4LV8B

Murine irga6 bound to toxoplasma rop5c, a pseudokinase gdi
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
397
structure length
390
Chain Sequence
NDLPSSFTGYFKKFNTGRKIISQEILNLIELRMRKGNIQLTNSAISDALKEIDSSVLNVAVTGETGSGKSSFINTLRGIGNEEEGAAKTGVVEVTMERHPYKHPNIPNVVFWDLPGIGSTNFPPNTYLEKMKFYEYDFFIIISATRFKKNDIDIAKAISMMKKEFYFVRTKVDSDITNEADGKPQTFDKEKVLQDIRLNCVNTFRENGIAEPPIFLLSNKNVCHYDFPVLMDKLISDLPIYKRHNFMVSLPNITDSVIEKKRQFLKQRIWLEGFAADLVNIIPSLTFLLDSDLETLKKSMKFYRTVFGVDETSLQRLVDQVEAMIKSPAVFKPTDEETIQERLSRYIQEFCLANGYLLPKNSFLKEIFYLKYYFLDMVTEDAKTLLKEIC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Murine IRGa6 bound to Toxoplasma ROP5C, a pseudokinase GDI
rcsb
source organism Toxoplasma gondii type i
molecule tags Transferase/hydrolase
molecule keywords Rhoptry protein 5 C
total genus 150
structure length 390
sequence length 397
ec nomenclature ec 3.6.5.-:
pdb deposition date 2013-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05049 IIGP Interferon-inducible GTPase (IIGP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lv8B02
5AUOB 1HYQA 5FUVA 1HE8B 1TEXA 2OCYC 1EESA 3EZ6A 4MYCA 3C16C 4M22A 3RAPR 1DG1G 2WAXA 3QI2A 2N42A 3TVDA 2GEDA 3MJRA 3HR8A 1ZM3A 1IAQA 1KI4A 3T12A 4F7WA 1KI1A 4M1YA 1GL9B 3VX4A 5J4LA 5FL7A 1OFTA 2G3YA 4P4UA 4TYQA 3I8SA 3TW8B 4A2PA 3KKOA 2ZRAA 3FVQA 1E4VA 2JLUA 3VAAA 4TMTA 3QY0A 3UWOA 1DBSA 2EFCB 3AVYA 2V1UA 2KWIA 3AP3A 2NO9A 2ZI7A 5F3WB 1E9BA 1JJVA 2GXUA 3QNUA 2DHRA 4JBXA 2DCUA 4HDQB 3W5IA 1ZCBA 4LJ8A 4P4TA 1JAHA 3PG5A 2C98A 2FFAA 2W6JD 2KSQA 4LDJA 5CYPA 4BQSA 3GJ4A 3W5JA 1QVRA 1S1MA 4HZUA 4PANA 4PZLA 1XTJA 2GDJA 3THWB 2G0TA 4KVAA 4ZDKA 1FUUA 1SHKA 1R0YA 3ADDA 1VHTA 1T4GA 1G5TA 2Q0HA 4M9XA 5CYOA 3WMGA 5HE8A 4RSGA 1MO3A 4JLPA 4G5GA 3LBIA 1MO6A 1TF2A 4NYMR 4JL8A 4LPSA 1COWD 3KXLA 1PLJA 2ZVPX 3CX8A 2AN9A 4URYR 3MMPA 4UKDA 4Q1AA 4DIEA 5TDHA 3K70D 2PZEA 1XEWY 2GF9A 4A1FA 4CW7A 5KDDA 3RS3A 1OXTA 2A78A 1YHNA 4AC9A 4MUAA 3U6KA 3R8CA 3KXIA 4DLVA 2PX3A 2QPAA 1U90A 3SYNA 3FGNA 4Z51A 4OI0A 2OFOA 2JJ8A 4M21A 4LYJA 1TF5A 3PITA 4PPNA 1NLYA 2QY9A 4EDHA 3CONA 2J9RA 1W48A 2GBLC 2JJ1A 4ZCLA 3B1ZA 4KITB 2W2XA 4CEIB 1U99A 1E2MA 2AFHE 5TMPA 2DBYA 1HUQA 2FSHA 3A1UA 3M1IA 4KV9A 3BFVA 1HV8A 4L16A 4ESVA 4URXR 1R5NA 1ZC4A 4BFXA 3VU9B 2D3WA 4JLBA 4NE2A 5JRZA 1KI6A 3ZH9B 1VYVA 1DAFA 1ZJ6A 5IF9A 1T0HB 1OB5A 1OH5A 3MWLA 3V9PA 3BB3A 2ZRFA 2CDNA 3A58B 2NMVA 2IXFA 1RC8A 1P9RA 3REFA 3BK7A 4WW0A 2XTNA 4M8NE 4CIDA 2C95A 4RKFA 1N5JA 3CH5A 4OQLA 1CKEA 3O47A 2ZJOA 2X77A 4LWZA 5JJIA 1E1QD 1Q1ZA 3P4XA 2ZJAA 2VF7A 4BUJA 1NSTA 1X1SA 2VHCA 3TSWA 4P3YA 4DLWA 2GCNA 1OJLA 3ZLJA 2ATVA 1MH1A 2ODEA 1QHGA 1MO5A 3AVPA 3RRZA 2IYYA 3CR7A 4C0SA 2ZSEA 4BFWA 1BMFA 1EG7A 2AL7A 2XNDD 4PZYA 4OHVA 2ZRIA 3B78A 5B64A 4E22A 3OF5A 4LI0A 1E2FA 3R7WA 1YR8A 4AD8A 1UKEA 1D5CA 1GSIA 3B1WA 3EZ9A 2CJWB 1KO8A 3ADKA 4O3MA 3QF4B 1II8A 3W8NA 2IYTA 3OFND 4BFTA 3GFOA 3K0AB 4YLGA 4A2WA 4YXWA 1ZM9A 1BYUA 3AF1A 3NC0C 2PCLA 1T5LA 2MSDB 4HSEA 3GEIA 5FBWB 1JPNA 1D9ZA 4R7ZA 5JZVA 1XZPA 3LX8A 4DLZA 1B0UA 2XSZA 3FE2A 1VG9B 3EA0A 3ECCA 2HJGA 4M0LA 3QKTA 4NU0A 3KJGA 3IQWA 4ZCIA 1A4RA 3CUEF 3CW2A 1NN3A 4GP7A 3CZQA 3CBQA 2VHQA 2QRNA 2IYUA 4L15A 4U5XA 1VHLA 2YC2C 2ZJ5A 5IDVA 2BBWA 2RGAA 3RYTC 3GJ3A 4AG5A 5FBLB 3IHWA 4HDOB 4GOKA 4BFSA 3ZGXA 1GNQA 1UBGA 3I92A 4JYCA 4ON9A 3DZDA 1OH7A 1R8SA 2O8EB 3LVQE 3ZZUA 1H8HA 3GLGE 1XD9A 4FMDB 1COWA 3GLGA 3AVXA 1AKEA 4ACBA 3OAAA 5JI3E 2DFKB 3C8UA 1W47A 1DELA 4IOLA 1E98A 4R9UC 1IN7A 3MUFA 3WYFA 5B30A 2XB4A 4B44A 3RHFA 1JNYA 1YR7A 4B3DA 3GMTA 2E1RA 4V0ME 5GVSA 5FH9A 3T1OA 4C0JA 3BAFA 2P5SA 2EFGA 4CEIA 4F93B 2QAGC 4PAMA 1UF9A 4LHVA 1ESMA 1G8FA 3RVBA 3ND9A 1GL7A 1KI3A 3GLHE 4TT3D 3GQBA 1ZAKA 5CIQA 2WWIA 4DDUA 4Q7JB 1FP6A 1E2HA 1G8PA 1Z6XA 3AVOA 1AK2A 1G4UR 1YRAA 4BLRA 2FA9A 1GILA 3A36A 3K0FA 4JZKA 3ZJYA 2KE5A 5K8IA 1DAIA 1G16A 2O0JA 1GUAA 2FZLA 3GJ5A 1TUEA 2OZEA 2R44A 4QBIA 3LXXA 3BD9A 3QKSB 4NKRA 3LWNA 2GCOA 2PJZA 3NWJA 1UDXA 4A8JB 3T1TA 3TIFA 3A1TA 4F4IA 4Q7MB 1HQCA 2YWGA 5EZ6B 4B33A 4OBEA 2A5YB 2IA5A 4QNRA 4GNKA 1ONBA 3ETLA 8OHMA 3AB3A 2RGCA 2LWIA 3T5DA 2I3BA 1GTVA 5C1BA 3Q3JB 2GKSA 1JEDA 2XZLA 1Q22A 1KO4A 1XTIA 2JLRA 2YOHA 4IOMA 1A5TA 4UNSA 1N6OA 3NTUA 2RHDA 3QKRB 4WOPA 3GD7A 4TQAA 1TMKA 5A5GA 3NXSA 4KXFB 4Q21A 3VR4A 1CTQA 2RGBA 3QJYA 4LGMA 4Q48A 1QZXA 2BBTA 2GXQA 4FCTA 5AJWA 4M9ZA 3DKVA 1AQYA 1FFHA 2BM1A 5FI0B 2JAQA 3BIFA 3JZMA 3LLUA 4LV8B 2OAP1 5EQTA 3AGPA 1YR9A 2B92A 2ERYA 3KDSE 3O8DA 2BCGY 2GCPA 3ZIAA 4JLMA 2GCOB 1M1YE 2FPLA 1Z07A 2ZJYA 2F55A 2R9VA 1YU9A 1IOZA 2EU8A 4D0NA 4JLKA 4KSCA 3TQFA 3WYGA 1W36C 2E9SA 3Q5EA 1DG3A 5HKKA 1ZIPA 4D4LA 3X1YA 5DSZA 4XTRA 5JCZA 1IN5A 3LW8A 5EUQB 4RVCA 4Q18A 2CL7X 1KSJA 2LKDA 4MKFA 1X8KA 2IS1A 1Q57A 1E96A 4HLCA 1NRJB 1VCOA 3CPEA 4YMVA 3L0PA 1SZPA 3L0SA 1DS6A 5F9HA 1NKSA 1TU3A 1J99A 3OAAD 4EFLA 5J40A 3OE7D 1G19A 2ORIA 3QG5A 4LY6A 2H7VA 1N6RA 4US2R 1F2TB 2VRWA 5KSOA 5JHGB 3TJZA 3PUVA 2HLDA 2ZQ5A 1ZD8A 1AN0A 5HE9A 1Q1QA 4LUCA 2HJVA 3HU3A 2Z4SA 1Q3TA 2HCBA 2BCJQ 3SN6A 1Z08A 2OEPA 2QZ4A 4Q47A 4BZXA 3K0SA 3A6PC 1LV7A 3PUXA 5LPNA 1SXJE 5HR5A 2WV9A 3LLMA 2PX0A 1N5IA 4D0GA 3RRMA 1FMJA 3W90A 2OLJA 