2GAFA

Crystal structure of the vaccinia polyadenylate polymerase heterodimer (apo form)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
297
structure length
286
Chain Sequence
b'MDVVSLDKPFMYFEEIDNELDYEPESKKLPYQGQLKLLLGELFFLSKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVASPSTADLLSNYALQNVMISILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDYPNQEYDYFHMYFMLRTVYCNKTFPTTKAKVLFLQQSIFRFLNIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase
molecule tags Transferase
source organism Vaccinia virus
publication title Crystal structures of the vaccinia virus polyadenylate polymerase heterodimer: insights into ATP selectivity and processivity.
pubmed doi rcsb
total genus 93
structure length 286
sequence length 297
ec nomenclature
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01358 PARP_regulatory Poly A polymerase regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2gafA00
1O9GA 3IV6A 3HNRA 2VDVE 1XDUA 3VSEA 3GJYA 3R9XB 2PV0A 3HCDA 5GM1A 2ADMA 4IV8A 2G8NA 5ICEA 5ICCA 5GM2A 2Z6UA 3BKWA 3DUWA 3OE5A 3EVFA 1HNNA 2QM3A 3A7DA 1KYWA 1QZZA 1I4WA 3UJDA 4NECA 4H0NA 2UZ4A 2JJQA 4GUAA 3DLCA 3T0IA 4YV1A 4WXHA 3CVOA 2XYRA 3LPMA 4YUWA 2HMYB 1P91A 1VBFA 3GO4A 3TLJA 3OZTA 1RJGA 5K03A 1ORHA 3FUTA 4RTPA 1QANA 2FK7A 5CIYA 1V39A 3M33A 4C07A 1R8YA 4OBXA 2ZWAA 5K0CA 2O0LA 4ISCA 3G5LA 2BR5A 4BY9E 3GGDA 4AZWA 4E2YA 2R3SA 3FPJA 3MAGA 4RTMA 1WXWA 2PT9A 4M7RA 4PCLA 2XVAA 5E9QA 3FPHA 3X0DA 3NVKI 1BKYA 1YZ3A 2CL5A 3DTNA 3G8BA 3UA3A 2YXDA 1VP9A 4CKCA 2P3QA 5DWQA 3B3FA 3CJRA 3P2IA 5GWXA 4YUVA 2EX4A 3BKXA 2ERCA 2P7IA 5LQNA 1Z3CA 3PTAA 3FRHA 3DMHA 1FP1D 2Y1WA 2VZ9A 5E9WA 2P8JA 4JXJA 3THSA 4ATNA 3ME5A 3EGEA 4QQNA 5CUQA 5EMJA 4IWNA 4FP9A 5E9JA 3B5IA 3BGIA 2ZIGA 2ZSUA 1VL5A 3D2LA 1JTFA 5CCBA 1P1BA 3OZRA 1P1CA 5EKXA 5M5BA 2AN4A 3FPEA 4EVIA 1KPHA 2IH5A 2PX8A 3LSTA 4KVZA 3M4XA 2YXLA 5DX8A 7MHTA 3KQVA 4R8RA 2IBSA 1TW2A 3B89A 4QTTB 3H2BA 1JQDA 3EMDA 1G38A 1KYZA 3SVZA 5FQOA 3G7UA 3UZUA 5HIIA 5CD1A 3PB3A 3B3GA 3LX6A 5EMMA 1OR8A 1IXKA 3AY0A 2N47A 5CVJA 3GWZA 2AS0A 3AJDA 5FADA 3P71T 3SSNA 5FULA 2P40A 2NXCA 5LQUA 1PJZA 3NWEA 3G8AA 4GEKA 3O31A 1VQ1A 3GU3A 1M6YA 4KW7A 4PONA 5EC8A 4AZSA 2HTEA 2IH4A 4E2ZA 1YF3A 4R8SA 3OFKA 2I6GA 3SMQA 2ZCJA 3ELYA 5BW5A 1QAMA 2VDUE 3TM4A 2UYOA 2PWYA 2OPBA 4GOLD 1H1DA 2V74B 2PKWA 5C0OE 3LKZA 5E2BA 2QRVB 4X63A 3SSMA 5F2OA 8MHTA 4QVGA 5DX1A 3FUVA 1FBNA 3CGGA 5EHGA 5LQCA 5DXAA 3G2QA 5GINE 2OZVA 2OYRA 3DLIA 2AOVA 2DULA 3GNLA 2GA9A 3OCJA 4O29A 4RVFA 3NW9A 4C08A 4XUDA 4BP1A 3LBYA 5DSTA 3FPFA 2H1RA 3HVKA 5B1SA 3M6UA 2WA1A 4PIPA 5LSAA 3QOXA 3UWPA 3KR1A 4HGYA 1WZNA 4PNEA 1FP2A 4IKPA 5FUBA 3EVCA 4YMGA 2OY0A 5CVVA 4RTOA 3A26A 2P35A 5K0NA 4DM3A 3DXXA 3EPPA 3EVEA 1X1BA 1NW6A 3NWBA 4QDKA 5E1DA 2AVNA 4YV2A 3CBGA 5E8RA 3G88A 2AVDA 2P41A 3I64A 5DT2A 1KIAA 3PX2A 1XVAA 3GXOA 3P9KA 3KQOA 2P3OA 1XXLA 2VDWA 2YTZA 3BGVA 2A14A 4HTFA 5EG5A 3TFWA 1U2ZA 2G1PA 2IFTA 4M37A 2ZBRA 3KQQA 2OXTA 3UJ8A 3M6VA 2C7RA 2IH2A 5K0BA 4P58A 5G02A 2BM8A 2C7QA 3MERA 3CJTA 4GF5A 5KQSA 2I9KA 5EIWA 3ORHA 2ONYA 2PGXA 3KPVA 4PYNA 5T64A 1D2HA 4FT2A 5DX0A 4E2XA 4E33A 2IBTA 5MHTA 5EEHA 1AV6A 2E5WA 4LWOA 4HGZA 1ZG3A 4C4AA 1JQ3A 1ZQ9A 4CTKA 3HTXA 3ID6C 1JR4A 1XCLA 2ZULA 3OU6A 4C06A 4K6MA 5LQJA 3KPJA 3SXJA 3GCZA 5D1HA 2GPYA 2ZLBA 2GS9A 3BXOA 4HTFB 1R00A 3PLAE 1RI4A 1VIDA 1SUIA 3GDHA 1IM8A 1ZGJA 3FTCA 2DPMA 2YQZA 3OZSA 1L9KA 2I62A 2ONZA 3CC8A 3SX0A 2AOUB 2P1DA 2Y1XA 4QTUB 5U4XA 4PYIA 3O4FA 1BHJA 4RVDA 3GRVA 2YX1A 1PRYA 5EGSA 4KRGA 2BZGA 3ERCA 1SQFA 1L3CA 4LG1A 3LHDA 3OU7A 3DR5A 3GRYA 3VYWA 3BWMA 3MCZA 1KPIA 2AN5A 3KR9A 1G8SA 5K01A 3C3YA 3MTIA 4CKBA 1WXXA 3I58A 2QY6A 3KU1A 5KS2A 4RYLA 3PT9A 3BWCA 4Z2YA 4BLVA 3GRZA 3IEIA 1R18A 5GOZA 1R74A 2EFJA 2ZIEA 3EVZA 4QQKA 5K05A 1M0EA 2AOTA 2IDKA 5DRTA 1YFLA 3EEOA 3MTEA 3T7SA 3NVMB 3HM2A 2IGTA 3QOWA 4PGHA 3FPGA 4DMGA 3UJCA 3LL7A 4MQ4A 3GRRA 3TR6A 3VC2A 2XVMA 1G60A 3K6RA 1MJFA 4E31A 3SM3A 1KP9A 4DCGA 1KPGA 1NKVA 1JG4A 5CCXA 1YZHA 1IY9A 1Q0SA 4OQDA 2VS1A 3LDUA 1N7IA 4YUXA 5CVDA 3KQSA 3LGAA 4AUKA 1ZHFA 2ZFUA 2NXEA 4P7JA 4B17A 3V8VA 3I53A 1L3IA 5EHIA 3LCVB 5K09A 1DCTA 3DH0A 3LCCA 5LQAA 2HR1A 1AQIA 2EG5A 1XDZA 3I9FA 4GOOD 4YMHA 3AXTA 3M6WA 2AOXA 2ZZNA 5EZQA 4R05A 2WA2A 3MQ2A 5DM1A 5DPMA 3BGDA 9MHTA 3REOA 1R8XA 2ZTHA 2C7OA 5EEGA 3P9NA 3OU2A 5DXJA 2AN3A 4F85A 1NW8A 1D2GA 2AR0A 2OO3A 5E8JA 2OB1A 5FTWA 5IH3A 3FZGA 1SG9A 2CMGA 4FSDA 2ZZKA 2Q41A 3P97A 4C04A 4E32A 3SSOA 1UFKA 2FK8A 4FR0A 4U7TB 2FHPA 3SGLA 3R3HA 1RI1A 3E23A 3IHTA 5DM0A 1DUSA 1F38A 3E7PA 4KDCA 4BP3A 3P8ZA 4V0QA 5GIPE 3FTFA 4KIGA 1JSZA 1VLMA 3A27A 3P2EA 4GC5A 2B2CA 4AZVA 4ZTBA 2O07A 3UJAA 4EKGA 1JG1A 3A25A 5K0LA 4CKEA 2GB4A 4EMSA 3HVHA 5K8VA 4QPNA 2LD4A 2PY6A 1O54A 1F3LA 4X41A 5FHQA 4YUYA 2O05A 5EOVA 1L1EA 2CWWA 3DMFA 3HA7A 2JHCA 2F8LA 2IP2A 1I1NA 5K0FA 3L8DA 4RTRA 3B7PA 2FYTA 2IIPA 1X19A 1ZGAA 1XDSA 2G71A 5E2AA 2PXAA 4R6WA 3E05A 2KW5A 2PX4A 3HA3A 1X1CA 2OBFA 2P3LA 3DXZA 4L7VA 4ER6A 5BXYA 1UIRA 4Y2HA 1X1DA 5KYGA 3G2MA 1ORIA 2GLUA 3LCUA 3O7WA 2PXXA 4DCMA 3KR2A 4DA4A 4XUEA 3EVBA 3U81A 4Y30A 3G2OA 2FRXA 1NW7A 5T6BA 3C0KA 3HEMA 4GOND 3EEYA 