4LV8B

Murine irga6 bound to toxoplasma rop5c, a pseudokinase gdi
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
397
structure length
390
Chain Sequence
b'NDLPSSFTGYFKKFNTGRKIISQEILNLIELRMRKGNIQLTNSAISDALKEIDSSVLNVAVTGETGSGKSSFINTLRGIGNEEEGAAKTGVVEVTMERHPYKHPNIPNVVFWDLPGIGSTNFPPNTYLEKMKFYEYDFFIIISATRFKKNDIDIAKAISMMKKEFYFVRTKVDSDITNEADGKPQTFDKEKVLQDIRLNCVNTFRENGIAEPPIFLLSNKNVCHYDFPVLMDKLISDLPIYKRHNFMVSLPNITDSVIEKKRQFLKQRIWLEGFAADLVNIIPSLTFLLDSDLETLKKSMKFYRTVFGVDETSLQRLVDQVEAMIKSPAVFKPTDEETIQERLSRYIQEFCLANGYLLPKNSFLKEIFYLKYYFLDMVTEDAKTLLKEIC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rhoptry protein 5 C
publication title Murine IRGa6 bound to Toxoplasma ROP5C, a pseudokinase GDI
rcsb
source organism Toxoplasma gondii type i
molecule tags Transferase/hydrolase
total genus 150
structure length 390
sequence length 397
ec nomenclature ec 3.6.5.-:
pdb deposition date 2013-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05049 IIGP Interferon-inducible GTPase (IIGP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lv8B02
3B1XA 3N5CA 2QMOA 2ZI7A 4LJAA 4A6PA 2PJRA 2OILA 5G40A 1N6KA 2ERXA 1RZ3A 2QAGA 3FTQA 4V0OA 1Q20A 2VIIA 3KUDA 3I8XA 4JT4A 3B1ZA 2R6AA 3RRMA 4NYMR 3K9NA 1I4LD 4LI0A 5EUMA 3C15C 3UKDA 1P9NA 1ZM7A 1M2OB 1AGRA 3BFXA 4Q4AB 2QAGB 2ZI3A 4HAWA 2Q3FA 4JS0A 1E2IA 4XD7A 1OIXA 2WPDA 1DAMA 4IEIA 2G1KA 4PC6A 5G3ZA 3CRVA 4DHEA 1LB1B 3CRMA 3CPJB 2WOJA 1XCMA 1U81A 2QPTA 4OQFA 3X1XA 2QA5A 1OXVA 2WAXA 4Q1AA 1OH8A 1ZAKA 3ZGXA 2FEMA 3CZPA 1UM8A 1QBKC 1ZC3A 3ZH9B 1CULC 1IY2A 1OHHD 1JPNA 4KYIB 3DEFA 2R6FA 2WAYA 2O8BB 2IYTA 2CEAA 2DHRA 2ZE5A 5EZ6B 4TMVA 3KQUA 1P62B 4ZV4A 1XJCA 3TSOA 1RW4A 2ZR7A 4LJ6A 3VKHA 1OLOA 1GOTA 4FIDA 3T1VA 1J2JA 2KBEA 1KSGA 3VMFA 5KTYA 4LX0A 2P3SA 4FCWA 2IX3A 1MO5A 4M53A 1E2FA 1CR4A 4KFSA 1DEKA 4RSGA 2CVHA 3WHKA 2ZVPX 2GEVA 3WHLA 3ZD7A 4XWKA 4KFRA 3I8SA 2EFDB 4Q4JA 1W2GA 4UXJA 1CR0A 4QBHA 4MYHA 2IHYA 4P4SB 1KO8A 1GIAA 2GEDA 1OFUX 1T3LA 2FSHA 3U61B 2Q9BA 4OQNA 1ZVQA 2REOA 4B33A 3GLFB 2ECKA 3TVDA 2VTKA 1KI4A 3PG5A 1RRFA 2GDJA 1H8ED 1XTSA 3A1TA 5CDFA 4CF7A 2FF7A 3CR7A 2ONJA 521PA 1VTKA 4B2LA 3B8HA 2BM1A 4Q01A 5DYGA 2OAP1 2XTZA 1IN7A 2HJGA 4YMTA 2X1VA 3CX7A 3SDZA 3BK7A 2BBWA 4BFWA 4V02A 2IEYA 1W46A 3SC3A 3TGPA 3RLFA 4D4JA 4MRPA 1NVVR 4I1OA 2A78A 1GAJA 1XNJA 2G83A 2QG6A 2YC4C 4TMZA 1CJTC 1N5IA 1XEWX 4LYAA 4N0EA 4B34A 4A8JB 3U44A 1JAHA 4L9WA 2YWGA 2QORA 2PCJA 3K0FB 4OHWA 1WXQA 2GJ8A 4CW7A 2JDID 3EZ9A 4IDHA 4PZLA 1IXRC 3T1TA 4ZCIA 5KDDA 4HLCA 5LB4A 1UDWA 1SVLA 3JVUA 1FUKA 4MITA 4B76A 1E2GA 2H5EA 3U44B 3B1VA 3RWMB 2OHFA 3MJRA 1FMJA 1K5DA 4LJYA 5AJYA 4HUQB 4EFNA 1GKIA 4GP6A 1S9DA 3CRRA 1IJEA 1NSFA 1S96A 4R2IA 2A5YB 3TSWA 3PCRB 1ZRHA 3PV0A 2G3YA 2GILA 1NKSA 3KQHA 3A58B 2ANCA 3NVAA 3FKSA 4NCKA 5EE1A 2H7VA 4TTRA 1W4RA 3EZ7A 1X6VA 3KZ1E 3QF4B 1HQCA 3K0CC 4M9XA 1XMJA 2J1LA 3QEOA 4Z8XA 3ZIAD 3IEVA 3UXMA 5UKDA 4JLJA 2P67A 2IK8A 2QBYA 3HU1A 2GK7A 4XVRA 2AK2A 4MRNA 3KXLA 1KKMA 5K8TA 1U99A 3MCAA 3CPHA 5EQTA 3LAWA 5CIWA 2ZJ8A 4H1VA 4NBSA 4JJZA 2XAUA 2QY9A 1OXUA 3TIFA 4GZMA 3NKVA 3U3MA 2XZOA 3OIUA 1KDRA 5FPHA 3L0SA 2ZM5A 1Q0UA 1ZC4A 2PZEA 3QF7A 1QHIA 4JMPA 4BASA 1PLKA 2FGJA 1U9IC 2V7QD 5KSYA 1IHUA 4EIWA 4ZDJA 4TLBA 1E98A 3U3RA 4C3ZA 5CM8B 4HAVA 4KXFB 2O8CB 2O0JA 4FWIB 3FE2A 4QOSA 1TAGA 1Z07A 2J59A 3FB4A 2IHBA 4DSNA 2NMVA 1TPZA 1Z08A 4IVRA 3UATA 2C9OA 1NNEA 3BERA 3AVYA 2HYIC 3WMGA 1ZM2A 2DFNA 3SR0A 1CJUC 3QXCA 3K9HA 1S8FA 4C4PA 4PQRA 3SBDA 2RGXA 3NH9A 3ZZTA 3WBKA 3TAHA 4Y0AA 1Q21A 2BDTA 2GZHA 5DI3A 5FUWA 1XEXA 1EXMA 4C2UA 2V6JA 1JXOA 3M0EA 3C41J 5HZHA 2ZI4A 1Z8FA 2NZJA 3P26A 2QROA 1R8SA 2GBLA 1ONBA 1ZU5A 4BLRA 5EE0A 4DB4A 3MJHA 2HT6A 2FMXA 1FL9A 4NL4H 1IM2A 2QQEA 3EWSA 4FI3C 1XEXB 3AKEA 2Z6VA 1GVNB 4JIMA 4PC3A 5JLJA 4AKGA 4GP7A 2ZRGA 1ELOA 1DAFA 4M1OA 1YR8A 1E2LA 4BFUA 4TYYA 4ZCMA 1A1VA 4HLUC 4JSTA 5JJIA 2CCGA 2D7CA 3DM5A 1HE1C 1XTIA 2QUZA 2RGGA 1YRBA 1ZNZA 3O47A 3GLGA 4DLRA 5TMPA 1IN5A 3MMPA 4PO1A 3ND9A 2KSQA 3I3SR 2BMJA 3EPHA 1W5TA 2CL0X 1FP7A 2HXSA 4Q66C 1G5TA 2G0TA 2NQ2C 2QAJA 1DOAA 3ASYA 4Q7KA 4NDZA 1EFRD 8OHMA 5AUNB 3I5XA 2CE7A 4TT3D 3I61A 3REGA 1F2TA 3NXSA 4OBEA 3I4LA 4ACBA 1CP2A 3QG5A 4CEJA 3C4JA 3KTAB 1NMXA 4OI2A 2QT1A 1A2BA 2WM9B 4V0MA 3RC3A 3ZIAA 2ZRAA 1KJYA 4HEJA 3LVQE 4EPXA 3LFUA 2O5VA 4Q19A 4A15A 1JEEA 4CEJB 4DRZA 1JEDA 1XXHB 3OFNA 4HUTA 4B74A 1OPXA 4H9GA 3H0KA 3UG7A 1RFLA 3G82C 2ZRCA 3E5HA 3SN6A 3T12A 1MABA 2ZREA 5TV2A 1D2NA 1F2UB 1DELA 4L8GA 5B58C 4DDTA 4WVFA 1E2EA 3FMFA 2IUTA 1SVKA 4XVUA 1GRRA 4PTLA 3ECCA 3AKCA 3KUCA 2V7QA 1AS3A 3EAQA 3OHMA 4DWJA 2WJYA 4MRSA 1MO3A 4LHVA 4YMWA 3UANA 1XPRA 1BKDR 1SVMA 1IY0A 5C4GB 1TQ4A 1UADA 1US8A 5CYOA 3AF1A 1N25A 4QHSA 2V3CC 1C9KA 1YZTA 3P4YA 5KU1A 2O8EB 3G5UA 1MT0A 3OIWA 4OHXA 4TYPA 2ZXUA 1HT1E 5M04A 4PHGA 5SZHB 1E4YA 4BLOA 2RB4A 2Q6TA 4NCIA 2OCYC 1JR6A 3BAFA 5EE9A 5F98A 1QHGA 5LD2B 3GEEA 1LY1A 1YKSA 4BFSA 4GOXA 1II0A 4ZDKA 2F3RA 3DL0A 5H70A 4ZDWA 2H16A 3M6AA 4PSAA 1L7VC 4UJ5A 2Z83A 2F55A 1T5LA 1OFIA 2BKEA 4TZ0A 1X8KA 4TL8A 4Q4LA 4A2PA 2VF7A 1XJQA 1YHNA 1MR3F 5HPYB 2XJ4A 3U3JA 4J0QA 3WBJA 1EFUA 3F3YA 3FVQA 5BN3A 1NY6A 1CR1A 1KO7A 4GI7A 