3OFSA

Dynamic conformations of the cd38-mediated nad cyclization captured using multi-copy crystallography
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
236
structure length
234
Chain Sequence
WRQTWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLADTLLGYLADDLTWCGEFDTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLDGSRSKIFDKDSTFGSVEVHNLQPEKVQTLEAWVIHGEDSRDLCQDPTIKELESIISKRNIQFSCKNIYRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosyl cyclase 1
publication title Dynamic Conformations of the CD38-Mediated NAD Cyclization Captured in a Single Crystal
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 79
structure length 234
sequence length 236
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.99.20: 2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase.
pdb deposition date 2010-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 3ofsA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ofsA02
1U4OA 3TNLA 5IN5A 1LC0A 2DBQA 3V2GA 1I2CA 3RQSA 4D7AA 3TFOA 3DBVO 4ILKA 1HLPA 3BZUA 3ONDA 5G2OA 3SJUA 1R12A 4U0KA 3F1KA 3W4JA 4RVUA 2WEKA 1B8UA 1HTBA 2XXJA 3FR7A 4UUPA 1BWSA 4EEZA 1JVBA 2JCVA 1CWUA 1XQ6A 4GKVA 4CL8A 1YBVA 5G4KA 5KCZA 3EVNA 2BH9A 5FF9A 3JD4A 3R6DA 2H63A 3GVHA 5G4KB 4E5MA 4WLOA 5FEUA 1PJTA 2PGLA 4Q3CA 3GDFA 1LDYA 1BXGA 2Z5LA 5L40A 3AM4A 1H9BA 1KEWA 3EHEA 2QG4A 1XLTA 1HE4A 1MC5A 3LLSA 5AXCA 2I3AA 2W98A 4FC7A 2G5CA 5JCJD 3JQDA 1ZIDA 4E4YA 5G0WA 4DQXA 4D46A 4HX5A 4J0EA 1U4SA 3R3SA 2GD1O 3PP8A 5IZCC 3WWZA 5CDYA 3DBRB 4JROA 4E5PA 4I5DA 1Q7BA 4R9SA 4UVGA 2VT3A 2O4CA 2H6EA 3LYLA 1PGOA 3ITDA 4TKLA 3QA9A 4FFOA 3RIHA 4MDHA 2VYVD 4XJSA 4FDAA 1RM4A 3H9EO 1GPDG 5T6BA 2JHGA 4EGFA 2I3GA 1ONNA 4M87A 1I10A 1P1KA 2PZJA 3PHJA 4NQZA 1JVSA 4R5HA 1DAPA 1VLLA 4HP8A 4WLVA 1WWKA 4MVJA 1V3TA 4QQRA 4RZHA 2NU8A 5A04A 4BL5A 4QSMA 3VH1A 4OH1A 1RYEA 5A5FA 3ZW9A 1X7HA 4UUNA 3O38A 3RFVA 3RBVA 5A3VA 3WNQA 4CUZA 2NQ8A 4R1UA 1VJTA 2NLOA 1HDGO 1OZAA 4QEDA 4K6FA 1P0FA 2QRLA 5DZSA 3KUXA 1LQTA 1SC6A 4XB1A 3VOSA 2NTNA 2VOEA 2JFFA 5H82A 4PLYA 1PL7A 3GVIA 4OKIA 1VSUA 4X54A 2P9CA 2O3JA 2YV1A 1A5ZA 3ROQA 1IULA 4TZTA 5HS4A 3KLMX 1T4BA 5KKAA 3UGKA 1G6KA 2NTJA 1I0ZA 3QIVA 1IPEA 3I1JA 2CY0A 4IDCA 4CMEA 1ISMA 1B0AA 1CDOA 3RUHA 3K73O 3OJEA 3NAQA 2PZLA 2X6TA 3DHNA 3GEGA 1CYDA 1LDBA 1KEPA 1HE5A 1T4DA 2BGMA 3ZV6A 1Z45A 1V8BA 1EDZA 4GQAA 4W4TA 2HJRA 4G5HA 4TVBA 1GCUA 4FS3A 2VRCA 2OMEA 4UAGA 3ZI0A 2GCGA 1PJ3A 3IP3A 3BYZA 3IKTA 2AA3A 3GY0A 4D3FA 3MTJA 5CPFA 4HNGA 2IDZA 4E5YA 2W2LA 1UZLA 3BMOB 4XDZA 3BTSA 3HE3A 3OM9A 2IRWA 2I5PO 4JQCA 1A4IA 3K9QO 3B1FA 3Q9UA 2JHFA 2WDZA 5AQ1A 1C14A 2J3IA 3D5TA 4WJZA 2Q49A 2BGLA 3QWHA 4MIYA 4E5KA 2ZATA 4XQEA 1LUAA 4MOWA 1GPJA 1VRWA 4KQWA 1JQBA 3TZQA 4I8XA 3DBLA 1XSEA 2PH3A 3PLNA 2W2KA 4DRYA 2VZ8A 3E18A 5CDGA 1E3JA 2O3TA 3DBLB 4U0JA 3PJGA 4ZD6A 2W2KB 3ZHYA 1U8FO 4J6FA 3I9OA 3ZWWA 2HMUA 4IDBA 2C54A 2Y0CA 3W8DA 3BHMA 4CLDA 2PFGA 3AU9A 3JYNA 5C37A 1U7HA 2OOSA 1EQUA 5KJCA 1EVIA 3LSYA 1BDMA 3G0OA 1YL7A 3NX4A 3KLPX 3LT4A 2O7SA 5JW6A 4B79A 3MJ4A 3K30A 3ZHBA 3DTYA 1ORRA 4LMRA 4CMBA 3GVPA 3PGJA 4BNFA 1V35A 3IUPA 4HV4A 1F14A 3ZW8A 3T7EA 1I3MA 5C7IO 5HM8A 1LLCA 4XWYA 4N54A 3R1IA 3RBXA 1V6AA 5EESA 4PLHA 4DA9A 4PLGA 1CIVA 2Y67A 2B4RO 4AJ1A 5JDIC 1DLIA 2O3UA 4Q3NA 2NVWA 1TXGA 3OEYA 1BTOA 3F9IA 1HYEA 2EGGA 5B4VA 1E1NA 3ENKA 3PQDA 4C7KA 3FWNA 3ZWOA 4CPDA 3ZWNA 2DUUA 2J3JA 4URFA 4NFHA 1OAAA 1U3UA 3ZWBA 2HDHA 5B4TA 1ISIA 1HWYA 2C82A 4ND2A 1W73A 4QFCA 3INGA 3P2YA 5KJ1A 1EFLA 4J91A 4Z9FA 3TL2A 4CLHA 4CMKA 1HDZA 4BNKA 2GUGA 2D5CA 4U5QA 5ES3A 2HRZA 4NHEA 1T2DA 2B37A 3E9QA 3K31A 4RL6A 5LC1A 1ZK1A 4Z0PA 3ZNQA 1NPTO 3HDQA 4FJ0A 3KYDA 3AM3A 3ZWXA 3Q11A 2D2IA 3INTA 4R16A 3KYDB 4YT5A 3AU8A 3GMSA 4Z3DA 4NH4A 3ZWVA 3NKLA 1PS8A 1V0JA 2X58A 2DFVA 4PG5A 5TC4A 1J5PA 4OOEA 1GV0A 2AG5A 5JAZA 2FWMX 3S1LA 3GMDA 1HDOA 4E13A 3QW2A 1XWFA 2ZQZA 2O7QA 3GDOA 2PTGA 1ZJZA 2DQ4A 2C59A 4GPD1 1E1LA 1EK5A 1JU9A 3PYMA 1Y9AA 3P5SA 4OIMA 4WECA 4DIOA 2IZZA 4WUVA 3HB4X 2PKQP 4PCVA 3COSA 3OMLA 4UULA 2IEBA 3HN2A 1W4ZA 1D7OA 1DXYA 3BHIA 4MJLA 1LBEA 3V5NA 3VTFA 3ANNA 3JCZA 1YVEI 1T2CA 5TNXA 4O6VA 5JMPA 4YB8A 3FRJA 4NJMA 5KVCA 1MX3A 1K6JA 1X1EA 3H9UA 3PYLA 3ZWAA 3FPCA 5A9RA 1GUFA 2FHSA 2WE8A 1XHLA 3ANMA 5T5QA 4J4TA 3DFUA 3ZNPA 4BOYA 5K0ZA 3L07A 4XEHA 3AJRA 2GYYA 3AI3A 3WGYA 1LRKA 4XYGA 5TS3A 1I3KA 2V65A 1Y7TA 2YUTA 2HKIA 3GPIA 4W9NA 3ICPA 