4LV8B

Murine irga6 bound to toxoplasma rop5c, a pseudokinase gdi
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
397
structure length
390
Chain Sequence
NDLPSSFTGYFKKFNTGRKIISQEILNLIELRMRKGNIQLTNSAISDALKEIDSSVLNVAVTGETGSGKSSFINTLRGIGNEEEGAAKTGVVEVTMERHPYKHPNIPNVVFWDLPGIGSTNFPPNTYLEKMKFYEYDFFIIISATRFKKNDIDIAKAISMMKKEFYFVRTKVDSDITNEADGKPQTFDKEKVLQDIRLNCVNTFRENGIAEPPIFLLSNKNVCHYDFPVLMDKLISDLPIYKRHNFMVSLPNITDSVIEKKRQFLKQRIWLEGFAADLVNIIPSLTFLLDSDLETLKKSMKFYRTVFGVDETSLQRLVDQVEAMIKSPAVFKPTDEETIQERLSRYIQEFCLANGYLLPKNSFLKEIFYLKYYFLDMVTEDAKTLLKEIC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/hydrolase
molecule keywords Rhoptry protein 5 C
publication title Murine IRGa6 bound to Toxoplasma ROP5C, a pseudokinase GDI
rcsb
source organism Toxoplasma gondii type i
total genus 150
structure length 390
sequence length 397
ec nomenclature ec 3.6.5.-:
pdb deposition date 2013-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05049 IIGP Interferon-inducible GTPase (IIGP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lv8B02
2PMDA 4CEJA 2ZITA 2FFBA 3PCRB 3RVBA 4DEYA 4HZUA 3B82A 1CBUA 3SFVA 1Z22A 3HDTA 2GBLC 4ZI3A 3C41J 3KUCA 1BKDR 3O47A 1YR6A 2DFTA 1DADA 1KK0A 1J8YF 2JDIA 1ZM2A 1WMSA 2VHTA 2A2ZA 2JATA 4OQLA 2ONJA 3VTKA 2ZRJA 1OFHA 2W00A 4PX9A 1ZNXA 4KI0A 3TR5A 2WWWA 2CHGA 2JJ2D 4A8JA 4EQ6B 5JECA 1XPRA 4AG5A 4RY2A 1DG3A 1E2PA 2QGNA 2GF0A 1UF9A 4XH9B 2WPDA 5BN4A 2FFQA 4OK6A 1G5PA 4PPQA 3AF4A 3B85A 4Z1MD 1KMHB 3MWYW 1TF5A 3ZGXA 4NONA 2WWYA 3NDPA 2IF2A 1IHUA 2PZGA 1U0JA 4DLWA 3LQRA 2YOFA 1OFUX 1LVGA 1YZTA 1TUEA 4BLTA 2KBEA 4PC6A 4LWZA 1WXQA 2OZEA 3DHWC 1WDTA 2HV8A 2ZSDA 4XSGA 3U2QA 3ZH9B 3E1SA 3QPUA 1Z6TA 2GXSA 1Q44A 1X86B 3BB4A 3AVVA 1UPTA 2YNMA 1XB2A 2F3TA 2VRWA 2A7QA 4JSYA 3T5GA 4TSFA 1PLKA 2JCSA 4I81A 1RW4A 5BN3A 4BGDA 4C0SA 3FFBA 4OK3A 1YZQA 5FPKA 4NL4H 3SS8A 2OCBA 2CMKA 2QY9A 4BUJA 1DPFA 4JT2A 2PJRA 1AGPA 2ZYTX 2IYZA 1JJ7A 1IBRA 3P32A 5KPDA 3EX7C 2AL7A 5FR1A 2QMHA 3EIHA 2B8TA 2ZI9A 3UK6A 2JLVA 3FHOA 4ZCMA 2V55B 4NYMQ 2QMEA 1KO4A 3EXAA 4M1YA 4OI0A 3MJRA 5EUQB 3LBHA 3EPHA 1T5LA 3U3OA 1DAEA 2CCGA 3MSXA 4QJ5A 3THXA 1QG4A 4WZBE 2FFHA 1FTNA 2VF7A 3IHLA 2Q21A 1II9A 1QRAA 4MH0R 1IN4A 1W4AA 2C95A 1NVWQ 4P4UA 1MRSA 3GLHE 4DSOA 2HYIC 4URYR 1D5CA 3WRYC 1GL9B 1L7VC 2AD5A 1IJEA 1FFHA 1M7HA 1Z0IA 5CYPA 4FD2A 2HT1A 5FBQB 4F4IA 1Z07A 3RS7A 2JLZA 3LO5A 3OEHA 3W6PA 2P6UA 3A58B 3E5HA 2IEYA 1G3RA 1MO3A 2D06A 5FTMA 3FHCB 1OFIA 1OHHD 1G8YA 1XDBA 2JJ1D 1D2MA 4B44A 5GJBA 3W3AA 3PEWA 3CIOA 3ADKA 1U81A 3KXKA 3TW8B 1GOTA 2ZTSA 1HQYE 1M1YE 1BMFD 1KSHA 3L82B 1EFCA 1E4YA 1LTQA 4RJLA 5FR2A 1DAFA 3QEOA 2HJGA 5JS7A 3LNCA 1PZNA 3BFVA 1VG8A 4FIDA 3DL0A 5HE8A 2QTVB 4PO8A 3ASYA 3GQBA 2MSEB 4MITA 3TVTA 3LXRA 5FH9A 4N3NA 4W5HA 5KSYA 1GSIA 3GP8A 5CLLA 4IEEA 4LUCA 2QAGC 3W90A 1Z3IX 1JEDA 2ZRGA 3C16C 2HLDA 2H17A 4I1OA 1EWQA 1T8TA 4OQNA 4B6EA 5CB6A 2XTZA 1ANKA 1FX0A 2C77A 4DCSA 3LV8A 1TEXA 3M1IA 2R9VA 4O0MA 3X1YA 1G5TA 2ZJ8A 4DLSA 3TAUA 2W6JD 2KBFA 3RSLA 4S2EA 4QM6A 1JAHA 1DOAA 5FBWB 3MJHA 5KTYA 1ZCAA 1Y3AA 1SXJE 2XNDD 1OYWA 3AVPA 1E96A 1JAIA 2RGDA 1XZQA 1AIPA 2AWOA 2Q9AA 2QUZA 3QPWA 4FCVA 3VNVA 5HCNA 1H8HD 5J5CA 3TW4A 4Z54A 3OESA 4Q66C 4NHOA 3QF4A 4Q1EA 1E2FA 2CK3A 3GLFE 2WWGA 3RHFA 5AUOB 1KGDA 2RH5A 1K8RA 2J9RA 1OB5A 1L4UA 1VPLA 2VP0A 3A4NA 5DYGA 4BFTA 4F4CA 1KYIA 2NIPA 4C0KA 3DMNA 1X1SA 1T3SA 2X1VA 2ZS7A 4RD1A 4A2PA 4M1TA 3VKWA 1GP2A 1SHZA 4OI1A 3Q7PA 1ESNA 3AF2A 4LYJA 2ZREA 3CM0A 5JLJA 1R8SA 1TQDA 3GJ8A 3D3QA 3U3KA 4FWIB 4JLVA 1NMZA 5KOYA 5JBQA 1MOZA 3PV0A 1CR0A 5DISB 2QM7A 1WCV1 4MYTA 5AJYA 4B3CA 3E70C 2P67A 3K70B 3ZZTA 1W5SA 4WZ6A 1M8PA 1N0UA 4KHZA 2YYZA 4B35A 1VTKA 5KHOC 1JALA 2C78A 1HY3A 2R6DA 3NH9A 4TYQA 2X2FA 2FG5A 4RD3A 3B7GA 1YJ5A 3G0HA 3EZ7A 4M1MA 1L8QA 5FBRB 2A5JA 1W4BA 4XSHA 1XMJA 3VX3A 4YMVA 3R20A 5K8LA 4PHHA 1Q1QA 3THXB 2Z4SA 3BH0A 4G0NA 4QBIA 4UJ3A 1YR8A 1TAGA 4I1UA 4US1R 4DUGD 2F55A 5CM9C 4YMTA 2BM1A 2XXAA 4TMXA 3RNLA 1E94E 3FKSD 2YOHA 1JR6A 3OE7A 3QKTA 5SZKB 3Q85A 1E9SA 1OF1A 2AK3A 2HF9A 2VYFA 3JVVA 1Z83A 3QKRA 1LW7A 4LZZA 4UNQA 4EFLA 2VP5A 3ZIAA 4TZ6A 1F2UA 4HLCA 4ZCLA 3U7FB 1HTWA 2WHXA 2P6RA 1P73A 1U90A 5FOUA 3KKMA 2V1UA 4R2HA 1AS3A 3BAFA 4FXPA 4LJAA 4MGZR 1ZD1A 2BJVA 2BMDA 2DFKB 3REGA 4IOLA 4W9MC 3X1WA 4MRVA 1U9IA 1MRNA 4QGHA 4WIAA 4DCTA 4DDTA 4IDQA 1T4GA 1XEWX 2V7QD 3DO6A 2UZ3A 4C2TA 4O3MA 3VR4A 2GK6A 2AKYA 3T1VA 1X3SA 4JBYA 5H70A 1ZC4A 3NBZC 1FUUA 1NBMA 2UVQA 3CPJB 4B73A 3PENA 5J4YA 3ZJYA 3AM1A 5FTNA 5EP4A 1KAOA 3ZS9A 1UBFA 1ESMA 3KQLA 4FWTA 1P5ZB 3CF6R 1W0KA 3R7WB 2QTHA 3SE0A 2C8VA 1E2QA 2VP9A 2WBLC 4JYCA 3AVTA 4QL3A 5LBIA 1M6NA 3MD0A 4A0GA 4V0ME 3QKUA 1FW6A 3KL4A 1C9KA 2YJTD 1RFLA 1N6KA 1XTQA 3ETLA 2ZANA 3AQ4A 5BYJA 2REBA 3QEJA 1E9FA 2ORIA 1YZKA 2VL7A 1D2EA 2F43B 3A37A 2ZE8A 4AI6A 2VP4A 1OE0A 2OE2A 4ABYA 3TH5A 2FMXA 2OESA 3OIWA 3WHKA 4RZUA 1XEFA 3Q5DA 2AK2A 3AV0B 5JWRA 4JLKA 3T15A 1TTTA 3EZ9A 1VYTA 4DIEA 2BKUA 2J7PA 3U4QA 4KLNA 4W5WA 2Z6VA 3T35A 2C96A 5DN6D 2R6GA 1UBEA 5JFGA 3C4JA 1NP6A 3I8SA 4B33A 1BO6A 1NVVQ 2ZRCA 1OV4A 5JEDA 4L16A 4G5GA 5E7MA 4TMZA 1NN3A 2QG6A 4Q01A 1FNMA 3UIEA 1NJFA 3W8RA 4LJ9A 1NLYA 