2GAFA

Crystal structure of the vaccinia polyadenylate polymerase heterodimer (apo form)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
297
structure length
286
Chain Sequence
b'MDVVSLDKPFMYFEEIDNELDYEPESKKLPYQGQLKLLLGELFFLSKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVASPSTADLLSNYALQNVMISILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDYPNQEYDYFHMYFMLRTVYCNKTFPTTKAKVLFLQQSIFRFLNIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase
publication title Crystal structures of the vaccinia virus polyadenylate polymerase heterodimer: insights into ATP selectivity and processivity.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Transferase
total genus 93
structure length 286
sequence length 297
ec nomenclature
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01358 PARP_regulatory Poly A polymerase regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2gafA00
3KQSA 5E9QA 2NXJA 1JTFA 3NVKI 3A27A 3RW9A 3UA4A 3ER9A 1NW8A 5LSAA 3G8AA 2Z6AA 3KR0A 4U7PB 1KPIA 1R8YA 1RI3A 3G89A 4POOA 5CM2Z 3CJQA 5HEKA 3SXJA 4PCAA 3EVEA 3IEIA 1AV6A 2JG3A 2VDVE 1BHJA 4QVKA 4WVLA 1VBFA 2FRXA 4PYNA 1L3BA 3SSMA 2PKWA 2PT9A 3FUWA 5F2KA 2ERCA 3FUVA 4F86A 2C7PA 1EIZA 1NBHA 2XBMA 2CWWA 3EVFA 5EMJA 1X1DA 4RTQA 3KQYA 1XDUA 2YXLA 3EEYA 3ELYA 3P97A 3KQTA 1VPTA 3LX6A 3FYDA 3UFBA 4ER5A 2ONZA 3M33A 3ANXA 5HIIA 2OBFA 2OYRA 2G70A 3ELDA 3HCCA 3LGAA 2IP2A 3U81A 4F85A 1QANA 3KPJA 3PB3A 1QAOA 3D2LA 3LKDA 4Y30A 2AOUA 5EEHA 4PNEA 2QY6A 3B3GA 2VS1A 1FBNA 3FUUA 5LR6A 2Z6QA 1WS6A 2VDWA 3NDJA 1EQAA 2V7EA 4X41A 4BLVA 5JR3A 1JG4A 5EKXA 3E7PA 5FA8A 4E31A 3FRHA 1AQIA 3DULA 4KW7A 5GOZA 3UBTA 5EHGA 4YUXA 2ZIGA 1NV8A 3TMAA 2ZZMA 1B42A 4OX9Y 2PXXA 5DXJA 9MHTA 4Z2YA 3AY0A 3B7PA 2EJTA 2GAFA 3ORHA 4R8SA 5DX1A 5F2OA 3UJ6A 3R0QA 4FR0A 3SVZA 4YMHA 1RI1A 2GB4A 5GIOE 3ERCA 1P1CA 2AS0A 4B17A 2A14A 3GJYA 5CVDA 5KVAA 1KIAA 4C05A 2N47A 3GRRA 1JG3A 5GP1A 3B5IA 1F38A 1SQGA 1JQ3A 2YVLA 1D2GA 1P39A 3EVAA 1WZNA 3P2EA 2IIPA 2H00A 3QV2A 4R6WA 4R6XA 5CVVA 4MWZA 3L8DA 1KR5A 4GOLD 2AR0A 3PLAE 2IBTA 3GCZA 2HMYB 3TPZA 1KP9A 4QQNA 1VP9A 2PY6A 3GRZA 1KPGA 4YV1A 2EFJA 3LCUA 5IKMA 1L3IA 1O9HA 2QRVB 2ZZKA 4PWYA 5DRYA 2XVAA 2AN5A 1RJFA 2YXEA 3TKYA 1I4WA 2BR5A 5K0CA 5EC8A 2NYUA 2I6GA 2PT6A 2OZVA 4XCXA 1JTEA 1T43A 3LSTA 3NW9A 4RVDA 2GLUA 4QDJA 2JHPA 4KRGA 4GOND 4FT2A 2KW5A 2HWKA 4M38A 1EG2A 2IDKA 2F8LA 2HNKA 5E1MA 3UZUA 4PCLA 3P2KA 5E9JA 2P7IA 4YMGA 3P9IA 3MCTA 4QQKA 3C3YA 3R24A 1Y8CA 4HTFA 3SX0A 3LBFA 3E23A 1NKVA 3QOXA 3I58A 4P7GA 5DM4A 2ZULA 3PX3A 3HEMA 1VE3A 5CUQA 1O9GA 3BGIA 2HV9A 1WG8A 2ZBPA 3CBGA 2ESRA 4FT4A 3FTFA 2FPOA 5B1SA 4C07A 5T64A 4V0RA 5K0LA 2FK8A 2AVNA 2FK7A 2UZ4A 3VSEA 4P7FA 2AOTB 4X1OA 2O0LA 5DPMA 3FTDA 3FPEA 5HIKA 2P3LA 5FHRA 1P91A 3EVZA 2H11A 3DXXA 4NECA 1JR4A 4EMSA 3OZSA 3FPHA 3CC8A 3BGVA 5EMLA 1DCTA 3FPJA 2IH5A 3FTCA 5DTMA 5DX0A 2H1RA 1ZG3A 4ER7A 2ZZNA 4FP9A 3FYCA 1VP3A 2AOWA 3TFWA 3M6VA 3EVCA 4HSGA 3TM5A 4CXMA 3OE5A 2IPXA 4GF5A 2ZFUA 4G56A 5LQUA 3EVDA 1PRYA 1WXXA 2O57A 2QE6A 3HVJA 4GC5A 1YFLA 4QTUB 1G60A 2PVCA 3DXZA 5EKUA 3EEOA 2PX4A 3KR9A 1WY7A 2EG5A 4R8RA 1YZHA 2DULA 4M7RA 4RTKA 3KQQA 3LDUA 3MCZA 2JJQA 1IY9A 1ZHFA 5BP7A 3G5TA 2FYTA 3GNLA 2WA1A 3T7TA 1F3LA 3ELUA 1AQJA 1JSXA 3HM2A 1UWVA 4PYOA 2JH9A 4EQZA 5LQNA 4DF3A 3REOA 5EG5A 1N7IA 3H2BA 2BM9A 4DCGA 2P3OA 5ICEA 4PYMA 2GS9A 2OPBA 4QTTB 1XCJA 1XCLA 1I9GA 5E1OA 1V39A 4YUVA 4Y2HA 2EX4A 3HNRA 3TM4A 2PXCA 5LQRA 3EVGA 4KDRA 4OBWA 2NXCA 5EOVA 3C6MA 2B78A 2ZVJA 2HR1A 3HA3A 3AXTA 3LCCA 2PWPA 3A4TA 3DH0A 1IXKA 1BOOA 3CJRA 2YXDA 5FWDA 2UYHA 3OZTA 4CKEA 4JXJA 3DMFA 3E8SA 3GWZA 3B89A 4FGZA 5KQSA 4DMGA 2AN4A 5FHQA 4HG2A 1FJXA 7MHTA 4EVIA 3LDFA 3WSTA 2ORED 3LPMA 3RODA 3C6KA 4AUKA 2ONYA 2PXAA 2YQZA 5ERGB 3BWYA 1U2ZA 5DLYA 1IM8A 4RWZA 5GM2A 3UJAA 2YTZA 3QOWA 4ISCA 3PX2A 2BR3A 1FP1D 5C9ZA 2B2CA 5ICCA 2ZBRA 2IFTA 3DR5A 3KQVA 4R05A 1Z3CA 3G8BA 1TW2A 3KHKA 3M70A 5EMKA 2QYOA 4RTJA 2C7RA 1KXZA 3G2OA 3NWEA 5CVUA 5K03A 5DTRA 1R6AA 3LKZA 3BWCA 5EZSA 3AJDA 4LG1A 4MHTA 1JSZA 2P41A 3DTNA 2IH2A 2AVDA 5EEGA 4HH4A 2ZWVA 4QDKA 4RVFA 4RVGA 4C03A 3F4KA 4RTRA 3MHTA 4QPNA 4OA8A 3BZBA 4XUEA 3EMDA 2AOXA 3K0BA 5FQNA 3EGIA 2XYQA 4QVGA 5E9WA 5C1IA 2NP6A 3LBYA 1ZGJA 1ZGAA 3B3FA 3BKXA 1BC5A 1XTPA 3O31A 3PFHA 4GOOD 5CD1A 3HTXA 2OB1A 2B9EA 2ZIFA 3GO4A 5LQCA 4IKPA 1DUSA 4GBED 1XDZA 5E8JA 2VZ9A 3T0IA 2AZTA 4ER3A 5EIFA 3VC1A 2G72A 4KIGA 3RIEA 3G2QA 3ER8A 3FPFA 5ICFA 4AZVA 1G8SA 3B3JA 4CKBA 2V74B 3CVOA 3BUSA 3OU2A 3OZRA 3EVBA 2JH8A 1L3CA 3MTIA 3M6UA 3AWIA 3CGGA 4PIMA 3NMUF 3OCJA 2YR0A 5T6BA 3UJ9A 4F84A 4X60A 4C08A 1JQEA 3DLCA 3CJTA 2R6ZA 3BT7A 1G55A 3PVCA 3GDHA 1MHTA 5EPEA 3PFGA 2QRVA 2XYRA 4DA4A 5HFJA 2ZSUA 2DPMA 2UYOA 2XVMA 2CKDA 1NW7A 1HMYA 2BZGA 2ZTHA 4PYQA 5DSTA 3FZGA 4X61A 5G02A 1SUSA 4LWOA 2PBFA 1SUIA 1VL5A 4GQBA 5E2AA 1P1BA 2PX8A 4DZRA 5LQJA 2K4MA 4RYLA 4FS8A 3BKWA 4P58A 4A6EA 2IH4A 2Y1XA 5DXAA 1NW3A 1MJFA 5EVJA 4GC9A 2OB2A 4E2XA 4UOEA 2HTEA 3DOUA 2O07A 5GINE 3KPVA 3A26A 3DMGA 4X63A 4MIKA 5HOQA 1Q0SA 1D2CA 4PGHA 2CL5A 3R6TA 5FQOA 2P3QA 3MGGA 4C06A 5K0BA 2BM8A 5FTWA 3HVIA 2ZCJA 3HCDA 4E32A 2PWYA 4ATNA 3I9FA 