3WJAA 5IN4A 1H6AA 1PX0A 2A4KA 4FOOA 2SCUA 2D8AA 4JN6B 1UZNA 1LXCA 4WNCA 1ML3A 2B83A 3LQFA 4UVIA 4E12A 4FJ1A 4YJFA 1EFKA 4RPLA 3DWFA 1M66A 3BMNA 3LK7A 3PDUA 4YJFB 5DNAA 1CERA 1YO6A 4CUJA 1B14A 3CKYA 5A9TA 5HRUA 2NVBA 4CMCA 4H16A 3BMNB 2Y1FA 2R00C 3G3EA 4MKRA 2DUWA 5BSHA 4EEXA 2Y1CA 4MKZA 4NI5A 1QORA 2ZCUA 2J5QA 1KVUA 3CEAA 4BO5A 4WEQA 3M2PA 1ZK3A 3GAZA 1H93A 1HDXA 2VHVA 4GKBA 4KDEA 3MOIA 4XYBA 3SLKA 3ZU4A 1T2EA 2DKNA 2Q2VA 2Y1OA 1A9ZA 5F5LA 5AXAA 7MDHA 3QSGA 2YFQA 4PZDA 2D3TA 4A10A 4XB2A 3PPIA 4ZVVA 4R1NA 4BKUA 2GGSA 4DIBA 5I9LA 3PDJA 1NM5A 1E1MA 3I4CA 5ICSA 4BNNA 4JBHA 1SPXA 3FF4A 1CJCA 1NQ5A 3AM5A 1LJ8A 3NTQA 1B2LA 3WYEA 2AG8A 5TSDA 1OC4A 2PA3A 2NU6A 2P4HX 3OH8A 1VM6A 4CM1A 3R3JA 3CZRA 4EW6A 1U5AA 2GR9A 3NT5A 3HDHA 4OOFA 3LT1A 1LSUA 2HMTA 5IZ4A 1LNQA 3S2IA 1ZVMA 3ZU3A 1I2BA 4FGWA 4BV9A 3VZQA 2JFHA 2QZZA 3ABIA 1HYHA 1KVQA 3K6JA 4R5MA 4AJKA 3CMCO 1PS0A 1H9AA 2EG9A 4ND4A 1DBVO 2VNAA 3UOGA 1DFHA 1PTJA 3IP1A 4NK4A 4YAKA 2Q50A 4CLEA 3TSCA 3A06A 2H5LA 1I2ZA 3OHSX 2C7GA 4W6ZA 1R37A 4UUOA 4PIVA 1P1HA 2QHXA 4WKGA 1CRWG 5IXSA 3GK3A 3JQ6A 4LCJA 1UH5A 3F46A 3VVCA 3UXYA 1WMBA 3IIEA 3VPGA 3RC7A 4UREA 2BRUA 4J49A 4NBRA 4A0SA 2I65A 5JBIA 2V6MA 3JQ8A 4D44A 3FHLA 3Q1LA 4OM8A 2QYTA 4YJGA 3NRCA 3JQ8B 1LA2A 3R0IA 4CM8B 3DR3A 4BNIA 1FF9A 2EWMA 4YJGB 3EGOA 3PWKA 3EW7A 1RKXA 5JAQA 1QRRA 3UN1A 4DLLA 4NBUA 1OC2A 4FC6A 1EE2A 2ZKLA 3FBGA 4W7HA 1M76A 5DF1A 4W99A 3EK2A 3INRA 4WCFA 3AUTA 5AYVA 3GHHA 2HK9A 4RVFA 5A4DA 1GL3A 1X0VA 4WCFB 1IE3A 1NASA 3D64A 3O9ZA 4TRRA 1EBFA 2ZJ0A 4KWIA 1NFRA 2Y0EA 1P1IA 2NUAA 4FD3A 4WPGA 2W8ZA 3LLVA 3TRIA 3GHYA 2Q1WA 3H3JA 4O1MA 1R4MA 3UCXA 1MGOA 1KEUA 1HEUA 2XPCA 1F0YA 4IDFA 4S1VA 4B4UA 2ZK7A 3D4OA 2D4AA 5TF4A 1MV8A 3WXBA 2Q3EA 1HXHA 2AEJA 2W4QA 1P33A 2V6BA 4GBJA 5DOZA 4AVYA 4CMJA 2EKLA 3WMWA 4AJJA 4TSKA 3QY9A 5A03A 5BNFA 1NVGA 3P7MA 2IEDA 2X86A 3NV9A 1R0LA 3UW3A 4AG3A 1ULSA 5B12A 4QO7A 1PSDA 3WLEA 3FNHA 3L9XA 5T8KA 1M75A 1M6WA 4A27A 1TT5A 4EI2A 1I33A 4CM9A 2C29D 3ASVA 1ENYA 5ER6A 4CMIA 2EJWA 4GMGA 2AMFA 1AGNA 4CMIB 2GLXA 4EYEA 1SBYA 2Y68A 3RWBA 2CMDA 1U3TA 4L4RA 2E37A 4BMSA 5THQA 1YB1A 4OMUA 5KJFA 1U3WA 1GUZA 5FFFA 3KTDA 4J7XA 2J8ZA 3QWBA 1B16A 3RU9A 2E49A 4JJIA 3DQPA 3VH2A 3DXFA 3U4IA 1ONOA 1DB3A 3RROA 2CVQA 3MJSA 1AUPA 1E7SA 1DIAA 1WDLA 4RVDA 1HE2A 3DAPA 5CFZA 1B3RA 1U1IA 1PJ2A 1Z7BA 2RAFA 3FN4A 1GD1O 1HZJA 3D1LA 5B1YA 4RORA 2FPPA 2DC1A 3E9NA 4CODB 5EQDA 2DBRA 4GMFA 1RM0A 3ZGYA 1SB9A 5AXDA 3ZNOA 4BNTA 5F1OA 5K6AC 1YB5A 1DFGA 4P38A 2EKPA 3IC5A 3WGZA 2VWQA 2PNFA 3LC1O 1RWBA 4WASA 5ENVA 3V2HA 4FGSA 2CVZA 1LDEA 2CUKA 3IOYA 4BKRA 3E5RA 4XYEA 4YAIA 2VT2A 2VTEA 1X13A 4M89A 5L4LA 2BI7A 5THKA 4IQGA 4TQGA 4YT2A 1B15A 3QLJA 4G65A 2D59A 4FCCA 3K8ZA 3KYCA 3GG2A 1DRWA 4MP3A 3WFIA 4BO7A 3C1AA 4U6QA 2FR8A 3PJEA 3C24A 1UR5A 1QV7A 3Q3CA 5JYEA 4XJTA 5T64A 3WQQA 1HF3A 3BMQA 4BKPA 4YEDA 4E3ZA 3ROMA 3WDSA 4DIFA 2O3SA 4DC1A 3O8QA 1E7RA 3NEPX 1DDOA 4J0FA 3AY6A 3DZKA 3O8QB 4MO2A 2TMDA 4LGVA 4I9HA 1ISHA 1UXKA 1NQOA 2GRAA 3RI3A 4B7CA 4BKQA 1HKUA 3ULKA 3L6OO 5KJ6A 1E0DA 1XKQA 2WD8A 3K5PA 4QXMA 5ER9A 2EF1A 3HQ4O 1SOWA 1WP4A 2DFDA 2PD3A 4ND3A 1BXKA 4RZIA 1LSSA 3U0BA 1XGKA 3VZRA 4EITA 1Q7GA 4JP3A 2X1HA 3S8MA 1A27A 4L0QA 3HNPA 4TRJA 4TWRA 3KETA 2PGDA 3C7DB 4JNKA 3DMYA 1K6XA 2DTDA 4Q3DA 1EBUA 1ZH8A 3ON5A 4YDRA 2I99A 3BAZA 1PQUA 4NU6A 3BTUA 2POQX 1MC4A 1X14A 3WQRA 4UEJA 3PK0A 1EDOA 5JC1A 5I9NA 2DBVO 4TVOA 2RBEA 5DCYA 4BB5A 1ZMTA 4QO8A 5I7FA 2OO5A 4I5FA 3GG9A 2CZCA 1OMOA 1VE9A 4ZQFA 3S2FA 2HUNA 2OGUA 2VUTA 4E2WA 1YRLA 2EIHA 4UVHA 5TIIA 5EL0A 3I6QA 4PG8A 4NBWA 5COAA 2Z1MA 1KS9A 1VL6A 4IIVA 2D0IA 4PLFA 4WNIA 2WE7A 2CF5A 1RYDA 1DC4A 3JYQA 1NR1A 4E32A 2RH4A 5A02A 5L7TA 1AXEA 1DOHA 3E6AA 2FP4A 3ITKA 4O59O 4B4OA 1QYWA 2WM3A 1J0XO 1B26A 2GNAA 1O9BA 3UICA 4ONEA 4DLBA 3GDGA 3ADPA 3KVOA 2VYND 3KM0A 4BO2A 3DDNA 4ZA2A 1BGVA 4HFMA 2VQ3A 4ZU3A 3D3WB 1C0KA 5AXBA 2PZKA 1AN9A 1K3TA 2O23A 2AEFA 2VHWA 3WBBA 4E5NA 1F17A 3FCOA 2FZWA 1T25A 2X5OA 4TKMA 2ZIZA 5DCUA 1N8KA 1N92A 1FK8A 3OJOA 1MXHA 4N18A 3JD3A 4GL4A 1E6WA 4KUGA 3DBRA 2E82A 2HMVA 1C0LA 4CL3A 3WGOA 4GX2A 1B7GO 1CQJA 4OAQA 1N5DA 3NJ8A 1YBAA 4N5LA 4YRAA 2B69A 5KKCA 2Y99A 4MIOA 4J2HA 4M86A 3ZWYA 4ZRMA 4FOSA 4MIEA 4K28A 1R0KA 3H6KA 4CR6A 4BNHA 5IDXA 4L9RA 2E4AA 4O5OA 3QWAA 5CPBA 5F5NA 2Z1NA 4CMEC 1UP7A 2OUIA 1H0KA 3GRPA 5JXWA 5KVQA 5BSEA 2QW8A 4NU5A 4PLPA 2FSSA 1F8FA 2EGHA 4NK5A 3ETEA 1KVSA 