4LV8B

Murine irga6 bound to toxoplasma rop5c, a pseudokinase gdi
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
397
structure length
390
Chain Sequence
NDLPSSFTGYFKKFNTGRKIISQEILNLIELRMRKGNIQLTNSAISDALKEIDSSVLNVAVTGETGSGKSSFINTLRGIGNEEEGAAKTGVVEVTMERHPYKHPNIPNVVFWDLPGIGSTNFPPNTYLEKMKFYEYDFFIIISATRFKKNDIDIAKAISMMKKEFYFVRTKVDSDITNEADGKPQTFDKEKVLQDIRLNCVNTFRENGIAEPPIFLLSNKNVCHYDFPVLMDKLISDLPIYKRHNFMVSLPNITDSVIEKKRQFLKQRIWLEGFAADLVNIIPSLTFLLDSDLETLKKSMKFYRTVFGVDETSLQRLVDQVEAMIKSPAVFKPTDEETIQERLSRYIQEFCLANGYLLPKNSFLKEIFYLKYYFLDMVTEDAKTLLKEIC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rhoptry protein 5 C
publication title Murine IRGa6 bound to Toxoplasma ROP5C, a pseudokinase GDI
rcsb
source organism Toxoplasma gondii type i
molecule tags Transferase/hydrolase
total genus 150
structure length 390
sequence length 397
ec nomenclature ec 3.6.5.-:
pdb deposition date 2013-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05049 IIGP Interferon-inducible GTPase (IIGP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lv8B02
4CT5A 1EXMA 1NP6A 3QBVA 4B74A 3K70D 1FNNA 3ZD7A 4LWZA 1NMZA 4C4PA 1XTSA 4BLSA 1CR2A 4II7A 2B6HA 2WSMA 1IOZA 3IO5A 3QEOA 1N6NA 3UATA 2GJ9A 4TTQA 2WOJA 1EFRD 1KKLA 1XD2B 1FQJA 4BLTA 5AJZA 3D6TB 4AYTA 1XXHE 3G0HA 2IUSA 2OXRA 3NWJA 1KK2A 2O5VA 1WE2A 4DCSA 3R20A 2D2EA 4QM6A 1N6LA 3EZ7A 1T91A 4FCTA 2YC2C 3EIEA 3RS5A 3SBEA 3TR0A 4N0DA 4BLRA 4MITA 4QJ5A 3BE4A 1Z83A 3S1AB 1GUAA 4JJZA 1I4TD 1OPXA 2AWNA 1PUJA 4IEIA 2VPPA 5LBIA 621PA 1NVWQ 4PC6A 3VKWA 3LWNA 1E3MA 4CZ2A 1OXVA 4NDZA 1EFTA 1AK2A 3JVUA 5FTMA 1VCMA 5JWHA 1QHIA 3TMKA 3U44A 1T8UA 3GFPA 3LH5A 2JASA 2FX3A 1NBMA 2BMFA 1G4UR 1KMHB 1Z07A 4V0MA 2GEVA 5L3QA 4FINA 4BPBA 2P5TB 2ZVQX 3IHWA 2HF8A 3C7KA 3P20A 1LF0A 2O8CA 1PZNA 5IRCD 4NPHA 2O52A 2QY9A 3AP1A 5A4JA 4RZ3A 4PZLA 3I8SA 5EE0A 4BLPA 3K0CA 1KO5A 5CK4A 1FW6A 2GVDC 3VMFA 4HUQB 4ASUD 1NG1A 5KO2A 1X1RA 1G8YA 2QROA 3EIQA 4OQNA 1XXHB 1NJGA 3O47A 2IHYA 4XVQA 1DOAA 3LFUA 4Q4JA 2F43A 1HYQA 3UG7A 4QG7A 3DHWC 3REFA 5SZIA 5EXSA 4L9WA 1KHTA 1R5OA 3IDQA 3GPLA 2HUPA 3UWKA 2ZYVX 1JECA 3KX2A 4NYIQ 1N5JA 4EFMA 1NF3A 3T12A 1Y63A 3TUIC 3G82C 4QGAA 4EAQA 1OKKD 3ASZA 2C9OA 3KJEA 5AUPB 4CIDA 5FBWB 2FEOA 1M34E 4HZIA 5L3SA 3QG5A 1KI6B 4X8OA 1JPNA 2Z5FA 1HT2E 1VHLA 4XSGA 1S9HA 3AF0A 3FFBA 3I5YA 5JWRA 2OLKA 3NHBA 1I2MA 1U0HC 4GBMA 3B9QA 3AGPA 1TUEA 3GLGA 2TMKA 1G3IA 1OFTA 4FD2A 4A8JB 3MLEA 1II9A 2P6UA 5G3ZA 1JBKA 2J1LA 3W5IA 3KUCA 1KO4A 4R98A 4TSFA 2J45A 1ESNA 2PH1A 4FCVA 1MABB 3ZDQA 4YXWA 4YDHB 4YMUA 2G1KA 4B71A 2YV5A 3P26A 3U5ZB 4KAXA 4I81A 721PA 2YC4C 2GCNA 1KO7A 4OI0A 2XGJA 1W46A 5L3RA 4UNRA 1KI3A 2ZRGA 4UNSA 5EE3A 4JL5A 1DAIA 5JEDA 2JLVA 1S0UA 1Z6YA 3KUDA 3CNNA 3NVAA 3TQCA 4AK9A 4DB2A 3AF4A 3CX8A 2ZR9A 4PPNA 1VMAA 4NHOA 2DFNA 4URXR 4U5XA 5M04A 1YR9A 4J0QA 5ELXA 1IXRC 1SKQA 4EPRA 3WMEA 3A6PC 2IA5A 1QHNA 1U94A 1U90A 5F9FA 3QNUA 1NKSA 5BN3A 4JLPA 2A5YB 2HEIA 2DWQA 5FUVA 5DIFA 3K0FB 5DN6D 1TPZA 4Q4AA 5KNBA 5J4VA 1OF1A 1Z0IA 3GJ5A 1G19A 1CXZA 1GKYA 3WNBA 2GAOA 4GMXA 4HAWA 2XAUA 1H8HA 3K53A 4B32A 5E3HA 1MR3F 5G3YA 2V7QA 4DC9A 2C8VA 1NLZA 2W6IA 4Q9HA 2C77A 5C2JB 1COWA 4LHVA 2PZFA 5JRZA 1XEFA 3NH9A 1LB1B 2D7CA 2XTMA 4M4SA 4C30A 4EIWA 4M22A 3GLHA 1GL6A 1FTNA 1KI9A 1CULC 4HB2A 1EFHA 4A0RA 3ZD6A 3AUYA 2FG5A 2YINC 1CJKC 2W0SA 1N0WA 2XXAB 3FPAA 5AJVB 1G21E 3B1XA 1E9FA 1Z08A 1TEVA 3T34A 2WWGA 4LHXA 1XNJA 121PA 4E5UA 5FOWA 2F1HA 4QBFA 3U6BA 4WA7A 2C98A 2QMOA 3H2YA 5CYOA 4YONB 1N6RA 1JR3E 3AVOA 1I4LD 3M6AA 3N2EA 4A15A 4JBXA 5JSZB 1SGWA 3GFOA 4XOIA 3VTKA 5HCIA 1WBDA 3AKDA 2Z6VA 1DADA 1QHHA 2KJQA 3TBKA 1OE0A 4W9MC 3QPVA 1Z0JA 4A8JC 1Q3HA 4B6EA 2DPXA 4RKEA 2F3TA 1E9BA 4PZZA 1YU9A 1GL7A 2BWJA 4JYCA 4KFTA 4Q1FA 4TQUS 3TH5A 5JWOA 3WYFA 2ZRKA 1RVDA 2D3WA 1YZTA 4YQFA 1N5LA 3L0IB 2WKPA 3QE0A 4A2QA 3HWSA 3K1JA 5DHAA 1JJVA 2GETA 4A6PA 4A92A 4D4MA 2ZXUA 1Q0UA 4I1VA 1BIFA 1XJ0A 3T1VA 3R9IA 3DVLA 2ZS8A 4Q4HB 4FW9A 3ZZ0A 1K5GA 2ZE5A 3CX6A 3A1WA 4AURA 2MSEB 2ZJAA 4LYFA 3U3OA 1ZM2A 2AD5A 4XTCS 1KKMA 4KV9A 5GVSA 3I1FA 1D5CA 2VO1A 2VP5A 1FP6A 3A4LA 2LKDA 3ECCA 3PENA 4JVLA 4IJMA 4D4LA 4KFSA 2REXB 2JLSA 4LJAA 2WZQA 2IS2A 4GDFA 1EWRA 2W2VA 4V0OA 1SZPA 2NQ2C 1X6VA 3Q7PA 1V5WA 4AWXA 4KJZA 4MYHA 1KDPA 1OSNA 3KXLA 4PC2A 3IKJA 1XJQA 1VPLA 2F1JA 4JLDA 3KQKA 2DB3A 1UBGA 3R9XA 4ZKDA 1XEXB 3DMNA 5FL3A 4ZDKA 1TQ2A 2B8WA 4PQRA 2VHCA 5IDVA 5BXQC 1TQ4A 1WDTA 2CCGA 2O0KA 2ZUDA 3P27A 4LSGA 3RSOA 4EFNA 3B2EA 4TMVA 3UMFA 1LW7A 1E96A 4MYTA 2C9YA 5EXTA 5AK0A 3SN6A 4BFTA 1YR8A 2AFIE 1G64A 3SJAA 2R65A 2KE5A 5FOVA 1CR4A 3LBHA 1EFCA 4D0GA 2X2EA 3EG5A 1S9DA 1R10A 2AXNA 2HT6A 1UJ2A 3W6PA 2KBFA 2AL7A 2JA1A 2IYLD 4IVRA 4GOXA 1A82A 4Q18A 4R9UC 1R6BX 4IXNA 2HXYA 2F9MA 1ZUHA 1UF9A 1XMJA 4URVR 2P65A 1CRPA 1W0KA 3IBYA 4XH9B 2PJZA 2X8AA 3SNHA 3MMPA 5KSPA 1W0JA 1FUKA 1GFIA 4AKHA 3I8XA 3QXXA 5EJEA 2H8KA 4TT3D 2ZVPX 1WXQA 1DG3A 1Q22A 4D25A 3FDIA 1F5NA 4NE2A 3RS0A 1OIVA 1SVMA 4C9BA 1Q12A 1VCNA 5DLQC 2ASEA 3NXSA 4PSAA 1OB5A 4Q9IA 3C14C 4F91B 4QBGB 2ZRJA 1FFHA 3FTQA 1NVVR 3KTAB 2J7PD 3TAUA 3WP1B 1Z0KA 1KZGB 1CJUC 1T3HA 2CCJA 2FA9A 4BFYA 1P3JA 2QTHA 4QKQA 2Q9CA 3WNCA 