4AI6A 3VQTA 2ZYUX 3QXJA 1D8TA 2I4IA 3U4QA 2VQSA 4GOXA 2P2LA 2CLSA 2V7QA 4NP6A 4LPKA 1OV4A 3EIHA 3FKSD 3NKVA 4CZ2A 1L8QA 4C0AC 2R2AA 3DO6A 4LJ4A 1G64A 4PSKA 2FJUA 4LX0A 1O87A 5KPDA 4HAYA 2FMXA 1TAGA 1ZVQA 3L2OB 4PO8A 5FI1B 5GJBA 1PJRA 4W9MC 2FU5C 4HUQA 2BC9A 3AF4A 1UBCA 4K46A 1D6JA 4B3CA 2MSEB 1PUIA 4DWJA 1DAEA 3CRRA 1P2UA 4LBZA 4JVLA 4O25A 2J41A 1NG1A 4LJ9A 4TLEA 1SHZA 4MYTA 4D26A 4PC3A 3NDBB 2AKYA 3K09C 5EXTA 5DNYB 2ODNA 1SULA 3DOFA 4OK3A 4ZDIA 5FUWA 3TNFA 3C15C 2HEIA 1QG2A 1X6VA 4O0MA 1C4OA 1VYTA 2C9CA 3QEJA 2V8OA 3ICEA 2RAPA 4DLYA 2NO7A 4IEEA 4CEJA 3TSZA 2WOJA 2VHJA 3CRVA 2XNSA 1HT2E 3UKDA 1NVVR 2ZUBA 1NVXQ 1OSNA 4NYIR 1N6HA 4QXAA 2ZS8A 1W1WA 2J7KA 2ZRLA 3GLHB 1R0XA 3EXAA 3B82A 1XX6A 4Q9LA 2QBYB 1CS4C 3SQWA 1M8PA 1TQ2A 2XX3A 1AJEA 1IY1A 4W5HA 3P20A 4BLPA 3RWMB 4C4PA 3CNOA 2XGJA 2XEXA 3HJNA 4IDPA 4EQ6A 2MSCB 5E7MA 3BS4A 1DAHA 5TB5A 4P32A 3D6TB 3BGWA 3JZAA 4HLQB 4PZZA 4DLTA 3A4LA 2NO0A 4PC7A 1CP2A 5DLQC 4V0NA 1G5RA 4TN1A 1G8HA 2WWXA 1UBEA 1OKKA 4R98A 3VNVA 2ZE8A 3B13B 2QT0A 2ZI9A 3A8TA 2H1LA 4YDSA 1KK1A 4C0HA 5ANRB 2Z83A 2BIFA 3SE0A 5FBVB 3UK6A 1OYWA 2X2FA 3F8TA 3RS7A 4YMTA 1SKYB 2CE2X 2GK6A 3C14C 3CKLA 3AF0A 4C3ZA 2H16A 5LB4A 1G7TA 1M2OB 2YNMA 3A37A 2JLXA 3AVTA 4A36A 2IYWA 1Q12A 4CEHB 1OHHA 4Q4HA 1NL3A 4DBLC 1N25A 1NF3A 4D4KA 2CCGA 2B8WA 3EC2A 2X1VA 4MKGA 1KSGA 5JCPA 1ZNZA 4GI7A 1VIAA 2B21A 3QXHA 2GJSA 4FXPA 4OHWA 2CMKA 3Q7QA 1CR0A 1XZQA 2WBLC 1S2MA 2FWRA 1NBMA 1XPRA 4A8JC 2WJGA 3HPRA 2ZI3A 2F9LA 2FPKA 4LHZA 2QE7D 2O0KA 2ORVA 5CITA 2NPFA 3GJ7A 4B6FA 1JR3D 3B9PA 4HYYA 1R5OA 5DYIA 2WWGA 3ZS8A 3M6AA 1E3MA 1KO7A 4CYMA 4QGGA 2J1LA 5EE1A 3EPLA 4GZLA 4ZV4A 2EWWA 3NH6A 4XSHA 1HH4A 3R8FA 1EGAA 1JEEA 2JLQA 3EWAA 3EZ2A 3NEJA 4RZ3A 4DIDA 5HPYB 4PXAA 4XD7A 1FX0A 3I1FA 4YDHB 1OIWA 2CL0X 4QL3A 3TUIC 1ODFA 1OPXA 4L4UA 4LC0A 4D4MA 4BFYA 2HYDA 1F3OA 3LAWA 3GFTA 4JBYA 3HR7A 1RW4A 5DHAA 1ZRHA 1E2NA 4OI1A 3RLFA 5CIWA 4QRHA 4DT1B 1KO1A 2BMFA 2ZR9A 3KQHA 3I5YA 1L7VC 3ZQJA 2QORA 3C7KA 3K9GA 2W0MA 4G01B 2D74A 2Q6TA 1E2EA 3U60B 2QNRA 4AURA 1ZU5A 4PHFA 2YOFA 2Q9AA 1G3QA 2C9OA 2XZOA 2EQBA 1E2PA 1YVDA 1ZP6A 3TE6A 1EFRA 2ZEJA 1O3YA 4Q4AB 3U3MA 3I72A 3RRNA 3JVVA 5BYJA 1BH2A 1H8HD 3OFNA 4PAOA 5FTKA 2PCJA 3C4JA 4Z54A 4XD7D 4E09A 4DB4A 5P21A 1P6XA 4B43A 1D2MA 1VDZA 1S3GA 1Q1BA 2GJ8A 4TL7A 1HT1E 4P33A 3AQ4A 3JVUA 5G3YA 4NCNA 4EJSC 1CR2A 1KDPA 1OIVA 2ZUCA 3FFAA 3QEOA 3B6EA 3THXA 1GP2A 1ZUIA 3SU8A 3GLFE 5JHHB 2GK7A 3AF3A 2ZJ8A 2OT3B 4UJ3A 4ZI3A 2R8RA 4A0GA 3GEHA 2V7QD 4C7OA 5E95A 3KQUA 4LCBA 3KQKA 3ZD6A 4A9AA 1ZCAA 721PA 4QC2A 3D7MA 1NLFA 1UEJA 3G5UA 1NMYA 3SS8A 5JSZA 5FOUA 1EFCA 3DOEA 2PT7A 1OW3B 4QHYA 1OIXA 1MRSA 4TZ0A 3OEEA 4IXNA 2WHXA 3SYKA 1XMVA 1E94E 4BECA 4DUGD 3PVSA 1W44A 2IS2A 5KDLA 1OHHD 3I4LA 4M1TA 4LJ6A 4J0QA 4QM6A 1G291 2Q3HA 2XTZA 4EPXA 3BFKA 5FTNA 3VFDA 5JWRA 2R62A 4TL6A 3CH4B 1M34E 3KKMA 4WZ6A 1P75A 2GEUA 2OLKA 4QHSA 3SBDA 1XPUA 3WBKA 3CZPA 4TL8A 1G5PA 3OEHA 1QRAA 5AK0A 3GP8A 4JL6A 3QXCA 2VSXA 4P4SB 4XVQA 3VR3A 4DSOA 3DZ8A 3T06B 2VH5R 2YJTD 4Q02A 5B2ZA 3G0HA 2VHTA 1GKYA 4YONB 2WSMA 1LF5A 4BLOA 1NSFA 2IWRA 1JJ7A 1HA3A 4A0RA 2QPTA 2J5XA 1Z29A 2C77A 2BV3A 3AKDA 2CK3D 4LJ7A 1SQ5A 4ZCMA 1S96A 2UZIR 5JS7A 3L8ZA 5K8LA 2RMKA 2XITA 2X8AA 3QOFA 3QVUA 3BBPA 2ZR7A 2CE7A 4BGDA 1LTQA 1U8ZA 1QBKC 1XEXA 4B34A 1UBFA 3GJ8A 4QBGB 4DKXA 1G1MA 3A4MA 4MRVA 2I1VB 4NDZA 4DSTA 4MRPA 3C41J 1IXRC 2ONJA 4QM7A 3W6OA 2WWYA 4DLUA 2YWHA 3FOZA 2LCFA 5DHFA 4ASUD 2H5EA 1TU4A 2VSOA 2OHFA 1KO5A 2ZITA 3AVWA 2RGEA 3TH5A 1Z6YA 4A4DA 1KY3A 2IEYA 1BO6A 3I32A 5KDOA 4P0TA 3AH8A 2PZFA 3RC3A 1LY1A 1G20E 2A7QA 4FMBB 4MH0R 2Q3FA 2XSZD 3KFVA 5GJWC 621PA 3H4MA 1R0ZA 1T8UA 1E9AA 2CCKA 2W2VA 2GAOA 2ZRHA 3CF6R 3CRQA 3TUZC 3A1SA 3ZS9A 4EAQA 2VLIA 4Q7KA 4YXWD 2C96A 4TLDA 2RHMA 4IDNA 1KJWA 3SJBA 2YHSA 3IIMA 4PQYA 1W0KA 4IRUB 1IBRA 2JASA 3ASYA 1ZBDA 5AJVB 3WHLA 1HY3A 3QPWA 4JSTA 2NO1A 1Z5ZA 1U0LA 2ODWA 2R6FA 5M04A 1RPZA 1A2BA 2WJJA 4PSVA 2JATA 3F5FA 4C0BA 1JB1A 4WAUA 1JQJC 1PLKA 2CNWA 1KK3A 3AVUA 1KHTA 4A0HA 3SHWA 2WIAA 2A3RA 3KX2A 1YZNA 1ESNA 4B47A 2ZUDA 2WTUA 1TADA 1U81A 2QQ0A 4TYPA 3W3ZB 4DDTA 2F7SA 4OYHA 3K0AA 2KI5A 2G1JA 4V0LA 1U8AA 3PJRA 1EWQA 2FSFA 3A1VA 4KYIB 1T6NA 5L3QA 2GF0A 1G3RA 3U44A 1FQKA 4NCJA 3Q85A 2L0XA 3DEFA 1IY2A 1P9WA 4FMCB 4MRSA 1LW7A 1ZC3A 1RRFA 1WE2A 2GEVA 3ZVNA 2CL6X 3CRW1 1R4AA 5DI9A 4HAWA 1BKDR 1E0JA 2F43A 2GILA 4B3BA 4ESHA 2YOGA 2DPXA 2WKRA 5SZKB 1AQUA 3TAHA 4ZKDA 1KMQA 4LYFA 3PEVA 3VNUA 5TY0A 2ZRGA 1IONA 1U0HC 2XJ4A 5EXPA 2OUKA 5CK4A 4MDEA 3K0CA 3KUCA 3N2IA 3GEEA 4D81A 2VPPA 1ETUA 4LC1A 3KB2A 3PFIA 4PQRA 2QE7A 2R6DA 1S3SA 2NGRA 2VP2A 1RJ9B 1K5GA 1U2RA 4AIIA 1IN8A 1K6MA 2VBCA 4NPHA 3B5JA 3K9LA 4AYTA 2XB2A 2AK3A 3NBZC 4TYWA 1RYHA 3E2IA 3KB1A 2FN4A 2Q3MA 5EP2A 3B1YA 1SVIA 1YR6A 2QQEA 2PBRA 1MABA 1TNDA 2J45A 1OXXK 1NVUQ 4DB2A 4OHZA 1DAKA 5BN5A 1G8GA 1US8B 2FSIA 1FPMA 4C0LA 2CBZA 1DVRA 1Z0DA 1FZQA 2W6JA 5EUMA 3QBTA 4B35A 1LNZA 3TUJC 2ZU6A 4Z8YA 5BN4A 3BH0A 5EE0A 1LS1A 1J70A 2VHUA 1M7HA 1UEIA 3K53A 1J90A 4DXAA 1YZGA 1FUKA 1IHUA 4NYJQ 6Q21A 2Q9CA 1JAIA 5FUXA 4B3XA 2GVDC 1X1RA 1AGRA 2JLZA 2FFBA 4PPGA 3SFVA 2DB3A 5E7JA 4X8OA 1W7AA 3DKPA 4QKQA 4L9SA 