1VPDA 2X4GA 4HADA 4DC0A 3HZZA 1KETA 2B0JA 2VUSA 1G0OA 2YYYA 3JSAA 5JY1A 3CZMA 1LSJA 4OSPA 3KEQA 4QECA 4HXYA 3MJTA 3JQAA 3DHYA 1VJ1A 1LI4A 1Y1PA 2B5VA 3GA0A 4R1TA 4AJNA 3JQAB 3EZLA 1ZNQO 1W0CA 5IDQA 2RHRA 3KSUA 3WGHA 2Q4EA 4DTIA 5CEEA 4XR9A 1XCBA 2NSDA 1NHWA 2DT5A 4IZHA 2CNBA 3V8BA 3L4BC 1DC6A 4L4SA 4QTZA 2RCYA 3F1LA 2X9NA 1NNUA 1JKIA 3C3XA 3RUEA 1FDUA 3ZWCA 1EMDA 3DAFA 4AJLA 5ITVA 1EVZA 2ZB7A 3JV7A 1LLUA 1ENZA 3OQ6A 4GX1A 3TZKA 3M6IA 4DBZA 1D8AA 5IZCA 1E7WA 3V2UA 2YV3A 3PQEA 5T57A 1UJMA 4LW8A 3GOHA 1JLLA 3NGLA 1N1EA 3BHJA 2ET6A 3WS7A 1JKFA 4AJPA 2C2XA 1NPDA 4YR9A 3ST7A 5L53A 3FNEA 3AI2A 3TZHA 4B3IA 1NX6A 3A28A 3TN7A 1LU9A 2PH5A 4ALMA 1J6UA 4BHTA 1AXGA 4ZQHA 3ZU5A 1Y8QA 1EVJA 5EPOA 2NTVA 4BNUA 3RJ5A 1MXFA 3BMOA 5JO9A 2XAAA 3FWZA 5GZ3A 1I32A 1Y8QB 2UYYA 3OJ0A 2Q45A 3AK4A 3LT0A 3WR5A 1H5QA 1ZEMA 2XOXA 3Q0EA 4D0SA 5DN9A 3CE6A 5ENDA 5FYDA 5JAMA 3QP9A 4Q3EA 5G0VA 3NT2A 1LRLA 4J2OA 1GDHA 2GERA 3FBTA 4HKTA 5TGDA 1EUCA 4EZBA 2BF7A 1GAEO 3ETDA 4YWJA 4C7JA 3H9QA 3KHUA 2FZEA 5JDCA 4TRMA 2AW5A 3M1LA 3M2TA 1K89A 4M49A 4P22A 4M54A 1KY5A 3WIDA 3U4DA 3S2GA 2O3QA 3B70A 5G0SA 2GN6A 3BMCA 3RUAA 3AOEC 1D3AA 4L75A 1PZEA 4K9DA 1HLDA 3MEQA 1YS4A 3X2EA 4ZN6A 3BMCB 4IXTA 4OGWA 1QG6A 4WGGA 1R4NA 1XELA 3DZFA 2IXAA 1R4NB 3VHRA 3G1TA 3TPCA 4YVFA 1UUFA 3GGPA 2B4TO 3AWDA 2OXIA 3H9GA 1DIRA 1I3LA 1O6ZA 2GZ2A 1KVTA 1A4UA 1GR0A 1JW9B 3NDJA 1V3UA 3GNTA 1ZCJA 2X23A 1WAMA 1YXMA 4XYMA 4OYRA 3VPHA 5CG1A 1C3VA 4JX8A 1K2WA 1YQXA 1ISGA 1DLJA 2DTEA 5TX7A 1BSVA 4CQLA 3ZH2A 5MGBA 2YFHA 3X2FA 4B3HA 3SJ7A 4CQLB 2BHLA 4IJKA 4FQ8A 3KZVA 2PV7A 4IY1A 4XIYA 3DZGA 2VZ9A 2O4UX 4MVJG 4DUPA 1QLHA 1SAYA 4PRLA 5L4NA 4AICA 3WG9A 4BNGA 3RC9A 4I1IA 1A7KA 4RCVA 4KZPA 3FNFA 4J9UE 3C7AA 2J3KA 2CF6A 3AY7A 4FFLA 4Z3KA 1LQUA 2WD7B 1FDSA 4CV3A 3GAFA 5JAIA 1WW8A 3OF2A 5CHEA 2ZJ1A 4AJ4A 2RH8A 3BIOA 4RO0A 1DC3A 2HCTA 3H5AA 1MA0A 5L7YA 1IZ0A 1JAYA 1EVYA 2EP5A 5F1PA 1Y81A 3RBZA 1UXHA 5K9ZA 1K0UA 3GZ4A 4A5OA 1A72A 3HJAA 1HYGA 2EEZA 5CAEA 4YT4A 4XGKA 4FFRA 4DYDA 4J4BA 4E2YA 3F5SA 1PQPA 2ZCVA 5EQFA 3JYPA 4HFJA 5C7OO 4DMMA 2B35A 3OIDA 4YJHB 1PGNA 4J7CA 1JA9A 4NZ9A 3W8FA 4OQYA 1RM3A 4IDEA 2JD0A 3OA2A 5L7WA 4W9NC 1JAXA 1GCOA 3JQBA 1PQWA 4AJEA 4DQVA 3PJFA 3JTMA 3K92A 3JQFC 4N7RA 4BVAA 5IG2A 4RLHA 1H6DA 1C1XB 1HDRA 3HWRA 1M67A 5ILOA 4E2XA 4NIMA 2FSVA 3PIIA 5JLAA 3VH4A 2IYOA 2JJYA 1WZEA 4PZEA 1NAHA 3QVSA 1SZJG 1P3DA 2WSBA 2ZYGA 4YJDA 1S6YA 4BQRA 2UUOA 4NNJA 1NWCA 1BVUA 4CMGA 4MVJD 2WYUA 2IODA 4MVJE 4JGBA 4O63O 3MZ0A 3WLFA 4BS9A 4IDGA 2X0JA 3RUDA 2ZTVA 4M1QA 3CSDA 2NADA 1T1RA 3QVTA 3SC6A 1WVGA 4A2CA 2I9PA 1OI7A 4PRKA 4BQPA 4WE3A 3TQHA 4P4GA 2BD0A 4YT8A 4LRSB 4XGIA 4A26A 2FY8A 4KOAA 2Y0DA 3E5MA 4ESOA 5IJZA 2NWQA 5A5EA 4IINA 3L6DA 4L8VA 2O50A 3WQSB 2EW2A 4QUKA 1VKOA 4YRDA 2O48X 3U49A 3CIFA 3H2ZA 3W4IA 4YYZA 3H9JA 1XDWA 4R68A 1H94A 1PWZA 4OXKA 1DPGA 1VJ0A 3A1NA 2GN8A 1GTMA 1QV6A 4GSKA 1ZMOA 3PWZA 4A7PA 3HADA 1UDAA 1PWXA 2QQ5A 4LISA 1N2SA 4EBFA 3PIDA 4GX0A 3AUAA 3WTBA 3JQCA 2VRCD 1G0NA 4HY3A 4ZJUA 1YL6A 4IQ8A 4ALKA 1GYPA 3VVBA 4YQYA 5TJ9A 5TT0A 1OBFO 3WGGA 4UEOA 2ZYDA 3DTTA 2W2LD 2OORA 1PGPA 3IUSA 3ONFA 4IMRA 3NJ4A 3RKRA 3CXRA 2PLAA 4J1QA 2Q2WA 4BGIA 4BO0A 1XEAA 4CV2A 1N9GA 2ILTA 1M6HA 4PZCA 1ZJYA 4RPJA 2LDXA 2EXXA 2GSDA 4GH5A 4CQMA 4MKXA 1N9GB 3ZWPA 1P45A 1SOVA 4R01A 4Z9XA 4BO4A 3I9NA 4CQMB 3D0OA 2X9GA 1IOLA 2VN8A 1FJHA 3WYBA 5HTOA 4LSMA 5U9CA 1E3SA 1Z6ZA 5A06A 1EK6A 4XQCA 3GLQA 5CP8A 4KTTE 3ZN2A 2J3HA 3LZ6A 2VWHA 4NR0A 2Q99A 4K26A 1QYCA 1VKNA 4K6CA 5DCWA 4GX5A 3IS3A 4RJTA 3B20A 2H9IA 3CUKA 3LF2A 5G0TA 2X7HA 4IGEA 1DRVA 2YQ5A 3TZ6A 1ZZEA 1I5RA 1PJ4A 3JQGA 1GY8A 4FFMA 4YA6A 2HLPA 3L6EA 1P9LA 1ZK2A 1YDEA 3JQGB 4L76A 3H4VA 4OO3A 1EUDA 1Y9EA 1HETA 2GASA 4WEOA 3C1OA 3LVFO 3GEDA 3JYLA 3PVZA 5I8WA 1ZBQA 3WYCA 3GVXA 5BNIA 1DFIA 2BLLA 4PLZA 1QP8A 5DOVA 3ZV3A 3PI7A 4BNVA 5FI5A 2F1KA 1ZEJA 4KDFA 4MVJI 3RD5A 1U9JA 3I4FA 4HUJA 2FOIA 1UDBA 2JAHA 4TROA 3GNSA 4MINA 4BO8A 1E77A 3GN2A 4KP7A 4CM8A 5I7EA 1Y5MA 3EAGA 3UAGA 4ZICA 1Z73A 2B4QA 2NM0A 1MB4A 1JWBB 4OXYA 1S7CA 4CV1A 3BTOA 4H3VA 4MVJH 3T4EA 4EUEA 4CLXA 4B3JA 4BMVA 5KVSA 1Y8RA 2HO5A 4R69A 1LSOA 4J4HA 3VKVA 1GUYA 3O03A 1Y8RB 1O89A 4PG7A 1A9YA 1LRJA 4LRTB 1I8TA 4XZ3A 3AFMA 4RPGA 4BGUA 4YCAA 2CDCA 3D7LA 4YACA 2HAEA 1NYTA 3H7AA 4RVHA 3U09A 3N58A 1X7GA 2EKQA 9LDBA 2C20A 3DONA 1HDYA 4BNWA 3T4XA 2DPHA 4FB5A 3DMTA 3AI1A 3QJ5A 3G1UA 1JKJA 4FSHA 