4LV8B

Murine irga6 bound to toxoplasma rop5c, a pseudokinase gdi
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
397
structure length
390
Chain Sequence
b'NDLPSSFTGYFKKFNTGRKIISQEILNLIELRMRKGNIQLTNSAISDALKEIDSSVLNVAVTGETGSGKSSFINTLRGIGNEEEGAAKTGVVEVTMERHPYKHPNIPNVVFWDLPGIGSTNFPPNTYLEKMKFYEYDFFIIISATRFKKNDIDIAKAISMMKKEFYFVRTKVDSDITNEADGKPQTFDKEKVLQDIRLNCVNTFRENGIAEPPIFLLSNKNVCHYDFPVLMDKLISDLPIYKRHNFMVSLPNITDSVIEKKRQFLKQRIWLEGFAADLVNIIPSLTFLLDSDLETLKKSMKFYRTVFGVDETSLQRLVDQVEAMIKSPAVFKPTDEETIQERLSRYIQEFCLANGYLLPKNSFLKEIFYLKYYFLDMVTEDAKTLLKEIC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rhoptry protein 5 C
molecule tags Transferase/hydrolase
source organism Toxoplasma gondii type i
publication title Murine IRGa6 bound to Toxoplasma ROP5C, a pseudokinase GDI
rcsb
total genus 150
structure length 390
sequence length 397
ec nomenclature ec 3.6.5.-:
pdb deposition date 2013-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05049 IIGP Interferon-inducible GTPase (IIGP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lv8B02
1HEIA 1NN1A 2QQEA 5P21A 4PO1A 5DO9A 1M2OB 3M6AA 2Q9BA 2WSSA 3GJ5A 2D62A 2YKGA 2QPTA 4CGZA 4L4UA 1A7JA 1ZUHA 1UBFA 4NCJA 3TNFA 3CWZA 1II9A 3P26A 3QKTA 2KSQA 5LBIA 3J81k 5G40A 2GXSA 2R2AA 1NVVR 3AF4A 2VHQA 1G8HA 1ZD1A 2GNOA 2ANBA 2A5GA 3IIJA 3KKOA 1VKJA 4EPVA 4TZ0A 4RD6A 4A6XA 4Z1MD 2J3EA 1AS2A 1ZUIA 4N3NA 1XTQA 1W36B 2QA5A 1FPMA 4TL7A 1JR6A 4G3XA 2FF7A 2ORVA 5CK4A 2O8EA 2EFDB 2P6NA 3KZ1E 2P6RA 1JR3D 4TQAA 4CEJA 4EFMA 2NO0A 5TV2A 3U44A 5BN5A 2QT0A 4PAMA 1S3GA 5FOSA 3UIEA 2Z83A 3BERA 4L8GA 3AVUA 3EA0A 3B2EA 2JLQA 3SS8A 3AVXA 2J0UA 4R71A 4B73A 3CZQA 1SXJB 1AN0A 3BH7A 2PZGA 4ZDJA 5J4YA 1D2NA 2FFHA 1V43A 3K0CA 1M7GA 1N3BA 5E3HA 3KQNA 1NVXQ 2HLDD 4FMCF 5TMPA 1IAQA 2RGGA 3T06B 2FZLA 2JIZA 2ZSFA 3OF5A 3Q7QA 3CNOA 3TAUA 1MOZA 3NC0C 4ZKDA 4CEHB 3L2OB 3ZJYA 3A6PC 4PFSA 2DR3A 3NKVA 2ZE6A 1TEXA 1W0JA 3MCAA 2A78A 4KAXA 1WDTA 2Q9CA 1K6MA 2ZVPX 4P32A 4Q1BA 3WBJA 1HUQA 2WPDD 3ZZ0A 2DFTA 3UXMA 4LGMA 4LC1A 3GFOA 4L16A 1NMYA 3VR2A 2Q0HA 3H2YA 2GCNA 4PZZA 4CYMA 2WBLC 2R9VA 2N46A 3SN6A 4PPQA 2YC4C 3ZZUA 2QBYB 4I1UA 1N5KA 2ZRMA 3IIMA 4YMWA 3FWYA 2V9PA 2ZTSA 4ZIRB 4W5WA 5IHPA 2C2HA 1E96A 3LBNA 5FOXA 3MJRA 3K0SA 4IOJA 1Z83A 4TQ9A 1EESA 2R65A 3LLUA 2HYDA 3UPUA 2EFEB 3SJZA 3W3ZB 1FTNA 3U3RA 5E4FA 4ZPXA 4ZDWA 3DOFA 5DYGA 2C78A 4FINA 3VKWA 1KK1A 3C41J 4PC6A 1TQ2A 4LJYA 1G4AE 3GLHE 5AK0A 1X3SA 3ZDQA 1J2JA 1DS6A 4UNQA 4A2PA 1XEWX 4P4UA 1VG0B 3NVAA 4OJKA 4DDWA 1W4AA 2ZRGA 1DO2A 2OFWA 3V4FA 3SQXA 5JJKA 3VR5A 5KSPA 3QEJA 1OXTA 4AG6A 2WV9A 1P7CA 2NGRA 4GI7A 1Q1ZA 2GAOA 1BO6A 1CEEA 4FMDB 4IOLA 2ZIAA 1GNPA 2FZ4A 5KUTA 1OIVA 2OG2A 3HWSA 5TVKA 5J47A 4U02A 3OAAD 4V0ME 1A82A 1IY0A 1IQPA 4Z8XA 2ZJAA 3R7WA 4EFLA 1F2UA 1EWRA 4LHXA 4C9BA 4DLZA 3EZ7A 1F48A 4R98A 4EQ6A 1JAIA 2I4IA 2BEKA 2ZAOA 4JSYA 1TF5A 3OAAA 4NL4H 2VPPA 5AUPB 1Z29A 5E7IA 4A8JA 4LI0A 3NDPA 3RVBA 1XNJA 5GJVC 3WNBA 1E2GA 1S0UA 2C77A 4QHSA 4NMMA 3DZ8A 3K8YA 3R9WA 3RYTC 1OFTA 1SVWA 3PQCA 2H8KA 3KDSE 3MJHA 1OH8A 1E6CA 4B3DA 1W4BA 1JPNA 1KJZA 3IEUA 4HDQB 4KVAA 4WXRA 4C7OB 1D6JA 5HKKA 1VYTA 4O0MA 5LB4A 1OV4A 4TLAA 1GAJA 4EPWA 2W83A 3T15A 3FMOB 4DUGD 2WKPA 2P6UA 3D7MA 4NPHA 4B3BA 1PLLA 2OBNA 3SBDA 2GHIA 1FNMA 3L0SA 2EFGA 3SI7A 5DHFA 5EP3A 3CIOA 3U7FB 4D0LB 1RZ3A 4A6PA 4EIWA 5FUXA 3QI2A 4A8JC 3K0EA 5EE0A 4M1YA 4RCZA 1X8JA 3C15C 4NHOA 4AD8A 1Q44A 1E2DA 3LQQA 5IK2D 4Z51A 2BM1A 1CLUA 2JLRA 2EWWA 2DFNA 3CRW1 2BDTA 1D8TA 1XMVA 1P75A 2VYFA 2JDID 3K09C 3AH8A 1FTSA 4A0FA 2BBSA 4HAZA 3FDIA 3CX7A 3HPQA 4M22A 4DSNA 1KY3A 2IYYA 4CT4B 1RRCA 2AX4A 3X1YA 5FTLA 4M1KA 3Q5DA 1NKSA 4QHYA 3T12A 1VCOA 3T1VA 1LB1B 1XMJA 1MABB 2P3SA 4FWIB 1AGRA 3SOPA 4NP6A 2VHCA 4Q02A 5JWHA 3VU9B 1NJFA 1AS0A 5A5GA 4HLUA 5EJEA 4DT1A 1GG2A 2CLDX 1P60A 3DM9B 4OKSA 5CIWA 1S8FA 2HCJB 5FUWA 4RD0A 1NBME 4O2LA 4B33A 3AF0A 4ZKEA 4AC9A 1I2MA 2FMXA 3RRYA 1AS3A 4A9AA 2PT7A 2BIFA 4DXAA 2QU8A 4O2RA 3A1UA 1FP7A 4URZR 5DH9A 1TF2A 5FTJA 4GOJA 5HE9A 2XSZA 4C30A 3KFXA 3GLHA 2G1JA 3NEYA 2D3WA 4PQRA 2F3RA 3G0HA 5JWOA 1GIAA 1YZQA 2F6RA 1R5BA 3G82C 1JJVA 4AYTA 2N1BA 4ITRC 4RD2A 1YZTA 4PTLA 4I4LA 3SJAA 1AGPA 3H4MA 1XZQA 5HCIA 1IN7A 2GJAA 3FOZA 1C4OA 1Z6GA 1E9EA 1J8MF 1F5NA 1GRQA 2BBTA 3IHLA 3ADKA 4KJZA 1GNRA 2B92A 2GAAA 3FHCB 4DKXA 1HE1C 4ZV4A 2ZANA 4PQYA 4D82A 3CX8A 3WYFA 3ADBA 1J99A 5CK5A 4BZQA 1XZPA 4F93B 3ZS9A 4D2IA 4IXNA 4A92A 2QNRA 2QT1A 2ZI6A 3Q7PA 3GLHB 1G5PA 2GZAA 4A0RA 3KQLA 5FR2A 2C9YA 5DSZA 2NPFA 3WP0A 1G18A 2OM2A 2R6GA 2ZQ5A 2C03A 1US8B 4GRAA 5FPTA 621PA 1P2VA 3FKSA 3RC3A 3ZVNA 3THYB 4Q4AB 3UMFA 4I1SA 121PA 2RGAA 1Z6TA 2HYIC 3CNLA 1JAHA 2FFBA 2R6DA 5JCZA 4RZ2A 4BLOA 4QJ4A 3QKUA 3V9PA 2OCAA 3REGA 1OSNA 1VMAA 1N6KA 4LJ5A 1ZUNB 4R7ZA 4XH9B 1FOEB 4MH0R 4XTRA 5CLQA 4KVGA 3Q8XB 1MABA 4D0GA 1XPUA 2FWRA 4UXJA 3WRYC 3IQWA 4QNRA 721PA 3A1WA 1G9XA 3DEFA 1ZRHA 2OCYC 1BOFA 2J7PD 2HUPA 1YR6A 3LBHA 5BW8A 2ZI5A 2PMDA 3JVVA 4JBXA 1OHHA 4B35A 2EU8A 4CEIA 1SVMA 3V00A 1NMXA 4NE2A 1LV7A 2VP2A 4M9QA 5FOTA 3W6NA 2CXXA 1VG8A 4AKGA 6Q21A 4B2LA 3WMEA 4U00A 2WSMA 1YRBA 4AYXA 3QPVA 5GADl 5LB2A 1G1MA 1KDPA 3EWAA 2FN4A 1CJTC 1YU9A 