1JTEA 1WS6A 3MCTA 4GC9A 3F4KA 4P7GA 5E1BA 1RJEA 5KVAA 1FJXA 4C05A 3TKAA 3MHTA 2ORED 1SQGA 5FWAA 4DZRA 4OQEA 2EJTA 4XUCA 3NMUF 2PBFA 2H11A 2PX2A 3PVCA 4EQZA 2NXNA 1AQJA 2VP3A 1Y8CA 1NV9A 1ZKDA 2B3TA 4PGGA 3RIEA 3JWGA 2G70A 2ZIFA 3EGIA 5D1NA 3ELUA 4HSGA 3C6KA 4EK9A 5E1MA 4P7FA 4RTSA 2V7EA 2YXEA 2PXCA 2R6ZA 3HCFA 5EMLA 1WY7A 3RW9A 3PFHA 4X61A 3OFJA 4X1OA 3KQYA 2B78A 3EGVA 3M6XA 3P9IA 4GQBA 1KR5A 2BM9A 5IKMA 2PJDA 3KQWA 2B25A 5FQNA 5GIOE 2UYCA 4OBWA 4KIFA 2HNKA 2I7CA 2NXJA 3P2KA 1QAOA 1BC5A 2EJUA 3CKKA 4FSXA 5GP1A 3TPZA 5C9ZA 4BLUA 4RTQA 3EVDA 3HCAA 4RTJA 3KPWA 4PYKA 3DULA 3TOSA 2ZZMA 3FYDA 5F2NA 2AOUA 2PT6A 4MTLA 3FYCA 4BLWA 2Z6AA 1UWVA 5EMKA 5DTQA 1RI5A 1L3BA 2AZTA 3G5TA 2ZWVA 4WVLA 3CJQA 1RI3A 3DP7A 4KDRA 1KHHA 4OA8A 4P7KA 3ER8A 3BWYA 2BR4A 4HC4A 1YUBA 4HH4A 4OX9Y 1RI2A 4KWCA 2CKDA 4ER7A 3HVJA 3M70A 3KPUA 5HIMA 1T43A 3S68A 1P39A 2B9EA 4CWAA 2FPOA 2BR3A 4GOMD 5DTMA 1G6Q1 1Q0TA 2XBMA 5HOQA 4QPPA 2QE6A 5CVUA 4PYMA 4AZTA 2QRVA 2NNWB 1EQAA 4PINA 3TM5A 2PVCA 4R6XA 3JWHA 5HILA 3MGGA 3SR4A 4PCAA 1EJ0A 3TMAA 3V97A 5HIKA 2JH8A 4F86A 3DOUA 5FCDA 4FZVA 2AOWA 2O06A 2P7HA 2G72A 2ZVJA 3ELWA 1EIZA 4XCXA 1TW3A 3UJBA 1SUSA 2ZW9A 1O9HA 1VP3A 2JG3A 1G8AA 3BT7A 3NDIA 3FUWA 3BZBA 4PYLA 1R6AA 3BUSA 3FUXA 3Q87B 2YR0A 3PS9A 1N7JA 1NBHA 4ER3A 3LKDA 3TKYA 5EZSA 4AX8A 1EAMA 4UOEA 3I5UA 4RV9A 3UFBA 1XCJA 4LECA 5DTRA 2GH1A 3JWJA 2OKCA 3LBFA 4PWYA 1SVUA 5EKUA 1NW3A 1NT2A 1XTPA 3G89A 2XYVA 3FUUA 5C1IA 3TQSA 2JHPA 2K4MA 4RTKA 3ANXA 4ER5A 2JH9A 5E1OA 1B42A 3T7RA 4FGZA 3T7TA 1NV8A 5LQRA 3KHKA 1N2XA 1NBIA 1FPQA 3QV2A 5K0GA 2HWKA 3P9CA 1AF7A 2QYOA 2IPXA 4DKJA 4IV0A 3GRUA 3NDJA 3AXSA 2XYQA 4RSRA 3AWIA 5JR3A 1YFJA 1EJ6A 3DMGA 4HRAA 1TPYA 3KR0A 4PYJA 1QYRA 5FHRA 3G2PA 3HP7A 1VE3A 2YVLA 3B3JA 3K0BA 4PYOA 3MB5A 4PIMA 4EKIA 5LR6A 2GAFA 5KQRA 3KKZA 5DLYA 5DM2A 4U7PB 3CCFA 3LECA 3R0QA 2AOTB 4GBED 4OA5A 5F2KA 4RTLA 3EMBA 4RTNA 4POOA 4YUZA 5EPEA 4YV0A 5LQKA 4V0RA 4A6EA 4LWPA 4CXMA 2IDJA 4CTJA 2NP6A 3UBTA 3OPNA 3KQMA 5ICGA 3FTEA 1HMYA 3HVIA 1DL5A 5CVEA 3A7EA 2Z6QA 4RVGA 10MHA 2NP7A 1QAQA 3VC1A 3FRIA 4PYQA 1JQEA 4M36A 5K0JA 5BW4A 5K0EA 2ZBPA 5P8WA 3IYLW 3BWBA 4RWZA 2PLWA 2PSSA 3PX3A 2HV9A 3KQTA 5ICFA 3NTVA 4QDJA 1D2CA 3GIWA 1M6EX 3RODA 3JWIA 4G56A 2H00A 3HCCA 5EQJB 1VPTA 4ER0A 1INLA 1JG2A 5EIFA 3LDGA 3UJ6A 1I9GA 1X1AA 5FA5A 1BOOA 4A6DA 3PFGA 4E30A 5FA8A 4E70A 4F84A 5JUWA 2PX5A 4E2WA 4MIKA 3EVAA 4RX1A 1JSXA 4MHTA 3HCEA 4C03A 3R6TA 1G55A 5CM2Z 5H02A 5HIJA 2UYHA 2ESRA 3A4TA 5EVJA 5HEKA 2OB2A 3UJ9A 4FT4A 4RVHA 3UJ7A 4QVKA 3NJRA 1XJ5A 3TRKA 4MWZA 3KQPA 3OE4A 3THRA 3C6MA 4DF3A 2C7PA 1SKMA 2PWPA 5DRYA 4HG2A 4M38A 3DXYA 5ERGB 1YB2A 3Q7EA 2YUIA 3EVGA 1MHTA 3UA4A 5FWDA 5HFJA 5HZMA 1JG3A 1RJFA 3LDFA 1WG8A 1RJDA 4X60A 3ELDA 5T67A 2CMHA 2JHAA 3HCBA 2WK1A 3KPYA 5DSXA 2UYQA 3ER9A 3R24A 2ZBQA 4FS8A 2BH2A 3C3PA 5DM4A 1NW5A 1EG2A 3FTDA 3WSTA 5BP7A 2FCAA 3E8SA 3HA5A 2NYUA 2O57A 4DQ0A 1NE2A 1KXZA
chains in the Genus database with same CATH superfamily
1VSVA 3ILHA 3KJXA 3QFRA 3ZUGA 4MQ5A 5AKLA 3SQOA 4EY6A 5T3YA 4N4AA 1JAHA 1WO8A 5I48A 2AL7A 4NEGA 3Q98A 3BQMB 4N7MA 3P2YA 4BKOA 1CY8A 2X58A 4DANA 2ZDQA 4ND8B 4H1WA 3HXOA 4YDQA 3LWZA 4GMKA 2I4MA 3C8ZA 1EE9A 2PSEA 1I4WA 5JS1A 3DWIA 4D4LA 5LVAA 1FNDA 5ALZA 2FZ5A 3B13B 3NH9A 1PS8A 2VUSA 3AC0A 3K3PA 3K9QO 4QJ5A 1DBVO 2X76A 2ZR9A 1OFGA 3LPMA 1QQTA 3NTRA 4RENA 4YUWA 2D7DA 4MYCA 3AEKB 3E22B 2Q9BA 4UUPA 3TLJA 3ZTYA 3N8HA 4CZ2A 5IEJA 2AT1A 1FUYB 3FUTA 1XCBA 3FPLA 1SM4A 4WZ6A 2P5TB 1G5RA 4CV2A 1JEYA 4MO9A 1HQKA 4F1KA 3OQIA 3QPVA 4KI7A 1OBOA 3ZNPA 4C7JA 1KDVA 2B8TA 3PNOA 4DVGA 5HQ3A 3FJYA 4LDJA 3R3WA 3ZHZA 2QVBA 1AS0A 1G4AE 4XI9A 4AJJA 1UZUA 4WDRA 1DDIA 3C1UA 1AUPA 1MA3A 1J9ZA 2JJ2A 3M4YA 4CKWA 4ZYXA 4G5QA 2B6NA 1J7KA 2O8CA 2CUZA 3SJCA 2BCJQ 4EX7A 3OCWA 4M1TA 3JTEA 5KKAA 2PXHA 3VRHA 1YVUA 2EEPA 2FETA 1RXWA 1MEOA 1Z3CA 2QU8A 3I62A 4IUCS 3ZD7A 1E0SA 1YU9A 3Q3CA 5COAA 1CV2A 1ML4A 2ACVA 3BIXA 4QJBA 1G20B 1NJSA 3LC7O 2FX3A 4FX2A 3NWJA 4GP7A 1XZDA 1D4ZA 2QMEA 1VL5A 4AAYA 3D2LA 2LV8A 1ZJWA 2FPPA 2PQMA 3BOSA 4IOKA 4FQ7A 1TNDA 3FPEA 5JMPA 2GZ2A 4QXOA 3ZE9A 3LSTA 3RC3A 5SICE 1Z47A 2YXLA 3P94A 3DO5A 3K35A 4OJYA 3ESAA 4M86A 4I6JA 1O7JA 4MRMA 5IJ0B 3B1JA 3BBPA 2X1HA 4JL8A 1T2DA 1UK6A 1P4SA 4LE0A 3VNAA 3LW7A 1B7GO 3TZ6A 4LIPD 5FUQA 3G79A 1UDCA 4KWTA 4WNCA 1SD2A 4FFBA 4KE7A 2HDHA 5JFOA 4PWZA 5KYXA 1JYFA 2HUPA 3IO5A 4A6EA 2WUVA 1ECLA 4OLBA 1LSUA 2HTEA 3DVRX 1GTJ1 4FFBB 4FOOA 4TUYB 1DRUA 2IYYA 2X5NA 3RGWS 1NUSA 4NABA 1U3DA 2OKGA 1DG9A 2WSMA 2EW8A 4EHIA 4F8EA 3DTVD 3AF4A 3GLHA 4AZ0B 1GG8A 2QTVA 1RRGA 1U7TA 1ODTC 3VKHA 3DM5A 2FEPA 4B6QA 1PE0A 3O1IC 3Q4GA 2CLIB 3PIRA 5LQCA 4JXZA 3NIFB 3B1WA 5CEFA 1DDOA 1NFQA 1T6NA 5KSPA 3P4UA 1L5SA 4IRXA 2WIJA 5KC9A 1E3QA 3KNZA 1C7EA 1XZIA 2XWPA 3V1MA 4AY5A 3QXXA 4DHEA 2G08A 3QX9A 1P74A 3IBCA 1SBYA 3KKQA 1EFLA 3KR1A 3KSUA 3U7RA 5DM60 1UKBA 2P4EA 1XNQB 5CFOA 1Y4AE 3UO8B 5A5GA 1Q91A 1PFQA 4HGNA 1W85B 5KJ1A 1KFBB 2HM7A 1P1RA 1YZLA 4OUDB 2JJ8A 2Q6OA 3D1LA 4YCDA 2FLWA 4AF6A 3WK6A 4EHNA 2DR2A 3ZLVA 3PHCA 5AVSA 3U7EB 5HE8A 4NBVA 4PM4A 4AS2A 2UYYA 2ZE5A 2AVDA 1JTVA 1N4DA 3IDOA 1KK3A 5FTLA 4A6XA 3PKJA 1Y3BE 