4D80A 3TUZC 3O8RA 2CK3D 5BWMA 1E9SA 5KSZA 2JLRA 5GJWC 2QGNA 1E1RA 1HY3A 2ORWA 3LD9A 1R6BX 821PA 4U02A 4LCBA 3M1IA 4OQMA 4V0NA 3HU2A 2ZRPA 4PX9A 421PA 1FX0A 1ZP6A 4QL3A 4IOJA 4RFSB 3SI7A 1T6NA 3SJBA 1WA5A 5ANRB 5KYKA 3EG5A 5SZJA 3CF6R 2AD1A 2PZFA 2P65A 3THWA 1OYWA 3AF4A 2VSFA 2HCBA 3FHOA 3EPLA 1E32A 3IQWA 5HCIA 4AD8A 2RGCA 3RC8A 2WJIA 1FX0B 2ZSFA 3K70D 3IQXA 3C5HA 1ZD1A 4ZKEA 5KHOC 1RJ9B 4R7ZA 4TT3A 4A0GA 1Z6XA 5K8UA 3EIQA 1OKKA 1XPUA 2QM8A 3QQ5A 4MKGA 5GJBA 5EJEA 3GP8A 2W6ID 3BD9A 3KB1A 3DZ8A 2N1BA 4G01B 5LBIA 3X2SA 1JNYA 5KSPA 1Z2CA 1UFQA 1ETUA 2ERYA 2GJSA 5H68A 2Q9AA 2ZE6A 4EPYA 4NHOA 4AG5A 1E79D 2IYQA 3BBPA 1SVOA 2QU8A 1NVXQ 3NC0C 4RD1A 4UNPA 4WBSA 4OJKA 3SHWA 4IDNA 3PITA 1NMZA 2D4HA 5EE5B 2WJVA 3HJNA 1YZKA 3R8CA 3RABA 4QM7A 3AP3A 1DARA 1N0WA 1WDTA 2CHVA 4B47A 4DCVA 5L3SB 1G5PA 3KDSE 1QVRA 3DZDA 2BWJA 1GL6A 4AY2A 3R20A 3PEUA 2XNDD 3S1AA 1GTVA 2QGZA 2UVQA 2J0UB 4NTZA 2ZI5A 1M7GA 4TMXA 4EPTA 3CBQA 2EVWX 4DCUA 5FI1B 2Z4RA 4DLYA 2VL7A 4KFTA 4BLTA 2G1JA 3GQBA 1W47A 2W0MA 1M34E 4POAA 3KJIA 3U6KA 4EFMA 2ZYUX 5TXGA 1G18A 2ONKA 4G5QA 1CJVC 1D2MA 1OFHA 1XZQA 2VP9A 3X1WA 1UEIA 2WOOA 2O8DA 4BLQA 5EZ5A 1RRPA 4UQOA 2HEIA 3W5JA 2JEOA 1DPFA 4LHWA 3AKDA 2ZUBA 4BUJA 4OQLA 3U3OA 5CIQA 4XIGS 3IGFA 5CK4A 3MWLA 1G8FA 4PPQA 1PZNA 5JEDA 3AVTA 4X8HA 4D26A 2DFLA 2CNWD 4D0LB 1RRGA 1JI0A 2AFIE 4DT1B 1KMHB 4C0KA 4Q48A 3BORA 3MD0A 2OAQ1 3RRZA 3WNCA 1NN1A 4DKXA 2BOVA 3FGNA 4QGAA 4FMDB 3FOZA 3BE4A 3QKRB 1J8YF 4MGZR 1EFTA 1MRNA 5D3MA 3MSXA 3MAAC 2FE4A 3R9WA 4MYUA 2AXPA 5KDLA 4Q4HA 3W6OA 4EDHA 2IF0A 2P0EA 5JSZA 3WNDA 2VHQA 2IYXA 2CK3A 3PVSA 1N3BA 2PL3A 3BH7A 1JR3E 5B57C 4KJZA 5EP3A 3JZAA 1NBMD 3CW2A 1U8AA 3QIAA 4PFSA 4UJ3A 3VQTA 1NLFA 2FFHA 4JL6A 5DN6D 2H18A 1IOZA 1ZCBA 4D25A 4JLBA 1NI3A 2J87A 4IFEA 2WHXA 2AKYA 1TEXA 2NZ8A 5J47A 1A7JA 1E0KA 1WRBA 4DIDA 5DYIA 4CRWB 1UDXA 4US2R 3IDQA 1AK2A 5CITA 5FR2A 1GKUB 2ZJAA 4YLGA 1S1CA 1GSIA 1Z0IA 2WPDD 4FCVA 4R98A 1ZM9A 2VHJA 3EARA 3QBTA 1LF5A 5FUXA 4Q1CA 4N3NA 3GJ8A 4B44A 3AVQA 3UPUA 1QHXA 2DR3A 5L3VA 4PPFA 5BYJA 4NYJR 1YZLA 2E1RA 3LW7A 4OHZA 1K5GA 4YXWA 2IC5A 2QRNA 3TVTA 3VX3A 3W5IA 3FPAA 2V54A 2EW1A 2GWHA 2IW3A 1G4UR 3DKVA 1XTRA 4HSEA 3LXXA 4MUBA 5CJPA 4LYFA 5AJZA 1W36C 4TWZA 5EXSA 4GPTA 2XTMA 4HAXA 1TUEA 3VHLB 2JIZD 2E9SA 1JXMA 1E79A 3AF2A 3IIKA 2RHDA 2C03A 4S35A 1KAOA 5FOWA 3A1SA 1Y63A 3ZS8A 4PC1A 4FMDF 1WBDA 3CUEF 3U7FB 2ZRDA 5KSOA 3L0PA 3T5GA 4DCNA 3GEIA 2XGJA 2QP4A 4D81A 1WBBA 4KODA 2ZR9A 1E0JA 5GJVC 1TTTA 3A37A 2I3BA 4LBWA 1NN3A 5E4FA 4QRHA 5HE9A 2RH5A 5DSZA 1WQ1R 4KV9A 2IYSA 5J4HA 3GLIA 1SKYE 2BVNA 1E9BA 3QVUA 4ZIRA 3KFXA 2FNAA 1EWQA 3BFKA 3PUYA 4HYYA 4AURA 1XMIA 2F43A 4BZXA 2A3RA 3H4MA 3O8BA 4LJ7A 2GEUA 2IWRA 4RFVA 3PEWA 2W83A 3NHBA 4HB4A 4Q18A 5TDHA 4DLTA 3SOPA 2IYZA 2W00A 2OSBA 1UKVY 4LOAA 4BEBA 1E2DA 1OH5A 2JLWA 2CNWA 1Z6TA 2V4ZA 4M22A 5AK0A 2WJHA 1JQJC 3DKPA 2QNRA 2ZI6A 1VCNA 3AB3A 4RY2A 4C0AC 1YJ5A 4K81B 3DM9B 4ZKDA 5FOTA 1BOFA 1CS4C 1SXJE 2RGAA 4E03A 5E7MA 1U0HC 4Q7MB 4AKIA 2A2ZA 2V9PA 4ON9A 3P20A 2IYUA 4BECA 2ZSDA 2CMKA 1ESNA 1F48A 2ZAMA 1CJKC 2WWGA 2YYZA 3KXKA 2ZRHA 5JS7A 4ARZB 1II9A 4NH0A 2WIBA 4JLNA 3N70A 2CCKA 5F9FA 3H2YA 2CHGA 1SKQA 2J7PD 2V6IA 3A4LA 4Q4AA 2J0VA 1SHKA 1HQYE 1OXSC 1NBMA 1P73A 2R44A 3LRPA 2QM7A 1EX6A 1B23P 3OEHA 1TL7C 3HR8A 4QFMA 5DN6A 4WZBE 4TTPA 3JVVA 1KI7A 4A4DA 1WP9A 2RAPA 4W5JA 2ZJZA 1XTKA 2FV8A 3FKSD 2X8AA 1V5WA 4A6XA 2IS6A 3LO5A 4MKIA 1QG2A 1ZBDA 4L16A 2UZ3A 5FPSA 4M2LA 1UBEA 2JGNA 3Q3JB 4O0MA 2O8BA 4KBGA 1G1MA 2EU8A 2HF9A 4HB3A 5H8WA 1P9WA 2CCJA 4CZ2A 4AKHA 1GFIA 1U0LA 1FTSA 4D4MA 4DSOA 3KQKA 4B71A 4V0KA 1VG0B 2ZRFA 1P6XA 3EW9A 4TQ9A 2HV8A 4MGIR 3L8ZA 2JIZA 2D2EA 3D7MA 3GFPA 3A1VA 2G9NA 3RHFA 5IRCD 4UNQA 1R0WA 3CNNA 5KNCA 1RYFA 4QGFA 2GJ9A 2WICA 4G0NA 4LK2A 1G64A 2MMCA 4PR0A 1EK0A 4QXAA 2LCFA 4WZ6A 2J41A 4AC9A 2F9LA 3AVXA 4URVR 4P4SA 1FPMA 3WYFA 3ZQJA 1YR7A 3BB3A 4OK3A 5AUOB 2JLVA 4IEEA 1Z28A 2AXNA 4U5XA 2HJVA 3GLFA 3NHAA 4B3BA 1UEJA 2XJ9A 3EZFA 4QGHA 2JLSA 2MSEB 3IO5A 1COWD 4LHYA 1WB9A 2IWHA 3QPVA 3T1OA 2X2FA 1KO5A 4XOIA 1GUAA 1SXJC 4DDUA 4BLPA 1VIYA 1G4AE 2EWWA 2R2AA 3BB1A 3TSZA 3ZVMA 4LYJA 4BWYA 2D2FA 3WP1B 5B2ZA 1ANKA 5FBRB 3T34A 3W6PA 3AKYA 2VP4A 3SEAA 1MO6A 4DDVA 1II8B 2IA5A 4JBYA 2DFKB 3NBYC 1E2QA 4OJQA 4OK5A 5JI3E 1KMQA 5L8VA 2KWIA 3VX4A 4KSCA 4NU0A 1P60A 1XDBA 4QBGB 3SYKA 4A8JA 2B7CA 1G3UA 2R65A 3K0FA 1E6CA 3IO3A 5EXTA 2QTFA 3KB2A 4ZPXA 2GRJA 1DVRA 4FINA 121PA 2VP6A 1KTVA 2ZITA 2H57A 5KNBA 3IHWA 3CIOA 4PC2A 1N2CE 4MKHA 3AGQA 4BFTA 3U6BA 4HUQA 3W90A 2KB0A 4B2IA 2QENA 4IXNA 3SS8A 3ZJYA 3THYB 2ZYVX 2J7PA 2K5UA 1TU4A 2NGRA 2QPAA 1OFTA 2DBYA 2CXXA 2WJJA 5B64A 1XMVA 1XWIA 3IIJA 2EFHB 4CT5A 2XITA 5AUPB 2PH1A 3QF4A 2J9RA 1KDOA 3WMFA 1QZXA 4US1R 2IBMA 4RKEA 5E3HA 1J7KA 2YC2C 4QNMA 4B3FX 3ZVRA 3B78A 1N5KA 3EX7C 4PHTA 3A8TA 3ADDA 4G5RA 1KK1A 4GDFA 4CYMA 2UKDA 4TL6A 4KSBA 2B7BA 1FQJA 5D3QA 3ZD6A 5C46F 1K6MA 4WW0A 2GXQA 1E9AA 2EFGA 3I32A 4W9MC 1OSNA 3QENA 3QE0A 1G16A 4DSTA 5BN5A 4Q7JB 2OCAA 1ZIOA 2R62A 3IPYA 4HAUA 4KO8A 4TN1A 2CJWB 2JLQA 2IS4A 1SQ5A 2PEZA 3OFND 1A4RA 1N6OA 3A1UA 3OIYA 5TY0A 2HT1A 2WWXA 2J0SA 3TNFA 5JMTA 1T9HA 3A4MA 2GF0A 4LJ4A 