4C2UA 1SHZA 2NG1A 5HE8A 3SFVA 1XFAA 4B3GA 1ZMXA 4US1R 1GKUB 2ZI3A 3ASZA 3B85A 3KUDA 3KXIA 2C8VA 4TN1A 4JLDA 1HTWA 3FMIA 5BYKA 3SJCA 4Q4JA 1KSHA 3C8UA 3CRMA 1L7VC 3CBQA 4HB3A 1QHIA 4F38A 4LY6A 1E2HA 2H57A 3K0AA 4MUAA 1T8UA 4JLJA 1L4YA 1GZSA 3SQWA 2RB4A 4IW3B 3EC1A 4US0R 1US8A 2FPMA 2VH5R 3FTQA 2UZIR 2VO1A 4JJZA 1DAFA 4CW7A 2WWWA 2ANCA 4FIDA 1U90A 3EPKA 2A30A 5B58C 4JZKA 1ZD8A 1JEDA 2WOJA 2GEDA 4UNNA 4F4JA 2Q3HA 1DTSA 2EFHB 2MSCB 3SYLA 3AVWA 3G5UA 1Q3HA 5FBWB 1OHHD 2VP9A 1OIWA 2D2FA 3JVUA 2QORA 1UBGA 1KO8A 1SULA 4AKEA 3CR7A 4FD2A 1EFTA 2OT3B 4HAYA 3BFKA 2G77B 3BB1A 4CRWB 4YC7A 5KDOA 1NN3A 2YOGA 3VNVA 5EP4A 2XZPA 2CE2X 2Y8EA 4JJKA 1NRJB 1GM5A 1EX7A 3U7EB 4LRWA 3QF7A 1NIPA 1JQJC 3B7GA 2Q3MA 5A0FA 1WP9A 2CVHA 3THXA 3R9IA 2QTHA 4TL9A 5JJIA 3K1JA 3GLGB 3B1XA 1EFRA 2UKDA 2BCGY 4WOPA 3VR3A 1W5SA 1YVDA 5J4LA 3X1DA 1R8QA 4DSOA 5KDLA 5F9HA 3VHXA 2DBYA 4FMDF 4D0NA 3QXJA 2OESA 4UJ5A 2QI9C 2Z4SA 3WNDA 3LNCA 4ZI3A 4CF7A 1K5GA 4GDFA 2WMOB 1MO3A 3ADDA 2FSFA 2HCBA 4C0HA 2A3RA 3EZ2A 3MGCA 4BEJA 1WCV1 2J0UB 2PZFA 3H84A 2RGCA 2OXRA 2C95A 1JALA 3A1SA 1VHLA 1MT0A 3WRXC 3GLIA 1NN0A 4QL3A 2X19A 4RD4A 4Q03A 5JI3E 4ASUA 1DPFA 3TUIC 5DIFA 2IUSA 1CTQA 3CW2A 3HU3A 4BFYA 1J90A 3EASA 3MWJA 4JL6A 3SYNA 2YZ2A 4XOIA 2D7CA 3K0FA 2ZUBA 2ZRCA 1KAGA 4LPKA 2O0HA 3JZAA 1N6RA 1UF9A 4TMWA 1MO4A 4EUNA 1U2RA 1Z0IA 3HR7A 3B1VA 3R8CA 4OQNA 5JFGA 1AKYA 2ZS7A 3U3KA 2YC2C 1N6PA 2A2ZA 2VBCA 4BFZA 4A36A 3UK6A 1UKEA 3QKRA 1R4AA 3IBYA 3U4QB 1KK3A 1G64A 3WHLA 2WJJA 4D6PA 5DI9A 2ZRJA 1IXZA 2GWHA 2W6JD 2VL7A 2PJZA 4HUQA 1P3JA 4B47A 2CHVA 1EFRD 1KTVA 1L2TA 1P2UA 5AR1A 1YHNA 2ZJYA 2JCSA 3N2IA 2XXAA 2ECKA 3RABA 2G3YA 2ZJOA 4GNKA 4Y0AA 4ERNA 2JA1A 4JLOA 4TL8A 1E94E 4DRZA 3QNUA 3B1WA 2IYQA 4PSKA 2O8DA 3BB4A 4DDVA 2JLVA 4GMXA 2BJWA 4AIIA 1D2MA 2XGJA 1ZIOA 3I5XA 1DG1G 4JYCA 2XEXA 4ASUD 1QDEA 1KZ7B 4KLZA 3LD9A 1JR3E 1ZCBA 3X1XA 4B2PA 2VF8A 2JASA 1IN6A 3ZIAA 3O8CA 5CB6A 1N6LA 3ZLJA 3C14C 4DSTA 5EQTA 1GITA 1M6NA 2N42A 5FI1B 4QBFA 4FCVA 3QKRB 3U4QA 2PJRA 2O0JA 3SBEA 1HT1E 2ONKA 4YMSA 1RRPA 4JL5A 1MKYA 4B3CA 2NPIA 4EFNA 4QBGB 2PX3A 2DCUA 3KKNA 4R2HA 3ZYCA 2FV8A 1I4TD 4TLEA 1SKQA 1XP8A 4MQBA 1GOTA 1QBKC 4FXPA 4D80A 1GP2A 2ZU0C 1C9KA 1XTRA 3BH6A 4CZ2A 1OJLA 3B1ZA 3OIWA 3QKSA 3K09A 4BLQA 1E0SA 2OHFA 3GP8A 1G7TA 2ZJ8A 1XEWY 2CK3D 1LFDB 3THWA 1PZNA 1IN5A 1G3UA 1CKEA 4MKGA 4LBZA 4MUBA 1CU1A 4DLXA 1AQUA 1CXZA 2FOLA 2ZE8A 4BGDA 1UADA 3SHFA 5JEEA 5KDDA 1TU3A 3OIYA 4H1VA 2YJTD 3U3JA 4QRHA 3I4LA 4YXWA 3I72A 2WJIA 4TMXA 3PEYA 4C0LA 3N5CA 2CCGA 2NO7A 1A2BA 1P73A 1EFUA 3GLFE 1KO4A 4A0HA 2IYTA 1X6VA 4LCBA 1G291 4Q9JA 2IX3A 2QMUA 4TYNA 2QEQA 5F98A 4FI3C 5DN6A 1NSTA 2EQBA 2QP3A 3AB3A 4J0QA 1XMIA 4KFSA 5HPYB 2QE7D 4JLPA 1MRNA 1Z0DA 2YV5A 4IFEA 4WIAA 5J40A 4AWXA 2BBWA 2ZRAA 1JJ7A 3B1YA 2F3TA 2KE5A 1TADA 3LX8A 1E2NA 5AJXA 1W0KD 2ZRKA 1U9IC 3D8BA 1GUAA 2AHOA 5A4JA 5GJBA 1Z6XA 3CRRA 3LXRA 3UMSA 5FH9A 4DEYA 5BQ5A 1XTJA 3W5IA 2V3CC 2RGNA 1YZKA 2DWQA 2R8RA 4NYIR 4MGKR 5KPJA 3Q5EA 5AJYA 5FOVA 1XD2A 5JLJA 3S1AA 1E2JA 4S2EA 3R9XA 1R10A 3VAAA 2H18A 3UMRA 2W6IA 5EUQB 4N1AA 1NVUQ 2WIBA 4NYJR 4G5SA 2F1JA 2ZREA 2HLDA 2OV2A 1NY6A 4B32A 4NYMQ 5CJ2A 5JSZB 4QKQA 5H70A 1FMLA 1P9WA 2AFIE 2V1UA 5HCNA 3CH4B 3TK1A 2FDCA 1XCGB 4HAVA 1E2QA 1P2SA 4NKRA 2IYSA 4B44A 4BRUA 4HZUA 1N5LA 3Q3JB 5AUOB 3SC3A 1J7KA 5FBLB 2DHRA 4B71A 3QXXA 2OSBA 2ZR0A 3OIUA 1FFHA 3LBIA 5FFMA 4MKIA 3MRSA 3RHFA 1DELA 3O8RA 2WOOA 3EIQA 4TZ6A 2IYLD 1DVRA 5JS8A 4RFSA 5E7MA 4PHHA 3C16C 1TX4B 4LHVA 4Q4JB 2VP0A 4Z1MA 1U9IA 5UKDA 4LWZA 2ZYWX 3A1TA 3BFXA 3X2SA 3VR1A 1W36C 3UG7A 3GD7A 4ON9A 3EC2A 1JXOA 4W5HA 4IKEA 1QHNA 1RJ9B 2BV3A 1O87A 4GZLA 1F2TA 5AUNB 3RDPA 5L3QB 3VQTA 4F4CA 1BYIA 2WWYA 4IOMA 1YR9A 1NLZA 4HB4A 4OHXA 1PUIA 1KGDA 3FKQA 4C0BA 2IYXA 3AVVA 1KSJA 5FPHA 4OQMA 3NH6A 1NLYA 3MUFA 4TT3D 2QG6A 1KMQA 2BMEA 4JLMA 4WVFA 4GL2A 1EFHA 1ZC3A 3FGNA 5M04A 1G3RA 2QMOA 5JEDA 1JB1A 1WQ1R 4K46A 1DOAA 2IYUA 2GK6A 2CCKA 4A2QA 3RS4A 4DHEA 2FNAA 4OK5A 1LVGA 3NEJA 3ADCA 3M1IA 5BYJA 3KJHA 2ZYTX 1MRSA 1W48A 1XD8A 4Q18A 3SZRA 1PLKA 3OE7D 3WMFA 2PMKA 3BD9A 3QBTA 3PCRB 4LBYA 1XTIA 2KWIA 3KB2A 5AJWA 1T9HA 4IJMA 3OEED 4EJSA 2O8BB 3AF1A 4PC3A 4Q9KA 3B82A 5DLQC 3AKCA 3KTAA 2JGNA 2Q9AA 1S9HA 1Z8FA 2J1LA 2G88A 3O8BA 4ABYA 5TY0A 2RKOA 4QG7A 2ZEJA 5D3QA 2JJ1D 3KFVA 3ETLA 2CJWA 2IF0A 2P5SA 2OFXA 3VR4A 4URVR 4R9UC 1OXXK 3RS0A 4HB2A 3VU9A 3IBGA 3EPHA 1FL9A 1SKYE 1SVOA 1E79D 2OILA 2R62A 1NBMD 3BORA 3K0FB 3AF3A 4M4SA 3U6BA 3IEVA 3VKGA 4NCIA 3L0OA 3LQRA 4OQFA 4YLGA 1RRFA 2WIAA 4CVNA 4YXWD 2XJ4A 4PC1A 1W7AA 1SHKA 2VSOA 2VTKA 4TT3A 1W47A 3QIAA 1IN4A 5JCPA 2XTNA 3W5JA 1DEKA 3IIKA 2IWHA 2BHRA 3AP1A 1E3MA 1KI3A 5B57C 1U94A 1DARA 4LV6A 1R0YA 3LAWA 3V4RA 4XVUA 1E1QD 2GXUA 1OXVA 1ZM2A 4TTRA 3VKHA 1XRJA 3QE0A 3I8XA 4JYBA 1ZAKA 2K5UA 4RVCA 1F6BA 1P6XA 2J41A 2GJKA 2MMCA 2EFCB 2O8CB 1KHTA 1CIPA 2HJVA 2ZJZA 5TARA 2A5DA 4C0QC 2BVNA 1OLOA 3EW9A 1W2GA 1ZBDA 3P20A 2Z5FA 3CPHA 3GLGA 4M0LA 2A9KA 4ZO4A 1IJEA 3B6EA 2X2FA 1XXHA 3RNLA 1UKVY 1KO1A 1P5ZB 4GPTA 3GJ0A 4B2IA 2AN9A 1UEJA 1X8KA 1BS1A 4UXIA 4JKIA 2QL6A 3AUXA 3SHWA 4YONB 1VYVA 2GJ9A 2H92A 1M8PA 1WMSA 1AM4D 4HAXA 1QHXA 2GBLC 3LO5A 2GBLA 