3BXXA 4EDFA 1GYQA 1KC1A 4UUMA 4IS3A 3CTMA 2Q46A 3PGXA 4MVJM 4XQGA 1LLQA 1BHSA 2DTXA 4B8WA 3RSHA 5H83A 3PYXA 4DPKA 5JSFA 2H1SA 1PGJA 3JD1A 2Y1GA 3B1KA 3OQ1A 4DBVO 3GQVA 2PD4A 2YZ7A 2ZQYA 3ZV4A 4CM5A 1F12A 5KVVA 4NJOA 5KJEA 1P0CA 3ZV5A 2BELA 5JCJA 3S55A 3FNGA 2C5AA 4E31A 1KC3A 5JMWA 1QYDA 5KNLA 1GQQA 3NT4A 1E5LA 1E3IA 5U4QA 1O0SA 4XKJA 3DZBA 3VDQA 4FIZA 4GSLA 1HRDA 2X8LA 3VH3A 5IF3A 2BFPA 1CEQA 1P77A 2PZMA 2Y93A 3IAHA 1LLDA 1GU7A 4GGOA 4I9NA 5COQA 4L74A 1IHXA 1XU9A 1AE1A 5C7LO 1SEPA 1E5QA 2R2GA 1YL5A 2C07A 4HWKA 5IAAA 2VYVA 2DBZA 3ZWMA 1SB8A 2PY6A 3GFGA 4FN4A 4J3FA 4N5MA 1MLDA 4GLOA 3RC2A 3WTCA 3PWSA 1GQ2A 3WSVA 3EVTA 3RAJA 2YW9A 1N1GA 3PXXA 3UH1A 3WIEA 2NV6A 3KB6A 4YAEA 4XQ9A 4RF5A 2X0RA 5T67A 5L51A 5TQVA 1A7AA 1T2FA 2Y05A 2DU8A 3IQDB 1N7GA 3C1TA 3F3SA 5KIAA 3OSUA 5BSGA 3AUSA 1GZ6A 3HDJA 1QYVA 4JIGA 1SNYA 1E7YA 2HRBA 5EIOA 4RDIA 4BUCA 2WYWA 3OA0A 5IXYA 1XG5A 2CDBA 2Q1TA 2ZB8A 4D3SA 1DIBA 3Q2IA 4OJNA 4AJIA 3OBBA 1DC5A 3HB5X 2JD2A 2AQKA 3VZPA 1NVMB 5EINA 3AUUA 4PVCA 1DAOA 1BMDA 3FD8A 1R16A 1E3EA 1YOVA 4Y67A 5FWNA 2UV8A 4K1LA 2CD9A 4JJFA 4PLTA 5L45A 4DQUA 3U5TA 1YOVB 4YBZA 3TDKA 2X0IA 3E9MA 1PL6A 2J5KA 3MJCA 3TOZA 1MG5A 3GEMA 1MFZA 3WGTA 1FDTA 3NGXA 5AOVA 2O3RA 5DT9A 1NHGA 2AE1A 2Y66A 4H7PA 2P9EA 3DBHB 3OQBA 4ND5A 1F8GA 2BKAA 1XU7A 2YQ4A 3I52A 4R51A 5ADHA 2GN4A 1UP6A 5L4SA 1IL0A 1YDWA 4R4JA 2OP1A 1TA4A 3W4KA 3HFGA 2O2SA 4IXWA 3E03A 2A9FA 3GPDG 4RGBA 2IZ1A 1ADBA 4II3A 4P4NA 1KY4A 4J1TA 5TRTA 4DGSA 2YDYA 1PJQA 4G81A 4LN1A 1UXJA 2CSUA 3UHAA 5CDTA 4OL9A 2BI8A 1UDCA 4J1SA 3H8VA 2C0CA 3V1UA 1E92A 3ROKA 5H81A 3GUCA 1NP3A 3ZHZA 1BG6A 2PKRA 2PWZA 3Q9NA 4NFSA 3B6ZA 1WLYA 2OHXA 3SC4A 4IGFA 5K6AA 2XXBA 2A94A 3F4BA 4XIJA 5HA5A 4BO3A 3WSWA 4JLWA 1I24A 4ALIA 1EUZA 3WGIA 4RV9A 5EMHA 1TB4A 2CDAA 2R6JA 4AJOA 2FPGA 3MOGA 2HMSA 1L7DA 1JDJA 4ALNA 3HN7A 1Q2XA 2AQ8A 1BRMA 3I9LA 5G0UA 1NTOA 1J4AA 5BT9A 2BMAA 2V6GA 3WX0A 3OJLA 5A9SA 3GVCA 3PTZA 4ZHSA 1O95A 1ZUD1 4IJUA 4M8SA 1BW9A 3UCEA 4DL9A 5A9SB 1WXDA 1PU2A 1BW9B 2X5KO 1ISJA 4TRNA 2X5JO 5F1KA 3IKVA 3QWIA 3ADOA 4RQUA 3D3WA 3I83A 5ILGA 1T1SA 1WDMA 4D42A 1P74A 2GZ1A 3MWEB 3H3FA 5TLSA 3BTVA 1G1AA 4RQTA 4R3NA 2VWPA 3UUWA 1LDGA 3PHIA 3FI9A 2P5YA 1ONPA 3G79A 1YKFA 3LC7O 3L77A 1IUKA 3QVOA 3JQ9A 3K2EA 3H5RA 2WTBA 3EMKA 1Q0HA 2YJZA 2ZB3A 2E48A 4PLWA 3A9WA 3PLRA 3GN1A 1GFSA 4R41A 3H2SA 5C3MA 3DAGA 2QIOA 1QKIA 3E1KA 3W6ZA 5DP2A 4I5EA 4PFJA 1BXGB 2X0NA 3KRTA 4E0BA 1C0IA 1KBZA 1TT7A 3KO8A 3L4SO 1NQAO 1TVEA 2J6IA 2RIRA 3DZIA 1CF2O 1YGYA 4KUHA 3P2OA 3QHAA 1QXSA 2VHYA 4U7WA 4J9VA 1D1TA 4R1SA 1LDMA 3CH6A 4GGPA 3PQFA 3W6UA 1KOLA 4BNZA 3ZU2A 1KYQA 1ZFNA 1U8XX 4CM9D 4PG6A 1JTVA 4CLRA 2DVMA 5HWSA 1Y5RA 4KUEA 4IDDA 2Z95A 4GVXA 4CLRB 3VTZA 5TT1A 4YRBA 5DDIP 4XRRA 4Y8VA 4JK3A 3PEFA 5DBFA 3RKUA 4A73A 1NFFA 2ZYAA 4CLOA 4L73A 1D4FA 2AE2A 1J49A 2Q1UA 4CLOB 1KIFA 3PZBA 1A71A 2P2SA 3JD0A 1TI7A 3SX2A 2DLDA 5GZ6A 4B7UA 1I36A 5JFOA 4F46A 2IXBA 4OHUA 1GZ4A 3PFFA 1C0PA 1ENPA 3VZSA 1L1FA 1WDKA 5EERA 1UZMA 3H65A 2EERA 3HFSA 4YQZA 4M55A 3KYBA 1I3NA 4OSOA 4PN3A 1X1TA 5B37A 1Q7CA 1X0XA 4PGFA 4O0LA 5JDCC 4BNMA 5JS6A 4J90A 3LF1A 3OIFA 1PJLA 1PZGA 3MTGA 1GADO 1H2HA 2I6TA 2UAGA 3ZZNA 3DL2A 1R66A 2G0TA 1RM5A 3PFWO 4BGVA 4Z6KA 1O8CA 3TL3A 3SEFA 3DOJA 3Q2KA 3WICA 3CINA 3D4PA 4Y6SA 1SCUA 4Q9NA 1PEDA 3IMFA 1DIGA 3K2BA 1IB6A 4FR5A 1EQ2A 2GN9A 4GWGA 4F6CA 1ZK4A 3EUWA 8LDHA 1QYXA 4LVCA 5LDHA 5MDHA 1UP4A 5CDUA 4INAA 1ZXLA 3CMMA 2EJVA 4D41A 3RU7A 3U4CA 3W1VA 3VAZA 4XCVA 1UXGA 2GO1A 1PL8A 4OXNA 3B1JA 4RF3A 1NR7A 3DEYX 2Q1SA 2EW8A 3PRJA 3IDSA 4ZGWA 2Y1DA 1YB4A 3FR8A 2VHZA 3L4BA 1V9LA 1Y6JA 3F6YA 2OFPA 1TLTA 4LK3A 4B4VA 1NQTA 2FR1A 1UAGA 2WYVA 5AVOA 4KTVE 5KOIA 2W90A 4GAEA 4EUHA 4F6LA 1R0SA 1PGQA 3IJPA 1P1RA 2NU9A 3GF4A 1Q1NA 3VPFA 4J7UA 5C5IA 1ZO8A 4C4OA 4MVJF 1PIWA 3C7CB 4NDNE 2A35A 1WNTA 4F3YA 3EDMA 3RUCA 1U2DA 5ITWA 2AQIA 2G82A 5DBIA 1HL3A 1HT0A 1ZXBA 4UVDA 1F06A 4TZKA 4Y98A 3D5QA 4IS2A 6ADHA 4PVDA 4KQXA 3WWYA 3K96A 3QV1A 2B36A 4ID9A 1HDCA 4RLSA 4NG5A 4BV8A 2UUPA 3JQEA 4NBVA 4CM3A 4IDAA 4JBGA 3UCFA 3JQBC 4FBGA 2V7PA 1KVRA 4UEKA 2P91A 1NPYA 3OECA 1B8VA 4HFNA 4U8GA 1ADFA 3VPSA 1HZZA 4IUYA 4HBGA 2OP0A 3MJVA 2WD7A 2P5UA 4WOKA 3D3EA 2AEMA 3FSRA 3I3OA 5EJ2A 5A05A 3FTNA 3H5NA 3OJFA 4ROSA 3KSDO 1QSGA 5B4UA 2OZPA 1FDWA 1GZ3A 2WWRA 1XA0A 3RC1A 4BNLA 3QWFA 4QFDA 4WLFA 1HSOA 4YJHA 3V1TC 3AOEA 3GC6A 4WLNA 1UAYA 1EEHA 3DO5A 3QE3A 8ADHA 