1L8QA 1OT3A 5J4YA 1L2TA 2NO0A 2O0HA 1BIFA 3EXAA 4W5HA 5J4KA 4NONA 3HR7A 2O8CA 1L4UA 1ZM4A 1G291 1C1YA 2YWHA 3BB4A 3BOSA 4US0R 4V0LA 2GXAA 1N6IA 3DMDA 3QI2A 3B6EA 3QSYA 1W36B 2AKAB 5IT5A 3B13B 5E7JA 4KCGA 1VG1A 3KKOA 1UF9A 3KFVA 4DBLC 2RCNA 4OL0A 3U4QB 1LV7A 2VP5A 4RCZA 2XSZA 3IEUA 1DG1G 1KIMA 2KI5A 4WXRA 3RS5A 3TR0A 4P33A 3AVOA 4P4TA 4XTCS 4QC2A 1A5TA 2W6JD 4DLUA 4V03A 2GAAA 4TL9A 4H1UA 4PO9A 3L82B 2RGNA 3DHWC 2JJ2A 1COWA 5BW8A 2REXB 3MLEA 1SZPA 3K09C 3LW8A 4KHZA 3R9XA 3ADKA 1DBSA 3KKQA 1QG4A 2ZRIA 4YQFA 2LWIA 3K8YA 4URZR 2PCLA 5JHHB 1W4AA 4LWZA 2DWOA 4I4LA 2DPXA 4Z54A 3W8NA 2HYDA 3E2IA 2MSCB 1VHTA 3L2OB 4GSYA 4RZUA 1ZD9A 4P3YA 3E1SA 1HTWA 1MH1A 5F2EA 3A6PC 1AKEA 1T8UA 2QQ0A 2ZRMA 3K9LA 1P2UA 1L4YA 4JYBA 3PQCA 5LB2A 1U98A 1E1RD 2GZAA 3DO6A 1G3IA 1CR2A 1YVDA 4B3CA 4B35A 5EXPA 3AGPA 4C9BA 1W44A 3NG1A 5FTKA 4LDJA 3RS2A 1D2EA 5JWOA 1X8JA 3Q5DA 4PXAA 1ZD8A 5CJ2A 3I72A 3BH6A 2G0NA 1P9RA 2VBCA 2D74A 1D5CA 2ZYTX 4O3MA 3B9PA 1Q1ZA 1ZCAA 1N6LA 3DPUA 4URYR 4PPGA 5DHFA 4DXAA 5K8IA 4XSHA 4YMVA 2NO9A 2RGDA 5DH9A 2C77A 2GTPA 3ADBA 2PJZA 3KTAA 2OBNA 2I4IA 1G3RA 4DC9A 5JHGB 1B0UA 4NPHA 1W4CA 3ZZ0A 2CLSA 4WIAA 3RNLA 1XRJA 1OKKD 1G7RA 4K46A 3TUIC 1WMSA 3CX8A 1ZNXA 2QE7D 2JAQA 3N2EA 1XXHA 2FOLA 2A5GA 1XFAA 4TMWA 5JWRA 3B2EA 1GM5A 2WWYA 1EX7A 1KY3A 4LPKA 4IXMA 4P32A 2Q3MA 4LBZA 4I1SA 2ASEA 3K70C 1OXXK 1P72A 1EWRA 1F2UA 1OJLA 1Q3HA 1UBCA 4IDQA 2D62A 2CL7X 1NL3A 1W1WA 2H1LA 4JVSB 4MRVA 4UNSA 3CNOA 4HDCA 4HDOB 4LBYA 1EESA 4OYHA 3RVBA 1LFDB 3TAUA 4DEYA 1AN0A 1Y3AA 4FMCF 4M1SA 1AGPA 1CBUA 3P32A 3QOFA 4G1UC 1QHYA 5G3YA 1M6NA 5FH9A 1XTQA 3UG6A 5FR1A 2ZANA 1W0KA 3IILA 5A5GA 3LBHA 4OHVA 2AK3A 1Z0FA 3WRYC 4DCSA 2O8EA 4XTRA 5AJVB 1DAHA 3GJ0A 5F3WB 4DZZA 1Z6GA 1P61B 2BCGY 1SKYB 1Z29A 1FP6A 1KJWA 2VQSA 3C5CA 1KI1A 621PA 2F1JA 1JPJA 4A82A 4B3DA 3H84A 5KDOA 3LV8A 1CRQA 4O2LA 3GJXC 1F6BA 3HP1A 1XZPA 2C5LA 1DAGA 4D4KA 2W6JA 4OI4A 3ZVNA 2EFEB 2ODBA 2GVDC 4JVLA 1VYTA 4UKDA 3U7HB 1LS6A 1YE8A 1QDEA 2QMHA 1KSFX 3CRQA 2Z5FA 1CIPA 2EQBA 3A4NA 3QXHA 5EP4A 2I1VB 1OF1A 4RCYA 2HCJB 1A2KC 3I62A 2OO7A 1IY1A 4R9UC 3MUFA 3EPJA 1P2TA 1VG9B 3CR8A 4ZDIA 3GJ5A 2JLUA 1E2HA 1TQDA 4F91B 2GJAA 3RAPR 4DJTA 1G6HA 1SXJB 4TZ6A 1HUQA 1ZIPA 2GCPA 3RANA 4ZI2A 1Q1BA 4CEHB 2NPIA 3SU8A 1C4OA 1NG1A 1GRNA 5GVRA 2JJ1D 4BLSA 1GNRA 4RFSA 1NVUQ 4ABYA 5B30A 3FFBA 5DO9A 1GILA 3BWDD 4TTQA 2WZQA 3THXA 1Z0DA 4AYTA 4JVMA 1OW3B 3D8BA 5FUYA 4EJSC 3L0OA 4IKEA 4QGGA 3VHXA 4C0LA 4TL7A 3AUXA 4EUNA 1R5BA 5KOYA 1D9ZA 4RZ2A 1E0AA 4KITB 2Y8EA 1BS1A 1ZJ6A 4RZXA 1F3OA 4DLZA 5CLQA 4ITRC 1YQTA 3THXB 4L15A 5BN4A 1DG3A 1KDPA 3EA0A 1RJ9A 4Q1DA 3VU9B 1GITA 2QAGC 3K0EA 1LTQA 1KO4A 4BFXA 1NIJA 1PV4A 2BMDA 4GOKA 3DDCA 1N6HA 1R0XA 3B82A 4PAMA 5JWHA 5C2JB 3L0IB 4CGZA 1JECA 4YXWD 4BZPA 1WF3A 1SVSA 1OB2A 2REBA 3DVLA 3QKUA 2GKSA 3PEYA 4L9SA 3UMRA 2WIAA 5BXQC 1VECA 1VDZA 5FOXA 1FTNA 1KZGB 4RVCA 1Q57A 3TKLA 1TQ6A 2BC9A 3I73A 2QE7A 1OE0A 3FMOB 4M21A 3VNUA 1E2JA 5FTNA 5KPDA 3F8TA 3O8DA 1E4VA 5L3SA 1R5NA 2ZR0A 3IHLA 4DEXA 1VCMA 2GCNA 3CWQA 2DB3A 1E0SA 3K0CA 3QXSA 2AWNA 2FFQA 2OM2A 3GMTA 4FCTA 1Z6YA 2J0UA 4JLOA 3WP0A 3V4FA 5J4LA 4B3XA 2QI9C 2ZRKA 4CEIB 2WWFA 2B8WA 1P7CA 3OEEA 1TF7A 4HLDA 3LXRA 3K0AB 2ORVA 1W48A 1MV5A 4PANA 2G77B 3MG9A 1I4DD 2FN4A 1PUIA 2ANBA 1HE8B 4C0JA 2YHSA 1NF3A 3CNLA 1CLUA 1YZGA 2NG1A 4Q03A 3LA6A 3V4RA 2YOGA 3OIVA 1KY2A 2BBTA 1SHZA 3P1JA 1E3MA 1IN6A 1G7TA 4KLNA 3NBFA 5TARA 3B60A 1U9IA 4GZLA 3F5FA 2ZE8A 3B7GA 1XMSA 4DT1A 2OBMA 1XD8A 5JI2E 3CH5A 1KMHA 4NYIQ 5FBWB 5CB6A 1R8QA 4GOJA 4F7WA 4MA4A 4JVNA 1KO1A 1YZQA 3TR5A 2VO1A 3QKRA 3NDPA 1RIFA 2QN6A 4LUCA 1VG8A 3H86A 5H1YA 1XU4A 1AJEA 3WYAA 1ODFA 4HAZA 3EC1A 1FZQA 1KK3A 4Q9LA 2BJVA 3A1WA 5TVKA 2BHRA 5GVSA 3PIRA 1JQLB 3U3KA 4DIEA 2OESA 1I2DA 1KZ7B 1RVDA 1IJFA 2FSFA 4TMKA 4QHYA 3AP2A 2C78A 3WY9A 2ZJBA 1YZNA 4M1TA 2VPPA 2R9VA 1W5SA 2FFAA 5CLLA 1Q1QA 4PZZA 2ZUDA 4LHZA 4B73A 1GNQA 1KSHA 1VIAA 4DVGA 3KXIA 5GJCA 3SE0A 1R0YA 1PVOA 2VSXA 1S9HA 2JJ1A 4EQ6A 4FMBB 4LC1A 1UPTA 3AQ4A 3EASA 5FTJA 2PLFA 3W9YA 1UKEA 2AFHE 1VCIA 3IIMA 3VR3A 1VKJA 2F9MA 3OEHD 1J70A 2C9CA 1X86B 3AH8A 5C1BA 1S3GA 4HI0E 4EQ6B 1VYUA 2JATA 2YOFA 2FU5C 4HLQB 5IDVA 3ZYCA 3EZ2A 2XXAB 3BRWD 4AWXA 4URUR 1X1RA 4DCTA 4LSGA 2FGKA 2GF9A 2RKOA 1IXSB 4UXHA 1AKYA 3ZDQA 1QHHB 1NN5A 3HPRA 4BQSA 3CRW1 1W49A 4DLXA 3UWKA 2VH5R 2V1UA 4IVPA 3C14C 2GCOB 1XD9A 3IUYA 4PSKA 3FMIA 2O8FB 1VPLA 1MO4A 2R6DA 1KAGA 1N0VC 5FL3A 5HCNA 5K8LA 2V55B 4LYHA 4GBMA 2EYQA 4LBVA 4NMMA 4Q9KA 2O52A 3EWAA 1E9DA 3OAAD 3TRFA 2N42A 2TMKA 5HR5A 3GLGE 4RKFA 3WRXC 1RC8A 3RS7A 4WXPA 1UKYA 1KGDA 2V1XA 2OZEA 5L3QB 4JLMA 4Z51A 1TUIA 3SJAA 3IBGA 4B6EA 3KX2A 2EWVA 2XNSA 4WAUA 4XWAA 1W0JD 2HLDA 1R4AA 4DUGD 2ZUCA 2BV3A 2J46A 4MGKR 4F93B 1ZINA 3KQLA 3SQXA 1YU9A 2FDCA 1Z5ZA 3RRNA 5KUTA 2O0KA 1HA3A 3MWYW 5ELXA 2OLKA 2CHQA 2PMDA 5IF9A 3K70B 3DOFA 4QNRA 3QPWA 1E96A 4O2RA 2RGEA 3GLHE 4FWTA 4V0ME 3UMFA 4P31A 1D9XA 2GZDA 2PT5A 2Z43A 1J8MF 2NPFA 4BRUA 4JLPA 4TQAA 4DLVA 1SGWA 3KQNA 5JBQA 4UXIA 4KYUA 2P5TB 3W3ZB 1DTSA 4G5OA 4Y0VA 5EXXA 4QJ3A 1CRPA 3CZQA 4URXR 4C7OA 1DADA 1U8ZA 3GCGA 4G5SA 1AA9A 2ATXA 1Z63A 2WTUA 3AEZA 5DI9A 1ZNWA 2JLYA 2IYRA 4YMSA 