3I53A 3M6XA 3LECA 3TQSA 1G38A 3PT9A 3OFKA 1O54A 3HP7A 4IV0A 1KPHA 4ZTBA 4HGYA 4RTLA 3KU1A 4U7TB 5DRTA 5EQJB 3P9CA 5GIPE 4OQEA 4RTPA 1X1AA 4DQ0A 1R18A 1SVUA 4FSDA 2AOTA 4A6DA 1YFJA 1YUBA 3MQ2A 3C0KA 4FSXA 2G71A 1KYZA 5GM1A 4GUAA 3OFJA 3GU3A 4HRAA 3EGEA 2PJDA 4O29A 4PIPA 4E33A 3UJ7A 3PTAA 5U4XA 4HGZA 2P1DA 5DX8A 2XYVA 2VP3A 4RTSA 3A7DA 5GWXA 3HCEA 4C4AA 4PGGA 2IGTA 3FTEA 4RX1A 5DM2A 1JQDA 3EPPA 1ZQ9A 3OU7A 4IV8A 4RSRA 3KPYA 5CVEA 4AX8A 3T7SA 4OQDA 5EMMA 3SM3A 3IYLW 3SMQA 3TKAA 2AOUB 1EJ6A 5P8WA 2BH2A 2CMHA 3KR2A 3SSOA 2OY0A 4AZSA 4RVHA 2P40A 1XVAA 3C3PA 2I62A 3OPNA 4K6MA 2P35A 3O7WA 4GOMD 5K0NA 2OXTA 2YX1A 5BW5A 1FP2A 4RV9A 4MTLA 3EGVA 5K05A 1DL5A 5M5BA 2WK1A 3DMHA 3LDGA 4P7KA 4BY9E 1I1NA 1UIRA 2AN3A 3A25A 3JWJA 3HCAA 5HIJA 3BXOA 4YUWA 1TW3A 1X1CA 2FCAA 2NNWB 4PYJA 2GH1A 1X19A 2UYCA 4EKIA 2EJUA 2Y1WA 3P8ZA 5BXYA 3KQOA 5EZQA 3E05A 2R3SA 4QPPA 1L9KA 3G7UA 4AZWA 4KIFA 2Z6UA 2LD4A 3MTEA 3PS9A 5HILA 5C0OE 5CCBA 5HZMA 1QZZA 5F2NA 2JHAA 2PX2A 3JWHA 3AXSA 4BLUA 2NXEA 3DXYA 5EHIA 4PYKA 3G2PA 4LWPA 5DTQA 3NDIA 1SG9A 1KYWA 2ZIEA 3THRA 4YUYA 2GA9A 2AOVA 2OKCA 5E1DA 5T67A 4DM3A 3A7EA 4LECA 1WXWA 3O4FA 2O06A 5ICGA 2PX5A 2PSSA 1EAMA 3JWGA 3THSA 2P7HA 5FULA 4CKCA 5DM0A 5K01A 1G6Q1 2ZBQA 1QYRA 5FWAA 4E30A 1ORHA 3HA7A 4KVZA 1H1DA 3NTVA 2BR4A 3FPGA 3P9NA 3IHTA 1NV9A 3GRUA 3VC2A 1YB2A 1RI4A 3P2IA 1NE2A 3UWPA 1D2HA 1VQ1A 1VIDA 4PINA 1SKMA 1YZ3A 2VDUE 4XUCA 3I64A 5FADA 1R8XA 3S68A 4XUDA 4RTNA 1ZKDA 3KR1A 3ME5A 4MQ4A 3BWBA 3G5LA 3Q87B 2FHPA 5KS2A 3G88A 2G1PA 3UJBA 1NBIA 4BLWA 3HA5A 2ZWAA 5K0JA 1L1EA 1N7JA 2UYQA 4ER0A 3CKKA 2ADMA 5DWQA 5LQAA 2IDJA 4PYLA 4P7JA 4EKGA 3R9XB 5K0GA 4BP3A 3GXOA 3DLIA 5KYGA 2ZW9A 3UJ8A 2I9KA 4M37A 1TPYA 4V0QA 4HC4A 4HTFB 3V97A 3X0DA 5E2BA 5CVJA 4KWCA 3SR4A 1SQFA 4PONA 5DT2A 2IBSA 8MHTA 4OBXA 4DKJA 1M6EX 3HCFA 1UFKA 5EIWA 2C7QA 3TLJA 3UJCA 1VLMA 2GPYA 1XXLA 3DP7A 4DCMA 3TRKA 5D1HA 5DSXA 5FUBA 1N2XA 5FA5A 4YUZA 3NWBA 4C04A 2O05A 1RJDA 4YV0A 3OE4A 4RTOA 2P8JA 5BW4A 3HCBA 5HIMA 5K0EA 3FRIA 4M36A 3MAGA 2Q41A 3SGLA 1Q0TA 3NJRA 3GRYA 1BKYA 2JHCA 3BGDA 3FUTA 1R00A 3G2MA 3GIWA 3I5UA 3K6RA 5K09A 2QM3A 5CCXA 3SSNA 1NW6A 3CCFA 4L7VA 2B25A 5MHTA 3KKZA 1EJ0A 3HVKA 10MHA 3GGDA 3FUXA 4YV2A 3P71T 3GRVA 1M6YA 1XJ5A 4E2ZA 1OR8A 2B3TA 3KQWA 3T7RA 2PV0A 2CMGA 2YUIA 4EK9A 1NT2A 1R74A 1RI2A 3KQPA 3MERA 5KQRA 4BP1A 1JG1A 1RI5A 1G8AA 2G8NA 3MB5A 4GEKA 4IWNA 3IV6A 1PJZA 1ORIA 2WA2A 4RTMA 4ER6A 5EGSA 3V8VA 2NP7A 5E1BA 1AF7A 3JWIA 2OO3A 1M0EA 3TOSA 3UA3A 1RJGA 3ID6C 5H02A 4CWAA 3Q7EA 1QAMA 1NW5A 2E5WA 3KPUA 1HNNA 3LL7A 3NVMB 2PGXA 3KPWA 5E8RA 4E70A 4E2YA 3LCVB 5D1NA 1RJEA 2NXNA 4WXHA 5DM1A 3ELWA 3UJDA 4CTKA 4KDCA 3LHDA 5FCDA 3TR6A 1KHHA 3DUWA 3M4XA 4CTJA 3VYWA 5K8VA 3M6WA 5LQKA 1YF3A 1FPQA 5CIYA 3KQMA 1QAQA 1X1BA 5IH3A 1JG2A 3R3HA 1INLA 5JUWA 3EMBA 3HVHA 1XDSA 4E2WA 2ZLBA 4AZTA 5K0FA 4H0NA 2I7CA 3P9KA 3OU6A 4FZVA 4PYIA 2C7OA 4OA5A 3BWMA 2PLWA
chains in the Genus database with same CATH superfamily
3W9YA 4I55B 2NXJA 3SYKA 5I9NA 2FW7A 3EISA 3LVRE 2Z6AA 2V7WA 4Q18A 2YFQA 3LUHA 1WEKA 1RI3A 1YJBA 4KQKA 4IIBA 4RJ2A 4JI5B 1OXBB 5F51A 1LDYA 4JKIA 3DWIA 3A3OA 2F1IA 3H9QA 4BVFA 4WA7A 4FJ2A 3MB8A 1EVQA 3PICA 2WSYB 2OILA 1T0IA 2XMCA 3NIBA 1Q16A 3T38A 4KBGA 3FUWA 3IUMA 2EZ8A 4B2LA 2W2KB 4F7DA 4RACA 3LOUA 5BW8A 3IAEA 3ZR4B 3Q4GA 2DVMA 1B0PA 1K1EA 2NU8A 2CWWA 1W36D 2JLAA 5G4KA 3QIAA 1L7MA 2G40A 3SEQA 3VHRA 1LPOA 2IDMA 1V6SA 3HR8A 4QSHA 4NARA 3GN1A 1E2DA 4KX3A 1D1SA 1QFXA 2WZDA 3N53A 4OK3A 1J39A 4RZQA 4I50B 4XZ3A 3RV3A 4F85A 4DV1B 4D9BA 3I2JA 3FI9A 2PS9A 2WHEA 3WRWA 4B3RB 3I9V1 2HF9A 1UXHA 3JYQA 4X65B 3B3GA 2YNMD 3ZCSA 2RMKA 1NI3A 3FUUA 1UXOA 2OORA 2V7EA 2FDRA 4NH0A 4X95A 4F46A 3KJXA 2HZ7A 2MHCA 3HUUA 1R50A 4IVNA 3PEEA 1UT5A 1ADFA 5DHRA 2D74A 1SXHA 2C7BA 2W6NA 3GBVA 3O0TA 1R4NA 5EHGA 2JIRA 5K3FA 1XZQA 1ABBA 1GUBA 2PXXA 3Q1LA 1XOIA 2RK4A 3HCRA 5IULC 3UJ6A 1U0EA 3E2PA 1P44A 4D3ZA 4P2GA 2W9XA 4CLRB 1YCHA 3DC2A 3PFIA 4E1AA 1O5OA 1PU2A 1QGUB 1QO0D 2N47A 3A9RA 4OJQA 4PYRA 4Q3KA 3T0FA 4B9EA 4E1BA 4EMUA 5FLXA 4NG4A 2QN1A 3Q6MA 4KPYA 2VF7A 1P39A 2V55B 2O9JA 3NM6B 2GASA 3AYZB 5JI2E 2PM8A 4LHEA 2YC4C 4JQSA 3KLBA 5BMVF 3FCSB 2PUAA 4C05A 4S1NA 2GEBA 1BEEA 2FQWA 5C1DA 3RBXA 1SHUX 4FHGA 4Z7OB 5ALXA 4C7OB 3HCPA 1RD4A 2EX0A 1UWCA 1T2DA 3EARA 4I4LA 4PCUA 2AN5A 4UM9D 4BX2A 4DQXA 4FFMA 4KNWA 1MXFA 2Z08A 4ZDIA 4A5OA 3JQAD 4KYUA 2OZVA 5LB4A 3JRXA 3MWKA 3UH1A 1GL3A 5ITZB 5LP1A 3L4BA 4ZRDA 1VLQA 2ZSAA 3R9WA 2X8LA 1UWKA 1M8JA 1W34A 2F17A 4XKJA 1U1EA 1YU9A 2Q0XA 3A4MA 4PFQA 1QHSA 1VG1A 3D4BA 4LE0A 3I9JA 2ET6A 2RAFA 3AB3A 3ZK8A 4UDOA 3C14C 5L3QA 2GYWA 1X94A 1DWQA 4MXDA 3ZD7A 1TM2A 2HFJA 3E84A 4ZANA 4DNOA 3GF4A 2FN7A 1T6XA 3K0HA 3U61B 1YL7A 2Z5VA 2TMDA 4ZVKA 5LFAA 4OMUA 4RU1A 1UT8A 4YT4A 4MB0A 2XT0A 1H94A 1EEXB 2PH3A 4X6XA 1A27A 2W0MA 1Z45A 2XOEA 1MQAA 4FEEA 5TGZA 1I5RA 2BMAA 1YNOA 4D3XA 4WDQA 4XWGA 1XCGB 4C22A 1IM2A 1PDVA 1M6VB 2IITA 3FNHA 2ZBPA 5FR1A 2FMXA 4U6QA 1KYIA 4NU5A 3TGPA 4BV8A 2QRMA 4K9OA 2UUPA 2N1BA 3LLCA 5IJ9A 1K7YA 3JX9A 5JYDA 4BJ3A 2BDUA 3O4GA 2ZJZA 4QPZA 1FDSA 1W52X 2DKOA 1KFBB 4UM5A 1LI5A 3FNEA 1ZAYA 5GV8A 4H7IA 4Q24A 4ZOCA 