4PO9A 1OLOA 1ZM4A 1OFHA 2F43B 2RGGA 5CK5A 5G53C 4YQFA 3TKLA 1GKUB 2WAYA 1MRNA 3V4FA 4V0KA 1Z63A 2OCPA 2C04A 4C0KA 1XJQA 2WJYA 2HV8A 2PT5A 1Z06A 2HUPA 1UM8A 4POAA 1CRPA 4KU4A 3PQCA 5J4YA 1LS6A 3TAUA 2GZAA 1PV4A 2P65A 3MWJA 3J81k 2CXXA 5B58C 3L43A 3DL0A 3KUDA 4DSNA 3TR5A 4JIMA 1P9NA 3T61A 5L3SA 3FFBA 4NTZA 2EVWX 1DADA 2P3SA 4Z1MD 4Q03A 1U94A 4URUR 2REBA 5DYGA 2B7CA 3NVAA 5EXSA 4G5SA 4JJZA 1LFDB 5J47A 3THXB 3S1AB 1IJEA 2AWNA 4LBYA 2F1JA 4OK6A 5AJXA 2QM8A 3DHWC 2WSSA 1OT3A 1W2GA 4NCKA 1IXZA 4TMVA 3BH6A 2P6RA 3KJIA 2PLFA 3MCAA 821PA 5KPJA 2QPOA 3HYRA 1XMSA 1ELOA 3FWYA 2WIBA 2W2TA 3B60A 5BN3A 1F6BA 2AWOA 2ZTSA 4Q4AA 1E6CA 1E69A 3GLHA 5J4HA 2VP5A 4Q9HA 2NTYC 2KJQA 2MMCA 1G8YA 2VIIA 2VL7A 1UJ2A 4U02A 4OQFA 2IYLD 1H8ED 3O8BA 5CB6A 3LD9A 2ECKA 4MGZR 4ARZB 4I1VA 2VP4A 1E0SA 4Z8XA 4OI2A 1MABB 3GLFA 4QGHA 4B3FX 4H1UA 1K8RA 3REGA 3SOPA 2CHGA 1ZNWA 2O8DA 2G6BA 1P61B 1SVKA 2D62A 3BH7A 3QIAA 3K0FB 1JBKA 4RFVA 5FOXA 4RKEA 3R9IA 1EWRA 1G3MA 3DVLA 4ZO4A 1I4LD 5K8TA 2J0QA 1WA5A 1A2KC 2ZRDA 1R0WA 1RE0A 3AP2A 3BB1A 1S1CA 3PUYA 4MKHA 4ARZA 4TMZA 2QAGA 3QG1A 5L8VA 4FN5A 3CPJB 1EFRD 4A8JA 1GRNA 1N3BA 5J4VA 3CRMA 3EW9A 4I1UA 5DN6A 1JALA 2AKAB 3F0TA 3OE7A 5JBQA 1MO4A 3TRFA 4DZZA 2IEZA 1WDTA 2DFLA 1IXSB 3NH9A 2IW3A 2FFQA 5JWOA 2HLDD 4NONA 4XOIA 1W36B 5SZJA 4DSUA 2C8VA 3U4QB 2EYUA 4AKIA 3CR8A 1XEXB 3IEUA 4CVNA 1KDTA 1UAAA 1E0AA 1EK0A 2IL1A 4M1SA 5CJ2A 2QP4A 5KO2A 2GESA 1MOZA 1X3SA 1CR1A 4ZKEA 2R6GA 5DN6D 1BYIA 4CF7A 2A2ZA 2YVUA 4CRWB 2GRJA 3FDIA 3Q5DA 1IM2A 5EXXA 3AKYA 3HPQA 2F3RA 5J5CA 4FIDA 3OIYA 2UVQA 2ZRCA 1B23P 4B75A 1RZ3A 4ACAA 4BE7B 3LRPA 1KI8A 3PEYA 1TQ4A 4V02A 4URWR 3ZYCA 3THWA 1ZNXA 2HF9A 4DLRA 2HF8A 3I8XA 1YZQA 4TTPA 4LOAA 4LSGA 1E9EA 4KSBA 1KK0A 3GPLA 4XTCS 2ONKA 5TARA 4E03A 3AGQA 4O2LA 2XAUA 1XNJA 1Q21A 4Q4JB 1SKYE 2XTMA 3R7WB 4KBFA 4G1UC 3VTKA 2CJWA 3NBXX 1FX0B 1GNPA 5JMTA 3H84A 4DUGA 1XCGB 2NOAA 5FOSA 1KSHA 2VP6A 3OIVA 3GLGB 4NH0A 3U3OA 1NVVQ 3NC1C 1A7JA 1Y3AA 3MWKA 4LYHA 4W5WA 5ELXA 3EARA 5AUNB 1XFAA 3BWDD 2BMDA 4Q1FA 1J2JA 5EP1A 3BJIC 5HCNA 1EFUA 2ZYWX 1P72A 3LY5A 2QA5A 3ZVLA 4K81B 4TZ6A 4LJAA 1H65A 2UKDA 4UXJA 4C9BA 5C46F 2ZJBA 2HT6A 3WRYC 5G3ZA 3WRXC 1D2EA 5AJYA 2ZSBA 2BJWA 4PPFA 1L4YA 1HE1C 2GTPA 3VU9A 4OQNA 1Z8FA 2VTKA 4M9SA 5DI3B 1D9XA 3HYTA 1VMAA 1TPZA 1P4SA 5FR1A 1CJMA 1GL6A 4NYMQ 2IS4A 1XEFA 1SVOA 2ZAMA 3MSXA 1KKMA 2YV5A 4AYWA 4JJKA 1N6LA 3RABA 2J0UB 4IOKA 5D3MA 1QHYA 1AGPA 1T3LA 2ANBA 2W00A 4RD1A 2IF2A 1Q20A 4B3GA 1GWNA 3AVVA 4JVMA 4AKGA 1R6BX 2WWFA 4ILEA 3RC8A 4MQBA 1CJTC 1W2HA 4UQOA 2G83A 2RGXA 1TL7C 5GVRA 4DEXA 2RGNC 2QTFA 3T1QA 2CVHA 2ZANA 1MV5A 1KGDA 3WNCA 1DAMA 3A1WA 1P5ZB 3KTAA 5KOYA 4AYXA 5J4KA 1HURA 5JRJA 3QKRA 4L5BA 2XJ9A 4KVGA 1NMZA 3QF4A 2P0EA 4FMCF 4CT5A 4KFSA 3GJ6A 1T0JB 1KDOA 4F4JA 2QENA 2ATXA 4UJ5A 3KQNA 2J3EA 3KQLA 2BBSA 3LXRA 1RJ9A 1KMHB 1X8LA 1RYFA 2D7CA 4I4LA 4LHWA 2GNOA 2WWHA 4IFEA 3NEYA 3I61A 4DCUA 4EQ6B 4JL5A 1GKIA 3X1ZA 4DHEA 1I2MA 3HU1A 1SGWA 3I5XA 4I99A 4HEJA 5CM8B 3TR0A 3R9WA 3FKSA 4FCWA 4EJSA 1UKZA 1Z6AA 3FMPB 4M1MA 4UXIA 5EJEA 4U00A 4IOJA 3QENA 1EXMA 1TUIA 2K5UA 4WXRA 3TSOA 5AUPB 3EPJA 2XOKD 1S8FA 2JLYA 2JDID 1M7GA 3SHFA 2ZE7A 5HTKA 4GRAA 1NIPA 1TF7A 3Q7PA 1GRQA 4IKEA 3PXGA 2W83A 4WZAE 2QROA 3MWYW 4FCVA 3W6NA 3ZVRA 2NZJA 4LV6A 3U3KA 4OKSA 2JLWA 4YMWA 2OBNA 5CJPA 4IFBA 1FW6A 3H0KA 4RCYA 1H8EA 3W8RA 4D25A 4PHHA 4C0QC 1ANKA 1XU4A 2FFHA 1Z2AA 2QEQA 2RB4A 5DO9A 4OHXA 1E2QA 3K9NA 5JJKA 1E2GA 2WPDD 4B71A 2PMKA 3W34A 2PEYA 1E1RA 3PR1A 1SVMA 1DO2A 4L8GA 3DPUA 2JGNA 2FPMA 1Z22A 4KFTA 3TLXA 2DR3A 4G5QA 2WSSD 1KJYA 1A1VA 4ZDWA 3LV8A 1QDEA 1W4CA 2XZPA 3U7FB 4DCVA 2AD5A 2PH1A 1L4UA 3OHMA 1YKSA 2D2FA 2TMKA 2A5DA 1ZMXA 2ZAOA 3G82C 1NN1A 3UXMA 2V54A 4Z1MA 4MYHA 1KJZA 1FOEB 2V4ZA 3KFXA 5DE3A 3OZXA 5HKKD 1XDBA 4Q1CA 2ZSDA 5JJLA 4DT1A 2G0NA 4BEBA 4KAXA 5FPYA 3SJCA 4N3NA 1N0WA 3CPHA 4LJYA 4PO1A 3I3SR 4TT3A 4NZYA 4QJ5A 2WVJA 1G17A 2DFTA 3HP1A 1W49A 1NY5A 2A5GA 3SC3A 5IHPA 2IBMA 1L2TA 1KK2A 4JT2A 1OXVA 5JLJA 3N2EA 1R7RA 3TGPA 4IHQA 3WMEA 3AUYA 4AK9A 1KI6B 3AF2A 4IXMA 5EP3A 3FPAA 4HAUA 3CIOA 2BWJA 5C2JB 3LO5A 1GNRA 3EIEA 4BEJA 3KZ1E 4BLTA 1ZM2A 1N2CE 4BLSA 1CEEA 2ZRBA 2O8DB 2GJAA 5A4JA 2ANCA 221PA 2ZYTX 5KNCA 2ZSFA 3D31A 3IILA 3T5GA 2YC4C 4D2IA 5DH9A 3TMKA 1UFQA 4LZZA 1XBTA 4KO8A 2OXRA 4DRZA 4XWKA 1F60A 1NN5A 2IF0A 1Z0KA 2KBFA 3L82B 4O2RA 4GPTA 4X8HA 5GJCA 5H1YA 3CF2A 4JT4A 2IXEA 1CRQA 3RS4A 3SEAA 1N6NA 3LH5A 3C5HA 2MMGA 4TYNA 4NL4H 3MFYA 2ZXUA 3QF7A 1IJFA 1EX6A 3PENA 4FMDF 1OF1A 1WBBA 4XH9B 4TTRA 1DOAA 2C5LA 5EP4A 2EFDB 1QHNA 1R10A 4JLOA 1MKYA 3KKQA 1KIMA 2ZRPA 3S1AA 1J8MF 1AZSC 2RKOA 4XIGS 3SFZA 4II7A 2R65A 4D82A 3RNLA 2FDCA 1OYYA 5FPKA 1G6OA 4Q7LA 2FH5B 1E32A 3UIEA 2O52A 4WXPA 1T91A 4B74A 5FTJA 2NQ2C 2FSGA 5G41A 2F9MA 3SYLA 2ERXA 5EE5B 4MYUA 3ZD7A 3DM5A 4EPVA 2C99A 5JWHA 4YMUA 1XJ0A 4M53A 3M4YA 2AXNA 2FZ4A 2VP9A 4DDWA 4RD2A 1XJCA 4U7DA 3EZFA 2NPIA 4IJMA 4TLBA 1YZKA 2GA8A 2C03A 1NNEA 2H92A 1AA9A 3NG1A 2EYQA 3SZRA 2O8FB 2Q9BA 2BMEA 1E2LA 2O8CB 4GMXA 3LX5A 1C1YA 1OFIA 3EPHA 3RSLA 4DCNA 2AXPA 3B8HA 4ITRC 5JEEA 1YJ5A 2QP3A 4GBMA 4ZIRB 3GLIA 3IBGA 1E9RA 1E9DA 4KLNA 2QAGB 3QKSA 1U0JA 4YMSA 2H18A 