3V00A 2GETA 1Z47A 1JJ7A 4C0SA 2ODWA 4C7OB 4ARZA 2IS1A 4C30A 1T0JB 3TLXA 4C0QC 4FN5A 4JKYA 3TW4A 3JZMA 1EFHA 1G21E 1T0HB 1GG2A 3GJ4A 1XTJA 1KI6B 3QJYA 4IOKA 1IAQA 4Z1MA 4OI0A 2ZJ5A 1YR6A 5KPJA 4PC7A 4TYQA 3M4YA 3WMEA 1Q22A 2GBLC 2AD5A 2UZIR 3LX5A 2P6NA 4Q9IA 2FZLA 2PZGA 5J40A 1AIPA 5AJWA 2D7DA 1FUUA 2ZSBA 1KI2A 1Z0JA 2VEDA 2C96A 3OE7D 1J99A 1V43A 3BIFA 3C16C 3TW8B 1IONA 2GESA 1JB1A 1S2MA 4W7SA 3T15A 4Q00A 2BEKA 2VA8A 3PFIA 4P0TA 2GVZC 3RS4A 3Q85A 5DIFA 3LNCA 4TYWA 4XJXA 1P75A 2F1HA 3IKJA 5AWFC 2BMEA 2JCSA 1KK2A 3PUVA 1XEFA 1DO2A 1Z06A 4DLSA 4M1KA 4X8MA 5JS8A 3Q8XB 2P5SA 2ZIAA 4E07A 4QM6A 3D31A 1BYIA 4EJSB 3CWZA 2JA1A 1JALA 4TLAA 1GL9B 1E94E 4GT1A 2B6HA 1X1SA 2XB2A 4EPWA 1AS2A 1CJMA 3LBIA 4NYMQ 2HF8A 3KJHA 5JZVA 4Z8YA 2ZJYA 3CKLA 2Q0HA 3SZRA 1N6PA 3LQRA 3EIEA 4HZIA 1W36D 3GJ6A 3OAAA 2LKCA 3T1QA 1KI9A 1VHLA 4KI0A 4RD0A 5E95A 1NKTA 5DHAA 3TJZA 1P4SA 3RS0A 3LWNA 3CPEA 3SQWA 4OQXA 3C8UA 5HTKA 1X8LA 4QJ4A 3QEJA 1GRQA 4I99A 1W0JA 4M9SA 5EP2A 4QKQA 4DUGA 4LHXA 5C18A 1OYYA 2VHTA 1G7SA 2B21A 2F7SA 2J5XA 2WSSA 2YWEA 2XSZD 4TMTA 4DB2A 1TMKA 5CM9C 2WWHA 4MKFA 1H8HA 2CLDX 2OV2A 2ZVQX 3VAAA 2WWIA 1FNNA 2JASA 1HEIA 2WV9A 2ZJ2A 1D8TA 4TQUS 3TQFA 3FYHA 2J3EA 4HATA 2JJ2D 2ZTSA 4IHQA 2C98A 1NN0A 5AUQA 5FPTA 4TLCA 2OT3B 1II8A 4I81A 3RDPA 5JEEA 5TB5A 5L3RA 3NBZC 4Q21A 2ZRBA 1Z0AA 3I1FA 2GA8A 2FPKA 4AYWA 2A5DA 4YDHB 2ZETA 1K8RA 4XVQA 2F1IA 1TNDA 1EGAA 2YINC 4YDSA 1E9CA 2FX3A 1R2QA 4AI6A 5FFMA 2BIFA 1JR3D 2RHMA 1U90A 3AF3A 1GL7A 5LDDC 1FMLA 3QNUA 3KJGA 2YZ2A 4N1AA 2WKRA 4Q9HA 1KOFA 3T61A 4ERNA 4RD3A 3CONA 2SHKA 2V8OA 4Q4JB 3MRSA 4A36A 3THYA 1E69A 2ZS7A 3GFOA 1CEEA 4U00A 2C9YA 2QL6A 4ZO4A 1E9RA 2FPLA 2ZQ5A 1H65A 3GJ3A 4F4IA 2C04A 4NE2A 3UK6A 2BKUA 1P2VA 2IXEA 1Q44A 2QSZA 4E09A 3OE7A 3BH0A 4YC7A 1MOZA 5EE3A 4CIDA 2H17A 2Z4SA 3TBKA 2C2HA 1NVVQ 3KKMA 3FFAA 3TK1A 4M9QA 3B5JA 4B48A 4RD4A 4EAQA 1W7AA 1WCV1 2C8VA 1S3SA 4RD6A 2QP3A 2CJWA 4IOMA 1LNZA 4TYNA 4E5UA 1RPZA 5JRZA 4LC0A 1M1YE 1ZNYA 2D3WA 3OESA 1UBGA 1HYQA 5BQ5A 2JJ8A 2IYYA 3VR5A 3DOEA 4Q1BA 3VR4A 2YJTD 2OFOA 2ORIA 3U7GA 1UAAA 2GAOA 1P2SA 5SZKB 3LBNA 1J90A 1Q3TA 3PUXA 1LVGA 4C0HA 2VHUA 4PHFA 4TLEA 1AQUA 2DWPA 4BGDA 4PAQA 1TQ2A 2I1QA 4IJMA 2OCBA 1JBKA 3GPLA 2QEQA 3LDAA 4LGMA 1NMYA 1O87A 5FBLB 1TADA 1KJZA 1GP2A 3VFDA 2IYLD 2VHCA 4ASUD 4LJ8A 5IK2D 1E9FA 3LX8A 1W0KD 1HH4A 2C95A 3K0SA 2WMNB 3U4QA 4B32A 1Z2AA 2ODEA 1M7HA 1RYHA 2AHOA 1O3YA 4FW9A 1AZSC 4IVQA 2ZSEA 3VR2A 4XSGA 5DGXA 1PLLA 1DAKA 3H1TA 2XOKD 4GNKA 3V9PA 4M9ZA 4AK9A 3ADCA 4NZYA 2QRZA 2ODNA 4IW3B 4A2WA 2ZJOA 1OHHA 3QKSA 3BXZA 1N5LA 4Q02A 1XD2A 5FL7D 4LJ5A 3SYLA 4ILEA 2QBYB 1NY5A 2Q21A 3AF0A 4HAYA 1G6OA 2XTNA 3E70C 2YNMA 1P5ZB 2R6CA 2PBRA 4BFZA 2PX3A 1TF5A 3LVRE 4C2TA 4Q1EA 4A9AA 3QKSB 3SFZA 3ZZUA 1XD2B 1SXJD 4LJ9A 1FQKA 2XEXA 3EZ6A 1DS6A 1CKEA 4PHHA 3NDBB 2F3TA 4D0GA 4QBFA 2ATVA 5CK5A 4M1YA 2OFXA 1IN4A 2FWRA 3GD7A 4HB0A 4PO8A 4PQYA 4FMCB 3RRYA 4IRUB 2B92A 4Q5IA 2H92A 4MYCA 3ICQB 2QT0A 2YOHA 3LH5A 1SVWA 2YWFA 1ZMXA 4EPRA 4FD2A 3GLIE 1JR3A 1KDTA 2A30A 3D6TB 3CH4B 2FPMA 5FOVA 1A82A 1N5JA 1S0UA 1FNMA 3LLMA 1P3JA 3ETLA 4JBXA 4LV8B 3CX6A 1ZUHA 3QVVA 1KI8A 2AX4A 5DNYB 3AVWA 1H8EA 1G8HA 2X19A 2BMFA 2ZYWX 4JYCA 3VKWA 4F4JA 4GMXA 4BZQA 4LY6A 1JJVA 1QHSA 1UJ2A 3BC1A 3MWKA 4OI1A 4JZKA 2CDNA 1U2RA 4LRWA 3ND8A 3PUWA 5FTLA 5DI3B 1SVIA 3EC2A 2GHIA 3QPUA 4II7A 3TE6A 3HYRA 4ACAA 2KJQA 3J81k 2PMKA 3BFVA 4LPSA 1E1QD 5JJKA 1T8TA 3MWJA 3HYTA 3HU3A 1HURA 3VKGA 2DY1A 4AKEA 1UBFA 2KE5A 3NWJA 4OK6A 2A9KA 2NO6A 4TSFD 3QXXA 3WNBA 1Z3IX 2JDIA 1PJRA 4JJKA 1G19A 1Q1EA 1OXTA 1IXZA 1ZW6A 3RYTC 5GADl 3NC1C 1W2HA 1G41A 1VMAA 3EIHA 3U2QA 3IBYA 3HPQA 5JECA 3U60B 4PSVA 1U0JA 3RSOA 4BPBA 4QJ5A 2WKPA 1PUJA 1G8PA 1NBME 1YR9A 3FHCB 5FI0B 2NIPA 3GLGB 4IDOA 1I2MA 3FMPB 3OEED 4HZUA 4A1FA 5FOUA 1S4QA 3T35A 2PLRA 4X8LA 3QBVA 4L5BA 4B43A 2JLZA 3CM0A 2GNOA 4ASUA 4B75A 2ZSAA 3Q72A 5IK2A 3TMKA 2VRWA 2BCJQ 3C7KA 2ZRJA 3GLHA 2A7QA 1DE0A 4HZUB 1F2TB 4I1UA 2CE2X 2E87A 2IYWA 2X2EA 4MGYR 1IQPA 3CO5A 2XOKA 1GWNA 3VTKA 2P2LA 4NCHA 2AL7A 3GLHB 3ZQ6A 1TU3A 3QUSA 3G0HA 4LV5B 5FL7A 1KK0A 1G3MA 4PQFA 4ESHA 2QPOA 2VYFA 1QRAA 4U7DA 1VYVA 3OF5A 1RRCA 4E22A 1QHNA 2BM0A 4JLDA 2JLXA 2NO1A 2R8RA 4WZAE 2QMUA 2QP9X 4R71A 1MKYA 3UMSA 3AVUA 2ZAOA 3I5YA 4W5WA 4KU4A 5E7IA 4CVNA 1T3SA 3L43A 1SXJA 4AYXA 5HZKA 1MABB 3NEJA 2RGBA 1G7CA 3NTUA 3U5ZB 4CEHA 2VP0A 1VCOA 5EP1A 4D4LA 4K8OA 1FW6A 1BYUA 2ZU6A 1ZU4A 2IS2A 4PZYA 2VF8A 3UIEA 4KVAA 1BH2A 4NCNA 1XCPA 2IXGA 1BMFD 5FPKA 3P4XA 3GLFE 5KO2A 3SNHA 2OLJA 3BGWA 3T5DA 2ZRLA 3WYGA 1US8B 4GMDA 4JT2A 1XBTA 2FSIA 4MQBA 5LD2C 5J4VA 1XCGB 4A0RA 2P6RA 3PUZA 4KBFA 4URWR 3B85A 2CL6X 2IEZA 4FXPA 5CYPA 1E99A 3FWYA 4HDQB 4JL8A 1RKBA 2WVJA 1T4GA 3GJ7A 1Z83A 4JKIA 1E2MA 3VU9A 2GJKA 3DMNA 1G3QA 3RWOA 1MRSA 5FTMA 1DAEA 3MGCA 3QG1A 1LS1A 2QMEA 1F60A 4KAXA 1OIWA 3D3QA 5CDFE 4XH9B 2XZPA 5G41A 3W8RA 1T91A 1S1MA 5SZIA 2F6RA 2OXRA 3OZXA 3KJEA 1G9XA 4O25A 3SJCA 4L4UA 1KKLA 4OKSA 3SJZA 2FSGA 2QZ4A 2W2XA 1GNPA 4PAOA 3U7EB 2ZEJA 3N2IA 1E1QA 1XX6A 3AM1A 3R9IA 1ZUNB 2J0QA 2G88A 2XZLA 1X3SA 5AJXA 3L8YA 1KI3A 5A4JA 4BE7B 1IN8A 4BEJA 1Z0KA 3KL4A 4NP6A 4DDWA 3GFTA 4R2HA 1OIVA 