA 2QPLA 2ZBGA 3T4PA 3AF3A 2R5WA 3X44A 1XAJA 3GJ3A 2PO5A 2PNJA 2I99A 3L7KA 3O7MA 2P68A 2VYCA 2QHXA 2LCQA 4W9MC 3HSSA 4DSTA 2A5GA 1W4AA 2XVAA 3KWLA 4PVCA 3AG6A 3AB8A 1Q1AA 2A78A 1R0KA 2FSVC 2ONKA 3JWJA 5CT6A 3BICA 5EJFA 4DDVA 5C32A 2GNPA 5AI0A 1RNLA 3T7IA 2JIPA 2R1UA 3NIGB 3N2EA 5EPUA 2B69A 2RGUA 5I9BA 1LRLA 2C57A 2F1JA 2PX4A 4J6FA 2IK8A 3QMWA 5FPPA 3MTDA 3OLYA 3FWHA 3QLUC 1YIOA 4IDOA 5EQJB 4TXMA 4H59A 4CFYA 2CK3D 5EZQA 3AV3A 1X7ZA 4HYEA 3RUDA 1L5WA 2V3WA 3ZTTA 3LT0A 4P38A 4GXNA 4GPIB 1ISMA 2HA4A 3HKCA 4X84A 4XIGS 4F6RA 4FVTA 1H0RA 1M54A 4FNMA 3EAFA 5TGZA 1CUIA 2V6GA 3H2IA 1P44A 2BCJQ 1NSYA 3P97A 2W98A 2C00A 4I9FA 4L2IA 4N7MA 3I2FA 2J0UB 3BOSA 4I1VA 2X77A 5EIBD 5BYKA 2Q4OA 3SLKA 4BZWA 3CLUC 4NU0A 1Z6YA 4KXXA 4FE7A 4O1MA 1WE2A 1R6AA 2ID8A 3FVWA 3II6X 4DM3A 1QIKA 3R8FA 1TA9A 1T0PA 4ZI2A 2CMFA 2PKQO 1ODJA 1J2UA 3NKLA 1OI3A 1BYIA 1O95A 3I01A 5K0FA 3LCCA 3H11A 1C7ZA 4FE3A 4AWXA 4X91A 3HHPA 1M2HA 4N40A 2OHGA 1U2DA 4MYTA 3CVVA 4MULA 4JGBA 2A9JA 2XYPA 4EJMA 2J6CA 2QTGA 4Y2SA 2I6GA 1LFDB 3A3KA 5KTRA 1UFKA 4YJGA 1RC1A 1P5FA 1HTWA 2ILVA 4BNUA 5IJ0B 3DO5A 5AKZA 1XEWX 2DF8A 5DBOA 4PZ0A 1G1MA 3K70C 4IIVA 2ZI7A 1G7TA 3R77A 4LC1A 1GUBA 2PBZA 4P22A 3TL3A 4C06A 3VBCA 4NBUA 2A7QA 2AQIA 4UATA 5ADWA 2AC2A 2YJZA 4R05A 2L18A 4OXNA 1UMKA 2QBYB 1YBAA 1JR3D 3ND9A 1GNQA 3BXEA 1R6UA 1MIOB 2A14A 1IAVA 4RXUA 1UZLA 4ZXPA 1VDMA 3W5SA 2GM9A 3MMNA 1WVGA 4BTEA 3TD6A 1GGKA 2WJWA 2QDKA 3PWSA 2JGLA 4Q15A 4WESA 5ALPA 2OMEA 1E32A 1LTHR 2HY7A 2VFAA 4QIHA 2HADA 5FFMA 4E2YA 1YVRA 1P45A 4FTWA 3V97A 2PUDA 4UXJA 4OHUA 4DCOA 4KO4S 4RSHA 1JHOA 2JJ2D 2HWUA 1A77A 3C6ZA 3M2TA 2OM6A 4YJ3A 5ALDA 1JJFA 5FPQA 4J0GA 4HAIA 4JWKA 3U80A 2NIPA 1EVLA 3CLUD 4XE5A 5FHRA 4KMRA 5LD2C 4P36A 4TOIA 3E1GA 3MCUA 4RHUA 3ICVA 2CV1A 1N5OX 1ZCZA 1Q84A 1Z63A 2AJCA 3EQ7A 1OH6A 2CNLA 1YJBA 1I1QB 2CCJA 1EP1B 3IAM6 2O23A 4Z0NA 3E7FA 2QV0A 2ZJFA 4DPLA 2QUKA 3C8HA 4TV9B 1OKKD 4XIJA 4HFJA 3JWHA 2BKAA 1XALA 3F71A 1ZJWA 2XVZA 3CH6A 3UAWA 3ZIDA 1M75A 3P71T 4PICA 1EM6A 2GD1O 1EB8A 1TW2A 2PD3A 4KJXA 3UQYS 5F3WB 3FFAA 4KK4A 4W1SA 3LY5A 1E2LA 1ZU4A 1ZAYA 1WXXA 3SZLA 1BH6A 1FP7A 4KPUA 4KIJA 4OK5A 1LNQA 1U90A 3E3LA 2WAXA 4JLOA 2W90A 3SQMA 4HF7A 2AN3A 4QLBA 3K70D 3PEFA 4GPBA 2Q99A 1DPGA 1QHNA 3NT5A 5LU8A 4MV3A 2O8FA 4PZLA 2PS9A 3R3HA 1XLVA 3GDHA 2X5KO 4U5QA 2HRZA 4O2RA 3FWZA 3GLFB 1O5IA 1G17A 1TKBA 2OHJA 3R76A 3D8UA 1JQDA 2WTAA 2FWBA 2ZIZA 3UMMA 3EDCA 4RVNA 3AVXA 3R1IA 1A9OA 1TKRA 4GBGA 4D1YA 1JXAA 2XT0A 1MORA 1CY6A 5KOIA 3UTCA 1KZ4A 2XD4A 1GUDA 2COEA 5KWEA 3PSAA 3NEAA 1Q11A 4NCXA 1RPAA 4ZVVA 4LOKA 1YE8A 1RKBA 