2CNWA 4HI0E 4LBVA 4P4TA 2H16A 3B2EA 1EESA 4WW0A 4C7OB 1HE8B 3TMKA 1KSJA 1R5BA 3DOFA 5BN5A 1QZXA 3IUYA 5HKKA 2YWEA 1R10A 2B6HA 2G0NA 1M7GA 4ASUD 4ZI2A 1GNRA 1M2OB 5FUVA 1Z0FA 2P2LA 3AP2A 4GOJA 4JLPA 4KJZA 4Q4AA 3U3JA 3GPLA 2IUTA 3NC1C 4KYIB 1N5LA 2GVDC 3C14C 3UWKA 4NE2A 1G3UA 2O52A 3QKSB 4C9BA 1WA5A 2OBMA 1QHNA 1II0A 3K9GA 4A2WA 2XB4A 1A7JA 4D4JA 2WWIA 3Q7QA 1XTRA 2XZOA 2N1BA 2Q6TA 4EJSC 3BC1A 3FMOB 3W34A 2IYUA 1I4LD 1UKVY 1KY2A 4MGYR 4NH0A 4KFUA 1UEIA 3BIFA 3QIAA 4B43A 1DG1G 1JXOA 3LVRE 3QG1A 5KSPA 1QF9A 1OKKA 1G8PA 2ZI4A 2WAXA 4HLUC 4QNMA 3HP1A 1R6BX 1VMAA 1KDPA 4MGIR 5IT5A 1E2IA 3QBTA 4QGGA 3DMDA 1XD9A 1M34E 1A2BA 4CZ2A 2OAP1 4LC0A 4DKXA 4JLMA 3BRWD 4EPTA 1JQJC 2AXNA 4NBSA 1KKLA 4ESHA 2CCKA 1UADA 3MWLA 4MUBA 1JNYA 5LD2B 1WQ1R 1CRQA 3E2IA 1OXUA 3KDSE 2CEAA 2FWRA 1CTQA 1TF7A 2JASA 3ND9A 3GJ3A 4W5JA 2CL0X 3QKRB 3CF0A 2FA9A 4P3YA 2A5DA 4L9SA 1F2UB 3T1TA 2WV9A 1WP9A 2CJWA 2D74A 2K5UA 1GKIA 3IHWA 2IYLD 4AYWA 4DSTA 2VHJA 3RC3A 1E2LA 4D82A 4TT3A 3D6TB 2J0QA 4IHQA 1E2JA 1MABA 2ZJ2A 4MGKR 5HR5A 3X1DA 4YLGA 5DHAA 5AJVB 1DE0A 3NHBA 2FN4A 3SQXA 3I73A 4NYJR 3IQXA 4CGZA 2R6CA 2B92A 3A4LA 3CW2A 3F5FA 3LW8A 3WY9A 2DFNA 1QHGA 3OF5A 1KO8A 1EFRD 3TUIC 4Y0VA 2IHYA 1A5TA 3W8NA 5E7JA 2BM0A 4UNSA 3U44A 1XCMA 2DCUA 2D62A 1GZSA 1N5JA 2QBYB 1YRAA 1T0HB 1KI4A 4F91B 1RYHA 4B6FA 5KSZA 3SU8A 3I5YA 1G16A 1I4DD 3U6BA 2ZROA 3PJRA 1ZIPA 4BEBA 3CZQA 3TRFA 2RGNC 3CNLA 2IXFA 2BMJA 3KXLA 2QROA 2C9OA 3KXIA 2J0UA 3NH6A 3OFND 4HB0A 2J0SA 1GRRA 3KKPA 3A1VA 4IRUB 3BB3A 3RS5A 4CEIB 1ODFA 5JSZA 1I4TD 3F3YA 3PUWA 1XXHB 3KJIA 2DWQA 3EPJA 2Q3HA 4M4SA 1ZM3A 3M4YA 3RAPR 2ZRLA 3AVWA 5HTKA 1KJZA 1ETUA 2WSSA 5M04A 2GESA 4KVGA 1IM2A 3U4QB 2VO1A 4D0NA 1YZNA 4LV5B 2QNRA 3ZLJA 3MWJA 3ZZ0A 4LYHA 4TYNA 4C3ZA 2JGNA 1NSTA 3AP1A 2XJ4A 2H8KA 5TXGA 5AUNB 4TQ9A 2N42A 5C1BA 4KBFA 2QT1A 3WHLA 3F8TA 3GLGE 2QAJA 1HA3A 2CLCX 4OBEA 2DHRA 2ZETA 1COWD 1W7AA 4LHVA 2FZLA 4PPGA 1AZTA 4MKIA 1V5WA 1WBBA 3EAQA 3U7EB 5F3WB 5KU1A 1KI6A 4FMCB 4PZYA 3L2OB 4OL0A 3N2EA 4Q4AB 3SQWA 2I1QA 4URWR 1Z5ZA 2F7SA 2ZR7A 4Q18A 4JLOA 1KJWA 3LA6A 3MGCA 4URXR 2XOKD 1W4CA 4FCWA 1WF3A 4LBWA 4OQXA 1G21E 2GRJA 2KJQA 1QHXA 2ZR0A 2GEDA 2JDID 3B1XA 3GEEA 3WYGA 1RZ3A 3U7HB 1ZINA 3DZDA 4F93B 1M7BA 3T1QA 3AF3A 4V03A 2RGXA 2V54A 1VIAA 4CF7A 4B2PA 4CEHA 3GFPA 3FTQA 3CPHA 1DAHA 4TL6A 2WPDD 3OIVA 3GJ6A 4QRHA 1UDWA 4LPKA 4P33A 4IOMA 2ZU6A 4LOAA 2FGKA 4NYJQ 5FPYA 1CLUA 4A82A 1R5OA 3I3SR 1GL7A 1A4RA 1II8B 3TE6A 5A4JA 1OH7A 2CBZA 1XD2A 1CU1A 1NI3A 3LLMA 2ZYUX 4LJ6A 2ZVPX 2OV2A 4LJ7A 1AJEA 221PA 1QVRA 2EFHB 3KUDA 3WBKA 5L3RA 3THYB 1W0JA 2ZE6A 3TAHA 3PUXA 3A8TA 3CR8A 3PFIA 4HYYA 4TQUS 1JPJA 4R9UC 1G41A 1FMJA 4DVGA 1ZUNB 1U0HC 1BOFA 4M9ZA 1ZD9A 2X19A 4HSEA 3FMFA 5AJZA 4HB2A 1G8FA 1Z6YA 1J99A 2VEDA 1P9NA 4NU0A 4RD6A 4UXJA 4TLEA 1MABB 2GNOA 1HEIA 3KZ1E 2OHFA 2VHQA 1E1RD 4F38A 3WYAA 1G4AE 1UM8A 1W48A 3I1FA 3K70D 3DVLA 2HJVA 5GVSA 1UBCA 3AKDA 5FPTA 5E7IA 5JZVA 5EXXA 3SJAA 3TUJC 2CHQA 4KAXA 1KTVA 1Z0KA 3QXCA 5G40A 5JHGB 1G5RA 1JB1A 4NCJA 3U60B 1N0VC 1MH1A 3QPVA 3HU1A 3BE4A 1G3IA 3BWDD 4BFYA 1S1MA 1IQPA 4NCIA 4J0QA 3D8BA 3TK1A 3WNCA 1YR7A 4Q4JA 1WRBA 4EPXA 1AN0A 1G3MA 1E98A 5CLQA 3PG5A 4FMDF 1E32A 3EG5A 4PSVA 4Q7MB 4ARZB 1ZU4A 2OLJA 5LPNA 5DI9A 2PX3A 1OIXA 1W4RA 2OT3B 3WYFA 4GMXA 1D2NA 4C4PA 5K8IA 2J0UB 1IY2A 2UKDA 2ZRIA 1OW3B 2GKSA 3NTUA 2ANBA 3SJCA 3CWZA 4RD4A 3FMIA 1EK0A 3BH7A 3WXMA 3T61A 1SVOA 3A1WA 1S9HA 5JSZB 4PQFA 3UXMA 4Q9JA 4M9QA 2BOVA 3OEHD 4HUTA 1RVDA 3NVAA 1ZNWA 2DB3A 2XB2A 2XTMA 4A0RA 2BMFA 4PHGA 4GBMA 1P9RA 4WBSA 1G6HA 4B34A 1NF3A 1RYFA 4DC9A 1SVWA 1YHNA 4R98A 4NP6A 3PITA 1AS0A 4Q7JB 3BB1A 3A1SA 3OEEA 2WICA 2CL7X 3ZZUA 4KFSA 2BEKA 2Z43A 4N1AA 5HZHA 3UG7A 1ZM7A 3EZ2A 2OSBA 1B0UA 4U02A 4M9SA 2AR7A 4D25A 2IA5A 4Q1FA 3UWOA 3EPKA 2D4HA 2IXGA 1KI7A 2PZEA 1UBGA 4EUNA 4QM7A 1VDZA 1E3MA 3NG1A 1VG1A 4V0KA 2C98A 1KI6B 1ZP6A 2F1JA 1J8MF 1FTSA 3V9PA 1XXHE 1FZQA 1RE0A 3BBPA 4KBGA 3REFA 1P60A 3AB3A 3NWJA 3QY0A 2P3SA 5TVKA 3ZVMA 3B9QA 4KO8A 2FSHA 2CVHA 1E4VA 5DE3A 2REXB 2WJYA 1SVIA 2HLDD 2REOA 1Q21A 1VIYA 4Q21A 1CF4A 2VBCA 2NGRA 2QAGA 2LKDA 3NC0C 1GKYA 5CIWA 3RDPA 1OXXK 3U6KA 1E79A 1UKZA 5DLQC 5C18A 1W36B 1W2GA 3RS4A 1WE2A 1YR9A 4CRWB 5JJIA 1R0ZA 4GDFA 1EWRA 1WBDA 4JBWA 4DB2A 3DM5A 5EP1A 4ERNA 1IY1A 3IIKA 1KY3A 3RRZA 3AUXA 3JZMA 4A2QA 2QU8A 1TEVA 3X1XA 4XTCS 2G1JA 3W6NA 4DLVA 3C15C 3L0SA 1NKSA 2F9LA 2HDNB 2JAQA 5J40A 1SVKA 2ZJZA 5LB2A 1U0LA 2QZ4A 3S1AA 4BZXA 2CLDX 3CZPA 4P4SB 4B74A 3I8XA 2VIIA 2V1XA 2WZQA 3LX8A 1XD2B 1Z28A 2AN9A 3SJZA 2G3YA 4WOPA 2O8BA 4BQSA 2WJVA 2W2TA 2ZAMA 3UATA 5J4LA 2Y8EA 2BBWA 3QXSA 4B2LA 3CF2A 1E2GA 3EC1A 1I2DA 2RHMA 3ADCA 3GFOA 1CJMA 4LBYA 2ZM5A 2QPTA 1GFIA 2H57A 3RC8A 1BH2A 1Z8FA 4IEIA 2J45A 3TGPA 3KKOA 4LPSA 4BFSA 2XAUA 1IY0A 3H0KA 4BWYA 3VNUA 4C0QC 4LJ4A 5FI1B 5IHPA 4Z8YA 2A5FA 1GNPA 4EAQA 3L0IB 1TU3A 5L3VA 3I61A 4I1VA 1RJ9A 2NZ8A 3EW9A 3KQHA 3U3MA 5D3QA 1GITA 4M53A 3LX5A 1Z0AA 3OZXA 5DH9A 4ZPXA 4DDUA 2GETA 5J4HA 5BXQC 3K09A 3NDBB 5ELXA 2IYVA 2ERYA 1GIAA 2ZRKA 3MWKA 2C04A 4KLZA 4XIGS 3P20A 1P2UA 2JJ8A 3CKLA 1MR3F 2PT5A 4CEJB 1P2TA 3BGWA 2FSFA 4ZDKA 4TN1A 5KDOA 2IS6A 1UKYA 3P4XA 3RABA 4HZUB 