3TIGA 4WKCA 1VGRA 1DC6A 5BSGA 1DFIA 2AZDA 1O9BA 2VPZA 1SXIA 1BS2A 2XGSA 2GK4A 2TMGA 4L16A 4M9QA 4O3FA 4L5AA 3KT3A 2V97A 1A50B 2ZZNA 2P2ZA 5B1IA 3BWDD 4N7BA 3OCUA 1NSYA 2WUEA 4WBNF 4ZYTA 4QGAA 4DC9A 5F23A 4GF5A 3W6UA 1DJMA 1CY8A 1KH3A 2E49A 2KB0A 3OLCX 2WU0A 2GLTA 4KE8A 1T1GA 4GC5A 4HL6A 3O94A 1Y6FA 1F9EA 1S9DA 1H2FA 2PKXA 4IINA 5DJ5A 4Q93A 1YZHA 1XCPA 4PZDA 4Z9XA 3OG9A 2D59A 1QOPB 2AC2A 5DLEA 1YQQA 2IW3A 1T4CB 4TN5A 2FLKA 2JCVA 3A4YA 1HSZA 5DBGA 3ABQB 3S2FA 5JNTA 2WNIA 2W90A 4C6HA 4BNMA 1X13A 3KKLA 3V32A 8GPBA 1N5LA 3GFGA 3Q8XB 1M0WA 4IHAA 3D6AA 1JV2B 1OT5A 2WU8A 2FUG1 1IDN1 4V0KA 2VI5A 3ZS8A 1V39A 4MA5A 4XW2A 1MC5A 4KFUA 1ZBQA 2HSGA 4O4LB 1FFGA 1NP3A 1GV1A 1YS7A 3I01M 1Q21A 4LRTB 3B2EA 4JJFA 2BCEA 2XB8A 3G68A 3GJ8A 4MV8A 4KOAA 2XCTB 2OXCA 3DFUA 4WSOA 3IQWA 1N8KA 1T4CA 2CLDX 3GOQA 1Q1ZA 4PC2A 3UUFA 4ZZ1A 4GU5A 1KF0A 2RGUA 5ALVA 1TQ8A 1HNZB 1WULS 1R5OA 4NZYA 1TVMA 1ZOIA 3W9UA 2GNPA 1CUYA 2X5OA 2ZUBA 3NIFB 3RODA 3UOAB 2VNHA 5CX1A 3V9PA 4YQYA 1V4NA 2CFTA 2REBA 4AUKA 3RYIB 4JLPA 1YI1A 1GG5A 3MOSA 4OI4A 1N3YA 3EMKA 4X3PA 1VGQA 1IM8A 2PLAA 1E1YA 2G9RA 1BXRB 1P73A 3K6KA 4IDBA 1R3UA 1I33A 3OQ1A 1NLZA 3PNKA 2C78A 1R5BA 2W6IA 1CZNA 2WE7A 4N18A 1FZQA 1TTTA 4ROTA 1WF6A 2HJ9A 4W8HA 4CNQA 4NEHB 3WDMA 1GRQA 1P7PA 1V47A 5DW3A 3H11A 4WESB 5BPHA 2X9VA 3QSYA 2ZREA 1RWNA 1X7HA 2ZWVA 3EZYA 2D0PB 4YECA 1MXHA 2PL9A 2RGXA 3H2KA 4OA8A 3BZBA 3E9MA 1YSCA 3X1KA 1R4ZA 4Q9DA 4G0XA 4R3NA 2VZ0A 1DX4A 4HWPA 2IZ6A 3RUFA 1ZGAA 3MGAA 4RJKA 2MWMA 3X1WA 4DA6A 5JIBA 1MO5A 5ILGA 4QM6A 1XQ1A 2VJQA 3KFVA 3HJGA 3WMFA 5LQCA 4E4TA 2CBZA 5JNRA 4HLUC 2AZTA 2DU8A 4HYEA 5B6IA 2R86A 3T7EA 2YCLA 4NCHA 1I0LA 4FZRA 5E3JA 1Z62A 5KNBH 1E6CA 1V2HE 4XQCA 4A92A 1MBZA 2C83A 1H0KA 4MA0A 3QXHA 4KO4S 4TRNA 3TQHA 2E55A 3WLLA 1CZLA 1ECGA 2YFYA 1F5NA 5A3RA 3RG2A 1T0HB 1CR0A 1FRNA 3CMCO 4U2KA 2RGBA 3IAHA 5CT9A 5TVGA 1LNQA 1RM0A 2UYOA 1QRTA 5EKTA 3FUCA 2BZGA 2BMEA 4GLBA 4NU0A 5CFQA 1ZOSA 3FJ1A 3BXEA 4X1YB 3NTRA 4DCTA 1NMQA 3E9CA 4OB8A 4CT5A 4ZOLF 2Y66A 1TJNA 1CUWA 3OM9A 3VMFA 4S12A 1U0GA 2GARA 2GAOA 1Q6YA 2ZR7A 4XAQA 3LTNC 4JP1A 4QL3A 5K20A 5CXSA 2OG1A 4HXYA 3PUXA 1T5IA 1QHNA 3OJFA 2HC9A 4M53A 4BHTA 1D2CA 9ATCA 4URXR 3C41J 3RIXA 4OXIA 3KTOA 4QNMA 4C06A 3DA8A 1MH9A 3RK0A 4LF7B 2WUDA 3GJTA 3HU1A 1WMDA 2JS7A 4OYHA 4ESEA 5KIAA 1ZKMA 2A1UA 2V1XA 4WPGA 5H9WA 3IHWA 1L7RA 3FWHA 3GUYA 5MFPA 2RJOA 2VRCA 1SQ5A 3R3JA 4HGYA 3FMIA 5M04A 3K70C 3FHTA 4KQIA 1D5WA 1XSEA 2QU8A 3L0YA 1PFKA 3ZPXA 3VNSA 2QTRA 4FGWA 4M8NE 1GUYA 4Q1FA 1O96B 3FSEA 2Q1XA 3EQ6A 3SVLA 4W6ZA 4JI8B 1MV8A 2PPVA 2ZT8A 1KYZA 4Q9KA 4JJKA 3T7AA 2POCA 1N78A 1H2WA 3G2JA 2Y1OA 2G04A 1NQOA 4ZP1A 5FUYA 4BBAA 3M6LA 3AH8A 5IKOA 4GX0A 2GQ0A 2VRBA 3HCEA 2OCAA 4MLCA 4JL6A 5DBEX 5FPHA 4UM9B 4DZZA 3GFTA 3KYCB 4YWJA 5JMWA 1JUDA 2OEPA 4CHGA 2GVDC 1AKUA 3B2NA 2YQ4A 4CM7A 3FN4A 1GFZA 3WS7A 5FPSA 4UBOA 4CZ2A 1H4TA 4AFNA 2I2FA 1AMUA 3UMBA 3SSOA 3F78A 4HNAB 4RKYA 1E1QA 1JW9B 5DCLA 5KDLA 3ZZTA 1O96A 3KJQA 3QMMA 3L1JA 3SLKA 3HXQA 3O7WA 2FMTA 2XQGA 5K05A 1AK1A 3NEAA 1SU6A 1E98A 1JU4A 2VYCA 5BV1A 1QIMA 3CRQA 3LTEA 5HIJA 4M9CA 4LJ6A 4ZAWA 5J63A 1C7JA 1N3LA 4YHBA 3ZW8A 4M55A 2GSDA 3Q9UA 1IZZA 1RWQA 4CV1A 1U9YA 4EKIA 4ZMRA 3Q9SA 4R1TA 5EZQA 3VR4A 2JJYA 3DC7A 2JEOA 4W5RA 4GR5A 2VZEA 2PD6A 5B3KA 5K0JA 1UOPA 5HQ3B 3UATA 1IRXA 2JFFA 1PQYA 1UBHS 2Q9CA 4CIAA 4HQOA 3CUWA 4XWWA 2G36A 2I2XB 1XZKA 4DQDA 1HPLA 3G2PA 1E3LA 3VBCA 3OFND 4GMDA 4RD6A 1ESDA 4BE9A 4G0VA 2V96A 3P52A 4KKVA 2PD4A 1H93A 3A11A 1DEXA 3RFVA 3T9EA 2TMKA 3RS7A 5KWEA 1EAMA 1BVUA 4M9UA 2UVDA 4M7OA 4AY2A 4D81A 1UL1X 4FBMA 5L3VA 2AD1A 3EVNA 4GDMA 4RCVA 1CJSA 3GLSA 1B16A 4LZLA 4YAEA 1F1BA 1PL0A 3QJ5A 4PXAA 3QITA 3L8MA 2ZJFA 3TVTA 2P2NA 3M6AA 2QE7D 1P9LA 4JUDX 5I7EA 1RI4A 5L7WA 3UWOA 1FP7A 3JQ7A 4XLLA 4D45A 3WLNA 4NATA 3EPJA 1TK3A 2FKAA 1OBOA 3O1IC 2IHYA 4MKHA 2QTZA 5B2ZA 3W3AA 3GT3A 4O0LA 3P9RA 2A3NA 4IXNA 4M7PA 4UFOA 3NNNA 3RI3A 2ECPA 3CRMA 3FSJX 2F1OA 3DJFA 4MQLA 5EQFA 1PFWA 1ZP6A 2AHOA 1BE6A 2WJ4A 3GWGA 4ER0A 4KGXA 1KHTA 2EZUA 2YJ5A 3K9FC 1XJWA 2NYRA 1JAHA 2IDJA 2ZRAA 1YQUA 1C9NA 3FYHA 4LI0A 3VSBA 1NQAO 2H4YA 4HUJA 1WNTA 5L95A 3SR0A 4F11A 4WGGA 2ZS8A 4AC9A 5EPUA 3O95A 4TV8B 4UQLA 5E0OA 3UGJA 2Q21A 2AC4A 2DPXA 3JQGB 4DKJA 4R9VA 1RLMA 1M6EX 3HCFA 4WY2A 1D6MA 3I39X 4FLFA 2KPOA 4GMHA 2QGFA 3DP7A 4F2PA 3DE7X 4RAOA 1G3UA 2F2TA 1QP7A 1Z08A 4JSYA 1MNQA 2OD9A 2Y99A 2GYVA 4M1QA 1DMSA 5IT9A 1R8QA 2BD0A 1SD2A 1UF9A 3X3HA 4RTOA 4EA9A 1S3SA 4F96A 2OLKA 1ZJWA 1MB3A 3NGXA 2Q0QA 4N6GA 3MAGA 3B2QA 2JIDA 5HTKA 2XQJA 1E61A 1VOTA 3QG1A 2X8WA 1VFPA 3D4OA 1C30B 3KKZA 5DVZA 10MHA 3VKHA 5IHXA 2BBTA 5DLPA 2PV0A 3WLJA 2BM1A 1NT2A 1H4SA 4M1MA 2ZATA 3JQBC 4X24A 2I2CA 5ALDA 1K06A 1CIPA 5EQTA 1U7XA 5CB4A 5KOHA 5D84A 3UGQA 3JWIA 3A4VA 2R96A 1K66A 3TOSA 3RSOA 3GT4A 3OC0A 5IDYA 3WDSA 2JAQA 1T1JA 2CUZA 2EKPA 4WRRA 3Q7EA 2QAGB 5ADVA 2LVBA 1NBMD 3VR3A 1ZL0A 3L18A 2Q3LA 4GYJA 3L7BA 4BFZA 3Q7IA 1EUCA 4C0BA 3OE7A 4PN3A 3U9SA 1AOXA 1OTXA 3BWXA 4IEFB 1QCYA 1HEUA 3A6ZA 4KXUA 2QN6A 4WH0A 2IUEA 4E4RA 1SCUA 1QE5A 2M9MA 2OCKA 1NVMB 3W1WA 4JBXA 3LE8A 4E2WA 1ULSA 1HI9A 3N3AC 1AKMA 5IBRA 4UU8A 2IYEA 1ZDMA 1SR8A 