2GAFA

Crystal structure of the vaccinia polyadenylate polymerase heterodimer (apo form)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
297
structure length
286
Chain Sequence
MDVVSLDKPFMYFEEIDNELDYEPESKKLPYQGQLKLLLGELFFLSKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVASPSTADLLSNYALQNVMISILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDYPNQEYDYFHMYFMLRTVYCNKTFPTTKAKVLFLQQSIFRFLNIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase
publication title Crystal structures of the vaccinia virus polyadenylate polymerase heterodimer: insights into ATP selectivity and processivity.
pubmed doi rcsb
source organism Vaccinia virus
total genus 93
structure length 286
sequence length 297
ec nomenclature
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01358 PARP_regulatory Poly A polymerase regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2gafA00
3HCAA 3NVMB 2BZGA 5CM2Z 4POOA 4X41A 1VP9A 3A7DA 5E1BA 1WXWA 5BW5A 2I62A 1KIAA 4RVFA 2VDVE 1MJFA 4PNEA 3FPGA 2E5WA 3FTFA 1EAMA 3E8SA 3HA3A 4RTMA 3EVBA 3GRUA 4GBED 3FTCA 2Z6QA 4M7RA 5K03A 2AOUB 4OBWA 2H1RA 2WA1A 3IEIA 5EHIA 4R05A 4ZTBA 3C0KA 5E2BA 3GU3A 1JTFA 4P7KA 3BKXA 3G8AA 4DQ0A 4HTFB 5E2AA 3DMGA 2AR0A 4E32A 1G8AA 3V97A 5FWAA 2VS1A 4PGGA 3UZUA 1JG4A 3G2OA 4MQ4A 2GPYA 1RI2A 2YVLA 3B5IA 3PX3A 2IFTA 2Z6AA 1YZHA 5HZMA 5FTWA 4RTPA 1KPGA 2YXEA 5D1HA 5EEHA 5GP1A 4BLVA 3GRYA 2WK1A 3FTDA 1NBHA 3HA5A 3GCZA 3CGGA 5GWXA 3T0IA 5K0CA 1BKYA 1TW2A 3DXZA 3Q7EA 4RVHA 1UFKA 4E2WA 3EVFA 4Y2HA 1X19A 3C6MA 3I64A 5EHGA 1XVAA 1TPYA 2G8NA 3B89A 4PYNA 5DM1A 3HNRA 2AVDA 2GB4A 2Y1XA 5CIYA 3UJ7A 2GA9A 3FRHA 4PYOA 2O06A 1D2GA 4C05A 4DCMA 5DTMA 1RJEA 3ID6C 3GGDA 3DH0A 2YTZA 5EMKA 3NDJA 3PS9A 2P41A 4XUDA 5JUWA 5LQJA 5HFJA 3FTEA 1KXZA 5EQJB 5EZSA 3CJTA 4MWZA 5GOZA 2QRVA 5HIIA 5F2OA 3LDGA 1ZG3A 2JHAA 2GAFA 5CVJA 5ERGB 4AX8A 1HNNA 2PWPA 4LWPA 1KHHA 4OA5A 2EG5A 2JG3A 3PLAE 4E2ZA 3JWGA 4YV1A 4RTJA 2OPBA 3OPNA 3KPUA 3LGAA 2NXNA 4CKCA 5FHRA 3K6RA 2IH4A 1FP2A 1UIRA 5BW4A 2JHCA 4GF5A 1I1NA 4P7JA 1JSZA 5CVDA 5GIOE 1ZGJA 1QZZA 3T7SA 2CL5A 2P8JA 3ORHA 4C03A 1RI3A 3M6WA 3AWIA 4QQNA 3V8VA 1ORHA 2XYVA 4A6DA 4RTLA 1F3LA 4E33A 1KPIA 4YUVA 2PX4A 1NW3A 3EMBA 3AXTA 4RV9A 4MHTA 2Y1WA 5E9WA 3UJCA 5DM4A 3NWBA 4GOND 1IY9A 2ESRA 2PXAA 3BZBA 3P71T 2AZTA 2NXEA 3K0BA 3MB5A 4JXJA 3EVEA 5HOQA 4G56A 2ZZMA 3Q87B 2QRVB 3GRZA 1EIZA 5FA8A 5E9QA 2C7PA 1G38A 2ERCA 4PYIA 5GM1A 1R8YA 2EJTA 3DLCA 4YUYA 3KPYA 2DPMA 5DSTA 2HNKA 2ZWVA 1M6YA 2PWYA 3MTIA 4ER6A 2VZ9A 3I58A 3TKYA 1XTPA 5CCXA 1VIDA 1M0EA 3HCCA 3REOA 5BP7A 4P7GA 3CKKA 3G2PA 3MQ2A 3QV2A 2C7OA 5ICEA 3P9NA 4X61A 2VDWA 4ER5A 3A4TA 1G8SA 2CMHA 2P7IA 3DLIA 3M4XA 4OQEA 4U7PB 5DX8A 2CWWA 2BH2A 5K0BA 3EPPA 5EMJA 3DTNA 3DMHA 2AOUA 3M70A 3IYLW 2AOVA 2XVMA 1YB2A 3FPJA 2PX2A 3HVHA 3QOXA 5M5BA 3OFKA 2G71A 5K8VA 2IH2A 3EEYA 3DXYA 3PFGA 3TPZA 5DXAA 1EJ0A 4PWYA 3MTEA 4HTFA 5DRTA 3UJAA 3FYCA 3MCZA 4XCXA 3G88A 1PJZA 4HC4A 4HH4A 4PONA 4EMSA 5C9ZA 3TMAA 1B42A 3CJRA 3FPEA 3PFHA 4XUCA 1X1BA 3M6XA 2BR3A 1WZNA 5DTRA 2AN3A 4DMGA 3BGIA 5LR6A 3HVIA 1DUSA 3EVCA 1NW5A 2OYRA 1L1EA 4QVGA 3JWJA 2IDKA 2OBFA 1FBNA 1JTEA 2ZBRA 3LDUA 4CTKA 1AQIA 3GRRA 2P3OA 4DZRA 5EC8A 3ANXA 3ELYA 2PXXA 4KVZA 2G72A 1V39A 4RTOA 3NTVA 4DM3A 2HMYB 4FP9A 2P3QA 3X0DA 1O54A 1R18A 1NV9A 2FPOA 3AJDA 3A7EA 3M6VA 3OZSA 4GEKA 4PYKA 3TQSA 3KR1A 2EJUA 1SQFA 3MAGA 2P1DA 3B3FA 3BWCA 3R6TA 3C3YA 5MHTA 1KYZA 1Z3CA 1RJGA 3BKWA 3BWBA 4AZWA 3NMUF 2G70A 4C08A 3MHTA 3MGGA 2YQZA 4YMHA 3HCBA 5DLYA 1G55A 3P9CA 2NYUA 5E8RA 5LQKA 1P91A 4LG1A 4Z2YA 1R00A 2Q41A 3FYDA 1WS6A 2DULA 2B9EA 3DR5A 5E1DA 2ONZA 3EGVA 4E31A 4E2YA 2EX4A 1ZQ9A 5DX0A 10MHA 1BHJA 3FUWA 4X63A 1JR4A 3PX2A 4V0QA 1ZGAA 5DRYA 3LKDA 1XCLA 3GJYA 4IV0A 5GM2A 1DL5A 1MHTA 2OB1A 3EMDA 3DOUA 1SG9A 3HVKA 3ER9A 1NW6A 1TW3A 3SMQA 3SX0A 2FHPA 1G6Q1 3EGIA 3MCTA 4AZTA 2ZFUA 1N2XA 4BY9E 4U7TB 3PT9A 4OQDA 3LCCA 4KIGA 4XUEA 5ICCA 1X1DA 2ZVJA 2QYOA 3KQTA 4QPPA 1SVUA 1SUIA 3B3JA 5DM0A 3THRA 3TM4A 1JQ3A 3OFJA 2KW5A 5EMMA 5DX1A 5EVJA 3UWPA 2O0LA 4M38A 1EG2A 1NT2A 2PXCA 2ZW9A 1SUSA 3G2QA 3KQSA 3GWZA 2AS0A 4HSGA 2PBFA 3TOSA 4E70A 1WY7A 5E8JA 4O29A 2CKDA 2GLUA 4ISCA 4L7VA 2HR1A 3HCDA 2XYRA 4Y30A 5FQNA 5K0FA 2ONYA 4RVGA 2AN4A 3LKZA 1X1AA 4FZVA 5GINE 3HTXA 3O4FA 5E9JA 4GOOD 4A6EA 3KPWA 4C4AA 4F86A 5LQCA 1SQGA 2O57A 5CUQA 3THSA 4QDKA 3AXSA 3I53A 2V74B 2CMGA 3EVDA 4BP1A 3ER8A 2IDJA 4HG2A 2VDUE 3FUVA 5DWQA 4YV0A 3F4KA 1UWVA 3UBTA 3U81A 2NXCA 3RODA 4FT2A 4GC9A 5F2NA 3PVCA 3UJ9A 9MHTA 1I9GA 2GH1A 1VL5A 4LWOA 3VYWA 2P7HA 1XDSA 5DPMA 5DT2A 3KQOA 2P35A 3GXOA 5EEGA 5CVEA 1R8XA 3SSOA 2ADMA 2LD4A 2FYTA 3UJDA 4C04A 2AN5A 3VSEA 4FGZA 5U4XA 3O31A 4ER0A 4RTQA 2AOTB 4H0NA 3B3GA 5EKXA 3OU7A 3KQQA 5T67A 3KQWA 3G2MA 2O07A 3EVGA 5C0OE 1H1DA 5K0EA 2V7EA 2UYHA 3NWEA 3UFBA 3ELDA 1NBIA 4C07A 3BWYA 4QTUB 5LSAA 1XCJA 2UYOA 3TRKA 1U2ZA 2NP7A 4KDCA 1HMYA 5K05A 2A14A 4M37A 4MTLA 3P8ZA 5HILA 2G1PA 1JG1A 1QAMA 1ZKDA 2R6ZA 2XYQA 3E05A 3I5UA 3KPJA 3KU1A 5FA5A 4FSXA 5K0GA 2YX1A 5KS2A 2QY6A 4AZVA 1ZHFA 2FCAA 1Q0SA 2ZLBA 3TM5A 3KKZA 3UA4A 5K0LA 3LL7A 2ZTHA 1XDZA 1VPTA 2JJQA 3P2KA 3HP7A 5T6BA 