2CK3A 3C4JA 2CL0X 3CPEA 4B48A 3CM0A 4NZYA 2J45A 1S4QA 4JIMA 2QSYA 3ND9A 3SYKA 1FZQA 1NJGA 4LJ7A 1A1VA 3M4YA 1G5RA 1KI4A 1FNNA 2OCPA 3TJZA 1W5TA 1QHSA 2XOKD 4LC0A 4Q47A 1BH2A 1II8A 2H7VA 2Z4RA 4PSVA 5EE1A 4IDPA 3QEOA 4A1FA 2GJ8A 1I4LD 2ZE7A 1JXMA 1X1RA 2KBEA 4MRVA 4DCTA 5JRZA 3R7WB 3QSYA 2WSSD 4HEJA 3P32A 1SXJC 4JBYA 2VP6A 1KJYA 1OB5A 5B64A 1RW4A 3QVUA 3CWQA 3IPYA 3K9NA 3K70C 4OI2A 1G41A 5KSYA 3F0TA 3FFAA 1FX0A 3KXKA 5HZKA 4AKHA 4MA4A 4S35A 4D81A 1P9NA 2D2EA 2AKAB 4KLNA 4G5RA 4BEBA 2ZSBA 2PEZA 3QG1A 1ZD9A 1IHUA 1VTKA 3I62A 5DGXA 1T3HA 1CULC 1KI2A 2J9RA 3AGQA 4L9WA 2F9LA 1VCNA 1ZW6A 4KBGA 1BIFA 1KZGB 3AVOA 4C7OA 2I3BA 1UDWA 1NG1A 3EG5A 4RCYA 1DG3A 3T1TA 1VIAA 2UZ3A 3LLMA 4JVSB 4E03A 2PL3A 1PVOA 1W36D 2RHMA 1LY1A 2CE7A 2IHYA 1VCMA 1UAAA 4M9XA 1E9DA 2WWGA 2IS4A 3GJ3A 3IKJA 4LBWA 5CYPA 4OHWA 4DCSA 5CB8A 2RGEA 3E70C 3LY5A 4A15A 1IY1A 3RC8A 2FFQA 2FSIA 3GEIA 4PANA 2BC9A 3DZDA 1UKYA 3FHTA 3HU2A 4EQ6B 2IBMA 4D26A 4U7DA 3BE4A 2VHTA 1WBDA 3KJIA 4JVMA 2CLCX 2JJ8A 4M1SA 5DN6D 1SVKA 5SZHB 4HUQB 4XVRA 1VHTA 4HLQB 4MYTA 3TSOA 1A5TA 1G17A 4BECA 2QAJA 3C5HA 2JLYA 3PVSA 3PJRA 2B8WA 3U61B 4KFUA 2QPAA 4YMVA 2V54A 3TW8B 5EXSA 2X77A 1GVNB 4UXHA 3GPLA 1OT3A 3VNUA 3BS4A 3OFNA 2C99A 1P72A 2JLXA 1XX6A 1AZTA 2OBMA 2YWHA 1GKYA 2VP5A 1N5IA 1G7RA 5SZJA 2F1HA 3FHOA 2WWHA 5FPSA 2PEYA 3RAPR 4DJTA 3IO3A 3W3AA 4LBVA 4ZCIA 2E87A 1OW3B 5J4HA 3KTAB 2V1XA 1ZU4A 4BPBA 2YOHA 2GILA 1DADA 3PUVA 3DM5A 4LV5B 1SXJA 3UATA 1D9XA 2O8BA 1GWNA 1J8YF 1KNQA 1Z28A 2ZITA 5JS7A 3CH5A 1Z08A 4B34A 4QXAA 3L0PA 4BRWA 3TW4A 3GJ7A 3QBVA 5K8UA 1XBTA 2GVDC 2ZS9A 4B6EA 3PV0A 1CJVC 2V6IA 2XTZA 3PENA 4UNPA 2ORIA 3JZMA 2ONJA 4M9SA 3GJ4A 1OYYA 1G3QA 5BWMA 2QN6A 4RD1A 1G4UR 4KV9A 1YRAA 1QVRA 2AFHE 4ESVA 4Q1AA 3D31A 1N5JA 2L0XA 2O0KA 4MYHA 4NCNA 4IFBA 2BJVA 2F43B 4D4LA 2ZAMA 2IYZA 3K9HA 4MRRA 4XWAA 3U60B 4OHZA 5DNYB 3T5DA 3WXMA 5TDHA 2FA9A 4H9GA 3ZGXA 4KITB 1G3MA 2ZI7A 1ANKA 1KI7A 1OE0A 3THOA 4TMVA 3BAFA 1W1WA 5C1BA 2C5LA 2G6BA 3AP3A 2X8AA 3DDCA 1S1MA 1K5DA 3HR8A 1R7RA 4JLAA 421PA 4IDHA 4HI0E 3ICQB 2IL1A 1W2HA 4PO8A 3FKSD 1H8EA 2ZUCA 1N0WA 1TEVA 3EARA 2WKRA 3IDQA 1G8PA 1XEFA 4BQSA 2W2XA 4FWTA 1AJEA 1NBMA 4DBLC 2BM0A 1XD9A 5L3SA 1NG9A 4ACAA 2GJSA 1ZNWA 2IUUA 4IEEA 2O8EB 5C2JB 3QXHA 2IUTA 3EPLA 4BUJA 2W6ID 2KI5A 2G0NA 4Q1CA 4GOKA 4CT5A 4AKIA 3EX7C 2NQ2C 4MGIR 4URYR 2ZROA 2J87A 2CNWD 4NYMR 4P33A 2AD1A 4PX9A 3FMFA 2E1RA 2P2LA 1Q22A 1H8HD 4DDTA 1NI3A 2NIPA 2VRWA 4LJ8A 2OAP1 2ZM5A 1JI0A 1II0A 1Z0FA 2RAPA 4LJ6A 3SFZA 2XNDD 2I1VB 1IM2A 3UANA 3CUEF 3RWMB 2WTUA 1U0HC 2PCLA 4BLSA 4N0EA 2F9MA 5DISB 4IDQA 4LJAA 2G83A 2ZXUA 5LD2B 2ZETA 1Q1BA 1QG2A 3AKYA 3EAQA 4DWJA 4Q19A 5EE5B 2ERYA 4NTZA 3B13B 5EZ6B 4OK6A 1Y3AA 2C9OA 3NG1A 3AVTA 2IXFA 4RD3A 3QJYA 2GCOA 2CBZA 3IUYA 1Q3TA 4EDHA 4G5GA 2DY1A 4JT2A 3MWYW 1CJKC 3K9LA 5L3SB 3FYHA 4OL0A 1ZM4A 2WWFA 4EPXA 4X8HA 3BBPA 3CRVA 1W0KA 2XX3A 4KFTA 1XCMA 5EE3A 1AK2A 1MH1A 3TRFA 2AD5A 2QPOA 4US2R 3D3QA 2J59A 4Q9LA 1U8AA 1XDBA 1ZVQA 2IS6A 4TTPA 1GFIA 2W00A 5J4VA 1BMFA 1KI1A 3P4XA 1CBUA 3FFBA 1SQ5A 3W8NA 1BYUA 4LYHA 3TGPA 2AK2A 1SGWA 2OCBA 3BH0A 1TQDA 1V5WA 3H0KA 4I1OA 4N0DA 4A82A 3K9GA 2IYWA 3K70B 1Q0UA 4AK9A 3NHAA 5GJWC 2XNDA 1B23P 2B6HA 2B7CA 1TNDA 1LF0A 4DIDA 1IXSB 1E1RD 1T3SA 4Q7LA 2ZRBA 1G3IA 3ZVMA 1XWIA 3E1SA 4V0NA 4Q00A 1VIYA 3Q85A 4JBWA 2KJQA 2WMNB 3E2IA 3ZVRA 3RRNA 3QF4B 1QVAA 1R5OA 3QPWA 3SNHA 2DB3A 4QJ3A 3UWOA 4KYUA 2JJ2D 4C4PA 1W46A 4KO8A 4IDOA 4DLTA 5CJPA 4Z8YA 2QUZA 4GBMA 2BOVA 3I8SA 5J4KA 4OQLA 2FSGA 2LCFA 2PH1A 4LSGA 4QHTA 1NL3A 4PC2A 4TMTA 3NBXX 4EKDA 5CLLA 4M1MA 3DMNA 4PPNA 1ETUA 1FQJA 1XPRA 1IN8A 2Z43A 2PX0A 4URUR 4BWYA 3CRQA 3NTUA 4LX0A 3QPUA 521PA 4UKDA 4DLSA 1K8RA 1C1YA 1AA9A 1Z07A 1Z5ZA 3HYTA 1TQ6A 1ZM9A 2F43A 1GNQA 4HZIA 5EXTA 4LOAA 1FQKA 2DWOA 4OYHA 4OI0A 4RKEA 3RS7A 2HT1A 3THXB 1R0XA 3OEEA 1KDOA 1R6BX 1XTSA 2C98A 2LKCA 4G5QA 2AL7A 2P67A 1YJ5A 4W5JA 5TB5A 4II7A 2VIIA 3OE7A 2OFOA 1GL7A 3VX4A 8OHMA 1S2MA 2WAYA 2QRNA 2VP4A 5L3VA 4O3MA 1UKZA 1RE0A 2PCJA 4WZAE 1XPOA 3NHBA 1GILA 1XJQA 1HY3A 2W2TA 1WXQA 4QFMA 3LH5A 1R0ZA 1Z0AA 3ZD7A 2QENA 4MDFA 4Q01A 5FL7D 5FR1A 2NMVA 2VLIA 4GSYA 3BJIC 5ANRB 5JHGB 5KNDA 1KMHA 1OH7A 1OPXA 4MKFA 4ZI2A 4LUCA 1CR1A 5CITA 5J5CA 5JWRA 3UWKA 1E0AA 4DUGA 2R6FA 2OZEA 2BBOA 2CVFA 4HLUC 5BN4A 2WICA 2J7KA 2VSXA 1TU4A 4FCTA 5EZ5A 3LXXA 3QQ5A 4BZXA 3EXAA 2DWPA 2D7DA 1HE8B 4NDZA 4D4KA 3CLVA 1OB2A 2B7BA 2B8TA 4OHVA 1W4CA 3O8DA 4QGAA 1HYQA 3PITA 3U2QA 2IYVA 5L3QA 1F2TB 3DMDA 1TMKA 4Q48A 4QM7A 4P3YA 4JVNA 1AZSC 3LRPA 1M7BA 5L8VA 2FGKA 4A4DA 1F60A 4MYUA 4XD7A 4NBSA 4PHGA 3ZS8A 4XVQA 1HV8A 3I92A 3HP1A 2MSEB 2REBA 1CRQA 3AKEA 4XWOA 1AKEA 2WJYA 4KSCA 4TQUS 1VG9B 2ODNA 3WY9A 2WWXA 4IDNA 1Z2AA 1RC8A 3H1TA 3KJEA 1YZUA 4M53A 3KL4A 4QNMA 1NKTA 2REXB 4FCWA 1E2EA 1SVLA 4I1VA 5IK2A 3TIFA 2DPXA 4H1UA 4MKHA 2I1QA 2QAGA 1LTQA 1NVVQ 1UBCA 5H1YA 4YDSA 1OIXA 1YR8A 4A8JB 3W6PA 3K70D 3OIVA 3TBKA 3I73A 1SXJD 5C18A 2FFAA 3RANA 2CDNA 1QRAA 4LYFA 4QC2A 5D3MB 4DB2A 2HJGA 2F1RA 4JLNA 4F7WA 2A5JA 2QROA 1N0VC 4JVLA 3DKPA 4XSHA 2ZRDA 3T35A 3QY0A 3SE0A 2J46A 2YWGA 1R2QA 3P4YA 4QGHA 5KSZA 3CO5A 2TMKA 1KSFX 4TLBA 4QBIA 2WJVA 2Q3FA 1U0JA 3CZPA 