1U5CA 1B3BA 3GR6A 4Y6PA 1CQIA 1C1XA 3IJRA 3RJ9A 4IQ0A 4BNYA 3M1AA 1NFQA 5L9AA 4LSWA 3UVEA 3I5MA 2HK7A 4DPLA 2FN7A 1O94A 1ZSVA 1PS9A 4E30A 4JCOA 2P68A 2NQTA 4EUFA 3F47A 1X15A 4W82A 4DLAA 5JDIA 3U9LA 1WZIA 1ZW1A 3GNQA 1P44A 4PG4A 2I67A 1QMGA 3EZYA 4S3MA 1SO8A 5BNTA 4IBOA 3KBOA 3ZCXA 4CUKA 1LX6A 4BKOA 1SMKA 3OIGA 4ALLA 2C7VA 6LDHA 1EE9A 3JQAD 2VWGA 2JCYA 1IYZA 3ZNNA 1IY8A 3AFNA 4XA8A 3ASUA 2YHIA 3PJDA 1KEVA 1PJSA 2GF2A 4J43A 3WNVA 1ARZA 3O4RA 1DSSG 4NPCA 5JNLA 2YHIB 1E3WA 1FDVA 4I5GA 4KWHA 3U62A 2DAPA 2OBNA 3GGGA 3NTRA 3AY3A 1E3WB 2JCXA 2D1YA 2ZTUA 1MUUA 4FPXA 3GT0A 3MCVA 3QRWA 4RF2A 2AHRA 1ADCA 5LCXA 5TJHA 2CVOA 3DZJA 2HU2A 1Q0QA 2VNSA 4IM7A 4NJMB 3SLGA 3UF0A 4CM6A 4E21A 1AHHA 1DEHA 4CMHA 2G17A 4UVEA 1LDNA 4P8RA 1L7EA 4Q39A 5L3ZA 1PJBA 3PZRA 4AJ2A 1U28A 2I66A 4BO1A 3JQ7A 2FMUA 5I8ZA 3E8XA 2PK3A 3JQ7B 3WMXA 2WMDA 4RVSA 2NNLD 3TF5A 3I6IA 1VC2A 2JL1A 2VHXA 4D43A 5J23A 4Z0TA 3JQFA 3QVXA 2NACA 4BO9A 4Z0HO 1U7TA 2VZ0A 1GYRA 4CR8A 1I01A 1B8PA 4ZQBA 3O26A 4WLEA 3U4HA 5GY7A 4DYVA 4YXFA 5KTKA 1K5HA 4GI2A 2O2YA 4YAJA 1P31A 3FPLA 4EJ0A 1DHRA 1GV1A 2GPTA 4G2NA 4E6PA 3NTOA 2JD1A 1RPNA 3I9JA 1XQ1A 3I9MA 1D1SA 3FTPA 2PKQO 1ID1A 3MWDB 3C8MA 1BVRA 4A03A 3SVTA 3U3XA 1VL0A 2BFMA 5JY6A 4ZRNA 5IFLA 4Q3BA 3ETGA 1M2WA 4QX6A 3N7UA 3LT2A 1TEHA 1V3VA 3QQPA 2ZB4A 1BXZA 4XD2A 1ULUA 1YONA 4DWVA 4EJMA 3HSKA 5FI3A 3PHHA 4CJXA 1CETA 5JC8A 3GZNA 4WK6A 4L4XA 4D45A 4JP2A 3VC7A 3GZNB 3MJEA 1XR3A 4XGNA 4XX0A 2IYPA 4U6SA 2Q2QA 4BNJA 2NVUA 3JD2A 1WMAA 4JBIA 1H2BA 3NYWA 4RPHA 1VSVA 2NVUB 2HMWA 3VPXA 3WFJA 1E6EA 5U1PA 3IL2A 3EY4A 1YQDA 4WCFC 2Q4BA 2R00A 1QR6A 2J5RA 1ZKMA 3D4NA 4YTEA 1YH3A 2OBYA 5A1TA 2VCYA 2YHUA 1T24A 3BA1A 1R6DA 5EN4A 2AXQA 3WB9A 1NBOA 4PLCA 2Y1EA 4BNXA 1ENOA 3DB2A 3DMTC 3GUYA 4XRGA 1I30A 2P9GA 4YPOA 1VI2A 3GGOA 3RUFA 2VRBA 3F5QA 4RVGA 4RDHA 1K6IA 4GWKA 4I9UA 3V1YA 4NMHA 2DM6A 3QVWA 3ROPA 4CM4A 4H15A 2EHDA 2JFGA 1E7QA 4ND1A 3OICA 4CM4B 1C1DA 1X7DA 1Z7EA 2G1UA 2PR2A 4ZQGA 3L0DA 2GDZA 1GEGA 1C1DB 2BFAA 2CFCA 4RPKA 3I23A 4KMSA 2VUUA 5DULA 4ALJA 1PJCA 1EZ4A 5GMOA 3G17A 4GVLA 1LEHA 2VTDA 3E82A 3G49A 5T8KC 3WJ7A 1E3LA 4RF4A 4D79A 3TFQA 3ONEA 4WCDA 3CPSA 2VOJA 3RFXA 4N5NA 3DOCA 3OFSA 2B5WA 3NDRA 3DFZA 3AOGA 2A92A 3NUGA 5HS6A 1LTHR 3RUIA 4DXHA 5JYDA 4MPDA 2WJPA 2HK8A 5CEFA 4DPMA 4NBTA 1T2AA 2FRDA 2BFOA 5BR7A 2PD6A 1N7HA 2VYNA 1NAIA 3DHEA 5L95A 5DBGA 4NFYA 5JO0A 4Y6RA 1DRUA 3TWOA 1NXQA 2EV9A 4HNHA 4LCEA 4E2ZA 3HHPA 4LMPA 1DO8A 2I76A 3NDIA 4ZQEA 3TOXA 1IPFA 3I9KA 4YAGA 1DJQA 3GFBA 4F45A 4B8ZA 1Z82A 1DHTA 3N74A 2ZTLA 1BDBA 1NWHA 1FXSA 4FJ2A 3WGQA 2F00A 2FR0A 1NVTA 4AJHA 3SBOA 1JWAB 3HDYA 5JE8A 2RHCA 1R4MB 2GZ3A 2JAPA 3F4LA 4R9RA 5I7SA 1FMCA 1MFPA 3A14A 2QZ9A 3PHLA 3UFXA 3W8EA 5KWEA 4D3DA 3KOUA 3ORFA 3ENNA 5ICMA 3RVDA 1R15A 4W7IA 4IJWA 4OQZA 4XDYA 4ITUA 1XYGA 3WOHA 3HG7A 1E6UA 4GLLA 1YBMA 3SXPA 1ZSNA 4R54A 4MVJP 5BSFA 4D0RA 1YE3A 3OP4A 3ZHXA 2AQHA 2YY7A 1E7MA 2C2YA 9LDTA 4CM7A 1TT5B 4IMPA 3T7CA 2QRKA 4IJVA 3JYOA 1U2GA 1XIVA 4II2A 3LU1A 2D5AA 1HSZA 4HFRA 4DREA 1Z75A 1MP0A 1P1FA 2QX7A 1W6UA 1H6CA 1YJ8A 4J16A 2JKVA 4FFNA 2LDBA 2V6FA 4WOJA 2G76A 5COBA 2HQ1A 3TZCA 4BB6A 3DZHA 2QRJA 1IZ9A 1GEEA 1RJWA 4IIUA 2BGKA 5DP1A 5A3JA 1YJQA 2XF8A 1WPQA 3AW9A 2YV2A 1MG0A 3LDHA 2DPGA 5CEJA 1PZHA 1Z74A 3ICCA 3VDRA 3KSZO 2X9VA 5GZ1A 2UDPA 5IDWA 4TMFA 3S2EA 4Z9YA 1PR9A 1SEVA 1P1JA 4LVUA 4AL4A 4XR4A 3GH3A 1AHIA 2HJSA 4MP6A 3GRKA 4J1NA 4DVJA 3KXDA 1E1KA 3TJRA 5JCXA 1JN0A 3LC2O 1KERA 5HBRA 4BGEA 3DBHA 1DIHA 4CV0A 1HE3A 2HSDA 4I08A 4PLVA 4CQMD 1ISFA 1U3VA 5G4LA 2IE0A 1VL8A 4BO6A 4B4WA 3WBFA 1T26A 4B7XA 4MP8A 5F3RA 3C85A 2NU7A 4OKNA 3L9WA 1GQYA 4BMNA 1DJNA 1LC3A 5I9MA 4R3WA 1IHYA 2FPIA 2C5EA 3KEOA 4IZIA 5IDYA 3KYCB 1OFGA 1W8DA 2EP7A 3UKOA 4CR7A 5CDSA 2YDXA 2TMGA 5LDGA 1PR3A 3Q6IA 4Q3AA 2PGJA 3ANLA 4P4LA 1ZK0A 4EJ6A 4QT0A 3BMQB 3RFTA 5I7VA 5JPIA 3RCBA 1Q0LA 1H6BA 1O5IA 5CG2A 3PHGA 4FFPA 3EYWA 2IZ0A 4WLUA 3HUDA 2E6UX 7ADHA 1QLJA 3JQ9C 3RASA 3STHA 1ADGA 3ZDFA 3DOOA 3OEWA 4E33A 2P4QA 4JJGA 4IPTA 2OL4A 4JXKA 1OOEA 2X22A 3P19A 4BIIA 3KV3O 4CMAA 4FW8A 4AFNA 3OETA 2QYSA 5F21A 4Y9DA 4DMLA 1ZSYA 4XYLA 3A4VA 1UXIA 1YQGA 3E48A 3EC7A 2ZTMA 3VKUA 2UVDA 1YWGO 3DC2A 1PZFA 5BQFA
chains in the Genus database with same CATH superfamily