1UJ2A 3H84A 3TNFA 3L0OA 3THWA 4HATA 4Q4JB 3AVUA 1Z2AA 2OCYC 3GCGA 3OAAA 4UXHA 1JEEA 1XEXA 2OUKA 3LQQA 3WMEA 3LDAA 4IDHA 3B9PA 5CM8B 2WJJA 2QE7A 3TLXA 2R2AA 2W2VA 4DDVA 4BZPA 3B60A 4GP7A 3OE7D 1YZGA 3LAWA 4XTRA 3DEFA 3K70C 4Q7LA 1UEJA 4A8JB 2RCNA 2VHCA 2JLYA 1QHHA 5TY0A 2WWHA 1MO6A 1SKYB 4RZXA 4OJKA 5TDHA 2E9SA 1N6PA 2FJUA 4YXWD 2ZI6A 3MCAA 2VF8A 4OHWA 1XMIA 1R8QA 1H8EA 2HCJB 4ESVA 3EIQA 3TIFA 3X1ZA 2GJ9A 2OBLA 4YMSA 5KNCA 2WAYA 5TV2A 1R0WA 1NBMD 2OILA 3KKNA 2GWHA 4LRWA 4A6XA 2J1LA 2CLSA 4NCKA 5FI0B 4DLYA 2WOJA 2A3RA 3VX4A 1NY5A 3P1JA 4LY6A 2OFWA 1CJVC 1KAGA 1U8YA 2FX3A 1GL6A 3SYLA 2HCBA 4GOXA 1NN5A 2BDTA 1ZIOA 1BYUA 5CJ2A 1W0KD 3QI2A 1DELA 4O25A 1T3HA 4B3GA 5KNDA 4HAVA 2HEIA 3BERA 4XVRA 2FFAA 4D26A 3TBKA 1NVVR 4JBXA 4LGMA 4C0JA 3K0AA 2W2XA 1A82A 2BBOA 1G20E 1SKQA 4V02A 4BLPA 3CLVA 5DIFA 4CT4B 1ONBA 1WB9A 1EXMA 1VHLA 1IN5A 1XBTA 2XSZA 4HAWA 1Q22A 1VYUA 1R2QA 4UNRA 4PSAA 3EA5A 1NIJA 5JI3E 2CE2X 4DWJA 1SQ5A 4G5SA 3R9WA 1ZUIA 4K81B 3B6EA 4KSCA 1E0JA 2IYWA 3RRYA 2NO1A 4KVAA 4L4UA 4E09A 2LWIA 1XPOA 2ZRFA 3H1TA 2QA5A 3GLIA 5FPSA 2O5VA 3RSOA 3CONA 1E0SA 1VCIA 3W5JA 1E6CA 2IYQA 4ZIRA 2O8EA 2QPAA 2PZFA 3FE2A 2QL6A 1AQYA 4XWOA 4PAQA 5HKKD 4ZKEA 3CUEF 5DI3A 1S8FA 1J90A 1KI1A 3MFYA 4DRZA 4BRUA 1HE1C 1AKYA 4AD8A 2ODEA 4DJTA 1P75A 3FOZA 1XD8A 2C9CA 1G1MA 2CVFA 5L3SA 4PSKA 2RKOA 3CRVA 2ZR9A 1OJLA 1KOFA 2OO7A 4Q02A 2ZYWX 3C5HA 1QHSA 4E22A 1N6LA 3T34A 5J4KA 2W6IA 1RJ9B 4H1VA 3JVUA 2IS1A 1YRBA 5H8WA 5E4FA 4IOJA 2RMKA 3WBJA 5AJWA 2I4IA 3GEIA 2N46A 2ODBA 2IL1A 1CKEA 3WNDA 1CR2A 3KKQA 4IJMA 2F1RA 4ZCIA 1EX6A 1H8HA 5JCPA 1KK3A 2Z5FA 2EFCB 4LV6A 3O8CA 4OI4A 4OK5A 2G77B 1AA9A 4K46A 2IWRA 5JS8A 4HLUA 1T3LA 3THWB 3EZ6A 3V4FA 3BOSA 1ZRHA 1KI2A 2ZEJA 3N5CA 3QVUA 2XNSA 4KFRA 5EP2A 4YDHB 2MSCB 4U7DA 1HUQA 4IOKA 1ZAKA 4IDOA 3J81k 4R7ZA 1RRPA 2QQ0A 4XD7A 4A0FA 1FX0B 1EFTA 1KK1A 1ZM4A 3B1ZA 1Z6GA 2AD1A 3ZDQA 4PAOA 2FPMA 1J7KA 4NYIQ 4F4JA 821PA 2GCNA 1XWIA 1E1QA 1JR3D 1LV7A 3FVQA 4XJXA 4XVQA 2G88A 2WWFA 4ZDIA 1OB2A 2JLWA 4LJ8A 1S1CA 5FFMA 2QENA 1Z2CA 3JZAA 4TYYA 2EVWX 1OIVA 3NKVA 1NLFA 2P65A 1OFTA 2D2EA 5EE5B 3P4YA 3FGNA 1CJTC 4DDWA 4M1SA 2GXQA 2AWNA 2WKRA 2FDCA 3QF4B 2NG1A 1IN7A 2PL3A 4HUQA 1QDEA 3SDZA 1CJKC 3EARA 4HDQB 5LD2C 5EP3A 2NOAA 2C2HA 3B1VA 4BZQA 2ZI3A 2GJSA 2WMNB 2OEPA 3LFUA 2RGGA 4KU4A 4PQRA 3I5XA 1GKUB 2GZDA 3FKSA 2XEXA 1W49A 2ZSBA 2J3EA 3MAAC 5AK0A 4B32A 5B30A 4Q48A 2B7CA 5B58C 4Q19A 1O87A 2EYUA 2CE7A 4MRPA 2XZPA 3AKEA 2AFIE 3GJ7A 2ZU0C 5GJWC 1UDXA 2IYRA 2IK8A 2VP6A 3CX8A 4KV9A 2YWHA 1E9DA 3PEUA 1XTSA 4HAZA 1U9IC 2C99A 2QN6A 3GLHA 4GOKA 2D7DA 4IVPA 2VSXA 1GRQA 4AY2A 4OKSA 4PC7A 1J2JA 3NXSA 4TMTA 3QVVA 3MLEA 1Q1EA 2J46A 5C4GB 5CK5A 2GEVA 2BJWA 2V7QA 1KI3A 2HF8A 2QRNA 2VTKA 4NPHA 3TSWA 3CR7A 4P31A 2V3CC 1E69A 1AM4D 1GTVA 1N3BA 3TR0A 3AVYA 2WSSD 2TMKA 1P2VA 1ZJ6A 3L8YA 5LB4A 5H68A 5JJKA 2PEYA 4Q7KA 2OXRA 3RWMB 4GZMA 5DYIA 2XXAB 3VKGA 3GJ5A 4WXRA 1YQTA 4E03A 2F6RA 1IXZA 3QJYA 3HR8A 3KJGA 4ZV4A 1SVMA 1U2RA 4UXIA 1LF0A 4MKHA 4W7SA 4B3XA 1CEEA 1L2TA 4LYAA 4ZDJA 5L3QA 4ZIRB 4DCUA 621PA 2O8EB 3B78A 5CIQA 3CWQA 3CRMA 2JIZA 2A5GA 3IEVA 3IILA 3R9IA 1E2MA 3DZ8A 4O2LA 4HB4A 1HYQA 4G5OA 2X8AA 2Q3MA 2Q0HA 5IDVA 1AK2A 2ZUCA 4OYHA 4JLJA 5F2EA 1QBKC 3MUFA 4KODA 1N6IA 1HT1E 3LXXA 3VR3A 4BE7B 3I72A 5L3SB 1RPZA 1U98A 1F5NA 2QRZA 3HYTA 4DXAA 1FMLA 2J0VA 4OQMA 5EZ5A 1OXVA 3K53A 1JPNA 3PUZA 3K0CA 4WZAE 1IN8A 4RKFA 4A4DA 1JECA 1W36D 2WJGA 4Q4HA 5DN6A 4B3FX 4LV8B 2OXCA 5FOXA 1RRGA 3CB4A 4LHZA 4AIIA 2BBTA 5JRJA 1XJ0A 4BFXA 1KKMA 3KX2A 1XNJA 2WMOB 4L15A 4RD0A 4MDEA 4QC2A 4QHSA 3CRQA 5LDDC 1LY1A 3M0EA 1EFUA 2G9NA 1SXJA 3HU2A 4TYPA 2QQEA 2ZJYA 4LBZA 4IDPA 2IEZA 2IF0A 4ASUA 5G41A 4AKIA 1NN0A 5BYKA 5CB8A 1NLZA 5FOVA 5JRZA 2OFXA 2BC9A 4JLAA 3KFXA 2C9YA 3P26A 5HZKA 3BK7A 1E2DA 2Q3FA 3QXJA 4H1UA 3GLFA 1BIFA 4Q00A 5E95A 1E9RA 3C8UA 4G01B 1W0JD 3BS4A 4GI7A 5JHHB 3OIYA 4WAUA 3MMPA 3IPXA 4HLQB 2SHKA 1XMVA 1TQ2A 4XVUA 3CO5A 3U61B 1W2HA 1BS1A 1KJYA 2O8DA 4YMUA 4TL7A 4PPNA 3V4RA 4RVCA 4US2R 1HT2E 4JIMA 1SULA 2P5TB 4ILEA 4M22A 4U5XA 5JI2E 1XF9A 2DWPA 4P0TA 1ZBDA 3C5CA 2QPOA 4JJZA 1U8AA 2IX3A 2HXSA 1R5NA 4HUQB 2ZRBA 3FKQA 3GJ4A 1F60A 3IO3A 1XJQA 2HT6A 4LK2A 3WRXC 2ORWA 1G64A 2QSZA 2Z4RA 4TMWA 4YONB 4G5QA 3D31A 1G4UR 5D3MA 3ICEA 2I1VB 1P7CA 4OHZA 4ITRC 2ZJAA 3QG5A 1MO4A 3EASA 4GL2A 4G5RA 1LFDB 3FPAA 3IBGA 1E9EA 2PH1A 4TZ0A 3QBVA 1P62B 5KO2A 5EXPA 4DSUA 1US8A 1HH4A 4UJ5A 2GBLA 3KJEA 2UZIR 2IS4A 3SNHA 2QM8A 4AKEA 1E2NA 5KPJA 3LWNA 3GLHB 2YC4C 1GDDA 1TPZA 3IDQA 2PCJA 2OG2A 4JMPA 2BEJA 3SHFA 5CITA 1P6XA 3P27A 5KSOA 1FQJA 3AKCA 2NPFA 4UNPA 4ACAA 4ZKDA 2GVZC 3VMFA 4RZ2A 2WJIA 3SBDA 3AP3A 2IXEA 3LH5A 4RFSA 2NPIA 5K8TA 1DO0A 1P72A 3ZS8A 3R8FA 1F6BA 2O8CA 1OYYA 5GJCA 1O3YA 4PFSA 2GJKA 2EFDB 2ERXA 2V8OA 3SHWA 3X2SA 3QSYA 3WMFA 1W46A 3I62A 1CR4A 5BQ5A 3AVXA 3KTAA 3ECCA 4MRNA 4PZZA 3O8BA 3OEED 4D80A 1RC8A 3EIEA 5FL7A 4PO9A 3B5JA 4QKQA 1VKJA 1E9CA 4G3XA 4TWZA 3TKLA 4EPWA 1T6NA 5SZIA 4DIDA 5L3QB 3PR1A 3RS3A 2CJWB 5IK2A 3RWOA 1HURA 3LLUA 4TSFD 5AWFC 5JMTA 1NKTA 2EWWA 2YINC 2J87A 4DLTA 4L5BA 4RKEA 2FF7A 4V0MA 1G9XA 3Q3JB 5CDFE 1KZ7B 4D4MA 1R7RA 3IEUA 2NZJA 2O8FA 4QBGB 3BH6A 