1N0HA 1VOTA 4NZPA 3W2HA 1T3LA 4OEHA 5EEGA 2CUNA 4B3GA 5AK0A 4ETMA 1C9EA 3ZW8A 2AD5A 4NDZA 4C5BA 5LZ8A 3UY4A 5J2UA 1SCBA 1YCFA 1YJXA 1KYTA 3SC2B 1AHPA 3ONFA 2QI9C 4HS9A 1AX9A 1CY0A 1Y6JA 3EMDA 3JRNA 4OQZA 4KFSA 4PCAA 2H63A 4RJKA 5GONF 4B3IA 2AQ8A 2DHQA 1MAHA 1U3WA 3DZBA 4P33A 4YVFA 1AN0A 1XF9A 5EP3A 5FNZA 2VUHB 4WCDA 3RSOA 5ELLA 3KUXA 3U56A 3IP6A 1L5HA 2GBLC 2FZEA 2PG3A 3SICE 4DAOA 4KRXA 5IP5A 3CCBA 5UKDA 1GLVA 4XWYA 2AG5A 3ZCQA 3STVA 2PCJA 1BA3A 1FDVA 2EGGA 2RGNC 4GQAA 1IUKA 1TGYA 1JG1A 2VDWA 3G23A 2VH5R 5KOHA 1JTVA 1TAQA 1YOBA 2YMLA 5EHQA 3BZBA 1GAJA 4YTEA 3AF2A 3ZKAA 3QBJA 3VTKA 3VZSA 4FYHA 1C7EA 2ZRHA 3LC0A 1TOAA 2AZMA 1WZEA 4HFNA 2R6DA 3EPRA 1VPLA 3V34A 2FEKA 4DZTA 2PUBA 2V55B 3EDRA 3PVZA 4Z9YA 4BFYA 4EG5A 1TT5B 3L7LA 2FZWA 2IYAA 2DY0A 2RCNA 4GVLA 4NCHA 2FSIA 3E1KA 2R66A 4NSNA 3GD5A 2WSIA 2BH2A 3R9KA 3ZI4A 4B6SA 5JRDS 2X0RA 4FS8A 3RCBA 7REQA 3B9BA 3KL4A 4BTLA 2X1HA 3E0QA 2WAYA 2DQ4A 1GVHA 3ZGXA 3TTYA 4JDPA 4DJ5X 4Q93A 3K9WA 4XFKA 3TTXA 4ALMA 1Q15A 2NUBA 2QVCA 1BWQA 2XMGA 4ZMBA 5LYJA 2E55A 2HREA 5JO9A 1JPNA 2A0KA 4ZO6A 5FLEX 1TZMA 5BVHB 4WBNB 1IZ9A 1M2EA 3LQFA 1GRVA 1W9MA 3NDRA 4GAEA 1Y3HA 4MMZB 2CV0A 1FBTA 2PGLA 2BR4A 1A98A 2XCQA 4I4NA 4Q34A 3GAZA 3ZW7A 4LYJA 4JI5B 1L8XA 2P9GA 4QL3A 4BOYA 1Z15A 1YFLA 4N3NA 2X86A 4MJXA 3RS8A 1L4LA 5GJBA 3B3JA 2G17A 4UUAA 1AVTA 1V4BA 2I55A 4J1NA 4OMCA 4WLUA 5FUYA 3NDPA 5HDBB 2PCLA 3KLNA 1LRKA 3GCXA 3M3HA 3EC2A 2XOKD 2K6GA 1QVZA 1LW6E 3N58A 1HQKA 2CK3A 3HMKA 3KSUA 3LWZA 4Y6LA 3GFSA 1I2ZA 5DX8A 1L0BA 2HL6A 4GOJA 5FUWA 3TMYA 3VO9A 3P2OA 3QFHA 1J9GA 2FN4A 2NT3A 3PP8A 4L5AA 3I58A 4MUEA 2PHZA 3IBFA 3MQFA 1YO6A 1MJ5A 4Q1VA 4XD2A 3V8NA 4NMLA 2WSSD 4EG3A 1K98A 3SS8A 4CQMD 2VH1A 1T6NA 3M70A 2YZKA 3L8CA 3DGFC 1SCUA 3W04A 4FZVA 3HC7A 3ZDZB 3QRWA 1PQUA 4NFSA 4J7UA 1W4RA 3OM1A 3CGWA 5A9TA 4YCSA 2QTTA 3D3EA 1GUFA 3ICQB 5AVTA 3IP7A 4YO8A 5IBRA 3RWOA 2AOUA 2CHUA 2JRCA 4Y2QA 1P3JA 1RPZA 2EBWA 3N8HA 3RC1A 2AW3A 4NICA 2EJBA 1IBRA 2ZRQA 1NC1A 2ACEA 3DEJA 3FE2A 3LQ4A 4WK4B 1K7FB 2EDAA 3H8JA 3JD3A 4ML3A 3TG2A 5C1DA 3TGWA 1KZGB 3JV7A 3Q3IA 1O0SA 2ZTMA 3RT7A 1WKCA 3WTBA 5TVKA 1SIOA 2C9DA 3IOEA 3K0HA 3U5ZB 2MT9A 3NHJA 4C7OA 3ZNOA 2Q9UA 1EJBA 2FW1A 4WVFA 1TKAA 1Y7TA 3BGOS 5E9QA 1G0NA 2Q4BA 4X97A 1JFSA 1XN1A 3MK31 3HJGA 3S2UA 4Z4EA 1PE0A 5KOJA 3L8ZA 4B7UA 3OFND 4URZR 2V5VA 4XFDA 1W0JD 2ERYA 2PBRA 4IDFA 1JR3A 2FSVA 2W43A 3KOWA 4TLDA 4UCWA 1C1XA 1CRZA 1RHJA 3P94A 2R1TB 2J67A 1ZGZA 4RMNA 3WJ7A 2VP3A 2D1QA 3NTRA 3QPUA 4TWIA 4HL6A 3WS7A 3BRQA 2I7XA 5FJJA 3IUJA 1CERA 1Y9AA 3E9YA 4FE4A 4JLWA 3D9QX 3BKWA 4MPTA 2BY4A 