1U4OA 3FMVA 1ZM7A 2JIRA 3KUDA 1L4EA 2UZ3A 5CMLA 5IN5A 5CB4B 2APJA 1JEYB 5FKJA 6NULA 3BL8A 3A9TA 3V2GA 4ZYXA 1EP1B 1I2CA 2Q3LA 4UAUA 3E22A 3DBVO 3N76A 4UBOA 4YP5A 3RANA 1C9KA 3K94A 2UXCB 4H1WA 4K03A 3SJUA 1R12A 4YRZA 1QTIA 1PFYA 1TVMA 1X39A 3NH9A 3W4JA 2BL4A 3F0TA 3QUSA 1BWSA 1V5WA 4JT9A 3OC0A 1CWUA 1UK8A 3KT8A 1UFKA 2MYUA 2C5LA 3O4FA 3W1WA 3EVNA 5KCZA 3V8NA 2BH9A 2RGBA 2ALJA 3R6DA 4KJZA 2QU8A 3GVHA 3U9TA 4E5MA 5AVWA 1XCGB 1FRVA 3C8HA 1A3CA 3GFOA 1A8UA 2EJUA 4XVHA 3H16A 3H1GA 3NOXA 4HNSA 4DSNA 2PJRA 4JT4A 3BL5A 2WB2A 2V7GA 1DQRA 1QIEA 4W1PA 3V48A 4D5EA 4C21A 2OHOA 3C3EA 2W93A 1M0WA 1P2TA 1QAMA 1H9BA 3QNMA 4N0PA 1DT3A 1H66A 2I3AA 5JARA 1CSEE 4GBED 1KDZA 4FC7A 1LW7A 5E8JA 4ECEA 1HYBA 1ZI8A 3IIIA 1N6LA 4E4YA 1MDFA 4LHWA 5JR3A 4X6XA 4D46A 4J0EA 1XBTA 3EDRA 4HF7A 3SD7A 2RJNA 1AK9A 3WLRA 1E2PA 2GD1O 3PP8A 4G1FA 2ZIXA 2BR4A 3QBEA 4ZOEA 1ZJWA 1U0LA 3CNNA 3PTLA 1LX7A 4C0KA 3T5DA 1QGDA 2HA3A 1FLAA 3D0KA 3WRVA 4CUJA 1G5HA 2VXOA 4BCBA 5ALLA 4R8VA 5DMXA 3RIHA 1KYWA 1GQOA 2QMUA 4KHZA 4MDHA 3DVQX 4DTCA 3A2KA 4ZYWA 3TM4A 3ZR4B 1A7JA 4B3SB 2W70A 1GPDG 5ALRA 4D8VA 8OHMA 4FQ5A 3AKDA 1GN9A 4EGFA 4GLFA 5DI9A 3U3ZA 4DSTA 721PA 4G36A 1CRZA 2XX3A 1U9IA 4PX3A 4YMGA 2YYSA 1H69A 4LJ6A 1VCMA 2FWBA 1WWKA 5FCDA 4MRPA 4QQRA 1P8JA 4DWWA 2NU8A 4JH0A 5BR1A 5LXTA 1OYWA 1T13A 1UF9A 2OCAA 1YV9A 2QUZA 2ADOA 1F2TA 4QSMA 3QH4A 3TMYA 5CB8A 4RD3A 4B3GA 2CCKA 2PEZA 1JMYA 2ZR7A 3GLFA 1XD2A 3ZDRA 4G0NA 1GUAA 2IITA 2ERYA 4QUGA 1HA3A 4WBNA 4N12A 4UUNA 3E81A 1Q6YA 3G2JA 2OILA 3HZRA 4ZK2A 1JQDA 2A1TR 3P27A 4AS2A 2CXXA 3Q8MA 4LOIA 4DCNA 5CJ2A 3C3WA 5DZSA 3FMFA 3QFRA 1BX3A 5EP3A 4LGMA 4GYJA 2BMWA 4ZCRA 1MBZA 5H82A 2QAJA 3RVRA 3HU5A 2RARA 3LUKA 3EMBA 3GVIA 1NBAA 2FUG6 3U4AA 4D4KA 4YDQA 2OCLA 5HS4A 2DX7A 1NVDA 3KLMX 4QIHA 4Y1GA 1JFRA 3UGKA 4AM8A 5BVHB 2C5HA 5DNYB 5JSUA 1IPEA 3I1JA 2CY0A 5JMOA 4P4SA 1E8NA 1GUBA 2JHAA 3IJEB 1KQNA 1SUAA 1HT2E 1CDOA 2FSHA 4V0RA 4ZO8A 1BA3A 1UMDB 2X6TA 3MCTA 1JEAA 1I3OA 3CKKA 1JJ7A 1WXWA 4MQ4A 6PFKA 1VLQA 1KEPA 4C4ZA 2FMXA 1T4DA 1TJ4A 3KJFA 1U2DC 3ED1A 3FM9A 1JHRA 1FYFA 2ETXA 2WQ6A 2RGNC 4W4TA 1OLUB 2D2FA 4HI0E 4L6AA 1YC2A 2ZR8A 3A10A 4B5LA 2R0QC 4FS3A 2PS0A 3EOAI 2HLHA 5DTIA 4U3JA 1DDGA 1JZTA 5CW1A 2PUTA 3BYZA 4TVKA 1I5OA 3IKTA 3LBYA 3K0HA 2JLWA 5A0VA 4E3WA 3LQ4A 2IP1A 2I03A 3A9UA 3AR6A 4JJEA 1UZLA 3U1BA 4YRIA 3BTSA 1Y8AA 3K9QO 4BJ1A 3B1FA 3EZFA 2WM2A 3Q9UA 2Y2UA 3FWHA 2CNNA 5GONB 1LVUA 3S2YA 2RH9B 3PXCX 4DOMA 5AQ1A 1C14A 1L5WA 3LUAA 5H70A 5A4JA 4C0XA 1U0BB 2Q49A 3QWHA 3GZJA 4RJKA 1CY8A 1D5CA 2QKYA 1VGVA 2QXYA 4RYLA 4TLEA 5FH9A 5DMHA 2HSGA 1Z07A 2VPXA 4BTVA 4M8NE 3IFSA 2I2WA 4L5AA 1A04A 1W0JD 4G4IA 2H1FA 4XLTA 4DCSA 5DIFA 3DDOA 1ZGCA 2GKOA 2PH3A 3E8SA 3L40A 1L7NA 4I6JA 3SXJA 2VZ8A 3E18A 4G4SP 4DRYA 5CDGA 5EJ8A 4QGSA 1DV2A 2W2KB 5AJXA 1FQKA 2GAAA 3IELA 4QARA 1XDSA 3HM9A 1SPBS 3ZWWA 2HMUA 4KH1A 4IDBA 1M6VA 2Y0CA 3ENWA 4TMZA 4WFKA 4FKBA 2PFGA 3LTEA 4LXIA 3W8DA 4CLDA 4JGGA 4Z7QB 1LBIA 1PFUA 5BUSA 5I7WA 2Z3ZA 4DDUA 1EVIA 2VBIA 1YL7A 2IE8A 3NX4A 3R7WA 2AF3C 1RBZA 1T9KA 3BE8A 4WVLA 4BYGA 1DX6A 1ORRA 4V0LA 3RKSA 4DJFC 4CMBA 3OU7A 3UAXA 3U9SA 3PC2A 2HY7A 4ZZ3A 4TYWA 1EG2A 3O2NA 2WU1A 3EQ6A 3ZW8A 4F5EA 4O4HB 1Z28A 3HO1A 3R40A 5EUCA 2IXEA 5JNRA 1I3MA 4MWDA 4BPBA 1JXQA 1ORIA 1BS1A 5REQA 4C4YA 4PWYA 4UCQA 1LWNA 4QAQA 1N7IA 3R1IA 1YBFA 3WK9A 1T8SA 3L7IA 4PLHA 3U19A 4PLGA 3NC0C 3NHBA 1CIVA 5HNKA 1S3GA 3FJ1A 1PFVA 4KGXA 3PUWA 1N2BA 1KZ6A 4TUYA 2O2GA 3V9AA 4AJ1A 5JDIC 5KYWB 3JAWB 4X1KB 4MRSA 2NVWA 4S35A 4EVQA 4P9NA 3OEYA 2XD4A 5JEDA 1HYEA 1Y5LA 3PNKA 2KJQA 3TLCA 8MHTA 5TPZD 3ZPXA 3FWNA 3ZLUA 2O14A 4CPDA 2DUUA 2J3JA 2AS0A 2B8TA 2IYSA 4NHOA 4EB0A 2Z0MA 2WTAA 2V58A 2J0UA 5HF5A 1VB5A 4RJJA 1TM1E 1BOOA 3GMIA 1MT3A 2BEVA 1VHQA 2QDXA 4MYSA 4TPKA 5CVEA 2OYRA 5BURA 1XRMA 2ZLBA 3U7JA 1G8YA 1HDZA 1U1DA 4U5QA 2D5CA 5ES3A 2C3YA 4BZQA 4AY4A 1SH7A 1RYHA 1ABFA 1UM8A 3R23A 4NHEA 3RIYA 3WO0A 5TS2A 3EPRA 3STTA 3K31A 3KFXA 4XH9B 3VHQA 5HKBA 4U9IS 1DIOB 2GI4A 2XGOA 4AJHA 4ZCSA 5I4BA 1U7DA 6ABPA 1E9SA 3KYDA 1ODKA 2BEUA 1VBMA 3Q11A 4E7PA 3BSWA 2V0GA 4L5CA 3QMMA 5BY2A 1T15A 2VLBA 4NBSA 2XRYA 3INTA 4X92A 4LVNA 1G41A 4YXWA 3SIRA 1Q92A 2QEQA 4PAMA 1UCFA 4LY6A 1K08A 3IPCA 1JXOA 1SQGA 2AXNA 2X2FA 1I0IA 3GT7A 4MKGA 3A1UA 2QUJA 1J5PA 1UMBA 2RONA 2O2CA 1GV0A 2A1IA 2AG5A 3VR5D 4PONA 3GMDA 4NAVA 1XWFA 5A4MS 2O7QA 2VFAA 2PTGA 1IBCA 1ZJZA 2DQ4A 2C59A 1JU9A 3PYMA 2PQ6A 3N86A 3TSYA 3P5SA 1NVVR 4TV9B 2BGRA 4F5ZA 1Q77A 4D57A 4F96A 4WZAB 1KI2A 3UT5A 1JYEA 3MM4A 1XZQA 4PCVA 1L5SA 2ATCA 2P6OA 1TTHA 3COSA 3HLTA 