3PX2A 5K3SA 4DLUA 3KQOA 1K3FA 2R8PA 3DP9A 4XIJA 5LKAA 4X97A 3QEJA 2RHLA 4MP8A 2OXTA 1H22A 1G5TA 2C7RA 4MLZA 1Z6GA 2H2AA 1FUIA 3ROQA 3VUEA 3CG0A 1HORA 5D3ZA 3AUKA 3MJTA 2HHLA 4K9DA 1MKYA 4AVYA 3HU1A 2H1CA 3K09C 1DBSA 3H16A 4K9NA 5EIWA 4X62B 3GHYA 5I8PA 3SYRA 4B4DA 5MHTA 3TLYA 2D7JA 3EFOB 2AJ8A 2IXTA 5IASA 2IHTA 2IZZA 5FPPA 5ENDA 1ZVVA 4DLAA 2DCMA 3DKVA 3JZAA 4LWOA 3A3PA 4WZAE 4Y6QA 2J9FA 4QOEA 3R4CA 3KSAC 3Q72A 2Q46A 1VJTA 1DE0A 4YO7A 3UNXA 4PLPA 3ZHYA 4EENA 2ODBA 1J2YA 3I5MA 1I80A 1XA0A 1J39A 2VYVD 2JJMA 5EWMA 4ZI7B 1YC5A 4YRBA 4QGHA 5KQPA 1WZCA 3FNEA 3BWEA 3C7CB 3OZSA 4PCVA 3EUAA 5BSMA 1L5LA 3RTAA 2A78A 4O1MA 1G5IA 1XLUA 1QHSA 3QWFA 2VNAA 3VPCA 3O4JA 2QROA 4OG2A 4Z8YA 3ZU4A 4LNUA 4IIVA 2J5XA 1GGKA 4PE5B 1G8MA 5CNMA 5A0TA 1DC3A 4LG1A 4Q19A 1H1LA 4AJ2A 5KCZA 4OEHA 3ZS9A 2EZTA 4C20A 1Y37A 3JQ8A 4OYLA 5BN5B 3GD7A 4JQOA 2NAFA 3JASB 3MJCA 2GXUA 4M76B 3QE4A 4GICA 2QY6A 3KU1A 3PFWO 1E8NA 4QNRA 1NPDA 1JBKA 2EIXA 4J9UE 3SLGA 4BMCA 3G02A 1RPZA 1D7AA 1O87A 1U8EA 2B4AA 3LOPA 1DP4A 2LCIA 4FGKA 1JFFA 2OWEA 4LJLA 3WYGA 1P5FA 2ZBUA 1BEEA 3PJDA 1CR4A 2VBFA 2IQIA 4N8SA 4WK2B 1UWLA 2JIRA 3DWFA 5G41A 5LZ4A 3WAJA 3Q8LA 3UJCA 2ENUA 1JJFA 1Y6ZA 3X3HA 2PNFA 1C3EA 1EU1A 2DF8A 1WW8A 3U5TA 4RZSA 3PPXA 1SCJA 3VJRA 1IY9A 4OQDA 1Z7BA 1MB2A 2GVZC 3BHIA 4HNQA 5FOVA 3V1TC 1SZJG 1QHHA 5BURA 2FKNA 5KYNA 1L7NA 1X2BA 1JMYA 4UTXA 4XYMA 2C98A 4UHJA 4DAEA 1XTRA 1B8VA 3WHLA 4DQLA 4E4YA 4AJKA 3KDAA 4HAIA 4DSTA 1ZMRA 1CF4A 2VUTA 2R1VB 1PZNA 3SHTA 4GZMA 3ZGZA 3I4FA 1WVIA 3FMFA 1IHYA 4H31A 2AJBA 1R8XA 3OT1B 3PYLA 3T9CA 4EUSA 3UEOA 1O77A 1V3UA 1XAIA 3P9NA 5EEGA 4Q5IA 4TTQA 1AKWA 4YV7A 3TAXA 4EG8A 1AA9A 4YASA 1KAEA 2H1FA 2CK3A 3CX6A 2H4YA 3ED1A 4J4BA 4BKUA 4ZI2A 5JV5A 1O8CA 3GY0A 2XNDA 4ZAYA 2FK8A 4YXWA 3VO8A 4DT1B 3JAWA 4UAGA 4EW6A 2DR0A 4NVRA 2RI6A 5EWMB 1VLMA 2D1FA 4GC5A 5TARA 3JD3A 4TTRA 3K09A 1E9SA 4AULA 3HKBA 3MT7A 1PWXA 2JARA 3N2IA 1JAYA 2KYRA 1E63A 3K72B 4JLWA 2P6RA 2PY6A 2HREA 3GMIA 4E88A 3IE1A 2FDCA 4GM0A 2X9QA 4U7GA 3U19A 1NQ5A 4H4EA 5A2GA 4YCSA 1SCUA 1DKNA 1WEKA 1ECPA 5HZKA 2IHKA 4B5LA 2ZJ2A 4MRAA 3DL7A 4LA4A 2VC2B 3ER6A 1X9IA 1SZCA 4YHBA 5CFPA 1RJ9A 2GX6A 4KPGA 4HD8A 2QZZA 5TPWA 1DBRA 3CZCA 1YU6A 1Z0IA 4BO9A 3IQGX 4YRMA 5KNDH 3NBQA 4DMKA 1FOEB 4KEAA 5EZ5A 3EB9A 4H3SA 2Q4DA 1PFYA 2OCAA 3DWGA 4O2LA 4CFYA 3ZWDA 2JGKA 4M88A 1ORIA 3DOOA 3V00A 4C6RA 2EV9A 3O7WA 2PXXA 2BGGA 1X7GA 1E1CA 2A9JA 2C5BA 4OHUA 4QO8A 4Y9RA 1BXZA 3Q5GA 4XSHA 3RRZA 4ARUA 4DLXA 1ZM9A 1W85A 3MCTA 2JHFA 3ZY5A 1Q6YA 3P7MA 2NG1A 3IT1A 1NKTA 2DH5A 3AB3A 1WEHA 4UARA 3MHTA 1EWYA 3P0HA 3QYAA 3K4QA 1RE1A 1SQGA 2CXOA 5FWAA 3PC6A 5LP6A 5C7OO 1KOFA 5IDYA 5FDFA 1AV7A 4Y2XA 1U1EA 2QJRA 1I4LD 2D0PB 3AUAA 2MSLA 2QLLA 1XK7A 3A28A 2B7LA 1TCVA 2P2ZA 1RWKA 4DR5B 3H3JA 2H5EA 1OILA 3JQ9A 3OZVA 4DCNA 3OT5A 4HSGA 1CIPA 1GZ3A 1G63A 3A1DA 3UAGA 5KSWB 5DYWA 3HCFA 4RIFA 1Y3DE 1SU4A 2RH9B 2FI1A 3ZGYA 1Z28A 1UKAA 3ISTA 2P2YA 3HCWA 3OFJA 4Y1EA 3TNDA 2WHRA 4D2IA 5DGXA 3Q3VA 3VU9A 4LFCB 2BRUA 1EA5A 1TFRA 2BM9A 3BVPA 3REQA 2QYSA 2W22A 4EW1A 2A5FA 4FYYA 4UHBA 4ARBA 1XN4A 1X2EA 2NO5A 3TPZA 4E08A 1OH5A 3ED5A 3HP4A 4JX9A 5ESRA 2H2DA 4ESHA 3ACBA 1X15A 5AM3A 1PEKE 3AK4A 3UHJA 2Q1XA 1TM3E 3M6FA 4EYOA 5AI8A 1RRFA 1VLVA 4PX9A 2VDOB 3ANNA 3FOBA 3PDCA 4LQDA 2CNNA 2P9TA 4PX3A 4A23A 5JW6A 2V4UA 4LHXA 3THXB 4D9NA 4PR0A 2R8BA 3L3BA 3GR6A 3SJUA 1JHAA 4KWHA 3SZMA 4P7KA 3W5VA 3UGJA 2CXQA 2GOYA 2AQ8A 2EWWA 4L3VA 4GVXA 2NTYC 1O0SA 1UMDA 3GUHA 1ZH2A 2HCBA 1YJBA 1IBKB 1FDIA 1E7RA 3CN7A 4KGVA 4GEGA 4IOJA 1A98A 1PL7A 3GN1A 3AUYA 2QE6A 4JODA 1W2WB 3TM5A 3AFGA 4HDCA 5TX7A 3DHEA 2Q1SA 5TT1A 5JAHA 3V97A 2YQ5A 2PGOA 4F86A 3DOUA 1AQLA 2C3YA 1M2GA 3CW9A 4YWHA 1RHJA 1ZLYA 1EINA 4WNIA 2D06A 4ENWA 1FRQA 3GUZA 3T4XA 5FOQA 3OP4A 4B35A 1R6AA 3NOVA 2R6R1 1P4AA 4XOIA 2ZUUA 3OLYA 5CLIA 4ER3A 2CL6X 3A6JA 4Q02A 3SKXA 3PEEA 1LX6A 2WV7A 3OOWA 3GBVA 2OMKA 4C6HA 2Z2IA 4RV9A 4RSHA 1XCJA 3A6EA 5CW1A 4UNQA 3UFBA 4XWOA 1SUCA 3U44B 2YWHA 3H2KA 4IFEA 2R47A 1WXIA 3HKDA 1XTPA 3FDIA 1CUSA 2O8BB 2ZTLA 4TWRA 5EYPA 2EBUA 2K4MA 1UJ5A 2Z2JA 4L8YA 4ER5A 4QRDA 2KB0A 2BPOA 2ZI7A 5CHYA 3OBIA 2RH4A 3BE5A 5LN1A 3KHKA 3RJMA 1FPQA 4UPVA 3SIWA 3U7FB 1QHFA 1AS2A 3C5EA 5JDCC 2HLDA 1RXYA 4MVJF 2HJ9A 5E38A 1VCMA 1Z6ZA 1II8B 1MFZA 2BKLA 3MUFA 3NDJA 4NV1A 3W2FA 1TX4B 3N8KA 4EEZA 2A9OA 1L8QA 1M5TA 1Z37A 1V47A 3VISA 1EUCA 4FR5A 1Z5UA 2OT3B 4M22A 2PBRA 2ZYWX 2BN4A 4UFNA 2NN3C 4AIRA 3PZBA 3A1UA 4FMBB 3I52A 4MUHA 2J30A 2ZRGA 4Q9AA 4W63A 4QL3A 2PRSA 3AOGA 3IKTA 2FWMX 1C0LA 1VKHA 2WF6A 3GP3A 1A7AA 3I9NA 3OX1A 1GM5A 2NTVA 3DDUA 3QEOA 4FJ2A 5AVOA 5JECA 1Z68A 4Y2GA 4I5GA 4KWIA 3WL3A 2GXQA 4YNBA 2XRZA 2ZBPA 4YH1A 5P8WA 3FGNA 4D8VA 3LG2A 4EQ6A 1N92A 3M5PA 2PSSA 2VOEA 3UG6A 1MVOA 4DLYA 4TN5A 3TLGB 1N2SA 1K92A 1RC8A 2AG1A 1RJ9B 1JG2A 2XUGA 1KAMA 2ZYTX 2EKZA 2QQGA 3OCVA 4MNTA 4C0SA 5AXBA 3CO0S 3B5JA 3LA8A 5FA8A 4CKYA 3IJPA 1NVWQ 3PQ6A 5FUXA 5T7BA 1IOZA 3R6TA 1IB0A 3KX2A 5EVJA 4KO2S 1HNWB 1KDYA 3IHKA 2HHHB 1F14A 2FOLA 2HHCA 3HYSA 3N2ZB 3QYJA 4B9EA 2GWRA 5B3LA 1EWQA 4OGFA 1TKCA 4IJWA 1R6UA 1BYIA 1U1DA 2XADA 3PVZA 2GD1O 3PNPA 3LQFA 3TBKA 3CZ4A 1UJ2A 3SX4A 3UT6A 6REQB 