1ZD9A 4DLXA 4KFUA 4HUTA 2OCAA 4HLUC 3CM0A 4HAZA 3K0EA 2OFWA 4FW9A 3EASA 1XD2B 4QFMA 3WYAA 1T3HA 2ZRMA 3PUWA 3LW7A 2ZSAA 4V03A 2P5TB 4YC7A 3EPKA 3R9XA 1KSFX 4GOJA 3U61B 3E5HA 4TYYA 1E0KA 4RD3A 2HYIC 4F4CA 2BBOA 2WJVA 2YYZA 4PR0A 1S4QA 4Y0AA 3FHTA 3X1WA 1DAGA 2SHKA 5AUQA 1DPFA 4NCIA 4RD0A 3SDZA 3CLVA 2OESA 4B32A 1E1QA 4AKEA 2HCJB 1W0JA 4PC6A 3ZZ0A 3TVTA 1ZU4A 1LF0A 2OXCA 2WICA 4TTQA 3U5ZB 1FNNA 4MA4A 2P67A 4Q4JA 1XXHA 5UKDA 1SXJA 1IN6A 3B9QA 4W5JA 2RGNA 4RD4A 2C9YA 1J7KA 3VHLB 4BPBA 3L0IB 3AV0B 4HB3A 3U7HB 1OXUA 3IIKA 2FEOA 5SZIA 4IDOA 2QM7A 1PLLA 1P73A 3WY9A 2OBLA 1CBUA 4PC1A 4MGKR 5FTMA 4JKIA 1CF4A 5TXGA 3SNHA 2QGNA 1XTKA 1JI0A 1FL9A 1QVAA 4MGYR 4DCTA 4HZIA 5FTLA 5A0FA 1BIFA 4MRRA 1GOTA 3O8CA 1XMIA 2BOVA 2JLSA 5FOTA 1R8QA 3EIQA 2CLDX 2IYZA 3V00A 3HWSA 2W0SA 1II0A 1T3SA 1W0JD 2ZRNA 4NCHA 4PTLA 2CK3A 4UNQA 4OL0A 1WRBA 3SI7A 2QBYA 5H70A 1CLUA 5BQ5A 2NG1A 3E70C 1W5SA 1SXJB 4B6EA 1NG9A 1VECA 4KODA 4DCSA 1YE8A 2EWVA 1KYIA 2QMUA 3PEWA 2HT1A 4RJLA 3KTAB 3RSOA 3CB4A 2GVZC 2YWFA 2ZI6A 2D2EA 3Q8XB 2HXSA 5F2EA 2JIZA 4NBSA 3VR6A 4WVFA 3N5CA 4A92A 4GDFA 1MR3F 2OBMA 1KMHA 4Q1EA 4HAVA 4TSFA 3P4YA 1JR3E 4GL2A 2WMOB 5K8UA 5KSPA 3UMSA 4PPQA 3MGCA 1W36D 1E9CA 2HXYA 2QSYA 2H17A 3OEED 4JSYA 2ZI5A 4TLCA 1AIPA 4NYJR 1II8B 4DLSA 2ZPTX 4TMWA 1SXJD 3SR0A 5DIFA 4RFSB 3RS2A 1W4BA 3GLIE 2G1KA 1S9HA 1CJVC 5E3HA 3ADCA 4ZIRA 3GLIB 4P4SA 4E5UA 3M0EA 1G4AE 2YKGA 4HDCA 3P1JA 4LHYA 4EPWA 3AM1A 4LYAA 3GJXC 5HCIA 1Z0FA 4JS0A 4URZR 1ZUNB 3GJ0A 5IRCD 3OIWA 2WPDA 1SVSA 3VKGA 1QHSA 5TV2A 3MLEA 1F2UA 3QBVA 1N6IA 1NVWQ 3FHOA 3BE4A 3Q9LA 2XXAB 3NHBA 1KAOA 1RIFA 2OFXA 4DDVA 4TL9A 4M1KA 3U7EB 1WQ1R 4L9WA 4R2HA 4I1SA 4Q1DA 1X86B 2IHBA 2J0SA 3IPYA 3K8YA 4G3XA 2OO7A 1Z2CA 2A5JA 3LQQA 1D2NA 2NIPA 2ZRKA 1G21E 1XB2A 4HI0E 5BW8A 2FEMA 4EJSB 4JVNA 1FQJA 1G7RA 2R6CA 2IX3A 2QMHA 4RY2A 2DY1A 4QNMA 3QE0A 4A6XA 3QSYA 2J0VA 5IK2D 4V0MA 4D4JA 4QOSA 3B1XA 4XWAA 3BORA 2DYKA 1N6KA 1TQDA 4FWIB 4JLAA 2O8CA 4UNPA 1E99A 2JDIA 3ZIAD 1TQ6A 3PV0A 4EFMA 1QHHA 5CM9C 4QG7A 5FPHA 1AS3A 1G9XA 3ASZA 4KI0A 3H86A 1GRRA 4B2PA 3WBJA 1ZUHA 2WWWA 5C18A 1PUJA 1TX4B 1E2JA 2IXGA 2IUUA 3L8YA 1XRJA 4HATA 4EPRA 1N5LA 2QGZA 4Q66C 2I1QA 3AKEA 4FI3C 2QN6A 4CDGA 4NYIQ 1XPOA 1PVOA 4OHYA 1VCIA 4CT4B 3BFXA 4IW3B 2GXSA 1Q0UA 1E4YA 4US0R 1G3IA 1U9IA 2QI9C 1JPJA 2AD1A 3NHAA 4RD6A 2VEDA 5GADl 1WB9A 3BXZA 2REOA 3IUYA 4XJXA 4WBSA 2ZM5A 4PFSA 5F98A 1X8JA 2CCJA 2PMDA 4PAQA 3ZVMA 3RS5A 1OFUX 2QTHA 4JBWA 4ASUA 1VPLA 1N5KA 3VR5A 5GJVC 3K70C 1RRCA 2PJRA 4HZUB 1DE0A 3KJHA 3VMFA 2AR7A 4R2IA 2FE4A 5CB8A 1OE0A 1E9SA 4DEYA 1T9HA 4X8LA 1KAGA 1XEWX 2F1IA 3VKWA 2OCBA 2FGKA 2OSBA 4MGIR 2IT1A 2QTVB 4WZBE 4EFNA 4LJ5A 1E2IA 4OJQA 3X1XA 1W4RA 1Z3IX 4D80A 2N1BA 2Y8EA 3FB4A 3F3YA 3U2QA 1VG8A 3IO3A 2A30A 2AHOA 2R6AA 3LVRE 4CGZA 2GBLA 2GJKA 1VIYA 1GFIA 2QU8A 1NBME 4S2EA 2QUZA 3LBNA 3MRSA 1HQYE 1QF9A 4QBHA 2GZHA 3QPVA 4B2IA 4E07A 3THYA 4C30A 3OIUA 2ZE6A 3IPXA 3C5CA 1FTSA 1NBMD 2Q21A 3B7GA 1E1RD 5JECA 3NBFA 5H8WA 2ODBA 5D3QA 4JKYA 1YRBA 1UDWA 1G7SA 1RRGA 2J7PA 1JQLB 1T8TA 4BFZA 4D6PA 3LDAA 1NJGA 1KZ7B 1BS1A 3U3JA 3P26A 4V0OA 5C4GB 4OQXA 2RCNA 1VG1A 3V4RA 5DGXA 4US1R 1G6HA 3LBHA 3UMRA 4KBGA 4BRUA 3VKHA 4LV5B 5JI2E 1CXZA 2QT1A 4UXHA 3KJEA 2BHRA 2FV8A 2E87A 4BZPA 4Q00A 4M4SA 3BERA 3FHCB 2BKEA 2JEOA 2NO6A 3FYHA 5BWMA 1KI7A 5CLLA 2OG2A 3UG7A 4AG6A 1EFHA 1R2QA 3IHLA 2PZGA 2O8FA 1YZLA 3VR1A 1XMJA 3WHKA 1E2KA 3AEZA 3CX7A 4PQFA 3K09A 5CLQA 1CU1A 1GIAA 3T15A 1NP6A 3IDQA 4KLZA 4Q4HB 4HB2A 2BEKA 3PUZA 1RKBA 2FX3A 5JSZB 1W46A 1JR6A 1G3UA 2ZVQX 4CEJB 1XD8A 5FBQB 2IC5A 3ONWA 4GZMA 1V5WA 1N6PA 2IYQA 4PSAA 3DDCA 3CWZA 2GETA 1RRPA 5FL7D 1SKQA 4C7OB 1RFLA 3DMNA 3L0OA 2C2HA 4TWZA 3IO5A 4PHGA 1NKTA 2PEZA 3KKPA 3O8RA 5C4MA 2JJ2D 1W4AA 1M74A 3CWQA 1WMSA 3TK1A 1YZTA 1AKYA 4BFUA 4IDQA 1V43A 4C2UA 1KZGB 5FUYA 2WJIA 5AJZA 2A9KA 4MITA 5KHOC 5CDFA 3H1TA 3EX7C 3GFPA 5KUTA 4FINA 3HU2A 3P32A 1SVLA 1E9FA 2FG5A 5L3VA 2JLVA 3KXKA 1Z83A 2GJ9A 3UPUA 4TMKA 2VF8A 3VR2A 3ND8A 2VA8A 4NMMA 4RCZA 2RH5A 2AFIE 2DWPA 3OESA 4AY2A 2KB0A 5JEDA 4X8MA 4DVGA 2D7DA 3SJAA 1VCNA 2QRZA 3IIJA 1KDRA 1Q3HA 5EZ5A 3NDPA 4A2QA 1FTNA 5D3MB 4F38A 1JXOA 1FMLA 2QAJA 2P6UA 4GSYA 4ABYA 1XXHE 1U9IC 1YZUA 2VSFA 3IBYA 4BWYA 4N1AA 1CR4A 5IT5A 1KY2A 5DI3A 4B48A 2LKCA 2FGJA 1VKJA 1ZD1A 5FPTA 2V9PA 5FR2A 4Q01A 3CNLA 4P31A 2QP9X 2BVNA 4ZI2A 4HUQB 1LB1B 1GZSA 1Y63A 3QUSA 1GAJA 4IVPA 4XVUA 1QG4A 1DEKA 2CLCX 2IYRA 2ORWA 1F2TA 5L3QB 2CVFA 4FWTA 3BC1A 3EWSA 4TSFD 5E4FA 1P2VA 3ZQ6A 2BMJA 2O8BA 5E7IA 1NI3A 3FMOB 4MUBA 2P6NA 4MKIA 1DO0A 1GG2A 4JLDA 4BZQA 2QL6A 1F48A 4PHTA 3UG6A 2JA1A 1N0UA 5KSZA 3H2YA 4LBVA 5FBRB 2ZREA 1G41A 3I73A 4KCGA 4EKDA 1F2UB 1Z0IA 1QHXA 4G5OA 3K1JA 2WKQA 2ZJ2A 3U44B 3IEVA 5F9FA 5DISB 1WP9A 4LK2A 1A82A 4A82A 1K5DA 2J46A 2BM0A 2B7BA 3TBKA 2WOOA 2OV2A 4TQUS 3LFUA 4WIAA 2QSZA 4Q19A 5TVKA 2Z5FA 4M1WA 3B2EA 1CJUC 2FOLA 4QJ4A 2OE2A 5SZHB 2C78A 4UNRA 1ZINA 1P2SA 1Z28A 4HAXA 3R20A 4Q9KA 1EX7A 1OXSC 2OAQ1 3CNNA 4DJTA 4OQMA 1P62B 3I62A 3Q72A 3UANA 1OB2A 1U98A 2WMNB 3TW4A 1AZTA 1XCPA 3T35A 4EPTA 5L3RA 2D06A 3OEHD 4IVQA 1UADA 3NIBA 3LQRA 4XVRA 2GWHA 4HLDA 1R5BA 2DWQA 2GXAA 1G7CA 4QGAA 4W7SA 