1KAGA 1X1SA 2DBYA 2ZRPA 2OT3B 2WSSA 3H4MA 1DVRA 1XMVA 4V0NA 2RGGA 2D74A 3QKRA 1G6HA 2EFDB 2XZLA 3U4QB 1HY3A 2GESA 5TV2A 4L5BA 4YMWA 1VYVA 2AKAB 1KI2A 2OAQ1 3SHWA 3PVSA 3SYNA 1G1MA 4TQ9A 4CEIA 5KPJA 3B9PA 2D2FA 3UXMA 2ZRHA 2HCBA 4ARZA 4JVNA 3TR5A 1QVAA 4HZUB 5DYGA 1ZYUA 1CRQA 4H9GA 1XD9A 4B3FX 3EPLA 4B3GA 2VSXA 2AFHE 4PAOA 4A9AA 1CS4C 2ZI5A 4LOAA 3BH7A 2RHMA 5J4LA 4OQLA 1TNDA 4OI2A 1AGRA 4QGGA 3THWA 5JJIA 2OBMA 3ZS8A 2K5UA 4QJ3A 4C0KA 2JJ2A 4I1SA 1P9WA 4LY6A 3AVTA 1DAHA 2XTNA 1R8SA 3AGQA 4LPSA 2V8OA 1Q1BA 1D8TA 4L16A 3B82A 2ZRBA 2VP9A 2BKUA 2IUUA 4D82A 1W48A 1W36D 2NO9A 4B44A 1D2EA 3UANA 1U8ZA 2CHQA 3ONWA 2ZSDA 1NMXA 1YJ5A 3RABA 1BKDR 1RIFA 1XWIA 5JEEA 2ZR7A 3T61A 2V3CC 3SEAA 1XTKA 1G5TA 3AM1A 4M1KA 1E4YA 2QP9X 1KK3A 2BEKA 2WICA 3PUYA 2WHXA 5AJXA 4B6FA 1YZUA 2IX3A 3VKGA 1NBMD 2GCOB 4RFSA 1FZQA 3AV0B 4GT1A 1DPFA 3W6NA 2WKRA 3KKOA 1G8HA 4DLRA 3TUZC 4BFSA 2BMDA 4BFUA 1T5IA 3I72A 1W47A 3OIUA 1IXSB 1P9NA 3AUXA 3ZLJA 1D2NA 1DAFA 1SVLA 4YDSA 1KAOA 2Z0MA 1SHKA 2R44A 4I4LA 5KUTA 1NY6A 3WRXC 2P0EA 2V4ZA 3LX8A 5DO9A 1OH7A 4AY2A 4P4TA 521PA 4D2IA 1F3OA 4HEJA 4W5WA 4DEXA 1RW4A 4HATA 1M6NA 1Q20A 2QGNA 2QU8A 4OJQA 4GOJA 4D26A 3AVXA 4F4CA 2FFBA 5E7IA 1N25A 1B0UA 1NVXQ 2XSZD 2J3EA 2RH5A 3CRVA 1QHYA 3JZAA 4D80A 1ZRHA 1Q1QA 4ZCLA 4JLMA 5H68A 2CL7X 4KLZA 4URUR 2QT0A 2QBYA 3MG9A 1OHHA 4ZIRA 4CYMA 1FMLA 2CVHA 2ZRLA 3LD9A 1WA5A 3BD9A 3KFXA 3DKPA 1CR0A 2ODWA 4Q1AA 1PJRA 2OESA 3I3SR 4CDGA 3TLXA 1S3GA 4DT1B 4YXWD 1RKBA 1E2FA 1T4GA 4MGKR 1W7AA 3VX3A 2J5XA 1US8B 1TF5A 5CLQA 1M7BA 2CJWB 5EQTA 1KIMA 5IHPA 4AD8A 1E2HA 1ODFA 4K8OA 5D3MB 3N2IA 1JXMA 4GSYA 4M21A 2O8EA 4WXPA 2Z83A 3VHLB 3MWLA 2QMHA 4GMDA 1JXOA 4JL6A 2IS4A 1Y3AA 1EG7A 2AK2A 2GF9A 4Q1CA 2PBRA 3O8DA 4TLEA 4CEJA 2ORIA 1TMKA 3BGWA 2RGNC 4PC3A 1EWQA 1E2QA 2G9NA 2EFHB 1ZINA 2PZGA 3KQLA 3RS2A 4E22A 2H17A 4WZBE 3WBJA 4ITRC 1AS3A 2OCBA 1R2QA 4TZ0A 2HDNB 3BJIC 3B85A 3IEUA 1AZTA 2IL1A 4LJ6A 4P3YA 3CRMA 1HQYE 3DZDA 1Q1EA 4JBYA 4PPQA 3CNOA 4NYMQ 1U0JA 2QAJA 3LBNA 1R5NA 2W0MA 3CZQA 1QG4A 1H8HD 1OFIA 2IHBA 2B92A 4HAXA 1R8QA 1RRGA 1MO5A 2V7QD 4NYJR 4A6XA 2NPIA 1UKZA 2W6ID 2ZRFA 4FXPA 1N0VC 3C5HA 5CJPA 5TMPA 2WPDA 3PR1A 1COWD 1Z0AA 3H1TA 1OLOA 1XP8A 2CLDX 3C15C 1OXUA 4R2IA 2ZS9A 4Z8YA 4M9ZA 1NN5A 4GP7A 3IBGA 5JZVA 1YR6A 2NIPA 1TQ6A 3AQ4A 4KO8A 3TSWA 2R6GA 2UVQA 4IDPA 4G01B 3CNLA 3DZ8A 4MDEA 1CP2A 3HYTA 4U02A 3SE0A 3NTUA 1WQ1R 4RD1A 4TWZA 2Z4RA 2IYZA 3I32A 1S4QA 2FMXA 3CR8A 4YMTA 1NRJB 1MKYA 4M9QA 5AUOB 2AXPA 2P67A 3QF4A 4P4SA 1G4AE 5FOTA 1Z0DA 1OIWA 2Q0HA 4P4UA 4C0QC 2VLIA 4EPYA 1IM2A 4W5HA 2Q3FA 1QRAA 2OV2A 5G41A 2J9RA 3X1ZA 1QBKC 2IUTA 3OIWA 2ONKA 4JLNA 4NZYA 1SKYE 1UBCA 4CW7A 3T1TA 1LNZA 4TMXA 2BEJA 3P1JA 3D31A 1RJ9B 2QAGA 2ZTSA 5FR2A 2IC5A 1E1QA 1GKUB 5TVKA 4CEHA 3NDPA 3IIMA 3UG6A 2CCKA 4DSNA 2LCFA 4ESHA 5JCZA 2VP0A 2FSHA 4NKRA 2CMKA 1FNMA 2G0NA 2EVWX 4LJ8A 1KI7A 3ZZUA 2QZ4A 1XZQA 5AJWA 4BEBA 2ZUBA 2JJ1A 3DEFA 3IILA 1TEXA 4MUAA 2IYSA 5KYKA 2VIIA 4PHHA 4OK3A 4ZDIA 4GZMA 4L4UA 3AVUA 1NJFA 4PAQA 5EZ5A 1NVVQ 3N5CA 3J81k 2FGKA 1JB1A 1KK0A 5AWFC 2IEZA 2DHRA 4XD7A 1LTQA 4LCBA 1SQ5A 2O8BB 2I3BA 2DR3A 1VKJA 3CLVA 1A1VA 4BRWA 5IK2A 5DSZA 1JNYA 221PA 4RCZA 2MSCB 1MH1A 3QXHA 4DCUA 4FWTA 4QHYA 4Q9LA 2QL6A 3GLFA 3PV0A 1N6OA 1SKYB 2BBTA 1FX0B 4MKIA 3UPUA 4DEYA 3VNUA 4WW0A 1MO3A 2W58A 3B7GA 1A2BA 4JVMA 1VG0B 4FIDA 2QUZA 2OZEA 4E03A 4C2UA 2IYWA 1AS0A 1XEWY 2QEQA 2IXFA 3U7EB 5E7JA 2J0QA 3BWDD 1NG9A 1NIJA 2CVFA 3AVWA 2XJ4A 3BH0A 1J90A 3GQBA 5KDOA 2R9VA 1FP7A 3VX4A 4LX0A 4WZAE 5JHGB 3I4LA 4M1OA 1UAAA 4LC1A 2WWIA 4QL3A 3M0EA 1TAGA 3RS3A 2ODEA 3IEVA 2BJVA 2PLRA 4RY2A 1Q57A 4PPGA 5KDLA 1TF7A 2ZJ5A 3VU9A 1E99A 4JZKA 5GJWC 3WBKA 2NOAA 3M1IA 4BFVA 4D4JA 2EFGA 4WVFA 3A58B 1IONA 3IIJA 4QHSA 4DIEA 3SYLA 3QXSA 4Q00A 1W0KD 1XFAA 4DDWA 2HYDA 1E2EA 4EPXA 2RMKA 4TLAA 2BHRA 1SXJD 3PUWA 1M2OB 1W0JD 1IAQA 5E7MA 5C1BA 5AR1A 3U44B 4PC7A 2O8DA 1ZNYA 3HPQA 2AK3A 2CL0X 3AB3A 2J0UB 1XPRA 3WY9A 1UKVY 4DCNA 2WIBA 4MYUA 4DLYA 5L3QB 1OIXA 1E9SA 1L4YA 1KZ7B 2QM7A 1RRPA 1ZU4A 2YWEA 4NU0A 2GAAA 4TMTA 2QPAA 3HDTA 4UXJA 3DL0A 4NBSA 4V02A 5HTKA 2JLRA 2NO7A 3AVQA 5EP2A 3NBFA 1J70A 2WJYA 1KOFA 2CHVA 4M2LA 4PHGA 3ZVNA 4MRNA 2C04A 2WSSD 1R5BA 2D4HA 1C4OA 4QGFA 1R7RA 4JLBA 2ZSBA 3T1OA 3U3JA 2X19A 3AVYA 3BIFA 1ZJ6A 5JS8A 1KSFX 3K0AA 4HLUA 2IYVA 3X1XA 2E1RA 3DOFA 5BN5A 3F8TA 4JLAA 3KFVA 2FFHA 2X1VA 3KB2A 2O0JA 3TNFA 1G3RA 4IOLA 4D0LB 3B6EA 3GLIA 1Q3TA 4BZPA 4NL4H 4IOMA 4PO1A 2VTKA 4JMPA 4TL8A 1J8YF 5JLJA 4LZZA 3Q5DA 3RVBA 4MUBA 4OL0A 4BECA 4DIDA 2JJ8A 1NSFA 3ZQJA 3A8TA 3CH4B 3CF0A 2JJ2D 4ABYA 1CR1A 4EDHA 3AEZA 2REBA 1D6JA 1FUUA 2A78A 3TW4A 3LDAA 1TX4B 4LPKA 2XSZA 1DAKA 2EFEB 4D4KA 1MRSA 1W1WA 3D7MA 2ZSEA 2QQ0A 3ZQ6A 5F3WB 2RGEA 421PA 3X1WA 2WBLC 2XX3A 4M1MA 5KU1A 1Z2CA 5FOXA 1CIPA 2VP6A 4FMDF 3R8FA 1DAMA 2GZAA 1Z2AA 3QJYA 1K6MA 2E87A 2OFXA 3NDBB 2ZRCA 4P33A 2WWFA 3LXXA 4QC2A 2JLYA 1KMHA 1Z06A 4IDHA 3ADDA 4WIAA 4GZLA 1J99A 5FR1A 3RRNA 3RWMB 1CEEA 4WOPA 3NIBA 4YMVA 4IW3B 3LY5A 3OEEA 4LJ9A 3LW7A 5FPYA 5JI3E 3GFTA 4XWOA 2BMEA 3Q72A 4LBWA 1QHXA 4HUQA 5UKDA 4JIMA 5K8TA 4NCIA 1XXHA 3QI2A 1TU4A 1D2MA 2RKOA 3U60B 4G1UC 4D81A 3BS4A 2PT5A 2R6DA 