3WHIA 1Z0JA 1W88B 4PRLA 1MH1A 1MAAA 3AINA 2F48A 2VJBA 1ANKA 4PIPA 2PXXA 1M1YB 5AKIA 3RASA 3U0BA 3WR5A 3FKJA 3LPAA 1TFRA 2NU6A 3KQYA 2D5AA 3OZ7A 5EMHA 5AR1A 1H2HA 4KKVA 5F51A 3B7WA 1FFCA 2W2OA 4IXNA 3V32A 4TTIA 2PMEA 4I9NA 1P2DA 1XZJA 4TV8B 1V1MA 3Q7QA 4EHNA 4JLDA 1Q83A 2L17A 1W5TA 3IIIA 4HY3A 3PYXA 2R6HA 1G20E 3HM9A 1BQEA 4DIBA 2GXAA 2VF4X 1W1IA 4AQDA 1U8AA 1J5PA 4HFMA 1G6KA 3SQNA 4DY6A 1QV9A 1LDYA 2VHVA 3E5NA 3VR5D 1E2HA 3BE6A 4G36A 3P9PA 3G0IA 2BHTA 2OFXA 3MT8A 2VKTA 3AG5A 3OCWA 1T0IA 3CX4A 1JKJA 2FMKA 2ZS8A 4RMGA 5HFNA 2SKCA 1ZOOA 3B5EA 4REQB 3H9UA 2X4GA 4F7WA 2XDAA 4J0HA 3EW7A 4IDAA 1H2EA 1Q3HA 5CJPA 4F9FA 1T34A 3HABA 5C5DA 1LNZA 2TECE 2O1SA 2RBKA 1FIUA 1COZA 4TLAA 3EMBA 3F1LA 5FUVA 2QQEA 2XODA 1PTJA 4NFYA 5FPSA 5GZ6A 1X70A 2Q27A 3ZXYA 3M1LA 2PH3A 4WCFB 2EG9A 3LDGA 3VO1A 1U7PA 2IHVA 3QU2A 2HJHA 1SXJE 4RA6B 4U6QA 1YA8A 4KO2S 5EJIA 1UK9A 3C6KA 3CUEF 1R50A 3DWIA 4Y1GA 4RD4A 3EUWA 1G0OA 3RUEA 1CQJB 1L1QA 2JHCA 3CIFA 1NLMA 2Q2NA 1IB0A 2Z5VA 5EMKA 4H1HA 3KJGA 2YY5A 4INOA 3NAGA 4XGRA 2JIOA 3FWPA 1D8TA 4YRJA 3QYPA 2E7ZA 4IIFA 5CTJA 1R4MB 3JAWB 4G1EB 2B8TA 4YAOA 1P1JA 2A9FA 1PEKE 5CYFA 5AVQA 5DYNA 4LJ9A 1IJEA 5CDUA 5JZMA 4PVDA 2OCKA 3LTEA 2EBFX 2PSEA 1JLSA 2QLLA 4CCYB 3UHOA 3RSFA 4RVOA 4IMJB 2NTVA 1FDRA 3KPWA 1OHHD 2DBRA 3LT4A 2VAWA 5AP9A 5EXDA 1M1ZA 1IQ0A 3EA5A 3QKRB 2XRYA 1KJ9A 1M76A 1Z3IX 1LLUA 4DIKA 1OWPA 4DJAA 1DG1G 1P0MA 5CFZA 2CXXA 4U8HA 1E2PA 4HWGA 1DIGA 4ZYYA 1V71A 3IULA 5ER6A 1ZNQO 3IDAA 1WMBA 2ZRFA 2A5LA 3FYCA 3BAZA 3R6TA 3QEKA 2Q5LA 4URWR 2ZLBA 1EHIA 5EXSA 5JEDA 4QXPA 3K72B 4JAVC 2JIZD 2AFHE 1EUCB 4LQCA 1WNFA 4D6PA 2NPOA 4BDTA 3GFGA 4N8EA 3ILVA 3FA2A 4C0XA 1RXUA 2I62A 2WKQA 3OIWA 4H1UA 4Y18A 5B30A 2ODQA 4JXJA 3DV0B 2Z2YA 2P4HX 3DZDA 1BSVA 3GRYA 5FPYA 3H9JA 5JYDA 4DV6B 1N1DA 3CE6A 2XB4A 4B7ZA 1DEHA 1UT8A 2B2CA 1RKXA 3DV2A 4ZEWA 1G18A 4Q4CA 4BCCA 1HZJA 4DCNA 1P9WA 2JBHA 2HA3A 5FFFA 3HMQA 121PA 4GGPA 4IQ0A 4Q37A 5TT1A 5CNIA 4ZXFA 4DRXA 2UZ1A 1GKYA 1TYZA 4ENUA 4JBLA 4RM2A 3TAHA 2UVDA 4DWOA 3NM6B 4YUZA 3G2PA 1FUEA 1NN5A 1R8YA 2B4AA 3M1YA 4N9WA 5AUPB 2WIBA 1AA9A 2IV7A 5EJ4A 5KKAA 2Q4RA 3D59A 4O2AF 1Q0PA 1X19A 4X6LA 5CU7A 5DW0A 1FUYB 2D06A 1P62B 3P9ZA 1FFYA 2GN8A 3W06A 3L0ZA 1N5MA 2FZ4A 3T7JA 3S28A 3WGUA 4S3MA 4D41A 3IPAA 4FR0A 2WTBA 1EZZA 3JYLA 3GPCA 4XSVA 3EFOA 5HRCA 2DLNA 5L53A 1DVRA 1RYNA 4IIGA 4LBZA 4B48A 1TIPA 5K01A 4JL5A 3UMVA 5A1TA 1R10A 4WGGA 4ZPJA 2W22A 2QM7A 2VJLA 1N8TA 2ODNA 5ESXA 2B61A 1XELA 1O6CA 2QQ5A 2IYRA 4O3FA 2FWPA 4QDOA 2R48A 2TMKA 2E4ZA 3M82A 1UZUA 2GBLA 3FNRA 3RLFA 3HE3A 1OTXA 1M7HA 3G49A 4TX1A 