2Q3CA 3PXGA 3G5UA 1O8CA 1OYWA 3ENZA 1DV2A 3G8AA 4DUPA 3KR0A 1HOTA 1T13A 1NVVR 1PZMA 1XRMA 4B2IA 5DNYB 3EXEA 2GVZC 9LDTA 2D3TA 5MN5A 4WVLA 3SSMA 1JDUA 2PLNA 1RVDA 1VZ3A 2RGCA 4OSEA 3KEGA 3VPDA 2ZRDA 1LUAA 2QJWA 4JUCA 4RTQA 3VO9A 3U7HB 1CF2O 2C2XA 2V54A 1Q7CA 1T26A 1KMCA 3FROA 4K28A 4KQJA 4QATA 4XWYA 2R1VB 3EDYA 1CJVC 4KIJA 4WFKA 1E2BA 1EK6A 4R2HA 1T6YA 1TKAA 2AB0A 4BN0A 2H65A 3FYTA 1Q7EA 1CT9A 1EDZA 1OF1A 3DAPA 5AOCA 3ZDRA 5KNDA 3C48A 4I1SA 1VYUA 4K9LA 4GPIB 3KPJA 3SKYA 3I6MA 5LP6B 5CJJA 2PG3A 4PNEA 2AOUA 2W6PA 3HJCA 3DUFA 2R8XA 5B1DA 5LR6A 3AONB 2NQTA 4HDRA 1LSOA 1N0WA 2PVPA 4LS3A 2IU6A 2WB4A 3FW1A 4MPPA 3GJ7A 4FMDF 4G37A 2X0RA 1I14A 4FLEA 3LY8A 5AJTA 4M9RA 1UBNA 1WPQA 2HA3A 4RCZA 1NQXA 2XE7A 2W11A 2ZSHA 1ZJYA 1TQ4A 2X3UA 3G9QA 3GPCA 4A8JA 5JXWA 3T4XA 2P2SA 4D9CA 3MJFA 5CGZA 5H82A 9MHTA 1GQSA 1EGHA 3HV0A 4F8YA 2JCXA 1FQKA 1SOUA 3CVJA 4RENA 3DE1X 1RPJA 1MENA 2C95A 2V4MA 4PNHA 4RVUA 4WX2B 2QP9X 4MZDA 4Y1RA 3U4GA 1JIIA 1YQXA 4AJ1A 3TL2A 1Z7WA 3F6PA 5LZ7A 2HSDA 4OJKA 1FFCA 4FW9A 2W2OA 2WPDD 1VPDA 4KXWA 4R3UC 4GGMX 4TQGA 1RYEA 2ZJYA 3AJRA 3LF2A 5BR8B 2IYTA 1PHRA 4OKNA 2ZYIA 4A2QA 2P91A 1K7FB 1EHYA 3SKXA 1NLUA 1ESEA 4B44A 4EHFA 4G1UC 4F60A 4JOSA 1KMHB 4Q6BA 5TGDA 3ZHVA 2R4UA 1LGYA 3RVPA 3UXYA 3WLTA 4WCDA 4UCQA 4Q9AA 4DA7A 3U3XA 3N0TA 3KP1A 3Q5DA 5IKMA 4KK4A 5BVHA 4OLJA 4BWFB 1XCBA 1ZCZA 1X7XA 2X5JO 4KUEA 3H04A 3RNLA 5MF6A 4DIUA 1XEWY 2QGZA 1D4ZA 2AQKA 2ECFA 2XTNA 2XWQA 3CKLA 3D5QA 3EODA 4FFSA 3U80A 2PHZA 2XT6A 3LSTA 2VEDA 3ZNQA 2A0KA 5DFAA 5I5GA 4WCFA 3PQ7A 4DBLE 2BGNA 1PSWA 2ORIA 4ILKA 2JAPA 2AEEA 3HMQA 4UMEA 4XR9A 3U1BA 3CZ5A 3QE3A 1YC2A 4KLNA 1DINA 4PCLA 5TRTA 1JJIA 2IEZA 3GJ5A 1OHHD 2PS0A 2QLMA 5CX4A 3WIOA 3TRFA 2Y71A 3T1TA 4DV7B 1F8XA 3Q6NA 3ZNPA 1X8XA 2P9TA 3PNSA 3GEMA 5LXTB 2HHHB 3CVVA 4HTFA 4MQEA 4NU6A 2ROQA 3TOCA 1IY2A 1DIHA 3L1IA 3GCXA 3NT4A 3P0EA 2A0WA 4ZK6A 2ZULA 3PX3A 4LHSA 4C3VA 1XL0A 1O9GA 3C6YA 1O95D 4PQRA 4Q02A 2J0SA 5MDHA 1QH8A 2X8AA 4LZAA 3TF5A 1ZN9A 3CBGA 3FFBA 4EI7A 4ZYVA 1GEGA 1R16A 1NR5A 1ZM3A 1RC0A 2WTXA 3LLVA 2X5XA 4HMOA 3OMLA 3JAWA 2O8CA 3HO6A 4KQCA 5FF9A 4JI7B 5C7OO 2W6OA 2YZMA 2ZU6A 2OZLA 4IXTA 4ACAA 5I6DA 2PK3A 5JBIA 3FPEA 1AIPA 3FZEA 5HIKA 3SQXA 4RSMA 4EFKA 3CXRA 4WACA 1GV0A 1JR4A 2K87A 3OD5A 1EPUA 4UVDA 4XGRA 1D4OA 4G86A 4PY2A 3NPAA 2XRFA 1J2UA 2AE1A 1YFKA 4YRMA 4OY3A 2IH5A 1L5FA 3KC2A 3W05A 1ZG3A 1NF3A 1NVWQ 1II0A 3OT1A 4ZJYA 1O7JA 2Y9MB 2NTEA 3A6LA 4TS1A 3GUHA 4KGZA 2NUAA 4OAPA 3P94A 1LQ2A 3V7WA 5CFZA 2D6FA 3HDTA 4TRJA 1ZISA 1D6SA 3EEOA 3H5WA 1TMGE 2PX4A 2QQFA 4G5GA 1EM8B 2R44A 3GRKA 2CV1A 2CFCA 2BBWA 4MPDA 4HWGA 3HYLA 3ZY6A 2VTVA 3KQQA 4BV2A 5J47A 2CZQA 2Y0CA 1JZQA 2Z6VA 3OPYA 3PNBA 1PR6A 3QFFA 2H0QA 3PRHA 5AW3A 2WA1A 1P1JA 3RARA 4DM4A 3BMNA 4CDGA 1IJEA 2A5GA 1GUZA 2R7AA 4QOGA 4DF3A 2ZRMA 4EW2A 3UMSA 3O9MA 4OO3A 1E2LA 5EZYA 5EE9A 2UYYA 4S1OA 4WLUA 1XEWX 3Q2KA 3GZNA 3W8NA 1WSWA 2VUTA 3HC7A 3K92A 2EARA 3MA0A 3Q40A 2NXCA 4HLCA 4MS3A 4IRXA 4XSGA 1KKUA 5I9MA 3IAS6 3UMJA 2GUWA 3OFSA 3A4TA 1NVKA 4LYEA 3DOHA 4NJEA 2WE8A 3P2OA 3PNLA 5F98A 5A3SA 4A6PA 1P2VA 1QK4A 1C3LA 2ZJ1A 3KV3O 2BJVA 3QP9A 1E18A 3IP7A 5J40A 4WK2B 3BILA 3RWOA 3K73O 3Q8MA 3PSHA 1IOLA 3VDQA 3LRTA 4CKCB 1ZINA 3C39A 2CXXA 1G5FA 1QVAA 1JMVA 5KDDA 1UAYA 1Z3IX 4Q66C 5A7GA 3WSTA 5EJ5A 4Z4QA 1RXYA 3ON5A 1DJNA 1RBQA 2OWDA 2FPXA 2GGSA 4MYHA 1L5HB 3NDBB 3RG8A 1ILEA 3DS8A 3FB1A 2ZAYA 2DE0X 3CY6A 2PGAA 2QD2A 1FP1D 2X41A 3KLNA 4ENRA 5KOYA 3I83A 2HMTA 3WRVA 2XKAA 3O5AA 4ML3A 5C4MA 1N6IA 2ZJ5A 2OOSA 3FYUA 4LMRA 4W82A 2V8BA 1JKIA 1BMDA 1COWA 1OT3A 2F90A 2JKYA 3KSBC 1OX5A 1QFZA 4LK2A 2XCQA 2VUUA 1G2QA 1R3DA 1EE2A 1XMXA 5I47A 1Y7LA 2AVDA 4AZ0A 5JZ9A 3AV0B 4FDTA 3PQFA 2DLNA 3ETCA 3H8VA 2B2XA 3L7LA 4HGPA 5ALZA 4U7GA 1C3XA 3BD8A 1FFBA 4Q5IA 1OI2A 1FSZA 5I4BA 4ABYA 4V02A 3WQHA 4YFYA 1GNQA 2IWHA 5JAPA 1OBFO 2YYSA 2R87A 4F9GA 2CFIA 3DBRB 4EX6A 3QXGA 3C45A 1B14A 4CFYA 1QPZA 2ADFA 5DNCA 3ZW9A 2EW2A 3TDNA 4GBED 3JZIA 4IJUA 1T3GA 5EIXA 3CV3A 2AA3A 3NHJA 2Z58A 1KRXA 1G291 2VOJA 4LTDA 2G07A 3PFWO 4AMGA 4R1QA 1H2RS 1VZ2A 4JJIA 4G4GA 2W5UA 3HDHA 3QVKA 3JQ9C 3PI6A 3QUCA 4IICA 4HEQA 3MTIA 3VZRA 1HEYA 2PLRA 3AY6A 4JGBA 3FVTA 3EGCA 1G5TA 1SWWA 1V7PC 4RJLA 2VBGA 4D9EA 1SELA 5CEJA 4Q1EA 3AVYA 1L4NA 3L1KA 1JDTA 3C3EA 3ZN2A 4BMPB 1G55A 1XPJA 1MHTA 4BVEA 2R79A 2PFSA 3GCGA 3KB8A 1PQPA 1YWGO 3QE4A 1NVEA 3H99A 1R0WA 1TQ2A 1V5IA 4LJ9A 5F5LA 3SI7A 3L8GA 3O4JA 4C4PA 4EYQA 2QSUA 4UM8B 3ROFA 1UFQA 2IXFA 1VL5A 2P9QA 4DDVA 4WW0A 4ZAVA 2NO6A 4BL5A 5KMGA 2VJAA 3D5EA 1X7WA 3L1HA 2OFWA 5LUAA 3VAZA 4LVNA 1G2PA 3ITDA 3UWDA 2AZMA 4B4OA 3L40A 1K4MA 2C5BA 1XAHA 1PI3A 4JODA 1X74A 3G23A 3DOUA 1CUJA 2LNDA 3NYWA 3R40A 5AYVA 3UICA 1XV5A 2I3DA 2I6FA 3AP3A 3EG9A 1TFRA 1W4AA 1YJQA 1Z56C 2PJZA 2GBLA 3A9VA 4H7EA 4IOKA 4XX0A 3EW7A 4LN1A 1A76A 2JIZD 4Y18A 4F12A 4O4HA 1WB9A 2LV8A 5KYVA 3ANLA 2YJ4A 3ORQA 5K6AA 1HUQA 4LJRA 5HQJA 5JC8A 5E7MA 3ZDDA 2XOKD 1YRLA 1RXVA 4KYTA 1EXNA 2ZUVA 3O3MB 3TQRA 4H7JA 4A0GA 1DCFA 4IGFA 4MS4A 3RWMB 1A5AB 1U81A 2FZCA 3CLRC 1SVUA 2OM6A 3RC2A 3OIUA 4A1OA 2O2SA 1HGXA 2HXGA 2XYGA 3H9EO 9ABPA 2DKFA 2JFNA 2YV2A 5KQGA 1Y8ZA 1G5IA 3TL6A 