5FFMA 4BRWA 1VCMA 3ADBA 1N0VC 4MDFA 1T5IA 3FMIA 4Q1BA 4Q5IA 3D3QA 3PIRA 1OH6A 4XSGA 2H57A 1P2TA 4BFVA 5HZHA 1CJKC 2ZE5A 1C9KA 4G0NA 1CIPA 1S0UA 2CNWD 4M9QA 3ZZTA 2XOKA 1P7CA 3SJZA 1UKVY 3DMDA 2Z43A 2FNAA 2W6IA 4C2TA 2O0HA 1DTSA 5LDDC 3MJHA 4AWXA 1WBDA 3AVQA 2N46A 3P27A 1I2DA 1Z6TA 3X1DA 4LRWA 4OK5A 1UPTA 2O5VA 4JLVA 4RFSA 421PA 1XTSA 2V6IA 3W9YA 1GITA 4Q9IA 2IYSA 4TMXA 4KYUA 4BASA 1JR3A 4N0EA 4S35A 2O8BB 4EUNA 5LB2A 5KNBA 2KBEA 2ZRJA 2UZ3A 3QXXA 1E79A 1GDDA 1AS0A 2AK2A 1VTKA 4PX9A 4Y0VA 2BDTA 1XCMA 2YZ2A 2V3CC 5EE9A 1UKYA 4ERNA 2V6JA 1IQPA 4I1OA 5AWFC 2DFNA 2JCSA 2ZIAA 4Q4LA 2BEJA 4LBWA 1KNXA 4BLQA 1FP7A 1W5TA 2IUSA 2EFEB 1J8YF 2OILA 4LHXA 3WNBA 2ZI4A 5H68A 3TQCA 4AKHA 2J0UA 1WCV1 3ZDQA 1FNMA 3EG5A 4HB4A 4QJ3A 1Z0JA 4IVRA 1WF3A 4CEHA 4FD2A 4KHZA 1PZNA 2G9NA 1SVWA 2J7PD 3W6PA 1QHHB 3U3RA 5LD2C 3U7GA 3WNDA 1IY0A 5KU1A 1Z6GA 2JJ1D 1RVDA 2X2EA 1ZNYA 2REXB 3AUXA 3LNCA 3RS0A 1XD2A 2X19A 2WJHA 4A0FA 2ZS9A 4IDHA 1AM4D 2YWEA 2WZQA 3WMFA 2GAAA 3AKCA 1G18A 5AR1A 4RZXA 1XXHB 2W6ID 4H1VA 2AX4A 4HLUA 2H8KA 3MAAC 1E2DA 2RGDA 4KFRA 3GCGA 3BB4A 4KJZA 1HTWA 3B1VA 4OI4A 1QHIA 1NIJA 1Z0AA 5IK2A 1I4TD 4M2LA 1M7BA 5FOWA 3RRYA 5KNDA 3RANA 3E1SA 3BOSA 3CX6A 3UATA 4ZPXA 2G88A 1Q1EA 4M1OA 5EE3A 5KTYA 5B57C 2EFHB 3IGFA 1BMFD 4PC2A 2J87A 2JIZD 3AP1A 3N70A 1OKKD 2OM2A 4UNNA 1IN4A 1NJFA 3FMFA 2GZDA 1TTTA 1US8A 4A6PA 1SXJC 2F1HA 5FL3A 1BOFA 5KYKA 4F91B 4MRNA 3EAQA 4NHOA 3U6BA 1GM5A 3QKUA 2IK8A 2NZ8A 4WA7A 1GVNB 1HEIA 3HDTA 4IEIA 4I81A 4K8OA 1KNQA 1AS2A 2Z6VA 3LA6A 3NBYC 4JLNA 3UWKA 3QQ5A 1KI9A 2FF7A 1P3JA 3X2SA 3QVVA 2WKPA 2VP0A 4TQ9A 3KL4A 2ASEA 1ZIOA 3WXMA 4R71A 4N0DA 2EW1A 2PLRA 3A4NA 3FTQA 1XTQA 2QMEA 4GMDA 1VYUA 3FKQA 3T1VA 4XWOA 3THYB 4QBFA 1P60A 3THOA 2J59A 2B8TA 3SQXA 3ICQB 1JXMA 1M6NA 2QG6A 2ZYVX 2DWOA 2Z0MA 3KKNA 1ZW6A 3K9HA 3SBEA 4OJKA 1KI2A 3CF0A 1KOFA 2V55B 3UMFA 5HZKA 2IUTA 4EIWA 2D4HA 3MG9A 4RZ2A 1JECA 1I4DD 4B76A 4EPYA 4HB0A 2VYFA 2YINC 4QGFA 2BJVA 5BXQC 2IWHA 4QHTA 1XWIA 2ZS7A 1XTRA 2A5FA 2F1RA 4G5RA 4RZUA 5LBIA 1U8YA 4GFDA 2CHQA 3K0CC 3RWOA 3QPUA 2QMOA 3EZ7A 2JJ2A 2CHVA 2IYXA 4JVSB 3PEUA 1NMXA 5L3SB 2W58A 2G77B 4JMPA 2V1XA 1WXQA 4DC9A 5JFGA 4Q9JA 3WP0A 4H9GA 3VX3A 1E79D 4A15A 2F3TA 1DARA 3B85A 3D8BA 1S9DA 1Z47A 2ZR0A 4B2LA 1EFTA 4GT1A 1Q44A 2PL3A 2ZROA 5KSYA 2HDNB 2VO1A 1YQTA 121PA 4F92B 2ZU0C 5CDFE 2CEAA 2BKUA 2O8EA 2IHYA 2ZETA 3IQXA 3DM9B 3MD0A 1F5NA 1OH8A 2Z4RA 1W0KD 5FPSA 3CO5A 2XXAA 4JYBA 2GHIA 4JLJA 521PA 3GLFB 1II9A 3VHXA 4D0LB 3QXSA 4GP6A 3RDPA 3EC1A 2ZJZA 5FOVA 1LVGA 3T34A 1CULC 4ZDJA 4TLAA 3WP1B 5LD2B 1NN0A 3BRWD 3IKJA 1NY6A 1KTVA 3PCRB 5JS8A 5BYKA 2XNDA 1NLZA 2B6HA 5G40A 2IS6A 1XF9A 1XP8A 4URVR 1MT0A 3K70B 2WM9B 1ZYUA 4B73A 1ZM7A 1TEVA 1KKLA 1VG0B 3EA5A 3W3AA 2IYVA 2F6RA
chains in the Genus database with same CATH superfamily
1SR8A 2H51A 1HYQA 3WSWA 5HIJA 2OCYC 1KEEB 4G81A 1EESA 4LNHA 4FDTA 3EZ6A 2BR5A 4MYCA 2PRKA 5FADA 3JQ8B 3UAXA 1DG1G 1RHQA 2WAXA 3QI2A 1EFDN 4EY3A 3G8AA 1GCIA 4YJ3F 4UEQA 3QNWA 1CUYA 4M88A 3AOEC 3T7JA 2HWYA 4GMFA 4PYKA 5J2UF 1KI1A 1GTG1 3FW1A 1CYDA 4UBNA 3SX0A 3VX4A 2EF1A 1UFKA 4YRIA 1USGA 3NEPX 5DLEA 1GTZA 1F9EA 3ZDEA 2QTAA 4TYQA 3P5SA 3TW8B 3SICE 3EBLA 3WOHA 2RI0A 2ZRAA 1T25A 3GRCA 1X1DA 3UWOA 1DBSA 2EFCB 2W2LD 4DJAA 1VHJA 2KWIA 3BQMB 2F48A 3EGVA 3C3AA 4MV5A 2FLWA 3KZNA 4EG3A 2BSAA 3I2YX 4LZPA 4BBPA 3D4IA 3RG2A 2XWPA 2DHRA 4HDQB 3W5IA 4Z9XA 1GEEA 1KS2A 1XR3A 4P4TA 1JAHA 1U9CA 2JGFA 4Y98A 2JIPA 3R76A 2QUAA 1QTIA 1P9OA 2QX9A 3GNSA 4LDJA 4XM1A 4U8GA 4D9CA 4W82A 1LI5A 1NGSA 2A14A 2JFNA 1K7YA 2P1RA 1CZKA 3FTDA 4L1KA 3O92A 3S8MA 3W5JA 3FPCA 1QVRA 2FPOA 1MQSA 4NENA 3MUNA 3W6UA 3WIOA 4O2BF 1XTJA 3IAS1 4AZWA 3NTVA 3K8OE 1RABA 3UZUA 3HUDA 4KVAA 4ZDKA 1FUUA 1OY1A 2AHRA 2ZP1A 1Y5NA 1VHTA 1GARA 4GLJA 4UZFA 1T4GA 1LU9A 4WCFB 2FDCA 5HE8A 5KB3A 4E21A 3D5QA 3TCXB 4HQKA 2EDCA 1MO6A 4EBFA 1YRLA 3RSZA 3LS2A 5LYYA 1MC5A 2VJOA 2ZVPX 4M8SA 2ZYHA 1EUDA 3C8ZA 4YROA 2AN9A 4URYR 3G0DA 2CEKA 4BYMA 5LP6B 1GKLA 2F90A 3CKKA 3BKWA 3F5SA 3QYAA 3DS8A 4R8SA 2IUFA 5EKXA 1NJ6A 2GF9A 3WNQA 5BR1A 3FFXA 4EENA 4Q93A 3LDGA 2OFFA 1OXTA 2AEMA 2QN9A 5AVSA 5JS6A 4MUAA 4MYRA 1QFSA 4AF7A 1WBJB 3U6KA 3KXIA 4IIXA 4DLVA 4WGGA 2QPAA 2C94A 4GNRA 4MCAA 2PL5A 4O4HA 1V0JA 3AHJA 2XADA 3Q41A 5F5XA 4XLTA 4MP8A 3FH0A 4ZOLB 4GX5A 1JEYA 2OECA 4LYJA 3RVPA 3ZHYA 3PITA 1QPBA 5IU6A 1DAPA 4IYJA 4XQEA 5IC6A 1EVIA 2GBLC 3IP1A 4AVYA 3FUWA 4B7XA 3GT3A 2QN1A 4CQLA 2ROQA 2VJKA 2RSLA 4AMYA 2UYCA 1DSSG 1FFXB 1A2OA 3BWBA 1WMBA 1W85A 3EOBI 3KLMX 2H06A 3AERB 1E2MA 4ARBA 1TECE 5JAOA 3A1UA 1FSFA 4KV9A 4DFDA 3BFVA 4L16A 2F8LA 4XM0A 1R9MA 4WRRA 3GOQA 4URXR 1ZI9A 2GLXA 4HBGA 1E77A 4YTEA 5JRZA 1HDXA 1T0UA 2WUFA 1DAFA 1YFKA 1T0HB 2XMBA 1RE1A 4B46A 1TVMA 3MWLA 4X54A 1RWXA 3BB3A 3LCRA 3A58B 3OUZA 4M60A 5LQKA 2NMVA 4GEKA 2AKEA 2IXFA 4GKAA 2EKQA 4CLOB 1R64A 4WHMA 1KAHA 4CIDA 2C95A 3Q98A 3NCTA 2GA9A 4DABA 4LOJA 1N5JA 4OQLA 3NHSA 4JI3B 4LWZA 1THGA 1PR6A 2X77A 1E1QD 3DBLA 3P4XA 2P2GA 3TQOA 2VF7A 3I5MA 3LLSA 4FGZA 3ZXXA 3PFKA 1Z8NA 4Y6RA 2ETXA 1P0FA 4WGFA 1DCMA 3S44A 4S1PA 3NT2A 2Y9PB 3ZLJA 1H2FA 3G2KA 3UB4A 1MH1A 2ODEA 1QHGA 3AVPA 3CN7A 4KNVA 2B5WA 3PKZA 3RRZA 