5K4AA 4BO9A 2QG6A 4OXRA 1X1EA 4IHJA 1QR2A 2PWPA 1XEXB 4L78A 5TARA 3MJDA 3UOGA 1FF9A 3GP5A 2RGNA 1V7ZA 4TMWA 1PSWA 4PCVA 3ASZA 2WSSA 3ZWQA 1JXOA 3KSBC 2P9ZA 4AO6A 2Z4SA 4GD3Q 4MUYA 1V3UA 4X00A 3ZX4A 3FNBA 1UR5A 4F86A 5G4KB 1Z4IA 2V6IA 4C14A 1SVOA 3GFBA 5EGNA 2ZUWA 3FHJA 4C4YA 3CRVA 1CP3A 1QK4A 1U6JA 3EA0A 3PZRA 5BUCA 5KUTA 1U0LA 2R1ZA 2PUAA 2HHLA 5H1YA 1P4JA 3K0AB 3P5SA 3TGPA 1RZVA 1YE3A 2IYPA 3L4SO 5LPNA 1Q16A 3DTYA 4RSRA 2FP3A 2GM4A 4O4LF 1PT5A 2YN4A 4NJOA 2W0SA 4NXNB 1TEHA 1ORTA 1FMFA 4GR4A 3R0VA 2R8OA 4PWYA 1FTGA 1W30A 1Y1TA 2B25A 2E1PA 4MS1A 4WK6A 4QGSA 4EI8A 3NJRA 4HQLA 4I2NA 5CW2A 1XDDA 5JAOA 5C7LO 4RTSA 2WU0A 2FW6A 4AURA 2BI4A 2Y99A 4BVBA 2WM8A 2GZDA 2ZT5A 1EFRA 4KAJA 1RM3A 4GRAA 3HRIA 3T7KA 3GJTA 4DW8A 2BFFB 2WUFA 3OAAA 1RBQA 1W2HA 2YICA 4UUPA 2I2BA 1EUYA 2QORA 1I4TD 1KIFA 2QTCA 3C3CA 3OO1A 3OPVA 4MV4A 2QD2A 2RK6A 5E1OA 2NVUB 3RW9A 3K71B 2PD4A 5F2EA 5K05A 1CJVC 1HF3A 1RVV1 1UBKS 1Y3DE 3C3BA 3HJNA 4IZHA 2VVTA 4MS3B 3U4DA 1WKBA 1GZ7A 1ZFNA 2X13A 2JLYA 3O6VA 5HG0A 5LDGA 4A6EA 2X4LA 1GIAA 2HBYA 4K9RA 2AJBA 5LIPA 1U0FA 1HNXB 3O4VA 3PXGA 1DTWB 5EPEA 1O9GA 3WO1A 5ICGA 3I30X 3OM0A 1KXJA 2ENUA 4PZZA 4A6PA 5KTSA 1NJ8A 1R6DA 4XB6B 4WY5A 3RRBA 1E58A 4NNOA 4EMSA 1AQJA 2DLCX 1WB6A 3I2IA 2B6NA 3KTAA 1L3IA 3NO4A 4M83A 4CM4A 3P9NA 4NU6A 4RVCA 3K2EA 3BMNB 3UMSA 3W2TA 3EZFA 4YWHA 3QLEA 2WYHA 2D1SA 5DOZA 3UCEA 4DVGA 1RXWA 1R0ZA 2GF9A 2EW8A 4LZNA 1WBBA 2EXXA 2JASA 2YFYA 1UDCA 1C14A 3L7DA 3EBPA 1H1LA 1GGEA 3DR5A 4DA8A 4ZV9A 3VR5A 5L40A 5M29A 5KYXA 5EIXA 5AJHA 4E32A 2Q3BA 5TMDA 1K6MA 4D42A 2FLWA 4MKRA 3F3YA 1BD3A 1EXMA 5FLXA 5E4TA 5G1OA 1E0SA 5KWIA 1XKTA 4JYMA 4E2WA 3KB6A 4J8PA 2PX8A 2I3ZA 1VJ1A 1T5DX 3HNPA 4EM6A 5EXEA 4CL2A 3OE5A 3TX2A 5AM3A 1YHYA 1X7ZB 2E82A 2W9XA 2WU1A 3U3RA 1K5DA 3GCWA 3RRJA 1UKZA 5CDFE 4NJMA 3HKCB 4FN5A 2C5FA 3WK4A 2P2YA 4DCCA 2XAAA 2EKLA 3FPJA 4JL6A 3WDLA 4BFVA 1YULA 4J6EA 1L8QA 2HA2A 3NP9A 1YNOA 3B6IA 4AS1A 3F7MA 3LA8A 5CW1A 1HKHA 4KP7A 5JS1A 1AHIA 1ETUA 5DGHA 5A4KA 2PUVA 3K16A 3H1AA 1DAMA 3ZE2B 3BF7A 3LECA 4RK7A 1HNNA 1I6LA 3FNIA 3M4YA 1GT6A 5A06A 4L5YA 1X3SA 2AX4A 1QRDA 2IYFA 3IMKA 3N28A 2ATVA 1ZISA 4AG6A 3H11B 1JIUA 3G2HA 3Q40A 3A04A 5IC5A 3N59A 3W5UA 4ZI7F 5BORA 3VJRA 1HWYA 1QPGA 3ABQB 5C7YA 5IEBA 1DV1A 1YS1X 5FTKA 1DXQA 3U9TA 1P39A 4H6PA 2P5YA 3EIWA 3VPFA 3RIEA 4NR0A 3DQPA 2DFVA 2E5FA 1K89A 4PQEA 1N7HA 4TM7A 5AXAA 1OHHA 1TLFA 3LW8A 1UDXA 3FM9A 4Q48A 1Z29A 2HU5A 1XZAA 3FUWA 3U4HA 2R3SA 4CODB 4HQNA 3ZZTA 1KORA 1SHLA 4IRMA 2NVOA 5AI8A 2NXNA 4LOJA 1JDVA 3GY0A 2VEOA 2VF2A 3RU9A 5ICMA 3BMOA 4LISA 1BZYA 3BL6A 