4OI1A 3RWOA 3K0AB 2ZRPA 1COWD 5JHHB 3ASYA 1A4RA 2IHBA 1E2LA 1T4GA 1Z6YA 2GCPA 4FMCB 2CNWA 3IPXA 1LS6A 5CM8B 1JBKA 3ECCA 2RHDA 4LYAA 1GDDA 4OBEA 1CS4C 1NVWQ 2EW1A 3L82B 3A37A 2NTYC 3GEHA 1NF3A 4E22A 1DBSA 2LKDA 4Y0VA 5DI3B 1KNXA 5EXXA 3TKLA 4MRSA 2ZI9A 1KDTA 2WAXA 2PT5A 4DC9A 1YQTA 1GRNA 3NWJA 1E0KA 3P27A 1Q57A 2FE4A 1NY5A 3T1OA 4Q1EA 1M1YE 4TSFD 4TYPA 2QP9X 1LNZA 2ZSDA 1G20E 4PQFA 4ZIRA 1JPJA 4M8NE 4BLRA 1CF4A 5JI2E 1OXSC 1W4RA 3VTKA 2RMKA 3BWDD 3NDBB 4KU4A 4G01B 5H8WA 5F9FA 3F8TA 4DVGA 4C0SA 2WJHA 4MYCA 5KSOA 4BE7B 3O47A 1OH6A 4Q1FA 4EPRA 4CDGA 3F3YA 2ZJBA 3R8FA 1EK0A 4FW9A 1UFQA 2YYZA 5EP2A 3BK7A 3KJGA 1XD2B 2XITA 4HLDA 4AY2A 4NH0A 4DEXA 1E2KA 2ZYUX 1RRGA 2FEOA 4LV8B 4Q7MB 1ZM3A 4C2TA 4B74A 3TR5A 1T6NA 1ZNXA 1JQLB 3HYRA 3E5HA 4JT4A 4URWR 4LZZA 2VSFA 2VHUA 3GLFA 4C0KA 3VMFA 4WZ6A 4LHWA 5C4MA 1G7CA 3A8TA 4Q4AA 5AJZA 3U3OA 2FPKA 2GETA 2O8CA 3OEHA 3OZXA 1PV4A 1T8TA 2NO6A 1IOZA 2G9NA 3CNNA 2FH5B 1VG1A 1QHGA 5JZVA 2CCJA 2XZOA 3WBKA 1BMFD 4EJSB 1HURA 3TQCA 3BFVA 4LJ4A 1DAHA 1KI9A 4GP6A 2WVJA 3C7KA 1QHHB 4DLRA 2OBLA 5AJVB 1OKKA 2O52A 1XJ0A 3U6KA 2FG5A 5KOYA 2JLWA 4QM6A 2ORWA 3B78A 4RZUA 4G0NA 4GZMA 4HB0A 3Q72A 4QJ5A 3WHKA 2IC5A 3Q9LA 4BFVA 1VECA 3THWB 2QAGC 4TSFA 2IA5A 2V7QD 4IRUB 1G6OA 3RLFA 1QHHA 5FTMA 1KJWA 4Q21A 4AI6A 2WWIA 2IEZA 1H8ED 2FPLA 3L8YA 1TPZA 3MWLA 3LWNA 3PUXA 4RFVA 1T5LA 2WZQA 2XNSA 1OXUA 1TF7A 2NO1A 1E9FA 2QP4A 4ARZB 1Z06A 2QY9A 3LX5A 5KHOC 2EVWX 1EWQA 5CIQA 4DIEA 3EZ9A 3EZ6A 2W2VA 2QTFA 5FBVB 1KY2A 1WA5A 1YZGA 3QVVA 3AGPA 3EZFA 2QRZA 1T91A 4Q5IA 1U99A 3K53A 4OHYA 3GLFB 1YKSA 3W8RA 1N25A 1LF5A 4B75A 4NONA 4U5XA 4WAUA 1I4DD 2OO7A 3W34A 3EA5A 3S1AB 2IXEA 3P1JA 1NSFA 2JAQA 1P2TA 5L3RA 2AWOA 1AQYA 1YZLA 2PBRA 3LW8A 4V0LA 3WYAA 1M34E 3NXSA 4E5UA 1VDZA 4C0AC 3CF2A 1Q1EA 1GSIA 1R0WA 1L4UA 1NLFA 4Q1DA 4HDCA 1YE8A 2JDIA 2H1LA 1KK2A 3X1WA 3ZQ6A 3AEZA 3A4NA 3BC1A 4IXMA 4TWZA 3TR0A 3BIFA 3KXLA 5K8LA 3A4LA 2FU5C 4MGZR 3QXSA 2QM8A 1M74A 3B5JA 4K81B 3SR0A 5F2EA 1RPZA 1G7SA 2HF9A 3MWKA 2IS1A 4IVPA 4FMBB 4TLDA 1UBEA 4D4JA 4JKYA 2X2EA 1Z6AA 4FN5A 2F7SA 4C0JA 3KKQA 3VFDA 4Q7KA 3A58B 3I5YA 4PC7A 1XMSA 1CJUC 2GESA 2YNMA 3ONWA 4M1TA 5DI3A 4POAA 1D5CA 2CLSA 3WNCA 2BMDA 3LVQE 3PG5A 2YVUA 3U7GA 2R44A 2DYKA 1RJ9A 2JATA 1NNEA 3WMGA 3W6OA 3U7HB 1KSGA 1N0UA 4NCKA 2C04A 1YZNA 2Q21A 2UVQA 821PA 2AKYA 4XD7D 2RGBA 5HTKA 2GA8A 5KTYA 3AV0B 1E98A 1RVDA 4P4SB 1E2FA 1F3OA 1SKYB 4P0TA 4Q9HA 4YDHB 4PPGA 2CL6X 4PSAA 5CDFE 4L5BA 5KNCA 4XWKA 5FUVA 1PLJA 1GRRA 3BOSA 1ZIPA 4BFXA 4WXPA 4DCVA 2MMGA 3TVDA 3T34A 2J0SA 1HA3A 1ODFA 1PUJA 3NH9A 4ZDIA 4NYJQ 3B60A 5B30A 1DE0A 2ZS8A 3A36A 1RKBA 5GVRA 2AR7A 2A5YB 2XSZD 4DLUA 4RY2A 3R20A 2V7QA 4I81A 2VEDA 5JSZA 2QAGB 4HSEA 4XSGA 5B2ZA 4M21A 3DVLA 1UM8A 1JEEA 1F2UB 1NN5A 3B8HA 3KX2A 4P4SA 4WZBE 4B43A 5FTKA 2BKUA 2YHSA 4PAQA 3N2EA 1E4YA 1HQCA 2AWNA 4MRPA 1FUUA 3TLXA 4JSTA 3IGFA 2VHJA 3GCGA 4OK3A 4PXAA 5EP1A 4G1UC 2CEAA 3RS5A 4DDUA 3KUCA 2JLUA 3IQXA 4LJ9A 2XB2A 1P61B 4YQFA 4CEHA 3U3MA 4UQOA 1FP6A 2QGZA 4PPFA 1S96A 1WF3A 2XTMA 5EXPA 3MLEA 3EPJA 2AXPA 3T5GA 4B3FX 5LPNA 5C4GB 4KODA 2XZLA 2PLRA 2V55B 4A2WA 1ELOA 4TL6A 4CEIB 1L8QA 4F4IA 2GDJA 3TUZC 4DZZA 2ZVQX 3HJNA 2IS2A 1QHYA 4AURA 3HDTA 2WM9B 2H5EA 3ZZTA 5KNBA 2ZJ2A 5FOUA 3IILA 4IHQA 2F1IA 3X1ZA 1CRPA 4Q66C 1P62B 5DE3A 2XOKA 1T3LA 2RGNC 5FUYA 2NOAA 4Q9IA 2HEIA 1A2KC 2ZUDA 4KYIB 3MG9A 2OAQ1 2BCJQ 1CP2A 2X1VA 4PHTA 2Z0MA 3CX6A 1E9BA 4I99A 5FI0B 1KO5A 3HPRA 2RCNA 1W49A 2P0EA 3PR1A 4MGYR 1VPLA 1E9RA 1IJFA 2J5XA 4OJQA 2D4HA 4G5OA 3MFYA 2GEVA 3QG5A 1WE2A 1UPTA 2RGDA 3TQFA 3L43A 5FPYA 3PFIA 1I2DA 1JECA 4BZPA 2C96A 4TMZA 4UNRA 4L9SA 1E79A 1R5NA 3F5FA 3QOFA 4ZDKA 3PUWA 1S9DA 1Z47A 1GL9B 4B6FA 2A5FA 3DPUA 4HATA 4HDOB 1Q20A 3EWSA 1S3SA 3SDZA 1IONA 2GEUA 3I1FA 1SXJE 3AUYA 3OHMA 2IF2A 5CYOA 2V6JA 1KYIA 1XJCA 1EG7A 2PLFA 1KMHB 2R6CA 4WW0A 3VX3A 4PR0A 1E1QA 2W0SA 3IO5A 3B9PA 1OF1A 1XB2A 3CR8A 4RZXA 4KSBA 5KO2A 3K0CC 3KB1A 1HH4A 2LWIA 1W0JD 1N6IA 4PAOA 3T61A 2GVZC 4IVQA 1TTTA 2GXAA 3NBZC 4M9ZA 2FGJA 3TVTA 5ELXA 3U44B 5GJCA 1G8GA 1PJRA 3CONA 2XXAB 2NZ8A 1KI8A 2P65A 2JLSA 2GCOB 1DAKA 2JIZD 4DLVA 1OKKD 3UG6A 1GL6A 4OI4A 3ZD6A 4ZCLA 4PZLA 2OLJA 2ATXA 4RSGA 4UJ3A 2H16A 5K8TA 3MD0A 2PZEA 2D06A 3OESA 2YINC 1R8SA 2HXYA 3AF2A 1N2CE 2R6AA 1FW6A 2GF9A 4JS0A 3THYA 1UDXA 3SEAA 3AM1A 1D2EA 1RYFA 4DT1B 4TMKA 3I61A 3D6TB 3PEUA 5FL7A 3AP2A 4ARZA 3CKLA 2VA8A 4XIGS 1XXHE 2QQ0A 2ZI4A 3GFPA 1HQYE 3FMPB 5TXGA 4IOKA 4TYYA 1N6NA 2P5TB 1H8HA 3AQ4A 4UNSA 1NMZA 1IY2A 4GFDA 5EUMA 5FBQB 1H65A 4B76A 1G21E 1KDRA 4X8MA 4LPSA 3RSLA 4ESHA 1RFLA 2OXCA 3GLIB 1KI6B 2CHQA 2AK3A 1QZXA 4NCHA 2BKEA 5FOWA 3TSWA 2IXGA 1E9AA 1CR2A 2SHKA 5GVSA 2AXNA 4CIDA 5BXQC 2W58A 1KK0A 3TE6A 4B3XA 1KKLA 5G3ZA 2JLZA 1ZU5A 3B9QA 3SU8A 3A4MA 4M1OA 5JMTA 1OYWA 2ZSEA 4QGGA 1NP6A 4A0GA 1X8LA 2GF0A 5AUQA 2BEJA 4X8OA 2RH5A 3LW7A 2HT6A 1Z0KA 2BWJA 1WB9A 3W9YA 1SVIA 3GLIE 3MAAC 4F91B 2JJ2A 1XU4A 1E9SA 4ZCMA 1J70A 1D9ZA 3TH5A 1FX0B 2XJ9A 1TAGA 5G53C 2C9CA 5KU1A 3C5CA 1U0LA 1GKIA 3TAHA 1QG4A 1WRBA 3MSXA 3ZH9B 1P4SA 1E9CA 2NZJA 5CDFA 4QOSA 3GEEA 1EX6A 221PA 1EXMA 3GMTA 5D3MA 4DLYA 4YMUA 4HAWA 4BFWA 4O25A 1XCPA 5JRJA 2ZJ5A 