4TSFA 4QHTA 3TUJC 1N6NA 2G6BA 4CEIA 1XJ0A 3AVPA 5C4MA 4GL2A 2ZI9A 4RD2A 1QVAA 2DYKA 1G20E 3K0AA 2OE2A 4G3XA 4ESVA 3LQQA 1EG7A 2ZPTX 3W3AA 2IF2A 4M1WA 4NKRA 2W58A 4M4SA 1EFRA 3TH5A 2VLIA 3THWB 2DCUA 5LPNA 2HLDD 5HKKD 3FDIA 2Q3HA 2B8TA 4WA7A 1U8YA 4UNRA 4Q9JA 3ASZA 1I4TD 4DSUA 4D2IA 4EFLA 3ZLJA 1NJFA 1LW7A 2GXSA 5JRJA 1R7RA 2HDNB 2IXFA 4KVGA 4MYTA 1NLZA 3RS3A 4UNNA 2DFTA 2NOAA 3VNVA 3O8CA 2GXUA 1GZSA 5FOSA 1DAIA 5HE8A 2KBFA 1KHTA 2AWOA 3SYNA 1R5OA 5DE3A 4MH0R 1G5RA 1NSTA 4F4CA 5JFGA 4A0HA 2IT1A 2YV5A 4S2EA 5EUQB 3X1YA 2LKDA 1JAIA 4NYIR 4P4UA 4LZZA 3T06B 2FA9A 2OG2A 3AVVA 2W0SA 1NLYA 2YVUA 2DWQA 3MFYA 3PEVA 2H8KA 4MDFA 3GEHA 2OCPA 5A0FA 1NRJB 1YZUA 1YRAA 1G17A 2Z0MA 721PA 4JLAA 2VSOA 3VR6A 5FBQB 1GKYA 4MUAA 1HV8A 3K09A 3S1AB 3KKNA 2MSDB 2FG5A 2ZS8A 3QKTA 2IL1A 3W34A 1U94A 5FBVB 1T3HA 4Q47A 3HWSA 5IHPA 2NO7A 2WMOB 4I1VA 4AIIA 3SFVA 4X8OA 3X1DA 1NVWQ 2EYUA 2OUKA 4Z1MD 4F92B 3EA5A 1BMFA 2ZROA 5CB8A 2FEOA 3R7WA 1XB2A 5KNDA 2X77A 4OHYA 2BEJA 2O8DB 4A8JC 4Q1FA 5JCZA 2F1RA 4Q7LA 1FOEB 2MMGA 2HUPA 1OB5A 4IDPA 2W2TA 2XXAA 2BBOA 2HXYA 5J5CA 5P21A 2QTVB 4G5GA 4M8NE 3FKQA 3R7WB 221PA 4B2PA 2IYVA 3WXMA 3B9QA 1QHHA 2GK6A 1OV4A 2C99A 2WSMA 1CXZA 2VP2A 4HLUA 1AZTA 4BRWA 1QF9A 3LY5A 4M1MA 2P6UA 2GCOA 4JL5A 2O8FA 3A36A 5D3MB 3IPXA 5BYKA 1IBRA 3NIBA 3K53A 4PPNA 4ZCLA 3RSLA 3UWOA 4M0LA 2J45A 2OXCA 3THOA 1UKZA 4ZI3A 3FHTA 4Q4HB 3ONWA 2W2VA 3AP1A 1M8PA 2CBZA 1KNXA 3HDTA 4EKDA 5JSZB 1KYIA 5DISB 1ZM3A 1CF4A 3X1ZA 4B3GA 1D6JA 1EFCA 5L3QA 1CTQA 2OBLA 5AR1A 4RZ3A 1OH7A 4YMUA 3K1JA 4A2QA 4CDGA 1FFHA 2PT7A 1W4BA 2A5JA 4TLDA 4AG6A 4D0NA 4XD7D 2FH5B 4JLKA 1XPOA 4EPVA 1BO6A 4A0FA 3NBXX 4XWOA 4YONB 2IUSA 2QSYA 2AR7A 5FUVA 1WE2A 1R10A 2ZU0C 3KKPA 2J7KA 1AM4D 4JLVA 4WOPA 4CT4B 1KSJA 4NYJQ 2L0XA 4BFVA 2XB4A 3SHFA 2Q9CA 3LLUA 2WWWA 3BS4A 1GDDA 1KNQA 4A92A 5HKKA 5G53C 3REFA 1AS0A 5JCPA 1G8YA 1Q12A 2WSSD 2IUUA 2W6IA 1TF2A 4JSYA 1LF0A 1M74A 1H8HD 3B1YA 3QXJA 2XX3A 2EFCB 4GFDA 3ICEA 3AV0B 1XXHE 4C0BA 1F5NA 4MRRA 3TQCA 3K9GA 3ZVLA 3Q9LA 4HB2A 1Z22A 1XEWY 1R0ZA 4QG7A 1G8GA 1DO0A 4F38A 1N0UA 3EPKA 1HT2E 1ZUIA 1M7BA 1NIPA 2XNDA 2FFBA 2PX0A 3AUYA 4IFBA 5DLQC 3QY0A 3NH6A 1SULA 1TX4B 4KLZA 3W6NA 2NTYC 3PR1A 2WJGA 2RGNC 2RMKA 3PXGA 5F9HA 3PENA 2PEYA 6Q21A 1TEVA 3F0TA 1AQYA 1ZYUA 3SBEA 2WBLC 1KI6A 4DLWA 3Q7QA 4RJLA 1ESMA 4BFYA 2ZS9A 3ZS9A 3CB4A 4KFUA 3GLIB 1E2PA 1NP6A 2FZ4A 3B1WA 4LV6A 3Q7PA 3R8FA 4D6PA 3I92A 3P27A 4ZIRB 2AN9A 1PLJA 2BJWA 2R6GA 4B6FA 2OFWA 4QBIA 2A5FA 2QTHA 2F43B 4GRAA 1T5IA 3VR1A 1E2KA 1XP8A 4NCJA 2CLCX 5FPYA 3CF0A 4D82A 1E9EA 1CU1A 5JJLA 2FJUA 2OEPA 4MDEA 1N6RA 3Q5EA 2ZRNA 2WKQA 1XF9A 1OH6A 3BJIC 4N0DA 1NJGA 1Z6AA 2CVFA 4JBWA 4EJSA 2N46A 2ZE7A 3CLVA 3PJRA 3NEYA 1RE0A 2BBSA 3CF2A 1E2NA 2YKGA 4IOLA 1NG9A 2D06A
chains in the Genus database with same CATH superfamily
1P5RA 1J33A 4GBED 4RCVA 4A6PA 2A58A 2D2XA 2FR1A 2OILA 2VXOA 3CCFA 3D8SA 3DT6A 4GNRA 3TOSA 4B80A 4FSHA 2QRGA 3PX2A 5G40A 4YCLA 5LXTA 2ERXA 3O4FA 3FTQA 1A8PA 1Q20A 2VIIA 3HXMA 1AHHA 3SX2A 4J2TA 4RLQA 3Q2KA 4C4XA 3NUGA 1C80A 4NYMR 5EQDA 3GJZA 1PNVA 3PJDA 1PL7A 4NV3A 1LA2A 4WNCA 5HIIA 1PSWA 3UKDA 1ZM7A 4DUPA 5KQLA 3T5PA 2E4YA 3C45A 3BFXA 4EYQA 5JC8A 4EJ2A 9MHTA 4U7JA 4U8GA 1V1JA 1T4MA 2WQ7A 1XCBA 4CCSA 1ODJA 1VMEA 4JS0A 3UMCA 1C2TA 2X0DA 5AKGA 1OIXA 5CFLA 2WPDA 1DAMA 3G0CA 3AB8A 4FZJA 3GVIA 4L85A 5G3ZA 3V4SA 2O9JA 4Q7QA 1L8LA 2Q28A 4L9AA 1JYEA 1H2XA 2JARA 2WOJA 3HLYA 4IDEA 3ZHOA 4XR4A 1XCMA 5JUWA 3LUCA 4KZKA 1M9NA 3V6LA 5CAEB 1OXVA 2WAXA 2F8MA 4WJLA 1PP4A 1AQLA 1KYQA 2BH9A 2ECPA 3LCRA 4Z7NB 2R00A 2H4FA 2FW8A 1UK6A 3DEFA 4BB6A 1IWBB 5B36A 2O5CA 1J8DA 2NZUG 3BHNA 5AVWA 1BEZA 4JN6B 4DDKA 5CDGA 1HFKA 1TUBB 4AUEA 2YZMA 3JQBC 1SCQA 1TECE 5CVJA 4IUBS 5JAHA 3KQUA 3I01M 4ZV4A 2UUCB 2P41A 2ZR7A 2BKLA 3NIGB 1A4UA 4LJ6A 3VMFA 2AJCA 3BA6A 1J2JA 2KBEA 1T9KA 1U3GA 3QYAA 2QX7A 4PZUA 3GUZA 3TOXA 3AJ9A 5F51A 2O07A 3QYJA 3LGAA 4I50B 5EWJA 4QLAA 3SQDA 2IX3A 2R79A 3ORQA 4Y6LA 4M53A 1CR4A 4KFSA 1LXCA 5JPCA 4LRTB 4NMWA 5EC8A 1V95A 3RAFC 3HKEB 3I39X 4JWTA 5IYZF 5JQGA 1FNDA 1RAEA 1V6CA 2XXBA 4RSGA 3WWPA 2O1XA 1M2JA 4R4JA 2J5BA 2GEVA 4L3OA 4LY0A 2CL5A 4PNHA 3QOWA 4ROSA 2Q5EA 3I8SA 3OECA 2EFDB 4ZZ3A 5JAMA 1PNTA 2GS9A 3R41A 2RK6A 5JPIA 3RUPA 3WADA 1NU6A 4JEUA 2DSTA 3DMTC 3E7FA 3KWMA 3RE1A 4JJ7A 3CCCA 2GEDA 3U61B 1LSJA 1N75A 1X14A 1NW8A 1QCYA 1USUA 1ZN7A 1U02A 2Y0EA 1ZVQA 3I2JA 3BPSA 3OPYB 2Z2KA 1MJFA 4M76B 3KVNA 3DAPA 4RMJA 3TTUA 4MA5A 1RXCA 2CXRA 3A05A 3PG5A 5EJ9A 3DT9A 4WKCA 4I9GA 1JN0A 1RRFA 2GDJA 2Q8QA 4MO9A 3TI9A 3VSDA 3VYVA 1PWHA 3GHHA 3LTEA 3CR7A 1IVYA 3KJZA 4RQUA 1B8OA 3O84A 1Q0HA 3OI7A 2BM1A 3Q0EA 4BYMA 3F67A 1L5VA 1U0FA 2PO5A 1ZONA 3QU5A 1F06A 2F8LA 4BNVA 1IRIA 2XRMA 3MCVA 1W75A 4M60A 1Q16A 1SQ0A 3H9BA 4C1BA 1JJBA 3D2AA 1H93A 3BK7A 1KHHA 1YMQA 2WV7A 3G9ZA 3ZTTA 5JO9A 5I9NA 3TLBA 2IW1A 2IU6A 4CQJA 3H5AA 3TGPA 3L7KA 2ZZMA 4RJKA 4MRPA 1NVVR 4UCWA 3UK0A 3VYSB 4LW8A 3GPBA 3ZQKA 3K8QA 4NE7A 4ZI5A 4QTUB 5J58A 4WUVA 3KQPA 5EERA 6YASA 2NUPB 4OV6B 3U44A 4OQZA 1Y1KE 2QORA 3RROA 3A04A 3QVLA 1K3FA 1LU9A 4UM8B 4AO8A 1ILEA 3JQ8A 1UANA 2JI7A 2V7BA 3INNA 2JDID 4IDHA 3UMBA 4YRIA 1IXRC 3T1TA 1O0BA 2K2WA 4QG3A 