2OZVA 4DKJA 1OR8A 1P1BA 1FPQA 3DULA 2ZIFA 3ERCA 3MERA 4BLWA 2I6GA 4BP3A 3LX6A 1NW7A 1Y8CA 3KQMA 1NW8A 4GOLD 4E2XA 5IKMA 3M6UA 4RYLA 2O05A 3S68A 5C1IA 3TFWA 5LQRA 4QPNA 4YUXA 1P39A 2IP2A 3ME5A 1PRYA 5BXYA 1F38A 3SM3A 4E30A 3LSTA 1IM8A 1JQEA 3CVOA 3DXXA 1P1CA 2B78A 1N7IA 3E7PA 4P58A 4QVKA 2IBTA 3BWMA 3LPMA 2PT6A 4ATNA 3LECA 2ORED 5ICGA 3G7UA 3BGDA 4KIFA 2ZZKA 1EQAA 2UYQA 3LBFA 3H2BA 5ICFA 5FUBA 2WA2A 4RTSA 2PY6A 1XJ5A 1BOOA 2PX8A 1YUBA 1WXXA 3R0QA 4K6MA 5EIWA 2IIPA 4IWNA 2I9KA 3BT7A 3HVJA 3HCFA 1VLMA 2PKWA 3G5LA 1JG2A 4CTJA 1KP9A 3EVAA 2B25A 3OZTA 4KWCA 4X1OA 4YMGA 1N7JA 5FWDA 3UJ6A 2OXTA 1DCTA 1WG8A 1VBFA 4RTKA 2QE6A 1KR5A 2IH5A 2BR5A 3CBGA 2ZWAA 2PX5A 3QOWA 3LCUA 4QDJA 1YFLA 5IH3A 2P3LA 1EJ6A 4KRGA 2ZCJA 3G8BA 4EKGA 4FR0A 3PTAA 2BR4A 3SSNA 4B17A 1QAOA 2PLWA 4RX1A 3A25A 1RI5A 2N47A 4GQBA 5H02A 3L8DA 4NECA 1YFJA 1KPHA 4F84A 4FS8A 1JG3A 3SVZA 5EKUA 3FUUA 3VC1A 3OCJA 4RTRA 3P2IA 2XVAA 4R8SA 5HIKA 4EVIA 4CXMA 2VP3A 2JH8A 3EGEA 1I4WA 4IKPA 3FRIA 3DP7A 3LDFA 1RJDA 3GO4A 5E1OA 1L9KA 3R9XB 3DUWA 3M33A 4YUZA 4GUAA 3SGLA 2B3TA 3PB3A 1RJFA 4AUKA 3CC8A 2IBSA 1AF7A 2BM9A 1L3IA 3AY0A 4PGHA 4FSDA 1ORIA 3NVKI 3RIEA 3EEOA 3OU2A 2ZULA 4R6XA 3BUSA 4RVDA 5DXJA 1SKMA 4EK9A 5F2KA 3KR9A 4PINA 1YF3A 1R74A 2OB2A 3UJ8A 1O9GA 1RI4A 4GOMD 2XBMA 4ER3A 1FJXA 3G5TA 5EOVA 2AOTA 3FUTA 4PYQA 2JHPA 3E23A 3LCVB 3KR2A 5HIMA 3SSMA 1NKVA 3KQYA 3FZGA 3JWIA 4R6WA 3UA3A 4OBXA 1Q0TA 3CCFA 2OO3A 3KR0A 5G02A 2NXJA 2PGXA 2OKCA 3JWHA 4P7FA 2C7QA 1VE3A 3D2LA 2K4MA 3SR4A 1D2CA 2FK7A 3DMFA 3UJBA 5EG5A 4CWAA 4YV2A 2I7CA 4KW7A 5FCDA 4CKBA 1IXKA 1FP1D 4GC5A 4R8RA 1X1CA 5CD1A 4DF3A 1BC5A 5GIPE 3ELUA 5LQAA 5DM2A 2H11A 3OU6A 2HTEA 5B1SA 4CKEA 3NDIA 4X60A 4DA4A 1QANA 3C3PA 3KHKA 3GIWA 5P8WA 3BXOA 2FK8A 5DSXA 1VQ1A 1NV8A 4F85A 4PYMA 5EMLA 4FT4A 5KVAA 1AQJA 4HRAA 3I9FA 3FUXA 2QM3A 2NNWB 1QAQA 3ELWA 5JR3A 2Z6UA 2PJDA 3HEMA 1JQDA 2ZIGA 3B7PA 2BM8A 3NW9A 2NP6A 2HV9A 2ZBPA 4RWZA 2ZSUA 5FULA 3KPVA 3EVZA 3IHTA 3BGVA 4WXHA 1KYWA 2PT9A 1QYRA 5CCBA 1RI1A 3TLJA 5T64A 3P9IA 5EIFA 3IV6A 2AVNA 4ER7A 1D2HA 3OZRA 2H00A 5CVUA 3TR6A 4KDRA 2YR0A 2AOXA 2R3SA 2YUIA 1R6AA 2PSSA 3LBYA 5FADA 2IGTA 5K09A 2C7RA 1T43A 1XDUA 2EFJA 2GS9A 2UZ4A 5LQUA 4LECA 4PIPA 4M36A 4AZSA 4RTNA 5KQSA 2UYCA 3GRVA 3R24A 2B2CA 5CVVA 4OA8A 1YZ3A 2F8LA 2JH9A 4PCAA 5K0JA 4QQKA 3G89A 2PV0A 5FQOA 2ZIEA 5HEKA 3T7RA 1O9HA 5HIJA 4HGZA 5EZQA 4UOEA 2AOWA 3FPFA 5KYGA 3A26A 5KQRA 4BLUA 5LQNA 7MHTA 8MHTA 3HM2A 3LHDA 3RW9A 4EKIA 4C06A 5K01A 3R3HA 3CJQA 3OE4A 3NJRA 4QTTB 1JSXA 2YXDA 3TKAA 3GDHA 4EQZA 2HWKA 3OE5A 1L3CA 1XXLA 1G60A 3A27A 2PVCA 3FPHA 5EPEA 3T7TA 3O7WA 4OX9Y 2ZZNA 2FRXA 2OY0A 3P97A 4PIMA 3GNLA 1L3BA 3HA7A 4V0RA 2IPXA 3HCEA 4MIKA 3SXJA 4PYLA 5K0NA 4DCGA 1AV6A 1INLA 4YUWA 3P2EA 3C6KA 4PCLA 1VP3A 4RSRA 5D1NA 5E1MA 4HGYA 3VC2A 5DTQA 3P9KA 1M6EX 2YXLA 3KQPA 5FHQA 1NE2A 3KQVA 4IV8A 5EGSA 2P40A 4PYJA 3WSTA 4WVLA 2ZBQA
chains in the Genus database with same CATH superfamily
2G5TA 2G9RA 4OP3A 1GUYA 2VQDA 4PQEA 2WWXA 1H8HD 2AGVA 3QJGA 3GROA 1E3JA 1KIAA 2ID4A 3M8KA 4PNEA 1OAOA 4BVKA 3KSAC 3U4AA 2HMWA 3GLVA 1N3BA 2E5WA 3PRHA 4FDMA 4ZT3A 1JHUA 1EAMA 1K0FA 3VNBA 3WLSA 2PT7A 3ZV5A 4EY8A 3S1AB 4OOEA 1T5BA 3AW9A 3PFNA 4XD7A 4RPKA 2AOUB 4FXOA 4DAOA 2VEOA 4ERXA 4QLBA 5CFZA 1UKCA 2JZNA 2ZI4A 3H5IA 3L0ZA 1MOSA 1HYBA 4WASA 4QD3A 3CLRC 5I9NA 3N6XA 4BUZA 2QRMA 5IJ0B 3E8XA 3T5PA 3CZ9A 3GFRA 3GT0A 4RAOA 5JBNA 4B3SB 1Q0LA 4FONA 2HU5A 4ZICA 4NYJQ 1E2NA 4QQRA 2Y27A 4ZEWA 1MJNA 1OMOA 3CCCA 4NBSA 3ZNOA 1JEDA 4M9RA 4XCVA 3K0SA 1Y81A 1RI2A 2IFTA 1PS0A 1IM2A 5KYXA 3EA0A 3JQ7A 5FTWA 2Z6AA 4IBOA 5KSZA 2BFMA 2XXJA 3FDJA 2R7MA 4F5ZA 1XC7A 2JLYA 4QBKA 1E1LA 4UJ5A 3DBHB 1E3TA 3FTDA 3S0JA 4H77A 5FWXA 3PC7A 5ALDA 4BASA 3ZVKA 1OFGA 2ZREA 2DKNA 1FRQA 3PE4A 1XFAA 3KQKA 1IEWA 2I67A 4UVGA 1G64A 3L5KA 4RD6A 4WDQA 5EUCA 2EW1A 4F5WA 3I5AA 4POAA 1EINA 5AHOA 4A2CA 4DCMA 1GCUA 4LOKA 2AFHA 4A10A 5JNVA 2ZUVA 4YDSA 4Q7LA 3DH0A 1E7WA 1WXIA 2BUBA 1KK2A 3AFGA 3BSSA 1WVGA 3L6RA 1A95A 4FJ0A 2IUYA 4OEHA 4Q19A 4RVUA 5FL7D 3ROEA 3CJTA 4CU2A 5JAHA 1QIKA 2B34A 2EATA 2R7LA 2W2XA 3I52A 1ZC3A 1X70A 2J3MA 1FVHA 4I6EA 5F2OA 1DVRA 4CUZA 5C5EA 4BO1A 4W5QA 1SUCA 4PZDA 3QP9A 3U48A 4PC6A 3L8EA 4H6XA 4E2ZA 2W37A 2IXGA 3OSZA 2Q5QA 3VO9A 4HB2A 3JZMA 4Y2SA 4E5DA 4ERNA 4EBBA 3E70C 2A3RA 3PUYA 1RBZA 3Q3EA 4Q9HA 1M5RA 1WZUA 2FJUA 1ZU5A 2EJVA 2XZDA 3CNLA 1YQDA 2VH1A 4KQHA 5HVNA 4KC0A 2HCTA 1V8PA 4JJ7A 1TT5A 2EZ8A 2JBAA 3EFOA 4XJTA 2NAPA 1VPWA 1PFGA 2IUUA 2VP6A 1F3LA 1EFKA 1UXJA 3OTHA 4FKBA 1IXZA 5CBKA 4MHTA 2Q5HA 2VJLA 2MT9A 2QOEA 2COEA 3NWBA 4GLFA 4WOKA 1IY2A 1G4UR 1C7FA 1QUEA 1W88B 2Y1EA 3HYRA 4L16A 3VDRA 2JIMA 3AQIA 3OPMA 5TJHA 4PAQA 2OCXA 1T2DA 1QH1A 3AEKB 4G56A 4ETWA 2NUPA 1GV0A 2QW1A 2VBIA 1Z0SA 2ZTMA 3VU3A 4CIVA 2Q8PA 4QJIA 4D3FA 5DNEA 3U3KA 3S8YA 1USUA 1A50B 1ZISA 1IZ0A 1H8EA 4TLDA 3KPYA 1ORVA 5NULA 3U9SA 3VZDA 3PFFA 4P2BA 4WESA 1TJNA 4O2AB 2D1SA 5LC1A 1JAXA 2ZYGA 5H0IA 1KEKA 1USIA 3LFTA 4QDTA 3WNDA 1A77A 4EJ2A 2J5QA 2RI0A 4EW2A 1I3NA 3GLIA 3CISA 1S9DA 3PDWA 2HIHA 1EXWA 4M22A 4TS3A 3HNOA 2K87A 2QG4A 3L7MA 1LLDA 2FR8C 3WQQA 5IAEA 2GPAA 5M5BA 1F2TB 1HSZA 