3W90A 1OFHA 2ZR9A 3LFUA 1VYUA 1IXRC 1KI6A 2O8FB 2ODEA 5LDDC 3RRZA 2FX3A 2IT1A 3IHWA 2FEMA 5HR5A 1E4VA 5HZHA 4EAQA 4HAUA 4BFUA 4KI0A 4HYYA 1XEXB 3BXZA 4KFRA 3SJBA 4K8OA 1N6OA 3ZQJA 3NIBA 2HF8A 2QBYA 1JNYA 2WPDA 5DYIA 2ZPTX 4RZ3A 4NYIQ 4HUTA 4Q7JB 2NO9A 2QMEA 3LV8A 5F3WB 1KO7A 3L0IB 3TUJC 2ZRHA 3FE2A 4GP7A 1ESMA 2IYRA 1XXHB 1VCIA 4LHYA 4EPTA 1KIMA 4P4TA 3LVRE 1ZNZA 2HV8A 3PUZA 3RS2A 1QF9A 4Z54A 3L8ZA 3M0EA 4LK2A 1Z0JA 2V8OA 3BGWA 3GJ6A 4KHZA 4AG5A 5JECA 1JR3A 3PEWA 4XJXA 2OUKA 1TQ4A 4X8LA 5SZKB 3HU1A 2VF7A 2EWVA 3WYGA 1BKDR 2REOA 4IVRA 1XTKA 4D25A 1Q21A 1X86B 1S1CA 1ZINA 1Z63A 4PZYA 4V0KA 3FB4A 4W9MC 4DLWA 2YWFA 3KQUA 1Y63A 2QM7A 2XB4A 1B0UA 1FUKA 1RIFA 4GMDA 1Z22A 1OFUX 1RYHA 3KKMA 1EGAA 1DAGA 1W44A 5G3YA 2CMKA 3RRMA 1LW7A 5G41A 2QGNA 4JMPA 4W7SA 1OH5A 2ZE5A 4JLKA 3REFA 2ZYVX 1G8FA 2GK7A 4V03A 5FL3A 3ZIAD 2OEPA 2HXSA 2J0QA 5IT5A 2QTVB 3BB3A 1ZP6A 2ZR7A 4Q4HB 3VR6A 4L15A 4V0MA 3DO6A 2G1KA 3KQHA 1Z3IX 1DAIA 3RS3A 4BLPA 3GJXC 2KB0A 2O5VA 3ICEA 4M2LA 1CJMA 2H17A 4F92B 2IK8A 1FMJA 1ZYUA 2WHXA 5E95A 1KAOA 3EIHA 3GQBA 2EYQA 4MRNA 2CJWB 3A1VA 2ZRIA 1M7HA 5SZIA 3WP1B 2GXQA 2W6JA 2ZRNA 3TSZA 1U98A 3QUSA 4BLTA 3I32A 1EFCA 1ZNYA 4PHFA 5AWFC 4DCUA 2RGXA 4EJSC 3DHWC 5EE9A 5LD2C 4YMTA 4JL8A 1T0HB 4Q4LA 4BFTA 4DSUA 3PEVA 5IF9A 3LA6A 3TMKA 1NIJA 5FBRB 4HLCA 2CHGA 1CR0A 2F55A 2ODWA 4V0OA 4Q4HA 2J7PA 3AVPA 4NU0A 3ZVLA 4D4MA 4WA7A 2GTPA 1E32A 1Z2CA 4HZUB 3QF4A 3ND8A 3AKDA 3VHLB 2BMJA 1YR7A 2ODBA 1TL7C 5CM9C 2CL7X 2DFLA 3CF0A 5H68A 1COWA 1U8YA 4QBHA 2YWEA 3CB4A 4QGFA 1ESNA 1E2IA 3EIEA 3MMPA 2ZRFA 5DHAA 4XTCS 2QSZA 3DKVA 1KKMA 4M1WA 5JBQA 1KOFA 4TTQA 1DO0A 2ZU6A 3UKDA 1T0JB 5C46F 3PXGA 1E1RA 4EPYA 1ZM7A 3OFND 2JEOA 3N70A 2BMFA 5KPDA 3QENA 3DL0A 1G16A 2QE7A 3FPAA 4BASA 4WBSA 4RFSB 4JLVA 1MR3F 4DCNA 3KKPA 1MO5A 4ILEA 2MSDB 1IBRA 3GJ8A 1TUEA 2B21A 3AVQA 1O3YA 1G19A 1XEXA 4ACBA 4KCGA 2VQSA 2W0MA 3CF6R 2E9SA 1P9RA 4CEJB 4BFSA 2Z6VA 4LYJA 2ATVA 1UEIA 3NC1C 2V4ZA 2O8FA 4DB4A 2DFKB 1G8YA 2GZHA 3NBYC 3PIRA 4GOXA 2OLKA 3I3SR 2Q6TA 2KBFA 4TYQA 2IW3A 4LDJA 2ZRLA 2FJUA 1E69A 3AVYA 1Q12A 1UJ2A 4MITA 1DAMA 1MO6A 2FSHA 4RKFA 1ONBA 4E09A 4JLBA 3CPJB 1WBBA 1SVSA 3GLGE 1N6HA 3QKSB 5FPKA 5IRCD 4KBFA 4V02A 1ZJ6A 2WKQA 5IDVA 1HT2E 5KYKA 4E07A 2J0VA 3QXCA 4LHZA 4AYWA 4IEIA 3NBFA 3RSOA 1E2PA 5FTNA 3OEHD 1U8ZA 4C3ZA 5K8IA 3PUYA 2EYUA 1G6HA 2QMHA 5JJLA 3T1QA 2IEYA 2JJ1A 4RJLA 2QZ4A 2ASEA 2ZSAA 3LDAA 1OFIA 2IWRA 4P31A 5HKKD 4OQXA 2YOFA 2HDNB 3DOEA 1LS1A 5BN3A 1II8B 2XAUA 1U81A 1AIPA 1E99A 2WJGA 3BRWD 4R2IA 2A7QA 2OE2A 3U5ZB 2G0TA 4URXR 4PO9A 4MDEA 2D74A 3FVQA 4TYWA 1ZC4A 3H86A 1SZPA 1E2MA 1X1SA 2GZDA 1Q1QA 1T5IA 1TUIA 5E7JA 2ERXA 3KQKA 1DAEA 1G5TA 4TLCA 1XF9A 4KXFB 2O8DB 2GKSA 1E0JA 1MV5A 2GRJA 3GFTA 1ZCAA 1CR4A 1GTVA 4GT1A
chains in the Genus database with same CATH superfamily
1UBJS 1N8KA 2HCRA 2VA9A 4S2UA 4PO1A 5DO9A 4O4JB 4EMTA 2EJVA 1LCIA 2PMFA 5FKJA 2Q9BA 1U0SY 3DXZA 2D62A 2ZSHA 3AL3A 3GJ5A 3HWRA 4AN0A 1KBOA 4L4UA 1YT5A 1K66A 1JYEA 1ZUHA 2M1ZA 2PMBA 3OX4A 4UHFA 3CWZA 3Q1KA 5CXXA 1L5NA 3QKTA 1PUXA 3J81k 5K3AA 3MYRA 3UNXA 1OBVA 2PPVA 3WADA 1NVVR 1G8HA 1QQTA 2XWBF 2FP4A 2ZUSA 4FUTA 1HO3A 5LQNA 2GNOA 2ANBA 4Y6PA 4HUJA 4K0KB 1RJGA 3R0VA 2CFCA 1VKJA 3H4VA 3OO0A 4A6XA 2J3EA 5DM60 2ZM6B 4CLOB 5BMVF 2JB9A 1FPMA 1EDEA 4RJJA 1J9GA 1L5WA 5BNTA 5CK4A 1JTVA 1YBAA 2EFDB 2P6NA 3HS3A 1NQUA 1JR3D 4G65A 4LN1A 1ADFA 1SHTX 1YU6A 2WE7A 4CEJA 3NGLA 3GI1A 1RI3A 4KWEA 2DQ4A 3U44A 3FRHA 3QY9A 5BN5A 5FOSA 4PAMA 1S3GA 4ID3A 4X95A 1JTFA 2Z83A 3BERA 3DD5A 3EA0A 3H5RA 5KTTA 4K86A 3SS8A 3U81A 4R71A 1CR6A 1CYEA 4YJ2F 1VI6A 1Y89A 3P0EA 5U4QA 4ZDJA 1D2NA 4J6EA 1VMIA 3UHOA 4RAOA 1A9SA 4KXQA 3KVOA 2WIKA 3BXXA 4GZ3A 2DT8A 4FMCF 3T9EA 1GUYA 1IAQA 3JY6A 2PZBA 4XB1A 2KS6A 1N2SA 1QNFA 1NBEA 3OF5A 3CNOA 3B6JA 5BT9A 5LZ2A 4FNAA 3SAJA 1XZHA 1MOZA 2RG1A 1RABA 3KOOA 1I5RA 4CEHB 4CTMA 5HUJA 1ZUD1 2CMGA 3A6PC 1PFWA 3DZIA 3OMWA 4PFSA 1FMCA 3WGNA 2D0OB 1SC6A 1ST2A 1CVRA 2ZE6A 4RETA 4BKMA 1IVSA 1EEHA 2C2GA 4FT4A 2A78A 3JQ9C 1WDTA 2Q9CA 3BZWA 2WAMA 2VJPA 1IJKA 2REQB 3PT5A 4OH7A 4P32A 4RF5A 4E4YA 4HV4A 3DOCA 2DFTA 1KZ1A 3K4PA 3N59A 4LGMA 1EK1A 3GFOA 1L3IA 1PQYA 2R7AA 3NS7A 4JP2A 4LOKA 3ZXYA 4C6HA 4GUAA 2ZIFA 2NYVA 3D5TA 2WBLC 1SD1A 2W43A 3M2TA 3ZZUA 1GPH1 4I1UA 4QDOA 1PI3A 3TQIA 3GFBA 1R0BA 3DCNA 1VSBA 3R76A 2WTMA 2IE8A 4ZIRB 4IEFB 2JEZA 1E96A 1QKIA 1C1XB 2OBFA 1D4AA 3MJRA 4Z9BA 4TQ9A 3WO1A 1V8ZA 1ZK0A 2R65A 2JGJA 1TA0A 2HYDA 2QL5A 2QRJA 3N2NA 4YRLA 2CNNA 3H9CA 4PIPA 4BNZA 5E4FA 1T43A 4JMLA 2UVDA 3EGVA 1E7MA 2CMHA 2CXNA 1UWLA 1XMPA 4FINA 4MQLA 3PNPA 4O1MA 1KK1A 1MIOA 5M3BA 1TQ2A 1P29A 3DAYA 3GVPA 3OTHA 5AK0A 2HR1A 1Z4IA 2OHHA 2CW5A 4MWEA 4OUDB 1P1FA 1XG5A 5BN1A 4CCYA 2IEAA 4RPGA 4H4EA 2HHLA 2OFWA 5C0OE 4HH4A 4D9IA 3VR5A 4UAJA 5KSPA 2HJWA 4QULA 3QWBA 3L5KA 4AG6A 4ISBA 4MCJA 3PQ3A 4PRYA 4GE3A 3JQ9A 5AI9A 1BO6A 2Q1WA 4FMDB 2FZ4A 2Q45A 5E0OA 4EYEA 1FUEA 4WKBA 4FYWA 4OQZA 3R5HA 4L51A 4H3HB 1OU0A 5TVKA 4JQYA 2QTVA 2CXPA 2WQZA 3W5CA 4IIYA 4B80A 4ZRNA 2XXBA 3DMPA 3FUVA 4LHXA 2SKCA 1WD7A 5AHKA 4C9BA 5CCXA 3PLRA 1WIWA 1LNSA 4O4LB 3S7TA 3L7NA 5IVPA 2H1RA 5H0IA 3PD0A 4EQ6A 5HIAA 2XD4A 1QNLA 4DM3A 2R4UA 