4IW3B 4JLDA 2RGBA 4E5UA 5K8UA 4M9XA 5BWMA 1G19A 1G8HA 2WM9B 1E79D 4C0BA 4V0LA 3K0SA 3T06B 4Q4HB 1CRPA 1S3SA 3TQFA 4DCVA 4Q1DA 2NMVA 2CCJA 4EFNA 2GCOA 1AS2A 1VG9B 2GXAA 3U44B 2RGEA 2VA8A 1ZW6A 3VR1A 2R65A 1MKYA 3SC3A 1D6JA 2L0XA 3VAAA 1Z6AA 4IXNA 4TQAA 3A1TA 3T12A 5E3HA 1SXJB 1TF2A 5J47A 3K1JA 5FOSA 4GP6A 1KDTA 1PLJA 5UKDA 1SVLA 1GVNB 3H86A 1PV4A 5AUPB 1N25A 4RCZA 1E2HA 4KCGA 4NCHA 2PLRA 1YZUA 2J59A 3PQCA 2FE4A 4CVNA 3HYRA 4LHXA 2GZHA 2OAQ1 4D0GA 3GLFB 1DAIA 1Z29A 4IXMA 3BD9A 1TMKA 1W36C 1TU4A 2XOKA 2Z83A 1ZNYA 2B8WA 4M1OA 4QFMA 4DHEA 1LS6A 2ATVA 3KJHA 4PXAA 4JVNA 2HUPA 2YZ2A 1OSNA 2ATXA 3IGFA 1NBME 3MG9A 3A6PC 4N0DA 2I3BA 1T5IA 4BFVA 5J4VA 2BVNA 1N2CE 4E07A 5EXTA 5IF9A 3AGQA 1T91A 1ZU5A 2YV5A 4QJ4A 3KQNA 4C2UA 1EG7A 2O8DB 1W5TA 3U3RA 3T5DA 2ZPTX 2IUSA 2J7KA 4QHTA 4A0HA 1G6OA 4EKDA 1GAJA 1NL3A 4HZIA 3CPEA 2IW3A 3Q8XB 2FZ4A 3W5IA 3EWSA 1CJUC 1IN6A 1KZGB 3WNBA 4X8MA 1S9DA 2DFLA 5DHFA 1NSFA 2EFGA 5EE1A 2PMKA 2D3WA 5EE3A 3VR5A 1ZC3A 1PVOA 5C4MA 5D3MB 3EC2A 4K8OA 2QP9X 3IKJA 1AKEA 1FL9A 1SHKA 2GHIA 5EZ6B 3VR2A 2CXXA 4Z8XA 1FP7A 3QF7A 1X8JA 2QP4A 3CH4B 3OAAD 3QQ5A 4IKEA 3FB4A 1YZLA 4DBLC 2QE7D 1US8B 3AEZA 2GILA 4GPTA 2BIFA 1S0UA 3LVQE 1KK2A 1PJRA 3ZD6A 3RS2A 3ND8A 3WP0A 1ZMXA 4D6PA 1ZM9A 2PT7A 1E1RA 3LW7A 4CEHB 1YVDA 3CH5A 4NDZA 4PC2A 4B48A 1VHTA 3K9LA 4O2RA 5FL3A 5AR1A 1MO5A 4L8GA 4FI3C 1FUKA 3QE0A 2WVJA 4RFSB 1XTIA 4IDNA 4D81A 3U7GA 5FTLA 4IFBA 2BCJQ 4HB3A 2O8CB 1RRCA 1H8ED 2GJ8A 4JKYA 1G291 1HV8A 2HXYA 4TMVA 2IUUA 3THOA 3C7KA 2CK3D 4NZYA 2GZAA 3I92A 2ZI5A 1QHYA 3HJNA 3FHTA 2J5XA 2F9MA 2Z0MA 2KB0A 4QHYA 1OH6A 3ZVLA 1S2MA 3KTAB 4AWXA 1UAAA 4JKIA 4IFEA 2AHOA 2RAPA 4NTZA 1E99A 5KDLA 1Q1BA 4II7A 4BLOA 1Q3HA 1Q57A 1D9XA 4B76A 3OIUA 4A9AA 3CBQA 5EQTA 4PO1A 5AUQA 4A8JC 2GF9A 2WJHA 5AJXA 4BECA 1VCOA 4FW9A 2FSIA 1KDRA 3A36A 2X77A 5JWHA 4JL8A 2JJ2A 4URVR 4AURA 4GT1A 1N6NA 1S3GA 4LHYA 3SN6A 1FOEB 3K0EA 2LKCA 3NBYC 1DEKA 1U8ZA 2XITA 1NVUQ 4ACBA 4HDOB 5TB5A 4A36A 5DSZA 5JCZA 3F0TA 2JLSA 5HE9A 2O8FB 4Z1MA 1P4SA 2BKEA 3SYNA 2V4ZA 1GILA 2XSZD 3VHXA 1Z47A 2VQSA 4HAXA 2PEZA 1XFAA 2ZIAA 4IVQA 3K0FA 4JZKA 2GCOB 3WMGA 721PA 2NO9A 1E9AA 4RFVA 1N0WA 1CP2A 3NHAA 1F2TA 4DT1A 1S96A 2ZJ5A 4U00A 4LJYA 1Y63A 3W9YA 1W47A 2DPXA 2H18A 1KO7A 2AKAB 2VSOA 4I99A 1JR3E 1MV5A 1B23P 4GMDA 5DNYB 2LCFA 1NVXQ 1OH5A 4UQOA 2F3RA 5A5GA 2PJZA 3GJXC 3R7WA 3PUVA 4BEJA 2NO0A 4RSGA 1KO5A 5HPYB 4FN5A 3ZIAD 3AVOA 4NMMA 4LCBA 3GLGA 5FPHA 3ONWA 4R71A 4TTPA 2VPPA 5EE9A 3UMFA 2IYSA 5FOTA 1CIPA 4LC1A 2WTUA 4S35A 2ZRPA 3PUYA 4PC3A 5C46F 3ADDA 2BBSA 1KSFX 4BFUA 2F43A 4TL9A 4EPVA 5EXSA 1TNDA 2ECKA 4X8HA 4FMCF 5KNBA 1Q1ZA 2GDJA 4LI0A 4AKGA 1K5DA 1VCMA 2BCGY 5DGXA 5TMPA 1AQUA 1ELOA 2QORA 3NIBA 2RGCA 4A92A 2C5LA 1S4QA 1G18A 2XX3A 1Z0JA 4Q03A 2W6ID 2GK7A 1KO1A 4DZZA 3QXHA 1P3JA 1MT0A 2OBNA 3RRMA 2ANCA 4QNRA 4Q47A 1IONA 4M8NE 3ZD7A 1ZVQA 3ZQ6A 3L43A 4UKDA 1DARA 4URUR 5FOWA 1DS6A 1ZCBA 3TUZC 3CRRA 2IHBA 1E2KA 3CNOA 2KWIA 4MRSA 2ZAOA 4ZO4A 1KNXA 4NYIR 4XOIA 4QOSA 1DBSA 4ZDWA 4C7OA 2ODNA 521PA 2QSYA 3IPYA 5BW8A 4A1FA 3PVSA 4JLNA 2BV3A 2OCPA 3QENA 3NEYA 3ZVRA 1NRJB 4GNKA 4F7WA 1IOZA 1XPUA 2QAGB 1OHHA 2XJ9A 3SYKA 1KNQA 1KIMA 2JJ1A 3PIRA 1GWNA 4KXFB 4POAA 3FDIA 3QKSA 5B64A 1N5KA 2BWJA 4XD7D 4ON9A 4BASA 4URZR 4PPFA 4EDHA 4JVMA 4FCTA 2VHUA 4WVFA 3UKDA 4DLZA 2DWOA 3K09C 5TARA 5FTKA 1G7CA 1GRNA 5C2JB 1XRJA 2J7PD 4RD2A 5F9FA 1E1QD 1V43A 1RKBA 2PCLA 2FOLA 3DPUA 1BMFA 4BPBA 1KDOA 3H2YA 2MMGA 1PLLA 5FBLB 2ZRMA 3SI7A 2R44A 2XGJA 2MMCA 2W0SA 3S1AB 4DLRA 4FINA 2EWVA 4C0HA 5KYKA 2CNWD 1XTKA 5CDFA 2O8BB 4V0NA 3PEYA 4AC9A 3IIJA 2JA1A 5KUTA 2QI9C 1YKSA 2QP3A 2WKPA 3LRPA 1QG2A 4QJ3A 3BFXA 2ZRNA 4B47A 4CDGA 4JJKA 1XJCA 3AH8A 3KB1A 4B75A 3HR7A 1Z06A 3VR6A 421PA 3AKYA 4YMWA 2FV8A 2R6AA 1OIWA 1C1YA 3L8ZA 4IVRA 4LJ5A 4TTQA 2W6JA 4D4LA 1N5IA 4X8LA 1AGRA 2VP2A 4GFDA 3KB2A 4FMBB 2QMOA 1BYIA 3VU9A 3UG6A 2MSDB 3DKVA 1LF5A 4Y0AA 2YVUA 2EU8A 4GSYA 1D8TA 4JSTA 2XNDA 2H92A 1N6HA 2VH5R 4EJSA 3HPQA 1W44A 3G5UA 4YXWA 4C0LA 1A1VA 4JVLA 1OKKD 2XZLA 1R0XA 2IC5A 3ZQJA 1IJFA 2B7BA 3SJBA 4WA7A 4AK9A 4LSGA 2IBMA 2NQ2C 3BXZA 3K0FB 4D2IA 3R8CA 1E9BA 1X6VA 2ZSEA 5JEEA 1DVRA 1F2TB 4DT1B 1U94A 2KI5A 2NO7A 1RIFA 1VECA 3EZFA 1PUJA 2EQBA 2O0KA 1XEXB 2CHVA 3TJZA 3AGPA 1LNZA 1G17A 4OHXA 3AUYA 2V9PA 1I2MA 1L4YA 4Q5IA 4Q9HA 2QBYA 2R8RA 3GFTA 5EJEA 4MDFA 2PX0A 1FNNA 4YC7A 1E2EA 2DYKA 3LBNA 3W3ZB 3HWSA 3GLGB 5FUXA 4G1UC 3V00A 4KSBA 1QHHB 2JIZD 4PQYA 1J70A 4AG6A 4AYTA 1SVSA 3WP1B 2C03A 1A2KC 4TT3D 1DAKA 4XWAA 3U5ZB 5P21A 2ZJBA 4R2IA 4CEIA 4V0OA 2VLIA 2ZS9A 1XXHA 4AKHA 5EE0A 2ZE7A 2YOGA 1XP8A 1P9WA 5B57C 2ZUDA 4D0LB 4C30A 1NY6A 1CXZA 3SR0A 2GTPA 3BORA 2A9KA 5G3ZA 2EFEB 3GD7A 4FMDB 5G53C 3UANA 2WIBA 4Q1AA 4A6PA 2EW1A 4DUGA 1XCGB 3G82C 5FTJA 4AYXA 2ZRHA 3VFDA 4OQFA 3B1YA 6Q21A 1NN1A 2FEMA 5H1YA 3EA0A 3CNNA 1IAQA 5SZHB 1Q0UA 2GCPA 1TADA 1P61B 1R4AA 4X8OA 4OHYA 1SXJD 3RS0A 2FNAA 2ZRDA 4BLSA 4Q9KA 1X8KA 1SKYE 5FBVB 1GM5A 3AVQA 3KFVA 2R62A 3K0AB 4PR0A 4QGAA 2RGNA 1T8UA 2YHSA 1UFQA 3I4LA 4GZLA 1TUIA 1FPMA 3Q5EA 4MKFA 3VKHA 2RB4A 2IYYA 4HLDA 4BLQA 3QUSA 1K6MA 1M74A 4B3BA 1ZUHA 2W0MA 4XWKA 3R9XA 1XX6A 3Q9LA 4JYBA 1NJGA 1GUAA 