2B35A 3UY4A 2VKTA 4TVSA 1R0RE 1PVVA 2IV2X 3HLYA 4EF5A 3DXYA 1QRUA 2FSGA 3NORA 3L06A 3P9YA 4L72A 2PD3A 1Q77A 1K8YB 1LK7A 4WKNA 1LI4A 4MVJF 3WB9A 4J0IA 1UXOA 5I45A 2ETVA 4UDNA 1BVUA 3OWOA 4DSZA 4GPZA 3DMPA 1TM5E 1XN4A 1RRPA 1Y1RA 3ZD9A 4B0PA 1MVOA 2WOJA 5K2OA 4MUFA 4QOIA 1XKXA 4BB9A 2ERYA 1HEYA 4MULA 2YY7A 3TD6A 4MQFB 3QFRA 3N2KA 3LDUA 1AQIA 1V16B 3PXGA 3NBXX 2NVUB 1TKAA 1E3SA 2Q5CA 4MUNA 3T4XA 1P1KA 2VOJA 1F4PA 3NQ41 1QPGA 1PR0A 3BX1A 1YQXA 3FNIA 2ANCA 4NHEA 4RSMA 4X45A 5AOAA 4DM3A 1YR6A 4NQZA 1N57A 3UMMA 3QYJA 1ADCA 4BRSA 3A7EA 4MIYA 3VKHA 4GL4A 4MKIA 1KDTA 3KELA 1HTTA 2H8GA 3BWCA 1Z82A 3ASZA 3WMEA 4EWLA 2BLLA 5HE8A 5TGDA 1ODKA 3PQ2A 4RSHA 3I8SA 3LXMA 5DCWA 4ZT2A 1SZCA 3L8MA 4RA9B 3V1YA 4DLSA 4JN6B 1TO6A 3EXEB 3QMMA 3JVVA 4DPLA 3BD7A 3SMVA 3CVUA 2DUJA 4MUBA 1MG0A 2B9EA 4M1ZA 3D4PA 3UIEA 5EJ5A 4JP2A 3DYVA 1ZUIA 3FCEA 1TX4B 2ONZA 3NJ4A 4OTZA 5E1DA 4E31A 1A9RA 5HRAA 2VRBA 1VFNA 3PX2A 2R11A 4MVJP 3TXYA 3IIEA 1JFTA 3F6EX 3BORA 1HG1A 1DU4A 4I4TF 4C6SA 2H17A 1T0JB 3MYYA 3RAFC 1C80A 2O7VA 3RK4A 1SG9A 2SBTA 2XYPA 3ZTWA 2PR2A 4FFRA 2P9EA 4J9VA 3MCTA 1L7RA 4WINA 1N2XA 3NALA 4WKGA 4ZOLB 2LCIA 2J8ZA 3PIIA 1Z26A 1E7YA 2BYTA 1XCGB 4Y2JA 4ML3A 4M1SA 1SVUA 1ONOA 3CPEA 3RS7A 1XMOB 3THRA 4L75A 3NV7A 5FEMA 2GF2A 3NC1C 1V5GA 4GP7A 4MQEB 2VYNA 3RR2A 2VZ0A 4EFLA 2O0LA 5JO0A 5KNBD 1D5CA 2B69A 2EJWA 3G2QA 1CUYA 2B8TA 3IT3A 4PZ9A 5TF4A 2Y93A 2AMJA 3TPCA 1W85B 1XMVA 3N74A 4Q66C 3EQ6A 3GDWA 1UKYA 4H1VA 4B7ZA 3THYB 4OKSA 2PKRA 3D43A 3VDQA 3K8YA 2DETA 2CSXA 3M1LA 3AL0C 4U9UA 3KKPA 1C8VB 4NZMA 3VI4B 4JP8A 3THSA 1QOZA 2NVOA 1JFVA 2Q4OA 3PJGA 1FA9A 3Q5GA 4NOJA 4QYWA 4JVOA 5CNKA 5DGHA 3BILA 1BXRA 3AVXA 2GRJA 5ALJA 3TQTA 1G8MA 1K5DA 1OI3A 4X1IB 1QC5B 5LLSA 3U09A 3U81A 5HX7A 2X77A 1YDMA 2ZUBA 4PQYA 5EWMB 1E94E 4CI0B 1E1CB 2Q45A 3BMCB 3S81A 4I9FA 4R0VA 4U2DA 1MX1A 2FR1A 1ZZEA 4O3MA 4DV4B 2B83A 4LDNA 4BNFA 4GKVA 3LBIA 3I2KA 3RTDA 1L7VC 3UWDA 4YCMA 1LZLA 1IOLA 4BE9A 2IVFA 1I3KA 4TQUS 2O59A 5FTJA 1C3OA 1VBNA 3B3GA 1DSSG 4L8YA 4AUMA 2XPCA 5K3FA 2Q5EA 2DU8A 3PGJA 4R1NA 3JAWA 5HOEA 2X76A 1V8BA 4GBGA 4CIBA 2XBUA 3R74A 2AEJA 2ZJ6A 3L0YA 1JQJC 4NBKA 3LOPA 4P22A 4ROTA 2VHTA 1EFVA 1QLHA 4ZJZA 1M8JA 1HMYA 2O7NA 2G1PA 1JH8A 2C7VA 2EZTA 1QG6A 3LUHA 1P60A 1UOEA 4OHRA 3DDWA 1Q6ZA 1PQYA 2YX1A 3C1AA 4OAOA 2A7QA 5A4AA 1UMDA 1D0IA 3EFBA 4M7PA 2FRDC 1HL7A 1NUSA 4HQ0A 4H18A 1DRKA 1TA0A 2GR9A 4B3JA 4CKWB 1GRVA 1U7TA 4K1LA 4KBGA 3UICA 1LV8A 2WFZA 1X7XA 3GZNB 3IMGA 4CEHB 1MC8A 1XVUA 4X54A 4HEQA 4EMTA 1LPPA 1L8XA 4OH1A 1JT9A 1LPNA 4DYHA 4OYLA 3GIDA 4L2IB 3QE2A 2C42A 4DY4A 2YOGA 5GZ6A 4M0FA 1WSBA 3TNLA 4LHYA 1QIMA 2H1FA 2P4SA 2I2DA 4LFAB 1F38A 1SH7A 3ZWMA 1T24A 3VKVA 4OLHA 1NUUA 3OIGA 3AFIA 3IP1A 4FNMA 4IX9A 4M1MA 4A6XA 4ZHQA 2J9YB 4O63O 1J22A 3LECA 4KUHA 5ICGA 2DHEA 4PO3X 4KIFA 3JCZA 2PXHA 2H31A 2X6RA 2C9DA 2L17A 4HYEA 4R7GA 5ICFA 2G7MC 2RGXA 1KHTA 2NWQA 1H69A 2ZAYA 4Y1EA 1M33A 1C50A 3U1VA 4XR9A 4GH5A 2YYSA 5IC5A 2JPDA 1R0ZA 3U3DA 3PFKA 3ZLUA 3EVAA 3GFVA 4CTJA 4FCVA 4WKBA 1N7JA 1A5AB 3AJAA 2NZ2A 5CFMA 3QU7A 4ZCIA 1EP3B 4YJ3B 5AVJA 3ZHZA 1KR5A 3QWFA 3LY5A 4B3FX 4S05A 3QOWA 1FFYA 2B1JA 2LKCA 1IZYA 4KLAA 3LNCA 3E81A 4NECA 3BD8A 3KXKA 4PO9A 4FFBB 5AO9A 1JG3A 1Y5MA 3K09A 4I4NA 1W44A 4EI8A 1JU4A 3VPCA 2RIRA 3I2GA 4RTRA 2RGWA 1QE5A 2VP3A 1T9BA 4FOTA 4G1VA 4MGZR 5KAPA 1DAHA 1NG9A 1L7BA 4CLRB 4ARZB 1NTOA 1IBMB 4Z0HO 4P0TA 5GVSA 2X14A 4N0DA 3AUJB 4UHHA 2YFKA 1UANA 3M33A 4P3NA 5E1OA 5K4GA 2LXNA 4LGYA 5AH0A 1T34A 4QWMA 1N0WA 1RAFA 2WLTA 2X19A 3ZY2A 2GXAA 1N6NA 2ZYTX 1MV8A 3KJIA 4J2HA 1BS2A 4L6CA 4OXYA 3V8NA 4R6XA 1DDIA 3BUSA 4NNOA 2QAGB 3WX0A 4J0GA 1HQDA 3OTWA 2I4RA 4PANA 1SKYE 1II8A 1E1RA 1XT6A 2P4QA 4HWRA 4JUDX 4PAGA 3WKAA 1JT2A 3KTAA 5AJWA 4YRNA 5K4AA 4GPEA 5J63A 3ZW7A 1CX9B 2AC4A 2I8CA 4K3VA 3EZFA 5I7VA 4QWWA 5AOCA 5KYVA 3RRZA 2HPZA 1XRMA 4MR7A 1BFKA 4R6WA 1AQNA 3E27A 2EDCA 3EEFA 2TECE 4AN1A 1EVZA 4D8TA 4HEA1 5AKHA 3FLBA 1XTZA 3WYAA 1BEUB 1U5CA 2QRGA 3F2IA 4FYWA 5FR1A 4ESEA 3VZSA 1Y3FE 1G2QA 1CTQA 1DP4A 4IIJA 5H9VA 3H13A 1BC5A 4PC3A 2BMWA 4HRXA 4ZD6A 2Q49A 3ZQUA 4CLXA 3LUAA 3MJDA 4DBZA 5A4IS 1QF9A 3FGZA 2H51A 2RGGA 5IJ9B 5LIPA 5IZCC 4MV1A 4KR2A 4X1YA 2EWWA 4ZYXA 1YS2X 2D1QA 3KLBA 3X43A 4LYAA 1SPBS 3VZQA 4W5OA 2PUGA 3ZDDA 2I66A 1AUPA 2HMUA 3GA7A 4XDYA 4P6VF 1R50A 2WAXA 3TR0A 3GLUA 5EE3A 2CHEA 3TSCA 4AMBA 1NOIA 3VQTA 3GJ5A 1JQDA 5CA0F 2NP6A 3NW9A 2ZBPA 1QFSA 1G5FA 2ZXEA 3D6TB 3CY6A 1Z0DA 1X80B 2CXSA 3BMOB 4W5HA 5BXQC 1XDWA 1VCOA 2QS9A 4IGFA 3JYQA 1W5FA 3ZXIA 3SJAA 4JX8A 1T9GS 4C2AA 4J0QA 1RFLA 1P2VA 4LTMA 2I76A 1VA4A 3DTTA 5DI3B 5M29A 1NUHA 2Q46A 2PRZA 1CD5A 5LQUA 1XR3A 2YV1A 3W4IA 4RTNA 1XXHA 5TEWA 4CQLB 2OR3A 5HBGA 5ALFA 5KTKA 4BKPA 1T9CA 4QQKA 1WMEA 2XGSA 1SBCA 3G1TA 3G89A 2X8WA 4C4ZA 5BVGB 1DJOA 2OHHA 3GGJA 4IFIA 3Q9UA 4RZ2A 3ADCA 1WB5A 1ZHHA 2RJOA 3OE7A 5AJYA 3ROFA 1DAPA 4WXPA 3U80A 2AOWA 4OHKA 4P38A 4I9NA 5EL0A 5KYGA 4JKOA 3G85A 4X44A 3ZV4A 4ZGWA 1AG9A 3P52A 13PKA 1SK9A 4JDUA 4OPMA 5DEIA 4ZV9A 4BO2A 4KTTE 4WLOA 2VUTA 1F12A 1VGVA 5AVYA 2E4XA 2HA0A 3BBLA 2BEVA 2Q21A 1UUFA 4X6YA 1F8XA 5ALXA 1AN9A 2I7DA 2PVCA 3FPHA 5ENDA 2B61A 5FPYA 4JC8A 4D2IA 