1Z34A 4JLOA 5B3LA 2I2DA 1AQLA 3L79A 1CUZA 2GNPA 2VK2A 5ETJA 3RSLA 5PGMA 2ZSEA 1W4ZA 1D7OA 1ML4A 2IOFK 1DXYA 2BBWA 4K6HA 3AZQA 1LBEA 1IK4A 4I46A 4M1ZA 4ER5A 3A9CA 4KWEA 5E6SB 4OHYA 2HLNA 2L18A 1EK1A 1IIRA 2I7XA 4I14A 4MQBA 1IONA 1P5ZB 5KVCA 4YB8A 1RLTA 2W6ID 3FWKA 4ZV9A 1Q1BA 4QELA 1JLMA 3PF8A 4EKYA 4B47A 2JZNA 1SKUA 2AFRA 2QAIA 4OQNA 3ANMA 5T5QA 5LSAA 4BOYA 1JSXA 3OKPA 2VCHA 4EZIA 1DBSA 1RIFA 3L07A 1Q6ZA 3TTUA 3T7SA 5CB0A 5CXQA 3I32A 3WGYA 221PA 1PNVA 2WSSA 2Q27A 5F2OA 2XMQA 2YBEA 2ZE8A 3IB3A 3GPIA 1GPNA 2NTEA 3ICPA 3WJAA 2A4KA 4FOOA 3UYLA 5AICA 1C4WA 1LXCA 1C9JA 1ML3A 1GT91 4DMKA 4RTLA 2ZVDA 1EFKA 4N5DA 3AX6A 3AJAA 4RPLA 3KQQA 5E2IA 2C3UA 3T7RA 3LK7A 1B4DA 2BKVA 1MQSA 4D96A 3UPTA 4WK4B 3WI7A 5HRUA 3NHZA 3T3IA 2PBZA 5LL6P 2R00C 2FGKA 4MKRA 2ZIFA 3JX9A 4EEXA 5BSHA 5J4KA 4MKZA 3NDPA 1W96A 2O8EA 2EKBA 4ML3A 4N5HX 3PGA1 1QRSA 2J5QA 4RTNA 1K68A 4CIBA 3PQ8A 1OGIA 4AMZA 3DVLA 2XWJI 5E7QA 4OBBA 3GAZA 3SNHA 3BGDA 3MOIA 3OM1A 4G63A 5E9QA 2Z3VA 3L0ZA 2Q2VA 4U7FA 2Y1OA 4KITB 1K6EA 1X19A 4RW0A 3W5CA 4OA5A 4Q4HB 2HRRA 2F55A 2FN8A 3NAGA 1RXSA 2P67A 4L07A 4TT3D 4XB2A 4A3SA 4JQZA 4A10A 5JYBA 2GZDA 5C5DA 1S1MA 1SUFA 1G60A 3H1FA 4I3GA 4E14A 1LF5A 4ZAZA 3WMFA 5JWRA 3BFPA 4D4MA 1M2HA 2QD5A 4F9FA 4JBHA 4JXXA 1LJ8A 1Z7GA 4HWRA 4Q9DA 4REQA 4RHUA 5ARDA 5FPKA 3GUZA 1TU4A 1VPEA 2NU6A 4ARUA 2ZUWA 2WTUA 4WN3A 1S9HA 4QUBA 5BN3A 3R3JA 3CZRA 4IG4A 1WOYA 4X1IB 2QN3A 1FSSA 2JAUA 3BEOA 4B6SA 5LJIA 3FCCA 3VKFA 2Z6QA 3QPDA 1IXRC 1LSUA 1W85B 1U8CB 2JEZA 2X2OA 2O06A 4KG7A 2V96A 2ATIA 4QBGB 5IZ4A 4D9CA 1LNQA 4Y2YA 1ZVMA 1QPBA 3S2IA 3ZU3A 5LD2C 5IKOA 1THMA 3AGPA 4FGWA 5DXAA 5LOVA 2F90A 3IDQA 2PL5A 2VEDA 4BV9A 2JFHA 2QZZA 2ZSHA 1HYHA 4RHTA 4R5MA 1N6KA 4EO7A 3T1YB 3CJQA 3LA8A 3R3WA 4U9HS 4YDHB 4P93A 1NBEA 1ZKDA 1IUOA 5K3AA 1CUJA 3O4IA 2V03A 2BDTA 3LY5A 1V26A 4DV7B 1XYVA 3RRJA 4F5YA 3G7SA 1JQ5A 1FRNA 4IV0A 4DUGD 4V3BA 4E1VA 4AD8A 3AEQA 5FBRB 3V8VA 3A06A 2IOYA 2PWAA 3N28A 4F6RB 1GA4A 3NHKA 2I0FA 4W6ZA 2Q29A 1JZSA 2ZXFA 3WL7A 5JALA 2YN4A 4WKGA 4ZOLF 2BJVA 3F46A 1NUQA 3CURA 1L5KA 2VJAA 4DHEA 4UPEA 1GSIA 1Y37A 3P45A 2I65A 1WV0A 5JBIA 2AV6A 2P4SA 3JQ8A 1FX0B 3AHDA 3FDXA 3T4PA 4ZKDA 2PSDA 1GQFA 1T9CA 5D1HA 3BSYA 4OM8A 4TYQA 4IV8A 4G84A 3NRCA 4QGAA 1G64A 4LQ4A 4OH7A 1L8LA 3OEHD 5DHUA 3OAAD 4KR7A 2EWMA 4I5IA 4YJGB 3EGOA 1MC8A 3PWKA 1A9OA 5JAQA 4DLLA 1OAKA 1DZIA 1ECFA 1MEJA 3N0RA 1UBCA 3LRTA 3PXGA 4R71A 4QXRA 3CONA 1OC2A 3IT2A 3ZVMA 2FUKA 2ZKLA 1P7VA 2IYNA 3BE6A 4R7GA 3M5DA 5FR2A 4EB8A 4WCFA 5JS2A 3SX4A 5AYVA 1ANKA 1T4GA 1GL3A 1NIPA 1W2GA 2DY0A 2BSXA 1EBFA 2C8KA 2J5BA 3DW3X 5DNWA 5B58T 2REOA 1U2GC 3SKYA 4B3FX 5D51S 2Y0EA 4MQ6A 1QAQA 1UWCA 2DQSA 2H9AA 2W8ZA 3G2PA 3KOMA 3D8SA 4LC0A 5HJEA 2OXTA 4J16C 4NCNA 3GHYA 1RI2A 2ZRJA 3H3JA 1KO8A 4O1MA 2F9FA 3UCXA 4ZI7A 2R8BA 4HDNB 3GFVA 4G97A 1AO3A 2D4AA 3BBLA 5TF4A 5LYYA 2Q3EA 3IBGA 3WXBA 1HXHA 3EMVA 4GPBA 3FOAA 4DANA 3M9LA 3ZCPA 4AVYA 2NV0A 2Q3JA 2QI9C 1J8YF 1U11A 4OU4A 3KYJB 1NULA 4B3TB 3WMWA 4QDTA 4Q1FA 2JBHA 3QY9A 1A82A 2ZOSA 1VE5A 1EFVA 3BWCA 1NVGA 3K8OE 1CY6A 1G291 1IB0A 2VHTA 1ULSA 3GJ7A 4QO7A 1PSDA 3TD9A 2DBYA 2XA2A 3AKYA 3F2IA 5T8KA 2AOXA 2OZEA 1R4AA 2ADMA 4EI2A 3QBDA 1MJHA 4W9RA 3ASVA 5AK0A 4CM9A 4D0LB 1ENYA 2ZR0A 2ZBFA 4GMGA 4O4JF 3RG8A 3T61A 4H7HA 1MB0A 5DSXA 3VV3A 4HNAB 4ZIRA 2GLXA 2RGWA 2Z5GA 3ZXUB 3RJMA 3ICEA 3K0CA 5D87A 2VDPB 5HUJA 2CMDA 2WKSA 4L4RA 3QF7A 4BMSA 5FUQA 3T5AA 4AXBA 2H1WA 5KJFA 1OXSC 5FFFA 3KTDA 4B9AA 4IIYA 1G2IA 4QA9A 1B6TA 4AX8A 4C88A 2DR0A 1Z4LA 2V6IA 3MD0A 3NOOA 3CNEA 5FJJA 1G8SA 1THZA 2XSZD 3PB3A 3DXFA 3U4IA 3UGTA 1BEUB 4C2TA 2CVQA 2O2HA 3AEKA 3MJSA 1EQAA 4IGKA 1BU8A 1WXHA 4JZYA 2VQEB 4A15A 4MGYR 2PH1A 4KQEA 2DSTA 3THSA 5B58C 5EJ5A 4ARBA 4EY3A 3N70A 4RVDA 1HE2A 3AC0A 3PBKA 4HZUB 4OHBA 1SHZA 3KPYA 2AZ4A 1GD1O 4POAA 3AZPA 1RHJA 3D1LA 3D3QA 2FPPA 3OHMA 4L8WB 4RORA 1DUIA 4TTRA 4XEUA 5FTWA 5EQDA 1VKRA 4KKXB 3O7WA 4X66B 3KKEA 1NP7A 1RM0A 5AXDA 4A6PA 2WJGA 2AYXA 2CMFA 1ZH4A 4RSMA 1MVNA 3PFHA 4AO8A 1X1SA 3V33A 3NWEA 2EKPA 3IC5A 1RABA 2GJKA 1N4AA 3PCXA 1DQPA 4NYJR 4WASA 3TR6A 5ENVA 3V2HA 3WSTA 2AX3A 4XDHA 3B7GA 4FGSA 1DOAA 3IP7A 5C4IA 3A6GA 1Z6GA 2FZGA 4OEHA 4EI7A 3UV7A 2QLLA 5LU9A 2VTEA 3MRTA 4M89A 2I3BA 4HTFB 5G41A 4IFIA 3FFWA 2GEJA 1J00A 1NSYA 1MW9X 1BZYA 1ESNA 2FWPA 3B13B 2D59A 1N25A 3DC7A 4G1UC 3K8ZA 3KYCA 4LCBA 1XUOA 5AKIA 1VHLA 4MP3A 3JWHA 2O2ZA 4WXMA 1K92A 3WFIA 2IHNA 1ADYA 