2IYYA 2XCIA 3H2IA 1MEOA 4QJIA 4YCDA 3G7SA 3VYWA 4PZPA 1IUKA 3KVRA 4WK2B 3QHPA 2RHWA 2ZRIA 3B78A 4UPVA 4E22A 2DLCX 2ENWA 3EZ9A 3B1WA 3G23A 2AG5A 6REQA 3P2JA 1U02A 5A7HA 3UCFA 3SLGA 4B8WA 4UW9A 2BHLA 1T9GS 2H4JA 4ZZ0A 2IYTA 4BFTA 3K0AB 1YQQA 2Y2VA 3R5HA 4CMEA 2BGWA 4YRSA 4D92A 4YXWA 1ZM9A 1BYUA 3AF1A 2PCLA 2Z8XA 1T5LA 2P5UA 3GVPA 3PXDA 1H4VB 4HDNA 2LDXA 4Q6BA 2XSZA 1JKMA 4MAMA 1WM1A 3QPBA 2PUCA 4M0LA 3KJGA 4QREA 2BEWA 5G1PA 1GYRA 4JN6B 3UH1A 5H4GA 1NA5A 4WZAA 1TLLA 1AXEA 1X1EA 3DE6X 1DQNA 3QWAA 4HNAB 4C4SA 4EKIA 3OZEA 4KR0A 1E8MA 3AOEA 3KZXA 2W2NA 1BHQ1 2X2OA 2RGAA 3IRVA 4AG5A 3CVYA 2I66A 2XMGA 4OFBA 2P9TA 4GOKA 1VJTA 3DMGA 1MTOA 3I92A 4DR6B 4ON9A 2EP5A 1T2CA 2O8EB 3LVQE 4BDSA 4Z4QA 4IWNA 3ZZUA 1CUAA 1H8HA 3FCYA 3LP6A 1XD9A 3GLGE 1IBKB 4JUBA 1SCNE 2M32A 3FPEA 4N39A 5ERXA 5H82A 3AVXA 4EYSA 3KEFA 1CY0A 3DEZA 1D2HA 4YAIA 1QLJA 1EXWA 1MW8X 1DELA 4FFWA 1DV1A 4IOLA 4C01A 3ZDXB 3G0BA 3MUFA 1BXZA 4AUEA 2VHVA 3IKLA 3SF0A 2XH8A 1Y4SA 4NESA 3ZD9A 1DCTA 3R7FA 4D3YA 4HEHA 4HPJB 1HTBA 1YR7A 2JAUA 5HA5A 3TPFA 4QTZA 3F6CA 1A9RA 4IBOA 4C0JA 3MJDA 3I2KA 2QAGC 2YZKA 4RY9A 4PAMA 1UF9A 3GYGA 3Q7SA 4LHVA 3GLHE 3O90A 621PA 1ZAKA 4V24A 1E2HA 2XVMA 5CDGA 2NWQA 4GPAA 1M2VB 4KYVA 1Z6XA 3AVOA 4UNRA 1GILA 1PFGA 1ZKMA 1CJCA 2HHAA 2KE5A 4KXQA 3FZQA 3VZCA 5K8IA 3SG0A 4OHMA 4W9NC 1T5DX 3NWOA 4GSKA 5LBTA 5U9CA 1UODA 1N77A 3EDYA 1GZ7A 2OZEA 1P2BA 3LXXA 5J1SB 3N8HA 5IN5A 3NWJA 1P5RA 3VR6D 5DX0A 1GPH1 1SCJA 3PYXA 3RF7A 3TIFA 1AX9A 1PGOA 1QS0B 5HRCA 3T1TA 1Y7LA 1HQCA 2V45A 2PXAA 2FRDC 3HB4X 3O4JA 3FFWA 2B82A 3CPSA 3BGVA 3U9SA 4BVGA 4PRLA 1ONBA 3B1JA 3WQBA 1NBEA 5A5FA 5C8VA 8OHMA 4IINA 2J09A 2YHIA 4NABA 4AAYA 4E94A 5C8YF 3RVSA 1CY8A 4NZ9A 5C1BA 1K4YA 2GKSA 3BWVA 3PNKA 4NICA 2DPMA 4DR1B 2B1QA 4GKBA 1YDWA 5M34A 1YACA 3HXLA 1A5TA 1WUKS 3NTUA 3G2JA 4KDRA 3PTZA 1YI0A 1G20B 2YWXA 4UNSA 4W9NA 3F5QA 4IUCS 4EB3A 4EHKA 3C3XA 4P22A 1CTQA 4BVAA 5D7BA 4CIAA 3LHKA 4LGMA 4EX6A 1QZXA 3PUHA 4WNIA 4CM5A 1B74A 2VJDA 3DKVA 4G0OA 4MNTA 4YP5A 4AMGA 3BIFA 3C4QA 1X2BA 3GNTA 1PQUA 1L7XA 3OPMA 4MW4A 3VTFA 2B99A 3ZCSA 4IS2A 4CM9D 1YR9A 3F96A 1DDOA 1E8NA 4IEFB 1LZLA 2IVFA 2FPLA 3NVMB 1DAOA 2BTOA 4RX1A 4UHJA 4JI5B 3KB8A 2FW8A 1THMA 4HXGA 5D6NA 2E9SA 3TQFA 3HC7A 3Q5EA 2IH4A 1WG8A 3LF2A 2ZAIA 3NOXA 5I4KA 4JZYA 1YDGA 3TX6A 3CX3A 5BW4A 3M3PA 3X1YA 1OPRA 5TF4A 2ZRQA 3FYTA 1SXPA 4TTVA 3USES 5FLKA 3LW8A 5EUQB 4RVCA 4Q18A 2QL9A 3PGMA 4E3WA 2LKDA 2VEOA 1J9EA 4MKFA 1IOLA 4N54A 3HVJA 4IIJA 2HMUA 1HQKA 1RXWA 1E96A 2JBWA 3P9XA 1OCEA 4MKRA 1Y6QA 2XE4A 5EKDA 5EKSA 1RQRA 4C6SA 1DS6A 4XX1A 5TS2A 3INGA 1TZBA 2J3KA 4WKPA 3VNBA 3NVKI 3T38A 3OE7D 1Z5GA 4AJKA 2H7VA 1N6RA 1F2TB 3HI4A 1JB9A 3KALA 2VRWA 1D1QA 2DX7A 2QN3A 2WJZB 4R9VA 3TJZA 5JHGB 4E51A 2BZGA 1AY0A 1FLNA 2HI0A 2R8PA 5CHYA 4PCVA 1QTRA 4LUCA 3PXAA 5BN1A 3N3BC 4DCNA 3I42A 1IVNA 2D1FA 2YV2A 3FOWA 4PYQA 1Q3TA 2HCBA 1HPLA 2P41A 4GVXA 4HQNA 4M6WA 2F1KA 4QBKA 5TC4A 3T3NA 1ILEA 1Z08A 3HCCA 5LXTA 4U2DA 3ZIUA 4Q47A 3K0SA 2XUAA 2O3TA 3A6PC 5LPNA 2PD6A 2WV9A 3H0EA 3OECA 2PX0A 4NBVA 5JWOA 1FSPA 2LP4Y 3I6MA 2Q9UA 1E4OA 2GH1A 3RRMA 4IJ5A 2VNSA 3IKMB 4Z9FA 2WAMA 2EXXA 3UJPA 3H8VA 1RLOA 3U4QA 3FDFA 3RAGA 1V7ZA 2GRAA 5K3SA 3URMA 4H35A 4AT1A 1NVKA 3NASA 3DDOA 3QE3A 4N82A 1OV4A 3G7UA 1FYEA 2XTAA 4DNQA 1FUIA 1I2BA 3VUEA 4CZ2A 3N1UA 1LLCA 4R2KA 4NFYA 2FQWA 4M0EA 4B84A 5B5SA 4RWZA 1NR1A 5T8KC 1GZDA 1OAOC 1RZRD 1V41E 1ZVQA 3L2OB 4PO8A 4W9MC 1ECGA 2N3ZA 1PUIA 2MSEB 2WFAA 3BBLA 2Q5EA 1JRLA 4LBZA 4O25A 4FOSA 4TLEA 4OL9A 1X87A 3VSEA 2HO5A 5E6UB 2D5BA 2O1EA 4MYTA 5JYDA 3NDBB 2YZNA 2AKYA 3ID6C 4BNDA 3ORQA 1SULA 4JBIA 4XWYA 1OGYA 1QP8A 5DV9A 3TNFA 4ZDIA 2WD7B 3C15C 2G1UA 2AFHA 3DKKA 1X6VA 3TCNA 4E2ZA 6YASA 3CEHA 4U7TB 3DZGA 1YFJA 3WGMA 2V8OA 2DFVA 3TB6A 2AF4C 3A2LA 2P1DA 4WECA 1KFCB 3BSYA 2JFGA 2E4ZA 2WOJA 3PQDA 3NORA 4IQGA 4PS1A 5EC8A 1AURA 4D5GA 2AI2A 3UKDA 1GTJ1 3HKEA 3S7ZA 1NVVR 1WKBA 1NVXQ 4RXTA 4NYIR 1N6HA 1LRKA 2V8BA 1RSZA 1SCDA 2ZS8A 1W1WA 3ICPA 4EUEA 1UZLA 3GLHB 2NT3A 2ENUA 4PLPA 5B6PA 1SPBS 1KHHA 2EL7A 1M8PA 2DQKA 1G8SA 2XX3A 4UVGA 5C31A 2GYUA 2XGMA 3KZMA 3HKBB 2OV4A 5IJAA 1AV7A 1NVTA 5DNEA 5I7RA 2GPBA 1FDSA 1HG0A 4P38A 1YCGA 2RJ3A 2XEXA 3HJNA 5AW3A 1SFRA 2BGNA 2I2BA 2PUVA 3KJXA 4BGEA 2MSCB 5AVYA 3P94A 2BGIA 2X4LA 3ES9A 5HKLA 1XDUA 1J06A 4H1WA 4HLQB 2WIJA 5JZSA 4UUPA 1HSZA 3MINA 3AB7A 1GAEO 5BVGA 3O75A 3C45A 1OKKA 4ZT6A 3CHYA 3B13B 1L7DA 3UK2A 1TGYA 2OORA 3S40A 1M8GA 6LDHA 2ZI9A 4HK4A 1N2JA 5ANRB 2Z83A 2BIFA 2VTEA 5FBVB 4ZYXA 5HOEA 3F8TA 1JDSA 3C87A 4BB6A 1NJ2A 1RMTA 4WJKB 1PU2A 4C3ZA 1UZAA 5F4BA 4ZN6A 1X9GA 4X1KB 4GICA 1AHNA 3CG0A 1DTEA 1XRPA 1ODIA 4L3OA 3ZDDA 2ZFUA 3AVTA 2CMGA 1AKQA 1N4AA 3ZY3A 3PRYA 1NL3A 4ICIA 3LIIA 1XDWA 1ONOA 3CH7A 1C7RA 1KBZA 1N25A 2IHUA 3AM3A 3KQSA 3JWPA 4ISBA 4FSHA 3ZE8A 3W2GA 1NF3A 3ZE0B 3JR3A 1LNSA 4I6GA 1BFKA 1EWKA 2WD9A 2X1VA 3VAYA 1N57A 1UBNA 3S5UA 1VIAA 3WV4A 4EH1A 2GJSA 4FXPA 3Q7QA 3TLKA 1M8KA 1XZQA 5A4FS 1RD4A 4MGEA 4IILA 5CM2Z 1JWLA 2EX4A 4BMPB 4AJOA 2FPKA 4GDMA 3LT4A 4Q15A 2B34A 3HWX1 2VPXA 3B9PA 4R05A 2Q7XA 2WWGA 4YPOA 1QJ4A 4GEGA 1KO7A 1EWTA 4CYMA 3I9NA 4RH3A 3WGIA 3FBGA 1E7SA 2J1LA 3GF4A 3AONB 4GZLA 4WQMA 