3UGTA 2FRXA 4UDXX 5AXDA 2CV0A 5JROA 2C4NA 5IN4A 2VK2A 1L3BA 3GNLA 5C3MA 3THWA 5B58T 3K53A 3OP4A 3UK0A 3EGDA 3D3NA 3PXAA 1VG8A 5DCLA 2YH2A 2PMCA 4IDQA 1KETA 1KH2A 1RPNA 3OZWA 3P2EA 1VP3A 2JZOA 4QDUA 2C8JA 2OYSA 1Y7HA 2EWVA 4E4RA 2I2XB 5C4MA 3L7YA 3AKCA 4O33A 2QL6A 3OMLA 1ZNQO 4DWVA 2DHCA 1AS3A 2R8EA 1QK3A 2GVDC 3MPOA 3EWSA 4D99A 1CUEA 3G0IA 1OYWA 3AX6A 3M83A 2RKWA 3DBHA 4RK6A 1N6HA 2OM2A 1NVUQ 2GKOA 2GF9A 3E2MA 3GFFA 1E9BA 2Q9BA 4ND8B 4N18A 4TMYA 3RYFA 3TNJA 1QFJA 3TW4A 5AIAA 2V45A 4HX2A 5LD2C 1C2YA 4I99A 4PO8A 4C29A 2I4NA 3TSZA 3JVDA 1JYFA 1FQKA 3GRUA 3NTUA 4UBKA 1MW9X 5KHAA 3SYNA 2ATIA 5F7JA 4PCVA 5CRIA 2WA1A 5CU7A 2OGZA 4IDAA 2PU5A 5C37A 2XB9A 3BOSA 3B12A 3NRBA 4P7KA 3NXKA 3AGQA 4QUIA 3WAKA 3VBEA 3VR6H 2GO1A 5BSHA 4CMCA 2ZBGA 2QVLA 4JWTA 4F11A 3EG9A 2WHEA 3NOOA 4LV8B 4F97A 4NZZA 1G9SA 1X13A 1U04A 2QRUA 1X7YA 3MTBA 3UZUA 2IS4A 2M6SA 4JT2A 1XA3A 4JUIA 1UP6A 4YRDA 2GNPA 3C3BA 1G8JA 1SU8A 1PQ4A 2V3VA 4L95C 4JSTA 1D2AA 4FQ8A 4ZVPA 3RUHA 2EP7A 4YJHB 5GP1A 2O8FB 4J3FA 3DAPA 1QHSA 3PDCA 4D5EA 1OREA 1E7MA 2A7XA 4NWIA 2V9PA 3CGGA 2VOEA 2DY0A 4N5MA 1G8PA 1H2AS 2HAEA 4RHXA 3WYFA 3A6HA 5ALTA 4E08A 2C1XA 2J87A 1UQUA 4EF6A 2XCTB 1GU0A 1KAHA 3K4PA 4BMDA 2FN4A 2WF6A 2AI3A 4AJ4A 1IEQA 1O77A 1J2TA 2IYLD 2HA5A 3GZJA 3DC2A 3FYHA 1C7ZA 2VNHA 4X90A 2C5GA 4G85A 4JVMA 3A6PC 4TVBA 3JYNA 5TGTA 1FJ2A 4E51A 2O06A 2V55B 3V2UA 2XNDD 4DEYA 2QPOA 3EPJA 4V0KA 1EE2A 3NHBA 2EKQA 1U7PA 5DGTA 3UMYA 5FUMA 5EQJB 2QMZA 1PYDA 3EGOA 1XZMA 4J2OA 1XLUA 4MICA 3FBWA 1Z0FA 3DFIA 1LZKA 1G7TA 5LWHA 1GZSA 3B6ZA 3QG5A 4FD2A 5ERGB 3V2HA 3A06A 3IDSA 3V4FA 1JFFA 1N2BA 3RUPA 4JYPA 1S2NA 2IXTA 4BB5A 3IE1A 3LA8A 4MI9A 3ROKA 1IJEA 3LSYA 2EIXA 1A82A 4HNAA 2IH4A 4NJEA 1FP2A 4UD2A 1YBAA 3IHWA 1O4WA 5JRZA 1CS0B 2AFVA 1I1NA 4KAAA 2H7XA 3VHQA 4B7UA 4L0CA 2CXNA 4A2PA 4LZOA 4G1MB 4N7BA 1CF4A 1GXSA 5AQ1A 5CDHA 3WRWA 4A26A 3W2EA 1L8LA 4HFNA 2F17A 1ZCZA 2O8EB 2F8SA 2W11A 1K5PA 1R6TA 3K1JA 4FMDF 2QM0A 4H31A 1USKA 2W9XA 1SKAA 1DRVA 1DKQA 1OW3B 3HB5X 4A8JB 5ILOA 1CZUA 3E7DA 5FPHA 4E5VA 4EJFA 3F98A 1QP4A 4NPHA 3W5JA 4YCCA 1A04A 1SKUA 1LPMA 4PYIA 1JQBA 3EW9A 1A9OA 4Q4AB 2JB9A 4CM8B 4BZQA 4DCSA 3VPHA 4Q6BA 4HLCA 1SIUA 2C9CA 4UQPA 1E7SA 1L5FA 1KJQA 3NX4A 1QO0A 4HB3A 4N41A 1TAUA 1SOVA 2VZ9A 2WWRA 1THZA 3SF8A 4QGAA 4YB8A 1N1EA 1ODIA 3PC6A 3I04M 3REOA 2O14A 3HL4A 4UMVA 3MQ2A 4Z99A 4CG1A 1FRZA 4B47A 3N0WA 4G0NA 3V1NA 3UUGA 4ER5A 1ECGA 1ZQ1A 1RHQA 1UBTS 1ZMOA 3MF4A 4R98A 3USCS 4BO4A 2JZCA 3DTNA 1H94A 4WZAE 4KQXA 2WTUA 3ODPA 3CPSA 2P2ZA 4PSKA 2ODAA 3L6UA 3OFKA 4Z3DA 4JYCA 1GZ5A 3RSQA 3AZPA 4JHXA 4XM2A 3INGA 3V1LA 4JMPA 4DOMA 3TPZA 3K5IA 1JU9A 4PX3A 4HH1A 3FW1A 4YROA 3GA0A 1IK4A 3RRMA 3RB8A 3G88A 2X4IA 1SCAA 4RA9A 1W96A 3EXEA 5JSYA 4FIZA 4HQOA 5ESRA 3AKEA 2DT8A 3UAXA 2Y1OA 4PXYA 5BR8B 2G77B 5D87A 2XUZA 1TCVA 4MLCA 2VNSA 1DXOA 3B78A 3C1TA 4FOLA 4ZKEA 1PR5A 1S0UA 3EVCA 5F64A 2AG1A 4QG7A 2JGLA 1M34A 4CMAA 5BR1A 4GLLA 4KX5A 1X9GA 3T3MB 1OLSB 2VDNB 2ZIUB 3IKJA 2HUPA 5IMBA 5H3HA 3T5GA 3WDLA 4KPEC 4EKYA 1S2GA 1WZEA 1DBPA 4IIGA 3BQ9A 3LS2A 4D8XA 4V2IA 1WVIA 4JELA 4ZYVA 1QTQA 1O54A 2OGSA 3M6VA 4TTRA 4AD8A 2VF5X 1KA9H 3ZIUA 2V3CC 3MAGA 1SQFA 1YJAA 2BJWA 2FPIB 3GLQA 3HJHA 1IM5A 2RARA 3IBSA 3OAAD 3NATA 1R1DA 1J4AA 4Z49A 4JXKA 2QYSA 2OUKA 1E32A 3A2KA 4EI2A 2PZMA 1KYIA 3JPYA 2P79A 2GASA 3WGVA 3W79A 3JASB 3ISJA 1W59A 3RS8A 4CI9A 5T8KA 3DR5A 2CCKA 4B8ZA 2EX4A 4AAYA 3MINA 1ISSA 3NWJA 4J76A 2XRFA 4CDGA 4LHZA 1NQUA 1QRDA 4PRLA 3IQEA 3OEYA 1Y5IA 2ZAIA 4PG7A 1B74A 5BQPA 4OQXA 2VWPA 3MMNA 4JP3A 1XCLA 3K9BA 4XWWA 4CM6A 4R8KA 3RBVA 2X15A 2WIKA 1P9WA 3LPCA 3UK1A 5HHTA 1PFQA 1MO6A 4OI4A 4BNHA 4X66B 3DPUA 2I3GA 2NUTA 5IAOA 3UPTA 1NMYA 2J59A 3BMCA 2CV2A 1U98A 2GBIA 1PJBA 4EYGA 3ZU2A 3H8VA 2MU1A 3CUSA 1MFZA 1PE0A 2ZR8A 3HU2A 2YHAA 4RLHA 1WX1A 4K7JA 3HL0A 1WSWA 1LPAB 4PXAA 4V38A 4M1QA 3VR2A 2H1HA 1ZEMA 1C0KA 2QTLA 4F9TA 3AWDA 2IXAA 5JAQA 2H5IA 2YWFA 5A71A 2WSMA 3KWJA 5BSKA 2HR1A 3K0CC 2EFDB 2JGEA 2YWRA 3K2IA 5CW2A 4UFNA 4B80A 1SU4A 4OU5A 3KHSA 1X1AA 4R40A 2BTQB 2LUOA 2AD5A 3KXIA 1RKUA 1EVKA 2NO7A 1ADFA 4OKNA 3GPLA 1Q0QA 3PFBA 4HWSA 1R4NB 2OKGA 3JQAA 3N75A 4ZVLA 4Q3CA 1JSCA 2NSDA 2V74B 2QUIA 3G82C 4G8JA 2C5SA 3PXBA 4EQ6A 1C9MA 1UM9B 3DM9B 4LRSB 1EK6A 4YV0A 4MGIR 2R84A 1MRZA 2PDAA 4GC9A 3A0RB 4BWVA 2X9GA 1IHXA 1NQWA 1PEYA 4RTSA 2C2HA 5DPMA 3ZJ5A 2ZIAA 1QV7A 1MIHA 3IEXA 4GLBA 5TPWA 4TTTS 1NVVQ 2M1XA 3O8QB 2AN5A 4U7HA 1H05A 4ER0A 5TIIA 3DOFA 3LQFA 2VQSA 1K1EA 4XD2A 1GZVA 1P1JA 1H1DA 1T2UA 2Z5GA 4JC5A 1IBLB 1V9SA 1ESCA 4EEXA 2GA8A 3A0UA 4JLDA 2CW5A 2FPKA 5ALUA 3S2YA 1PL0A 4OAPA 1OFVA 2GRUA 2F3QA 4P54A 5HJ2A 5T4FA 3F8TA 3DZKA 3D4OA 3CE6A 1NMXA 3KPJA 2R6ZA 3W5AA 2CNBA 4FR2A 4IZIA 1U5BB 5E9AA 3PQEA 2HI0A 3A14A 5TX7A 3I76A 1TJYA 3DYIA 4YQEA 1ZK4A 2HHLA 1PAUA 3FWPA 2YW9A 4OU4A 4RXUA 5CG2A 5ITVA 2IA5A 4P35A 1M2WA 4XX0A 1KI8A 3SC6A 1SXJC 3C7AA 2GXQA 4FE4A 1M72A 2B3DA 3MBKA 2I6GA 5EXEA 1E3DA 3H11A 1CBUA 1HOXA 3DGFC 2H54A 4NZYA 4JV5B 2DHQA 1L2TA 2VUIB 2PS1A 3QSGA 1EBBA 1ZAKA 1KVSA 4W7HA 5JEDA 2AUTA 1HE2A 1HURA 4G23A 4JEHA 4D82A 1XMSA 3EDRA 5CX1A 1YDGA 3UWOA 2UAGA 1OA1A 1EMDA 3ABRB 4CUKA 4D4LA 