4RKFA 2JGFA 2VPYA 4ARZA 3IUQA 4ZK6A 1LRLA 4ZT5A 3I9LA 3G13A 3U13A 3ASUA 1YSCA 1PL6A 4ZN6A 3PD1A 4DSUA 4FDAA 4BKMA 1EX6A 5K8LA 2JI8A 4RK4A 4TLDA 2OFOA 4PHGA 6REQA 3NHSA 1TVKA 2FWBA 3IEXA 1JG3A 2VYCA 2GCPA 1QH1B 2NSJA 3GHHA 3PQEA 4MB6A 4M53A 1HSZA 1RQ2A 3KLPX 4PSCA 4UASA 4X60A 3ZGNA 3H4MA 3C24A 2PUBA 1ZO8A 1S8OA 1AGYA 3I8XA 4MQFA 4W1QA 1YZFA 5CT8A 3PNYA 1N9ZA 4Y7DA 5DM4A 3WYAA 2RD2A 2J9ZB 5IXJA 3FWPA 2FCAA 3U3MA 4ITRC 1QJ4A 1QF9A 3CNLA 4U2GA 1E99A 2GM5A 3P26A 2G0NA 5HTKA 3AKDA 2ZJ8A 1TAGA 1TZBA 3MWKA 1F06A 1WXFA 3RS4A 2ERYA 4DUYB 5LL6P 4HQLA 3PL5A 2V58A 5BNWA 4NSNA 3TO5A 2IF2A 4LZOA 2GZRA 1OI7A 1V4NA 3FSEA 3I01A 1OA0A 5GJCA 1W19A 4AO8A 4C7OB 1QP8A 3BA6A 3P5SA 5TDHA 2DECA 3ISJA 2UUAB 2NADA 3BWVA 1SBHA 1IH8A 4B3XA 5KNDA 1Z4IA 4FEGA 4H6VA 4W8GA 2LDBA 1GGNA 1O03A 3AFIA 3CWQA 2WU4A 3VKGA 1RP7A 3MINB 3P0RA 2X5KO 3DDSA 1HGXA 4KQMA 1F4VA 1PDVA 2NU7A 3W3ZB 5JAIA 2HLDD 4QFDA 3KOXA 1NQWA 3ZV3A 2WRZA 3OSUA 2W48A 4URHA 3V8PA 2AR9A 3T7IA 2XCRB 4A9AA 5E9QA 3HB1A 4ZVKA 4OF4A 4LRUA 3AEUB 3K6SA 4MVJM 1R3DA 1PZXA 3RFFA 3TBFA 5HVNA 4QE3A 2BFEA 1KHTA 5FBLB 3KTAA 3AX6A 4RABA 5LQNA 3VNBA 3QFFA 1Z8NA 1NQTA 1RXIA 1PNQA 1XEXA 2QTLA 3HKEB 3P5BA 3QV1A 2HK9A 1FCJA 4JAVC 4JJFA 4ZAGA 2BFEB 1WPGA 5I6DA 5JQGA 2AF3C 2OXFA 4MARA 2PKRA 2Q21A 4GXRA 1G4UR 1QIKA 4TLCA 3F9CA 4KI0A 4A5SA 3SY8A 1IM5A 2PLNA 4PAWA 1M5UA 2G1AA 1G8HA 4OB7A 4MP6A 4ARSA 5LIPA 4P22A 1ZISA 3BF7A 3S8EA 3BHMA 3IQHX 1TW2A 4V0MA 1KC1A 5FPSA 1QHXA 2NAPA 2YXBA 4D79A 4LBWA 1YJAA 4RANA 1FU8A 1FE8A 4G8JA 1NKSA 1LVUA 2FSPA 3PB3A 5GGXA 5HIIA 5A7GA 2VXBA 3EQ7A 3NNSA 1TYZA 5J4KA 3U09A 3UPUA 5FADA 3SSNA 1UC4B 1BD4A 2XMDA 4G3XA 1PJ3A 4BN0A 4E21A 4GXTA 1BE0A 8GPBA 2W6IA 3BN3A 4BO0A 1YF3A 3DCJA 4DEXA 1LJ8A 4LBZA 3IP6A 1QAMA 1SXJC 3PF9A 1VJCA 3T5PA 3ZU6A 1NVGA 5ALNA 2GN4A 1RJWA 1PW7A 2VDKB 3IOEA 3DXFA 3CUVA 4WLNA 5F78A 5C52B 1AKEA 5HF8A 3ZGLA 3MMXA 4J7UA 3K1JA 1XPJA 1TM1E 3C41J 4GU5A 1DUVG 4MVJP 1GGHA 3AL2A 3UAZA 3MOGA 1I5RA 1XQXA 3L6UA 5J23A 5HKAA 4C7KA 4DBLE 1SIBE 4YBRA 2GHIA 5AOVA 4IBOA 1R0KA 1P2GA 2ZIAA 2WA1A 5H70A 1GFIA 1LPNA 3P0IA 4ZDWA 1HEIA 5J2TA 5F7OA 2DG2A 2W6JD 1MIOB 3W8NA 1C5KA 2CHQA 1CUAA 2JRCA 2OHOA 1JIUA 1DXQA 1HZJA 2YYYA 3NTOA 3D8NA 1GU7A 3IPRA 3ZWBA 3EPPA 4WSOA 3ST7A 2PL5A 3HYNA 3RRBA 1CCWA 2IYSA 4Z2AA 3G88A 4MCHA 1LLQA 4ZZIA 1YCDA 5SZHB 5ES4B 3I4CA 1VMIA 2GO1A 3B1FA 4LRSB 5COQA 3T7CA 2A14A 3DVQX 1I2MA 1Z6YA 4Z51A 1DTWB 3F49S 3QFCA 3UJ8A 2OVBA 1LBIA 3FGPA 2JFBA 2QL7A 4P58A 1QF7A 1B76A 3ORYA 1EUDA 3ONDA 3BDVA 3PLNA 7REQA 4CF7A 2BM8A 1TF2A 3R4VA 4GQAA 2YS6A 4KKXB 5IAEA 1F51E 2GJSA 4H60A 2BEJA 3DQZA 2VOJA 3DLTA 4ENQA 1NONA 1U81A 3PPWA 2W43A 4G89A 2XSZD 2Q2QA 1J7JA 2RKBA 1KZHA 1ZN9A 2FSUA 3H6HA 4I55F 4C4AA 1JB9A 1ZQ9A 3WL6A 4WD3A 3ZLBA 3DO6A 2XKJE 7GPBA 4EFLA 3D6VA 3PJRA 4D8UA 3IAFA 2HPHA 3DJYA 1YI1A 1EEHA 3DM9B 3I0NA 3WIVA 3GLFE 3AFHA 3GX1A 4WHMA 3EHEA 4MR9B 4O4LA 5FORA 5EHZA 2HF8A 4EQ6B 5JH7F 3GP5A 3U9TA 4Z4IA 2P9YA 4C4RA 1Z7YA 4R81A 2JD0A 1HYEA 3MGBA 1X7HA 1DCKA 2YHAA 3DG9A 1AKTA 3BMCB 1AY0A 4OXRA 3WWYA 4D82A 2W2XA 3DMRA 3RRFA 3EDCA 2H4HA 4D4GA 3M1YA 1ZNYA 3RK0A 3TOVA 1CRQA 2BT4A 4HB4A 4YDHB 3LHDA 4IDQA 3RSCA 5PNTA 1J90A 3AJ9A 4YB8A 4DY4A 3BWMA 2V45A 4MUKA 1PN3A 1X70A 4HYEA 4JT8A 4Z53A 4U1RA 3IQXA 2Y1FA 2DYKA 3GT4A 3EPRA 4ZQBA 2VAXA 3IEIA 3AG5A 2F4VB 4ZV9A 4EW2A 4C2UA 1U28A 5K05A 3QEBZ 3IBFA 5F1YA 4RKEA 1N32B 1SY7A 2WM9B 5KNCA 4CUJA 1T35A 1P2VA 1QGDA 3F46A 1Z2DA 3H7AA 3P4YA 3ZXXA 5A1TA 3Q11A 3LF2A 3TR6A 5NLLA 4O2AF 1HE4A 5LDGA 1DC6A 1HDCA 3AUXA 4M8IA 3L77A 4WXMA 1X92A 2VF8A 5CCEA 1E1LA 5FTNA 5JPCA 3R7FA 4BZZA 4P3OA 2CSXA 1Z29A 3FHOA 4E5MA 3LDUA 2ZI5A 2J5BA 3NS7A 3WO1A 1OXBB 2JLWA 1ACLA 2BFPA 5D3KA 4ASUA 1N6NA 4MKFA 3MJHA 3QYFA 4QYXA 3ESRA 1VMDA 4Q1AA 1DCTA 4H15A 3V4LA 1VE5A 2OGWA 2ZT8A 5JZBA 4CEJA 2RGGA 2WDZA 3AXTA 3HP1A 3KG2A 4HLNA 2PSFA 1V1JA 2PBLA 2CVPA 2CXNA 4MZXA 3WGGA 1XHFA 4FVTA 2ZJ3A 4G1VA 2FP3A 1SVOA 3PIDA 3ICOA 3T34A 4H7IA 4L51A 3VZRA 1PV4A 2F90A 3N3AC 3F98A 4B74A 4NNPA 1NW8A 4IIBA 4A8PA 1K5GA 2HLPA 4ITUA 1RQXA 3FZGA 3R7WA 1OX4B 3C7KA 5F64A 4R0MA 5KPJA 1SCNE 1ZSVA 3N28A 5DYNA 5AMXA 2PGAA 4OXKA 4RHXA 1VE9A 1WCIB 4NPAA 2AUNA 2YJGA 5IBRA 2V4MA 4NOKA 3ODGA 3WWPA 4A91A 2WZQA 4XEUA 4BMDA 4CMIA 1CS4C 1SCUB 1D1PA 1N2IA 2JIMA 3U4MA 5F4BA 1Q5PA 5DBGA 3RI3A 3G1WA 3T5DA 4EFMA 1JDNA 3O8RA 3DEHA 2IHJA 2XTMA 4UZSA 2Y1DA 1O95C 2VDLB 3L5KA 4LHYA 3MUNA 1EXMA 5DLPA 4L9RA 2Y27A 1XTKA 3DMNA 4GP6A 3MUEA 3KS9A 2WVJA 2PXAA 1WVGA 4O4IA 2WM8A 3E05A 3HA3A 3LXMA 3P2JA 4KGZA 4WJZA 4EB6A 5JNUA 4AICA 2HRRA 2OFXA 4JJGA 2V9PA 5ANRB 3HJUA 4B45A 2XT9A 1JHYA 1SRRA 1UIRA 4S1VA 4ZVSA 3GJ3A 4E5DA 4LKOA 4UBLA 2VPIA 1AO0A 1K6JA 4JBXA 4HAWA 3QF7A 4RPCA 3QKTA 2WJVA 1UFVA 5LOVB 4IRMA 5AM2A 4JVMA 1ZCJA 1C1DA 2YVAA 1F2UA 5AJUA 1N9KA 1AX9A 1W94A 2Z57A 2BP7B 3BRSA 3MFYA 1OTYA 1D0VA 1YQUA 3OIGA 4IZ6A 4BNKA 2ECKA 4XUCA 4DC1A 4YUAA 2PX2A 4ZTUB 1P2FA 4EQZA 1Q21A 3ZY3A 1H2EA 3DT6A 1XWIA 4FYJA 1JGTA 1NV9A 4GZ3A 3KL2A 3T3HA 1DS6A 3E9MA 1WKCA 3RO7A 5CFMA 2G63A 4TWAA 5C32A 4RTSA 3OKPA 1YE3A 2YXEA 4DNOA 4EKYA 3QU9A 4FIZA 2VHJA 1IN5A 2V0GA 4GX5A 1EVJA 1RPTA 1T3TA 4QBGB 4J94A 4PZLA 5H59A 