1KJJA 2MINB 3KCQA 3EWAA 4U2GA 4RZ3A 1VBKA 4E1VA 2F2TA 5JNRA 1E5XA 2PLNA 5CAEA 3KNZA 3UOAB 1HKUA 1XALA 1ODFA 1OPXA 2CNKA 3FVTA 5HEKA 4BNGA 4BFYA 3CZCA 4D4MA 5BOSB 1T9ZA 2GZ2A 1Y8ZA 3GFTA 1XZJA 2ZB4A 4H0CA 5G02A 3HR7A 3JQBC 2APJA 1PVDA 3TG2A 3JX9A 5EZQA 3C7TA 2X13A 3R23A 1IK4A 4IDCA 5D01A 4TRMA 1H2RS 5AK3A 4F8YA 4J07A 3WKDA 3I5YA 4XGIA 2W48A 5AESA 3OETA 2QJOA 4NEGA 3ZQJA 1YS6A 2QYOA 3U60B 1E2EA 3C5EA 4DDKA 1IHYA 2QNRA 1RAEA 2RGUA 1VE3A 5K7SA 2NYAA 1AXRA 4NS1A 2Q9AA 2CL5A 1G3QA 4CMBA 2EQBA 1OI4A 3D02A 3IEPA 5JD3A 4DBZA 3RLIA 2IIPA 5DW3A 3IEKA 1SC1A 2ZEJA 3P71T 1M6EX 3F73A 1HDGO 2FWPA 3UBMA 3RRNA 1AMNA 1IZ0A 1JS1X 2I3GA 1I32A 1PNOA 3D4PA 1BH2A 3ZX5A 3ORFA 1RHMA 2GBPA 3BRWA 3OFNA 4PAOA 1XVVA 2PCJA 4DAOA 3HXQA 3MJCA 4REQA 2WJPA 3QXGA 4KE7A 2PKWA 3IUPA 1LJLA 4MHOA 2GN6A 1S3GA 1JHUA 1WMAA 4P33A 1A72A 2PJDA 2ZUCA 2O2DA 2PRIA 2BFBB 1SU8A 1CUEA 3SQNA 4L7VA 2HW8A 1Z39A 3EFHA 2JFUA 5CBPA 3GEHA 1QGAA 2ZTHA 1TJ5A 2V7QD 4KZKA 4BN5A 4DEVA 4LCBA 2YS7A 3KQKA 4YS6A 4TTIA 4A9AA 4TVKA 3EGIA 721PA 2Z2XA 4NAUA 3HVRA 2J6BA 1O95D 1FX1A 1NLFA 1Q95A 1PHRA 1JZQA 1TMOA 2XA9A 1NMYA 2XUJA 4C6RA 2DWUA 1GO2A 3LUCA 1QP4A 1U8UA 2PT7A 4RGYA 5CT6A 5AW9A 3RROA 1BX1A 2A1UB 3BMNA 1AHIA 3OMXA 3VZPA 3HVHA 5KQGA 5AHWA 4QHYA 3MNFA 1DFGA 4MWDA 1ULHA 1DKRA 2BE7A 3AIKA 4ER5A 3OEEA 4QUEA 2WT4A 3GC6A 3NAZA 1AQLA 4L07A 4OXQA 4YUVA 4RMHA 5I9SA 1H4QA 5C37A 3SYKA 1XMVA 1E94E 4BECA 3URKA 1HYEA 1W44A 2IS2A 3K2EA 5KDLA 3RUDA 3TIIA 3U31A 2VSQA 3JTMA 4Z53A 1G291 2ATCA 3IUBA 4XPIA 4C7VA 3PGLA 5DHUA 1HC7A 1LPMA 2AEFA 4ETMA 2QK4A 4N3GA 3GLKA 1OU0A 4LZNA 3RRXA 1PE0A 5D00A 3UGJA 4NBRA 1AZLA 1K0FA 4PNEA 4UTNA 2OLKA 2J33A 2GI4A 4QHSA 3WBKA 2VJYA 1XPUA 1QORA 2Y4OA 3OEHA 4ND1A 4KWCA 1PQ4A 4HGZA 3RSQA 3UW1A 4HDRA 1PRYA 2B4KA 4L8LA 4PY2A 3VR3A 2VH5R 4UVHA 2EJBA 1XZEA 4PGHA 1I9GA 3V2HA 3D6JA 4XOUA 3BREA 2WSMA 2PG3A 1RRMA 3NJ4A 4R8LA 3ROTA 1NSFA 4BLOA 1JJ7A 2HMSA 1CY6A 2J5XA 5JSFA 1FC0A 2XF8A 5CRIA 4RK5A 2G28A 4LFCB 3ZLVA 2H5LA 1SQ5A 2VKQA 5JS7A 1J0BA 2UZIR 3EGOA 3L8ZA 5GONB 5K8LA 1FFYA 4K9MA 3ZHCA 4XWTA 4YMLA 4MVJF 4XW2A 1SKBA 1C1XA 1GZ3A 5AM5A 5ESWA 4LFAB 5B1EA 3GT4A 4N7RA 1U8ZA 1VSQA 3RSCA 3W2TA 4LCJA 2HA5A 4NNJA 2H3HA 1XEXA 3VPDA 3DZCA 4E14A 3GJ8A 5IVPA 4DKXA 2C29D 4HWRA 2VJBA 1G8KA 2WTXA 1L1EA 1U2SA 2OBBA 1BMTA 3NYIA 4NDZA 3WGUA 3EVAA 1E3WB 4DSTA 1G9TA 2DAPA 2OHOA 4WDQA 1NWHA 4KTVE 3LCJA 4LHSA 1UAGA 1IXRC 4H3SA 5AVRA 1RQNA 3W6OA 2XF2A 5JW6A 5CEEA 4X62B 1FCJA 2DGDA 4MVXA 3ANLA 4EMUA 5MFPA 4F2PA 3F46A 2W2OA 4ASUD 2FMKA 2ZITA 3OM0A 4D79A 1Z6YA 1E1KA 5KDOA 3SDSA 1QMGA 1GPLA 2RK6A 4TV8B 3L0DA 4R2JA 5SY4A 3RC3A 4FOOA 3I23A 1MMFB 3HL0A 2A7QA 4QEDA 4XPZA 4CTMA 2VSNA 4CM1A 2PGDA 2Q3FA 3NTOA 4B17A 2CCKA 2HQSA 3CF6R 4X1IA 1P1IA 1V1MB 1ZKDA 2D7JA 2WU4A 2UUAB 1EFLA 4EAQA 4IF6A 5CA0A 4AUNA 4HNVA 4G0QA 4S12A 4IDNA 4ZQFA 4ZAXA 3ELBA 3K8QA 1EVQA 4XB6B 1W0KA 3SR3A 3BHNA 3EF0A 2VRNA 3D64A 4LVNA 2QTBA 3Q10A 2IZ1A 2MU1A 1XAHA 3GLQA 2HNBA 4L75A 4PYIA 1ZBDA 4IX1A 3TWOA 1CB7A 2PX4A 3EPRA 1HY3A 1QP7A 4GI5A 1AKWA 1AKRA 2B94A 4R41A 2ZG6A 2QW1A 2P35A 3PFFA 1DC7A 3ZDRA 1OT5A 1QH0A 3OPYB 4B3MB 3PX7A 1Y9AA 2QNIA 4J16C 1CUJA 2JZNA 5M04A 3HK2A 3FYDA 4PSVA 1ULUA 3W6ZA 4X97A 3BGDA 2GAJA 5HBGA 4XARA 1P5FA 2OV3A 4CF5A 2AG0A 2Q29A 3F6YA 3S2YA 3FTFA 3I62A 2ZZNA 4KN6A 1JQJC 2PXCA 2ZZKA 4ISCA 5EUCA 3FNGA 2QD1A 3QLVC 4Z49A 3SHWA 2XKAA 2X3YA 5ARCA 3KX2A 2XGSA 3HWWA 4B47A 5E8RA 5IDXA 2DR2A 2VJQA 1FRNA 2FDXA 1HDOA 3K0KA 1SUSA 4K0KB 2WWRA 4N48A 3BHJA 1ID1A 3HCPA 3WA7A 3B3GA 2KI5A 2A1IA 3ISTA 4IR7A 3PJRA 1KERA 4PCUA 1T6NA 2AMLA 3FFTA 1Z38A 2P9FA 3V7UA 3LLCA 3Q85A 4AWBA 1P9WA 1ZS9A 2WE7A 3KVYA 4QUHA 1O77A 4FMCB 5EYPA 1LW7A 2C61A 2FUG6 1U6IA 1WE2A 2GEVA 4DN6A 3ZVNA 2C2XA 1FXSA 2ZBDA 5EHZA 4J6FA 4HAWA 1V3UA 1E0JA 2F43A 4OOFA 3WKCA 1CUZA 1Y6ZA 3WV5A 3I2GA 2NTVA 2WNIA 1R0BA 3K1YA 5SZKB 4BNHA 3GVHA 2QIOA 3E7FA 3ILHA 5DHRA 4ZKDA 4LYFA 2IYOA 4UAJA 5CFRA 3VNUA 3R8XA 2PUEA 1Q17A 3L84A 1IONA 1A96A 2QD3A 2XJ4A 3I01A 1EJ0A 3R5XA 3VR0A 3KUCA 1K66A 4D81A 4LC1A 1H6CA 3MYYA 3QHAA 4TXMA 3UH0A 1JSCA 3FDJA 3UJCA 1A95A 4PQRA 1V9CA 1WD5A 3LKDA 5DZSA 3OIDA 1NVDA 3D3WA 2YFYA 3DR3A 1K5GA 3DVAA 1U2RA 3EIFA 4O1IA 2Q2OA 4O4HB 4S24A 4AP9A 4EUHA 3HWRA 3N7UA 4XGKA 2IPXA 4CL3A 2W6ZA 4TYWA 3NYWA 4NBLA 5K3EA 4GF5A 3KB1A 5CGQB 4LG1A 5EP2A 1EU1A 4IV0A 1CZLA 1G8MA 2W43A 4JNKA 2QQEA 4Y9TA 3TBFA 2QL5A 2J45A 1OXXK 2GM4A 3RVNA 4DB2A 3FYUA 4LDQA 1WVGA 3WGHA 4PG6A 3UMYA 4U7PB 4ZYZA 1GZUA 3C43A 3RYHA 5K51A 5LU9A 4HWTA 1EJBA 2ZVDA 3NU1A 4K26A 5DASA 1BKSB 2W6JA 2PGOA 1NOKA 3IBCA 2DT5A 4B35A 1LNZA 3CLHA 3KLNA 3WTBA 1J9ZA 4F46A 1LS1A 1M7HA 1UEIA 2FG7C 2WC1A 3K53A 4FUTA 4DXAA 1YZGA 4K9NA 3OQ1A 4NYJQ 4MS3B 3DAFA 2F17A 4NBWA 3CZRA 4B3XA 3ZWNA 3MHPA 3FCCA 1X1RA 3OVMA 4KUEA 4UE6A 4HS9A 1Z88A 1VP3A 3UM9A 2NW6A 4OKNA 1YJBA 3FHLA 1TLFA 1YVRA 3L1JA 1SA0A 3DWIA 3SFVA 3VVCA 1HNNA 3TIVA 3VPCA 3DDSA 7YASA 5IZCA 2F43B 4ARIA 4X1KA 3DDUA 5IW8A 3TKLA 5IDYA 1M6VA 3H5TA 1QV7A 5I8WA 4OOEA 1MENA 2WJYA 2HUPA 4KIUA 3D8TA 3HUTA 2Q2NA 4H6PA 1H6AA 2Y9MB 2ZBFA 3PQCA 1LS6A 5J4YA 2GZAA 1PV4A 1K3UB 4NPCA 4BMDA 2D8AA 2PZAA 3MTAA 1T2AA 3BE5A 3EH2A 3V33A 3KU4A 3FRJA 3GZNA 4JIMA 4IJQA 