5AW9A 3CW8X 1ZSVA 4R1MA 4E33A 3ZGOA 2B8EA 4MQFA 5FKJA 2Z0MA 3SF8B 2VZ8A 2P1DA 2AI1A 1JYFA 3DT9A 1TO2E 3B3QA 3SKVA 2FZVA 1ATZA 4N7JA 1D8TA 3WNBA 3QXCA 1A9YA 1SOAA 4HS9A 5GONB 1TVCA 2AFVA 3BRCA 3E2IA 1OFHA 4IV8A 2C96A 4YLEA 1WHSA 2HA0A 2C8VA 5GJBA 1CS0B 3ZDAA 1KGDA 4V2IA 4EFDA 1NOJA 2NV2B 4Y8VA 1FRZA 5I9LA 3BEOA 2BH2A 4U6NA 1P17A 1DZIA 2BISA 2ZT5A 3L4KA 3EEQA 3ETJA 5F3DA 4K6MA 2H4HA 1SEVA 1AKWA 2VJDA 4Z54A 4YRCA 2YX1A 3KT8A 3TB4A 3I8SA 4RPJA 1D2MA 1NIJA 1RWXA 1ZJ4A 4UXHA 3RSQA 4BY9E 4CL2A 4WZAE 3A25A 3ESQA 5IAEA 2HRDA 3RBAA 2C8LA 3UPUA 4Y1GA 2PWAA 4QBTA 4B7XA 4K0KB 2UU9B 2CB0A 1V71A 2AX3A 5A03A 1B23P 1MO2A 3AWDA 5BN5B 2BAGA 3MMXA 3AM1A 1XNGA 4M99A 1ZRSA 3AR8A 5HILA 4G9EA 1HDXA 5F9MA 2DUWA 3O91A 1ZMXA 3HZZA 3JD1A 2PRKA 1UJ5A 4RFVA 1AU9A 2IE0A 3EOAI 4QQRA 2C9CA 2RONA 2NSHA 3CBQA 4MRNA 5TQJA 4PGFA 2Q07A 1O4VA 2Q3EA 2H48A 4YEDA 1YDWA 1E5DA 1K7SN 2DY1A 2C88A 2EQAA 2B4KA 2JIQA 2O6HA 2P7HA 3O8BA 4OFZA 4XE5A 3ZQJA 3GLRA 1I3KA 3LXUX 1EUZA 1ENZA 1PNRA 3LGXA 2BR4A 1EGAA 3B8HA 3ZJVA 4HH1A 1QP4A 3PGJA 3PUVA 2QRKA 4PEVA 4ZQFA 5IC4A 2RH4A 2AEJA 2UXBB 3FDJA 4PO3X 4GX5A 3JZDA 4JLVA 4GKKB 1D2HA 1IUOA 1Q77A 1FX0A 3ABIA 4K9DA 4DLYA 4X9XA 1L4GA 3ND6A 5EJEA 3S8YA 3N76A 4F2WA 1O0CA 3G88A 1GKUB 3UJBA 3AY3A 2UYGA 5KJFA 3NALA 4NFSA 3ZHRA 4NOMA 3FFWA 4PO9A 5JSKA 1N8NA 1R0KA 3LPDA 2GZ3A 3LPAA 4KK3A 1QHIA 2FWAA 3BMQB 3FXAA 4WOJA 4YJ3A 3OZDA 3TW0A 3ACCA 5JS8A 4ESOA 2FSGA 1UK6A 1SQFA 2RB4A 2JH3A 3DOFA 3IT2A 1JE1A 4WMLA 3IEKA 1N2EA 5FTJA 2Y92A 4NULA 1O2DA 3TEJA 1P4GA 1JH8A 1F6WA 2RI1A 2XVXA 4YYZA 3M89A 1JPNA 2GXSA 4MGIR 5EXTA 5JXJA 5HP4A 1O3YA 2OK7A 3E7XA 2OFFA 4AMUA 2AG8A 1FUUA 1HETA 1OU0A 2CVFA 3KB1A 4MH0R 3HYCA 3HZOA 2YWDA 4F4FA 1DQRA 4R8LA 3RSGA 3KDAA 3ZVMA 2EIXA 2VWPA 2R4QA 4HZIA 2E18A 1ZRNA 3HN6A 1X7YA 1CUAA 2JHCA 3BGDA 4J16A 4Q3LA 4TTSA 2OESA 2W2NA 3TZKA 3VYTB 2HSZA 3E7DA 3JALA 1C7ZA 3FCYA 3SSNA 1MB0A 2E89A 4EGSA 3ADOA 1UQRA 3PWKA 4JCCA 4D0GA 3U4QA 1XTRA 1Z5ZA 2EV9A 3KZOA 1U5BB 4JAVC 4LCJA 4MW7A 3ED1A 2LPMA 4X1KB 4CKZA 1XJ0A 4F06A 1KZYC 2WM9B 1NZFA 5LDGA 3ROTA 1G5PA 2ZXFA 4DAEA 1YIAA 1CXZA 3MB5A 2ZDHA 3QFSA 3PC2A 3OEWA 3G7NA 4FJ0A 4U7DA 4FE4A 2OYSA 4I1VA 3CZ9A 3KJZA 2C5GA 2DC1A 4A26A 1NR7A 2WZCA 1K75A 3ZIDA 3EIUA 3D3KA 3N2EA 3VHLB 3KJIA 2PT7A 1R0BA 1P6UA 3VYRB 4AP6A 4AIRA 4GO1A 4BNUA 1IHUA 5B6JA 1IY0A 4RZHA 1UMBB 4I08A 4EB8A 5KX5B 3PC8A 2AMJA 2F48A 3RSHA 4PO8A 2ZJ3A 3O8OB 2YVAA 2C9BA 3E5HA 3IFSA 4J9UE 4CHTA 2I29A 3KQNA 4G1FA 1EVKA 1INLA 1PJBA 4OHRA 1I6WA 3O6VA 5AK3A 5AKEA 3W8EA 2W2XA 2ZQ5A 3B12A 2FP3A 3LK6A 4FPXA 1Z0AA 4AKSA 4EHDA 1K7CA 5BNTA 1YDGA 5AK0A 4BXOA 4JOCA 1YKSA 4K86A 2VH1A 2XAAA 3CG4A 3EDCA 4NYMR 4R83A 4KGDA 1EGVB 3U7IA 1JQAA 1JVNA 3DB2A 1NU8A 3R2JA 4IFBA 1CJUC 1ZZEA 2CYBA 5CTJA 5ENDA 4ZVOA 5H80A 3A0RB 3G8YA 3CJQA 5CM2Z 4CBVA 5EHXA 3IUEA 1C0LA 4PLFA 4X90A 3I9KA 1NUSA 3ETLA 3QKTA 1JG6A 1Z2PX 1BWPA 3ABZA 3LT5A 3NHKA 4R1OA 2C2ZA 1Z5WA 3ZZ1A 2I7DA 2XEXA 4NZMA 3GAFA 4G9GA 1VC2A 1WTCA 2ZYVX 4F21A 1R0LA 1MABA 1NBHA 2VO1A 3K32A 1JIJA 1QCDA 4ALKA 1E1NA 1KAEA 1QGOA 1QGYA 4IUDS 3IP6A 1ZX1A 4MEAA 1J23A 1Y8RB 1J9EA 3BA6A 3LX6A 1W5EA 4KAJA 5DULA 4BAGA 3M33A 4YJ2B 3IKMB 1OD6A 2WSSA 3IODA 2RHLA 4LGMA 4LJYA 4PU0A 4U9UA 3SQNA 1EFPB 1CDEA 1ISGA 1HYHA 2XV1A 2AK2A 3EA5A 3K9BA 3RE1A 3TW8B 3WRXC 3MRVA 1JMKC 1ZNXA 1ZWLA 1BKSB 3HCNA 2D4AA 5EWMB 3LKDA 5FBZA 5IC6A 4AY6A 3PXXA 3GQBA 4CL0A 2PZEA 3STHA 2X9GA 1QIIA 1TAQA 1FDIA 1KDVA 3IKJA 4FB4A 3NDJA 3RSCA 1RWKA 3U5ZB 1V0JA 1U7ZA 2OXEA 1ONNA 1Y48E 1XEXA 1J8YF 4C4SA 3KTDA 1H1LA 4OU5A 4J3NA 2J3KA 4BN5A 1QPBA 4KQFA 3AGQA 2V5VA 2YOHA 1ZICA 2HRBA 4BEBA 4RETA 1EP9A 4LNAA 1XNHA 3BX1A 2CLHB 4XJXA 1NYLA 3OMWA 5JWHA 4FR0A 2C4KA 4C0JA 5HZHA 4QUAA 4RF4A 1EFPA 3UW1A 1S8OA 4ZV4A 1F60A 2A14A 4HQRA 4Z1OA 5CVDA 1N7HA 1IJFA 2FPLA 3HCOA 1PLJA 4KIWA 1DJOA 5AESA 1J70A 2C98A 1DOAA 1J2TA 2CLEB 3EW9A 2FMKA 4TSFD 5ULLA 4PM4A 4R9RA 3SYLA 3QBJA 2Q46A 3AEZA 2DQKA 3Q88A 4WFQA 2JVKA 3ZI4A 1ZM7A 2GEUA 1E3MA 2Y1FA 1XTQA 1UWLA 2OP0A 2XXBA 2Y77A 1WQ4A 2AR0A 3K0AA 4CM4A 3KKKA 2FSVC 3WI7A 4BATA 3A2KA 1RFGE 2RK6A 4UXIA 1SUFA 1SULA 3H2JA 1RLUA 1MR3F 4LZNA 1NMSA 3PNPA 3L7NA 4EITA 4YCMA 2Q1WA 4TV9F 3WKEA 1NLFA 1O58A 5G0VA 1KZHA 3UV3A 4NC9A 5K0CA 1ZD1A 4WEOA 3PX7A 1JTEA 2AR7A 3IQXA 3GGSA 3MGKA 4KYVA 3NW9A 4E5NA 2Q6TA 2Z2IA 3NC0C 5B3LA 4GNRA 1LY1A 3SE7A 5CFOA 3JQPA 1T6NA 4BFSA 1EG2A 3V3TA 2E87A 2CFOA 1TJ5A 4DUGA 1TVEA 9GPBA 4L57A 3P2KA 3I0NA 1E7WA 5DIFA 4YP5A 3O8QB 4TWZA 2J1LA 3T3EA 5EESA 4DSTA 5JC1A 3CIFA 1QIHA 4IHJF 2ORYA 1NN3A 2DTEA 4MS1A 1BMFA 1XN1A 4EHLA 1L4BA 1V11B 3I4LA 1UMDB 3IUYA 1C7FA 1P2UA 1RAFA 4WBNB 4ZYUA 4MYTA 4RLHA 2W8BB 3DHVA 4QWWA 2H1SA 5AJYA 4UHBA 4Q15A 1VE3A 1QP8A 2HRQA 1GYRA 2W93A 1NXPA 1T5LA 2JFWA 2NYAA 3MRSA 4PTZA 3AFIA 4DWVA 2O8BB 3T5TA 2FW9A 3KT0A 1H1TA 3DQZA 5AVOA 2ZI5A 1Y9EA 3AVOA 1P0PA 2O8NA 5K3BA 1POXA 3NRCA 5GGXA 2GJ8A 4P7FA 2V7UA 3L05A 4J0GA 4NV1A 5LM3A 2AK3A 2PR2A 3V48A 3LT4A 4NPAA 3Q3CA 1XROA 5ALUA 5KREA 1O94A 1P91A 3LO5A 3ZV4A 3KBOA 1KI3A 3DGEC 3RIMA 1D09A 2G67A 1RP1A 2QN2A 3IE0A 1UBJS 4HVLA 3FB4A 4PZPA 1DIRA 4CLHA 2WTAA 1VE9A 5JALA 4NJOA 4MWCA 1NQVA 5IJ9B 3DL0A 4PX5A 1E0SA 3AF0A 