3NBXX 5CK4A 5SZJA 121PA 2JLQA 2OCAA 2RHDA 3N70A 2JLUA 2FH5B 2WOOA 4MKGA 2YKGA 3GJ0A 4BRWA 1TX4B 4EFMA 3GMTA 3SZRA 2BHRA 3ICQB 4CW7A 4D4KA 1T0JB 2GXUA 3GLIB 1OPXA 2G83A 2PBRA 3IBYA 1XMSA 1D9ZA 4RZ3A 2EYQA 4NKRA 3RANA 1KMQA 3B13B 2V6IA 1CR1A 4RCYA 2GAAA 4JLBA 4JVSB 3LBIA 2IWHA 4CYMA 3ADBA 4DB4A 2W83A 2YWGA 4QBFA 4I1SA 2PLFA 3H4MA 3IIMA 1Q20A 3O8DA 1II8A 3UMRA 3IO5A 5DI3B 1ZYUA 2IT1A 2WKQA 3K9NA 3RLFA 4QG7A 3FMPB 4GRAA 1NMYA 2YWFA 4JS0A 3EPLA 1E0AA 3A1UA 2B21A 2GA8A 1VYVA 5A0FA 3PXGA 2GEUA 1W1WA 3GEHA 3LY5A 3THYA 4UNNA 4DEXA 2P0EA 3O8RA 1OLOA 1ZD8A 1JR3A 3QNUA 1EX7A 1XTJA 1N6OA 4QBHA 3A4MA 3VU9B 3AF0A 5JJLA 1TL7C 1IXSB 2ZYVX 4MQBA 3TVDA 1P2SA 1OXTA 1FP6A 3MRSA 4M0LA 5JWOA 4N0EA 4EJSB 3CX7A 1TQ6A 1QVAA 1G7TA 4TLAA 1Q3TA 4DCNA 1IXRC 2FGJA 2IS2A 2J41A 4HAYA 2D2FA 2DBYA 2XTNA 4KITB 4TTRA 1NIPA 4PHTA 3RYTC 3W6OA 3L0PA 4LHWA 3TSOA 3B1WA 1G7RA 4CIDA 3NEJA 4NCNA 2ZI7A 2R6FA 2FU5C 2IYTA 1CS4C 2ZRAA 2H1LA 3DKPA 3EWAA 4M2LA 1LS1A 1F48A 2E1RA 1SZPA 1NG9A 2IYXA 2KE5A 3QXXA 2OFOA 2G1KA 1X1RA 5KDDA 1HQCA 2ASEA 4M1WA 5FL7D 1SGWA 4YQFA 4ARZA 1CULC 5FUYA 4PTLA 3I32A 1PUIA 3ZVNA 4BFWA 2DY1A 5IK2D 4MYHA 2QEQA 3LD9A 2GJAA 4MYCA 2JLXA 2A5YB 4DLUA 4EQ6A 1U99A 2QT0A 4JL6A 1Z08A 2GAOA 2CDNA 5HCIA 1C4OA 1JXMA 3ASZA 4Z51A 2OM2A 1G8GA 5FUWA 4WXPA 2O0JA 1KMHA 1QHIA 1R0YA 1VCNA 2X2EA 4I4LA 4OI2A 3UPUA 1ZNZA 3K9HA 2H7VA 3ZYCA 5CYOA 3SEAA 3M6AA 1K5GA 4JL5A 4Q9LA 3QOFA 2E87A 2F1HA 3BJIC 3DOEA 1KI8A 1LB1B 4TYWA 1KSGA 2ZSAA 2ODWA 1EFHA 4PZLA 2QGZA 4EPYA 2ZQ5A 1DAGA 4QGFA 3N2IA 5CJPA 1Z63A 3T1OA 4BLRA 1AZSC 2F1IA 5GADl 2HYDA 4TLCA 4B71A 2ZS8A 2Q9BA 1XU4A 1OT3A 2G0TA 2G6BA 2ORVA 1NNEA 1T9HA 3NBFA 2JLRA 4EIWA 5ANRB 3K0CC 1JJVA 2YC2C 3B8HA 1E0KA 4OHVA 4B3DA 4KFTA 4MA4A 4H9GA 2BMEA 3CX6A 1KHTA 2FPKA 3HU3A 3FFAA 2P6NA 2QTFA 4P32A 2WIAA 3CRW1 4Q1BA 3FYHA 4HAUA 1TQ4A 5IRCD 5F9HA 4KYUA 4LDJA 2OLKA 3DDCA 4F92B 1EFRA 1NG1A 1Z6XA 5L8VA 2ZXUA 3UMSA 4B2IA 3KQKA 2ONKA 4HDCA 4LX0A 1OH8A 2ZVQX 4PC1A 5F98A 2NO6A 3PEVA 1G7SA 1YE8A 4M1KA 4DSNA 1VG0B 1SXJC 1XZPA 2A30A 3TQCA 3SBEA 2AFHE 1KI9A 4PANA 1F3OA 4EPRA 4YDSA 2CL6X 2KSQA 3IQWA 1GNQA 4CT5A 3KQUA 4MRRA 4BFZA 1DAMA 3OFNA 3SFZA 4TL8A 1DTSA 4P4SA 2ZSFA 2WSMA 4TLBA 3VHLB 3VQTA 4Q1CA 1X8LA 2P5SA 2VSFA 1JI0A 1XEWY 3HPRA 5B2ZA 3RRNA 5G3YA 1H65A 2Q9CA 4MYUA 4Q4LA 2JEOA 1XCPA 4M21A 8OHMA 1EGAA 1FQKA 1YU9A 2QMUA 1Q12A 2V6JA 4LYFA 4TMKA 4TLDA 1NMXA 4HEJA 4NYMR 4QXAA 3BFKA 2RGAA 1JQLB 4PAMA 3Q72A 1GG2A 2W58A 2ZJOA 3AF1A 3DM9B 3D7MA 1N6RA 4A15A 1G3QA 5EUMA 3SOPA 3GLIE 1RRFA 3FWYA 5GVRA 2FSGA 5GJVC 2H5EA 1UKEA 3K8YA 2DR3A 2O0HA 4Q9IA 4C0AC 2AXPA 2NTYC 1Z0DA 1OXSC 2A78A 2AX4A 2ZE5A 5DO9A 3TSZA 4DLXA 2ZUBA 1COWA 3OHMA 1DO2A 1JBKA 2FPLA 4PHFA 4MUAA 4JT4A 2D7CA 2FEOA 4L9WA 2WWXA 4US0R 4OJQA
chains in the Genus database with same CATH superfamily
2ZITA 1BN6A 1CQZA 3UAWA 2FFBA 3PCRB 1ZL2A 3HYLA 5KS2A 3OP1A 3RUHA 3T4UA 2NUPB 3CLRD 5IN5A 1YRWA 1SXIA 2XYPA 3JARB 3B82A 4RTQA 4WXYB 2IBTA 3N6XA 2B7LA 4DJEC 4ZI3A 1GTSA 3C41J 4KV7A 3VBEA 1XDWA 3O47A 3P94A 4XQEA 4GYWA 3OJOA 3ZNNA 5B3LA 4Q34A 4ZHQB 2SKEA 1VBFA 4M0EA 1NRIA 3G85A 1QGAA 2H1SA 1ZM2A 1WMSA 2HFJA 4P86A 5ALNA 3BSFA 1GGNA 2A2ZA 3E9MA 3HUFA 5CFLA 1KC3A 5ADWA 2JCXA 2MSWA 4XB1A 1VMDA 2FFJA 1QHFA 2JATA 3EISA 4KGDA 4OQLA 2ONJA 2R00A 2ZRJA 5BVHB 1WKVA 1VL5A 1T6BY 3TQRA 3ZW9A 2VTBB 3VR5H 4DMGA 2D1YA 2C9BA 3HFGA 4DWVA 2FUKA 3A7DA 2G40A 4RY2A 2J5QA 1E2PA 5KVSA 2GF0A 1UF9A 4ID9A 5A4AA 4MEAA 2D54A 5B6IA 2HZBA 1EGQA 1G5PA 1Z4QA 1DHRA 5TEVA 2F59A 1QAMA 2RG1A 2H7CA 4Y2XA 1H23A 1MUUA 4XJVA 4QUAA 4B3HA 2XMDA 4Q7QA 3NDPA 2IF2A 3G9TA 1UL1X 3LQRA 4I50F 4JB0A 2YOFA 4D9CA 1X15A 2X7XA 1QLJA 1YZTA 4U9IS 2QTLA 3IX7A 5I4CA 4E5YA 4GZ5A 4PC6A 4LWZA 5KCZA 1XZBA 3K6RA 1QGZA 4XCXA 3DHWC 4JXJA 4JROA 3NGMA 1QPGA 4P84A 4QOGA 5EKXA 3ROEA 2ZSDA 4XSGA 1FLAA 3R24A 5GONA 5CAEB 3ZGNA 4B7ZA 2FVXA 3PUJA 4GQIA 1Q44A 4C4OA 1X86B 2BW0A 4F4FA 4HSGA 2A94A 3LUJA 1UBUS 3T0FA 2I66A 1XB2A 3URMA 1A9XB 3BSSA 5AM4A 5KVQA 1K3UB 2A7QA 4KL8S 4EOGA 4YHHB 4PLPA 3T5GA 4TSFA 5AW3A 3GBPA 1NI4A 3P8ZA 1RW4A 2B69A 5BP7A 5K6TA 4BGDA 4UEWA 1WB4A 1KR5A 2CXSA 1RKUA 2CMKA 4WEQA 2HLHA 1H0HA 4DIFA 5L53A 1AGPA 2PJRA 1IBRA 3HVUA 3P32A 3L7KA 1D7AA 3EX7C 2H06A 3C8ZA 1U0BB 2B25A 2YN4A 3KV1A 5HBGA 2EX4A 3Q88A 3LF1A 4F12A 4ZHSA 5TJHA 3ONFA 4EF4A 1V41E 4ZCMA 3DOHA 2V55B 2A9QA 4WSOA 2GHRA 1XZNA 1LZKA 2EBUA 3FNRA 3TRHA 2PN1A 3EPHA 3LBHA 2O7NA 2UYQA 1DDGA 2ZYRA 4HDNB 3VSBA 5JAMA 3WL8A 2AZDA 1ZVJA 2CHUA 4GQBA 3SF8A 3IULA 1M33A 3F3SA 1NXWA 2QU7A 1GCUA 2PZKA 3GEGA 2DPHA 4OBWA 4BDSA 2WU3A 4BQEA 3D7KA 4K9QA 1HQKA 3WGKA 2Q21A 2QJOA 1QRAA 4DR5B 4YQYA 2RHWA 1W4AA 2HRDA 2A4MA 2HZ7A 1W85B 2BRUC 4RMIA 3TR6A 1UWVA 1L6RA 2SKCA 2I03A 3GX1A 2VRCD 4CIXA 2ES4A 3BRCA 4JBIA 4DSOA 4EG1A 3B12A 2WWRA 1E89A 1ZONA 4U7HA 3T4PA 2J07A 1GL9B 3K2BA 3WRYC 1L7VC 3HVKA 2V7UA 5FHRA 3IKMB 1FFHA 4BP9A 5CYPA 5JD4A 3DONA 2OGZA 5F78A 1YL7A 2JAWA 4F4IA 3USCS 2ZXEA 2GN2A 4G0VA 1DSSG 2C82A 2W6NA 1T5OA 2P6UA 3PFFA 4JEMA 1G3RA 1Y7LA 3PNQA 5EMJA 3HTXA 3MZ0A 5FTMA 5JMWA 3FHCB 4MV5A 5L9AA 2FZGA 4F2HA 1G8YA 5LR6A 1E1YA 2VUUA 4JYPA 5DNVA 4EMTA 1JEAA 2O2JA 1Q7BA 2WA2A 4QVKA 4B44A 3W2TA 4YCLA 3RRJA 