4Q4AB 5J4KA 1Z8FA 2QSYA 1DO0A 4M1WA 4PAMA 1KY3A 5A0FA 2PCJA 4NYJQ 3IQXA 1U8YA 1ESMA 1BYIA 2QGZA 2IWHA 2L0XA 1P60A 2EYUA 1KI6A 4MRPA 1G17A 3Q85A 3T5DA 3LAWA 3U3MA 4QM7A 1LV7A 1KY2A 3PG5A 2FOLA 1IN8A 2FV8A 4G5RA 4PX9A 3W5JA 2XOKA 2G83A 3K0CC 4HAZA 2GF0A 2GK6A 1Z63A 1ZNWA 4DDVA 2WWYA 3BXZA 3O8CA 4A8JA 3K9GA 3FMPB 1FTSA 2VA8A 1F48A 3FHTA 4B34A 3ADBA 1G8GA 1OHHD 4MRVA 2JLZA 5B30A 4B3DA 2QTFA 2ZRMA 4PXAA 2QRZA 2W2TA 2GXQA 2I1QA 3AP3A 2IXEA 2QM8A 3MJRA 3KJGA 1P61B 1ZM9A 3GP8A 3EZ6A 2ZITA 5CIWA 3BB1A 5EUMA 3R9WA 2FF7A 2C78A 1KSJA 2AX4A 1KDRA 2B21A 5CB8A 1W4BA 1GAJA 3FE2A 4PO9A 3THOA 3VR6A 5KHOC 4XSHA 1Q44A 4O2RA 3RSLA 1QHHB 1E32A 1OYWA 1IN4A 1HV8A 1ZNZA 3I5XA 2N46A 3H0KA 5CM9C 4DB4A 2ZPTX 1S8FA 2FDCA 2SHKA 2FPKA 2XNDD 3AF2A 3X1DA 4DSOA 2AWOA 3K9HA 3LO5A 3RS7A 3K0FA 4JT4A 3HR7A 2OCPA 3PJRA 2OM2A 3EXAA 2ZEJA 4MRSA 4TMKA 1HTWA 1XCPA 2RAPA 4HB3A 3W9YA 4IXMA 3BFVA 1E69A 4S2EA 5BWMA 2WKQA 2IYYA 4IKEA 1U9IC 2C2HA 3I92A 4PANA 1P6XA 5AUNB 2PLFA 1KJZA 1GNRA 3VFDA 1KDOA 1OXTA 1JPJA 3TUJC 3RAPR 4UNQA 1P73A 4BWYA 5D3QA 2XJ9A 3GMTA 2OG2A 2XB2A 1VECA 1E6CA 3CRRA 1JALA 1CLUA 4DDTA 1XTJA 3ADKA 4JVSB 2GJSA 4XWAA 4CRWB 2QA5A 3X2SA 4CGZA 1GP2A 1BO6A 2CE2X 2WPDD 3CPEA 2D06A 2HLDA 2IYXA 3KKPA 3AP2A 3GJ6A 4LUCA 3ZVRA 2H18A 1ZBDA 3QF7A 1ONBA 4A82A 1CF4A 3I61A 1G16A 2PT7A 2OE2A 1GOTA 3NEJA 3VR2A 4ZDWA 3SJZA 4GRAA 3VNVA 1AQYA 1IY1A 1E9DA 2D62A 4OKSA 3REGA 4Q47A 1Z29A 4ZCMA 1XMIA 2ERYA 4NONA 4R2HA 5EP3A 3MWKA 3T5GA 1M7HA 3G5UA 3K70B 3A1UA 3K9NA 3ND8A 5KNCA 1VCIA 1D9XA 3PQCA 4NCHA 4ON9A 5B57C 1KI1A 2F1IA 1JEDA 1E1QD 1OW3B 2P2LA 4DXAA 1P72A 3BC1A 4TTPA 1II8A 3QKTA 4KVGA 1GILA 3IHLA 4IFEA 1GSIA 2JIZA 4KXFB 4TYPA 4TMZA 2OUKA 1XU4A 4JBWA 2CBZA 3BB3A 1IN5A 1IBRA 1E98A 2IW3A 2QPTA 1PLLA 2ZAMA 3CWQA 3W8RA 821PA 2JJ1D 2RGCA 4URZR 1BMFA 1NI3A 3N70A 3UK6A 2FFQA 2VHUA 5J40A 4EUNA 4AIIA 3EZFA 2VF7A 4AKEA 3GCGA 4DRZA 2CEAA 5IF9A 4LBVA 1G5RA 2WWXA 3QPWA 1QDEA 1T3LA 3ZVMA 1JR3A 4XD7D 4QOSA 1L2TA 2ZYUX 4RZ2A 2ZI6A 1SXJA 5KNDA 2OILA 4TL7A 4KCGA 2GJKA 4P0TA 4W7SA 1XZPA 3PUXA 1F2UB 1KJYA 4OQFA 5IK2D 2PZEA 2B7BA 3CX7A 1P75A 3QXJA 3CRQA 3THXA 1U0LA 1N6HA 1X8LA 4DHEA 3U2QA 4KSCA 4B2IA 2PX3A 2P3SA 4NCKA 4FMDB 4ZV4A 3LX5A 2J87A 4QRHA 4ARZB 4UXIA 2ZUCA 3NC1C 1Z3IX 2O8FA 4KVAA 4A0FA 3K09A 1VCOA 1I2DA 3ZS9A 3EPJA 4D6PA 1OXSC 2HCJB 1N5IA 2DY1A 4N3NA 4IFBA 1E9EA 3FYHA 1ZD1A 4HB4A 4X8LA 2P6RA 4NCJA 5C18A 1U98A 2XNSA 1ANKA 1Z22A 2A7QA 5SZKB 2HYIC 2VHJA 2ZSFA 3EARA 1UDWA 4PSVA 4FCWA 3LVQE 1E4VA 1OT3A 3R7WB 5HKKA 1E0AA 5GADl 1NN3A 1WMSA 3FOZA 1G3MA 5L3VA 3L2OB 3LVRE 2I4IA 5E4FA 4Q66C 5B58C 2ZSAA 1NY5A 4HUTA 3RRMA 5F98A 1EESA 2EQBA 5CJ2A 5DGXA 4LK2A 3FHOA 2IF2A 2EWVA 3K70C 1WBBA 1FQKA 4DJTA 1G8PA 1MOZA 5HR5A 4Q01A 4OHYA 4JLKA 2JCSA 3F5FA 1Z0FA 5FUXA 1AS2A 2R6CA 4H1VA 3LW8A 2JLUA 4UQOA 3EW9A 4B43A 1H8EA 1JQLB 1WRBA 3MFYA 2J41A 4DLVA 4AKGA 5SZJA 1G7SA 4PPFA 1YKSA 2REOA 2YWFA 4RD0A 2NO1A 1U8AA 2JATA 5A5GA 4MDFA 1O3YA 1CU1A 4JKYA 2VH5R 2ZIAA 3SZRA 2GWHA 2LKCA 3WYGA 1G8FA 2BIFA 1F2TA 4HZUA 1GG2A 4B48A 3FGNA 3B5JA 4QFMA 5FL7A 4WXRA 2G88A 4IVPA 3UWOA 1W2GA 2CNWA 5JECA 1G7CA 1TUIA 2N1BA 3WYAA 3OESA 3VAAA 4DSTA 3RRZA 3LBIA 2VP2A 4B2LA 3K9LA 5DHFA 4BFXA 2BBWA 1VG9B 2JDIA 3TE6A 3VR1A 1R4AA 2FZ4A 2ECKA 3W3ZB 2C5LA 5CLLA 2FGJA 1AKYA 5EXXA 1E9AA 1GTVA 1VIAA 2WWWA 2ZANA 4KYUA 4URYR 1QHSA 2AD1A 2ODNA 5FOUA 1AA9A 4CVNA 3GJ4A 1XCMA 3RNLA 1ZD8A 1DTSA 1PLKA 1RZ3A 3NG1A 4IDQA 1IY0A 2ZI9A 3PITA 1XMSA 2OXCA 4UNNA 3C16C 3D8BA 2ZRAA 3AF1A 4I1OA 4RD2A 4Q48A 4Q4LA 4EJSA 5TXGA 3B60A 1SVSA 3NHAA 4LI0A 1RRCA 5CDFE 2ZRIA 4BZXA 4X8HA 1QZXA 3CRW1 2GCOA 1HH4A 2QNRA 2UZIR 4AYWA 3OEHD 1XX6A 3PIRA 4NMMA 2IYUA 2F7SA 1GRQA 3WHKA 1PVOA 2FSFA 4HDCA 4M1YA 3X1YA 2O8EB 4JLOA 5EZ6B 2FSIA 3LRPA 2BMJA 4O2LA 3OEED 4FI3C 2ATXA 1VYUA 4M0LA 4C0HA 4JLJA 2GXSA 1OH6A 1G41A 5FBQB 1KTVA 3LLUA 1W5TA 1T9HA 4LRWA 1IJEA 4EQ6A 1OJLA 3V9PA 2FEMA 5GJVC 1BYUA 3ETLA 2GBLA 4HLDA 1QG2A 3L0SA 5FI1B 1RRFA 2GCPA 5FPKA 2XNDA 3CONA 1P4SA 1GZSA 4GP6A 4NP6A 4ZO4A 4M8NE 1KI4A 2VP4A 3AVPA 2A2ZA 3QKSA 3CPHA 4BZQA 1ZIOA 2V55B 3A37A 4BLQA 4OJKA 3MUFA 3THYB 3HP1A 4FMBB 2E9SA 5FI0B 1W4RA 4L8GA 3C4JA 3A1VA 3RANA 2G0TA 2XOKD 5SZHB 4MGZR 2IWRA 3RYTC 3R8CA 2WWHA 1N3BA 1MO4A 3PUZA 4N1AA 4LBZA 2FJUA 2EFCB 1YE8A 2KWIA 2IBMA 1XPOA 1N0UA 1ZW6A 2R2AA 1FOEB 1NLFA 4HSEA 4Q02A 3TAHA 4DKXA 1UADA 3IPXA 1K8RA 1EK0A 1HA3A 2Q3MA 3L82B 3WRYC 3ZH9B 2OCYC 1FMJA 3C41J 5DI3B 4P4SB 1US8A 2YVUA 1BOFA 3HR8A 4ESVA 2CJWA 2V1UA 1VDZA 5GJBA 2BCJQ 4TLCA 3GLFE 1YQTA 4QHTA 1R0XA 1NN1A 3MGCA 4QXAA 2EYQA 4EFLA 4K46A 2GJ8A 2QAGB 1D9ZA 1F60A 1XF9A 4M9SA 2KBEA 3BAFA 4BE7B 4PQFA 4OK6A 3RS4A 2RGXA 2PCLA 1B23P 2GXUA 3IIKA 1UDXA 1DBSA 3SC3A 2R8RA 4V03A 1DARA 4LJ4A 4MQBA 2OBNA 4IVQA 3BB4A 1XJCA 4DCVA 4TN1A 1NMYA 2WAXA 1A5TA 2W00A 5FPTA 2CHGA 2BC9A 1W49A 1ZP6A 2GZDA 4YLGA 3I62A 3ZGXA 2OLJA 4B33A 1MT0A 1E0KA 1OYYA 4TYYA 2VHQA 3FVQA 3HU2A 1ZM3A 1KO1A 3K0SA 1ZM7A 2XITA 2A5JA 1TU3A 1KJWA 3GD7A 2RB4A 2KI5A 2RGDA 3EC2A 4Q1DA 2OCAA 1W4AA 2HT1A 3EWSA 5LPNA 3KZ1E 2WTUA 1CJTC 2HLDD 1WCV1 2GA8A 1OV4A 2YOGA 1X8JA 4ACBA 3GLFB 4BEJA 3A36A 4IDNA 4KLNA 2ZE8A 3FMIA 1P9RA 2PMDA 1DELA 3T1QA 3UMSA 2A30A 