4Z8YA 4BPRA 4EHKA 4RYDA 1MO6A 1IN8A 1E1LA 2CEKA 5DYWA 5KOIA 1Z4PX 2FU5C 1L4EA 4J0FA 2E6KA 4LOIA 1NNUA 4TMYA 4HAWA 3GJRA 4CKYA 3NAGA 4QXMA 3ROGA 1EQUA 5BYBA 1YHNA 1PFGA 5KYWB 3CZAA 5JATA 2OBBA 2JJQA 3HADA 2ES4A 2C0PA 1AUPA 5CK4A 1PJTA 2Q5HA 4L7QA 3UWKA 5C81A 4RANA 2GZRA 1JR3D 1JGTA 1X92A 3GRFA 4CVNA 4XRGA 1E96A 1QHHA 2PMBA 3PFCA 2HMUA 1V95A 2IPNA 5TMEA 4BWVA 2GS9A 2DCUA 1DCKA 2B98A 1U0HC 1U1GA 2MU1A 4JVOA 5ECGC 3STXA 4J8PA 3TZBA 3HNRA 3GG9A 4M21A 4Z9BA 3OIFA 4W5HA 4DOMA 3TAHA 1PLKA 4KDRA 2RH5A 4PVCA 5ALPA 4RULA 1UDCA 2VA8A 4LJ7A 1N6KA 2VDOB 1RIIA 2WI8A 3OC6A 1AC5A 2YXDA 1EWTA 5FOQA 3EXFA 1QQ6A 5IG2A 3U4CA 5F78A 3D2CA 3DVSX 1NI4B 1ZONA 4MRAA 4HXFB 3W6PA 2G63A 1FDWA 2WJAA 5FUWA 2R48A 2I3ZA 4BJHB 3NEJA 3GH1A 5DOZA 4Y3UA 1BQEA 1JZSA 3E48A 4JBLA 3DOEA 4RK5A 4WZAB 4BJ5A 3A2NA 2CXPA 4FKMA 4Y7CA 3HL0A 1OFGA 1GA6A 2FFHA 2BE7A 2ONYA 2YQZA 1MUUA 1VRVA 4H3VA 4IDHA 4Y2RA 3CTMA 1JA9A 4FMBB 4CCWA 3THXA 4C5CA 1L7BA 2EBHX 3F9IA 3PA8A 2V6MA 1QV7A 4Z1MA 2BR3A 1WV0A 4ZEVA 5BWCA 4WNAA 2EQ5A 4E5YA 2XIQA 1RXCA 5ALWA 4B1FA 5ALMA 5DU2A 5EXSA 1N2HA 3UAWA 2CL7X 3M70A 4BKRA 2WRZA 4UVEA 1LSUA 5DTRA 4DQKA 3TX2A 4GRDA 1ZY2A 3FPBA 3FF1A 2QMHA 3THWA 1IQPA 2VDMB 4WDRA 2F43B 2YOGA 4KQ9A 3TQOA 5A4JA 3K3PA 4OHFA 5AXCA 3MHTA 4QPNA 4MV1A 4EWLA 2QHXA 4XUEA 5FQNA 2II6A 4QPJC 4YRBA 1PFQA 1N75A 3PFHA 3B3FA 2VTDA 3MMSA 1GITA 4OXQA 5CA0F 1GL6A 1HDYA 4S05A 1OIVA 4FVTA 4J3JA 3VPBA 1NG1A 1P2TA 4RMIA 3USCS 5T5QA 4HVAA 3TG2A 4KQEA 4HADA 1HLDA 3AT1A 1CNFA 4BNGA 3N1UA 2GN4A 5IMBA 2ZRBA 3BA1A 3FA2A 3E53A 4KMOA 3DTTA 1B2LA 3QJGA 2UKDA 2VAPA 3KSDO 4URUR 2WLSA 3QBTA 1RCFA 4MINA 4DCPA 3OZBA 5FPTA 3I2IA 3KOZA 3EAFA 2PAAA 2C92A 3NMUF 3OCJA 2I87A 3QVLA 1QRAA 1CR1A 3C1TA 2GPJA 4LV8B 1ONOA 3GAMA 4RK4A 3VH2A 3VTKA 3W6ZA 1JI3A 1XWFA 2I71A 3OZGA 1VHDA 3GEHA 3SR4A 2VCHA 2BFCB 3NONA 4LJ4A 4BNDB 3GLGA 1H69A 1G21A 3GNTA 5D3ZA 1PZFA 1A04A 2BF4A 2YJNA 5G02A 3W5UA 3MTGA 2Z3WA 4BGEA 4TZ6A 2OC9A 3ZJYA 2FRVA 2BELA 1YQGA 1DFGA 3KLOA 1KO1A 3QWFA 4BNTA 1BH6A 5JRJA 2D8MA 8ADHA 2IT1A 5E95A 1DKNA 3NOXA 2LBPA 2G5GX 3T95A 3WMGA 1P74A 1E9RA 1U0TA 3ZE2B 1IUPA 4ARUA 2FR8A 3MTAA 1DQSA 1U7OA 5HOQA 2OHXA 5B30A 5LQDA 1PJ3A 1Y6JA 4Q3AA 4X1IB 4XTCS 5JYEA 3H4IA 4QQFA 2ZPTX 3ZY4A 4F2HA 1ZR4A 3LA6A 5EUBA 3D4IA 1ID1A 2IOQA 3W5HA 1L7VC 3FSGA 3S44A 1MLDA 5BVGB 4HWKA 5IYZA 1WMFA 3I53A 3M6XA 2C29D 3FNIA 4LHXA 4ZFNA 3WY9A 1H2AS 2WAOA 1L5QA 1O54A 1DKPA 1CZUA 4JU9A 4B9AA 1T9GR 3OBIA 4O4IF 4U7TB 3GNSA 2LP4Y 3PD1A 3OOWA 4M1WA 3S27A 4BRSA 2IUYA 3HNPA 1GR0A 3CEMA 5FORA 4DQ0A 2OQVA 1E4YA 4OOEA 3VO1A 1W88B 1Q0HA 2N46A 4G2NA 5DLQC 3MQ2A 2ZKIA 2ZKLA 1BMQA 4BNFA 5J58A 5FPQA 1LDGA 2A84A 1M5RA 1C3EA 4MPTA 4W9NC 5DX8A 4NH4A 3KYDA 3QPAA 2QN9A 3S6JA 3VR4H 4P80A 4YPOA 2QSYA 2CXRA 4FCCA 1Q0QA 3II6X 1K5DA 1SVNA 2F8MA 2RGEA 3O26A 1VL6A 4IDNA 5H70A 1DDOA 1OXUA 2NACA 4IDFA 4M0KA 1YACA 4YCNA 4OQDA 3VU8A 3VNVA 3LVQE 5TQ2B 4LXQA 5P8WA 3AINA 1C3JA 1P4SA 2RHDA 3CLTC 3K6SB 2VTBB 1J90A 4YRKA 1C3OA 3BH7A 4LW8A 1E6EA 1DKOA 1UPBA 5B36A 4L0QA 3BH6A 1VIYA 1I1NA 2GXUA 3CNLA 1GT91 1ZK0A 2H8GA 2OVBA 2HZBA 2PGNA 2XVYA 1XMJA 1E9EA 3IA2A 1X9IA 3IP8A 1K97A 3LT0A 3M1YA 2GH1A 1U4NA 4GZ3A 4II3A 4OATA 3ZXUB 2R9VA 4S3MA 5HKOA 2CLSA 3H17A 1MJ5A 1XP8A 4H4DA 4KX5A 2QORA 4OLFA 2HK9A 3PS9A 2FA9A 2CLFB 4LRSB 1MG0A 3VR0A 5CG2A 3ILYA 4G5RA 1M83A 3KEQA 5B7NA 2VRWA 3W3AH 2WC1A 1QB7A 1OASA 2CNBA 3SZ3A 1PGJA 2OGZA 2FX5A 2C5AA 2JCGA 4PYKA 1SFRA 2LWIA 3FI0A 1F0YA 1ZXBA 5EPOA 5G1NA 2RD2A 3A10A 1LWNA 2NZ8A 4JLSA 1O03A 2Q45A 2B1JA 2X0FA 5EJ7A 4IJQA 4AS2A 2FQQA 3DFKA 2R8EA 3ZWYA 4LVCA 3TFOA 5HPYB 4KE9A 1SPBS 2ZBQA 3QHPA 4X66B 3L1UA 2GWRA 2J41A 3A37A 4PICA 1PW5A 2AW5A 3BORA 3G9UA 1JSCA 4HB4A 2GRUA 2QDXA 2H2FA 3E4DA 1ETHA 4J03A 4ZA2A 1TLLA 1OPXA 4L3VA 3S1SA 4AS1A 1WWKA 4M49A 2BZ0A 3J7AC 2HHJA 1CY6A 4B6RA 1TJYA 4MEBA 3I5YA 2VXYA 4FC7A 4DIKA 4DVJA 3N5KA 1Z83A 2OO7A 1XKXA 4J0QA 1N5MA 1JQKA 3EGXB 4EDHA 2VOEA 3GUZA 2MMGA 2YJTD 1KVSA 4B73A 3EFEA 2D0OB 4CTNA 3TAXA 4QQ8A 4D8WA 3RJZA 1OFUX 1GAJA 3OLXA 1R6TA 1XRRA 4YROA 3ZBTA 1MVOA 5H3CA 1J8DA 3BIXA 4QGSA 1JFFA 3PJFA 1EYZA 1IVYA 4MB6A 1JN0A 3KZ1E 1M34A 5J4LA 4LXYA 4Q05A 2R6HA 2DR2A 1GZVA 5CXXA 3OMXA 4LOHA 5ARDA 2IBSA 1C80A 1KJYA 3ZU2A 2JZOA 1MIHA 1KK1A 5G0SA 5EIWA 2FZWA 1MIOA 5IZ4A 1M7HA 3KHUA 1ZU4A 2G3YA 4C0QC 3QX3A 3NCTA 4DB4A 1OH5A 4GMKA 3JRNA 3C74A 2GHQA 3N87A 5HKKD 4ZARA 2VPYA 4DT1B 4WKPA 2NX2A 3U7EB 2VA9A 3T9FA 4F4IA 2IY8A 4C4ZA 4MV6A 1GGNA 1JXOA 1JWLA 5K09A 1GA1A 3V8RA 3AG6A 1NW6A 2MR5A 3YASA 1VFNA 1CUDA 2Y1LA 2F67A 3JQDA 4P31A 2YIDA 3U09A 2M6SA 2WINI 1JKFA 1WSDA 2B69A 4INPA 4J1SA 4Y6SA 4HV4A 1IXYA 3HHEA 4IXMA 1D4AA 3R6DA 2QMUA 1QFSA 4B48A 1BKDR 3KQWA 1BEZA 1ZSYA 3DMDA 5D7BA 3QU9A 2BTEA 2YUIA 2E82A 3CG0A 4YP0A 4JUAA 1VPEA 3OA0A 2JBAA 4OVKA 4TTAA 4QG3A 1M7GA 3F49S 4G85A 4GPTA 4TT3A 3TSAA 4ZQGA 4O2AA 3R7LA 1Z4MA 2FQ1A 4YMIA 3E1GA 3OCVA 5NLLA 5KYXA 3VKUA 1IEVA 4G5FA 4KAFA 2GT1A 1PD1A 3X1DA 3B1WA 3UT5A 4DIDA 2I8AA 5L40A 1NW5A 4EB6A 3KT6A 2FQYA 4WFIA 3NVMB 1X1RA 3OQIA 2VPIA 2B7LA 2Q2OA 3ELWA 3STYA 3UJDA 4ZO4A 4AUEA 4EGCB 3GI1A 3ZD8A 1ZNQO 1UKVY 1WUTA 1S2LA 5FX2A 3O75A 1VPVA 5U9CA 1A8UA 4DLNA 2A33A 