1HT2E 1TB4A 4Q3OA 5FPHA 1JFSA 1ZNXA 3MZ0A 4PAQA 4YT4A 4RXTA 1JU4A 1RS0A 3NIDB 4L5AA 4L1KA 1RBMA 4KZPA 5TQ0A 3S44A 2R62A 4FSXA 4KQXA 5J2TF 4MKXA 2PAAA 1HE2A 3VR4D 3BEOA 4OGGA 4EITA 5JXWA 1VRWA 4PYKA 3BRWD 4TVBA 3DD1A 3FYDA 3K8QA 1Z5GA 2IYFA 2M2IA 3VQTA 4PBRA 3EAGA 2FLVA 1AUVA 4ZCIA 4BTLA 5CT4A 1XRMA 5T8KC 5FBHA 2H4ZA 5FUYA 4ZYZA 5BMVA 1KHHA 2IYAA 2KJQA 4NBRA 2GM4A 4K1XA 2A94A 3EDOA 2Z9BA 1T3GA 2BSQA 4Q9DA 2J3JA 4O1IA 3N70A 2FN3A 2ZWMA 5DYGA 3ENZA 5JVDF 5JBNA 4YAIA 4I0WB 1QIDA 5HOQA 4NYIQ 1WDLA 1E0DA 4PYMA 4AZTA 4D3FA 3ZVKA 4C0KA 1QP4A 3ZVNA 4EHAA 5I01A 4MS3A 2PMFA 4EB6B 1LRKA 4I55A 2X9VA 4F4UA 4M0LA 4BASA 4W5QA 1V5GA 3DDWA 1VXOA 5E2IA 3VR3A 4I8IA 4I1YA 3CKLA 3G7SA 3ELWA 4FBGA 3W2IA 3FDFA 5AKHA 1LTHR 4KJXA 2HA6A 4EEKA 3IMCA 2JEYA 2WUFA 4XFKA 3LXRA 2OSVA 1RKUA 3MRXA 4LZJA 4BNMA 4XA8A 1E1MA 2X23A 2ZKIA 3WAKA 1FS6A 3D7SA 4JWKA 4MIEA 1KY4A 3BDIA 4IDHA 4S1PA 4L4XA 4LOJA 2H1OA 5FD8A 3SMVA 4DR6B 2ZAGA 1W36B 3BFXA 5LB4A 3VUFA 3S4YA 5TSDA 4F3YA 4KITB 2DPHA 1NVKA 4RTKA 3ANXA 1KGDA 1I5OA 2FX5A 1S2NA 3O82A 121PA 1JDBC 4QDTA 2XUJA 2B61A 1BXRB 2F9FA 4GO1A 1LPSA 3T7TA 1REQB 5FV7A 4JMLA 3T6KA 5K0SA 4GECA 4AWBA 2WSSD 3OPQA 3PPIA 2E55A 4HADA 4DMMA 1SAYA 3QLUC 4UCFA 3BRCA 2D2EA 2G36A 2WIKA 3GFTA 3ENWA 1M72A 4H7HA 1R8QA 4A1OA 4F2HA 1EJ6A 3G0OA 2CHVA 4N7BA 4DXAA 4D8WA 4YAUA 1TVMA 1XDGA 2W2OA 2ZT5A 1TTQB 4JUCA 4URZR 3OZCA 5IVPA 2O3TA 4QOFA 1L8LA 4TQGA 3K9WA 4JNKA 3CCFA 3IKMB 4IVQA 2QAGC 1X74A 3KAQA 2ETVA 3QUQA 4LUCA 4YI3A 4AB1A 2GJAA 2OK8A 1HYHA 3PJEA 1YBFA 3QTTA 2DMRA 2ID8A 4FU0A 3PUKA 1HT0A 4Q39A 2XB2A 1SU8A 1QTRA 2ECOA 4J6EA 4LDQA 4WY5A 3TZLA 3DAPA 3L9WA 5AI0A 4B31A 4ZOBA 5CVEA 1ZESA 1GFZA 2NTNA 5ECDA 5K0JA 2WWWA 3HRIA 4HS9A 4XQ9A 2QTTA 1V48A 4JLKA 1MX1A 3IYLW 4I5EA 1WLYA 1L7EA 1M3SA 1M6HA 2E4VA 2GBFA 2IRWA 4PICA 5GPBA 5KNCH 5ICFA 4U2FA 3GCGA 4OREX 5LZ7A 1OKKA 1CB0A 5AK5A 4ER0A 2O0JA 1VPTA 4EB8A 1DCFA 4BN4A 3LDGA 2JPDA 4OAPA 1EP9A 4F84A 3PQCA 2QA5A 4OFWA 1B43A 1EWVA 4JUIA 1NXXA 4ACAA 3EVAA 1J70A 3IJEB 4KLZA 3GVPA 3I28A 5JHHB 4BLOA 3HHEA 1IZ0A 3JD2A 5JNWA 3FOZA 3UJ9A 4DY6A 1SZPA 4TZ0A 3ZDQA 4R2WA 3OUZA 5LB2A 1YJ8A 3L5OA 4OYYA 2P0YA 3GGSA 2XD9A 1V11B 4ZDJA 3FKQA 3UHAA 2NUPA 5JSHA 2JAHA 1M0SA 4ND3A 2C00A 2CZGA 2H5JA 4ZT4A 1PFKA 1IZYA 3HL0A 1GRVA 2I3BA 5AH0A 1UMCB 1VL0A 5IANA 3HFSA 3UA4A 2IEIA 3DW3X 3ECAA 4WDQA 1HQCA 4KQ2A 5F5LA 5H80A 3AILA 1QIJA 1C41A 1ABBA 5AYVA 2IIQA 3A2LA 5T67A 4CCYA 1R4ZA 1K08A 1P19A 4MV1A 3WA6A 3P45A 1SA0B 3VR3D 1EX9A 3D2AA 1ZXLA 3P9RA 4IOMA 2AKEA 1FNBA 2O2CA 2AJCA 4GR4A 1E2JA 2V9CA 4JYBA 4QXMA 4C21A 4D98A 4YR9A 1WKVA 2C3PA 3RSHA 1H42A 1W5FA 1Q11A 1P6UA 1U7PA 3H5RA 3B6KA 3AR3A 3OZAA 2W6NA 3HNRA 4LNHA 5DN6A 5IAGA 5BOVA 4BVFA 1FX0B 3CLUC 2TS1A 5F3DA 5AW1A 3GJYA 1XTTA 2DQYA 2OM6A 4L5IA 4PAMA 4MJ3A 3TAUA 1FLVA 1SU6A 2CMDA 2YIJA 3T7EA 5HMMA 4AJ4A 1QO0A 3U31A 1T9GR 1V45E 4TTVA 3C8MA 1TUGA 2WNSA 3CVJA 4EVSA 3OQIB 3EOZA 1G41A 1ELOA 4LDRA 1Q1EA 2YHSA 4P54A 2D2XA 3DUFA 4IEEA 1UDXA 1RWWA 3NHLA 4N8EA 2HBQA 2JZNA 1C7RA 2VSNA 5DNEA 721PA 3U4QB 5IKOA 3DZDA 1XD8A 1YL7A 2BMWA 1U3FA 1RJGA 1Y1TA 3ZK9A 1AE1A 3L0CA 2ES4A 3ZWVA 2ETXA 3NBZC 1USWA 1HG0A 5IZCC 2DE0X 1MAAA 3KYBA 2G04A 4G8CA 4KOAA 1V2HE 2O0LA 3H7IA 1ZH0A 2EU8A 4H4CA 1ESEA 1K9VF 4EB0A 3M2PA 1WU7A 1YR1A 5CH8A 5FLEX 1N2BA 3N6RA 4AZWA 2NVOA 3MAGA 2QENA 2ID9A 2X8JB 2WYHA 4UM9D 4UFPA 3D81A 4MB2A 4NU8X 4J75A 5CDUA 4QGFA 5EQFA 5T41A 1YASA 3C6YA 5CA1A 3PICA 1OLUA 1SC1A 4H6PA 2P75A 1I6MA 2VHCA 3DEKA 4A5OA 5K1ZA 5F7ZA 3ROXA 8ADHA 3P2IA 2OO5A 2J0SA 1SMKA 1KA9H 2X7JA 3LT5A 3WX0A 3AR5A 1E66A 1VIMA 3PE4A 3UJNA 3ET4A 4I4TA 1QX3A 1IB6A 4OK6A 2Q6IA 4M0DA 4US0R 3ZUPA 2F43A 1ZR2A 1QVWA 3EF1A 4PS1A 1T3HA 2WLSA 3DMTA 2ZE7A 3OZGA 4FNOA 4EI9A 3CM0A 5BMOA 6AT1A 1FLNA 2A0UA 4TYMA 2IS2A 1U0EA 2IQ5A 2XOEA 3B78A 1JE1A 4D97A 3TVDA 1Z9BA 4C0WA 5MFPA 4WZBA 3FYUA 2NGRA 1YOVA 3O8OA 3VDXA 4DDKA 4EVIA 3U6BA 5HOEA 1SUWA 1VG9B 1YRAA 3G82C 3FE2A 3JARA 3O84A 4M99A 2GMWA 1KSGA 1SBQA 2FVXA 4LEIA 2F1HA 1WV0A 5AVWA 4RF5A 3A4MA 1VXRA 3SXUA 3PXXA 2FZLA 4C14A 2B8WA 3F8WA 5D3MB 1ZMXA 4J49A 4UMFA 4RM3A 2WBLC 3W5AA 2QX6A 4BN5A 4JFAA 4AZSA 4UTRA 3VC3A 1GA4A 4HB0A 2FXVA 4HLCA 4RHYA 4WLOA 4YRDA 4E2ZA 1YBMA 1YA8A 1HTTA 4R2KA 1BE8A 2H1VA 2Y2UA 4C0XA 1P1FA 4E5YA 4OFZA 4O59O 3RYCA 3IILA 4FMDB 3TKLA 5C0OE 4AZ3A 1SCQA 3F6BX 2AI3A 2LP4Y 4HQRA 5GZ3A 3F6YA 2ZRQA 4MRVA 1C7JA 4EUEA 4JV5B 4HLQB 3F6PA 3O75A 3CGGA 3D7RA 5KYYB 3F0TA 2ZETA 1U2RA 3G2QA 3NAGA 1YS2X 5DXAA 3RWOA 4EJSB 3EXFA 3GNLA 4O29A 4Z6KA 4XDHA 1T2FA 1BRTA 1HYBA 5LLSA 3W8DA 5HS6A 3TBHA 2Z83A 4AP5A 3ABOB 3BWDD 4OXXA 3C98A 4PG7A 4R41A 5LSAA 3QOXA 1MJNA 1JS1X 2ADOA 4HGYA 3DE3X 2H1HA 2BONA 3GJSA 1P75A 5ILQA 3W34A 1M7BA 1M75A 2FUNB 5ER9A 3LFHA 1NOJA 3O2QB 4N8DA 1LBSA 3FLBA 4DUZB 2QAGA 4UPDA 2IX3A 1AH2A 1L7XA 4DLZA 3R40A 1WXGA 1PT7A 2SECE 1KQNA 3B82A 4FCCA 4HNAA 2PU5A 4QGGA 4YV2A 5ENZA 5ISMA 1OZHA 3L9XA 4HX2A 3QPUA 5DT2A 1BX0A 2PGNA 2O7QA 2P65A 3EDMA 3ONVA 2VDWA 4HBZA 1LTQA 1YRHA 4YAFA 3BL8A 2IY9A 4Y6GB 1DU4A 4UAUA 3KQQA 1UH5A 1SXJA 3CLRD 1Q2XA 3PHLA 1N1GA 4FYVA 1TJNA 4BUCA 1WMDA 2JIOA 1SVIA 1TRKA 2BH9A 4S3MA 5FLXA 2GEBA 1V5IA 1PTJA 2C5EA 3FWYA 