3SVZA 4AX8A 3AW8A 1LSUA 4K3VA 6NULA 4LJ4A 3OLZA 1ICEA 3AEQA 1XFAA 1GKLA 4XIYA 2MYPA 3SBXA 2BD0A 3TLBA 2P4EA 1VPVA 4GZ3A 3WFZA 2EP5A 3OEHD 4AWBA 2EJWA 1QHYA 1G8KA 2FX3A 5HJ2A 1B8OA 3D1JA 3MWEA 1N0WA 1Z39A 1Y7LA 4U2GA 1CUSA 2QL9A 1WMSA 2QA5A 1CEEA 4X8LA 4YJHA 3IILA 3QVGA 2ZBDA 4D4IA 1LLCA 3C5VA 3C4QA 4R51A 2OO5C 3RSQA 3KU1A 4B4WA 4FOSA 5IJXA 1QO7A 1KGDA 4AJPA 3GFPA 4WKBA 2X1VA 3ZLVA 3N8NA 3LC2O 3SPXA 1AF7A 5LNK6 4TT3A 4MW5A 1H4VB 4R2JA 1VE7A 1RXEA 2YJ5A 3L3BA 3N70A 5BURA 4HEQA 3NAMA 1I1NA 2O2CA 5ALEA 5LQMA 1TPYA 2J5BA 2CLEB 3RUPA 1WQ3A 3H86A 1D1PA 4I1UA 4YMGA 3UBTA 5JS2A 2CLDX 4X85A 1CF4A 4UZEA 1R12A 1JNXX 2NQTA 3GUUA 3JD1A 3VKWA 3LX5A 4I1YA 1JQBA 2NYUA 4N9QA 5H7XA 1G16A 5A71A 5GVSA 2JL1A 5IU6A 1OCEA 3DTVD 1N2SA 2H9IA 3K20A 4U2KA 4N0MA 1IHUA 4JVSB 4CTMA 3S81A 3WZLA 4WE3A 2OHHA 4A23A 4FQ8A 5H02A 4PYLA 2P69A 1YGYA 1TUGA 4YACA 3ZOKA 4CG0A 1JR4A 5IARA 1V16A 4XQ9A 3PF9A 4NCKA 2GZ3A 5F73A 3U7IA 3W7VA 2C5EA 4QGHA 4TWZA 4HYYA 1XEAA 5CP8A 1P31A 1PNTA 4L28A 1ZKMA 1T0HB 3R75A 3WISA 4BEJA 2Q50A 3EEIA 4L6IA 4M0LA 5KYVA 1N77A 1AGRA 3ZJ5A 2BEUA 2BMVA 1GDHA 3FFBA 2C7VA 3LLCA 3VKGA 2XA9A 4JVNA 1Y63A 1TEVA 1A9TA 1H23A 3C98A 2E3JA 2XNSA 3P9CA 2A9PA 3ITNA 1ZMOA 2H2DA 3AVQA 1KC1A 1QK5A 1UXOA 4ND8A 5LOVA 3LL7A 2I54A 1B2RA 3OWHA 2IYEA 1JEAA 2YBEA 3CPEA 1KE1A 3JYQA 1E7SA 3AY7A 4NG5A 3WQRA 1M6EX 3F49S 3TZLA 3R6GA 2HBQA 2JAUA 3ASUA 1E66A 1GAWA 3ZY5A 4PG8A 1IXYA 3KQTA 3IQHX 1VHJA 3U4MA 2VPQA 4LBYA 2Y1LA 5JHHB 4G0QA 2C2MA 1UIMA 3OFKA 1LJ8A 1WEKA 2JLZA 1QF6A 5A4FS 1VKJA 1YI1A 2PQ6A 1E1QD 5DHPA 4PO1A 2CL5A 3DUFB 3UGTA 4BLWA 4F5ZA 1JQJC 4IXMA 3JYHA 2F3UA 4EY3A 3IAXA 5KSPA 5FWYA 1FQJA 4Y30A 3ID6C 1FVXA 3E5MA 1RAEA 1VSBA 1OT3A 1GPWB 1R3UA 1YBHA 1N6IA 5KNBD 1L5HB 2AOXA 5K8UA 2C2WA 2TS1A 3IO3A 4JJAA 3DYVA 2QLMA 3I2KA 5D3KA 3EMKA 4QTTB 5DSTA 1TYAE 2Z5LA 4L9RA 4OM8A 3CONA 3GVPA 2WD7B 3HB9A 1GA6A 1WPQA 5AFSA 5K3OA 4IY1A 5J5CA 1NBMD 5CD9A 4GNKA 2Z9BA 2O8DA 4D0LB 1KFJB 1WDKA 2WJHA 4FP9A 1XUOA 3ZGVA 2RC6A 3FNHA 4OLAA 1PL6A 4P0QB 1S89A 2HBRA 3JALA 3TZKA 3VC3A 3A32A 2YWHA 1K3TA 3RKUA 4CNBA 3NIFB 4W8OA 4RM3A 721PA 1RFLA 2AMVA 1ZUIA 2VDMB 1QMGA 1YAJA 3JQFC 3MTJA 3NTOA 4MMXB 4AX4A 4D4JA 3TZEA 1VKRA 1Q7TA 2Z8XA 1TZBA 1LFAA 4JP3A 3DLTA 4YRAA 5K0ZA 4YRMA 1H6AA 4FI3C 1HLGA 1E3WA 3P0IA 5ADHA 2WJ3A 5REQA 3STUA 7REQB 5DW3A 2YJNA 4J3NA 4WI1A 2QIOA 1QFYA 3QG5A 2FPXA 4QD3A 4K6FA 1LY1A 1RTTA 2K2QB 3K8YA 1NVVR 1DL5A 5LYJB 3FSJX 4ZODA 1NBIA 2CY0A 5BRNA 4ENTA 4AWAA 4FS3A 4R5HA 2JZCA 3F2VA 5KYGA 1ONBA 3VR1A 1G8FA 4HLNA 1R9MA 1UXGA 2ZJ4A 3HQ4O 2PDAA 3PUWA 2OCAA 3PXAA 4EHIA 3PXBA 