3DKVA 3LA6A 5DYIA 4BASA 2UKDA 5B2ZA 2UZ3A 1U2RA 4JSYA 2WJHA 1G5PA 3ND9A 1GRRA 4LYAA 4F4JA 3TSOA 4KU4A 1NBME 2VF8A 2C96A 3E2IA 3KKNA 1M7GA 4V0ME 3V4RA 3IGFA 2J46A 2FPLA 4OQXA 4M9XA 2IK8A 4E07A 4RD6A 1AZSC 4AC9A 4DUGA 1ZCAA 3OAAA 4DLZA 3EPKA 4WBSA 3VU9B 4A4DA 1S1MA 1Z28A 3PUVA 3C8UA 1UBFA 3FFAA 3GLIE 2ZE6A 1X3SA 4DLTA 3O8BA 4C0AC 2JIZD 4EPVA 2LWIA 3JZMA 4IDOA 5GJCA 1UPTA 2JLXA 3VR4A 5KPDA 2OAP1 2QAGC 4TYWA 1BMFD 2DCUA 2YYZA 1DEKA 3OHMA 3W6OA 2QPOA 2ANBA 4PFSA 5DH9A 4Q9JA 3KKMA 4PR0A 1T0HB 1W36B 2NTYC 5K8LA 3AKCA 1IN6A 4TQAA 4L15A 2DWOA 1JR3D 3E1SA 1Q21A 4Q7MB 4JT2A 2W6JA 5DE3A 4A36A 2P6NA 1T8TA 1OFUX 3NBXX 3VR3A 1LVGA 1OB2A 1IN7A 1AJEA 2G6BA 3TRFA 3GLGE 4OI4A 1P2TA 2QMEA 1T5LA 4ZI2A 1YVDA 4ERNA 2CK3A 2PEZA 5EE9A 3KQNA 4C7OA 1RFLA 2WOOA 3ZYCA 5JI2E 3PEYA 5EUQB 1KGDA 3SQXA 3K0AB 4PHTA 3QIAA 5K8UA 5CIQA 2O8CB 4LGMA 2FNAA 1PLJA 3L8YA 4HDOB 5EE5B 4A0HA 1CJMA 1XDBA 2MMCA 3GLIB 1YRBA 2FSGA 2J0SA 4LDJA 2ZQ5A 3P4YA 4KSBA 4KFUA 4Q4JB 4DDUA 3NH6A 4IHQA 2F43B 1E2NA 1A7JA 1Z6XA 2J7KA 3BBPA 4QNMA 3TSZA 3P32A 4URWR 4Q9KA 1XD2A 3U7FB 4Q19A 3D3QA 4M1TA 1AKEA 3TVTA 1SVWA 1G7RA 4ZKEA 1TTTA 2FZLA 3OE7A 2A3RA 3CW2A 1KNQA 2ZREA 5L3SB 4PZYA 4DVGA 3UMRA 5HKKD 2VL7A 4OI1A 4O3MA 2H57A 1DG1G 3B1VA 1KDTA 3BORA 2X2FA 3S1AA 2JGNA 2XZPA 4LJ7A 3RRYA 2J0UA 3L0OA 5DNYB 1LS1A 3WXMA 1OFHA 3GLGB 4C0LA 3EX7C 5CK5A 5TARA 3B13B 3DM9B 4EPTA 3RC8A 2YOFA 3TGPA 1P2SA 2NGRA 3LNCA 1YZGA 1T3SA 2ZRNA 1GM5A 4NTZA 5HE8A 4O0MA 1YZLA 3PCRB 5DISB 2IXGA 2QN6A 3AH8A 1XCGB 3SFVA 3GLHE 4B3BA 3ASYA 2IF0A 1H8ED 1UFQA 2FFAA 2QE7A 4KFRA 4Z54A 3QEJA 3OEHA 2QQEA 2GRJA 5JFGA 4OBEA 3LV8A 4Z1MA 3BOSA 1NLYA 1ZUNB 3BK7A 4M1SA 1KK1A 4LYJA 5J5CA 2YNMA 5LD2B 1L4UA 4JS0A 1UEJA 3K8YA 2WV9A 1W36C 4RKFA 2GDJA 1LF5A 3RDPA 3WMFA 2WJJA 3NKVA 5K8IA 2YOHA 5FL7D 1GITA 4WZ6A 4LV8B 1RE0A 4I99A 2QT1A 2CNWD 2KB0A 2ZR0A 3W3AA 4DLWA 3DOEA 3IO3A 4DCTA 1VYTA 4NCNA 3H84A 5HPYB 2GTPA 2WIAA 1H65A 1WP9A 4DLSA 2C03A 1X8KA 3VHXA 2JDID 5JJKA 1IHUA 2WJGA 4W5JA 3GJ7A 4G5OA 2QENA 1HE8B 4UXHA 5J47A 3WP0A 4MYCA 2GNOA 2Q9BA 2NZJA 4GOKA 4GL2A 8OHMA 1WF3A 4HLUC 3FKQA 3SBDA 3PEWA 4BRUA 3MWJA 1ZC4A 3NEYA 6Q21A 2V6IA 2ZJYA 5FTNA 1TADA 2ZI4A 1U9IA 1T6NA 4S35A 5FOSA 1ZM4A 1G3QA 3GLHB 4FN5A 2BBSA 2ZJ2A 3SJCA 2IT1A 2OFWA 1LFDB 4UJ3A 1OXXK 4MH0R 3BH6A 1QVRA 2Q21A 4FMCB 2NZ8A 4ZDJA 2ZE7A 4KYIB 5IT5A 5JJLA 1MABA 4BLOA 1XTQA 2RHDA 1HEIA 2B8TA 4Y0VA 5BN4A 4IOJA 1KNXA 3EWAA 1W5SA 1E1RA 1HURA 4EPWA 3SQWA 4F92B 3FKSA 3KQUA 3OIVA 3ADCA 2OO7A 1Z6GA 4XJXA 3FHCB 3QG1A 2HV8A 2WAYA 5KSZA 2O0HA 5J4HA 3QXCA 2MMGA 1UBEA 2DFTA 1T0JB 5C4MA 1E79A 2BDTA 3LLMA 1DS6A 2GEUA 1HUQA 1MV5A 2ZYWX 2OBLA 2KSQA 4TMWA 2ZI3A 4AG5A 5FH9A 4Q21A 1GWNA 2OHFA 2NO6A 4DZZA 2VHTA 4IRUB 1J8MF 1DAGA 1I4DD 4N0EA 2ONJA 4IEEA 2GJAA 1GVNB 5FPHA 2R6AA 4XVRA 3DDCA 3MSXA 3TKLA 1MRNA 4O25A 1YZNA 3Q7QA 1KMQA 5LD2C 2CLSA 4G5SA 2FU5C 5HCNA 5DI9A 4OK5A 1ZNXA 4JKIA 1SVOA 4HYYA 1BS1A 2BOVA 3DPUA 1ZMXA 3QBTA 4KITB 1SXJE 4Q7KA 5FTLA 4BFWA 4OHWA 1XRJA 4B3CA 2G1JA 2XXAA 3E5HA 1W4CA 5KOYA 4DWJA 1ZIPA 3A4MA 1E2IA 2ZU6A 1QF9A 5EP1A 3MCAA 2PX0A 2EU8A 3PEUA 3U3RA 3TIFA 3W8NA 2GEDA 5HE9A 1JEEA 1E9RA 2VBCA 3IQWA 4TTRA 5FUWA 2VSOA 4MGIR 3U61B 3MRSA 3HJNA 1ZUIA 3OFNA 2QI9C 1N5KA 4HB0A 2JEOA 2YWHA 5G40A 5JSZA 3CH5A 1M8PA 1YR7A 2XTZA 3B1WA 3B8HA 3ZIAA 1PV4A 3SYKA 4G3XA 4L9SA 1II8B 4KODA 3H86A 1IQPA 5C4GB 2FN4A 1G291 4G5GA 3SDZA 3FMOB 4TYQA 2XEXA 4Q03A 1R0ZA 2D7DA 1RYFA 2ZAOA 4XWKA 4UJ5A 2J0VA 2Y8EA 4RD4A 4RVCA 4NYMR 3UIEA 1ETUA 4MKGA 4F4IA 4RD3A 4HLQB 2GKSA 1NSTA 3LQRA 3MWYW 3RC3A 4B73A 3KKQA 5CITA 5FFMA 4DSUA 1DO2A 1SXJB 2OEPA 1JAHA 2QSZA 4Q4HA 2CLCX 4C3ZA 1YRAA 2PL3A 2QG6A 5TY0A 3SHFA 3QPUA 1GNQA 1GL9B 2Z4SA 3GEHA 3HU3A 1VG1A 3THXB 3V4FA 5F9HA 2AR7A 1XPUA 4MKFA 1ZU5A 1ZVQA 5FPSA 5ANRB 3A1SA 4QBHA 2BVNA 4RCYA 4RSGA 1O87A 4GI7A 4JJKA 4Q5IA 1AM4D 1S3SA 1NIPA 1G18A 2HJVA 5JMTA 1IXZA 2O8FB 3QKRB 3SJBA 1XEXA 4ILEA 4OHXA 3QVVA 3MD0A 4RZXA 4AKIA 2Q9AA 2ZROA 1EFUA 1BH2A 1KSGA 2I1VB 1E2DA 4BFZA 1VG8A 2W2XA 1G6OA 3PFIA 4PTLA 2QP4A 3SFZA 1EFRA 3EA0A 2QTVB 4XTRA 1E2PA 3SR0A 2NMVA 1Q1ZA 1FL9A 3GEEA 4UKDA 1ZD9A 1KO8A 2IYQA 1CBUA 4CEIB 4G0NA 3QVUA 2JLWA 1YZKA 2IYTA 4OYHA 1N6PA 1NN0A 5P21A 4DUGD 3WMGA 3OAAD 3MAAC 3Q8XB 2H16A 3HPRA 1EX7A 2CE7A 5JRJA 3CBQA 2H7VA 1E0JA 3B1ZA 3TW8B 2G3YA 1UM8A 2ZYTX 3THWB 3AVVA 4U00A 3U7HB 4LV6A 1N6IA 4C0JA 4P32A 1W2HA 4BGDA 3RLFA 2QMUA 5CYPA 3L43A 5GVRA 5H70A 3IPYA 2WM9B 1QHGA 3CF6R 1KSHA 1F2UA 3F3YA 1AGPA 1P2UA 3ICQB 3L8ZA 3SI7A 2YZ2A 3CIOA 4JSTA 5CM8B 4LHWA 1YZQA 2R6FA 2P5SA 2W6JD 3CUEF 3A4NA 4V0LA 5F2EA 2EWWA 2ORVA 3KTAA 1S96A 1AIPA 1SVKA 4BQSA 5H1YA 4TYNA 2PMKA 4B3XA 2CK3D 3Q5EA 5FTKA 1F2TB 4RFSB 3EC1A 4C0SA 4ASUA 2GK7A 2VSFA 3GJXC 4WAUA 2FWRA 3U4QA 1P7CA 4AYXA 1L8QA 2WJIA 4R7ZA 1EX6A 2F55A 2ZJ8A 3SS8A 1SXJC 2BJWA 4YC7A 2ZM5A 5AJYA 3EZ9A 1SULA 4PHFA 1DE0A 1VTKA 2H5EA 5BYJA 2F9LA 3K0EA 5AUQA 5TB5A 4OQMA 4B2PA 2ZJBA 2VEDA 3B78A 1RYHA 4F38A 1OKKA 1E2GA 2HF9A 1TF2A 2EW1A 2ANCA 4MKHA 4OHZA 3R7WA 3V00A 3WNDA 5JS7A 5KSYA 3BFKA 2JAQA 3TVDA 3EIHA 4HAVA 2FH5B 5BQ5A 1IY2A 5LB4A 1CTQA 2ZETA 1FPMA 3OE7D 2H1LA 2BBOA 5CB6A 4AI6A 2GHIA 4QGHA 4A0GA 5LDDC 3K09C 1V43A 3PXGA 