5AVXA 1JL3A 3ZE0B 3SDBA 2WDPA 2DFLA 4DC0A 3LQYA 4YLGA 4AZTA 2G7MC 1RC1A 3WVNA 5JBQA 3OU6A 2WDZA 3FBTA 3LF1A 4XX1A 2CJWA 3JPYA 4QO8A 5KNDH 1L8LA 4H77A 5F3WB 1SUPA 3NUQA 1IBRA 2AFRA 1K92A 5DBIA 4FMDB 2W6JA 2QX9A 3RHZA 3HDJA 4RY2A 3W9BA 5LMZA 4LHVA 2FPPB 3EVEA 3WGTA 1FDUA 2A9FA 3DM5A 3ZCVA 1OTHA 4PZZA 1R6XA 1TZCA 4KR2A 1CNEA 2PKWA 3FUVA 5TPZA 4ZHQF 2OV4A 3U0VA 2C3UA 2NV6A 1MV5A 1BHSA 3UCEA 2XCRB 4E11A 1MT0A 3NBUA 1NDQA 3G2NA 4LY0A 3WLFA 1Z0DA 2FEWB 2XTJA 2QXTA 1P5JA 1T9AA 3HSKA 3MJVA 4G4JA 4ZU6X 1I7LA 5HIIA 3EG5A 3KXPA 2G70A 3CX8A 2NMVA 1XZFA 1E1RD 3OHSX 4A2PA 4IWXA 1WXGA 2IP2A 5IX8A 4BTLA 1KORA 1QAOA 1ZK3A 3MWDB 1CB7A 2X2EA 3D2LA 2O5RA 3H1BA 3SLRA 1IB0A 3UFXA 3M3DA 4GLFA 1VJ5A 1Y98A 3SYNA 4P35A 4KAAA 1OIXA 5JR3A 1T3SA 1ZHHA 2V58A 1G9TA 2D1FA 3E9DA 3ESAA 4DUYB 1UEJA 1W8DA 4I6EA 1CQJB 4UCWA 4Y2VA 3PGLA 1DXHA 2W00A 1YKFA 4C4YA 2HK6A 3DHEA 3K5PA 4QT0A 3RAEC 3AM4A 2HD4A 1XMSA 3GGOA 4YACA 3VZBA 1UK7A 3AY0A 5FOVA 3Q7RA 2QTFA 3PYXA 3WYEA 4XJTA 3ZXIA 5IANA 3JAKB 3OQPA 4IV5A 4ZAYA 5IDQA 2XMQA 3KX2A 2FXVA 1VTKA 1TAUA 3QQ5A 3EOBI 2IS6A 3HWWA 2FZGA 2A5LA 3UWSA 4EPWA 2BZSA 521PA 5JNLA 1N5IA 2ODEA 3I9NA 3IS3A 4G4SP 1OXKB 5CVVA 2WTUA 4YPFA 1J99A 3ENKA 1L1FA 5IXYA 1EG7A 4HNGA 3AF4A 3QXJA 3OPYI 1JLHA 3A1DA 5DBFA 3T1NA 3VDNB 4EY3A 3D0KA 3K0FB 1I01A 1L4KA 4U8GA 5IAJA 5ARBA 2IUSA 1L4UA 1KPGA 1OAAA 3I04M 2VUIB 2P75A 2V7PA 4FYHA 2DQSA 1BRTA 4JR2A 4Q4CA 3PYLA 2BFEB 3SQMA 2DH6A 5CLHA 5EC8A 2ZXUA 2CL6X 1IHDA 3GR6A 1E9FA 2XMPA 4MKRA 3VI4B 4OQNA 4AB1A 3MCUA 1TEVA 1TJ4A 1UJBA 5BN3A 2X6QA 2F59A 2C2BA 3TL3A 3AR2A 3OLZA 4RD2A 4YTEA 4Q9IA 2QX6A 2YFHA 1SCKA 1U3GA 1P7YA 3D43A 3GLHE 4CCYB 3DYBA 1AJEA 4YVFA 4ME6A 1DIOB 3EF1A 1W85B 1DO2A 3OQBA 2OCDA 2CHQA 3BIWA 3V1NA 2OM2A 1KQGA 4NMXB 2XD4A 3ESBA 3S99A 3WGNA 4MV5A 2QL7A 5I5EA 3AP2A 4TYQA 5DM4A 2DETA 1LK0A 4H35A 5ALGA 4EVRA 1U2DA 1ODLA 1J8MF 3KD3A 2ZRJA 3DVAB 3COPA 3MJDA 1NXTA 1H22A 3AZQA 4I5DA 4QEZA 5TPWB 4Q1DA 3TIVA 1EXDA 4I36A 2PQMA 3F90A 1L5NA 4C07A 3R5XA 4RXMA 1RMYA 2YNMA 1R6DA 3CEHA 4CN9A 1SZJG 3T3NA 4BLQA 621PA 3IJPA 3UHJA 3VR6A 5EUMA 4E4YA 2W48A 3AEXA 2OA0A 1MORA 3GMIA 3LPLA 4D8XA 5J4YA 1TF2A 2F3TA 1LQTA 1Y8AA 4BO9A 3I32A 4F6LA 3MTJA 5DGTA 3BXPA 3QWIA 5C7LO 4Z86A 1AXGA 3VTFA 2Z2JA 3FPJA 4DR5B 1I2ZA 4L6IA 4TKUA 5CDYA 5C80A 3I01A 4H6WA 1P4RA 4WV3A 1XAJA 3L46A 4TL9A 4ER7A 2X9NA 2GO7A 2G4CA 1WMBA 2HJHA 4Q9JA 2HA7A 3WOHA 5EIOA 3EULA 1YZUA 5AP9A 1TL7C 3QTLA 5CBPB 4EMBA 3OE5A 4G56A 2DPYA 2F4VB 1QO0A 2I2WA 1ZD5A 4QO7A 1VJ1A 2WSIA 3ZS9A 1LX6A 4DG8A 4LF9B 2N75A 1G5QA 5LJLA 2HNBA 2I0FA 1DUIA 1BA2A 1GL9B 1II8A 3A3NA 3HP1A 4C76A 4E15A 1A7UA 1NSFA 4HGNA 4M0FA 5HIAA 2GCIA 1JU9A 4O2RA 5FOSA 4TOIA 5KYTA 5JJLA 4XB6B 1DWOA 5BN1A 4M3NA 1MX9A 1MX1A 1A8HA 5THKA 2EGHA 3BDAA 1QWSA 3IVXA 3OZ7A 2LCFA 2OV6A 2ZT7A 2J0EA 1EFVA 2VFAA 4EUHA 2DFNA 3JQAA 4F3NA 1LH0A 3EVGA 1JQBA 3K2EA 3C7KA 2J4DA 3F71A 4LGVA 3LCCA 2R68A 4GLOA 5FI0B 5JJCA 2ODNA 5ALEA 1J0XO 2J08A 3H7AA 3HBJA 1KOFA 3DMFA 1BFUA 1QTNA 3DVLA 4Y6QA 2FSFA 3SIXA 1JFLA 3IT1A 5G0TA 3QPWA 3AF1A 2GM5A 4HTAA 3SJBA 3CPSA 5JD4A 4OBBA 2TYSB 1Z6ZA 3UT0A 1KDTA 3B36A 3I5AA 4Q82A 1AG9A 3I5MA 2ZWMA 4NYMQ 3FCCA 4ND2A 1XUOA 3LFUA 3FPAA 3V42A 1BE8A 3NVKI 3WXBA 3AEYA 3I2KA 3TW6A 1I6MA 5JVDF 1J42A 3Q3EA 3ZY5A 3D59A 2YY7A 4RWEA 3A1FA 2CBGA 1NASA 3QOWA 3MF4A 1SIUA 5ALNA 2X4IA 2BTQB 4YB8A 1E6UA 4RE5A 1QRDA 1MJNA 3L6EA 4XD2A 1EX6A 1POWA 3A8TA 4QBIA 4MJ7A 5JAUA 4C7KA 1TW2A 3FGOA 2A67A 1KY5A 2QYOA 3DGFC 4MI3A 3UEOA 3B52X 4ZI7A 2QUKA 3DAGA 4CKBB 1FFAA 2H8KA 2J31A 1QYCA 2YVQA 2YZGA 3BWCA 3N0XA 3Q85A 3DTNA 3EPRA 4RPKA 1J9GA 4MV4A 2R60A 5I7WA 1UMCA 1DXQA 2OGTA 2ZIXB 3Q7SA 1N9GA 1IOZA 1U5AA 2RGGA 2C82A 3ABSB 3KOYA 3HFGA 3DCIA 1E7SA 4MMXB 4KMRA 4RZSA 5JMPA 3K0BA 4YIKA 1X15A 1E2NA 2CUTA 4KFTA 5EJFA 4B3CA 1K3UB 1JIVA 4BQOA 5C8XA 1ZN8A 2G0TA 2QRZA 2R7LA 4OK5A 4WOKA 3TECE 2HTFA 4GOOD 5CD1A 1XL1A 3HTXA 2GOYA 2H18A 2Y05A 1CZRA 5CJ2A 5G41A 4EO4A 4CMAA 1FDTA 2F62A 2ZPAA 2H2WA 4PFSA 3T35A 1QQAA 2VZ9A 4HDNA 1UPTA 5HZKA 4ER3A 2I78A 4UTNA 1AO3A 1Z38A 3ER8A 3N2GB 1P4HA 5CDUA 3AEUB 1U3UA 1Z0ZA 3QUAA 2QR2A 2CXUA 2TMYA 4GQIA 3HJHA 4U02A 1XQWA 4CKBA 4M9ZA 2OTCA 4ENUA 4O2LA 1TT5A 1XD2A 5A3JA 3BUSA 4JB8A 1TGVA 3OEYA 1ZIOA 5E7JA 4F38A 4OUKX 3UMYA 4JOQA 1WXEA 3VVLA 2IXAA 3HLYA 1NFRA 3NTXA 2V3WA 4X60A 3R5SA 1EZ1A 1XTIA 1PBTA 4XD7A 3TTSA 3BT7A 3E1SA 1XNJA 1I3MA 1MEJA 4Q0MA 2I2AA 3PTZA 5FI1B 2HADA 3IP9A 5C52B 2JAUA 4MGZR 1CJBA 1NW7A 1VL0A 5EUQB 2RG1A 1M2OA 3KKQA 1CR2A 3ZQ6A 4BEJA 3HFRA 1YRAA 5IKEA 5HUQA 1U9IA 1EWRA 4HYQA 4HZUB 2ACVA 2VVTA 3WYDA 2FPMA 2YZ7A 1PVVA 1N3IA 3A70A 3LXMA 1U0JA 3GCDA 4LDRA 3ZHTA 5HVNA 3JD2A 4AI6A 1VDZA 2RBGA 2FR1A 1NRJB 4R1LA 3T34A 3LVBA 4W6QA 1SRQA 2JDID 1SBTA 2R8ZA 3ORRA 1RSZA 3PGKA 3QWHA 3IMEA 2RC6A 1AZTA 3Q7TA 3R4CA 5B7GA 1AXEA 2WIFA 5K8CA 2J3LA 2V65A 3GDWA 2UDPA 4WI1A 1FYVA 1IUNA 1VMAA 2Z1MA 3RLIA 1IWOA 1I4DD 4A15A 3IRVA 3ZJ4A 2XAUA 4YWHA 4E32A 1SCJA 4R98A 2J3HA 3C6XA 4ZC8A 1ZNZA 1DBVO 2BOVA 4A8JC 4QDZA 3PQEA 1Y9AA 4O6VA 4Q48A 3AX6A 4ZTBA 4YDHB 5BR4A 3SWWA 1DTWA 1W94A 2NU7B 4Y1EA 1X1AA 4YA6A 4R41A 3VYUB 2FHSA 2XT9A 5TDHA 2KMLA 3M2PA 3SY8A 2QIPA 3PJGA 