1QFSA 4KDFA 5ALMA 5KQSA 3RUEA 1U7ZA 2IITA 4G5GA 1ISGA 1E2NA 3QXJA 4PYNA 1KS9A 2HBYA 3Q5DA 1Z0DA 3EGCA 4FFPA 3QMWA 5D86A 3M5WA 2AG5A 2PCLA 1B0PA 1KJQA 4RFSB 4RQTA 1BQ4A 3IO3A 3W3AD 1YRWA 3FH0A 2P78A 2ZLBA 3MT9A 1U7UA 2VDQB 5KYUB 5G4LA 3NU1A 2QD2A 2V1XA 1EVKA 3E8XA 3I73A 3PVSA 4TLMB 4FDTA 4I50A 3R8FA 4YX9A 4QTUB 3E9ZA 3WB1A 5U4XA 1UQUA 4XEHA 3WLEA 4BTEA 4TWJA 2O59A 4PZ0A 1TT5B 1CY2A 4YRIA 3ILXA 4YLYA 3IUNA 2OBMA 2GEKA 1FP4A 4LRTB 3L92A 1W88A 3UJ3X 3PR3A 3C5CA 1XX6A 3DE1X 3QY9A 1E96A 3ZCSA 3D3NA 2FF5A 4ENPA 2X1LA 4EUNA 3GARA 5JTTA 4M9ZA 1G8PA 3UHOA 2EG9A 4DHWA 1P77A 2QZJA 3B9PA 3HA2A 3KSZO 4ZVVA 4CLXA 1SG6A 4U2DA 1JXAA 4W5TA 2JZCA 5CDHA 2QTZA 5BSFA 4MS4B 4R0VA 4XGRA 3HJCA 3HWSA 1Q22A 4UEJA 1FL9A 3EZGA 4QU8A 1OXTA 1Q44A 4WQMA 5AKZA 1GDDA 4WGGA 2IGTA 4E12A 4DMGA 3QPCA 4XYLA 4B75A 1HDYA 1RBQA 2PM8A 3M3PA 4YP7A 3KQNA 2CNWD 3EFEA 3WDKA 3JQAA 1J0AA 2V8BA 3Q0EA 4DNPA 3ZK8A 2GK4A 1R15A 1UBMS 1QDLB 3JSAA 3MSXA 4NV0A 3BREA 1KI6A 1G9SA 3DOFA 4PFJA 3H5OA 3JASA 4TTIA 4U63A 1Y6GA 1PJRA 3A3NA 1X3SA 4RSMA 2VNHA 3GIDA 4DMUB 1V8PA 3OT4A 3TGLA 3KFVA 2R7AA 3RVNA 4XVUA 4BQIA 4N7RA 4EGSA 3I53A 3U16A 1O89A 3E8MA 2BGWA 1WZEA 2WD8A 2ZRJA 5CR9A 3T1QA 5EZQA 1AGXA 5BQFA 3ABRB 5CB8A 5IT5A 9MHTA 4ALJA 2IYOA 5F52A 5B64A 4JYAB 1Y6RA 1IEXA 2RHRA 5A0FA 1ZH4A 2HNAA 3AY3A 3RNLA 1C30B 1NWCA 2JLQA 3QUTA 1R9MA 3S1AA 1WNFA 4DC0A 2XCUA 2XMQA 5IAAA 2O3QA 3ETGA 4FSDA 3QEAZ 1NM5A 3MW8A 4YMUA 5A71A 4J3JA 3SGLA 1BKDR 2EEZA 2BP7A 3CNHA 4EY7A 2XUAA 5CH3A 5JZOA 3FTFA 2H2WA 1XZBA 3GEEA 3UGQA 1Q7CA 2IXAA 5ALPA 4AM8A 5CA1F 1ZOIA 4UBMA 4U02A 4LVNA 1ZNQO 4WK4B 5JS2A 3VAYA 3O3OB 5LDDC 4OGWA 3AJ8A 1UBNA 1QGUA 3EZNA 4FKMA 4JT2A 2CWWA 5JI3E 3ZYZA 4YIHA 2FW1A 4QSHA 3LBAA 1ZITA 4QPJC 1E3WA 4ZVUA 3EXIA 5E3JA 3V46A 5CEJA 4IVRA 2ZWOA 3E9EA 3UJHA 3ZBQA 5LBTA 1ACMA 1BGXT 1G21E 2Y4OA 4DTIA 5TMPA 2NQ2C 3ZDRA 3OA0A 2J4CA 5E6RA 4KFCA 2KW5A 4LHSA 1OWMA 2M6SA 2VYQA 3HYCA 3P4XA 4X84A 3IIKA 3IIEA 1MB9A 5BXYA 4DQKA 1IG0A 3LHIA 1TCUA 5CT9A 3NHKA 5KTSA 2G0AA 2CHFA 1CS0A 4G0NA 1E4YA 1TQDA 4F4DA 1K0FA 1NW7A 5JSFA 3T1NA 2Y9MB 2IL1A 1G6KA 1K89A 2C7GA 2ODPA 3FCYA 3C3EA 4NE9A 3BMXA 3ANLA 3TDMA 1G9XA 4WIAA 1DAFA 4BLTA 1ZIDA 2JL1A 3TKAA 4C05A 4RVCA 1ZWKA 1IBSA 4EAQA 1QTIA 4HKTA 4ZI3A 4O2RA 1GSAA 2PBFA 3CEJA 2R84A 4JGIA 1HFKA 3LQQA 1R6BX 4JX8A 1QIIA 2C4VA 2GYYA 1ANKA 1ORVA 1JAXA 3SEQA 1F7UA 1U5BA 4RSGA 4RGQA 3SPXA 3VH4A 5CVCA 4BWFB 1JH8A 1EP2B 3WJ1A 4P7FA 4R51A 1D5WA 3UB4A 2FR0A 1U3TA 1UPCA 1XZNA 2CNLA 4IEFB 4W9NC 3BICA 3B6ZA 3DONA 3WK9A 3I83A 3EGVA 3DOJA 3EW9A 4GX2A 2C4NA 1G7CA 5IULC 1RABA 1PBNA 2ZKLA 2Y0EA 3UOGA 4BNYA 4COOA 2YJ4A 1SR8A 2ACEA 2K87A 1DOAA 3H65A 5H68A 4OBWA 5CTJA 4EYQA 4CQLA 4YCNA 1FSGA 2O2SA 3TYXA 1M8GA 2YV2A 4XJVA 5AXCA 3R3ZA 3T3IA 4I5FA 3SDZA 2I1QA 2QVXX 3JQQA 3NBYC 2P8SA 4D80A 3JATA 3FF4A 1BH2A 3ONFA 3JQFA 3FYCA 2W2VA 1YQEA 2R00A 4OO3A 4UBKA 4WBXC 3CXUA 3FJOA 5J5VA 4IIXA 3BFPA 3HY3A 5TC4A 3QNWA 4O0LA 1J5PA 4LV5B 3DB2A 1D9ZA 1NN3A 1M6WA 2XKAA 1VBNA 2RHCA 3A3YA 3G6KA 4B4WA 1AQYA 4IZIA 1O4VA 1TMOA 1Y9DA 1NMXA 1HOTA 2MWMA 3ORQA 3NZEA 4QRIA 4Y2JA 4E13A 2D54A 1IVNA 2Q5EA 1U1IA 4TL7A 4OQFA 2BHLA 4C30A 4EG5A 1E1CB 3V8QA 1DWQA 1Q1ZA 1BDJA 1I2CA 3RM3A 2IELA 3UK1A 4GOMD 4DYHA 4LPSA 2ZUEA 3M9LA 5GVRA 2IY8A 3LNCA 1AN0A 3MSCA 4H7FA 2MIIA 4RE5A 4BYMA 4R6XA 1W8DA 2CLKB 4HS4A 3SYLA 5JH7B 1PGJA 3FTNA 2DFDA 1KZ6A 1M34E 1HDIA 1S3GA 1Z74A 2FSFA 2XB6A 1L5FA 4RE6A 1Z4JA 2ST1A 3HK2A 1TO1E 3HB5X 3H5TA 1Y1SA 4OPMA 2VP2A 4B47A 1YMQA 4FLMA 4MS4A 1U28C 2BGTA 2G4LA 5THXA 2HGZA 3PS9A 5C1OA 3HZRA 4K9QA 3HB9A 3B2QA 2QX7A 4CM8A 4C7VA 4DLPA 3E9YA 1L5VA 2WFAA 2XECA 3TW8B 3I5UA 2X14A 2C88A 2DAPA 3ZE2B 2G5CA 1XUOA 1L8OA 2CEAA 4LECA 2GH1A 2H2HA 5KHLB 2PZAA 4QUIA 3SYNA 4F6RA 1XEXB 3FUUA 1K88A 3HKEA 1Q20A 2HCJB 4KFRA 4Q66C 3N74A 5KTMA 3ICEA 5LUAA 4KUGA 3HQ4O 4KPUA 1UWCA 5KI6A 4MP3A 1BAPA 3PDHA 5ES3A 3EWSA 1JT9A 2B20A 4K46A 4WCFB 4D56A 1NMYA 1X14A 4JB8A 3WL8A 3DBHB 4UVGA 4FDVA 1OXMA 4ZFNA 2BL4A 4RSRA 4S05A 1XZQA 1C8KA 1P7YA 2WSLA 1BVYF 2H1LA 3V48A 1SOAA 2OD9A 4F5WA 1CUZA 2XE7A 4IHAA 1H5NA 1ZJJA 1ES9A 2KMLA 4RQBA 1AXEA 2QG6A 2W4QA 5DN9A 4CUZA 1NQVA 2RSLA 1VA4A 4U7PB 3CCCA 3CCBA 4IDCA 1GCIA 3KWFA 2ENWA 2AMVA 3QU4A 4ZANA 3KDSE 2HWUA 2AB0A 2BGKA 1JLLB 1DIRA 1OSNA 2P2LA 4H4DA 2NM0A 1J56A 1Y8QB 3AZQA 1OREA 4HX9A 4INOA 5KNBD 1Z2CA 4EEXA 2PG3A 4H7KA 1E64A 3QOYA 4JKOA 1PIWA 3N2KB 3OJLA 4PXSA 4MVXA 4GM1A 1JHDA 4WN9B 2F8TA 1ORWA 1UBKS 2O48X 3GQBA 3MLAA 3PRJA 4DBZA 2O0HA 4C1BA 2O7NA 4ETMA 4NJEA 1N34B 4NCAA 4CLRB 1CP3A 2J3IA 2R8ZA 4F93B 1PR0A 1GARA 3I2JA 3CMMA 1E2QA 3Q3JB 4H08A 1YVEI 2JJ2D 1PT5A 5HRCA 1ZGGA 3TZHA 2XH8A 2FN4A 1QCZA 4EZIA 4EHHA 1ZUHA 4HNRA 5FPTA 3PHGA 1CQPA 1B0AA 2H0QA 2PE5A 3PGLA 3IQWA 2BFBA 3FR8A 3SF8B 1XXHB 4U8GA 1PEDA 2GPSA 2WTMA 4CMGA 4G84A 1NW4A 3MWYW 5D8DA 4CR7A 3A0RB 3NASA 5KX5F 3NIBA 4OHBA 4HVTA 3PF8A 3RJ9A 3A10A 5IW8A 2FWPA 3QELB 1QKKA 3VMFA 4R01A 4GL2A 2VT6A 4J1TC 1MXFA 2Y9PB 5KWIA 5MN5A 2EZ4A 3KKOA 1EFDN 1I0ZA 4UU0A 1QO0D 5EIAA 3T3DA 4UPEA 5F3WB 2H1IA 3PYMA 4FZ5A 2PHZA 5FO1A 2AHOA 3EVGA 4PIVA 3AFMA 1KJIA 3IALA 3MQFA 3RYTC 4X1KA 2ZSIA 5FBKA 1RRMA 1IIRA 5CB6A 2BEUB 1R16A 