4HI0E 4TLDA 4EJSB 1E2KA 1U81A 2CDNA 4HLCA 4B47A 4MGYR 4US0R 3SU8A 1RC8A 4ZIRB 1VIYA 4U7DA 5JCPA 4YMSA 3VKHA 2RGNA 3NC0C 1OH8A 3BERA 4Q1BA 5TDHA 3BRWD 3W34A 4LC0A 3LXRA 4F93B 4TZ6A 1N6KA 3A1TA 4H1UA 4LYHA 4I1UA 1CJVC 2A5FA 2QP3A 4DLUA 4QBIA 1AQUA 2DYKA 3U6KA 2F1RA 3FB4A 1HQCA 5G53C 3T35A 4EQ6B 2R62A 3E70C 5HZKA 2J59A 4TL9A 2QE7D 4EKDA 2DWPA 4POAA 1AN0A 4G5QA 4QJ4A 4RFVA 4ZCIA 5EP4A 1Z47A 2VYFA 3TQFA 4PC1A 3JVVA 4Z1MD 5FBRB 3KQHA 1MO6A 1F6BA 4XVUA 1EGAA 1WB9A 3CPJB 2NO0A 3C5CA 4P31A 4Q7LA 3QKSB 5DN6A 1OH5A 3O8RA 3ZZTA 4CEJB 1G20E 1C9KA 1XBTA 1YHNA 2H92A 3DO6A 2WJVA 2IEYA 3I73A 1ZCBA 2Z43A 3FMFA 1UKYA 5C46F 3CO5A 4K81B 3OF5A 5B64A 1TQDA 3TK1A 3RHFA 5FUYA 2X77A 1E2MA 2C9CA 3P4XA 3RWOA 3Q9LA 1UEIA 3QKUA 4GFDA 1ELOA 3HU1A 2A5DA 1KYIA 4FWIB 3W90A 2YKGA 4TSFD 3GJ0A 4NYIR 2BKEA 3GJ8A 4JYBA 4QNRA 1S2MA 3PEVA 1ZC3A 1XB2A 3EZ2A 2RGAA 3VR5A 3KB1A 4NH0A 4RJLA 3DMDA 2GILA 1G3UA 1NVUQ 2WMOB 2QBYB 4ZPXA 3OZXA 4CT4B 1K5DA 4KHZA 5FBVB 5KDDA 2N42A 1U99A 1UKEA 3QQ5A 2GVZC 4LHYA 4RZUA 3FWYA 2G77B 3TJZA 1SHZA 2ERXA 4TLBA 3QSYA 1VHTA 2A9KA 5H8WA 5EXPA 4ACAA 4DT1A 2A5GA 1P2VA 3EASA 3QF4B 4OHVA 3QENA 4LJYA 4C0BA 1JR6A 4TL6A 3OIYA 1A2KC 1XTIA 2CXXA 2W83A 1E1RD 3CR7A 1II0A 4JL8A 3AKEA 5JHHB 5D3MA 3FKSD 3CZPA 4EJSC 4Z51A 4HAUA 1P62B 2RCNA 1LS6A 5BW8A 1M74A 3AKYA 1NKTA 4GPTA 5LB2A 4US2R 2VQSA 1E79D 4C2TA 1HT1E 2AKYA 5FBLB 4B76A 4CEHB 3HYRA 5EE1A 4PO8A 4R71A 2IS6A 2DFLA 1GIAA 4GNKA 2GZHA 2YJTD 2Q6TA 3ICEA 4Q7JB 3Q3JB 2C99A 3THYA 1TL7C 2Q3HA 3GJ3A 4DLXA 1LY1A 1J2JA 2NG1A 2B7CA 4B75A 2XZOA 3CKLA 2F6RA 3F0TA 2AN9A 3CB4A 2NPFA 3AF3A 4DBLC 1JAIA 5CDFA 3SOPA 2IYRA 4M53A 2DFKB 2GBLC 2HXSA 3QY0A 3L0PA 4KBGA 5E95A 3U7GA 1E9CA 4FMCF 4IOKA 4KI0A 5DI3A 1HE1C 1CKEA 1N2CE 2ATVA 2C95A 3NBZC 2AHOA 1JI0A 1E94E 1XEWX 3QOFA 2V54A 2BCGY 2V9PA 3NBYC 4MA4A 4PQYA 4V0KA 4X8MA 1GRNA 4B35A 1Z6AA 1J7KA 3CM0A 3UKDA 4UNPA 1RPZA 4Q1EA 1KI8A 3KXKA 3DM5A 1S1CA 3EA5A 3KL4A 3CF2A 3T15A 4ZI3A 4A2PA 1XD8A 2HJGA 5J4YA 4CF7A 5FTJA 3WHLA 1Z5ZA 1G9XA 2V1XA 2VRWA 4A1FA 3OFND 2ZRDA 4D0NA 1Z6TA 2BM1A 4LV5B 3U3KA 2GXAA 1GKIA 3ZIAD 1E0SA 3ZVLA 2OFOA 4HDQB 1SVIA 1RJ9A 3KDSE 3VQTA 1IJFA 4E09A 2BV3A 4XIGS 3BFXA 2PJRA 4Z8XA 4BUJA 1M1YE 2RGBA 5JBQA 1A4RA 1G7TA 3CWZA 2MSDB 2WVJA 1ZAKA 5BYKA 3B1YA 4HAYA 5L8VA 1XTRA 2JLQA 4KBFA 5HZHA 1E2LA 2ZU0C 2FE4A 4TT3A 1JJ7A 4A2WA 3ZJYA 2V6JA 2XB4A 4MRRA 4F7WA 2WMNB 2YHSA 3KJHA 1X86B 4AG6A 1E2JA 4LHZA 3MJHA 1L7VC 2ZS7A 2F3RA 2J7PA 3M4YA 2ZI7A 2O8BA 2ZJOA 2QORA 2O8DB 2YWGA 1GDDA 1NL3A 4C7OB 3EPHA 1P5ZB 4US1R 1NNEA 2IS1A 2QRNA 1GNPA 1DAEA 5KSOA 3KJIA 4LBYA 1R0YA 1C1YA 4Y0AA 1W44A 2ZJZA 4PSKA 3LQQA 3QUSA 3GEIA 3EAQA 1PUIA 1R0WA 3KXIA 5KTYA 2FPMA 2ORWA 2OSBA 3T06B 3IUYA 2PEYA 4JLVA 2BM0A 2ODBA 2CL6X 4LJ5A 1FX0A 1JQJC
chains in the Genus database with same CATH superfamily
4CT5A 1EXMA 4G5HA 3B6JA 3QBVA 4B74A 1KEEA 4D45A 3C6YA 4LECA 2FN7A 4BLSA 5K2OA 1J5EB 2WSMA 1PR0A 4PCLA 2VSNA 3AI7A 4Y1RB 3D3WA 1G5IA 1N6NA 1FTYA 1Q7TA 4OMCA 4TTQA 4URFA 2PKYX 1XD2B 4IQFA 4BLTA 3DWFA 2QGFA 3A3OA 4L9AA 1W87A 1YS1X 4OP2A 1FZTA 2AMVA 1UKAA 1I1HA 1CNMA 2IUSA 5DBIA 4DPKA 4FQ5A 4MR7B 2Q1TA 2ZT8A 1G0OA 1N6LA 1T91A 2EOAA 2AR0A 2EW2A 1NQUA 3ME5A 3OQVA 3RK0A 2YC2C 1PL0A 3SBEA 7ADHA 1Y6JA 4MITA 4QJ5A 4JLUA 5K8VA 4IYJA 2P9YA 3AX6A 3C3DA 2BGGA 3G0OA 1I4TD 4JJZA 1GFZA 2REQA 2AWNA 4X66B 5J2TF 1B6GA 2VPPA 621PA 3EGXA 1SB9A 1R50A 3LWNA 3NIFB 1E3MA 1PTJC 2QVGA 3LU1A 3JQPA 1DBQA 1TK3A 2FPPA 2YMMA 4IJKA 5A05A 1M9NA 2HHCA 3B52X 5IULC 4C2AA 4Z53A 3TGLA 5I51A 1XYGA 4HQ6A 4LSMA 1T8UA 3GFPA 3LH5A 2BFWA 5SV2A 4RELA 3HWWA 5E0OA 3L4KA 2BMFA 1KMHB 4DA8A 4D6XA 4LMAA 1PFKA 3STUA 5LYJA 5L3QA 2QNIA 3PWTA 4U1RA 3E48A 2G82A 3C7KA 3N7TA 5BNWA 2O8CA 1SUPA 5IRCD 2QRHA 1H0HA 3Q40A 4CIXA 1U1EA 2JFHA 5I4CA 5DOZA 3K2IA 3SF8B 5FWYA 1WZNA 1FW6A 1TZJA 1JHZA 2GVDC 4HUQB 1BW9A 4UCFA 5IW8A 3VMFA 2J3JA 4ASUD 1G8YA 2QROA 5EJ5A 5LR6A 1NJGA 3G7NA 1A7UA 2HDWA 2DXIA 1DOAA 3LFUA 3ORQA 4Q4JA 4AJKA 4WNIA 9LDTA 1UMCA 3DL4A 3WL8A 4Y6PA 3UG7A 5ALXA 3REFA 5SZIA 2Y77A 1QORA 3NTOA 4DANA 1L4BA 1BGWA 4RY9A 3UWKA 3H9CA 4E3ZA 5J2UF 2P11A 2HDHA 2WU8A 4N39A 4NYIQ 2ZUTA 4EFMA 2W2KA 3S2FA 2P9FA 2D1SA 3Q6MA 5DHPA 5LMUB 1GGMA 1OKKD 4YS6A 2IOHA 5AUPB 2E6KA 2BT4A 3EDCA 5L3SA 2CLLB 1P7YA 2B0CA 2ZWAA 2OXFA 3QG5A 3QVGB 1JPNA 2Z5FA 3KWLA 1SIWA 2WJWA 3AF0A 4KX5A 4PS0A 1UMBB 1OBCA 4UBLA 3V7UA 3MCUA 2BUAA 4HV4A 5JWRA 5K0FA 3RKRA 3QVOA 2OGTA 4C0XA 5K7SA 1UH5A 2P3LA 4Y6SA 3TTWA 1T10A 3RYCA 3I9V6 3UJCA 3U62A 3GLGA 1AUQA 1G3IA 5SY6A 1MAVA 1V41E 2FEPA 5AJUA 4A8JB 3F9IA 2BTQB 4ND6A 5G3ZA 1JSZA 4ROSA 5IM5A 5BW5A 2J1LA 1ZL2A 3W5IA 4R98A 1A9YA 2G25A 1MABB 1KY4A 3PDUA 3UK7A 4BP1A 2V6MA 1B1CA 2DR2A 1SQ6A 2GGSA 4QDTA 3I34X 3G9UA 2C2ZA 3K6RA 4GRIA 4YDHB 3A27A 2G1KA 3TBHA 5K8JB 2A92A 2WEKA 3WRWA 3U5ZB 1HETA 4NMHA 5I7OA 2OGZA 5LP6C 2Z6QA 3MLAA 4XQCA 5FXMA 5HEKA 3QMPA 4IIGA 2ZRGA 5EE3A 4JL5A 1JHUA 3L1HA 3M3PA 5KVVA 1T4BA 5JEDA 1ZUNA 4PYMA 2A9FA 1S0UA 3MPUA 4Y2YA 3WVNA 3CNNA 3X0DA 2O2ZA 3CX8A 4XYLA 2WDPA 3D7KA 1M2WA 2GD0A 2VZLA 4DREA 3O2QB 4ZGGA 3ZCQA 1U7UA 4U5XA 1YR9A 4HQOA 1UKBA 4U3JB 4M7OA 3DAHA 2IA5A 1QHNA 1U94A 2JFFA 1U90A 1XQXA 2DH5A 5KB3A 1YSCA 3QNUA 