4M1YA 5EP4A 2X7JA 3MJ4A 3F5SA 1DAGA 1JJ7A 3OTOB 3V9AA 1ISIA 3RIGA 3VPSA 4F1WA 3AR9A 1TCBA 3RWMB 2BKVA 3T3HA 4BEBA 2Q5JA 1V8DA 3LUJA 4QQFA 1K2VN 3MBIA 4H4DA 4TKUA 1M1NA 3U62A 4F92B 5IT5A 3EARA 3PWZA 3RB8A 4ARSA 4PU0A 3D0QA 3SG0A 3OTIA 2Q3DA 2SECE 2XE7A 4HWKA 1EQAA 3ZKWB 4XQGA 5DO9A 5E3JA 1GGJA 2OV4A 1REQA 3PB3A 5GM1A 4BP8A 1XAHA 4FFRA 4UEOA 3C74A 3EH1A 2RGGA 4IUCS 5BQOA 3ICEA 2XRFA 2FP4A 1XMJA 1VL0A 5DI3B 1ZH8A 1R2QA 2VTKA 1ZMRA 2XTZA 1B43A 2YCBA 1MVNA 3DOCA 1I0ZA 5L3RA 1YR7A 1SCUB 2VZ0A 2I2WA 3OU7A 1RWWA 4GSKA 4TS3A 3WE7A 3G88A 5AVJA 1H5UA 4LGYA 3WHPA 1Y9JA 4BFCA 4D8XA 5CVDA 5GOZA 3IUEA 4G4JA 4L95C 5LQRA 2OK8A 2Z6AA 2GETA 3G8YA 2PZFA 3BRCA 4RMHA 1FU4A 1UWCA 1ZG3A 2D2XA 2H1RA 4C04A 3GRRA 1BCRA 2AOUB 3UUEA 4A8PA 2IU0A 2XWBF 1WL8A 3M6VA 4G1CA 2JIBA 4OFWA 4Q3AA 2G5GX 3ZEAA 3PWTA 4EVIA 1PX2A 4K9OA 5ARDA 4QPZA 4P08A 3WLNA 2C5AA 1JQLB 5F7OA 2PL3A 3A70A 1PYDA 1II0A 4XZ3A 4MYHA 3R3XA 1XWWA 5D51S 4X7RA 1T4GA 2JIMA 3WG9A 2ZVDA 3CE9A 1Q1GA 3H4IA 4Q3NA 4IVRA 5C35A 1I6KA 1XD2A 4MV8A 4B3HA 5B4VA 1IY9A 1G7CA 3A9VA 5KOJB 1VCIA 3TFOA 2CLOB 1JZSA 3P4XA 3B38A 2C07A 1Z4QA 4N0QA 3FUVA 3OZSA 1G21A 1UBFA 3S1LA 1C1XB 2K7ZA 1AQIA 3L93A 4RDCA 3NWOA 2ZJ0A 3U2QA 4D57A 1RM5A 2NTEA 4W5OA 1PGPA 4YEDA 3INYA 2CNKA 4RA9A 3FSGD 4IH4A 3W78A 1R3DA 1A8UA 4EELA 3RUIA 2DWCA 2VBGA 1YR3A 3C8ZA 3IBYA 3LBIA 1BEUB 3AT1A 2DR2A 3ONEA 3D1VA 4RE5A 1MT0A 4J7CA 4RK5A 4TS1A 1JQAA 4WRRA 2WWVD 3S27A 2H1OA 1YQXA 3KEGA 3U49A 2HV9A 2NU6B 5G0VA 1E5QA 2ZSUA 1PKEA 4MQEB 2XD9A 2ODPA 2A8YA 1MRSA 4B7CA 1ONOA 1T9AA 3BFVA 1HYHA 3U16A 1DEAA 1PZNA 1Z5UA 1V1MB 3K05A 3OOEA 3W2FA 2OGTA 2GA8A 2QRNA 4GP6A 1N1EA 1QNLA 5A5GA 2ZWMA 4KW7A 4TWJA 1P6UA 2GAOA 2B4YA 3PFGA 4EB3A 3DF7A 1FFBA 4O4JF 4BO1A 1KH2A 1NHGA 4BXOA 1UPAA 1QF9A 1KRXA 2NN3C 3GRVA 3HL4A 3S2FA 2BWJA 1BH2A 3RFCA 3L0CA 3L8HA 2X40A 1CF2O 1J49A 1W5EA 3BX1A 3DTVA 4AIRA 4D02A 4ITVA 2ZYRA 1QH8A 3HGQA 3M7IA 4WX2B 3T5GA 3O8CA 4KFCA 4WPGA 3TQQA 3F6CA 3FZGA 1FDWA 2HJVA 3AVOA 4EVRA 4F91B 1FJ2A 2HA5A 4QSHA 5KKCA 3ZDCA 3UHPA 4BRWA 1D0VA 4O63O 3JQ9A 1ATIA 1BX3A 4RH0A 1FXWA 4X61A 2RBGA 3HR8A 1E9VA 4EDHA 2Z6UA 2SNIE 1Z73A 2IUYA 2YS6A 4RNCA 2JGAA 5JYEA 3K70B 1S9DA 2H2FA 1WCWA 1LPNA 1GYPA 1UT5A 5EIOA 4ESEA 1V5EA 1MIHA 3DF9A 1IOLA 3K0KA 4F5YA 4Z4GA 3TQOA 3T1OA 2YIJA 2H1HA 4FMDB 2QRQA 4DR7B 4HMQA 3RANA 4HAZA 5J5VA 3X2EA 2ZIVB 3UOAB 2PKEA 3CR8A 3EDYA 2A2ZA 4N41A 3ROKA 1Q20A 2A9RA 4W8HA 5H4HA 1E6UA 1E7MA 3GJSA 3BWYA 3H4VA 3WNQA 1OZHA 3BD9A 3LCJA 4QUDA 1USIA 5KDDA 4GDMA 2C4TA 1F2DA 4CL0A 3LP8A 4ZO8A 3CF4G 4TS9A 2M98A 1IZZA 4FDTA 2OO5A 1XVAA 1I5EA 1UUFA 