1GHTA 1VE1A 1JI3A 4GXNA 1EFRA 4PY2A 3F8SA 3AONB 1RJDA 1M2KA 4LX8A 2YXNA 4PZDA 2Z8XA 5H3HA 4R5MA 4GRAA 2I2BA 3VVMA 4IY1A 4YCCA 1NBME 1OGJA 2DBYA 4KIUA 4XD2A 5K3DA 2PZFA 3BQ9A 4G2TA 3QUBA 2JVIA 3E8SA 4QPDA 4YRLA 2GI4A 3EISA 3TXXA 4ZHQF 4V1CB 3ICQB 3KWMA 3NGXA 3ZI4A 3OQMA 3NOQA 3BG5A 1E2EA 1TM5E 3L01A 1RWQA 3UENA 4BLPA 4IIFA 4A16A 2ZRCA 1L5RA 1V8BA 2ZOSA 2FEOA 3DZGA 1YDFA 4DNQA 3GPBA 5BNTA 2FR8C 3NALA 5BQ5A 3Q7PA 3K8OE 3IOCA 1F0KA 1I8TA 1P9OA 5BWMA 1WHSA 2IT1A 4UMVA 3QOFA 4V0LA 1TAHA 2FW9A 3INGA 3QUAA 2FG6C 3T0IA 2WJAA 3HXMA 1XK6A 4A36A 2HMYB 1R4MA 4K28A 4CDMA 2BUCA 2PUJA 2ATVA 1ORHA 4F9TA 3DV0A 1QANA 1P73A 1T2AA 5CA1B 1UXJA 4EJ6A 5H8WA 2GYUA 1KQGA 2V3VA 4L0QA 4I2NA 4R9UC 1DAOA 1CUVA 2J85A 5AKEA 1EE2A 3LLUA 3ZDYB 1VL1A 2AUMA 5DBEX 5J1SB 1I2DA 3R20A 3KCQA 1E0KA 2GF2A 4MIYA 2ZYGA 1U98A 3FIUA 2RHHA 3EN0A 4X8LA 1ZM2A 5DNAA 1UBEA 3G8DA 3ZK7A 3ZPXA 1EESA 2V7UA 1Y7PA 1JIXA 3OE1A 4J7XA 4TXMA 3NVKI 2IOFK 4OBEA 2EP7A 1ST2A 4RCVA 1DT5A 4UHHA 2ZUWA 3L7KA 2Y77A 3I92A 1ML3A 2W2MA 3MGCA 1QM5A 3K53A 3NGMA 1C4WA 4URUR 3TUJC 1RAEA 2P7IA 4G81A 3VSAA 3ZR4B 1P6QA 3PTAA 3FRHA 4EB3A 1NLMA 2ZRPA 4QGAA 1EJ2A 4F1WA 1QH1A 1TO2E 3JU3A 1ZJYA 3QWHA 4DQXA 1CUXA 2HX1A 5DLDA 2VWPA 1E9EA 3EJ6A 1OIXA 2CLDX 4BGVA 1SD5A 4RMNA 3IEVA 3JPYA 4HRXA 1KI8A 1RZVA 1XU4A 2C1EA 2XIQA 3EIOA 3QENA 4B71A 1P1BA 1B6GA 3MHPA 3KHSA 4DR3B 1OKKD 2V0CA 3JXEA 2PX8A 2QT0A 4M6WA 3AF0A 5I3CA 1U4OA 4LMBA 2I6UA 3BAZA 5EXPA 4RJ2A 2PSDA 4QTTB 5AXAA 4BMYA 2GCGA 4TSFD 2P4SA 3GDGA 5CITA 1VCIA 1XCOA 3JX9A 5IYZF 4BQQA 4PAGA 3WZLA 5FT9A 1XEWY 2V5VA 1DV1A 1D7OA 1M1YA 3H05A 5ED0A 5HCNA 1B26A 2O8FB 5FULA 2GEJA 1ZGCA 5AOAA 1HDZA 4YMHA 1LBEA 2UUPA 2WM2A 2YW9A 4GBGA 1QKJA 5EC8A 4DXDA 1XNRB 1G1AA 1XWWA 4FEYA 3WY9A 3HDTA 3PQ4A 3BL6A 1OX4A 5H83A 4HLUA 1KEWA 2OV8A 5EMNA 4Y2TA 1QXSA 2NUTB 2QRVB 3BIWA 2ZSHA 3W5IA 2EGGA 3UTCA 2OL4A 5AK6A 1R9NA 4N6OA 2PL3A 5EUCA 1O6ZA 1TC1A 3LUKA 2CLMB 2VZ8A 1P4JA 3HKCA 4D41A 3FLAA 1CFZA 2HMWA 3COSA 2GA9A 2VCEA 1H6DA 2GQ0A 2ONCA 3NW9A 4K9OA 2I2XB 3HVKA 3KZCA 3E22A 3L84A 4FHZA 3W2EA 4BFVA 5FOXA 2DBRA 1MO5A 2BGMA 2QRNA 2Z09A 1NF3A 1J9GA 3FDZB 3UQYS 5BVGA 5CFNA 4QA9A 3ITNA 3WOVA 3DAGA 4IDNA 1FW8A 4HP8A 4NS1A 2ZYUX 3ISVA 4KB5A 4M60A 4MKGA 4D5EA 5FWNA 3V55A 3NWBA 4BO3A 3PFFA 2WW8A 4DLRA 2QL6A 1NL3A 1HXHA 2OE2A 2NPOA 4LTMA 4EWLA 1GRNA 3IKLA 3SDBA 1RR6A 2ZP1A 3MTDA 3VBCA 2JIDA 2QI9F 5L53A 3J81k 2XBUA 1XQWA 1U3GA 3GUCA 4PRYA 3O73A 4IL5A 5JRDS 4WLUA 2C1XA 3E27A 1WSDA 1ZGBA 2B4KA 4F4FA 2GRAA 1Z5VA 3NCTA 1ETUA 3OUUA 3EG5A 5DHQA 1N8TA 1O58A 1UXIA 1EKXA 3TXYA 4DLKA 2C7BA 3DFZA 4GF5A 4MUFA 2I9KA 2Q7XA 2PGXA 3KPVA 5CH5A 4AMUA 2CKMA 5DGIA 5HBGA 4LMRA 5JS6A 5BRJA 1U2GC 4P6VF 3K8YA 3LPAA 1HTBA 1CNFA 1P0CA 5EKSA 4YCAA 1GZ6A 3FLMA 1PGOA 2BTQA 2ZSAA 1A3CA 4MMZB 4U2EA 2VUUA 2XVZA 1QS0A 4MDHA 3ZCVA 2Y1XA 3I61A 4TLAA 5FYQA 3WQHA 3Q9SA 5IAKA 4A6PA 3CISA 1XVVA 4K6OA 4P4LA 3RYFB 2I6SA 5TQJA 4LOIA 1SQFA 1OGIA 2Q2OA 2DH6A 3LYAA 4JH0A 3W8EA 1HO3A 5IM4F 3Q8MA 1A95A 5HG0A 1AT1A 1UL1X 2PNJA 2R6DA 1CJKC 3EDRA 5K01A 1JNXX 1WPXA 1QP7A 3PDIB 2D7CA 1F60A 1JPNA 2YINC 3C3KA 4KUEA 5H4HA 3L6RA 4GPZA 1GNLA 1I7NA 4DZZA 5KU1A 1PTJC 2XYPA 3HN6A 4BLVA 4HDSA 3GRZA 3Q9UA 1R18A 1G5PA 3AU8A 2EKLA 3GMDA 3EVZA 3ICWA 1GQOA 5T8KA 1I6KA 3FW1A 3HM2A 1X7WB 4N40A 4JP3A 4WH0A 3TFQA 4WBNB 3JR3A 3RFXA 3MJRA 1LK5A 2XE6A 4NARA 4ND1A 3OWHA 1ISMA 1QYCA 4LDNA 4RW0A 4FDLA 2G40A 2OFWA 4IUYA 4JASB 5EZYA 1LPOA 1U8ZA 3N76A 2JFFA 1S3FA 4K9PA 2I0FA 3EIWA 1OC2A 1ZHFA 4G0PA 4F60A 2DTXA 5E4YA 3IESA 5K8UA 3ZDXB 1ULAA 3COJA 1QE3A 3LCCA 2XKKA 2HR1A 3I9FA 3QSGA 1MB3A 3N0VA 2BE7A 3WE7A 1Z2OX 3D9QX 2XF2A 2OA0A 2CJPA 2Q50A 2IW1A 3HRHA 4R54A 4W1RA 5DMHA 3AM1A 5F9FA 1I13A 2PUHA 3EG9B 1CUUA 1ZEJA 2ZTHA 3K2EA 1VKZA 1XP5A 5IJAA 3TEJA 2PTHA 2C5SA 2ZPUA 3NORA 3OU2A 4TMKA 1IBLB 1FFAA 3GLKA 2AR0A 4QEKA 1ZXBA 5IH3A 5ALHA 3OLVA 2GILA 1E5LA 4G8DA 4LDAA 5T3UA 1ISFA 1O1YA 1CJMA 3SSOA 1WULS 2QORA 4ZAZA 4HBGA 4HZGA 5I7UA 4Z4HA 4GSYA 1L5HA 4U9HS 1E2LA 1D3AA 2P6NA 1KE1A 2XWBF 4FC6A 3L02A 5D51S 5LP6C 5CNKA 2ZYRA 2I80A 4D4IA 1J8FA 1GVNB 4EPWA 4GM4A 1FFSA 3ENQA 4QEZA 4PLGA 4JI5B 3X1ZA 5EI5A 4Q4DA 3IJRA 2P9CA 4P38A 1XA4A 2X15A 2YV5A 1KMNA 5FHQA 4WY2A 3UXHA 5DEIA 3VTAA 4DLWA 1LNQA 3QLUA 2H7YA 5LLTA 1RLTA 4LSWA 5HK8A 3G1UA 3PUHA 3Q6NA 4G01B 5FBVB 2JGNA 2NZUG 4D3XA 1FDUA 3RS0A 1YDWA 1CUEA 3NCHA 1PQ4A 3DL2A 2WD9A 1XL1A 4QAJA 3MWJA 1OC4A 2OBFA 3L0IB 4L7VA 1FSZA 1RBYA 2FEXA 3PWTA 3TJMA 4FLEA 3EGOA 4KYTA 4PSAA 1QFYA 4WK0B 1F2UB 2ZAOA 3U1VA 1T8RA 4FIDA 2QX4A 3PA6A 1CUJA 3PD7A 4MB0A 2DWQA 1FP6A 2GAJA 2DUJA 5F1OA 4MQEA 4RV4A 5E95A 1DHRA 3ZEAA 4ZCMA 2HA4A 2HF9A 4Z0HO 1UDAA 2QRMA 1UXGA 4ZCSA 1YB6A 2Q5FA 3VXKA 4CMEA 3I0ZA 2C8KA 3IAXA 1LF0A 3KD3A 1DO0A 3DBLA 2PFSA 4JSYA 4PBTA 3RIMA 4EKDA 5BY2A 3NUGA 1BIFA 1V9CA 3WLNA 1FUKA 1YDGA 3GA5A 1GTG1 5CXUA 3PGVA 4R1UA 4CNBA 4R2XA 5DP1A 5DIZA 2ZIFA 4EM6A 4IIJB 5AESA 4Y6LA 5I9IA 5F33A 4LVCA 2ORWA 2JJ1A 4WRRA 3TLBA 2HTFA 1H2WA 3U3XA 4CV3A 2P0AA 4NCKA 1H4SA 1YOVB 1ND6A 1Z16A 4DCUA 2ZPTX 1N7HA 3ZWMA 4PHHA 3C6QA 1T29A 4A92A 2B35A 4Y2UA 4EJ0A 1SOWA 1KIMA 1SCBA 1V6CA 2VUIB 3M4JA 4J2TA 4KR9A 4IGIA 4E1VA 5AFSA 3GLSA 