4XAQA 3R44A 4YP0A 2A5YB 2FRDA 5DIFA 2BEUB 1S2LA 4Q4AA 4Y2RA 5AKIA 5FX2A 3ABOB 2A0XA 4O2BB 4C6TB 5IX8A 3PCTA 2C2WA 1KOJA 3QTLA 3T4XA 3WNBA 2RJOA 5IBPA 4GMXA 3AW8A 3OHPA 1EFVB 2R6HA 1I6MA 4D0SA 2ACVA 2GZRA 3JQGA 7AT1A 2XMZA 5FBKA 4EUKA 1K6IA 1R12A 3OG9A 3OLYA 2C77A 1COWA 3ZK8A 4EVQA 2IEDA 2ESRA 4AZ3B 2I1LA 1PL6A 2NP6A 1LB1B 1RWNA 1RI1A 4HGYA 3AL2A 1KI9A 2NV2B 4ER7A 2IEIA 1KQFA 2I3GA 1CJKC 5EAIA 1K2WA 4EY5A 2ZB2A 2DPLA 3FPAA 1GAWA 1LBIA 3L41A 2JVJA 3LGSA 3IVCA 1G21E 3B1XA 1E9FA 1Z08A 3AINA 5AJVB 3T34A 2BELA 4DPLA 1M2GA 3G9QA 2HW8A 3TIVA 4GOOD 3RTAA 121PA 3HVUA 4JEIA 1IK4A 5FOWA 5AM1A 1SOVA 1ECPA 4K9OA 2QMOA 3NOQA 5CYOA 4TMYA 1K7XB 2G06A 3L04A 1Z36A 5KYWB 3AVOA 1OWMA 2F00A 2QMZA 3M6AA 3DE0X 2P4QA 2Q6VA 3QFTA 3UW3A 1NOKA 4A15A 3FLEA 2RKWA 2GO7A 3VA7A 4MV6A 4JJ6A 1K4KA 1RPJA 5FJJA 2C97A 1BXRA 4IAOA 2IZOA 4DMUB 4M0KA 4YR9A 3PICA 4MZDA 2Z6VA 1DADA 3LK7A 1OZFA 4WSOA 5IJ9A 1L6RA 1EDOA 1GPJA 1D2AA 5KNDH 1Q91A 3DFMA 5K4HA 4W9MC 4J29A 4BNZA 1Z0JA 4NF2A 4B6EA 3HHPA 1JZSA 1DEAA 4TRRA 2JI4A 4YASA 5CB4B 4HSGA 1NZDA 3CRZA 2P75A 1E9BA 1CIJA 4L4XA 3GO4A 1X9GA 4JYCA 4WCFC 3IE0A 1O95A 2C94A 4FGJA 2NUTA 1TEHA 5JYDA 2SCUB 4IJ5A 1LU9A 2H8GA 4YQFA 2IIQA 3TTUA 4RKYA 1N5LA 4YJ2A 2PLWA 3L0IB 2WKPA 3INTA 3OFSA 4E1AA 5IZCC 3W4JA 2JGDB 3ESDA 4ZALA 5HK9A 1L7NA 4A6PA 4AO6A 4HGQA 3L4JA 1Q0UA 4Z7OB 1SBHA 1YIOA 3T1VA 2F3QA 4IMIB 4YI3A 3I6MA 3ZZ0A 2NQ8A 4FW9A 5KOJB 3G02A 3MS2A 1Y1TA 2QYHA 2IE0A 2PSEA 2ZJAA 3U3OA 3F3SA 1HQDA 1ZM2A 2AD5A 4LDZA 4NV0A 1KKMA 5BWCA 5GVSA 4UTRA 2O0MA 1D5CA 2QRJA 1QYRA 1BVRA 3A4LA 1ECFA 3ECCA 4IJMA 3RHTA 2QVBA 3ETJA 4LJAA 2WZQA 4XA8A 3S2EA 2IS2A 1V7ZA 1OLSA 1ZRSA 2J3DA 1O4VA 3ZD9A 4KW7A 4KUEA 1T34A 3EOAI 1X6VA 1V5WA 4AWXA 3I6BA 1AX9A 3L8HA 4MYHA 1OSNA 4QTTB 4Y0NA 2LPMA 3IKJA 2I66A 2DB3A 2OL4A 3FW1A 1PF7E 3ZE7A 3DMNA 4IMJB 2B8WA 3LGAA 2VHCA 3NMUF 1W4ZA 1TQ4A 2O0KA 4DW8A 2ZUDA 3P27A 3G68A 3WGJA 2VRCD 1U1GA 1PW5A 3D5QA 1M2VB 3GUCA 2Z08A 3UMFA 4MYTA 4JEHA 2D1YA 2C9YA 1CQWA 4V0RA 2AFIE 3M6XA 3MCTA 4W63A 1M72A 1MX3A 3HADA 1EFCA 4C7VA 1EIZA 2C9DA 5HX7A 5K0ZA 1XVIA 3GAMA 1S9DA 2AXNA 2JI9A 4KH0A 4XFJA 2V7GA 4GX0A 4KN6A 4TVOA 5DM0A 3RD5A 3RW9A 5K20A 2JA1A 4IVRA 4I5FA 2IYFA 4Q18A 4QYSA 1R6BX 3SS9X 4IXNA 2XE4A 1ZUHA 2FW6A 1U3DA 4TTIA 4URVR 4IPTA 2JS7A 1N3IA 3E53A 2POCA 2P65A 4PLVA 2C61A 2XDYA 4OPMA 1M83A 5AVZA 1QO7A 4BJ1A 4DIKA 3DL7A 3JRWA 1EHCA 1RKQA 4Z4FA 3OP1A 3EIOA 3MBIA 5KINB 2ZOSA 4AN4A 5GONB 4GUDA 1U9YA 1VIVA 4Z9BA 3T5TA 3WLQA 5EJEA 3GJZA 4YRNA 3KOWA 1VL5A 1ZHOA 3OVMA 3WGMA 1WXQA 3ZTTA 1S2NA 2I6TA 2VHVA 1Q22A 2ZPUA 4FBGA 2EP5A 4BVBA 4C9BA 1VCNA 2QN2A 3IBTA 1WDMA 5IH3A 4PSAA 3TGWA 3D0RA 5BR8B 3H19A 5HGXA 5JJLA 2ZSUA 3DPIA 1FFHA 3A6LA 2CXHA 2IXAA 1KZGB 1CJUC 1JDTA 4BFYA 4DTIA 3E7XA 1P3JA 1BJTA 1Y80A 1PG5A 2HV9A 2DECA 2QTHA 3IXQA 2XUJA 3QUBA 3WNCA 1Q0LA 3Q7TA 1BA3A 2DBYA 4IY1A 3EY4A 2FW7A 1P29A 1QRDA 2VXBA 3H4MA 3OZGA 1XVVA 4EX7A 3C3XA 1YZ3A 2YWJA 1HY3A 2FTKE 4FM9A 3RAEC 5P8WA 2GESA 4OV6B 3G49A 1Y8CA 2R4QA 1G60A 3JASA 4F2GA 1VYVA 2AKAB 2I6UA 1BWQA 2L17A 4O2AF 3J7AC 2A9JA 1KI2A 3FCEA 4YB8A 3PVSA 4BAUA 4E7PA 5AVXA 2W2LD 1JSLA 1A98A 3EZXA 1QIHA 1WSAA 1QO0A 2D2FA 2Z5VA 3KB6A 1PT5A 1O97C 3UXMA 1X8XA 4MQ6A 4JVNA 4LOKA 2OWDA 4QEKA 1ZYUA 1UJMA 2QL9A 3IA7A 2P30A 1CRQA 4CIVA 3IKTA 3OTOB 3A1CA 1C0LA 1Z0SA 4PAOA 1L8LA 4N18A 4A9AA 5LVAA 1LPAB 4I9UA 2J3LA 5J4LA 3W8DA 2GBGA 1YZFA 4HDMB 5HCUA 4Q12A 4QJ3A 4CL2A 3RK1A 3RYFA 5AFSA 3Q8LA 1QRTA 2C5EA 4Z4QA 3WLMA 2CVOA 1MVNA 2X7HA 2M6SA 5E6UB 4YT4A 2DFPA 4BUCA 5KYYA 3PCXA 1QIFA 3AVTA 1DAHA 1K27A 1R8SA 2XTNA 1WU8A 1ZIYA 1RHMA 2C4HA 5JE8A 2V7WA 1PD1A 3B82A 2OCDA 4OQZA 4YAFA 5SYMA 1W48A 1Z8NA 1ADCA 2F8LA 5DW0A 3NJ4A 5K0EA 1DZIA 1NJ5A 4H7IA 1XA4A 4XFKA 3IDZA 4QSMA 3RABA 1JX6A 1XWIA 3RSZA 3LTNC 1ES9A 1X74A 3CUSA 4MI9A 5FWXA 4E12A 2V3CC 3SEAA 3HJFA 4Y2VA 4D5GA 2JIQA 3RBVA 3AM1A 4M1KA 1E4YA 3QWBA 4EKYA 5BPHA 2B5VA 4FKBA 5H83A 2FX5A 1LA2A 1P2DA 1UAYA 1YB6A 1KMMA 2WICA 3A9UA 3M5CA 3NVMB 1YZUA 1OLUB 3PUYA 3CSSA 5F21A 3V8BA 4B6FA 5KWVA 4R1TA 5FEMA 3KP1A 4RFSA 2J3MA 4GT1A 2J5RA 4YMIA 1L9KA 4N0PA 5C1OA 2WKRA 1MOPA 3UCXA 4KAAA 1P1FA 4XDYA 5A9TA 3W7BA 4DLRA 1T3ZA 2AMFA 1EP1B 4FBMA 3V32A 3TUZC 1KPGA 3NHFA 3WZ2A 1AQLA 3FUTA 3G6KA 2IV2X 3B9BA 4RF3A 4DILA 3U19A 1L4KA 1P9NA 4MR9A 5LLDA 3C6QA 5FA8A 3UA3A 3BMCA 3ZLBA 1CB0A 3JX9A 5TNXA 5KUTA 1J0CA 2AFHB 4NULA 2V4MA 1ULTA 1UBKS 2I62A 2V4ZA 3LX8A 4OYLA 2XCOA 5DO9A 4AY2A 1YQDA 1EDEA 2ZGVA 3W05A 1SC3A 1ZVJA 4EJMA 3KD3A 4HATA 4H6XA 4HNQA 2QGNA 2QU8A 1O1YA 4CXMA 3B51X 2FOIA 2WU3A 1NVXQ 2RHJA 4UHBA 3LJKA 5ARCA 1NONA 5FFNA 2J3EA 1VMIA 2JGRA 2QUHA 2JIOA 3GRFA 2Q46A 3LPLA 4G25A 4L1KA 2MINB 4RCVA 5JNLA 3I3OA 1ZH0A 2OSVA 2ORYA 2X1LA 5H68A 2J3HA 1PX0A 2CL7X 5IM4A 4EPVA 3ITEA 1USGA 1N4DA 4PNHA 4G9BA 2MSWA 4URUR 3RODA 4X3OA 4X7MA 3AU8A 4KEAA 4M88A 4I3FA 2DBQA 2A88A 2Q27A 3JTMA 5C1PA 1GCOA 4F45A 1YDWA 1FMLA 2CNDA 3TTYA 1L7DA 1SUBA 2ZRLA 3LD9A 4IJWA 3WIEA 3Q8MA 4K9LA 1P1KA 1WUYA 2VRBA 1PYDA 3FX2A 3FXAA 3K2BA 4FHFA 4Q1AA 3VAYA 1PJRA 1NZFA 3E8MA 3U3ZA 3TLXA 4W6QA 1WXIA 3UV7A 3O6VA 2ILTA 4NNPA 2C1EA 4O4HB 1O58A 5D87A 5EUCA 4NOKA 2YY7A 3RVNA 1T4GA 1TM5E 3A6JA 4KQGA 4MGKR 