5C5EA 4Q6BA 2VNIA 1GXSB 3ADKA 3TW8B 1V7QA 3W2GA 4EX7A 4HWKA 2ADFA 9ABPA 1F6DA 1RHJA 3LVFO 3PC4A 1GFWA 2ZTSA 1B1CA 1N8TA 2VAXA 1Y5IA 1M1YE 4H7PA 4RULA 4X00A 1K88A 1NHWA 1FYFA 2O57A 1RACA 1H93A 4RJLA 4KAJA 1UT6A 5FR2A 1B2RA 3DYBA 3KR2A 1ZJ4A 3QVSA 2HJGA 1T35A 1PZNA 3LNCA 1BFKA 1KZHA 3P97A 4FN4A 5DTJA 4JODA 4MUEA 4PO8A 4E21A 3ASYA 3GQBA 3H8JA 3IT2A 4DMHA 2BGKA 1R0CA 4N3NA 3PLNA 3ANTA 2PSEA 1KWGA 2GYVA 2WT4A 1CS0A 3DBVO 4FYVA 3JAMA 2QX6A 4BEWA 4QOFA 2GT1A 4PLWA 1GFZA 3MXOA 3ZHTA 4DA8A 3OA0A 5JPDA 1EWQA 1CVLA 4KUHA 2ZAYA 1D07A 5I7AA 3BWXA 4YX9A 3UGJA 4GE3A 1SUCA 1W5BA 4L6IA 3ENZA 5C8DA 2ZIXA 2ZW9A 4Z9AA 2BFAA 3JQ8A 2HK7A 2XOXA 3CVVA 2V6FA 2R9VA 5TVGA 1GZ6A 1XLTC 1AOXA 2VDKB 3DFIA 5DCYA 4LZNA 1SOWA 4DLSA 4EJMA 5LDHA 1FFSA 4BTLA 1PBTA 1TLTA 4S2EA 3X2FA 4CG1A 5JZMA 3RJMA 5K3CA 5KOIA 4RS3A 5KTYA 3LUBA 5DYYA 4EKYA 2NWQA 4P6VF 1MAVA 1XYVA 3L0DA 5D6NA 4CMIB 4I66A 3KEGA 1OYWA 1O4VA 4YAWA 4DM3A 5KYUA 3K6SA 1XAJA 3I0ZA 2RGDA 3BWYA 4FSDA 4FCVA 3QPWA 3R4CA 1FS5A 2QE6A 3NHRA 4K9LA 3ADOA 1N78A 5C8VA 5J5CA 2H1CA 2ZUVA 4Y1EA 1E2FA 3IMFA 3DV2A 3G88A 4J03A 2UYHA 1LI4A 2Z8YA 1GDTA 4BV8A 1YJXA 1OB5A 4KMRA 1L4UA 1VPLA 1AZLA 3TZKA 5GONB 1KYIA 5GP1A 3DHEA 4EI8A 1XRPA 3JPWA 1T1EA 3VKWA 1YTLA 4IFIA 3AG5A 3Q7PA 3V4OA 3ZY5A 5JNTA 4ZMSA 4YDRA 2QRLA 2XT0A 3CM0A 5JLJA 1AG9A 3MUNA 4HQFA 1OT5A 2BR5A 3GQVA 5TF0A 4B9AA 4J91A 4FWIB 2L2QA 4HAIA 1NMZA 3AJRA 2FRVA 5KOYA 1BA2A 1CR0A 1U8XX 5HIJA 4Y6PA 1LBQA 4LWPA 3WHIA 1L7NA 2QW1A 2WM8A 1DXHA 3ENKA 3H9GA 2E5FA 4N7JA 4WZ6A 3KXDA 4TX1A 4YJGA 5FWXA 4EHFA 4J3FA 1VTKA 1JMVA 4ZQIA 1QDUA 2B9EA 3E3OA 4U7WA 2FX5A 2X2FA 1JHQA 3MLBA 2ENUA 1JA9A 4RFLA 2BFEA 2D4AA 2YXLA 4R1LA 2VSYA 4TRMA 2XUOA 1C7JA 2M98A 1GY8A 3A2MA 4DUPA 5K8LA 1JZTA 3LYLA 4PHHA 3WOHA 4Z5XA 1YQUA 2Q1WA 2PGOA 4N8SA 5F64A 4MW2A 2OOSA 5DBGA 3ZQ4A 2P79A 1I5OA 4PX2A 1B16A 1HFEL 2ZSIA 3A3OA 5CM9C 4YMTA 5LKRA 4MPJA 4CFSA 1MEOA 4TROA 4XR9A 3LRTA 5GTDA 3QWFA 5DN9A 1A71A 3WLQA 4JBNA 2YRXA 3JVVA 4LDAA 3TLJA 1H6BA 3QKRA 1LW7A 5DYWA 1EUDA 3KPJA 4EFLA 2VP5A 3EDOA 4CT0A 4CCAA 1UIMA 1W8DA 4AY4A 3R6GA 4IQGA 2P6RA 1U90A 2EF0A 4G5YA 1QWSA 3E9NA 3HEAA 2EBFX 2I4OA 4FGUA 1R4MB 3BAFA 4YRTA 2FMHA 5JSKA 3OECA 1J22A 1NPDA 5DGTA 1KVQA 2YQ4A 5DM2A 3AR3A 3MPUA 5BRAA 4ALKA 2QMYA 4W9MC 3W6ZA 3X1WA 1OTXA 1U9IA 3IP7A 3WLRA 4DDTA 1YIOA 2FF5A 2DBZA 4E30A 2JAUA 1XU9A 3I2FA 3RTDA 2AKYA 1P5HA 4EI7A 1IVNA 1RM0A 3DUFA 1ZC4A 3TLZA 2FPPB 1FUUA 1NBEA 3TIGA 4B73A 3V48A 1WW8A 1KZ9A 4S2UA 1U2PA 2FHSA 4NJMB 1NV8A 5EP4A 1JKXA 2C9MA 4FFNA 4RY9A 3ZS9A 3OOJA 4UE6A 1ESMA 3HDHA 1P8JA 5AVTA 3KQLA 1QFSA 1RZUA 1QV7A 4H0FA 1CSEE 3T9AA 1F0YA 3RYFB 4I55A 3SE0A 3L7CA 2C8VA 2JGRA 5IC6A 4MJ3A 4QL3A 4MVWA 4F8EA 3M3DA 4A0GA 4XYBA 3GH3A 4XPIB 1W5AA 2PUGA 1CS0B 3A1NA 4QU9A 3JWJA 4XWTA 5CXQA 2YJTD 5J3JA 2ATIA 2ZANA 1JMKC 1EEXB 4PG7A 3TGWA 2REBA 1TIKA 4OQEA 3QEJA 1QFMA 2QL5A 3PRHA 1YZKA 2D1QA 3C3MA 5DX0A 3VC7A 2B78A 3CE6A 2IUEA 1Z35A 1W9MA 2AC4A 2OE2A 4ABYA 3LNTA 4DUYB 2YIDA 2OESA 3ZGLA 3JQ8B 4ZEMA 2FHPA 4IV8A 5JALA 2O0LA 1SUIA 3AV0B 5KHAA 3DNMA 4WWHA 1SCUA 3T15A 1JPVA 1E3WB 4MTCA 3BA1A 1VYTA 1C1HA 3OQMA 4Z0TA 2J3HA 1QYCA 2NW6A 3C74A 3T35A 5DN6D 3N0VA 3A9VA 2GARA 4CG2A 4Y9RA 1EJ0A 5IU6A 1YCHA 4N5LA 3I8SA 3NANA 7YASA 1BO6A 2ZZKA 3BD7A 5CLFA 1NFQA 3M5DA 4LMBA 5JEDA 1KOJA 3K6SB 4RTOA 2HMYB 1TT5A 1NN3A 1U31A 3L8MA 3K72B 3VSDA 4IDDA 3WHPA 3PF8A 3QU9A 5IBQA 5ALQA 4LJ9A 2C7GA 1TK2A 2IEIA 1E7SA 1SFRA 2VG8A 1JRLA 3EXIA 4KH1A 4YVFA 3I9KA 4WW0A 4OLFA 1Q7CA 1ULAA 4EA9A 2YXNA 1JU3A 3B1JA 3I5AA 1HE8B 3FSGA 1KSJA 5GOZA 4CMBA 1IIBA 4C7OB 1DJQA 3FXAA 3HSKA 2P4UA 4JI0B 2RHGB 1UBJS 1K8QA 3CUUA 4U8HA 4P1ZA 3W7AA 2RJ3A 3GNTA 1D4OA 1FQWA 3PHJA 1RJEA 3AU8A 2GZ2A 5CNMA 4KXYA 3ZWVA 4NBLA 1R16A 3OP4A 4NE2A 2O52A 3QKSB 1WA5A 2O3RA 2OOKA 4WZBA 4A2WA 4IDGA 3S8YA 3M6IA 2FZCA 1JJIA 2WWIA 4TGLA 1FXSA 2XZOA 4LISA 1C30A 1HLPA 2P7IA 2Q6TA 1PL0A 3COPA 1BX3A 4U1RA 4YUVA 3WIEA 1XDSA 3V55A 4D7AA 3GMSA 4Z7OB 3R4VA 1YF3A 1DFGA 5HFJA 3E8XA 4D9IA 1VGQA 3UAZA 3KSUA 4RF3A 3BIFA 1FJ2A 1P0PA 3EAGA 4YJGB 1OREA 4B43A 5FWXB 5CLHA 1NUQA 1QH8A 4D9GA 2W93A 3HL0A 1OKKA 5E9WA 3I37X 5T8KA 4B09A 4K3UA 2GZSA 3FA2A 4HLUC 1PGPA 1VGRA 2JLCA 1R6BX 3D3WB 3OQVA 4MUMA 4IQ4A 4MGIR 1E2IA 4UUNA 5IT5A 1EM6A 2CMHA 1BD3A 4FHFA 1OVMA 4CZ2A 2WP0A 5CYGA 4TRNA 3FTCA 2PYZA 3HA3A 1VSUA 2Z2ZA 3BRWD 3M5PA 4K87A 4LOKA 3TZEA 3UFBA 3MJDA 1C29B 3ZCXA 2QN1A 4JUFA 1M2EA 1HRDA 5J59A 3RK0A 1PJZA 2HHAA 1KKLA 3ZNOA 2CCKA 3ZWPA 4E2FA 4MUBA 4NFYA 2CHFA 1HZZA 1Q14A 1ISIA 2IBSA 1S02A 3NKFA 2VDVE 3D8RA 3FWHA 3QUTA 4KZKA 5JH7F 1OASA 1P8AA 2JF0A 3HYCA 3IQFA 3QKRB 4PZAA 3CF0A 4W5JA 5ECYA 4P3YA 5G0SA 1PR4A 4QLAA 1THZA 1A5SB 1VSTA 1E62A 1THTA 2WV9A 3EZLA 3IHWA 2CJWA 1GKIA 1PT5A 1UK9A 4P22A 4AYWA 1VRCA 4DSTA 3H5IA 3RC3A 4IZIA 4TT3A 3D6TB 1FDIA 2FN3A 4IHQA 2QX9A 3KT6A 5D1NA 4NXNB 4L4RA 3SZLA 3HCOA 5G02A 4C2AA 5HR5A 1FIUA 2DTDA 1G2QA 2EJCA 2XUZA 5ITZA 1HDYA 1N2HA 2FN4A 3NHBA 4MR7B 1RLJA 4HGZA 3U1VA 3WO1A 4F04A 1B93A 2YS6A 4V38A 4CM4A 4CGZA 2HEGA 3F5FA 4KXWA 1P2DA 1V3TA 1W52X 2DFNA 4IO1A 1D6MA 1KO8A 1AA6A 4QYMA 4Y0VA 4YMIA 4KPYA 2FUCA 2X9NA 3BXGA 3FPFA 3NZEA 2G06A 3W8NA 5IDXA 2PX6A 2YMMA 3P9IA 