1LDEA 3H6HA 2BEKA 2ZAOA 3HKCA 4NMLA 1XGKA 4WASA 4XWTA 3VSAA 3KBBA 2I03A 2WU4A 1M33A 3NDPA 1XNJA 1S0UA 2C77A 4NMMA 3C7AA 3K8YA 4NFHA 1JW9B 3U31A 3R9WA 1WZIA 3T4EA 2H8KA 2ZQYA 1SCIA 3KDSE 2BR5A 1J5PA 3SEFA 5LBUA 1PNOA 5CVVA 4YREA 4E2YA 1G21B 3OQVA 1W4BA 3DMFA 2VKTA 1EXNA 3IEUA 1YONA 3OD1A 4UM5A 4EG8A 4UPEA 3H87A 4R6XA 5L40A 4KOAA 1A95A 1NPYA 5HKKA 3EXFB 5ES4B 1KJQA 1SC1A 2ZIXA 4O4JF 1RWMA 4GBGA 4EPWA 2W83A 1S2NA 4K88A 3R0JA 4NPHA 4MVJI 4HNQA 4CF4A 5F7OA 3HNPA 3ND5A 4CFSA 2YHAA 2GHIA 5A2GA 5K99A 3NIDB 3U49A 3D6JA 1PU2A 1TTQB 1YK1A 1MC8A 3JWIA 4IXDA 4FFSA 3TTUA 1RZ3A 4OHRA 3K72B 5FUXA 3G0CA 3PFFA 3HKBB 4B3TB 5FPQA 3K0EA 2IU4A 4M1YA 4NMHA 3TG2A 3IJPA 4NHOA 4MHSA 4OFBA 4PG6A 3MFQA 3D6AA 3RB8A 4V1CB 1CLUA 1H5QA 2P27A 3COSA 3F5SA 2I22A 5EY5B 2PKXA 2QRPA 3F6BX 3Q3GE 1D8TA 2ZXEA 1C8VB 1P75A 2F3PA 2I7VA 1RQRA 1HZZC 1YL5A 1C3OA 1YFKA 1EX9A 3VR2D 4ABTA 5AM2A 1S2GA 3BZUA 5TR9A 1NUAA 3WBFA 2OXTA 3GLKA 1FJHA 3K6RA 3NIWA 4Q34A 3WE7A 4EG5A 1A0OA 3UMGA 1KY3A 1RWKA 4H6WA 4QATA 4UBJA 4YCAA 5EJAA 4CT4B 2QLJA 2AX4A 2YWDA 3E15A 4K6MA 4DFDA 1T8YA 1QMGA 1YB2A 3Q5DA 3QYAA 4BX3A 4NNJA 4QHYA 1VCOA 5JPCA 2XDAA 5JIBA 1LB1B 1FMTA 2XGGA 4FWIB 3W8DA 3BL8A 1MCZA 1NDUA 2NSJA 4E5MA 5A6VA 1A8SA 1AS0A 3O4IA 2FPGB 1IB6A 4UVEA 3TEFA 1HNNA 5BO5A 3V8NA 4DT1A 2YXBA 3JQGB 3AR6A 1P60A 2J4CA 1R8YA 1MV8A 1WPXA 1YQDA 2Y1CA 3C3EA 3H0CA 4I08A 4JJ8A 3TFWA 3VDMA 1M8JA 4O2LA 4ZICA 1UBUS 3IQIX 1P4HA 3AF0A 2FRDC 1BJTA 2FMXA 1WV0A 3Q41A 5HDQA 4YCLA 3M6FA 2CB0A 4O02B 5K3EA 1QFZA 3CUWA 1O97C 1OLXA 2QXTA 5DH9A 2NZWA 3B36A 3JQGA 3PKZA 4C30A 3EMVA 1V35A 4WNYA 1NW8A 4G9EA 5T4FA 4I2NA 2BH9A 2CLEB 2WYIA 4M83A 4CR7A 4UTRA 2WMDA 5FNZA 3TFOA 2F3RA 2OAGA 2Z3ZA 3H2ZA 5AJHA 5FA8A 5FCDA 2JFQA 3F90A 1A8HA 3P2OA 4REOA 1KEWA 4RD2A 1A4XA 1DC4A 4PTLA 2ZZMA 1DXQA 4I4LA 1YKFA 2H52A 5ENVA 4GNRA 3ACBA 2QVZX 4L1KA 1IN7A 2Y67A 3P97A 1Y9EA 2JAWA 1E9EA 3IHLA 3ADKA 4N5NA 1AC5A 2B92A 4HGNA 4K7JA 2CXOA 2V7UA 3BX1A 2ZANA 3NALA 3TLMA 1ORHA 4PQYA 4R31A 3A04A 3BFPA 3ADBA 3OKCA 5CX4A 3GN1A 4CLRA 1Y5RA 3O9MA 3DR5A 2GEBA 2W4QA 3VR6H 4IKOA 2JGRA 2PS9A 3TTXA 4KR9A 4A92A 1FYVA 4RKQA 4L7VA 3ZWWA 4B4OA 2E82A 1UT8A 3KOXA 1G5PA 4B17A 5D5HA 5FR2A 2C9YA 3WP0A 4EW6A 1G18A 2OM2A 3DD1A 3ITEA 3MIIA 5FPTA 621PA 1G8MA 2H1IA 2XQIA 3E1KA 1DOHA 1K2WA 4HG2A 3FKSA 5J1TB 4C4XA 5IKXA 5CVEA 4P34A 4ZQGA 2WP8J 1N5DA 2PD3A 121PA 3CFYA 4I1SA 5EPUA 3RIYA 4IKPA 3CNLA 3ESYA 1JAHA 3L46A 2X6QA 2B7LA 2WT4A 1EWTA 3V4PB 1E5XA 9LDTA 4YR7A 1HETA 3K94A 2Q2NA 4AKTA 5HVNA 4KACA 1ZRNA 3R3ZA 3SIXA 4MHTA 1W25A 1N6KA 1ZGZA 1NFFA 3MILA 4P5PA 2XDQB 5CLQA 3AI7A 1HR0B 3K2IA 4EL0A 3MGKA 1ECLA 1MABA 1G21A 5MDHA 1ULBA 3OTWA 2FWRA 2I8CA 4ENPA 3FPGA 3HRHA 3IQWA 3N3AC 1VLLA 2DKNA 2YV1A 2EBFX 2YXEA 3LUHA 3LY9A 3A1WA 1QH0A 1KYVA 4E2WA 1WMAA 4FGJA 5G02A 2J7PD 2QSUA 3B2QA 4MUGA 1HFJA 1UMDA 1YR6A 2IUEA 4WDRA 5COBA 3ZHZA 5BW8A 3EE6A 1L8AA 2Y2UA 3JVVA 3QA3E 4JBXA 3NP7A 1FMFA 1D1QA 1F0PA 1V4VA 2LP4Y 2QTNA 2GM9A 4F9TA 3EFOB 4NE2A 4G63A 4DANA 3ANNA 1LV7A 2XTJA 3AW8A 3KOUA 4M9QA 4ER0A 1W6UA 3TD9A 5LUAA 1XCOA 5B1EA 1LFAA 2CXXA 4MNTA 4I3FA 1J1IA 1L3CA 5FRDA 4B7ZA 4F2DA 5BMVA 3TSYA 3ZWVA 4EARA 5T7BA 3QPVA 1OROA 2E89A 2SECE 2H2GA 4L8VA 5DK4A 1SHZA 2NG1A 2XQKA 1PJ3A 3HJBA 5HE8A 1ZMXA 3ERCA 3QELA 1GKUB 2GPBA 4LXIA 2JCXA 4JNKA 4US1R 4WKNA 2J5BA 1B00A 1PWYE 3B85A 3I2FA 1XMOB 4MA5A 3KXIA 5AICA 1UXJA 4TN1A 4U9HS 5JSFA 4P80A 3UUEA 1GGHA 1KSHA 3C8UA 3CRMA 1L7VC 1X1DA 5ERXA 4F4UA 5HTOA 5KDDA 4HB3A 1QHIA 4XR9A 1EJ6A 4LY6A 2C5SA 4YRMA 1J0EA 2IHJA 3K0AA 4INOA 3SQWA 2XDYA 2CSXA 4IW3B 3SR4A 1WB6A 3L0ZA 3FVVA 5DU2A 1XRNA 1US8A 3NJ4A 3MPUA 5IJAA 2FPMA 1C7EA 1TRKA 3FTQA 4HBGA 3I23A 2VO1A 2IUYA 2G04A 1QIKA 5SV2A 3EPKA 2EHJA 1U90A 4I55B 3CURA 4DXHA 4JZKA 1EHCA 3OPQA 1JEDA 2WOJA 1LJUA 1DFHA 4F4JA 3B7WA 5J2UB 4HSGA 3GRPA 1JA0A 3OTGA 5FUBA 5FQOA 1Q3HA 1A4IA 1ZOPA 3BAZA 2VP9A 1OIWA 4MPPA 1J33A 3JVUA 1FQOA 5HEKA 4J0GA 1RHJA 1KO8A 1USKA 4FD2A 4LMPA 2MSNA 3BFKA 5LC1A 3RGGA 3ZWYA 2G77B 4CRWB 4BLUA 1NN3A 1QTNA 2YOGA 5H80A 1XQ9A 4G4JA 2QIPA 5AVKA 3FH0A 3H17A 4EFKA 1X42A 3A9VA 4Y8VA 4OP2A 2CE2X 3SLRA 1ZUWA 4J03A 3F7TA 1RPNA 2FPPB 4BO1A 3LY7A 1XZ8A 4RMGA 4EATA 4ER3A 1SUCA 2Q46A 2ISQA 4LRWA 3WLHA 4BNXA 5K51A 2FI1A 3B7GA 3O8LA 4CQLA 5BR1A 3PDIA 3IOBA 1M2EA 3LYHA 3THXA 4FEYA 5FQNA 3WWPA 3PNQA 2JBAA 5DULA 2O14A 2Y0BA 2I7DA 3G59A 3OEYA 4RF2A 5CVDA 4UMDA 1RQLA 2UKDA 3DAFA 3G7NA 3HDQA 2BCGY 1BXGA 4MDYA 4P7GA 3VOAA 2ASVA 3WZMA 5J4LA 4WADA 3X1DA 1R8QA 3C8DA 3JQ6A 2JFXA 2FEAA 1ORIA 3RJZA 3UJ9A 3MJVA 1CRZA 2DBYA 3ENVA 3JQAB 4NESA 1ULSA 4UJ5A 3HUDA 2Z4SA 3DWIA 3WNDA 3LNCA 4ZI3A 4NULA 4CF7A 3DVSX 1X0XA 3DLCA 1I1QB 2WMOB 1MO3A 2IZ0A 3KAQA 3SICE 2NZUG 5GWXA 2HCBA 2A3RA 2XRYA 2E4WA 2VQ3A 3EZ2A 4IV5A 4NS1A 4L78A 1WCV1 4UHEA 4UUAA 1DTWA 4H0NA 5BPFA 2PZFA 4RA9B 2OXRA 4AKHA 3A1SA 3DC2A 1EEXB 4CDRA 5I7FA 2C57A 2XWQA 1T29A 3EXG2 4EHAA 3OPNA 3QOYA 4GXNA 4M99A 3QMWA 1NFQA 4ASUA 3TUIC 4S1VA 2IUSA 2I4MA 4L2IA 4ZU1X 3HV0A 1IZ9A 3E8XA 4WFQA 5JJ5A 1SIUA 4M8KA 4FCCA 3LGSA 1JJIA 1VIMA 4AY6A 4JL6A 1VC2A 4RACA 3UUGA 1QF6A 3T3OA 3K0FA 2BONA 4QYXA 5EG5A 2OC9A 3O31A 2HN9A 4HJRA 3RU9A 3BEOA 2QD5A 3I39X 1UF9A 7REQB 4TMWA 