5K9ZA 2R85A 3TQRA 5IAEA 5KNLA 4TRJA 1US8B 1NC1A 1TF5A 1DWPA 3O94A 2CJWB 5EQTA 5LMZA 3OM0A 5IHPA 1ODFA 4K8OA 2NVBA 5D3MB 3FOEC 2GEKA 2OKCA 2P7HA 3PNQA 3DR5A 2Z83A 3VHLB 1J20A 2YDYA 3QVLA 4FOTA 1BCRB 1ZEJA 4TXJA 5TMDA 1BOOA 3OJ0A 1EG7A 2Q1WA 5AI5A 2D1RA 3O8DA 1WMBA 4CCYB 4KXLA 4JR2A 4CEJA 3EXEB 3VU0A 2J8ZA 3AHHA 4ZYTA 1EUCA 4BLUA 4MTCA 2EFHB 4UQPA 5CA1B 3PR3A 4HR7A 1OGYA 5F9MA 4FGKA 1AS3A 3GT7A 2PLNA 3JYQA 3W79A 3KYDA 1LVUA 4K9NA 4LDQA 1X39A 4PZCA 3HA3A 3BJIC 3IEUA 4DJ5X 1HQYE 3DZDA 3ITNA 3GU3A 1OUMA 4EK9A 4Z5XA 1GKKA 1R4NB 3CNOA 4Y2PA 1U0JA 2IDKA 4RA6A 1WUTA 5CT5A 2VPTA 3DO5A 4HWPA 5HWSA 1Z4LA 4LNAA 5M5BA 1H8HD 4MVJE 2C59A 1ISGA 2WSYB 3COPA 4R2XA 1U8CB 2Y6VA 1JQEA 1TTHA 2HPAA 4A6XA 4Q3NA 5CJPA 1UKZA 2W6ID 2YFQA 4FXPA 1N0VC 3C5HA 4MXDA 4WLOA 1DKMA 2Q0XA 4EZEA 1QFXA 2CLDX 1C9EA 1X2EA 4UUNA 3DAGA 5KJEA 5LCXA 1EVQA 4G1CA 1NN5A 4FHEA 4WEQA 3NP9A 4UPEA 3UJNA 3HXTA 4PZPA 1YOVB 1A8SA 3NQ41 3BD6A 3S40A 3DTYA 2R6GA 5BSFA 3ZY3A 1N8SA 1XCBA 2BSAA 2EFJA 3CNLA 3NCHA 2YJ4A 5EJMA 3ZTWA 4HQKA 4JENA 1C7FA 2BONA 2FZEA 4P08A 4BO6A 1WQ1R 1E8NA 2AW3A 3BTUA 5FI5A 4HEQA 4DA6A 1NF9A 2HBZA 3BVPA 2FMXA 1Z4JA 4CDMA 2FUKA 2NSYA 4JJFA 4KDFA 4M9QA 3RSHA 3EGDA 4Y67A 2JFGA 3E9DA 2W37A 1T8PA 5J3JA 1GXSB 4P4SA 4JXKA 1TMGE 2CJFA 5FNZA 1LDBA 5LZ8A 3C39A 3EGEA 4B6JA 2ZZKA 4RDXA 1SWVA 1Y4AE 1K9SA 4PO3X 5K6AC 1IM2A 1K8ZB 4OMUA 5IN4A 4OXIA 4LTDA 3UV6A 1DIGA 2J9RA 4L0QA 1RHRA 1EX1A 2WJ4A 3DR3A 2RGWA 2A9RA 4IDEA 1OJ7A 4WZBB 1UFOA 2FW8A 4QYWA 2VDLB 1C0IA 2IP2A 3P1JA 1RJ9B 1UDCA 1XVTA 3S5UA 3JQFC 3GEBA 4L5AA 1TT5B 2IC5A 5BSUA 5TVKA 1AKNA 4CEHA 1ULBA 1JA9A 5KC8A 4ESHA 1RQXA 5JFTA 4A6DA 1H42A 1RQRA 3DZJA 3I9JA 4R1LA 3B2QA 2YRFA 2VP0A 3E9YA 4X1IB 5F2KA 4EF4A 2GEJA 4AICA 2G0NA 1ONOA 4G26A 2DBZA 3ZZUA 5AJWA 1OX6A 3GJQA 1K97A 2ZUBA 4ZV7A 5AW0A 4OLBA 4JITA 3L01A 4MUAA 2VK2A 2OD9A 1PRYA 5JATA 2OV8A 3LDFA 3RTBA 4XPZA 2GK4A 2J4FA 4B4WA 4MGHA 3HBLA 2QG4A 5EZ5A 2YWXA 1AZLA 5CA0B 2PKXA 2PGXA 3BXOA 3H87A 3JWHA 3NIGB 1JB1A 2H1SA 4FGSA 1IMOA 2Y1DA 4ALNA 3PE3A 1P4GA 3DEAA 4XD7A 3H9EO 1LTQA 1MRZA 5MF6A 3B6IA 5EJ7A 3FTCA 4MHOA 1WXXA 3PXCX 1POWA 1NYLA 2I3BA 3LRXA 4Q05A 2VT3A 4DMGA 5F1YA 5K6RA 3P8ZA 3VR2D 1VZ2A 4D57A 4CLRA 1M6VB 3TLJA 1U2PA 4BRWA 1RCFA 1Z15A 5DSZA 5TLSA 4JI0B 1JNYA 4RCZA 3W9SA 4D3ZA 1MH1A 5MHTA 1ZR2A 2QTRA 3ZJ4A 4F3YA 4RGVA 3LPNA 1WV1A 1KVRA 3GZ4A 4DCUA 4LVNA 5CVEA 4Q9LA 3EQ9A 1M0SA 1NQAO 3ZBUA 1SKYB 2CT8A 1FX0B 1O6GA 2YWRA 3SKXA 3TE7A 4BY9E 5CCXA 1L5QA 3UWSA 3F3MA 1FDWA 1MO3A 3D1LA 3ASUA 3QPBA 3FOBA 2GN6A 1K6JA 3QLUA 4ZAWA 1VG0B 2OMKA 4A8HA 4AQYB 3WLFA 2Z2JA 3BTOA 3OZTA 3JD1A 1F4PA 5ALIA 4HWRA 2VJCA 4MRMB 1U2SA 1ATIA 2I2FA 4QFBA 4DC0A 1KFEB 2WP0A 2QEQA 2KMLA 1LJLA 1SZJG 1WPXA 3HDHA 3NBAA 4OQYA 1QCDA 4Z0TA 3STVA 4LYGA 3AVWA 2A86A 3O82A 1YMQA 4PW0A 3FPJA 5HA5A 3OQNA 4RWEA 2W2QA 3T99A 4ER6A 1FP7A 3VX4A 3MS7A 4LX0A 2HB6A 4V1CI 3C8ZA 4R8VA 1IM8A 1AG9A 3I4LA 3JATA 3OC0A 4QYIB 4XR9A 4LC1A 3F1LA 1KIFA 1L4FA 1QJ4A 1Z9BA 4HLNA 2VNIA 4R6WA 3WB0A 3ZEIA 3ZDXB 3MQFA 2P35A 1EBUA 2JFOA 3OQIB 4WFQA 3TLKA 2WU0A 4JZKA 5K8CA 3P0IA 1N2CA 3H0EA 4MQLA 4K9KA 4BFVA 1E1CA 2G36A 4KQKA 3IIJA 4ZD6A 1Y3BE 1UCFA 4OHFA 4AZTA 1W0KD 4DDWA 3X1MA 3KSBC 1G42A 3BE8A 3DZBA 3HA2A 1VZ3A 3QELA 3K05A 2X0IA 1MB9A 6AT1A 3PUWA 1M2OB 3GEGA 4KVFA 2EGGA 3GHHA 4F8YA 4JROA 5E7MA 1U8XX 3W3AH 3PI6A 5AR1A 5C1BA 4PC7A 2O8DA 1F0YA 3ZWNA 1Z34A 1ZNYA 3OKCA 5HTOA 2I7VA 4BX0A 5CEFA 1W85B 4MIYA 4CF3A 2IU0A 2WIBA 4MYUA 3RREA 2PMCA 1CQIB 1QYVA 2HK7A 4R1SA 3TDNA 3SM3A 1RD4A 1RRPA 5HOEA 2GAAA 2WJPA 2QPAA 1TI7A 3I05A 1QYCA 3DL0A 4V02A 2IOYA 2NO7A 1YUMA 3AVQA 3QHAA 8LDHA 3NBFA 1KOFA 4GLFA 3OWXA 4FDTA 2C04A 1QQTA 2QTTA 3O0TA 4Z99A 5BNFA 2D5LA 1C4OA 1QTRA 3EH1A 1ZMTA 2BFEB 2JVKA 4JLBA 3DMHA 4LEIA 3SQMA 3JQBC 1QB7A 2CFCA 2ZQZA 4PLHA 5LOVB 2W2NA 2WUGA 2Y4NA 3F96A 3VU8A 3AEKB 2WIJA 5JS8A 3CZ9A 4HLUA 1ID8A 3QEAZ 4XRGA 1I0ZA 2XGSA 2G1PA 2IYVA 3P2MA 3OZBA 5HFNA 1F1BA 1PDVA 3KTFA 1V8ZA 1YDGA 3DW3X 4JLAA 1QH9A 3HY6A 2FFHA 4KACA 4ZVLA 1H22A 4IOLA 1JWBB 1ZGZA 4QUEA 2M6KA 4D0LB 4BWGA 1A69A 3GLIA 3OZRA 1V37A 2WYIA 3O8OA 2B98A 1W73A 2WTMA 3HKBB 2RJ3A 2ZWMA 3USZA 4BMOB 2VTKA 3TFWA 1F3LA 1OC2A 3EFOA 3Q5DA 3CO0S 5JVDB 2P6PA 3BBLA 3IB6A 1RMQA 2JJ8A 4INJA 1NSFA 3OETA 3SX0A 3ZQJA 3A8TA 1ILEA 2H6EA 2XPCA 3EQ8A 4ABYA 4F21A 5LDHA 3LDAA 1TX4B 4L2IB 4LPKA 1V5FA 2XSZA 3NT5A 2EFEB 1Y4DE 4N76A 1MEJA 2ZBVA 1EWVA 1NW4A 1W1WA 1XLVA 2C7GA 3R6TA 2PL1A 3EXFA 2IYPA 3V6MA 5F3WB 1PK9A 3B3AA 5CH5A 3HU5A 4R01A 3PEEA 5FOXA 4E32A 1E6EA 2VP6A 4Q37A 1Z2AA 2FSVA 1K6MA 2RHBA 2OFXA 5BMVA 2ZRCA 3MB8A 3R3VA 5J5AA 1S8OA 4XQGA 1Z06A 2MYTA 2JIMA 3AFIA 3TPFA 3O95A 3I9NA 2WSIA 3MILA 1QQ5A 1DKLA 1OMOA 4IW3B 3OEEA 4HNTA 4LJ9A 3AWIA 1P7WA 3Q72A 1TE2A 3RT1A 4LBWA 3AEYA 1D5WA 2PAAA 2JKZA 3Q15C 3GUVA 2BGJA 3HEMA 4NZNA 3TMYA 2CD9A 1UK8A 2ZULA 4NCIA 1JDBC 1A5BB 1XXHA 3QI2A 4R31A 2YY5A 1D2MA 2RKOA 5BN3B 3N3BC 4QLAA 5SY9A 1RDFA 2D00A 3C5EA 4L0CA 2UVPB 4YJFB 4Z3DA 2R6DA 2OCLA 4DEVA 5K0TA 2QJRA 4LMBA 1ZI8A 4JQCA 4YIHA 2PMEA 1KY3A 1IL0A 1U8FO 2XR1A 3FRJA 3I2IA 3NIDB 4P4NA 5FHRA 5HILA 2BGRA 4ENTA 2PCJA 1W6UA 3EULA 5BR1A 3AHFA 4U7FA 2M9MA 1RLJA 3IE1A 1IHPA 1N8TA 1P60A 1CZKA 