4RZIA 1W1WA 1H0SA 4XRRA 5IKXA 5KJEA 3ZNQA 5F4ZA 3U81A 4MV1A 3H42B 2OM2A 4XLTA 3AHDA 1V37A 4OQ4A 3LA6A 5LA6A 3WJ2A 4BMSA 4YRNA 2B9EA 2OCDA 2Z2IA 1KF0A 1MB0A 2GYVA 2IUTA 2ZYSA 3MWFA 3VSAA 3OZWA 2NV0A 1XNJA 4BECA 4UAUA 4II2A 2IEIA 4QM7A 3OD1A 2D54A 3GXOA 5SYAA 5KNBA 3GUCA 4GYWA 3X0DA 3O0DA 2R6ZA 2GNAA 1ETHA 4ZCMA 1E61A 3EOBI 1VPWA 1QTRA 2NZXA 3TAXA 1FMLA 5EFZA 1VLJA 1QKIA 5H68A 1EBFA 3IV9A 1ONPA 2BV3A 4WECA 2Z4RA 1QRTA 2SKEA 1N2CE 4K1LA 4BDSA 2HSWA 2VBFA 4CR6A 3LOQA 1BMFA 4HDRA 4J94A 3VZQA 4DV7B 3M6LA 1GN9A 5AKYA 5DP2A 3JRWA 4B2IA 4QLOA 1GQSA 3IEPA 5JXHA 3CZ4A 1BXKA 3G2NA 2PA0A 3NALA 5BSFA 4DDWA 1USGA 5IC4A 3M5PA 1WP9A 3RBAA 3QH4A 4IZOA 2XE6A 3OVMA 4FR5A 4A5OA 1ZH2A 3T1HB 1AURA 5LYYA 3AQIA 3R3SA 1XQVA 3F0TA 5IN5A 3RVMA 4CLOA 1J2YA 1RXYA 1YNSA 1Z38A 3T52A 1CFZA 1K06A 1R5NA 2ECOA 1SCDA 2CVQA 4OL9A 1QTQA 1EZ4A 2GFHA 3AY0A 3LO5A 5ALKA 2J6HA 1XL0A 3CUYA 2IYNA 5DGCA 3GEGA 4JYZA 1A9RA 2GYWA 3QBDA 1EHCA 3ZCRA 3G1UA 1E96A 1KBOA 2LCFA 1UQTA 2QSJA 4MROA 2LZ0A 2QTAA 3HP7A 3DVAA 1SKUA 2GHQA 2O2XA 2HWKA 2W70A 4CU5A 3G8DA 4TV8F 4TUYF 3MUNA 5EWMA 2IPOA 2APJA 2ZE5A 4MB6A 2IKQA 2JGFA 2QVXX 3T1NA 2QYOA 2EFCB 1EP9A 4WXPA 1JFVA 1VIDA 2ZB4A 4KN6A 4A1FA 4RSMA 3CHYA 2NYRA 4BFXA 4OXYA 3PXUA 1Y8AA 4ESVA 2O2HA 4NBRA 2DPGA 4X7PA 3RG2A 1SU6A 1TYCA 2YV1A 5G4LA 3AP3A 3OFJA 4IJMA 1ODTC 1ZVJA 4LZLA 4BASA 4C0QC 1H2WA 4KZKA 4EGCB 3OPMA 5FTJA 4NATA 2UZ0A 4IHJB 4FDLA 4GPD1 3V80A 4KQ1A 2QP9X 1B7GO 2FPWA 1SULA 3N3BC 3MRVA 3REOA 4AY5A 3BGIA 3AVYA 3L5OA 1SHTX 4XARA 3GG9A 3KZMA 2QPTA 4HN4B 4K6OA 4D9MA 4JZYA 4WERA 1E5LA 2PRIA 2Z58A 1I8TA 3ILHA 1PYGA 2ZXEA 2HMWA 3AEYA 4JDUA 4A2PA 5C51B 4OHRA 1MZVA 1T3SA 3KG2A 1O77A 4Q7MB 3L0IB 1QLHA 1K0UA 1OFHA 4F2HA 3AVWA 4B6OA 4PYIA 1Z26A 1NZJA 1UPFA 1C7FA 5HKKD 1Q7BA 1EFHA 2QTBA 2DX7A 5AW5A 1M74A 3O03A 3BCUA 3HUDA 4X24A 2MSCB 3SHOA 1IZ0A 2VA8A 4ZO7A 3UV3A 2DQZA 3H2GA 1T3GA 3WB2A 2NQ8A 1J70A 3LXXA 5FB3A 2D0OB 4GX5A 3UMFA 4EG0A 1DTEA 1Z6ZA 4O4IA 1YQEA 3V5NA 2ECQA 1EXDA 1A5AB 1KP3A 2OBYA 4BGDA 3B6ZA 3Q7SA 1N3YA 3A8TA 3T9FA 3UO8B 1E3QA 5C52B 3K9HA 1JAHA 2NO6A 3D43A 5JISA 1TVMA 3VNQA 4P4UA 2H11A 2IHTA 4IIBA 1GADO 1NW4A 3REFA 1A9QA 1M2WA 4MCIA 2RAVA 4I8IA 1ID1A 1KYYA 2DPHA 1JHPA 3FSGA 2PUGA 2BBTA 3IC5A 1JFFA 1OTYA 4ZJUA 4G65A 2F4VB 1XRMA 3EEYA 3IO5A 3NBYC 1MX3A 2C1XA 4UFOA 1UPCA 3D7RA 3KDAA 1XNGA 3OLWA 1US8B 5I6DA 4AF7A 1O8CA 3Q8WA 4IWNA 4QPNA 3SU8A 4XWKA 4H9GA 2BOVA 2EVWX 2G83A 2ZBQA 1RAAA 1ZA1A 1U0OC 3IUQA 4K03A 2AV6A 2WU3A 5P21A 5EP1A 1ZP6A 3ZH2A 3WGLA 3UENA 3UHAA 1RRFA 4YBZA 1XDBA 2OYSA 3KTAB 4CM4B 1QTNA 2OORC 3FMGA 2AX3A 3B53X 