1R6XA 4NG4A 4EUNA 1Y4AE 3R3WA 4MR7B 1V11B 2QQFA 1GD1O 2XVZA 1X1BA 4MWZA 3U4CA 3RADC 4Y98A 2J3DA 1UZAA 3H5NA 3INNA 2ZS7A 4G0PA 5T57A 2Z09A 3NHZA 4JI0B 2A1TR 3WO0A 2RBEA 1VLMA 2RBKA 1L5QA 4OXNA 3DBRB 1ULZA 1EUZA 4R5MA 1R00A 1KK3A 1T2CA 5KVVA 3WHLA 3KQVA 1P18A 3M5CA 4G4GA 4D6PA 1KFKB 1IXZA 3LTNC 4BQPA 1CPYA 4PWYA 2VL7A 2PJZA 3M70A 5DYWA 4B47A 1P8AA 1Q84A 2RHOA 1EFRD 1KTVA 1L2TA 1M2VB 1P2UA 3HEAA 5AR1A 3EQ9A 1G9TA 3SMQA 1GT91 5C9ZA 5IYZB 2FPIA 1V4BA 2QR2A 4XJVA 2ZJOA 3ZR4B 1KEEA 2K2WA 2JA1A 3H7AA 4JLOA 3L6OO 1E94E 3FOCA 3BSYA 4J2TA 3T54A 1L4HA 5E4JA 3ANYB 4QUDA 2FPRA 1DINA 2PT6A 4GMXA 3OU6A 4BNUA 4AIIA 2X0RA 4QTTB 1ZIDA 4QXMA 5DV9A 5LOVF 1T1JA 1QDEA 1KZ7B 2D2VA 3P9PA 1JEJA 1JF8A 4B2PA 2J3MA 3F8WA 3DWGA 1JQKA 1NUPA 1I80A 1O8BA 2AQHA 1PDVA 5ALDA 2N42A 1XZIA 2BTQA 2WA2A 3M33A 4N6NA 3G85A 4UBLA 1IHDA 2O0JA 4X6UA 3CVOA 1USVA 3ECAA 4F4FA 1U3GA 4YMSA 1MKYA 4B3RB 4QFCA 1G66A 4MVJE 3S2GA 3RRBA 1EHIA 1O6BA 4DHWA 3A2MA 1RMYA 2IIQA 3WLSA 1I4TD 3H1PA 3Q2IA 4XYGA 3GNTA 3K0HA 4COKA 4D80A 2X8JB 2ZU0C 5F1PA 3WK6A 1QJ4A 1XTRA 1VIDA 2FR8A 1NXOA 3U7IA 3VC1A 3D2AA 3K09A 1U7UA 1Y3HA 4KGXA 4OL9A 4QQNA 1E0SA 4Q82A 3R9KA 2G9UA 3UFBA 2AUNA 2HTFA 4C29A 1ODIA 4IJVA 4F2GA 3TF5A 4YMHA 4NECA 3T6KA 4DABA 1LPSA 3KG2A 4G8CA 1XEWY 2H29A 3R8XA 1LFDB 1MW8X 2AZXA 3O93A 3CLUC 5ITVA 2HQOA 4UMVA 4MKGA 3FLMA 4W6QA 4YAWA 5IUJC 1ZWKA 2KQUA 5EQDA 3RYFA 4KR7A 1AQUA 1XZCA 2V6GA 4I36A 4WESA 2FN7A 3LOUA 3LUDA 5DSTA 4DMCA 1P3DA 2ECQA 2XZDA 3EVNA 3R5XA 4ZQEA 1TJ3A 3U3JA 5CDGA 1SG9A 2WJIA 4U7JA 1WXHA 4FDMA 5BUSA 1FLVA 4YT2A 3PEYA 3GROA 4Z3KA 2NO7A 1RZRD 4CDMA 2AXEA 3I45A 2I55A 5FWXA 1PGOA 4GGPA 1G291 1SU8A 1QPZA 4F60A 1T36A 1O94D 2QMUA 3D7NA 3NQ41 3B48A 4FI3C 1MENA 4B0OA 3P9YA 5DN6A 4H18A 1YI8A 2YBEA 4TTIA 3ED5A 2E7ZA 4TLLB 1QS0A 2PWZA 4P0PB 2HJSA 1Z0DA 5EMMA 2PO7A 1KZ6A 4WIAA 4BAUA 5F78A 5J40A 1M5UA 1R4ZA 2OD9A 1ZXBA 5JZMA 2F3TA 5CDTA 2VYQA 1QYRA 4Y9UA 5AJXA 4H1TA 4E2ZA 2WF7A 2B30A 1GUAA 1I13A 5A4JA 3FPHA 1Z6XA 3CRRA 5FH9A 2V3CC 2IOHA 1MB3A 4WLNA 4DYDA 3RKUA 3HY4A 5T4BA 4CCWA 1ZH4A 2QZSA 3PHLA 2VR1A 1XD2A 1ZKDA 4R41A 4EFDA 4WOCA 4BMDA 1K7SN 1JHUA 1L7OA 1R10A 4S2EA 2AFIB 1NGSA 3ME5A 4EVQA 1R9NA 2WUFA 4TOIA 3VSDA 3RGWS 5A6SA 5KMGA 2XE7A 4N1AA 1A9QA 2GN4A 4AMZA 4E1BA 3AI2A 2WIBA 3T7EA 2R6HA 4TS4A 3ND7A 1FNBA 1NY6A 1QO9A 3BXPA 4FFMA 4NYMQ 3L8FA 4N3AA 4W1QA 1V3UA 4QKQA 1G8JA 2E55A 1FMLA 1JVBA 3RSCA 2V1UA 4MCIA 3IOCA 5HCNA 3REQB 3QNWA 3G0IA 5CVCA 1Y6FA 2FDCA 5ALNA 3CZ5A 2BFNA 3VR6D 3G7UA 1LXCA 1E2QA 2DUWA 1E0DA 2FW1A 1Y7LA 3DEJA 3PE3A 1VSQA 2CYBA 3LUCA 4R2XA 3TLJA 4B44A 1IULA 3G1WA 4P3XA 3BL5A 3SC3A 3EVAA 4EYOA 1IY9A 3ANSA 3QXXA 3A32A 5ILQA 5EKSA 2QIOA 2AG1A 4EEXA 4RV9A 3UVEA 3D4PA 3JQAD 5JAIA 3FNGA 4HD8A 4RX1A 2XQGA 1YBMA 1WUHS 2EJTA 1DZ3A 2A58A 3RHFA 2ZCVA 3O8RA 2W8BA 4FYJA 3K1ZA 5CA0F 2IYLD 2OP1A 3SVZA 1IMJA 3KXDA 4RFSA 5JS8A 2WP0A 4PHHA 1TX4B 5MHTA 1WXDA 4RS3A 2B78A 3PJDA 4LWZA 2HIGA 5I9TA 1A7UA 4QQRA 1JXOA 4KQFA 3T9DA 3VJLA 1IZ0A 4KR0A 1NDQA 5L3QB 4WUTA 2DUNA 1BYIA 2Q41A 3FUTA 3NT2A 4ZK6A 4C03A 1V96A 1YR9A 3DTYA 1LI4A 4TUYA 3GQBB 3H97A 1YS7A 4W4TA 5IEJA 3S5JA 3CX3A 1KSJA 3GMSA 4OQMA 2Q8NA 3NH6A 3OFKA 3ZJVA 3M6IA 4TT3D 4UBOA 1SU6A 4N9QA 3GLVA 1ZC3A 1AKNA 3FGNA 1G3RA 5JEDA 1JB1A 2YY6A 3BSWA 1AUVA 2L69A 3HFJA 2HU7A 4RIIA 4HNSA 7MDHA 3RS4A 1KQFA 1N36B 3IAXA 3ENQA 5IKOA 3M1IA 1IC6A 1KGSA 2G1AA 1JSLA 1E89A 1M1XB 1I51A 1TEZA 2CT8A 4BUCA 3R40A 3UAGA 4NCXA 2FLVA 1PLKA 3A6HA 3NT4A 4X0EA 1W19A 1EU1A 3QBTA 3BD9A 5JD4A 3FJ1A 2LNDA 3DVAB 1M2WA 1JHVA 1T9HA 3KQOA 1N0IA 3KEGA 1T2UA 3WYEA 4EJSA 4IFIA 5KCZA 2QV0A 1ZN8A 3E5RA 2JGNA 1Z26A 2XI4A 3RYCB 1WDLA 1LWOA 4PNPA 3HYCA 4HRXA 5CT4A 3Q8WA 5IC6A 4ABYA 2Y71A 1FS5A 5A9SA 3MJEA 5FHQA 2VPXA 3CZ4A 3E81A 2E85A 1QJCA 3GB9A 2VJQA 2JJ1D 2ZKIA 1SUPA 4U9IS 3SZGA 2P8SA 4E3ZA 5KYWB 5KJFA 3ETLA 4FNMA 1Z5OA 1I0IA 2G7ZA 3N8KA 1JB9A 2VJDA 4FILA 1JV2B 3HN2A 1GPYA 2ECPA 2ID4A 3ZJ4A 3RS0A 4ALKA 2R68A 5LZ4A 4HB2A 4JI8B 3JU3A 5BV8A 3VU9A 1EFVB 2XOEA 3ZDYB 4CNQA 4ETIA 3EPHA 3ZJ5A 1FL9A 3A1NA 3BORA 3K0FB 4AY3A 5FFFA 1HE3A 2XYGA 3CZCA 4FFLA 4DXDA 1RMQA 3MTJA 3UBTA 3PI7A 4NCIA 4UVDA 3NUZA 3EEQA 2P3OA 4H7PA 4YLGA 1KRHA 3HB9A 2YFKA 4DGQA 3QVTA 3W2GA 1XOIA 1W7AA 3GIDA 5TQ0A 3C3MA 2J07A 2VSOA 1ZMBA 1RLMA 2H5LA 3AHJA 1MA0A 3K5PA 4TT8A 2YW2A 4ZO8A 4EMUA 3PHGA 4CM4A 4DN6A 1ULTA 4GLFA 2HXGA 4I4TB 3NBAA 4QPPA 3IIKA 2IWHA 3W5JA 2BHRA 1FTGA 2NVOA 5JS6A 2O23A 2ZT5A 3GW8A 4FE7A 2YIVX 5E9AA 5SY6A 1DTWB 4LDNA 3VC3A 4JEUA 1U94A 3TXAA 1YF3A 1UPUA 4FBLA 4LV6A 3KLPX 4GSLA 3V8PA 4YHHB 3LAWA 1E3WB 1JKIA 2GXUA 1DMRA 3G2PA 3F78A 1ZM2A 2VPWA 4Q3NA 4TTRA 4YRSA 3I8XA 5AIBA 1UBHS 1L0BA 3G49A 1ZLYA 2OQIA 2ZXFA 1Y1TA 4WCFA 1RWNA 2EFCB 1CIPA 2A35A 2ZJZA 5HIIA 5IVDA 3R9XB 4AU1A 4C0QC 3SY8A 4RULA 3VV3A 4H15A 1ICIA 4LS3A 1QDUA 1E62A 5K09A 1S8AA 1Z4MA 3PHCA 4MRMB 2BE7A 1NMQA 3B6EA 1PJLA 5JBIA 1UKVY 5F7JA 3DLTA 4G0UA 4B45A 1DJNA 4XJSA 3GJ0A 3HHEA 1Q74A 2AN9A 1UBOS 1R8XA 3FCYA 1QGED 4GM1A 3I6BA 4JKIA 1PQPA 3LL4A 4JP3A 5CH3A 5AI6A 1VYVA 3GXBA 1YJAA 2PR2A 2X76A 3A4TA 4Y9TA 1MOSA 1AM4D 4QAQA 4G09A 1WSAA 5CVUA 3ZNNA 5JOQA 5KQLA 3LO5A 2GBLA 3AEXA 2VNIA 2NVUB 4GD3Q 1L7PA 3CPEA 5LOVA 