1VECA 2R8RA 3JSXA 4JT4A 2WWHA 1PQPA 4CLRA 4LF6B 2ZZKA 1Z6ZA 4MPDA 1L9XA 1GGMA 1YL6A 1HF3A 2HCFA 2PX8A 3DHNA 4J4HA 4CMBA 2PH1A 3PQCA 1KC1A 4YP5A 2JI4A 2ZT5A 3HCFA 3WGJA 5JZOA 1LLCA 2FGJA 1PFUA 3V4SA 4D42A 1RXVA 4DIKA 3UJ6A 3KTOA 1MEEA 3PRJA 1HDYA 3H0EA 1FW8A 1UEXC 5FIUA 4BFSA 1NVBA 3G5UA 4RLFA 1ENZA 1SKYB 2ZYVX 3OQ6A 4LNUB 3A1EA 4PY2A 4QDJA 2C3UA 3C3DA 3RVLA 1J20A 3INTA 2QRKA 1EJ6A 4AKTA 4E5YA 1WDTA 3QXXA 4ZCMA 1KTIA 3G8BA 5BN5A 2CV1A 2EBHX 3D3JA 7REQB 2PLWA 3OT1A 1L1RA 4BJHB 3HUUA 4GZMA 2WW8A 2B82A 3Q8KA 3O91A 5EJ9A 3DLBA 1WXGA 3HHEA 3VC1A 4UU8A 5EE0A 2VDPB 2PKCA 3P2IA 2XVAA 5IWCA 2P1ZA 4U2KA 3OJEA 2W42A 1NY5A 4DDMA 3SPXA 2WG0A 3NBQA 3FMVA 4DRYA 1IOVA 1MH1A 3H8JA 3LDFA 3D64A 1A9TA 2AQHA 5EIBC 1B76A 4ZU6X 1NX6A 1MNQA 2QDKA 1P0FA 1JLRA 3O84A 4U9HS 4ZYZA 4NH0A 5BURA 1ORIA 4HO1X 4PC7A 3Q9SA 2A1IA 1VDMA 2H07A 4GOKA 3V4ZA 1DAIA 1T6XA 1TYZA 3OURA 3P4UA 4LZNA 2JEOA 3NHWA 4M8IA 4GSKA 3REGA 4GICA 4BX2A 1H42A 2UYGA 4XARA 5IEBA 4GOJA 1EA7A 3OTGA 2C3PA 5JFGA 1OTYA 2NNLD 1M1YB 4WY8A 5FUXA 4JVLA 2UUCB 2FWBA 3DHEA 2NZWA 1HE3A 3I62A 3E23A 3AI7A 4DS3A 4IWYA 1WKCA 3N05A 4RIIA 3E9QA 2ZUDA 1JMVA 1RQPA 1W8DA 3BL5A 1WTAA 3E3AA 3FLAA 4LPKA 1H5QA 1UDBA 5BT9A 3VBCA 4YDQA 1NNSA 1O6GA 5I9BA 1TF5A 3VR6D 4ZO6A 4P3KA 1VJ0A 1YUMA 4C0LA 4YV2A 4YH1A 2B4TO 2D62A 1OH5A 5IAJA 2FF7A 4Q02A 3QXCA 1NIJA 1EDDA 1JKFA 1PSDA 2IT1A 2BEWA 1Q7BA 2NIPA 3H9QA 3LVFO 3OQIB 3V7NA 1JR6A 1N2CB 3MJEA 4FINA 1MAAA 1CDOA 2X41A 3T12A 1NXVA 5IT4A 4KPYA 2G7ZA 3GJZA 2D5AA 5CXXA 1H2WA 2IXBA 3Q5DA 2Y99A 1G17A 1II9A 1KQPA 2O8DA 1EUZA 2O8VA 3KB1A 3R77A 3E4DA 3CYFA 4PWZA 5JH7F 1RTTA 1U94A 3HXTA 2XJ4A 3JY6A 2UXBB 1I4OA 1U1IA 4X84A 2ZJOA 5PGMA 4B3TB 1XCPA 4MRNA 4A36A 1I9CA 1E9EA 1UCFA 4NONA 1ISRA 5D2CA 1GQRA 5ESWA 4DSOA 3NPMA 1ZR2A 1SG0A 2BW0A 4RWEA 2RCYA 1H2EA 3TUJC 3OJCA 1JEJA 3BH6A 3KPVA 3VR3A 2FFAA 4JOCA 3BWEA 1YR8A 1I6LA 1L7QA 1EUCB 1UT5A 4FOPA 1IC6A 2E1PA 4G5FA 3DV9A 4KXWA 2WLSA 2JGNA 1L5HB 1QGAA 1ZVMA 2I2AA 2CNDA 3NBFA 3DVLA 2YR0A 4C4RA 5JC8A 3T95A 4PHGA 5ALOA 3BIWA 2VHJA 2X4DA 1U3WA 1YMQA 1M75A 2X5KO 1YBHA 4FEEA 2C7RA 4JLSA 1JDNA 1M73E 4IIJF 2XUKA 3ZJVA 1E5LA 1VZ3A 1WQ1R 5CYPA 2CJWA 3S8MA 4MVJM 2IX3A 5REQA 1E0DA 1GSOA 1RDFA 1ZDMA 1C3XA 4MS3A 1NJ2A 3BQMB 2Q8NA 3KT8A 4N3AA 2W4QA 4PQRA 5LBIA 3KALA 3IUJA 1Y6ZA 3TQIA 2IU6A 3RYCA 1UXKA 2NUBA 5A5FA 2NACA 2Q1WA 1HFWA 4C01A 3KQNA 2JAPA 3R5HA 8MHTA 3ODGA 1GTSA 2BGJA 5E38A 4NLLA 4F4HA 3KLNA 1DHTA 1TZKA 3V33A 4C6TA 4NZ9A 4OQYA 2XMPA 1U81A 1C30A 1ZGCA 3TKAA 1RXUA 3U4DA 4BO9A 2ZB4A 3H8SA 1L3CA 5EPEA 2QBYB 4UZSA 5JCOA 5IN5A 1TQDA 4N7JA 3E0XA 2DF8A 1JJ7A 5COQA 4PAMA 4QBFA 3RKSA 1Y98A 3IBCA 3AETB 2V5UA 2ZKLA 4KXMA 4MO2A 4WD3A 1GPNA 1ND6A 4PZAA 5CITA 1KY4A 5IKEA 5A0FA 2RG7A 4O0LA 5BWNA 1R4ZA 1W5EA 1NYLA 2Q4RA 2A59A 2HF8A 2ZJ1A 4OYHA 4W5WA 3RAJA 4TVOA 3QBVA 4U63A 2IEAA 4QUBA 5JXHA 3RWBA 4HGYA 5LQSA 1ISIA 1SCDA 1ZO8A 3SR0A 1BE0A 5T4BA 3HXOA 5HZGA 4ZTZB 3WMGA 1YHYA 1KMNA 2I8AA 2WQ6A 5E3HA 4YV7A 1SVNA 3HCAA 1R6UA 3FOAA 4FCCA 4G0VA 2HCBA 5IASA 2WJ4A 2P0EA 4LMBA 2R6DA 1Z4JA 1ZL0A 3B1JA 3A7DA 1RZ3A 4EUNA 1XDBA 3R0ZA 2AA3A 3AIMA 1Q19A 3TRDA 1A4IA 1RXSA 2IY9A 3O95A 4ZVSA 4AZ3A 7GPBA 4RTMA 1IQRA 1LBSA 1OFUX 1KI2A 1SD5A 1VIAA 1AD2A 4G5QA 3GLGE 5THXA 3DHVA 3KOXA 4UPDA 2Z2KA 3IEIA 3C48A 1MJGA 3BD9A 3ZHBA 5KTNA 1PU2A 3V2GA 5BVHB 1B2LA 3N7AA 4F0JA 3G8AA 3IP5A 2DT5A 1P77A 4KQ1A 5AVVA 2AR0A 1EWYA 4JY7A 1LQTA 4NCXA 3L4JA 3CX4A 3DFZA 4NG4A 4UNIA 1S8NA 1M74A 2WU4A 3D7LA 1ECFA 2JGRA 4H1HA 5AQEA 3N8DA 2UZIR 1FK8A 2V0CA 4UTVA 3H2KA 1SUWA 2O9JA 3FOWA 3RHTA 4AJLA 1YQGA 3ZKAA 1DBQA 2HMSA 5KSOA 4ZXFA 3QU4A 1DC8A 3T0IA 1LQUA 4MKZA 4JEUA 5IYZA 1V35A 4UTXA 1JDJA 1MG5A 5FFMA 3FA2A 1DC3A 2WD8A 3VU1A 3EVFA 3DMDA 4XPIB 1KORA 3ISTA 4UTPA 3EX7C 4PBTA 4RL4A 4CTOA 2WIBA 4MRAA 2IPOA 1TPYA 2B8NA 1YQWA 2Q3DA 4DR4B 3L05A 1U28C 4IMRA 1L0BA 3CRRA 1ZESA 2H1WA 1JB1A 4UEJA 5B7PA 4UUQA 1RMYA 2G63A 2WD9A 2WSBA 5KJ6A 5EMKA 3NDJA 1PT8A 1J39A 4RKEA 3MWEB 4BIMA 5AESA 2NO1A 3QF7A 4GGOA 3VR0A 1W93A 4LF5B 4G9EA 3OQHA 1XG5A 2QTGA 2FW9A 1BA3A 3E5NA 3IA2A 4CM8A 3C3KA 4V1CB 1Y5RA 3KT0A 3AM5A 4OA5A 5FB3A 1Z2OX 1FBTA 1E62A 3JZFA 2Z56A 4QASA 4B6JA 5A5GA 4GAEA 1F0NA 3ABSB 2ANBA 4MRRA 1V5FA 5JDIA 5LMCA 3WRXC 5G0TA 5F1YA 3I4LA 4P4GA 4BV8A 4AZ3B 3ZDZB 5J4HA 2XZTA 1OBHA 4MR8B 1GKLA 3K05A 3M3PA 3OCXA 3T0GA 4WZAB 1KVTA 5ISMA 5TQJA 4KFRA 1E2GA 3SSAA 3GG2A 1C3JA 4L28A 5KQGA 3MUOA 1D1PA 2WJWA 5IK2D 1IWPB 3M6FA 4DJAA 4YT2A 2XNHA 5GGXA 3TRFA 2VRCD 2ESRA 3NB0A 1Z07A 3HLKA 4XW2A 1KE1A 4C7BA 2NADA 2YWHA 2C2YA 4EA9A 1C4OA 3WFIA 2OCAA 3PICA 3TLGB 3A36A 4PZUA 5MF6A 1CJUC 4P86A 5HNKA 1YU6A 2ERCA 1U2GA 3VKUA 2DWPA 2C3YA 5FWNA 5KSWB 4OLBA 1GGVA 2O0KA 1U4SA 2MHCA 3KLOA 3ADDA 1PWEA 2WE8A 3I9MA 2J3IA 3MTIA 4F6LA 4X5OA 3B1KA 4IFTA 1CF2O 4O2AF 3DDUA 3DMTA 4HLNA 5KCZA 3NHMA 1UP7A 5ARDA 1OLSA 3DL4A 4OYRA 4Y6GB 4BEWA 3SQXA 2JFXA 4K03A 4UEQA 3V5NA 5CFOA 1G0OA 5AW6A 2W6ID 4DDWA 3DEFA 5KTPA 4IS3A 5HG0A 2QUBA 4XLZA 1P4AA 1R3DA 4IDNA 1EFHA 1LBIA 2OCDA 3HVHA 4MKHA 5E4TA 5I7HA 4UU1A 3N76A 4N0PA 5FYQA 2FPIA 3SK0A 1NONA 2XDYA 5A06A 2WFAA 4PWYA 3FI9A 4IIBA 1JEQA 4MYTA 1A7UA 2VHWA 3AUSA 2BF7A 4HAOA 