3DLBA 4G0YA 4L4UA 2I4TA 4NZ9A 3PDIB 5HG0A 1VYTA 1F12A 3EGEA 3EGDB 3HYRA 3IP1A 2GTIA 4U7WA 2OE2A 5AHKA 5U4XA 2OK8A 4RVCA 3BVPA 4BJ1A 3DV2A 1YQTA 4ARZB 4YDSA 3B1ZA 1Q7TA 1U0OC 1U8CB 2XUKA 4GXTA 1O1YA 2JGJA 4MVJF 2Y0BA 3EPPA 3OECA 4JC8A 2O2DA 3KXDA 3FOFC 1MNAA 2QB5A 3NYIA 2D7DA 5H4HA 1I0ZA 1YDMA 2F7SA 2YRXA 3F8WA 3FIJA 3L7JA 3LBAA 1GU0A 1PWYE 1GKLA 3ZHSA 3P45A 3C6BA 1BN7A 5AQEA 1Z13A 4K6OA 5JMOA 2CLMB 2OY0A 1EX7A 3GLFE 1G59A 1G4UR 5JSHA 2I62A 1SC4A 1VBKA 2BKEA 4E94A 3DZBA 5C8YA 3GK3A 2HAEA 2A9RA 1E3WA 3R0IA 3ACDA 4WCFC 3JWJA 3QKSB 2DB3A 4KFRA 2E1RA 1Z6YA 3V1TC 2C7VA 1JX6A 2Y1WA 3MT9A 3V9AA 5LMUB 1HNWB 3Q1KA 2VATA 2IU3A 4LSMA 1IXRC 1MPXA 4Q3DA 4EJ0A 5IZCA 4ZOBA 5IK2D 3KVVA 2V3CC 5BNWA 1C7IA 4DLSA 1JKJA 4OP1A 3D6HA 1W0KD 3S2SA 1ODJA 1CQXA 1NHWA 1ZXXA 1W76A 4BLUA 1WCIA 1K0FA 2P5YA 1B2RA 4LWPA 4L75A 3GJ4A 4R5HA 2HGSA 2PIDA 3QFRA 5JS2A 4D0RA 4B8ZA 4P3YA 4OX9B 3DLPX 1YT5A 4PXSA 3L7IA 1HYEA 4RIGA 1G20E 1IRIA 4XIGS 5JSYA 3NNSA 2PX5A 4DJAA 4AJHA 5KVCA 2PA3A 4OQQA 4JB2A 5FBRB 1N2JA 3ONWA 1MH1A 3CTPA 4H0CA 1ORHA 4HX2A 3FY4A 4E30A 4EG6A 1S8AA 4NXMB 4LXIA 3M7IA 1CQZA 3O3CA 1UUFA 3V6LA 2AI2A 2A9VA 3E1KA 1EFHA 4YRQA 2D8AA 3N6VA 4Q03A 4BP9A 1WBDA 2O54A 1JAIA 1VQ1A 3BERA 3H75A 3K1ZA 2H1OA 5SZHB 1XD8A 3CRW1 3KJNA 4EQ6A 3MWYW 1Q7BA 3SDZA 4C6TB 5E0KB 5BV8A 3AESB 3CWZA 3MW8A 1VDMA 4DEXA 5JJBA 4HQ6A 4BFLA 4CIVA 1TUBB 2QL5A 2WUFA 2GKGA 3M4NA 3MCVA 4GMFA 5AI6A 1VE5A 5EXDA 3CR8A 4PYLA 3A14A 2F9FA 3OE1A 1K5GA 3R9XB 2IY7A 3L82B 3QPUA 3K05A 1B0ZA 3DLIA 5J2UF 1TVKA 4D8TA 3HXMA 4G65A 3TZCA 1R4AA 1CP3A 4V0QA 4UARA 4JKYA 4JC4A 3K4QA 3RUCA 3WGZA 3EZXA 4LQDA 2C7QA 2H6EA 3U7QA 5A3QA 5CH8A 2AKAB 3C3DA 1I24A 4LY3A 1QYXA 2D1TA 3RAGA 2BGUA 4LK3A 5FUBA 3ZX5A 4E1VA 1FLAA 1WXFA 4UDXX 4CCAA 1JA1A 1Z8FA 1YCFA 2F00A 3QA9A 3NG1A 1CUVA 1EM6A 1SHTX 2W4QA 4G6ZA 5TQVA 3W5IA 3FNRA 3UKJA 2VPXA 1FVFA 2F1KA 3ZGVA 2PBZA 5JCJD 2P9CA 3ERCA 1U0LA 2RKWA 3I5UA 4FTWA 4IJ6A 5AKGA 3ZWPA 3IR7A 4DM7A 4ICIA 4CMIA 2R5WA 1B6GA 3DBLB 5TMBA 4YPVA 3GLHB 1J06A 1KJNA 3JASA 1FYDA 3NYRA 4UU1A 2JW5A 1MOZA 4YV2A 4Q7LA 3GRVA 3R5HA 2QP3A 4U4AA 4CPDA 4MW4A 1MB4A 2X19A 4Y2TA 2CMGA 3EGWA 2PZ8A 3ZNOA 2B9VA 3WL6A 1JG1A 2G8NA 4TMXA 4BCCA 1CE8B 2A0UA 5DYIA 4MUFA 5JLAA 1GTG1 1ST2A 3T9BA 3B9PA 4GM4A 5CAEB 3FFXA 5WRFA 2H17A 2CVHA 1ND5A 4DGSA 3BMXA 2FEKA 1QAMA 1PDOA 1T5HX 1KFCB 1QUEA 2EF1A 2JGNA 4Q3OA 3WBKA 5F52A 2CK3D 2HHAA 1L4YA 5FCDA 2G83A 5EMNA 1RYNA 1XQ6A 2Q8QA 5HYVA 2IX9A 3GDOA 1Q11A 3FYUC 4V0OA 3RIHA 3CVXA 4AP5A 4FZJA 4PQGA 1D2AA 3R3HA 5JYCA 3LHKA 1ZD2P 1MW9X 2QE7A 5EZ5A 3C1UA 1QO7A 3EAGA 4JUFA 5AWFC 5K8JB 1GGMA 2PUWA 4LCEA 3SICE 1ZD8A 3B51X 3O8NA 4I99A 2WKRA 2WWFA 1OZGA 4KQMA 3A1TA 1H8ED 1MJGA 1IVNA 4O63O 2WJWA 4O59O 7ABPA 2FX2A 2H2HA 4HOYA 2W6CX 3VPSA 3IBYA 1KP3A 1DLJA 1DIBA 1PSZA 4ZOEA 3FGPA 4C2UA 4B31A 3MGCA 1ZQ1A 1EEHA 1DKRA 1T8WA 4OHXA 2HSWA 4CTOA 3DB1A 1BVHA 1OBCA 2PT9A 1RHKA 1C2TA 2QF7A 3HKEB 5L9AA 1EUYA 4XVRA 2X1HA 2OP1A 4E03A 4V1CA 5HSGA 1UIMA 2PDAA 1XDUA 4R69A 2F1JA 2BZ1A 3D3WA 3TXYA 1VPTA 5F4BA 5K2OA 4CTMA 3RU7A 2RHJA 3V1LA 5IEJA 4XWAA 4F6RB 1P8JA 2XW6A 4QG7A 5JTUA 2HWYA 4XDHA 1RZUA 1AKQA 4AKEA 1TYCA 3MPUA 2LE0A 3PUZA 4RH1A 1ZNWA 4I9NA 5L3SA 1G3RA 2YYYA 1E6LA 2ECQA 1JHXA 4TQAA 5GZ1A 2A94A 1W0CA 3MIIA 2VDWA 1GNLA 4JLDA 4MV7A 7REQB 1CDZA 3FX2A 4FYPA 4X41A 1APBA 4TN1A 4CT0A 1QIFA 1BDHA 3ZZMA 3HB4X 1PR4A 3F7OA 2EKLA 2M32A 3FRHA 3GMDA 1QLWA 2JCYA 3QU4A 4KI7A 4TV9B 3O73A 3FZQA 2FG7C 4D80A 4XPZA 1Q57A 4Z2YA 3IDAA 2X4LA 4K5QA 3ECCA 1NRIA 1TCAA 3SHQA 4JJAA 3UT6A 5FWXB 5KHLB 4DCOA 4V39A 1N92A 2GB4A 3LQRA 4GX1A 3ND8A 4IO0A 4US2R 4B8WA 1EJ2A 1KU6A 1UC8A 3R7WA 2GBLC 3WSVA 3BB3A 3CNHA 1H4QA 5LKAA 4KMSA 4A8TA 1ADJA 1VRCA 2PWZA 2SKDA 1EDDA 3CQ9A 4I5FA 5ALQA 3TWOA 2QTAA 5K6AC 2YVLA 1V3VA 4L4ZA 2V5AA 4ZEXA 2IIPA 5A1TA 5AW8A 3QV2A 2IHNA 1XTSA 5CDHA 1V7CA 1BDIA 1GAEO 1PTJA 1T5DX 1YCGA 4G9BA 2PX6A 4N6NA 5AXBA 1YE5A 2PKCA 3IVRA 5LYYA 1QQTA 5B57C 3DSRA 2HHCA 3GRZA 2GWHA 2RGRA 5KSYA 1V3UA 4BB5A 1EX9A 1RW4A 5BQPA 1JJBA 2YBEA 1AZWA 3CEPB 4IVPA 2YXEA 4G25A 4QXPA 2F9MA 2NVUA 3Q0IA 3SN6A 1O77A 2O8VA 1E9DA 3OX4A 3G9XA 4BCDA 1J2RA 3NBZC 4MWDA 3TSYA 4I9GA 5DASA 4PLHA 3M4YA 1R6UA 3CUKA 4FT2A 3EZLA 2PBRA 3D3EA 2E5FA 2W43A 3CR3C 4X6UA 1TCBA 4KLRA 2QRPA 2WTEA 4Q9NA 4DYVA 2NAFA 2ZXEA 3PU6A 3H65A 2O7RA 3ONVA 4GXQA 3OTGA 4LVOA 5DZSA 2WWWA 2QW8A 4TKVB 1RJWA 5F35A 3SC2A 1KZ1A 1Y8CA 3QU7A 4JYMA 4NCXA 5U1PA 3RHTA 3RJMA 1E1DA 4AU1A 4BO7A 1RAHA 2H59A 1L1QA 4OM8A 4OUDA 1KJIA 5EKSA 5J23A 3EFOB 2QYSA 3KQKA 4CLDA 3QVJA 4ZYLA 1I3CA 1BS9A 2ESRA 3QH4A 3UENA 3M1IA 4ZKEA 1EFLA 2FPOA 1B4DA 1E1CB 2ZWPA 4GX2A 3JY6A 3N7UA 3REFA 3RRXA 5GTDA 2FK7A 1KDZA 2F8SA 1K86A 2E4ZA 4ZZIA 5TQ0A 3RBZA 3VX4A 1TCCA 3NT5A 1LBTA 1BEUB 2IOYA 5EP2A 5DBHX 5TARA 3VFDA 2IEGA 1Q17A 5M3BA 3W8RA 2PO7A 5E6RB 5FTMA 5HF5A 1Q12A 3RASA 4YDQA 2X9QA 1U65A 4BVJA 3IJRA 2Z6QA 1BFDA 1ESNA 1WUYA 2HMSA 2EG9A 2MYPA 3F3KA 3ICEA 4G89A 1WHTA 3DTVB 3BMOA 4G84A 4Q9HA 4TXMA 3H2ZA 1VBNA 3ND7A 4O2BA 1OREA 3QW2A 5JCPA 2IPXA 1N25A 5DHPA 1QE0A 3HKBB 4D3SA 1OWPA 5HE9A 4XFDA 1FQJA 1ULHA 2WPDA 3DXZA 4OL9A 5CM8B 5LYJA 4DR7B 1NU6A 2QTNA 3ZWBA 4I4IA 1AQLA 4R54A