3Q2OA 5KDDA 3DJYA 1K92A 2G04A 4H27A 3I0MA 1QO0D 2PNFA 3QVWA 4HLCA 3U4GA 5HUHA 1SXHA 4BN0A 1BROA 4DMMA 4MITA 5MN4A 2H5EA 3AUFA 1OLUB 4IIJB 1VMKA 4K6CA 4OJNA 3MJDA 2OHFA 4B3SB 1E3WA 3MMSA 3CJQA 1GKIA 4ZEVA 5I9IA 1G20B 1IEQA 1Q0PA 1S9DA 2PRIA 3Q88A 4FGLA 4NEQA 1DEAA 4ZREA 1FS5A 4LVCA 3COJA 1EUCB 2K7ZA 2YZKA 3C24A 3EZLA 4PICA 3NVAA 3KE9A 3NWOA 4IZHA 3R7LA 3ANLA 3FKSA 4NCKA 1TM4E 3RLIA 7ADHA 4X20B 1W4RA 4G4IA 4AN4A 1WIWA 1N8SA 3K0CC 3ONVA 1ID1A 3QP9A 3WRXA 1JLLA 4A91A 2QXUA 3IKMB 2RHBA 4M88A 1HFWA 2ZATA 3MJSA 3C8ZA 1Y5RA 4UHKA 2P67A 1I0ZA 3DS8A 3IUMA 1FY2A 1T2DA 5F4BA 4DM3A 5DM0A 4XVRA 4IV5A 1O6BA 1D7AA 3EHDA 1KKMA 4JELA 5JAPA 2H48A 2FQWA 2P7IA 5CYFA 5ALFA 1U99A 1QQ7A 1P4RA 2PXHA 3G85A 3LAWA 4YIKA 5CIWA 1HE3A 3DZBA 4H1VA 2DU8A 3WXBA 4KAFA 2F59A 3PCXA 3AU9A 3QWFA 5AW8A 5I9LA 1C0LA 2BCEA 3R3JA 5KNLA 5FPHA 3CUWA 1QXSA 3L0SA 3TFWA 1Q0UA 5D85A 1K4KA 2H29A 5K3SA 5EVJA 2I6QA 2XUHA 3EODA 4JMPA 1NDHA 1YZFA 3AL3A 4GOLD 3INRA 2GBPA 5KSYA 4N03A 2J09A 4LE1A 5DLDA 1Q91A 1K86A 1PBTA 1ZCJA 5ILGA 3V9AA 8ADHA 5K3EA 5FBZA 5D6OA 2QG4A 4V1CA 3ES9A 3ETEA 1FDVA 3GRYA 2A8YA 1Y4ZA 4N5DA 3VDQA 3GWZA 5IJ0A 1CUXA 4G0WA 1B2RA 5DTMA 1YDFA 2DKOA 2WP0A 3KFLA 2C8JA 2PVPA 5F52A 4DSNA 4JEIA 4PVCA 4F6RB 4BX9A 2GNPA 3VH1A 4CQMA 1J6UA 2UZ0A 3BXXA 5AHKA 5EJMA 1U2DA 3ANYB 4MI6A 3TTTA 3JQ7B 4NZZA 2HYIC 1BA2A 2WF6A 3HB1A 1ZSYA 2DFNA 2JGLA 3BIXA 2IPOA 3JQAA 4HH3C 4W9RA 1KDZA 4AXBA 3RAEC 2HWWA 2BP7B 4C4PA 4MS4A 2K87A 3AOEC 4MX8A 4PQRA 2BEWB 2XMRA 4L4YA 3TXAA 3BT7A 3WBKA 3DMPA 2WU8A 3DV2A 2HR1A 3OTGA 1QP4A 3MHPA 5DI3A 1AO0A 4D45A 3WFZA 4CUZA 3NNDA 4C2UA 4K9MA 2V6JA 3I1YA 4FZ3A 2XT6A 3JQCA 3M0EA 1M5TA 4HGRA 5BYBA 3WB9A 1A9XB 1RXYA 2PL5A 2NZJA 3JQ6A 2QROA 3R6WA 1B76A 1ONBA 3F5SA 3PYMA 4BLRA 3D4IA 1RU3A 3AO0B 5EE0A 4M46A 1YB4A 4KN6A 1LRJA 1IFXA 3U48A 1UL1X 2XA1A 4TKVB 4EMUA 2QQEA 2A0FA 3EWSA 1UFOA 1YD7A 1XEXB 3OMWA 4UCXA 4Y7CA 5BUQA 5IC4A 3PJEA 2I03A 1Z4OA 1M5RA 4AKGA 2PUAA 3ISJA 1DKLA 1LI4A 3Q2IA 3QTBA 4GP7A 1ONNA 2XUDA 3LCCA 3GCDA 1RC0A 1Z5OA 2VNSA 3DR3A 4PLCA 5IKMA 1JHOA 5K8JB 4ZEWA 2A9JA 1EEXB 3A6GA 1RJWA 2XHZA 1DG9A 3CFYA 4I9FA 2CCGA 3TQHA 5GQSA 1HE1C 1XTIA 5HP4A 1ZNZA 1AK9A 1R4MB 4DLRA 3K72B 4K9PA 5KX5B 4IIUA 1ZK2A 4LQCA 4AECA 1YZYA 2X22A 1TEZA 3V4ZA 2JGDB 3I3SR 2CL0X 3D7LA 1BH6A 4Q66C 1G5TA 4Y2UA 5CA1F 3TRKA 1DOAA 3HCRA 1UXKA 2DPHA 5C7LO 1U7DA 2QRVB 8OHMA 5EMJA 2UYOA 4MEJA 2G28A 4MWGA 2MSWA 2PUHA 3A4VA 1GAXA 3B7WA 3H2BA 4KR9A 1WXGA 5T4BA 3AY0A 3JZFA 3M7IA 1EXNA 5EKSA 3WRVA 4K0KB 3O6VA 3KVOA 4UBNA 2V7TA 2VTEA 3JQFA 1YOVB 4D8VA 4XYLA 3T3HA 1NMXA 3A6EA 3DE1X 4OI2A 5LQJA 2HLNA 3QVXA 1MAVA 2QT1A 5DP1A 1TKRA 1XLWA 1ORHA 2NXWA 2WM9B 3ZXYA 5A3SA 1V41E 4OOEA 4HEJA 3LVQE 2AF3C 5B55A 1G2IA 5A6SA 3LFUA 4UHCA 3VPBA 2JEYA 1H6BA 1ACLA 1HKHA 4AZVA 2FZWA 3GT3A 4KP7A 1IU9A 1JEEA 2IEBA 5CH8A 3VV3A 2OUIA 2A4KA 1TVKB 1JKFA 1XTBA 1K98A 4EG1A 4HUTA 4B74A 1OPXA 3UG7A 4D3FA 3CH6A 3ZOKA 1PQWA 3KAQA 3O4GA 2GFHA 3T12A 3WL7A 5C35A 1FIUA 5TV2A 3HLKA 2XAAA 1PS0A 2KLHA 4DDTA 1DIOB 1Y8ZA 4CDRA 4FVTA 4RULA 3FROA 4PLVA 5F7JA 1F20A 4D1YA 3E35A 4KK3A 1AS3A 5BUZA 3OHMA 2WJYA 4DPMA 3ZV5A 3N0VA 4IJUA 2XMDA 4D42A 4E1VA 4KH1A 1SUAA 4KWEA 1IY0A 2ZM6B 4F56A 1MW9X 1ISRA 4ZALA 4HVCA 1XCLA 3G1TA 1DIHA 1EJ0A 1C9KA 4XX0A 1Z74A 5JDCA 3OIWA 5DDIP 1A95A 3TLGA 3EFOB 4DR5B 3RVNA 2IY9A 2OSVA 4YY3B 5CVEA 1MX1A 2NQTA 1GYRA 1QHGA 3DH0A 3PUIA 5ALXA 4MQ4A 4TWIA 5CRIA 3TCKA 3LUFA 1CY0A 2CUZA 1YKSA 1DWOA 4RNCA 1VIMA 2SKEA 4GM1A 4MQFA 3Q41A 3ZD8A 5H70A 4AY5A 4K88A 2Z83A 2BF4A 1K3TA 2G82A 2XCTB 4HFNA 4M6WA 1SC1A 2X5NA 3O90A 3KQOA 3NGMA 4I55F 1Q77A 3RODA 4TZ0A 1P4HA 1V1MA 1Y37A 1WXIA 2G1AA 3ESRA 3GZJA 4Q4LA 5REQB 1EIWA 2I55A 3IT1A 2J3QA 3OZEA 1NUAA 4HHEA 4WUTA 3WBJA 4ZT5A 1U1FA 3FVQA 3ESQA 1IZ9A 3S1LA 1KYTA 1RLOA 1KO7A 1U11A 3NUZA 3ICWA 4JD5A 4P3KA 1QFYA 3CJTA 3VVCA 4M7OA 2CK3D 1E9SA 1BNCA 5BOVA 5I3CA 4QUJA 5AKJA 5IM4F 1F38A 1U65A 5JYEA 2ORWA 1Z4LA 6NULA 5F5LA 5I4BA 4GQIA 3M1IA 4OQMA 5HTOA 2I9PA 3HU2A 3SPXA 4EFKA 4L7QA 3AHEA 2MWMA 4EHAA 2OQIA 4DNFA 4QJIA 3IJRA 1XRNA 3SI7A 3SJBA 5KYKA 1SKMA 1L4EA 2CNOA 2AG6A 1DDOA 2EARA 4IQFA 2W2LA 4WEOA 3VU8A 1DPGA 5F7XA 5H83A 1E3EA 3MTBA 1QHFA 2HCBA 2VSFA 4OUDB 2CNDA 3KPWA 5JANA 1GAEO 2QVGA 3QI7A 1H2AS 4AD8A 1SUIA 2W22A 4UAUA 5BORA 5DTRA 1V1RA 3D5TA 4RTPA 5CB4A 3AXSA 4OLFA 1UMBB 1ZK0A 4KXVA 3THSA 1LC3A 3TW0A 2B5WA 2VNHA 4LHSA 5A4IS 3K70D 2GZ1A 2CLLB 1VBNA 3AYZB 3P9QA 4KR6A 1QQTA 5DNUA 4F5EA 4CMEA 3HU5A 1M3SA 4WLFA 1XPUA 1HDEA 4C0WA 1ODKA 1C7QA 4UUQA 2Z04A 5K2MA 3C85A 3UW3A 3KB1A 2O1SA 2JIQA 2EJWA 3DE3X 5HRAA 3GP8A 3C2QA 4G01B 1D0SA 2JBAB 5IKXA 4HYQA 3X2SA 1IHXA 1JFSA 1I6MA 4H1TA 1GZ4A 3KCNA 4RNDB 1BX0A 2XRZA 2G8NA 5H68A 2HTFA 2Q9AA 5E1BA 1XTVA 4NH4A 3O8OB 1C7IA 2AE1A 4HN9A 2QU8A 3F4LA 1NVXQ 3NC0C 3SHWA 1V6AA 1VI5A 3R3XA 1C3EA 3FTNA 4P3OA 2D4HA 4S1PA 1LRKA 3R8CA 5K0BA 3RABA 3AP3A 2IODA 1PTJA 1SRRA 2JGJA 1W30A 1I9GA 1E7WA 3FX2A 3TIGA 3MGGA 4BVEA 1G5PA 4LXGA 1PDOA 2V5VA 3DZDA 4FGUA 3UZUA 1DDGA 1FDUA 2OOKA 2VDQB 3O31A 3PEUA 2HWXA 4L2IB 2QGZA 4F2GA 2NSYA 4LIPD 1NXQA 4XM2A 2HPAA 4NAHA 1TLLA 2Z4RA 1I33A 1G60A 4KFTA 5FJJA 3GQBA 3RRBA 4IIBA 3UM9A 3WNVA 4OMCA 5FO0A 2W0MA 3ZNPA 