3WLHA 5HQ3B 3DD1A 2A92A 1WMAA 3ZCQA 2X22A 3IVXA 2OV6A 2WM3A 5IJAA 1F06A 3N3BC 4CN9A 5GIOE 4JASB 4MS1A 2QDKA 2NU9B 2D62A 2TECE 1BHO1 3LHIA 1KI4A 4EYQA 3SU8A 1IG0A 2PZBA 3WG9A 1Z5GA 5JYBA 2IE0A 2ZROA 1YGYA 3BGVA 2M6KA 3CZQA 3TRFA 5IFLA 5JD5A 2BMJA 3OFND 2QROA 2QLMA 4FHCA 4HB0A 3NH6A 2J0SA 8MHTA 5AVJA 3OMWA 4MK4A 2H2HA 4A6DA 2WIFA 2WJ4A 3AYZB 4RIFA 4LXGA 1T9DA 1RHUA 3EMDA 3GDGA 4JOCA 2VVTA 4RIIA 5K0FA 2B9VA 5JSZA 3ESQA 3QMWA 5TQJA 4LECA 1XXHB 2AZMA 4V2UA 5TX7A 3KBBA 3KR0A 3KJIA 1NXVA 3N28A 4J1TA 4DJAA 2Q3HA 1X1CA 2B4TO 2ZIWB 4NBWA 2A1IA 1H4TA 1KQ3A 2ZRLA 4DWOA 2WSSA 2ZYHA 3O8QB 4BO8A 2KX7A 1FTWA 3JYNA 3L4BC 5TMDA 1BDBA 1H2XA 5IEJA 1RTTA 3HMQA 3ZLJA 1NXSA 1YB1A 2EZ9A 3MWJA 2OC4A 4Z9FA 1GVHA 1MAAA 5J2TA 1BGXT 1OBCA 1NSTA 1O96A 2XJ4A 3D2BA 1TT5B 3OTQA 4TQ9A 4U2FA 4ZQHA 2J31A 1CQIA 1Y37A 4KBFA 1C7EA 3F8TA 2DCMA 1HA3A 1PJCA 5IDWA 4HEA1 1COWD 2D5IA 5F1KA 1RM4A 1W7AA 2FZLA 2ONCA 4TUYF 4YQEA 4MKIA 5B7NA 3H5OA 2PYDA 3U7EB 3EUAA 1C5KA 1HOTA 1O5IA 4TT8A 1FFAA 2F7SA 4Y1RA 4G4SP 1AD2A 5K51A 1KJWA 1GNTA 1GJRA 3WK6A 4URXR 1RADA 4HK4A 3OPMA 3N8NA 4C78A 5K7SA 5KC9A 4JBLA 2XMGA 5KOJB 5BOVA 2XA1A 4ZTUB 2OLEA 2MT9A 3DH0A 2R48A 3B53X 2Q5FA 5ERGB 1SQFA 3EF1A 4COOA 4E6PA 4Y2UA 4F93B 2B34A 3DTVB 1M7BA 2WUGA 4LCEA 1GPYA 1Y5NA 3EYAA 2RGXA 1QH1A 2Z6AA 2JGMA 3NHSA 1ZKMA 4DIMA 1VIAA 2C20A 3HV2A 1QH8B 4OGGA 3KQWA 5JAOA 3CPHA 3RC9A 1CB0A 4E1BA 1NX6A 2QZPA 9LDTA 4KRFA 2JFQA 3QBDA 3W5BA 5CG1A 5JY1A 2I34A 4LPKA 1I10A 4IOMA 2I7TA 2ZJ4A 4FDMA 2A0FA 2VAWA 3BJMA 1WU8A 3CH7A 3JQBA 1A4RA 2I6SA 4K8RB 3WICA 1A04A 5A4JA 2CBZA 1AO3A 1CU1A 3T7KA 2NXWA 3UAXA 4LFAB 1WO8A 3HRIA 1BHJA 1UZLA 4WCFA 3G0DA 3HE3A 4YYZA 221PA 1BEEA 5EYPB 2YXBA 5HIAA 4FYJA 5L3RA 1W0JA 2ZE6A 1JI3A 1AKTA 3PUXA 2OHJA 4AL4A 4KR9A 4JIGA 1RIIA 1JG6A 4BJ6A 4TQUS 2PGAA 4R9UC 4DVGA 3D2LA 3LT5A 1U0HC 1LBTA 3T6KA 4M9ZA 4HSEA 4AJHA 1RI4A 1G8FA 2QRGA 1Z6YA 5LOVA 4TLEA 3KZ1E 2FW0A 1DOZA 2BH9A 3PA6A 2VZEA 4CR6A 3MT7A 1TVKB 4LXUA 1V16A 2YFQA 3I1FA 3T4EA 5ITZB 4NZ9A 2HMWA 1WHSA 4HQNA 1FQOA 4X3PA 5IZCC 1HGXA 4CM4B 3AKDA 2DT8A 2GAIA 4TV9A 5FPTA 1PWHA 3WLTA 3SJAA 4D9HA 1UPBA 2QLFA 2HU7A 2PH3A 2H1VA 5KB3A 1Z0KA 3UAYA 1E77A 4Q4DA 1PFWA 2IDZA 2VZ0A 3E5RA 3SQMA 5JHGB 4I2VA 1M10A 4QUKA 1D3AA 1GGKA 2AH5A 1PV2A 1RAHA 2E85A 3HU1A 3ZWBA 2HQRA 3BWDD 4BMPB 2CMDA 3N53A 4LE2A 3TK1A 2ODPA 1FYXA 1UXOA 3QLUA 4XYMA 5LP6F 1U2EA 4MS1B 4UHKA 4BKQA 4BWFB 1UP6A 3DZJA 4CLEA 3DUWA 1TYEB 3M2TA 1JHAA 2Y1KA 1TKRA 3PG5A 1CQXA 4HY3A 4OXYA 5CLQA 3EG5A 4ARZB 1ZU4A 3IKTA 4KR2A 4Z2YA 1GTG1 3ZGOA 3N2KB 2O0MA 1PJLA 3A05A 4LYGA 4R83A 1ORTA 1W4RA 3DWFA 3BRQA 1BEZA 4IDFA 2ZRIA 1IEXA 2GKSA 3IMEA 3IXQA 3LSYA 2F3PA 3D4BA 3ZE0B 2BLLA 2W2OA 4IQ0A 2XUKA 1R8XA 2ZSJA 4OXNA 1SVOA 1AQLA 1S9HA 4QUHA 1LC0A 5JSZB 1H5UA 3KG2A 4Z4EA 3R9KA 4URFA 4Q9JA 4Q15A 4DCCA 3KOZA 3FKJA 2BOVA 2LNDA 4HUTA 3GWGA 1E4EA 1Y81A 2H2IA 4H18A 2WR8A 1M76A 1PI3A 1L4LA 2QD1A 1E8DA 1BS9A 4FEAA 4JJEA 3VO2A 3I4FA 4M0KA 3RRBA 3H42B 3SMVA 4DKJA 5CFRA 1RQPA 2I2WA 3IERA 4J49A 1RYFA 2QTTA 1Y3HA 4QO8A 1SVWA 1YHNA 5AI0A 3PITA 4NWIA 2I9PA 3ILSA 1C7FA 1L4BA 2A9VA 1E1NA 3FBTA 1D7OA 5E9AA 2WICA 2CL7X 3G2MA 2TYSB 2A0KA 3ZZNA 3KVYA 3EZ2A 3OTOB 4DNFA 3QIVA 4M9SA 5ILGA 3WL7A 3A0RB 3ZDBA 4Q1FA 3UWOA 1D2AA 1KI7A 4YUXA 3WZ2A 2Q4RA 1KJJA 2QYSA 3WLKX 1QO9A 1EUCA 4WBXC 1VG1A 3IRUA 4KK4A 2F1JA 3G0OA 1YNOA 1H2AS 3E2PA 4EO7A 1FZQA 2DFDA 4KBGA 3SEZA 4D9NA 3IUPA 1QDLB 2P3SA 3OPVA 5A1JA 1EE9A 3ZVMA 1WCYA 3I01A 3D0OA 2CVHA 1E4VA 1U9JA 5DE3A 5IBPA 5H3LA 2REOA 3HKCB 2NO5A 3OI7A 4BWVA 4AW9A 1RXWA 3DV0A 3FCXA 4XWGA 5CIWA 3PNKA 4TLLB 1OXXK 4ZO7A 3U6KA 1E79A 1KGSA 3S5JA 3ZLUA 3ZXYA 5C18A 1EFPA 1W2GA 1X77A 3RS4A 2AUMA 4KQIA 1WR8A 1YTUA 1OV6A 1W87A 4P3NA 3A1EA 3JCZA 4QQNA 2DQSA 2JVJA 4MHSA 2AXEA 2IELA 1QH1B 2AV6A 3U7RA 1H5QA 4G1CA 1IY1A 3RRZA 1ZK4A 3AUXA 5K09A 3SHQA 3X1XA 1A50B 5CBPA 2G1JA 2I2CA 3PD0A 3E53A 1BVYF 4DLVA 3C15C 4HWSA 1E3JA 3NIFB 2HDNB 3CH6A 5KTTA 2ZJZA 3FYDA 3GGSA 4QQKA 5AM5A 4I5GA 5KKCA 1OFVA 1ULTA 2YMQA 4P4SB 4CODB 3I8XA 1MQ9A 3IUBA 3PWZA 3LX8A 2C0QA 3RAGA 3V9AA 2AN9A 2WQZA 4DLLA 4WOPA 1KYZA 1LW6E 1NMEA 1CRZA 2NN3C 2PGDA 1X2EA 2ZDGA 3V1UA 4BQSA 4WCFB 4B2LA 1K6JA 3PXEA 3CF2A 4Y6LA 1FRZA 1THMA 1FYWA 2FRDC 1CJBA 3Q5GA 4YDQA 4G97A 3WL4A 1WEHA 1GFIA 1PYGA 3PDUA 2C58A 3UC5A 1P7ZA 1IXKA 3IQHX 1P0MA 1TO6A 2BE7A 2XAUA 4R6WA 3VNUA 3O0TA 5BSWA 4C0QC 4P81A 1Y8CA 4LJ4A 5I3CA 1JKFA 2UZ1B 1GNPA 1TU3A 1L7OA 2IHVA 2RHRA 4FX5A 4Y6GB 4ZT3A 5L3VA 3O38A 1X1QA 2PZJA 4I1VA 3IAHA 3UJ8A 1TZBA 4G23A 5D3QA 3LX5A 1Z0AA 3OZXA 1IDN1 3C87A 3NLLA 2GETA 3QWHA 1OCEA 4DDUA 1RBYA 1UC8A 3CUVA 1WHSB 5EG5A 4WLFA 2ERYA 4TV9B 1CUGA 1S01A 1B0PA 2A35A 4CMEC 2MWMA 1P2UA 3MQ4A 3FDZA 4RF4A 4PINA 2IU4A 2PZ8A 3BCHA 4IIUA 4CEJB 5AKJA 3NMUF 3BGWA 2FSFA 4ZDKA 2YFYA 3HDJA 3QUBA 1Z88A 4TKLA 3NNSA 3D0RA 4HZUB 2BP7A 5SY4A 1CZKA 3H1BA 4AB1A 2PL1A 1K2WA 4YCNA 2MYTA 1MW9X 4LSZA 4ZVKA 4KNVA 4D97A 2ZWIA 1XEXA 5CM8B 4G0QA 2QE7A 3W8FA 2W2VA 4PCUA 3OOSA 3VR6D 3B60A 4GP7A 4BZPA 4DDVA 2P1RA 4TV8F 1YJ8A 4W9RA 3DTTA 3LAWA 3FYSA 3V8NA 3N1UA 2RC5A 1EP3B 2PQ2A 4HOYA 10MHA 1KL7A 1WUJS 1NAHA 1JQKA 4J4BA 5B36A 4L6CA 1QHHA 3DR5A 3X1KA 2FCRA 2P6OA 5I8WA 3ETCA 