4RORA 3UT6A 1VRCA 1P18A 3H9EO 1J33A 1UMCA 3L1IA 3PFHA 4GI3A 2NOAA 3C3MA 3H4MA 1SQSA 5FFFA 3TLZA 4Z7QB 1RKVA 1O0SA 1UC8A 3NEYA 4TL9A 4OB8A 3FCAA 2DQYA 1KO4A 1YOBA 2FDRA 2C98A 5AHRA 4TYMA 1P2TA 4HQ6A 3PX7A 5DBGA 1J06A 2FTKE 3RSFA 1O8BA 3O9VA 1K7FB 5ALWA 2JIDA 3UVEA 4E46A 2C9BA 4Y0AA 5FNZA 4CLHA 1T8PA 3A28A 1TQ6A 1DCFA 1G16A 1C9JA 1LY1A 5NLLA 3DAYA 4U7DA 4HP8A 2BGWA 3IEVA 3HCRA 3QKUA 1NNI1 4UE3S 3GPCA 4NEQA 3TQSA 5CD9A 1CKEA 1Z0UA 3BWXA 1QU2A 2EJUA 1PF7E 4JUCA 1T8RA 4B4VA 4KRYA 4IOMA 2NTNA 5SZHB 5KPJA 1MAVA 1LBHA 1PT9A 5IVPA 1E59A 2JAHA 3NMUF 5ICMA 4PTYA 3HCBA 1KKUA 4JT9A 2HA4A 1E4YA 5E0KB 3DT9A 4IO0A 5ESDA 1B8OA 3ZXSA 3OJXA 2ZAOA 3OCCA 5EINA 3X1XA 3S1SA 2FV8A 1RWMA 2WZDA 2YBDA 4IUCS 4C4PA 2ZXUA 3E3NA 1XDDA 2VJCA 5K51A 2Q5LA 1ZQ9A 2C1ZA 3K0AA 2BTQA 2KB0A 4UUPA 5KDOA 3IKTA 3URKA 1WHSB 2QUKA 2FHSA 4C5BA 5HQTA 3DTVD 5FOVA 2WWGA 2HIGA 3GJYA 2HYDA 2YV4A 3ENQA 2A0XA 2ZAMA 2G1KA 2JFOA 1KZYC 2QA5A 1DDOA 3BIOA 4CIDA 4DGQA 4EB3A 3SMQA 1KOGA 2CXOA 3MCWA 1Z2DA 3C24A 4F93B 2HWYA 1I80A 1T0BA 3CWCA 5EXSA 4I3FA 4PX5A 1X74A 2FA9A 3G2HA 3NM5A 3ROMA 3GAFA 4JQZA 5BUZA 4IIFA 1KJJA 1NJFA 1YO6A 1JJAA 1SXGA 2GEDA 2I1QA 3TM4A 1W0JD 5CAEA 3GJXC 1PQWA 1VE6A 3B8EA 5LP6B 4ZREA 3T5BA 3UWPA 3ZGLA 3AG6A 1R6DA 2OE2A 4CM4B 4MIOA 2FMKA 3GWZA 3EXHA 4LZAA 4C3UA 4G86A 1WY7A 4RD4A 2C0PA 1FW6A 1ZBDA 4L7VA 2C2ZA 1K5HA 3HB0A 1G98A 2OGUA 4L7QA 1A4XA 2XCUA 4A16A 1J5XA 2H3EA 2RBEA 4M8SA 3I5YA 3V4VB 1Z6GA 1BDHA 1GDTA 1W94A 2VTVA 1J7KA 3PHBE 3WKEA 2IPMA 4GE0A 1U7XA 4TRNA 1TKRA 1U5BA 4RXMA 5BORA 2CMGA 4NYMQ 1XRJA 4Y7DA 2HHHB 2PUEA 2XLCA 3VNSA 4M55A 3HCOA 1M9NA 2GAIA 1U0RA 1MT0A 5I51A 2IYEA 5G4KA 3VYWA 4B09A 4I3HA 1ZN2A 3KQOA 3BHIA 4BB6A 4RS3A 1QQBA 1E0AA 3IILA 4C04A 2Y0PA 3B2EA 3I01M 4M8LA 5DLPA 5JC1A 3BERA 3SQDA 3OU7A 2CDRA 2FXVA 1ICIA 1AOXA 1BRMA 2DQKA 4Z9BA 1QNFA 3JRNA 4ZVUA 5K0EA 1JN0A 1NVEA 2W2KA 2BCEA 3AESA 3BXFA 2Q3FA 3P9PA 3QLTA 4G0ZA 1N0UA 4NJOA 3UFBA 3W4KA 4TKVA 5CFRA 5J4YA 2AFIE 2Z98A 2X0FA 2XIQA 4J0DA 5LSAA 3GLFA 1AHIA 3IA7A 2J67A 2Z1DA 2W6QA 2JFWA 4O4IA 3VH1A 1QONA 2MSEB 4KJZA 2R6AA 2Y0BA 3R8XA 4NF2A 4BBZA 2CLDX 4BQRA 2GD0A 1R6VA 2QY6A 1SZPA 3QSYA 1CLUA 1I1QB 1ZHFA 2YN4A 2Z8ZA 3OOSA 3AINA 3MPUA 4G0QA 4NY1A 3BSFA 3CUKA 3DFUA 3LL7A 3WK4A 1VPTA 4AFNA 1JJIA 2XGJA 3P4YA 1LGYA 4KE9A 4K9OA 1XJ0A 3ZHVA 4LNUA 5FO0A 1CIVA 4DVJA 1P80A 4EMUA 3MERA 1E5XA 2G0NA 2BJVA 2OP1A 2FR0A 4BNLA 2RGRA 3U3RA 3VDXA 5HDBB 7REQA 4QPNA 3BE8A 4C0HA 1A5SB 2Q9AA 5E7MA 1MB4A 4ACBA 4NOLA 1F2VA 4UAGA 4QYXA 3V46A 2FEWB 1WXHA 2XW6A 1ZK2A 2Q5IA 1N3IA 1T8WA 5J43A 4GPIB 4CM1A 4E4TA 3E7PA 4BIIA 3OOEA 1G8HA 5LA6A 4QVKA 2I22A 3PGMA 3V1MA 3BWMA 2IBTA 2P6OA 1MQ9A 2C2WA 3UCEA 2P68A 4YT8A 1K8QA 5JSKA 3FSGA 1RCTE 4MB6A 4E5UA 5BYJA 4KUEA 1Y1TA 3A9RA 4EA7A 1S2IA 2B1IA 4HAZA 3WRVA 1O96A 4I19A 4X1OA 5JBIA 3ONEA 1NWCA 4TOIA 4CF4A 3V48A 4RTKA 2HDWA 3P2JA 2C5LA 4OSEA 3SYLA 1J1IA 1L1QA 2PZEA 1MBZA 1FTWA 3M49A 3OX4A 4LSMA 5CMLA 5EZYB 3WK7A 5I7FA 2H1OA 4P92A 2B4KA 5D6OA 4BGEA 4IXMA 1YD7A 3OIFA 1CUHA 2PX6A 5IW8A 4BWYA 2YV5A 1J1ZA 4M46A 1XVIA 4XR4A 1GV1A 3ND6A 4EW6A 3V2IA 1V8DA 1FMLA 4P7BA 3DAFA 1TUEA 1K0UA 1CRWG 1VE9A 4Z0PA 3BIFA 2HPHA 3EDCA 3I0MA 5AI0A 5ALZA 3LPDA 2G8LA 4TM7A 3CUYA 1FFCA 2CD7A 2O8NA 2WSSA 2XKBA 3DP7A 3OY7A 4FKZA 5LDGA 5TVKA 1EM8A 4X3CA 5IFLA 2OV1A 4N1AA 1ANKA 1DAKA 4NEHB 4LGVA 2Y2UA 3HGQA 1A5TA 3G5MA 5CEEA 5CGQB 1AF7A 3K5WA 1KJ9A 4LZPA 4G5RA 3M4JA 3DV0A 3KL2A 3MWGA 2ZULA 2JLQA 3COSA 2PSFA 4IJ5A 5F3DA 1K8XB 3CS3A 5F2KA 3EC7A 1XKLA 3I34X 3PNYA 4DUZB 4E07A 1KR2A 3P0FA 3E8MA 2JVKA 4YRMA 3SX4A 4LVNA 4QXQA 5BMVA 3D3QA 3WAJA 1ZNXA 3T4PA 3A05A 3CF4A 2ZBEA 4PYQA 2B7BA 1XQXA 3RM3A 1X14A 1YDWA 2LRHA 4G5YA 4X00A 4C14A 1TPZA 3MWFA 3DEKA 3ED5A 3PCRB 3VPXA 4D3XA 1MAUA 5DBFA 5G40A 4DLLA 3KSZO 4ACAA 3G0DA 3PJEA 4K86A 4OBXA 3ACCA 2WYHA 3BIXA 3CW8X 3WYEA 5BQ3A 4EITA 4XDGA 1GPAA 2FUNB 1GRRA 2PFSA 3TTTA 3FKJA 4IZHA 1V96A 4COOA 3OQPA 5FJIA 4P9NA 1L5HA 5FA6A 3BRWA 5JD6A 3DMFA 1E5DA 3I6BA 5C1PA 4MVJH 2PWAA 5G2OA 5LL6P 1U0HC 4D25A 2VAMA 2O0HA 4YMSA 5GIPE 4EJMA 1FU8A 3D81A 2PCLA 4QPJC 3AJ8A 3PPYA 4CKEA 1FFGA 5DV9A 1XPOA 3W2IA 3G0HA 4AXXA 4II3A 3TZ6A 3BGWA 1PI3A 3KLMX 3PGXA 5DSXA 1ADGA 1QV6A 2Q0HA 3IO3A 5F77A 1MDFA 5CVCA 3RBXA 2EFEB 2VZEA 3C3JA 4MEAA 4IDEA 3AQ4A 3T3PB 3MFYA 2QM3A 3D3WB 3LGSA 4AKEA 4EOGA 1LDMA 1SB8A 1KEEA 3C15C 3JRXA 3UHJA 3R9KA 2L82A 3C7TA 2BM8A 2NX2A 3DL0A 4M0UA 2HBQA 4EY4A 5E6SB 2TYSB 4X97A 2AJTA 3ZK8A 3VA7A 4AG3A 4RU1A 1O1YA 2ZU6A 3F1LA 1NXSA 1W4AA 4L3OA 1IHDA 3IMKA 3QLEA 4MIEA 2ORVA 4AY2A 1VMAA 1ULUA 2ZYUX 2VZ8A 2H00A 4M0EA 3B7GA 3EVNA 4KXYA 4D3DA 2YN0A 4REMA 1CW2B 3UOGA 2BFNA 5L3SA 3AR5A 4KOEC 4FN5A 2GESA 1KDOA 4RMNA 1U9IC 5CVVA 4B2LA 2JH9A 1DAEA 3PQ7A 1UAGA 4J16A 3AM4A 3LWBA 3V6MA 2QT1A 1Z5WA 3AJEA 3GUZA 4ZOCA 4B46A 3WIEA 4Z7NB 1JIJA 1O9HA 1R12A 4LZJA 1GQ2A 3L0BA 4XQCA 3WLNA 2G4LA 1XD2B 2QORA 1WXFA 2KX7A 3M5WA 4DMHA 4EM6A 1G20E 3PJDA 1S5PA 1IOZA 3GAAA 4YRQA 1BWQA 4GPBA 5G3ZA 4O5AA 5K01A 1M7GA 3KOYA 1QWOA 5GJCA 2X7XA 3RJMA 3GLGB 4LOHA 3I6YA 3CVYA 2OO5C 1X1SA 1QNLA 2HK8A 2HWKA 1FDOA 3K6KA 3T7TA 5BR4A 5LMUB 1UBOS 4TUYA 3R7NA 1XWIA 3C39A 2OL4A 4TTPA 5BQOA 