5LCXA 1X0XA 5AVSA 2QX8A 1OZGA 2AZ4A 1XD8A 3BIFA 5ELMA 3THRA 3NANA 2Z09A 3VU9A 1G8SA 3H5OA 3QFCA 2VPTA 5AI9A 4C4ZA 3BFJA 4UTNA 5KVVA 3R3WA 4H27A 5IAOA 3HVIA 1X1DA 4IL5A 3BZWA 5KKNB 4D25A 1NIPA 4X44A 3MWLA 3VM6A 1T0JB 4J0FA 2BI8A 3VHRA 4Y2JA 1NV8A 1B1CA 4XQCA 4MR8B 3QIVA 4KQJA 5BP7A 3UJ6A 2PRZA 5J1SB 3AO0B 2FRVA 3QXGA 4RTMA 1GPAA 3HU2A 4DNFA 1YVPA 1UKYA 1XA4A 1GSAA 4FGJA 4GWKA 4HEA1 4KWHA 3WGJA 2OUIA 4LF5B 4F71A 3AIMA 4YMUA 4M1QA 2ZCJA 1DAIA 2VF7A 3DZ8A 2QTFA 1G5HA 4NJMB 2RHLA 1SB9A 1EDDA 4P2BA 2YBDA 4BLUA 4O5OA 2OR3A 1NJ2A 1DDIA 4BNNA 1BGWA 5I7FA 2HA7A 1F4PA 4YIHA 3PEEA 2NWQA 4HNVA 2E21A 4QUEA 4QT4A 2YL2A 3ABSB 3CUKA 4ZVLA 5FL7D 2YW2A 4HWRA 4MLDA 5FOXA 4IJVA 3KQQA 4I7EA 4E22A 1GWNA 1B42A 2D1RA 3PPWA 5CVJA 2OHIA 2YNMC 3QWAA 5KO2A 1QDEA 2IWHA 1P7YA 4IYJA 3T1QA 3IHKA 3VHLB 1K7CA 4MDEA 2D7CA 4RE6A 3FXAA 1P7WA 1D2CA 3A6PC 1NJ5A 1FSSA 3H16A 1ENZA 1DQZA 1BNCA 3QKWA 4H6VA 4MUIA 3KJIA 4P82A 3U3ZA 3UXEA 2BFBA 1TX4B 5K09A 4J0JA 4PRZA 4N03A 2PSFA 1LTQA 1P1RA 2ODEA 3DHWC 4ZAXA 4O25A 1W29A 2PX6A 3F3MA 2XPCA 5FBHA 2PJDA 2GI4A 2RARA 5AM1A 3LDHA 4LZZA 1YK0A 4JJFA 1FYVA 2F3SA 2DQKA 2ECFA 3BMOB 3TZCA 2EWVA 2WSMA 1YZTA 1X7WB 4LRUA 5FPKA 2RAUA 3QYJA 2QTWB 1PNQA 2HI0A 1Z88A 2HFKA 4TTJA 4BVFA 2H4YA 3AEQB 2GWHA 2VP4A 3CUSA 3K1JA 2FPKA 3IVCA 1IUOA 1YACA 1AM4D 5LMCA 4PYOA 1R66A 3A2LA 1P1HA 1QPBA 3MWEB 4II3A 3U3MA 4HOYA 2ZU0C 4MINA 5ALFA 4XVHA 5DYIA 5LWQA 1Y8RA 3QVGB 4LV6A 3HBFA 1MOZA 2VHWA 2FOIA 1RQNA 1L5SA 3AF4A 4AT1A 5F78A 2DJ5A 1DCTA 2WIDA 1GARA 3O8LA 3PD0A 4M0PA 5KQPA 2X8BA 2BMAA 4RD6A 1Y0BA 1ZK1A 3CRMA 4G5OA 1J09A 3PNVA 4QUGA 4YP7A 2ZUTA 5HX7A 3MWGA 4PG7A 1V3QE 4P53A 5IVPA 2CVFA 4NNJA 1E6EA 4N5HX 1DQSA 4DTCA 3AKZA 2W2KA 3RTDA 3BT7A 4FEYA 2UUPA 1KU6A 3O3NB 3O4GA 4N8SA 2QIPA 4JB2A 4QEKA 2BIFA 4OHBA 3SBDA 3W5HA 4V39A 1AH2A 1ZIDA 1IM5A 4MVJI 1FA9A 4R0VA 3CNOA 5C8YA 4CF3A 3TG8A 5IT0A 1NP3A 1NQAO 1XZDA 2NO4A 5DNVA 2BM8A 1N8NA 4PV7A 1J8FA 5LQDA 1YHZA 3PDJA 2PVSA 1DNPA 1G1AA 2B92A 4BLVA 5A3JA 4YMWA 5E7MA 5K3BA 2BEUB 3NXSA 1A9YA 2X0NA 3ASVA 3ENQA 1UAYA 5DP1A 2QGZA 4KN8A 4O8CA 4PYKA 1KR2A 2J59A 2ZJ6A 1Q44A 3MT7A 2J3KA 4GXQA 3LTNC 1LDEA 2CD9A 2HTFA 4ZO4A 1FRVA 3LDUA 2V98A 4YFVA 3W6NA 4ND8B 1E1DA 2FRXA 1J20A 3GVIA 3ZCTA 3ENKA 2DP4E 2B2XA 2HXSA 3LWNA 4OIFA 4B4UA 5JFGA 3P0JA 4UAGA 3GBSA 1NIJA 1AK1A 2VKQA 2H7CA 3V33A 4YH1A 1RIFA 3ZUGA 2DHEA 4LHWA 2BT4A 4E08A 3I9JA 1ZA2A 3MCAA 4X1IA 3IBGA 4DSAA 5CX1B 3QVWA 2F90A 4PZDA 4JI6B 4AS3A 1QZ3A 3K0FB 1YA4A 1V47A 4I55A 2B78A 4RCZA 5DEIA 5AQEA 3RLIA 3MGCA 4CKYA 4EEKA 1O97C 4S1OA 4EGFA 1N5LA 5IDQA 5U1PA 3SX4A 2N9UA