1FRQA 4OJKA 3ABQB 4ZAZA 1V6CA 2E9SA 2YASA 4WNAA 2DBVO 1XJ5A 1JFTA 4EVSA 1UT5A 3PNYA 1DBVO 2WYUA 5EIBD 4LVNA 4EEZA 1R8QA 3L6BA 1C9NA 4BAUA 4I9FA 4ESVA 1FYVA 3TIFA 4RPHA 4Q3KA 2GJ9A 2OBLA 3X1ZA 2XXAB 5AHRA 4KPEC 3G5AA 1Z5NA 1QYXA 5HOEA 1R0WA 2VR1A 2GWHA 2IW1A 2O54A 3RTBA 4DLYA 2WOJA 3W5UA 4DR1B 3KLOA 1V26A 5L4LA 3I04A 4MUHA 5CA0A 3PFCA 1IY8A 5TT1A 4JEIA 4BMVA 4KKVA 1P4GA 2OFWA 4EL5A 3SX2A 2FWPA 2OGTA 5IX8A 2WINI 3W34A 3LC1O 4GC9A 2HCBA 5FV7A 3SYLA 3RIXA 3ANYB 1XVUA 2BDTA 2V96A 3O73A 1KETA 1BWQA 1ISJA 2R84A 3CF4G 1EUCB 3IUQA 3GGDA 5CJ2A 1U2SA 5DHQA 4AROA 2JI4A 4ENRA 4B81A 3SX4A 4YWJA 4GC5A 3TNJA 3V46A 2HEIA 4UHFA 2VT6A 3WFZA 1R27A 1JBQA 5IARA 4OREX 2BY4A 4LE1A 4C0JA 1LLCA 3LK6A 2BBOA 3C8HA 4EX6A 4CT4B 4YRDA 4Z4IA 3DV0B 2HMAA 4ETIA 5ICCA 1L5HB 2G1AA 5JARA 3LFTA 1G5QA 1M1NA 3EQ8A 1XBTA 1W96A 3HADA 2ZT8A 4KO1S 1CC1S 2HDHA 3MRVA 4QIHA 3DB1A 3VR6H 2W4MA 5E2BA 2C7QA 2V4MA 3AJAA 3KT0A 4C5AA 4HC4A 4I8XA 4ATNA 1N2XA 1X92A 2QRHA 5JI3E 3GDWA 2MIIA 4PZDA 5F3DA 4DWJA 2C2BA 4LXXA 5CBPB 3OX2A 1ZUIA 5I6DA 3B6EA 3GWZA 3R40A 2DWCA 2YN0A 2NO1A 4DG8A 2Y77A 1LBHA 4E09A 5A2QA 1G2OA 4NOLA 1ZJJA 2ZRFA 3H1TA 5LXTA 2QA5A 3NONA 1DEHA 1C1DA 2O5VA 4LN1A 1K97A 4P0QB 1KE2A 4IIGA 1ABEA 1B26A 1ZA1A 2JLAA 3WGUA 3SVTA 2WRZA 1AN9A 3O2NA 5L51A 4J9VA 2PZFA 2QL6A 2ZWMA 2G5CA 4HADA 3W5SA 4XWOA 4MS3A 4I14A 1SCIA 1A8IA 3MFYA 1SRQA 4NBKA 3OBIA 4YLYA 1NXXA 1VMIA 2ID8A 3MOGA 5KWJA 1XXLA 3FOZA 1G1MA 5LYJA 2HHJA 5JD3A 4PSKA 4IJ5A 4KO4S 1Y1PA 5K2MA 4RVOA 2ZR9A 3I28A 4WECA 5HBRA 1OJLA 3AEXA 2O7RA 2OO7A 4Q02A 2Q50A 3TTVA 4EQZA 1QNFA 2G7ZA 5FADA 3KLPX 4H1VA 2UYGA 5F21A 3TIIA 4C4SA 2IS1A 2D8AA 1EVQA 3DTVD 4OJTA 1AKUA 1ITZA 2MSLA 2PWZA 3RFUA 3WBJA 4OQQA 1KVRA 3GJSA 4BBZA 3DR3A 2Z2KA 2IL1A 2ODBA 2PKEA 3KYJB 4RH1A 4WI1A 2PSSA 1H2HA 4N5IX 3TD9A 5BR4A 4WKOA 4BIIA 4QTUB 4CIWA 2F1RA 4MJ7A 4YIKA 3JQQA 3P9QA 3MGGA 3ROGA 5BR1A 1G1AA 2HF2A 2C2KA 2Z5FA 3C3XA 3FDZB 3M82A 4LV6A 4UVGA 4GM4A 1GUFA 2QR5A 4P7FA 3G8CA 1IEWA 3TX6A 1AUOA 1QCZA 4LTMA 3SKXA 3TIXB 4BB6A 5C7IO 5JS8A 1G8KA 3EZ6A 2H2DA 2BP7B 4YJ2F 2W6MA 2ZEJA 3N5CA 1YB5A 5LC1A 1NVEA 4RXTA 3HKEA 2TMYA 4G1MB 4JH0A 1HDGO 1HUQA 3JRXA 4NLLA 3ZCTA 1YASA 4JJ8A 1ICIA 4CLOA 4A0FA 1FX0B 2NZYA 2H1OA 3HVRA 3O3CA 3CZAA 3RTGA 1FC0A 3UBTA 4AJNA 5D00A 1LDNA 1XC7A 1GT6A 3FWPA 4CLDA 2C29D 4H59A 3HA5A 1SUAA 2CNKA 1LV7A 1Z2DA 1MJFA 2P9HA 3A6FA 3FVQA 1RWVA 3IEKA 3LPAA 5IJWA 2RHCA 2PRJA 2CKMA 4K26A 5FFMA 5DXAA 1Z2CA 2CNOA 1M2WA 4IAOA 4M0MA 3ULKA 3WGHA 2YY6A 2OP1A 2UXBB 5TJ9A 3I42A 1NLFA 2P65A 4MLZA 1WV0A 3O4GA 4IGKA 3TCXB 5JZOA 5ICSA 4J4TA 1AURA 4FR0A 5F7OA 4DCOA 1P6UA 2I4MA 2YVLA 5LQRA 2WKRA 4MPTA 5NULA 3KQMA 2NG1A 3N8DA 2LXNA 4FFPA 2JIPA 4O63O 1QDEA 1SQ6A 2AIRA 2CVOA 2G09A 2Z8ZA 5AQEA 5TQ0A 3WGLA 3WQSB 2BMWA 3BRSA 4HDQB 3QLEA 5LD2C 4RL6A 2C2HA 3CS3A 3RGWS 4BZQA 3BD6A 2OEPA 2V5UA 4J7UA 5HM8A 4NR0A 4EF5A 4KU4A 2YZMA 1O57A 5IP5A 1P1RA 3PICA 5AK0A 1BFUA 1W49A 2J3EA 3MAAC 3RFVA 3WB2A 2XYVA 3U9TA 2B7CA 4Y2RA 2YMPA 1XGKA 3L8CA 2Z3VA 2QTNA 3II6X 3IOMA 1EVYA 3DV9A 2X0FA 5HRUA 3ZGZA 1I7SB 3UPTA 4R1SA 4YGYA 3AKEA 3HEBA 3UOAB 2CXQA 3GJ7A 5GJWC 2ZWAA 3N7AA 1VM6A 2IYRA 1N4DA 2IK8A 2QTRA 4QVGA 2HNBA 1GQOA 3PEUA 4XUCA 2P1DA 2RDMA 1TA0A 1Z26A 2AJLI 2P2CA 3GLHA 4JY7A 2D7DA 1NC3A 4P7KA 2X6QA 3S99A 4I50B 5C1PA 4AY2A 1SIUA 1V4NA 4YP0A 2PH7A 3NXSA 1GTJ1 1MJNA 3AFNA 1U7TA 3AI1A 1M1NB 3L5OA 1FNDA 2J46A 4HGOA 4P08A 1T0BA 4PU0A 3AY7A 2V7QA 2BJWA 4R68A 1KI3A 5C4GB 2CUZA 2QRNA 3E7DA 2W42A 4LKRA 5I7UA 3WIOA 4LQ4A 3AL0C 4AJKA 1E69A 1BWPA 4F86A 2BGGA 3HXOA 2WSSD 4IO0A 2W90A 1KYWA 1FTYA 4N12A 5H68A 4N5NA 4XJTA 4X54A 1SM4A 4BNKA 4Z53A 4FNGA 2PGIA 5GMOA 3DB2A 1NPTO 4PNHA 3VKGA 4UBLA 2QVGA 2QD4A 4DG5A 1R66A 3SXUB 4XI9A 5LMNB 1H3NA 1GNLA 3O95A 4UXIA 1LF0A 3AFIA 1ABFA 4B3XA 3KEOA 3Q9UA 1KEWA 4IPTA 1V9CA 2Q4DA 3FVTA 4LYAA 4N54A 3ORSA 1SN7A 4EHJA 4ZRMA 4ZDJA 621PA 5L3QA 1LPMA 2QTWB 3KTFA 4QXRA 2JIZA 1CW2B 3R09A 3IILA 3NNNA 4LYEA 1UWCA 4HJXA 2PSFA 1ZESA 3DEJA 5EOVA 4G5OA 2HBZA 5AVYA 2IXBA 2Q0HA 4E1AA 5IDVA 1V5EA 5F2EA 4CM3A 1QBKC 3IAM6 3LXXA 1ODJA 2ZM6B 2EWMA 4BE7B 2QRZA 4DXAA 2CMGA 1FMLA 2J0VA 4HXFB 2YIMA 4OQMA 4W99A 5CHYA 1OXVA 1JPNA 3K0CA 4MVJG 4QZVA 1J4AA 2Q5OA 3C0KA 2O3UA 4Q4HA 4F56A 1YJAA 1TM3E 3S55A 4EGFA 3CB4A 3GUCA 4PAGA 2OUIA 2VJBA 4ZXPA 1FFXA 2BBTA 5I45A 5JRJA 1KKMA 5ALDA 3KX2A 2G0AA 3H4IA 3DQPA 1NHGA 1YACA 1EPUA 3L6RA 1XNJA 4L15A 3T7DA 4PYJA 4P36A 3L7JA 2NVUA 4QC2A 3QW2A 4QHSA 5LNK6 1VHDA 5LDDC 1HL7A 3M0EA 2G9NA 1QP8A 4QYXA 1SXJA 3LYUA 4TYPA 4FYPA 3P9XA 4C7MA 5LJIA 2EGGA 2QQEA 4L51A 2ZJYA 2MSNA 4LBZA 4QYSA 2R47A 4IDPA 4L08A 2JFBA 2YY5A 2OHVA 3FSJX 2NYAA 1NOKA 4KDEA 1NN0A 4C3UA 4JZYA 5EUCA 2PLAA 2QOEA 3ZX5A 4AJJA 4PO3X 1WY5A 5JZ9A 2F4VB 3RFFA 2BC9A 2XCIA 3KFXA 1MAWA 3BK7A 1E2DA 1BIFA 1WTCA 3HRKA 4KSYA 3F71A 4XDYA 1U3WA 4KE8A 3ZHBA 1JTEA 2XKAA 4G01B 1W0JD 2V7VA 2V6MA 1VIMA 2GHTA 3OIYA 2CZGA 1GLNA 1N9ZA 3MMPA 5IXSA 5A7GA 2QJWA 3UWSA 3FM9A 1PFUA 2SHKA 5ERYA 1XMVA 5AKIA 4ENVA 3CTPA 4XVUA 1L5OA 3JQFC 1BS1A 1FEZA 1LLQA 3NFRA 4FZVA 1N34B 1JR2A 4WESA 4CIYA 1YNSA 1SULA 1T9ZA 2EJBA 4M22A 4FFRA 4U5XA 1IOVA 3LYHA 3LOPA 2DWPA 1SG6A 3N39C 4K1LA 3C5CA 4Q37A 4OHKA 4ZVPA