4DR1B 2CMDA 5LXTB 2VDLB 1HE5A 5L3QA 2HN9A 5BVHA 1H2HA 1SXJD 3IT1A 3UATA 1ZD2P 5CDSA 4X64B 3DEHA 3K92A 3MJ4A 2HQRA 1GDDA 4P8RA 2XUIA 2C3OA 3DUFA 1ZA1A 3C6KA 3MRSA 2VT6A 3BHNA 3PFCA 4MW9A 4ZQFA 2AQKA 1PNRA 1JAIA 3TX6A 1GNSA 1T5IA 2YXLA 2ZI7A 5FHQA 2Q6LA 3HJBA 2FZGA 5BYBA 4YWJA 3CR8A 4MAMA 3P7MA 5CM2Z 1N2GA 5D3QA 2Y6VA 2RGNA 5ALIA 4EW3A 3GJ7A 2A86A 5JE8A 1A8UA 2GWRA 1C81A 3AOEC 2EP5A 3H16A 1RHKA 3OM8A 2R68A 4MXDA 4MW1A 4F8EA 5KOHB 1PR6A 4XPIA 4R84A 4EX7A 2FW8A 2ZIXB 4KCGA 3WNVA 4MV0A 2VH2A 1CHNA 3MTQA 3HNPA 3NRCA 4FGJA 5T5QA 4UU7A 3O2JA 4PPNA 1JAZA 2AEMA 1W34A 1GPMA 1MQSA 2VHQA 2AHOA 3AK4A 4RGVA 1ZM4A 3ZHOA 2UXCB 4ZV4A 5ER9A 5FWAA 4JEMA 2C82A 1MRSA 3BXGA 4GFDA 1RWXA 2P75A 1NY6A 4RH0A 1SHLA 3ZN2A 4J1QA 1QS0A 3ZX5A 4KNYA 1XRSB 1NULA 2Z2IA 1VJCA 3Q3CA 4H7HA 1U1EA 4I5IA 3PNOA 4R9VA 4DNXA 1JIUA 1SULA 4ZJYA 4XWKA 1Y9DA 3V34A 5K0CA 1TW2A 3B9RA 4MUEA 2AD1A 1Q1NA 1JWBB 1SUFA 1Z4KA 2V6BA 2YJ5A 4DZZA 3RFVA 1TUIA 4IHJA 1MVLA 5EIBD 3VSBA 3I64A 3NOQA 1Y9JA 2V7QD 4WZAA 4DUGA 4YUAA 4OFXA 4MR9A 2PQ2A 4N7RA 4Y6SA 3WLQA 3H04A 4I81A 2PK3A 5SZJA 1GU7A 4KYTA 1YNOA 5AK6A 3ADOA 4GVPA 3I0NA 4KV9A 4OQQA 3S55A 1EIWA 1P81A 1X15A 2AF4C 3NT5A 2QAIA 3AEZA 4KE7A 2XQJA 3T5MA 2R97A 5JMWA 1H2ZA 1AX9A 1H6AA 3UTDA 3WL7A 2PYZA 2CLSA 4C0BA 1REQB 3D8BA 2D0DA 1JDSA 1WL8A 1ZG3A 4PTLA 4YBZA 2C2BA 6REQA 3DBVO 2YWBA 4LWPA 2HK7A 1A2QA 3F67A 1TXGA 4BX8A 1JLLB 2NTJA 4GZLA 5CCDA 3UKOA 4EUFA 1W9MA 4INAA 1EEXB 4Y9UA 4CKCA 1DV2A 2D06A 1TVMA 3GVHA 3KLPX 1IN4A 4B6QA 1FPMA 2PZ8A 3L1HA 3R6WA 1SKBA 3WNCA 1ZIOA 3GD7A 5ED4A 1O95A 4TLMB 3RC3A 5D7NA 1IMJA 3ADBA 1XPUA 2C4HA 3ORHA 2OAQ1 3ZWDA 4Z9YA 1OX6A 4Y2UA 2EARA 4G81A 2AN9A 4A6DA 1L5KA 5KJCA 3OCVA 3UJCA 5D5PA 2AW3A 1E3QA 3ZE0B 2BMAA 2SICE 4ZO8A 4W5RA 3G8DA 4MARA 1ZY2A 4QX6A 3EMVA 4D3SA 4KFCA 2MDTA 3AU9A 2R6JA 2WHRA 3UW3A 1J9GA 2Q8QA 2RKOA 4BV2A 2Y4OA 3C1UA 4QEDA 1NPTO 3U7EB 5BV0A 1JB9A 4C7VA 2XMBA 1X8LA 1VB3A 3GYGA 4NJMA 3TZKA 5LFAA 5IVKA 2PJRA 4V24A 3QW2A 2QWXA 2Q3EA 1OWLA 1T8SA 1SBZA 4K26A 3A4TA 1G8SA 3QUBA 4MQLA 1YZTA 4PZCA 1NU6A 5DX8A 4B3GA 1C7RA 4O0MA 5DCUA 2PMBA 4CIWA 3GJTA 3KYCA 3OJLA 4H3KB 3IYLW 1TF7A 3TNFA 4DL9A 2HZ7A 1MEOA 2PX2A 3FPJA 3WJ1A 3IE2A 2CUNA 4PFQA 1T9DA 3E82A 2ZP1A 5AJZA 4YCSA 2QJTA 3NVDA 3N3AC 2FETA 1PJ3A 3FYCA 1JSLA 3TIXB 3QPDA 1CR1A 5ALYA 4P82A 3COYA 2E0IA 2NG1A 2ZJFA 3D7KA 2HXGA 4QYTA 1OV4A 4HVCA 1L5OA 1QYIA 3OQ1A 3HGMA 2WVGA 3OF5A 4M9SA 1LBTA 4E94A 2NU9B 1GCAA 2R85A 2Z5LA 3RIMA 1ZNWA 4YPVA 2W2MA 1UFVA 1Z4QA 4KQGA 5BW8A 4B40A 3U39A 2VJAA 2CVPA 1DUVG 1FZQA 3AFOA 3FWYA 3TGWA 2P3OA 3UAWA 4DZRA 2CFIA 5MN6A 4P98A 1VIYA 2PXXA 4LXUA 2SNIE 3QBTA 3A9UA 4C0QC 1G291 3KUKA 4ABTA 1HSOA 1RPTA 2PKEA 1RMTA 2QROA 2JFQA 3UYLA 4MA0A 1LH0A 4LPSA 1TLFA 1ZIPA 2HHJA 1EWVA 4PVDA 3OZSA 1HNXB 3QUCA 1FNCA 3S99A 4CMJA 2IHTA 5AVUA 5MHTA 4QOSA 1AC5A 3R7LA 3LFUA 4R5MA 3M6IA 2ZXFA 2QX7A 1B41A 3EGXB 3NRJA 1DKRA 5EXXA 5AW3A 3LU1A 5I9LA 3T3NA 2J0SA 1FEZA 1QX4A 2JLBA 4HNGA 2ID8A 2I4MA 1NMSA 3AW8A 5JAZA 4C6RA 4LOIA 2XZLA 3OCYA 4G0MA 2Q41A 3KOMA 4Z3KA 1JR3D 1ELOA 3PC8A 4XVHA 1OGYA 3NVAA 3BULA 4XAQA 4JBLA 1V25A 1RC0A 1WABA 5JZMA 2OCKA 4RFVA 3OZXA 3AR6A 3LC2O 5GONB 3ZYCA 4DJDC 3G2JA 1W5SA 2CVFA 2DWCA 4TMZA 1IB0A 4AY4A 2WWVD 3ER9A 1EG7A 3VAYA 2WQ7A 3KK0A 1PT6A 2VAPA 3ZE6A 1I2CA 3LHIA 1YJQA 3VYSB 5FLKA 2VA9A 2MIIA 3EUEA 1D6MA 2ZJ5A 3EZNA 1V1RB 1PJAA 2GZDA 2N46A 2XGMA 4H6VA 4I8DA 4QPPA 5AFSA 1V4NA 4AZ0B 3BTVA 1C7JA 3NKFA 4ZMSA 2VR1A 2GJKA 4E1BA 3Q7RA 5EVJA 1G5PA 3GGPA 3SIPA 1UOQA 1XHEA 3FCCA 5J9FA 4ZYWA 4C4TA 1CZLA 1SXJE 3ZGZA 2E2WA 4D6YA 3IDOA 4EVQA 1BDMA 2IZ0A 2AFIB 4B7CA 4GXRA 1EVLA 4OP1A 1ACMA 3L02A 2OOKA 3HHPA 2IE0A 4HQFA 1SCQA 2EV9A 3AR4A 4CMEA 4UOZA 2BHLA 2QN6A 1T9GR 5LQCA 3OIWA 1F8UA 4H7PA 2BRUC 1DELA 2ORYA 4QDKA 2H2GA 4EPVA 3C3CA 1ZOLA 2PM8A 3BRCA 1M2VB 3CZ5A 4NHOA 2IDJA 4S3MA 4ZU1X 4BHTA 2VNJA 4DJJA 2C2KA 5DWQA 3F90A 2EFCB 4FT2A 2QT0A 1TU4A 1YRBA 4E09A 1HX7A 1V43A 3DXFA 1F2UA 1O0CA 1VL5A 3U37A 4P0PB 2MSCB 3AF1A 2XMZA 5TXGA 4DC0A 1TM3E 3JATB 3H83A 4BFXA 1BG6A 1VXRA 4INPA 2EOAA 1VE5A 3BCUA 2NV2B 4F12A 3KQWA 1OE0A 3HEBA 3F7TA 2FG6C 4UQOA 2P2CA 3EHDA 4DG5A 1M54A 1XU7A 2GM5A 1H9AA 2QZ4A 1AB6A 3MWYW 1K4KA 4RF5A 4C07A 3BWYA 2QRZA 1T9KA 1XCJA 4MCHA 4RZUA 4TT3A 4WOBA 4UCXA 1O9BA 4OJTA 2G4CA 2Y3IA 5DHRA 4MVJD 4Q01A 4DKXA 16PKA 1NZDA 3NNNA 2A14A 4YEDA 4ECEA 1CV2A 2HRDA 3C4QA 5FA5A 1DB3A 3TLXA 1TRHA 3WWZA 5A9SB 1OXTA 3Q9LA 4MUYA 1JPJA 3N6VA 4BYGA 2KBFA 4JH0A 3DDHA 4N12A 3A4LA 2H1SA 4DKJA 2BFBB 3MA0A 1W76A 2OZLB 1ENYA 1S7CA 1VPVA 4Z4GA 2LE0A 2EQ5A 5TJ9A 2HCRA 3DMYA 4YNBA 3HUDA 1IB6A 1CQXA 1NATA 1ZFNA 3WNBA 1GFZA 1WY5A 1XK7A 1PYGA 4LXTA 4D79A 3WGLA 5IKPA 5HSGA 4CEIA 1XN1A 2H9IA 4I5GA 4UQLA 1P39A 1K8ZB 4RQUA 4QHYA 2PU7A 4ENWA 4COKA 3UAYA 5I8PA 3F3SA 3VPSA 4I0WB 3TE7A 1AKVA 3K31A 3OO1A 4BUCA 4BEJA 4UBOA 4KI0A 2ORED 1CE8A 4U7FA 1K6JA 2PJUA 2AI1A 2UYQA 1H6BA 3I1FA 3OBIA 3WI7A 2G82A 3O1IC 3VYRB 5D8DA 4O4IF 2O2EA 1JHVA 3M3HA 5EIWA 1ISPA 5BOSB 1AU9A 1N3LA 2DJIA 4M49A 2B25A 1S7GA 2XOEA 1OLUA 3TKLA 1YA6A 3EAFA 5D84A 1FMCA 3F7OA 4Y1RB 3HKBB 3BD6A 1QP0A 4KWEA 1QX3A 2WFMA 1YB4A 1I3MA 2R2AA 3LY8A 3H1FA 3HDHA 4K9NA 4QYSA 