3IDFA 1FFHA 1OXKB 5JNVA 1OF1A 3LDAA 2HNKA 3CKYA 4D3YA 2WE8A 1J22A 4FI3C 1T5LA 4P33A 1IY8A 5GP1A 5HGXA 3BXZA 3COZA 2VDJA 5DWDA 1RZRD 1HNXB 2HYIC 1RWVA 3WGZA 4XUGB 4RD4A 2MMCA 3Q7QA 1NUAA 3DULA 2PKCA 1NIJA 1DEOA 1P7VA 3GGOA 3KEGA 5F2NA 4PG8A 4YHHB 3N8GA 4WWHA 4Q6WA 3BCRA 4QC2A 1SEVA 1Y8QA 4KQ1A 1YBAA 5C34B 1UWVA 2WIDA 3QE0A 1MZVA 3BE6A 1YGYA 2PUAA 6LDHA 5IF9A 2IOQA 7ABPA 2HEGA 3VPFA 3ER8A 3ZHVA 1NY6A 1T9HA 3OWOA 1NI5A 1SXGA 4X1YB 1IJKA 5J5AA 1USKA 4QBFA 1HM5A 1C0KA 1NX6A 3MLEA 4RDCA 3RVJA 1GTSA 3GUVA 2SHKA 4GGOA 4QPPA 1R0LA 1L5GB 5GONA 3SQMA 2XCIA 3FTPA 1JEYB 2VP4A 4GOKA 1BWSA 3QUCA 4PLHA 2PIDA 2QG4A 4J0CA 1QVVA 1X94A 1L4EA 1XKXA 2V7WA 3VAZA 3S99A 4HZIA 4DA7A 2O06A 4TRRA 2KS6A 3QU2A 4J4TA 5G1NA 1T15A 1VP3A 3ZGXA 2YN0A 2REBA 4AROA 4DLSA 3TR5A 5EP4A 3OHPA 3MMZA 4LGMA 3RYHB 4Q4AA 4AQYB 3PDWA 1CEYA 4CE6A 4E6PA 4LOAA 4AX8A 3NTUA 1MAWA 4PQFA 4YMSA 4NQZA 1O6BA 4PPFA 3EFOA 1Z08A 3LWBA 1BJKA 1N6IA 3Q9LA 4LDPA 4PWYA 1EK2A 1FQKA 4CVNA 1XMQB 4NBTA 4Y2VA 4KN8A 1KY3A 1UADA 5E1OA 1ESNA 4KL8S 3DZFA 2C2HA 3IAM6 1IJEA 2Q5OA 1X6VA 2OSBA 3ZXIA 5IBQA 1E4OA 2ZRMA 3RANA 1YR2A 3VOAA 2VJQA 4DABA 1WR8A 1ZI8A 1WF3A 3LQRA 4L4YA 3DCYA 4XW2A 4UZEA 5D00A 2ATCA 3H5NA 3VHLB 4ZICA 4DREA 4BFLA 1LWNA 4RDXA 1I0LA 1LDEA 3SQLA 1Z22A 3I6MA 4PYJA 1H6BA 3O4IA 4IIDA 2ZROA 4UOQA 4BB9A 2ZDGA 2VYNA 2JA2A 1UINA 1ORRA 2P9HA 1QKIA 2W58A 3P9SA 3WQSB 2O8BA 4PTZA 1TDJA 3RAJA 5JY6A 3JYPA 3VKWA 5G2OA 4ZPJA 5I5EA 2LR0A 1T1RA 1CUYA 2EL7A 5HKLA 4JGBA 3EX7C 4IXWA 1BROA 4ZOLA 1ENPA 3CX4A 2GAOA 1JW9B 4WKGA 3A7EA 2D4AA 4GOXA 3WNQA 4L0MA 2Y1EA 4RULA 3FSJX 3EIXA 1JQEA 2EBWA 2V6IA 4OXNA 1CUHA 4PYQA 4YA6A 2O7VA 3QWBA 4AD8A 2DUMA 3G9TA 1D4FA 4EYKA 1TUBB 3Q7IA 3IMEA 1SXIA 3N5KA 3DBOB 3KQTA 4NYMR 2REQB 2OYCA 2NSLA 1KFJB 4Q9NA 3O95A 5FTMA 3V5NA 3ESXA 1M6EX 4FN4A 3G23A 5EE3A 5EQJB 1IUNA 2Z5LA 3NHFA 3X1WA 4NCIA 4B6OA 4BNLA 1XXHA 5J2TB 2Q1TA 2ZUBA 1UP7A 2Y67A 3MF4A 3OT1A 4IICA 1W47A 4BO2A 5KDLA 3TD2A 3QVTA 3U1TA 3W5HA 3KLBA 4AO6A 4NOJA 1JDUA 2UYHA 1WZUA 5JAUA 4F21A 3OQOA 2ESRA 2F64A 2JJYA 3A4TA 1GPJA 3DJFA 4ZYWA 1OLSA 4OQYA 2QTRA 4J0EA 2RAFA 4NHEA 1SOUA 1LPPA 2AYXA 2FE1A 3I1JA 3ETDA 4MMXB 2AC7A 3CW2A 4O5OA 3VVCA 4MUAA 1JHRA 1PT9A 3P19A 3FGZA 2FW6A 2FPPB 2XPCA 3CZRA 1CP2A 3RREA 3ZJ5A 4TV9B 3TRIA 2F6RA 5G53C 2Z3WA 4MCAA 3Q7EA 3G0CA 1NI4A 4RIGA 3K70C 2G25A 2ET6A 4V3CA 1K4MA 2EAUA 2OQIA 2BMAA 3N05A 3E48A 1MRNA 4LS3A 4PFSA 3AR9A 3LY5A 5HZMA 2ZSBA 5LYJA 5KX5A 3AHGA 2WTUA 1WMSA 4N18A 2XDYA 5JC1A 2YZMA 4AKSA 3ROKA 2LWIA 2XUDA 4OUKX 1DEAA 1NSYA 1PS9A 2CFTA 3QLEA 2GZAA 3BL5A 2IYPA 3CEHA 3FR7A 3KB2A 3QF4B 3IUSA 5B4TA 4QUBA 3NVDA 3FTQA 1NRXA 3DL4A 1Z2EA 2J0UA 3ADPA 1RXCA 5COBA 3U26A 2LCFA 5BUCA 3B9BA 3WIDA 4R84A 3GCDA 2C59A 1FK8A 1TGVA 4WXEA 2XT6A 1D8TA 2FWAA 5BQOA 4XLZA 2W2LD 1KTIA 1ZUD1 2W8BA 4KXUA 5KYUA 3CF0A 2QU7A 3MN1A 5FFFA 5LA6B 1RVDA 1T9BA 3C3XA 3CRRA 3CUKA 2JAUA 3IMGA 2AFHB 3LP5A 3OTWA 3SIRA 3SS9X 5ICEA 4PVDA 3A7DA 1J8MF 5HQ3B 4EUHA 3ABZA 3VNSA 3GLFB 3SZRA 2X0IA 3AEKA 1MRSA 2DBVO 2JJQA 1T34A 4O08A 3INRA 4Q1EA 5I9NA 2M1XA 3CVOA 2ATEA 5TQ2A 4ZHQA 4E3ZA 3BIFA 1RTTA 2FUKA 1GUZA 2GPAA 4MVJG 1GFSA 3RYCB 1XSEA 4MVJD 3MYRA 1XEWX 2Q7OE 3RYIB 3SKYA 5CIYA 2RG1A 3UAVA 1D07A 3PYXA 4NZNA 3RS8A 1EHCA 2GCOA 4KUHA 1PFVA 4INAA 2C4KA 4OCZA 4TSFA 2AG8A 1TKBA 1SBZA 3DKIA 3RE1A 1HF3A 3TSAA 1W76A 4IPTA 1AUOA 2RH8A 2ZRKA 5ADVA 1JVSA 3S3TA 2Q4BA 1H2FA 3DE5X 1QFJA 3G8BA 4BEWA 1Y8AA 3EHDA 1IY0A 5GWXA 1MV5A 4GX1A 2HSDA 2HJGA 1QR6A 1T5SA 3CTMA 1MQ9A 3LQ2A 5I9BA 5BR1A 4FYKA 3V1UA 521PA 1HYQA 1TA9A 1A5SB 3ADKA 4MQ6A 4QULA 3A4IA 4EO7A 1JR2A 2IE8A 1KJ8A 3FMPB 3JQAB 2ZUDA 4YI5A 3U3RA 1XYGA 3OO1A 3USCS 1V16A 2ZSUA 3DCNA 1X0VA 4B6RA 5CCBA 3KKNA 3RK4A 1AGNA 3ROGA 3LHFA 5KX5B 1A96A 1DZ3A 1ZC3A 2VJMB 4KVZA 3JWEA 1XZLA 2RC5A 1LQUA 1ZI6A 3FB4A 4PX5A 3I1YA 4N7JA 4YMIA 3KQVA 1S8NA 2WT8A 3UK0A 5I7EA 3VPBA 3R7SA 2GLXA 5CLJA 1ZUWA 3E9NA 3KZOA 4HRVA 1DLJA 2PEYA 1US8B 3L1VA 2WSIA 2B1QA 1ACJA 2AS0A 2P91A 3LZCA 4TM8A 1QG0A 2CNKA 4L9WA 1DRKA 2NX2A 3G17A 4M9UA 1PJZA 1O94C 2O2HA 4L08A 2O2GA 1TVKB 1LK0A 3O31A 4BVKA 1VRCA 2R85A 1XLTC 2BMEA 3ETEA 3UATA 5KYXB 4IDFA 1JN0A 3SMQA 1W9HA 3SXUB 3TM4A 3VJLA 4ZVLA 3H19A 2DQSA 2OPBA 5BN5A 4I1RA 1H1LB 4XRGA 4YJDA 3U0VA 4LF4B 3IOMA 2PYIA 4J2HA 1JF8A 4JBGA 1G59A 1CNMA 3AIMA 2VI5A 4HDSB 5E3HA 1CY4A 3OD1A 4YONB 5JZ9A 1UKVY 4ENRA 4MAFA 1G3UA 2W83A 3L1IA 3W7AA 4A2QA 2IYQA 4OY3A 3WLLA 5HDBB 3D59A 4B0OA 4YRPA 5I9MA 2AFVA 4OQXA 2XZPA 2OILA 4D57A 1RYMA 4F38A 1FP2A 1XNGA 1GWNA 4X20B 4DA6A 5IYZA 4YMGA 4RK0A 4BO7A 1E3LA 1MU0A 1P60A 2XQGA 3IT3A 3W6ZA 2WE7A 2MSDB 3RSGA 3T12A 2DOKA 3WG9A 1SXJB 1O5OA 1KH3A 1KU6A 1X1BA 1Y7TA 2UVPA 4M4SA 4M1KA 1K4KA 3BSYA 3LXXA 3QKSB 1CULC 3SHFA 3V8NA 3S81A 3QVGA 4RHUA 3D6FA 2ZBDA 2B4TO 4PQRA 3C1TA 5CDSA 3E0QA 3NC1C 4JYCA 4OJTA 1F6WA 1HWYA 4B9AA 3CLHA 3AEZA 4QSMA 4B2YA 5IPFA 4RKWA 1G8KA 2YHIA 5NULA 1J09A 1KK1A 1QFZA 2ECFA 2O0MA 5CYPA 2ZYVX 4JA2A 5A3RA 3IHWA 4KR2A 3T1OA 3AF6A 4FFDA 1S6YA 4RPGA 1JIJA 2ZG6A 1NVEA 3TVTA 3GJ5A 2W6ZA 4V0KA 1VG0B 3ZOKA 1PR2A 2RCYA 4V02A 4OYHA 1K63A 3H97A 4I6GA 5DXFA 1VG1A 3UN1A 1T6BY 4MHOA 5EAIA 1XCLA 3KO8A 4M1ZA 3UWSA 3WRYA