1V5GA 4FQ7A 1ZR4A 1QPZA 4EFMA 4ISBA 5TXGA 5DGHA 3TL6A 4I5GA 1N5OX 3HB4X 1XZFA 2VP9A 2FCRA 4ZVTA 3ILYA 3DWFA 3ZU4A 1A9XA 2O8DA 1XL0A 5C7IO 1L3BA 4D8XA 1NE7A 3W5JA 4ZYVA 4YCCA 3AKDA 3U26A 3JWGA 5HF8A 1DO8A 5DNAA 1LDEA 1AKMA 4OFWA 5AOVA 2DR2A 5DK4A 2VJNA 1C81A 3MWLA 4HRAA 2P9BA 1X1DA 2PGDA 4PZ9A 5BSMA 4C22A 5JEDA 5CBPA 1C0PA 3EMDA 2XMBA 2JW5A 5TLSA 2J32A 4OREX 1WZEA 4RSMA 5IN4A 1FXUA 3ZE6A 4EECA 4U5QA 4BBZA 1SUDA 4X1YA 3WS7A 3ZWVA 1J21A 2OAQ1 2P69A 3WNCA 4DR1B 1AKUA 1NN1A 1Y81A 2BOVA 2IYOA 3FOZA 2TMYA 1LJUA 3D81A 1J8YF 1T4CB 1EFTA 2ZT8A 2JFYA 4OXXA 1U7WA 3CRNA 3RIYA 4A6EA 1Z33A 3GEMA 3MAAC 4HF7A 3QEAZ 2CV0A 1X39A 1UJ5A 5JSQA 1IHDA 2PZAA 3D6FA 3R9WA 1TVMA 5KOHA 1OILA 1SQGA 1ZGAA 1PL0A 1DKUA 3EIUA 4ARBA 2LUOA 3H2KA 1W581 5JSZA 2MR6A 4RVHA 4YA6A 1E6UA 3EXHC 3S8YA 3WICA 1CUAA 1N5DA 2IYXA 3GEDA 1UIRA 2GPWA 4GKVA 2OCLA 4YQEA 1BJTA 4RH0A 4LEIA 4Q3DA 1YQDA 2IOQA 3BG5A 2CHUA 4QUGA 5DB4A 1LX7A 3GRAA 1RPJA 1U8AA 3KZXA 4GKAA 5IC5A 4TN5A 2AMYA 2NXJA 4IEFB 5JSKA 4ARSA 4DZTA 3KZKA 3KAPA 3PHBE 3UKJA 4P36A 4BNUA 3IS3A 2J87A 4JC4A 2J08A 4DXHA 4F84A 2X3FA 3IMGA 1YRLA 1XL1A 1XMQB 1WRBA 4DIDA 4EY3A 4Z99A 3GA0A 1I5RA 2FSUA 1TUGA 1AK2A 3P0RA 1F8XA 5CITA 5FR2A 5KYYA 3IXLA 3OX3A 4YLGA 1QH1A 5D8DA 1GSIA 1E3TA 4FCVA 3CT6A 3QBTA 4QAQA 5ICMA 3GFVA 3GJ8A 3O0TA 1U1GA 2IH4A 2DR3A 2AW3A 3CN7A 3PLRA 4JFAA 4R68A 5DCUA 2QV7A 2VF4X 5HF9A 4NYJR 3ETJA 5IEJA 1J5XA 3LW7A 1TAQA 1Z82A 1K5GA 4IIFA 4JI2B 3OFVA 2IC5A 3VX3A 3ROFA 2GAFA 5TR9A 1ISFA 2V54A 4X85A 2VYVA 2GWHA 2IW3A 4O2AF 1PF7E 5AHXA 4RXMA 4MWTA 5DF1A 2QX8A 2WFZA 1OGJA 3C74A 5DTEA 5LQKA 4GPTA 1AF4A 2NVUB 4JUFA 3VDXA 3GFSA 1RBZA 1L5KA 3IHTA 3DEAA 2HW8A 1AMOA 4QTTB 4IUYA 4HNTA 1JXMA 1E79A 3IIKA 3OCUA 3WRYA 4F3TA 2C03A 3G9QA 4LSMA 2CUKA 4WECA 3VYWA 1GDTA 4AROA 2PBZA 4WSOA 5LJIA 4YAEA 3ZS8A 3RHSA 3U7FB 4KVFA 1J2RA 3GGSA 3GEIA 2XGJA 1ULUA 3GUVA 3HZRA 4B85A 3O8QA 4C5CA 4BQIA 2DBVO 4KODA 2ZR9A 2EP5A 4C4TA 5TPZA 2I3BA 1NN3A 5E4FA 1AU9A 2O7VA 1ZL0A 3DBIA 1NVKA 1EFLA 3H2HA 3IP7A 5A2GA 2HUNA 4EW3A 2YNMC 3GLIA 4GC5A 3W4JA 1LRLA 2R48A 3CUUA 3F7TA 1MVLA 1E9BA 2VUIB 3L1HA 3M1YA 2FNAA 5K01A 1J1UA 1DX9A 3SSOA 1JVSA 1RKVA 3ZK7A 4HH0A 2J4DA 1XMPA 5EKUA 3HO1A 3AW9A 2EKQA 2R96A 2EZTA 4RZIA 3UAVA 2VJQA 1TK3A 2PRKA 1CE8B 4IRMA 5IM5A 2W83A 3HXTA 2IOFK 4OM7A 4Q18A 4S1VA 5HBRA 5CLIA 1EQAA 4MW4A 4D5EA 4EX6A 2OSBA 4FI3F 4LOAA 2TMGA 5A04A 3PNKA 4R8RA 5EYPB 5TJHA 2V4ZA 2NYAA 4QIHA 2GHQA 2JLBA 4M22A 2WJHA 4MGEA 5AK0A 2GN1A 3IMFA 5LJLA 1RC1A 2QIOA 2QNRA 2ZI6A 3TI7A 3AB3A 4C0AC 2FWPA 3PZRA 1CUBA 1A97A 4K81B 4U6NA 4CTKA 3KU1A 1QZ3A 2HSDA 3C5EA 4Y1EA 4NG4A 2OHXA 3FA2A 4ZVQA 1EVZA 2BUCA 4YQYA 3KEMA 5IMBA 3DOUA 5EEGA 3DMRA 2C3OA 1MZVA 2PKQP 1Z39A 5DXJA 4UE2A 1F48A 1QWOA 1O89A 2WWGA 2WIDA 3KXKA 2PV0A 2ZRHA 4ARZB 4NH0A 1GPH1 2FEWB 1PFKA 1M2OA 1N1DA 4P38A 1LQ2A 3UFXA 5F9FA 2EF0A 1IUNA 1ZLXA 2WYHA 2VH2A 2YXLA 2VDVE 4WKPA 2J0VA 3PC8A 3SBOA 1SHKA 4W1RA 5BV2P 5I9BA 3I45A 3SEFA 4B8WA 2OGUA 3Q9UA 1KH2A 3QNMA 4DA9A 1P73A 4PLFA 4F46A 4ZN6A 5B4UA 2QM7A 2ZBDA 5LA6A 4PZAA 1BFDA 2A0YA 1BDMA 4P0QB 4WZBE 3TEMA 4XRRA 5HUJA 1GPLA 3JVVA 3KL2A 2QL9A 4QEDA 1KI7A 3MA0A 2E3JA 1JU4A 3I9KA 4W5JA 5C8YA 2ZJZA 5FHRA 3UENA 3SQMA 1P0FA 4TS4A 3L6EA 1U7OA 4DJJA 4L02A 1YRHA 4UTNA 4DSAA 3E7DA 5I45A 3DPIA 3JWIA 4BMSA 3RB8A 2OOSA 3IQZA 1XIVA 2XUKA 1R6XA 3L7MA 2VDPB 3D3JA 1SD1A 3D3NA 4OIMA 3RQIA 2FZVA 4ABTA 1H3EA 4O0MA 1H0KA 3UA4A 4REQA 1AQIA 1B6GA 1ZHOA 3EEFA 1R4NA 4HB3A 4IYRA 5H8WA 1ISSA 4JWKA 4CZ2A 5C34B 5BW5A 4FDVA 1RLTA 2XYRA 2J4FA 3DTVA 4RTKA 7REQB 3ITDA 4UUBA 2DMRA 2I6SA 4BKRA 2VWQA 1VG0B 2ZRFA 5AESA 1LPSA 4ZOBA 1P6XA 2CNNA 1CRZA 2HV8A 4RPHA 3G2KA 3EB9A 4O2BB 1S8NA 3L8ZA 4CODB 5A4AA 5IC6A 4IFTA 3S2YA 1YFLA 5IRCD 3FYDA 5JH7F 2XD4A 3Q8MA 3CNNA 4FDTA 4NE9A 4C14A 3UV6A 1BCSA 5KNCA 4WASA 4QGFA 2WICA 2I87A 4LK2A 5A05A 5C4IA 1W6UA 3V46A 1TC1A 1EK0A 3PICA 4UZFA 4WZ6A 2J41A 4C2AA 2BTQB 3HM2A 4MLZA 4R8LA 3IMEA 3AVXA 3CA8A 3FYSA 2XWBF 1FPMA 3TKYA 1JWAB 1YMVA 3WYFA 1U2PA 3BB3A 4OK3A 4HV4A 4E4RA 3SC2B 1L1EA 2JLVA 4MVJD 1J7JA 4IEEA 4LWOA 4DMFA 1CIVA 2HMWA 2Q3BA 1YCGA 1A98A 2HJVA 1CVRA 2V3WA 3NHAA 2PSEA 4IXWA 5JSFA 1JIJA 5A71A 4LWQA 1QDLB 2XJ9A 3EZFA 5GM2A 4BNKA 2JLSA 4MI3A 4BGEA 3IO5A 3LT1A 3NC4A 1PCXA 3EMKA 2WUDA 2LR0A 2IWHA 2WQZA 5A1JA 3EN0A 3OZAA 1GUAA 1OX4B 4AX8A 3F98A 1XP5A 1HNZB 1E20A 1ODTC 4I08A 3HXOA 1R4ZA 2EWWA 4MROA 4MPPA 3QE9Y 1FJHA 3UOGA 3FDJA 3PUKA 3VZCA 2WD9A 4IDDA 1DC6A 4LYJA 3WAJA 1SU7A 1S2OA 2ZB8A 5FBRB 1WDLA 3BEOA 1T36B 3L8DA 2KMLA 1MO6A 1II8B 4BBJA 4LY3A 5IHXA 4IUCS 4JBYA 2UV8A 2DFKB 1WKBA 1E2QA 1U2TA 2K6GA 2X0NA 3GUHA 3NBYC 4LMRA 5CHEA 3SF8B 3TLAA 3UTCA 2JLCA 2ETVA 3ZBTA 5FD8A 2BR3A 3AJEA 4BQFA 1FP2A 1XDBA 3U80A 5GGXA 4JQCA 1QP0A 1G3UA 3K0FA 3UF0A 2YWBA 3F1LA 1RAIA 4L8WB 1MDFA 3NVDA 4WXEA 2UUPA 5EXTA 3QVGB 2QTFA 4R6XA 1OWPA 3CKKA 3T7SA 2GPTA 3L0CA 2HV9A 4FINA 121PA 4E13A 2G9ZA 4JSRA 3J7TA 2ROQA 5BSKA 5BPFA 4WN9B 1N2CE 4O4IB 2YRWA 1FFSA 1L5SA 3FJ1A 4HUQA 3KKZA 5FEUA 3HUFA 2NO5A 1U63A 4IF4A 3SS8A 2P35A 3DE2X 1TU4A 2DBYA 1W1UA 4DMCA 2VYNA 2QLFA 1CQIA 1PEKE 4XFJA 1XMVA 4CT5A 1V45E 5KWJA 1MB9A 1ADJA 1VLQA 4EHBA 2JKYA 3H9GA 5IT0A 3FYUA 3ZTYA 4UVHA 