2ZWAA 5JPIA 4G1FA 4DRXB 3JQ8A 4PICA 1CUXA 2QV0A 1Y8QB 4WV3A 4K6OA 1P31A 1WQ4A 3LDHA 2M32A 4OF4A 4TGLA 3GMSA 3ZNPA 2MSLA 1ODFA 3C6YA 2ORIA 2X5NA 1RYMA 2V7WA 3IVAA 4HWKA 4QUEA 2ZT8A 3SVZA 1UWLA 3IXLA 1HDZA 4JB8A 3TLBA 4CXMA 2QSYA 1LBQA 2B98A 2YHSA 3F4LA 1YZYA 1ACLA 3FTPA 3O1JC 4AMGA 5HIKA 2XB6A 4UW9A 4FE3A 4OHUA 1NOKA 5FI1B 4J3NA 4YAIA 1I01A 1WE2A 1W581 2DG2A 3TE6A 2F6RA 3BICA 1QJCA 1WHTB 2BFEA 2GJ9A 3B6KA 1HY3A 3QPCA 4UHKA 5EP4A 1DX6A 3VJLA 2WHPB 4AECA 4F1WA 4JODA 1SBNE 5IJWA 2GI4A 3NVKI 1NN3A 4BAZA 1ACJA 2AFRA 1UL1X 4YRRA 2IYOA 4MRMA 5HF6A 2AEEA 2PUJA 3DB1A 5KWIA 3ZQKA 8AT1A 1QCYA 3H87A 3LK7A 1N75A 4N47A 3DQZA 2D5BA 3OZUA 4LX0A 2ZSBA 4D44A 1FJXA 2V4ZA 1TK9A 2BTOA 4ALMA 3W6OA 1BH2A 2XJ9A 4YP1A 2PBLA 5AHKA 3KZ1E 4YP7A 1U90A 2NZUG 4ZARA 3F6CA 4QEZA 3G6WA 1EX6A 4R2IA 3RVDA 4UXJA 4BPRA 1ZVVA 3OCUA 4LOLA 4MW5A 2UYYA 3D6HA 2AZDA 5HPYB 1EUQA 5L7TA 2DUMA 1ECPA 1WMSA 2FK7A 4X65B 4BQQA 1GZHB 3L7LA 4A0HA 1I7QB 2JGDB 3SJZA 3F9IA 4UVDA 4DMRA 1UBLS 1MX3A 1OU0A 2CLKB 3P0EA 1GADO 3REQB 4PLYA 4HGRA 4Z54A 2CCGA 4PSVA 3RBZA 1YZQA 1KY5A 3BXOA 1V5WA 1MHPA 4R4JA 3ICWA 1RQXA 4TLBA 4B8WA 3K5HA 4CT5A 5I7EA 3K1AA 2B1QA 3GDFA 4NK5A 1MAWA 3RVBA 5EJGA 3WWDA 1ZJYA 3FVRA 4G3XA 5BMVF 1AQJA 3K6SA 3VNQA 2GO7A 3ELWA 1G20B 4Q3BA 5MFPA 4NRDA 1JRLA 4G26A 1Q1QA 4YT5A 3L7CA 3T7AA 1L5ZA 5A4MS 4WJKB 3WV4A 3RRXA 4M8KA 3EC2A 3GLGA 3P2YA 2PHZA 1Y8AA 1Z8HA 4L8GA 5E7QA 1SXQA 2XODA 3RU3A 5EIFA 1W48A 4U6SA 5FO1A 4D8YA 1JR3E 3EMKA 1ZK3A 5JJCA 1W0KA 1X7WB 3R09A 1UBUS 4EELA 1JBQA 4JP5A 5IDWA 2QTCA 3C7CB 4MB0A 1BWSA 2AQIA 5J4KA 3PA8A 4RH1A 1PCXA 1N5LA 4INOA 5KYKA 1LDEA 4JI8B 4MPRA 5FNVA 3WRYC 2ZRQA 5AW7A 2B6NA 2YRXA 5K8JB 4I55B 1GQSA 3L0CA 1OPXA 2ONCA 1ZRNA 3A2LA 3BJIC 3AILA 3C6ZA 3IC5A 3MK31 1GPH1 2OHXA 4B4KA 4ECAA 1FUEA 2MWMA 2OSVA 2PZAA 3BGSA 3TXAA 1F9AA 2R1ZA 3LQQA 2LZ0A 4JI3B 1C0PA 1HFEL 3KTFA 4DLVA 3CZQA 3HJAA 1NJ6A 1O58A 3OE5A 1XXLA 4J9UE 4YK7A 1BH6A 1H0RA 2B8JA 2V54A 3O7WA 1RLJA 2CMFA 2XHZA 3IDAA 2HWWA 3U7HB 3IDQA 4PYLA 1TAHA 1YIAA 2LDBA 2POCA 4V02A 1YS4A 3RU2A 3UB2A 2FR8A 3V8QA 3EWAA 2B99A 1UK9A 3HZOA 3OPVA 4OHOA 1QKIA 3LPLA 2R5NA 3O0TA 4DEVA 3RRFA 3HFJA 4WK0B 5AW8A 3R5JA 1FZTA 1M6EX 1ZA2A 1FP6A 1WCXA 5B1IA 3HBNA 4H27A 4JP1A 3PE3A 1KZ6A 2X8LA 3A2NA 3OEEA 4TXLA 2HD4A 3HFRA 3LCJA 3RLFA 3CEPB 3KFVA 5HUJA 5D85A 3OZ7A 1E1MA 1WXWA 1GNRA 1M83A 1DEHA 3IQXA 3B20A 1DI0A 3PJFA 4H17A 3RTAA 4FHFA 5KUTA 1V7PC 5FUVA 1SCNE 2BFCA 2JANA 1W52X 2R1VB 3OCZA 1Y1LA 2JIRA 2GZSA 3B2NA 3H17A 2ODEA 4JSRA 3RFFA 3ZZ1A 4HYQA 3TDMA 5K03A 5GJWC 2Y1CA 5KJEA 2ILTA 4JI5B 2PUDA 5CH8A 2W58A 5F2EA 4LW8A 4OLAA 2OBXA 3AZOA 3COPA 2C20A 4TUYF 4EO9A 5LB4A 1JBEA 2QW0X 4HYYA 1NXXA 3R1IA 3BDIA 3LUFA 4HTFB 3LH5A 4MVJE 1E7QA 1N5IA 2R1TB 3H97A 3ILYA 4OL9A 5TDHA 3UHFA 3V97A 4IG4A 4NYIQ 1DLIA 2QX9A 1J56A 2QGFA 3T1TA 1PD0A 3UEOA 2DQ4A 3CEJA 3CBQA 3CX6A 4HEA6 2XCSB 1E96A 5ITZA 3ZU4A 1ENPA 3PNSA 3HB4X 4JX9A 1MR3F 1KAEA 1LNZA 3GCZA 1PJ4A 4IR7A 4GKKB 4WACA 3TZLA 1JVNA 4B74A 5BN3B 4Z51A 4ESHA 1VKZA 3U3MA 1FC0A 3PWSA 3VZPA 1OBVA 2TS1A 1ZVKA 2CKMA 2FLWA 1D0VA 1FSSA 2HMVA 3OBBA 3BCSA 3I9JA 3WBJA 3MJCA 3R7DA 1SHKA 5DK6A 221PA 4PYNA 3AR9A 1KQ3A 2X0NA 1HT2E 2GB4A 2LCFA 2PFGA 3H84A 1DO8A 4DR5B 2LDXA 3FTQA 3WDMA 3ICQB 1EFLA 5DTMA 1OV6A 1BGVA 1E89A 2Z8XA 4R7TA 2Z2ZA 4QG3A 3ZGOA 4JITA 1NUPA 2PZGA 4YN3A 1L7PA 3ML1A 3JD3A 4K40A 4RY2A 4ID9A 4JQOA 4XH9B 5DP2A 4MHSA 5ECYA 1XEAA 3IS3A 3DZBA 5HIIA 2O2ZA 4FLEA 1HTWA 1T8YA 4GXNA 5JAUA 3L1JA 2FWNA 5CLLA 4BZPA 5A62A 2C9MA 5B12A 4URFA 5F9MA 1S4MA 4YMWA 2PR7A 4EG6A 3GT7A 1OASA 3B5JA 4Q1DA 4BGIA 1WP4A 4EBFA 3C7KA 1HLDA 1JX6A 1TI7A 2H9YA 1XFDA 3LGAA 4NI5A 4DIMA 4WDRA 4NS4A 1O94C 3CF4G 4JBGA 1ABEA 3JWPA 4DMKA 3HXKA 5BMOA 1GUDA 3VUFA 1Z25A 1NURA 4IHJF 3RF7A 5IARA 1NG1A 4WGFA 4ENTA 5DM70 3AKZA 1A9XB 1UC4B 1L7OA 1XP5A 2HIAA 2Y9MB 3R3JA 4LMRA 3RTCA 1QIJA 4RZHA 3HWRA 1Q0HA 4MDHA 1US8A 2IEGA 4Y7CA 1EFPB 3H9JA 2DZDA 3K2BA 1QHHB 2NXEA 3MB5A 4KO1S 4JSYA 3HA2A 4A73A 2PMKA 5C7LO 3Q87B 3K1ZA 2XEDA 3X2FA 1L8AA 2HRZA 4FFSA 2ZJ7A 5CIWA 5JVDB 2PJZA 4UMDA 1G38A 4BX9A 2JVIA 1A9ZA 4R1MA 3W3AA 5LIRA 1NVWQ 1PK7A 3CMMA 4X8OA 2VTBB 1R0CA 3C98A 3UBMA 5CDUA 1GAJA 2A5JA 4ZVNA 4CKZA 3L84A 3ZIAA 4G4JA 5K3CA 5F98A 5LKRA 3V3TA 1CRQA 2FSHA 2BGKA 4NMWA 1GZ7A 5L53A 3OHSX 5CBPA 2O2XA 3WO1A 1EFDN 1CC1S 3PWTA 3ILHA 1M6WA 3ABOB 1KZ7B 5EJ4A 3IBYA 1ADBA 3DMHA 3B60A 1FP4A 4MS4A 3HMQA 5C1BA 3CZ4A 3M9LA 4DIBA 4DQXA 1YBFA 2CJXA 4LI3X 2H5LA 4DT1A 3WYCA 2IH2A 3EEYA 4TKZA 1CJVC 3DL2A 4JYBA 4TV9B 4YHBA 1EJ0A 1HO3A 4EECA 5B58C 2FRDA 1EDZA 4HZUB 5C34B 2FEOA 4HH4A 3ZS9A 2PH5A 4UUAA 1YH3A 1GNTA 1T6BY 2F9MA 2OTCA 2W2PA 3P9XA 1UDWA 4KQ9A 4CV0A 2VH5R 1WWKA 2IP1A 2WSIA 3WZ2A 3WK9A 1XZFA 1DUIA 1DAFA 4U2CA 5AW0A 1G5TA 1NU8A 1XZBA 4P3XA 4N3BA 1M8GA 2OFPA 4R9NA 3RROA 5K0ZA 1RZRA 5DNAA 5L3RA 3QF4A 1G2OA 5ITWA 3T1YB 3DLHA 3DO8A 2J9FB 2XECA 4QVGA 4LJ5A 5GONA 3K9CA 5KVCA 4XGRA 1Q1GA 1JKIA 4QM7A 4RPHA 2J41A 1VLHA 1U0BB 1VKRA 3FPKA 2CLOB 1JXOA 4JQCA 4LIPD 4G5GA 4KHZA 1T2FA 4MA5A 1FTQA 1CIJA 1PKXA 3Q3HA 5GADl 2PA3A 1TMGE 5DLQC 3X0DA 1H22A 1JHAA 4MQ5A 2VG8A 4ALLA 1EK0A 2XX3A 3QU2A 4JJ4A 4PLCA 4FYIA 4IH9A 2WPDA