1KI6A 2AOXA 4YV7A 1T15A 5JAUA 1S3IA 3MZ0A 5A6VA 1R88A 3LAWA 3D6HA 1H4VB 3TEMA 1ESCA 4WI1A 1UKCA 3ILVA 2FOLA 2O1XA 1EYZA 2FV8A 2LZ0A 2ODTX 3H13A 3OLXA 2XOKA 3JPYA 3UFBA 2D7JA 1MQAA 2G83A 3K0CC 2GK6A 3O8LA 1ZNWA 3A2KA 3BXZA 3O8CA 3RUIA 1KAQA 4GP9A 4OQQA 4P3NA 1KZ6A 4DA0A 4EYKA 2H7CA 5JNWA 2P9CA 1VA5A 3VDNB 2LW7A 3CF4A 3R7DA 3I01A 2HSEA 2DX7A 1JDPA 1JYFA 1SCKA 2QTFA 5REQB 3EF3A 3ZXIA 2I1QA 4G65A 2IXEA 2QV7A 1QK3A 3KJGA 1P61B 4DMFA 3ROKA 2BFBB 3HFJA 2WG1A 3BB1A 2BFDA 1KSJA 2AX4A 2CMDA 4LRUA 4Y7DA 3OLCX 1SU4A 4JBLA 1W35A 4PO9A 1S7GA 5ALTA 3THOA 3VR6A 4IXTA 2EKDA 4YRMA 1Q44A 1Z5WA 1RWOA 2JBAA 3W6UA 4F06A 5AI6A 1QHHB 2W93A 1BAPA 1ZD4A 2HPVA 1X77A 2WZBA 5FA5A 3VPBA 2ZPTX 2BLLA 3LT5A 3IIEA 5ICMA 3INNA 2XNDD 1IBCA 4PYQA 1FUEA 1NU6A 4GM1A 1UBLS 5FOQA 2R8PA 1GPMA 4LQDA 5F35A 2RH4A 1MUUA 3K0FA 3HR7A 3PPYA 5GPBA 2OM2A 4MRSA 3ZU2A 2OFPA 3VJLA 4IR7A 2CB0A 1FSSA 2RAPA 3CNHA 4IQ8A 1VOTA 4S12A 1E7QA 2AJLI 5DMHA 2QVCA 4IKEA 5DX0A 2JKYA 2WVGA 3I92A 4PANA 5ULLA 3OCXA 3WSWA 4CQMD 3U1BA 4JJGA 2DOKA 1QP4A 4BNFA 4LDNA 1GPUA 4QOFA 4RK6A 1E5XA 1T4CA 1Y5NA 3AR5A 4XB1A 5ECGC 3IT3A 1INLA 2D4AA 3IT2A 1TJ5A 1QLHA 2VHZA 1GR1A 3DOHA 3M6WA 1R4ZA 4YV2A 4QU9A 5KYGA 1E6CA 4YP6A 4IV0A 4RW0A 3ZCTA 3DZGA 3L8EA 2XVAA 3L6CA 3R75A 3EQZA 4XWAA 4CRWB 2J09A 1XE3A 4CGZA 2R2GA 1GP2A 1BO6A 2ERCA 2MIIA 2WPDD 3E3MA 2D06A 5JCOC 2X86A 3KKPA 4AY5A 3ZVRA 2BH2A 3D6MA 2IEAA 4J1QA 2BDEA 2GD6A 3UMBA 4PIPA 1IDOA 4C76A 4A82A 3R9XB 3I61A 4DR6B 5IJ0A 1G16A 4EL0A 2PT7A 4N40A 3TVYA 1WHSB 2OE2A 3U81A 1GOTA 3QFFA 2D1TA 5CLJA 4FB5A 3SJZA 5HMLA 4YCCA 2IXTA 1MB4A 1KARA 1NASA 4YJ3F 4U63A 2QD1A 2AC2A 3Q3HA 4YDRA 1IHXA 4BC1A 4HT3B 1YJAA 1Z29A 3SLRA 2FWNA 1OFGA 3RVOA 3MBOA 4J16A 2CY0A 1PSZA 2Q5FA 2ERYA 3IVMA 4NONA 4X1KA 3H4IA 1NF8A 3PQEA 3T5GA 1Z3CA 3IR7A 4E14A 1KEVA 3U7QA 3ND8A 1IVNA 2GN2A 1J0BA 3ST7A 2IPMA 4EBBA 2DQKA 3LWDA 4WN9A 4CMGA 5JQGB 4BXOB 1CUBA 2ZKIA 3O91A 3LHIA 5JD6A 1JEDA 2F3UA 1E1QD 2P2LA 1EWKA 1II8A 4KB5A 3NP7A 3IHLA 1LDEA 2JIZA 2X40A 3HKDB 3BYZA 3P0EA 4IFEA 4BS9A 2EP7A 3DKKA 1B6TA 2DGDA 1P77A 3BQMB 1IBRA 2GTHA 4WOJA 4JOBA 4NXMB 4DV7B 3IUMA 2QPTA 1JILA 1PLLA 4JGGA 1WWKA 2JJ1D 2YHIA 4URZR 1QIDA 3FCYA 3P2OA 3UK6A 3BRSA 1MJHA 1OU0A 1PT8A 2LR0A 4GG1A 2PUHA 1IPHA 2VAMA 2IIPA 2RI0A 1L0BA 3IV9A 3T4UA 4AKEA 2D5CA 2IYEA 4JP5A 2G0AA 3TPZA 4AULA 4CLOB 1AKRA 3GPDG 1O6CA 1K0UA 3N0RA 4KG7A 3QPWA 4MB6A 3VR0A 1QDEA 4B9EA 3ZVMA 1JR3A 1PW7A 4QOSA 1UFRA 3DF7A 2BUCA 3UAWA 2ZYUX 1JIKA 1OTHA 1SXJA 4WASA 1FYVA 3EVCA 2XB9A 4LMRA 4RABA 5LQUA 4W7SA 2CW5A 1OA1A 4P0TA 4RHTA 1KTIA 3AZPA 3PDJA 3HCDA 5IK2D 1W5AA 2B7BA 3OZEA 4EI7A 1KYTA 2F2TA 2R5NA 3IXLA 4IFIA 1JHDA 4BWFB 5FPQA 1I6WA 3THXA 1BD3A 1N6HA 1O6ZA 1KAEA 2C7PA 1SQSA 2YJGA 3HYCA 1NYRA 1XK6A 1RYYA 4DHEA 3JQRA 3QX7A 4QPCA 2RAFA 1WMEA 4KSCA 3NTQA 3TN7A 1D04A 4NCKA 3GOHA 4FMDB 4MYRA 4ZO9A 3HUFA 1GJRA 1EXDA 3UXEA 1MXFA 1ZRMA 1JHYA 2J87A 1O08A 4QRHA 1B4DA 4QYXA 1W1IA 2HMVA 3L1KA 2ZUCA 2RHHA 3N86A 3NC1C 1G5QA 3UWDA 2HRRA 4FQ7A 2VF2A 2Y1LA 3K09A 3M5DA 5EZYB 1WNFA 1GGJA 3ZY6A 4B2YA 1I2DA 5JNRA 3SDSA 3QE9Y 4R2WA 3M1LA 3FYHA 4HB4A 1PT9A 1P2FA 2XNSA 2CDAA 5C18A 3U4DA 1Z22A 3FOFC 4K03A 4NMXB 5JMOA 2ZSFA 1UDWA 1ZPDA 1PI3A 2Q5EA 2AQHA 3CLTC 2EJWA 3L8CA 4I9HA 3F6RA 3FTPA 4LZLA 4AXXA 2FE1A 3UUEA 5HKKA 1S7CA 1NM5C 1NQXA 4RNCA 1NN3A 1YA8A 1WMSA 3HLTA 2UUBB 3LVRE 4P7GA 5B58C 2ZSAA 3E6AA 5G0WA 1EESA 1PFWA 4C06A 2CSXA 5DGXA 2OO5C 1YI8A 1YBMA 3FHOA 3Q7RA 3VOSA 1KVSA 2OGUA 4Q24A 1FQKA 3FMGA 1XRSB 3TX6A 4RMJA 2UXCB 1RWQA 5IAOA 4OHYA 4JLKA 1E3SA 3F5FA 4PF1A 3P52A 4FK8A 4URHA 3ZV5A 1TA9A 3DFFA 3LW8A 4MS4A 3ZWDA 1GY8A 3GRKA 1OBOA 2ACWA 3HA5A 3LCCA 4UQOA 4B43A 1SXPA 1JQLB 1PL8A 1OVMA 1TA0A 3V7YA 2QD4A 3OZFA 2GCEA 3WFJA 4AKGA 4L6CA 5SZJA 4DL9A 3MMSA 1G7SA 4WNAB 2C31A 3BTVA 2VTDA 2NO1A 4FZVA 1O3YA 4MQEB 2AOVA 1H2YA 1DX9A 3VYTB 4B3MB 1O4WA 4E94A 1CZRA 1Y7LA 1ZD3A 3K6KA 3MWEA 3SIWA 5L9AA 5IBRA 3RYIA 3ZZMA 3SZRA 1U4NA 3V7WA 5CDUA 3WYGA 2H4HA 1G8FA 3QJGA 1ND5A 1R9GA 4G5FA 4R0NA 4GYJA 3VNRA 4LZOA 1YZHA 2D2VA 3B5JA 3QOWA 4IZ6A 4U2DA 5FL7A 3C1TA 3DAOA 4E5DA 2G88A 4IVPA 4NFSA 1E7WA 1W2GA 4XKJA 1G7CA 3UWOA 3WYAA 2DETA 2JD0A 2NUAA 2H0QA 3NONA 2Y05A 1MW9X 3FYDA 4PE5B 4BFXA 3K9LA 5ALUA 1VJGA 3OPYI 3Q6NA 2FPXA 3NM6B 1SBCA 1TW3A 1L8OA 2C9BA 4KGDA 4KRXA 3TE6A 2Z2IA 1I4WA 3F5DA 2VS1A 2V6GA 1VMKA 3TXAA 2FOXA 4MK4A 1S6YA 3R8XA 3V1MA 3T5CA 2FGJA 4URYR 4KYUA 1SEVA 3W78A 4X6UA 3QU7A 2ODNA 2XRYA 1AA9A 1CW2B 2IEGA 3LC1O 4U9IS 3NS7A 4X94A 3PB3A 1RPAA 4QARA 3DD5A 5C4IA 2WNIA 3AHJA 1JEYB 5K4AA 1D4ZA 1VGQA 3DH0A 4FEYA 1IHOA 2MWMA 4D4HA 1YA4A 1FX1A 4ITUA 1ZGGA 2NP7A 1WCXA 3ZHSA 1ULAA 1USKA 2ZRAA 3BXEA 3GRRA 1A8IA 1C7ZA 4KE7A 4TKUB 3PPXA 3CUVA 4B4VA 4BQEA 1Q0HA 1SVSA 2A84A 2IODA 3NHAA 4Y6RA 2QZ9A 1J21A 3H7AA 2GCOA 3R3ZA 2QNRA 5LDGA 1RABA 2H1VA 2VN8A 3FKJA 3OEHD 4G1EB 2IYUA 4GLBA 1PVOA 4A91A 2FSFA 2Y9MB 3X1YA 4JLOA 5EZ6B 3GUZA 3UY4A 2VNSA 4O2LA 4PYNA 1CUIA 3EG9B 4M0LA 3TSAA 2HMYB 3CVJA 4C0HA 1NBEA 3KR2A 1NQTA 2N9UA 3OIDA 1Z2DA 4G67A 4PRLA 4WEOA 3E2MA 3LLUA 3UOGA 3ZEAA 1IJBA 4Y2GA 4LRWA 3G89A 4XUDA 1YJCA 2PG3A 3CLRD 2WYHA 3PFNA 4UTOA 4IV8A 3V2IA 1EM6A 1BYUA 5DDIP 5GJVC 2GBLA 2J6CA 3L0SA </