1QTNA 1QZXA 2CWWA 1JT2A 2P3LA 3QVMA 4XLLA 2PZ8A 3W2EA 2VZ9A 1YDWA 4B7ZA 2I4MA 3B78A 2IYEA 2WJ4A 5AI6A 1XQYA 1VJ0A 3ULKA 2XYHA 2FEKA 1ZRMA 1Z3CA 2UKDA 3C3BA 3GQVA 3SZ3A 4IR7A 4TL6A 5K51A 2XNHA 2ZYAA 3KBBA 3T3NA 1JIIA 4LDNA 3ZD6A 1Z62A 2Q4TA 2QXYA 2VP3A 1UDCA 1E9AA 4W9MC 4DSTA 3QENA 3RFUA 5BSUA 5BN5A 4E70A 4C7VA 4O5OA 4AB1A 2WFMA 4XUDA 4TTTS 2RIRA 4MWEA 1ZAYA 2H1RA 2JLQA 4TKUA 4RVGA 4JBHA 2ORYA 1JP7A 3IEIA 1C4XA 1RAHA 2WIKA 3OFND 1N6OA 3D9QX 1GNLA 1LLFA 2YFQA 4J1QA 5ELLA 3K9QO 5BQFA 5KJFA 5DBIA 3ETCA 3RVSA 2I65A 2JFPA 5JXIA 1SEVA 1T9HA 1RT9A 4PYQA 1Z8HA 5HK8A 1P4JA 3FY4A 5BWOA 2BHLA 1H22A 5LZ5A 2NO0A 1BIFA 2NU6A 2KW5A 4QFDA 3DXXA 4YCBA 3SIXA 3HR7A 2O8CA 2XCQA 5AQ1A 1FLNA 1XVLA 2C5AA 1DINA 5EJIA 3BOSA 1EVYA 1TTQB 3BB4A 3MPUA 4JJ8A 4US0R 2GXAA 3QI2A 2UVPA 1NJ1A 1FLVA 3JQGA 4HXFB 2PL9A 3B13B 5E7JA 3LC1O 4HBZA 1VG1A 3KKOA 1RTKA 2RG7A 3H42B 2NN3C 3LKDA 3QMMA 3SEZA 4CJXA 3FPCA 4OL0A 1CY1A 1ECPA 3FBGA 3SP1A 4RCZA 3MD9A 1URPA 1IYZA 1DG1G 2C0CA 2KI5A 1QYCA 2XNJA 3IEUA 4L50A 4WXRA 5JASA 2NYUA 3AVOA 1MB3A 2BZ0A 4HN4B 2Z8YM 1QF7A 3P96A 2PSFA 1A5TA 4HAOA 2GAAA 3IAFA 1YC5A 4H1UA 3TNDA 3T7CA 2I2CA 2Z5GA 5U4QA 1COWA 3ACBA 2REXB 2RI1A 1SZPA 4KHZA 3X1KA 4YQFA 2QK4A 4KQEA 3NRJA 4QYWA 1EK1A 3DFIA 4JB3A 2YWRA 4P58A 4LWZA 1NBOA 1F7UA 5E1DA 3T5CA 1XDWA 2R5FA 4I4LA 4JUIA 5FBHA 1JSCA 1R6AA 4YRCA 3A7EA 2HRQA 3MEQA 3E2IA 2CT8A 3IP6A 2MSCB 1KDVA 3P9CA 1XZBA 1UJMA 4GSYA 4OLJA 1KC1A 4EO4A 3T95A 1AKEA 1JFTA 1HG1A 2M9MA 3SR4A 5CFZA 4YT8A 2NTEA 3NAZA 3DO6A 3ZE7A 1G3IA 3QELB 1CR2A 3M3DA 1TW2A 4E14A 1B6SA 4B35A 4DAOA 2F90A 1W4ZA 3WHIA 4C9BA 3G2QA 5K0LA 3VVBA 5FTKA 3RS2A 4LDJA 1D2EA 4H7EA 5CJ2A 1FEZA 5CXQA 2VBCA 1K4MA 3B6JA 1PEDA 4WKNA 4O3MA 4DXAA 1ZCAA 1J0AA 2EJCA 3DPUA 3PPIA 3W7BA 2H5IA 3VPFA 5ARDA 2Q2NA 4Y2XA 5DOZA 1N32B 4ZQBA 4TUYA 1JR2A 1F6WA 2AI1A 4L5AA 2OBNA 4V0QA 1D2GA 1H9CA 1CSEE 3RFFA 2XUOA 3S2ZA 4EFDA 5BN3A 1LWOA 2M6LA 1W4CA 4B7UA 4I3FA 1XOIA 3I2KA 1HM5A 2IP4A 4GQAA 5D00A 1DX4A 2R4QA 1MJ5A 4QYMA 1OKKD 3NWEA 1THZA 1PU2A 3HRIA 3CX8A 2XQJA 1VSQA 3LPCA 4KX5A 4LDAA 1XFAA 4AWAA 1CQWA 2YHUA 1GM5A 1EX7A 1KY3A 3BEDA 2JBHA 1X0XA 2AE2A 2G25A 1GGJA 1VBMA 2Q3MA 1V16B 2XIJA 2ASEA 3OC0A 4HTFA 5DYNA 3K70C 1EWRA 1F2UA 5B4TA 5JLAA 3MGBA 4H18A 4IDQA 1NL3A 5TVKA 3AUTA 4IGAA 4LBYA 2HA5A 2FAXA 2PZKA 4XDYA 3HEMA 3RVBA 1PWYE 5T4HA 2EZUA 3D5QA 3GT4A 1JDJA 1CY7A 4CLOB 2IPNA 1CBUA 2DC1A 1YE3A 3BXPA 1QHYA 3JQDA 3A0RB 5KVVA 1XTQA 3UG6A 2XUIA 3LUJA 2BKAA 2YQ5A 1BGXT 5K0CA 3PXUA 1YF3A 3JQBA 1Z0FA 4F5YA 3GU3A 1O7JA 4EY6A 2O8EA 3MJTA 4XTRA 4QRIA 1DAHA 1Q7EA 2WTBA 3DVAB 3HJUA 4XYGA 1GTG1 5A5EA 2A9PA 4L78A 4DZZA 1Z6GA 4JI4B 3C3MA 1H42A 1GQYA 2Q1UA 1Z29A 3MUNA 4LDZA 5GTDA 2GX6A 3HA3A 2VQSA 3C5CA 1KI1A 3ZGYA 4PE5B 4IGFA 4B3DA 1RI3A 3E8XA 2O50A 4O2LA 1X1TA 3ZX5A 4YIHA 5BSHA 4NBNA 3LIIA 2C5LA 1QUFA 1U0GA 1Z16A 2W6JA 4OXKA 2IHJA 3G2PA 4CEIA 2LCIA 4KQIA 1C9NA 2JIMA 4HWOA 2WI8A 4LVNA 4J6EA 2F9FA 4UKDA 1UZMA 4FFDA 4G9GA 3WIDA 1ZOLA 4INPA 1N2ZA 1QDEA 1VKOA 3DMTA 1NASA 3HBMA 4OB8A 2EQBA 4UUAA 3DCNA 4GOOD 3DVQX 1BWPA 3BULA 4D3YA 2CFRA 2E5WA 1OF1A 4HKTA 1HQDA 3SG0A 4LF7B 4HJXA 1SUWA 2DPGA 3GYGA 3OZBA 3KYBA 3E23A 4Q93A 1IY1A 2YWJA 2P68A 3CQ9A 1U0NA 4BBPA 3EPJA 1VC2A 3E53A 1JFFB 2FYTA 5SYAA 1NBAA 3RG8A 3BTOA 5A3QA 4EKGA 3LPLA 1SXJB 1B8UA 2W8BA 1WHSB 2AEFA 1CUUA 3RANA 1VPEA 5ESRA 5KNBH 2NPIA 4QBKA 3SQNA 3K9CA 4GW3A 1GRNA 2PPVA 3A1NA 4R0MA 4GMFA 1NVUQ 1W9HA 3K2IA 4OYRA 3MRVA 3VJRA 2H1FA 2CC2A 1NAHA 5ICFA 1OW3B 4B4KA 1V2GA 4QGGA 1FDOA 4IKEA 3VHXA 3MJEA 3NHUA 1SCBA 1JSRA 1UPBA 1BGWA 5LYJA 5KOYA 3IR7A 2J6HA 3U4MA 2QDKA 4KITB 2C2BA 2Y8EA 1BS1A 2O7NA 2I0FA 3DUFB 3M4NA 1A72A 3Q1KA 3V2HA 1Z5VA 1RWWA 2VDMB 4ITRC 4YAGA 1T1RA 2ID4A 3HUTA 4P34A 4L15A 5BN4A 2YY7A 1L4NA 2V8BA 3TTWA 1P7ZA 2NSLA 3A2KA 4Q1DA 1GTZA 3FI0A 2X58A 4KH0A 3FUUA 4K9KA 2A0UA 2QJOA 3NOQA 1ZW1A 2BMDA 4IS2A 1XHEA 7MDHA 1MIOA 4GOKA 3CS3A 1N6HA 4IPTA 3B82A 5EZQA 3S0JA 2ACWA 1WMBA 3L0IB 3UXYA 2XW6A 4J94A 4I8IA 1TU0A 2XCOA 5C80A 2W6MA 3D02A 1MG0A 1SVSA 1OB2A 2OPHA 1BHSA 4CE6A 1P4GA 1JLKA 3I4FA 2PUGA 2HRCA 2ID7A 3O38A 4WLEA 4BTEA 3LBAA 3R3YA 4J0EA 1JJAA 4UHJA 1PR4A 1CRWG 1SVUA 1KZGB 2CEKA 2MYNA 1Q57A 2IYAA 1TQ6A 5T57A 3CVWA 5EWLA 1OE0A 1UXIA 1E2JA 5KPDA 3F8TA 3ODPA 3R75A 1SOAA 1ZY2A 5FUQA 1R5NA 1W1IA 2GF2A 4CI9A 5SY6A 3PA8A 3WO0A 2D5CA 1BMTA 3K0CA 2AWNA 13PKA 4FCTA 4I2NA 5CUQA 1H2HA 4CEIB 2C00A 2A0WA 2WWFA 2B8WA 2PA3A 1SNYA 1CHDA 3IXMA 3RHTA 2V7GA 3P0FA 5TF4A 3LXRA 3SLRA 1E8NA 5FX2A 2EIXA 2PXCA 3AJDA 3ZWDA 3KQMA 2PFGA 2AOUB 3MG9A 5CDHA 4JDPA 1HC7A 5GIPE 4EABA 4I4CA 2L18A 3H6GA 1BQ3A 4P3NA 5DM1A 3CNLA 4OLAA 3JYNA 1YZGA 3BSSA 2QUJA 3LA6A 1B8PA 1JEAA 3PHJA 3A9VA 3C6QA 3OCCA 1R3UA 3Q7EA 4FS3A 4EYKA 2B0CA 2R3SA 3VPGA 1IN6A 2UYHA 1LI7A 1TCCA 5TARA 2Z2YA 4FM9A 2ZPAA 1K8XB 3T3PB 4BP9A 1MAHA 3L92A 4KL8S 3KELA 3STTA 4LTMA 4N82A 3IULA 1XMSA 3AERB 2BGRA 3CH5A 2QTWB 1W8DA 2OZVA 4Z4IA 5FA8A 2OV6A 2HOQA 4GOJA 5KSWB 1NI5A 4GC9A 4RAOA 5DNDA 1K63A 1KO1A 3CYFA 3BMOA 1LK5A 1YZQA 4UBMA 2VO1A 2PWAA 1MFZA 3IOCA 3CLTD 4OBWA 2OCDA 2JRLA 1U8FO 3O1HB 4R1PA 4LUCA 3S7TA 4P7BA 1GTSA 1VG8A 3I9JA 1K9VF 3H86A 4LRSB 3WYAA 4B3MB 3WTCA 4EVSA 4HDSA 1FZQA