3HJAA 1N2JA 3F3SA 4WLOA 4JIMA 3FCEA 5J5VA 2EL7A 2QSYA 3UHJA 1H9AA 2C3YA 4TKLA 1V7QA 3M4YA 1PTKA 4YQEA 1XTPA 4QYSA 1PV1A 4Q47A 4KTVE 2V59A 1OAOA 3NAGA 5JXWA 1TLTA 4ICIA 3SX2A 3WR5A 4UTOA 3H16A 1K5HA 1MN6A 1YJXA 4C6SA 4HVLA 2ZE7A 5AKYA 1JXMA 2J6CA 4BGEA 4ZOLB 1YRQA 2QRLA 4TXJA 3P32A 3IODA 4LXXA 2D8AA 1H1LA 4QNNA 5A0TA 2FMKA 3UXHA 1RWWA 4YLEA 5LZ9A 1YI1A 1C30B 3QVUA 5HKAA 5JQGF 4ZQCB 4PCLA 1UKAA 2VXBA 4Y0NA 3TECE 2LRHA 2IPMA 5BSTA 3OG9A 5HA5A 2H4JA 2Q07A 3FFAA 4FX2A 1WTCA 4C14A 1FX0A 3N2KB 1SUFA 2OL4A 3A9TA 3FI0A 4MA4A 3WLLA 5GZ1A 4IH9A 3E9CA 4G5RA 5B6IA 5EHIA 3QG1A 2A8YA 1ZVMA 3A10A 1IHUA 1KOJA 2RKWA 2GN8A 1OZAA 3DLAA 1CULC 1PNQA 4J6FA 1EDOA 1VCNA 1VE6A 2X2OA 4KBGA 1BS9A 1KYXA 3FR8A 4KN5A 2I3BA 3T1TA 3EG5A 2ZRQA 4EB6B 3U0VA 5I4KA 4K9SA 1JEYB 3D2BA 3UTDA 2E21A 3K6KA 3U5TA 2GMWA 2IHYA 1PEAA 1QK4A 3GZ4A 3H8SA 3HM9A 3H99A 1UAAA 2HCFA 4EI9A 4A0QA 2VLBA 3ZHCA 4M9XA 3VH1A 3M6LA 3PUHA 4P84A 2IS4A 5T3YA 4IZHA 5T41A 3WGUA 3IMKA 2ACKA 5CYPA 4DCSA 1L4EA 1IY1A 1QE5A 2ZT6A 3B53X 4IVNA 3GEIA 3O1IC 1ZGHA 4PANA 5JMPA 4ZMBA 1M66A 3BMCB 3HU2A 1MAAA 3LIPA 2F62A 2IBMA 4WPGA 1XAGA 3HBMA 1PGPA 4BL5A 3FNHA 4QU5A 2OORC 4PY2A 1JDNA 1C9NA 2CXTA 2W7TA 1L7MA 3PGVA 1MD9A 2CLCX 3M6WA 3T3IA 5I8ZA 3H83A 4P83A 1K1EA 2I2BA 3NYWA 1U2DA 2JEYA 2ZB8A 1VHTA 4OF4A 2O2XA 1WJGA 2ADFA 2H85A 2R1UA 1G17A 3LZCA 2QAJA 2PBZA 3C5HA 4P7JA 3O9ZA 2W42A 3U61B 4PG7A 1BD4A 1M0TA 1WMBA 2V54A 2V5AA 3GARA 2QRVA 2Y0PA 3TW8B 4E7OA 5K0CA 2IU0A 4YMIA 1CZNA 2DTEA 1WUYA 1ZN2A 3EGWA 1O89A 4HPXB 2C99A 5J2TA 3G8YA 4LNUB 3CLHA 1J06A 3UK7A 3CNHA 3EZNA 1PJAA 2WKWA 2YWHA 2ZJ0A 4Q6WA 1N5IA 3D8NA 4UU7A 3AUAA 2F1HA 2X15A 1YRHA 2NU9A 3FHOA 4PICA 2BZGA 2PA3A 2ZBQA 3V7UA 2GZMA 3CF4G 3V1YA 5EIFA 5IAEA 3C98A 2E87A 2LW7A 3WQBA 3P2KA 3D0KA 4AVYA 4EA8A 4YWHA 4YT4A 5KQGA 2W8ZA 4BPBA 1ZU4A 1VRVA 4P0QB 3IP5A 4B40A 2G63A 1JG4A 2VJMB 3PUVA 3QJGA 3WK5A 1X8XA 4YI5A 2I2CA 4MP3A 4B1FA 1GWNA 1J8YF 2RIPA 1CUDA 1QHEA 4L6AA 3VKFA 3UWMA 4HY3A 4TWIA 4CMEA 4RLFA 3JYNA 3RTDA 4RDIA 3SF8B 2FUCA 3FPBA 4LJKA 4UM9D 4KUGA 4RHUA 4BMCA 2QMZA 3BPSA 3WLAA 1Q7GA 2DBVO 4N5IX 4NENB 4D8YA 2YJ3A 4L8WB 5CA0A 5K8UA 4D3ZA 5KQMA 4N03A 1XBTA 2ZS9A 1V8PA 2ID7A 2V6IA 1GTG1 3H18A 4K87A 2OGTA 3JZMA 1SKAA 2ONJA 3N58A 4E21A 4M9SA 5CFRA 2IEDA 2P75A 4UUMA 1A8UA 3PR2B 4RD1A 1Y1KE 2EL9A 4DV2B 1GZ7A 4BWGA 1FW8A 5DLEA 1JG1A 2L0XA 4D1YA 4E5KA 1JI3A 1GL3A 3NAMA 3A25A 4IFBA 3C6YA 4JC8A 2EJUA 1DC5A 3PU6A 4JR2A 4RPJA 4XWAA 1YV9A 2OZKA 4KRFA 4OHZA 2XYHA 3T5DA 2J85A 3KLBA 4YECA 3BE5A 1IU9A 1VA5A 1ZJJA 1OE0A 1GPUA 3BRCA 4W99A 1PTJC 3ID6C 4TMVA 1AKTA 2QOEA 4NV1A 1WD5A 1X9IA 2C5LA 4OB8A 3DDCA 1S1MA 4JLAA 421PA 4RK5A 1NRXA 4CKEA 2JGMA 2VT3A 4OIFA 1GG5A 3KJXA 1N0WA 1RLIA 1M10A 1H22A 1MVLA 4P92A 3KUUA 3PDHA 1JEOA 4N8EA 2GERA 3PHIA 5HKLA 3HB1A 4BQSA 1L1EA 1B7GO 3D2CA 1PZFA 4LE0A 3AHHA 1NBMA 1ODCA 1YAJA 4PLFA 5E9WA 1XD9A 2OQRA 3DFZA 1U8FO 1SQSA 1FU8A 1MNAA 2WZBA 3OY2A 2H2AA 2O8EB 2FQWA 4GM0A 4FDAA 3GUVA 4LF4B 1IWPB 1TD9A 4WLVA 1ZMTA 1SC9A 2VRNA 1XQXA 3P8ZA 4CT5A 1NXTA 3TRJA 3IOEA 2YCLA 2ZROA 1PG2A 2J87A 1KE2A 4NYMR 1D1SA 1O1YA 4PBTA 2AD1A 1DWUA 5JNUA 2XE6A 1WG8A 1D2GA 3FMFA 3RUDA 2P2LA 2ZYSA 5KVQA 2H2FA 1Z7BA 3HA3A 3LT4A 1II0A 3R6GA 4Q7EA 2IIVA 4LJ6A 5C7LO 3U9LA 1EX1A 1YASA 3MCVA 3PIDA 3SE7A 2O3QA 3LFHA 3F4LA 5ES3A 4D8VA 3P5SA 5KYGA 3UANA 4XUGB 2PNFA 4ML3A 1GFZA 3AIKA 1U0HC 5JE8A 3FOFC 3LCRA 4CMJA 1H4TA 3P19A 2F9MA 1EQUA 2G9RA 2Q50A 3AFMA 3ZU3A 3FYSA 4RQTA 5JO0A 1LDGA 4C7BA 3RBAA 5LD2B 3C6XA 4FM9A 4NOLA 4ZVVA 4HQOA 3BQ9A 2YYYA 3E7DA 3OIFA 4DWJA 1QE0A 3E22A 2WJWA 3JAKB 1DIGA 2ERYA 2G5GX 3PICA 4MB0A 3IUJA 3B13B 1D04A 3OOEA 1Y3AA 5EZ6B 1QUFA 1W94A 4Z4QA 5HMLA 6GPBA 2GCOA 3IUYA 6REQB 1CD5A 4FFWA 3X2FA 3AMVA 1XEAA 2ZIUB 4EDHA 4G5GA 4DMRA 3MWYW 3DAOA 1CJKC 1I4EB 1BX3A 5L3SB 4WLUA 4S1TA 1K6JA 1CG6A 1ZM4A 4CTOA 3TZCA 4XUEA 1TFRA 1DC7A 4Q3KA 1I3LA 4W1SA 4YJ3B 3WG9A 2CUNA 2POQX 4EGJA 3GUZA 2CVZA 4G0WA 4HS4A 3LRXA 3CRVA 2XX3A 1PQWA 4KFTA 3RAJA 2V0NA 4L74A 3T7CA 4DDMA 2QPOA 5JW6A 1OWNA 1L8XA 3AEQB 3L9WA 4EGCB 4DUYB 4MQ4A 1ENZA 3JALA 2VQFB 1GFIA 2W00A 3C3DA 4DV3B 2D0PB 1B43A 4QVGA 2ZBUA 4D5GA 2ZIEA 5JPIA 2AFRA 1UUFA 3GA0A 2JNWA 1VP9A 1EMDA 5C37A 4UW9A 3BH0A 2OCBA 1TQDA 1V5WA 3HJTA 2Z2IA 3JWPA 4F1KA 4H2DA 1W8DA 3K9GA 2IYWA 1IEQA 1XLTC 4MPRA 1BDIA 3U7JA 3ZDEA 1LK5A 2ZSIA 1TCAA 4LWQA 1JDTA 5BWBA 4J43A 1TNDA 1LF0A 5J3JA 4N18A 1IXSB 3T7TA 4J1TA 4Q1VA 3IHTA 2ZRBA 2GBFA 3UA3A 4YJHB 3QVGA 4B4WA 1QP0A 5GY7A 3L5OA 2EZTA 1HQDA 4QUHA 1PRYA 5LLSA 1Q6ZA 5HX7A 3IV9A 3RVOA 4TWBA 2TMDA 3JD0A 4H7FA 4JBWA 3ZDAA 1P7VA 2YUIA 5KWSA 1VJCA 2UZ0A 4I4TA 4PRLA 1PJ8A 1U0GA 2XNKA 3HE3A 4XOIA 3WIBA 1LDYA 3C7CB 4KYTA 3NETA 5K0TA 4F06A 4KO8A 4MW5A 3T52A 5CJPA 1HL7A 4Z8YA 3I8SA 4OQLA 1TMGE 4XGNA 5KHAA 2GZ1A 5CFNA 1FYWA 4YCJA 2LCFA 4DA7A 3GR6A 3P4UA 3FPEA 3RC9A 2PMEA 1WQ4A 3HUTA 4ZWNA 4O2AF 3R7FA 1SU7A 2VDKB 4QHTA 5ED4A 4TMTA 2Z2JA 1B93A 3LF1A 2NO5A 4M1MA 3DMNA 1VJTA 2G67A 1HSZA 1U1DA 4KXVA 4XOUA 5DHTA 4BTVA 1XPRA 4OA8A 1KYZA 4YFVA 4EUHA 1Z2EA 3CRQA 4LFAB 3I2IA 1K8RA 4MVJH 5ADHA 1C1YA 1AA9A 1Z5ZA 5IYZA 2OBXA 2E6KA 3AILA 2NU7A 2QTRA 3D9QX 3H3XA 4OYHA 3BK2A 4NQRA 4RKEA 3THXB 1J07A 3OEEA