3T61A 5L3SA 3JPWA 2OGTA 1O6BA 2EVWX 4KMSA 4QDUA 5EQJB 2B4RO 3G2QA 2XMDA 2REBA 5C7IO 1FLAA 2QZZA 1KU6A 3C3CA 1LFDB 1RCTE 3JQDA 3JQGA 3PL1A 1XLTC 4G5SA 3UUFA 5I4IA 4DKJA 2AWNA 5DYNA 5DTIA 2F1JA 5PNTA 3M81A 2JANA 4QQFA 3ZGVA 5BSWA 2E85A 1OT3A 3M8KA 1O58A 3F4KA 1R15A 3NNNA 4V0SA 821PA 2IQIA 1XU7A 1P1BA 2MT9A 4OHRA 3HYRA 4JH0A 2JPDA 1RZRA 1ELOA 3FWYA 3UK1A 2W2TA 2AWOA 1ZJ4A 2QRUA 3F5MA 3GLHA 1JF8A 1JIXA 1P4HA 3P0FA 2VP5A 5AOVA 4BVLA 5C0OE 5L40A 3HDYA 1UM9B 2YV4A 4UUQA 5C5DA 4WH0A 3F9CA 6PFKA 3EA4A 2VL7A 4U02A 4OQFA 4WVLA 2IYLD 4BJ6A 5CB6A 2AZDA 1PQWA 3BILA 2WT9A 3UJHA 4AS3A 3DVQX 2XOEA 4RY8A 5JPCA 1E6MA 3RYIB 1MABB 1Q0SA 4FU0A 3RW9A 3OT1B 1E3DA 3REGA 3EAFA 3LE8A 3VYVA 3GHYA 1ZNWA 1SVKA 3BH7A 2ADOA 3HJHA 2Q5IA 1K3FA 1T8YA 4JR0A 1OV6A 3ZWMA 1YS1X 3DVLA 2FW9A 2VT3A 4ZO4A 1I4LD 3HV0A 1WA5A 2WNHA 1B16A 4H7EA 1L5MA 1R0WA 4OD0A 1QIDA 4W6ZA 4DGQA 5J2TA 3EG9A 4OB6A 4C7MA 3QG1A 3F6BX 3H2ZA 5L8VA 1PEYA 1RI5A 4LZJA 1YT5A 1EFRD 1TJ3A 1GRNA 5J4VA 2ZSUA 3KJZA 3OPXA 1YCHA 5IYZB 5FRDA 4I1RA 3REOA 2FPGB 3EW7A 2MSLA 4GXQA 1EX9A 1EDBA 2V96A 1M5RA 3TRFA 4DZZA 3REQA 5AM1A 4WXMA 1ZH4A 2DFLA 1WZUA 2D5LA 4YUAA 5TQVA 4FIZA 3LZCA 1KEWA 1YIAA 3D54D 2IOFA 4NONA 5E38A 4E88A 1TTQB 4DSUA 1FB5A 2C8VA 5BWBA 3GRYA 1EIWA 3BF7A 1EK0A 5CJ2A 1O94C 5DXJA 2QRVB 1H5NA 4ZKEA 1UPAA 1QIGA 2YH2A 3JARA 1BDJA 2PUBA 1I0ZA 3KU1A 1XN1A 2QOEA 1HG1A 4YJDA 3R9KA 2GZRA 5IJ9A 3H8SA 3AKYA 5C1OA 3TVYA 1B23P 4FIDA 2UVQA 4Y2TA 4G0VA 4B75A 1FP4A 1RZ3A 3TRHA 4ACAA 3UQYS 4BE7B 5BWNA 1PJZA 3QEAZ 2B20A 3FWZA 4UFPA 4BQPA 2HPAA 2NO4A 1N9GA 2WFLB 4IL5A 4DLRA 1YZQA 1D8AA 1QZUA 4LOAA 2RHGB 3FG9A 1EQ2A 2OGZA 4GYJA 2ZIXA 4YNBA 5DCLA 5EWMB 1K4KA 4RPKA 5AXDA 4DADA 5D3KA 5I6DA 2IUEA 1W75A 2Z56A 1GTSA 2XZTA 3T54A 1SEPA 3RGGA 4AJHA 5DRTA 2PVPA 3TL2A 5ENDA 1SKYE 1Z75A 2JGMA 1VYHA 2PWPA 3QEMA 3KV1A 3CF4G 2LCQA 3TTTA 2G6TA 1K5HA 2J67A 2AGVA 4R2WA 2YIJA 4DUGA 3HYCA 2NOAA 3VR5D 2WYVA 3EEYA 3D7LA 1D04A 1N2CB 4WLUA 2JI7A 4QXOA 1T2NA 3H5VA 1THZA 2OAGA 4W5WA 3KCNA 1NF8A 2Q62A 4LYHA 1J00A 2Q2WA 1XFAA 1IAVA 1J0CA 1UC8A 4C78A 1TZCA 1J2JA 1K98A 1U4NA 4FPXA 1PJ4A 1T1RA 4C22A 1CY1A 4EGJA 2HQ1A 2VYND 1RYZA 3PCTA 5GONF 3TTXA 1H65A 3Q1LA 4ZOEA 1XMXA 5THQA 4Z3KA 4C9BA 3KLOA 1LPPA 1KQOA 1ZVJA 3G8DA 3K31A 3PDWA 4RV5A 4X1YB 5AJYA 3TD2A 3TLAA 2BJWA 2E82A 4DYHA 1UFRA 4QQKA 4DCOA 1S2OA 2HBYA 2VTKA 4R1UA 5LP6C 3PQ8A 3L0ZA 4I14A 3KETA 4MCHA 3PDIA 3TLZA 1JLLA 2IS4A 3LYHA 1W87A 3BIOA 1XEFA 4KWIA 2E4YA 2JG3A 1DTWB 5HBRA 3MERA 3F6PA 1TOAA 3QX8A 3FB1A 4IOKA 4YALA 4OSEA 3KVVA 2AXEA 1T3LA 2ANBA 3BMQA 4NDNE 5MFZA 1YK1A 2W00A 4RD1A 2GD2A 3UYLA 2INGX 3WDKA 4DLLA 1O7JA 3T0IA 3QX3A 1DJMA 1H2YA 2WKWA 5KTNA 4MQBA 1CJTC 2W2LA 4UQOA 2G83A 3R77A 5JROA 5I9TA 2JEZA 4G1FA 3PFNA 3WISA 4DEXA 3V4PB 1YNOA 1BFDA 1ML3A 4ZV9A 2JKVA 1MV5A 1V6CA 1NTOA 2OGSA 4DIUA 3MOGA 4K0RA 2FKNA 4AYXA 1UXKA 5JRJA 5LN1A 1FFGA 3ZWWA 2X7JA 1PYGA 2GARA 2O4UX 2P0EA 4FMCF 4KFSA 3I05A 3JQQA 1PTKA 5T4HA 4CKEB 4DG5A 2VAMA 2ATXA 1J49A 3GDOA 3UKOA 2Z57A 5T8KA 4AJLA 3GL9A 1PR4A 1RYFA 2Y2UA 3KZOA 4I4LA 4RHTA 3SYRA 4IFEA 3BQNB 3NYRA 3NEYA 4RTQA 4QA9A 3U39A 4NATA 4RO0A 3BTOA 4K05A 1T9GR 5FF9A 3TNYA 2AI3A 3X1ZA 1VJGA 1C0IA 1DQRA 1CS0A 5CA1F 4I99A 3UPDA 3B7WA 5CMLA 1XQ9A 4CF6A 2Z2JA 1A9PA 1UKZA 2GNAA 1OFVA 2VUHB 3FMPB 4J76A 1B6SA 4K6HA 4MUKA 4M1MA 4O2AB 3JS5A 4NC9A 4OU4A 4U00A 4V0RA 1R4ZA 2E5WA 2PH7A 3MZ0A 4CBVA 2H2HA 4DV2B 1SBYA 4KE6A 1TD1A 4IOJA 1EXMA 1TUIA 3NKLA 1N3YA 2SKDA 4NE7A 3VO2A 4R01A 5BR8B 2XOKD 5A5EA 3CCCA 4P2GA 1S8FA 1UOQA 3WJ1A 2OQVA 5LZ8A 4BMZA 3EC7A 3N8DA 3RK0A 3VSDA 2ZE7A 1MJGM 5DDIP 2Z08A 5KWIA 3TEJA 2WP8J 1TF7A 3OJWA 3ZLBA 1B0ZA 2Q8QA 2QS9A 1GL3A 3C7AA 3IT1A 4LZAA 2W83A 4TXLA 4WZAE 4FCVA 5F1OA 3RASA 4AXBA 4CG3A 2JLWA 3U3KA 3LMKA 4F0JA 4BRZA 2OBNA 3AV3A 4HADA 3GFSA 4GH5A 1KFEB 5KYNA 5HUQA 2HUNA 3KLPX 1HTTA 2FUCA 5BV2P 1XU4A 5EFZA 2DBVO 1OQAA 3O2QB 13PKA 2PEYA 1NXVA 2O6HA 4UZEA 3E1GA 1EG2A 1T1SA 1V8OA 1NRIA 3PR1A 3D8SA 4J0CA 4D96A 4DXHA 4AKSA 1ITZA 4Q3CA 4L8GA 1TIKA 5CA1B 5AVZA 5CA0B 5DYWA 2FPMA 3ZBQA 5DOZA 1RM3A 3BVPA 2H3EA 2YJ5A 4KFTA 3TLXA 2V6FA 1TYBE 4RMIA 5FA6A 4P7FA 4IMRA 4RELA 1AKTA 1Z74A 3NOOA 4D46A 2P8SA 2XZPA 4LXTA 2PH1A 2CVOA 2OZKA 1V8PA 1L4UA 1PNTA 2XIJA 1EFVA 1RXUA 2D2FA 4IWXA 5LBUA 3RIEA 1ZMXA 1T1IA 1TEHA 1NN1A 4L85A 4OEHA 5LIPA 1FOEB 3C1TA 1MOSA 5DE3A 2BDUA 1EP2B 1RI3A 1Y7HA 3HDGA 2ZSDA 3OA2A 4Q3OA 4DT1A 5JJLA 2G0NA 4KAXA 1JHRA 4E2YA 3K3PA 1N0WA 3CPHA 5IC5A 1J7JA 4IUBS 4NZYA 1NVGA 4TT3A 1G17A 2VJPA 2REQB 3HP1A 3DT8A 2NN3C 3ZTWA 1DKLA 5IHPA 3SSOA 3WLAA 4YJHA 1Q91A 3ABZA 2IY9A 1TO1E 3ESYA 3OPQA 4QWMA 1KXZA 3T9AA 1M10A 2VCHA 2VT6A 4MW7A 2JIQA 3SHQA 2XLCA 2YQ4A 3KLBA 2ZK7A 3AM4A 3EFEA 3N2YA 3H18A 3WMEA 2Q2QA 3AUYA 4QUGA 3AF2A 3GJQA 4IXMA 3Q11A 4DYVA 1C4KA 4HAUA 3CIOA 1ZEJA 5C2JB 4NIMA 3EIEA 2K6GA 3IYLW 2FPUA 3D8UA 4C4TA 2XYVA 3KZ1E 4BLSA 5JXGA 1J25A 1MRZA 2OBFA 2RH9B 1C3OB 2OCIA 1ZO8A 2ZRBA 1JDPA 1J8DA 3IR6A 2GJAA 3SEFA 5A4JA 2O2XA 2ZYTX 3P9PA 5CFZA 5CVCA 5KNCA 3IILA 3T5GA 2B36A 2XAAA 2DWCA 3O3CA 2CVZA 1E3TA 1XBTA 1ZN8A 3H83A 3UV6A 1CUBA 3VA7A 2DHEA 2IF0A 4QQRA 2KBFA 3PXCX 3MVEA 1I7PA 3OFSA 3PC7A 4MR8B 1FTGA 1N36B 3U7IA 2ZULA 4OP2A