1XTIA 1WTCA 1QV7A 1XDUA 3Q3CA 1LJUA 1E3DA 4XJTA 3CLVA 3X2SA 4FMDB 4UTZA 2X1VA 3BMQA 4E3ZA 2OCXA 4GZLA 3S2ZA 4DIFA 2YMLA 1E7RA 1XKTA 2P0AA 2GWRA 2C3PA 3QLTA 2R84A 4MLCA 2X6RA 4DIDA 5M04A 4CEIB 1NURA 1PBTA 3DZKA 1JQKA 3AUJB 3AY6A 2W00A 2GYVA 5CVDA 5C8XA 5LLTA 1WBBA 2ODNA 1S5PA 1GG8A 2JGAA 4YAWA 2GPBA 3C98A 3RVMA 1WPXA 4RKYA 4B7CA 4YCLA 3A1VA 3N8KA 2WD8A 3K5PA 4JVMA 4QXMA 2VUHB 4W1RA 2DFDA 2PD3A 2PPVA 4RD6A 2IH4A 3RVNA 5B3JA 1RHUA 1SCKA 1DO0A 4EITA 3EBOA 3KELA 1M2EA 1M1NB 4JP3A 1V4NA 2P3SA 1RKUA 2CXHA 2XIQA 3BJMA 4RVOA 2HB6A 4JJZA 4Y2RA 1T9HA 3VYSB 4C87A 2GJAA 4TWRA 2XNJA 1ZM9A 1L5VA 2DTDA 4XB6B 3WKDA 3CPJB 4P83A 2IF0A 3MB8A 4GMHA 1NNEA 4KNVA 4ZHQF 2GK4A 2HSZA 1GIAA 4YJ2B 3HJUA 3UJ3X 4E1AA 5HZKA 1XMIA 3L18A 2R5WA 4YDRA 5EMNA 1PQUA 4NU6A 5ALKA 4WI1A 4BVHA 3X1MA 3O74A 4QPPA 4UEJA 4A8JB 4B45A 3TAHA 4V0NA 2ZDGA 2F64A 2RBEA 4CEHB 2OPBA 3L01A 5THXA 1YASA 2GK7A 2XODA 3N2YA 4I5FA 4JKOA 1C7IA 1NLFA 3CX3A 3JARB 4IV5A 3TG8A 1DKRA 5B64A 1J8QA 3GXBA 4KXWA 5HG0A 5DCLA 5H0IA 1II8B 2Y4NA 1EU1A 2IEAA 1KI9A 1JEDA 3WHLA 4UVHA 4ETWA 2PMEA 1EVKA 3DAOA 4BFTA 3IKJA 1WZCA 3UHOA 1KS9A 3LBAA 4IIVA 2D0IA 4ZO6A 3STWA 3TTVA 1IHUA 2WE7A 2CEKA 3T1QA 2RH4A 2QOEA 4QM7A 1BCRA 3D6FA 4KE7A 4X20B 3OI7A 1DOZA 1U9IC 2G40A 3B89A 1B26A 2GNAA 3GLTA 1NV8A 1CDDA 2FP4B 4ZEOA 3ADPA 2LW7A 1W0KA 2VYND 2C4HA 4XPZA 2ZB2A 3QXGA 1BGVA 1O9GA 3LY8A 4P3KA 5AXBA 1C0KA 2GZRA 3QVMA 1KL7A 2P40A 1NONA 4RCZA 5HCNA 2VRWA 2O23A 2W2OA 3SZRA 4PZLA 2VHWA 1NKTA 3AJ9A 4AMVA 4FCTA 1DXQA 4BNDA 1NN3A 1K8ZB 2HQRA 2VJQA 3GLHA 4I2VA 1F17A 2A9RA 2FZWA 2X5OA 3BWXA 4XQ0A 2QLJA 1N8KA 4KVFA 5AK3A 4N18A 5FBWB 1G4AE 1JPNA 3DBRA 2YIDA 1VI6A 3DLPX 2PUJA 3N2ZB 4RM2A 3SFZA 3TLEA 1WXGA 4CL3A 4M1MA 4EGJA 5B7PA 1CQJA 3H19A 4S1PA 4P82A 5ECGC 4YUVA 4LFBB 5K99A 4HJXA 1WCYA 3QVJA 4XXHA 4MIOA 4J2HA 1SUEA 2A57A 1T9AA 3VX4A 4W6QA 2YWEA 3KKKA 4FOSA 4MIEA 4K28A 1H2YA 1YI1A 4JR2A 4ZRMA 3L4JA 3DZDA 4RZUA 4N7JA 2B1GA 3IHKA 4DQDA 1GNQA 4FWBA 5F5NA 4AKSA 2JI6A 2IEYA 1UJ4A 1H0KA 2CB9A 3IVMA 4NU5A 1ZUHA 2QW0X 3KQYA 4C7MA 5ECYA 4OYLA 3O2QB 3T5PA 3TIXB 1Y48E 4RJIA 4ZDIA 1VPDA 2X4GA 4HADA 5ICGA 3BGOS 4ZDWA 4PPFA 1G0OA 4NPHA 1JEJA 5DB4A 4OUDA 4AUMA 5C1BA 1Y33E 2W6OA 3CZMA 1LSJA 2QJRA 4C0AC 3RLIA 4R2HA 2UUAB 5ECDA 5J1SB 2CL6X 3I01M 2FZKA 3KEQA 1JX6A 2CVHA 2Q7DA 5AD1A 1VB3A 4HXYA 4QECA 4FGZA 3UWKA 3D6UA 4MQMA 4UBKA 1VJ1A 5AI5A 1Q1EA 5HILA 3RVPA 3ZGVA 3A6LA 3WOVA 1TJYA 3OX2A 1D07A 3U60B 1PT8A 3FNBA 3JQAB 3NU1A 1SKAA 3Q7QA 2HCJB 3NTVA 4DM4A 3IVAA 5IDQA 1NI4A 3WGHA 4LSGA 3BK7A 2UZ4A 4HGYA 2H2FA 4ZI5A 1EXNA 2BFFA 3H2JA 1XN1A 4IZHA 1I4LD 2GM5A 2OGWA 2RCYA 3I6BA 3G0DA 5GGYA 5IBRA 2OO7A 1F1BA 1NNUA 1W4RA 2PAFA 1K5GA 4NZPA 1M2NA 4L51A 3SQDA 5HJ5A 2PJZA 1FFXA 4AJLA 1IHOA 1IC6A 4TM7A 1Y1LA 3TG2A 4WZBE 421PA 2JGEA 5CVCA 2CJWA 3JV7A 1LLUA 3OQ6A 3TZKA 1W1WA 5JRJA 5LMCA 5SYAA 4DBZA 1XXLA 3D6AA 1U80A 1P39A 3IH5A 4EENA 1F2VA 5G53C 3ZZMA 2QPLA 4JVNA 4C1NA 3IOMA 5E4FA 4KBYA 4LBZA 1YZGA 1JKFA 2HMAA 5FNZA 3FB4A 3ST7A 5LN1A 1JWLA 5I48A 3KVYA 4YIHA 1X42A 4JB0A 1HNZB 4ZVPA 1YRAA 1LU9A 3ZHVA 2O0JA 1J2EA 2P2LA 1JDBC 2PH5A 5CT9A 4BHTA 4C4RA 4Q15A 1Y8QA 1VIAA 1EVJA 4JSTA 2NTVA 5EPOA 2B21A 1MXFA 3RJ5A 2QP4A 3ZUGA 5JCOC 1K5DA 3F9CA 3NPMA 4HGOA 1ZHOA 5EIWA 4Y2VA 2BW0A 2I29A 3I3SR 3U81A 2VJBA 2Q45A 3AK4A 1XHFA 1SXJA 1H5QA 2V7BA 5E0KB 3SQMA 3WIUA 3NP7A 4HEA6 5TMBA 5ENDA 2QORA 4LJYA 3UK2A 4BRZA 5EGSA 4WKBA 4OCZA 4EFDA 2O1WA 2QVGA 1N8SA 2HSJA 4ADSG 1XTSA 3DULA 3A4LA 3RRXA 1E4EB 1R64A 2V7QA 3EWIA 4P1ZA 1TKCA 4JLPA 1WNFA 1AU9A 3MWYW 3I9FA 5EYPB 3H5IA 3MT7A 2UKDA 1K66A 4MMZB 1UEJA 4QOSA 3TRFA 4EZBA 5TPWA 1GAEO 4C7JA 4P0PB 4TTTS 2Q8NA 1EUCB 1Z17A 3VNBA 5AW4A 4EKIA 2J09A 3FETA 4MUYA 3M1LA 3D4LA 3R5FA 1K89A 4LHVA 4M49A 4XAQA 4B33A 2XEDA 3TBHA 5IJWA 5ALPA 1NVBA 2XDQA 5G0SA 2X0DA 1GKKA 3A1DA 2PUAA 3BB3A 2WC1A 3HUTA 2ACVA 3ESAA 3P9RA 5KQMA 3MEQA 3TW4A 1OI2A 1BXRB 2FAXA 3TM5A 1CR0A 1H3NA 4EMBA 1ESDA 1IWOA 3UG6A 2QN8A 1MW8X 3DVRX 3BJIC 1R4NA 4IW3B 1XRSB 3TVYA 5EGNA 1QAOA 1E59A 4I3FA 2PM8A 3H2HA 4FEGA 3BXPA 3NC4A 4LY0A 3KVNA 3VNRA 3TPCA 1JNYA 2H7XA 4PINA 3WAKA 1UUFA 2P8SA 3GGPA 4IJMA 2OXIA 3BH7A 5K0JA 5ALZA 1O6ZA 3NDJA 5ECWA 3R7BA 1JW9B 1TCBA 3O0TA 4WZZA 3IE0A 3KKLA 4PGGA 1YXMA 3TEJA 5CG1A 3IQZA 3HXLA 3SSMA 3UWDA 1K2WA 1TAGA 5J4LA 5LLDA 2DTEA 3KCQA 4PC2A 5TX7A 1I1QB 4INPA 4YLEA 2D2EA 3I76A 3VZDA 3FPAA 2VUIB 4R2MA 4UD6A 5DN6D 4G0QA 3KU4A 1EAMA 2H4JA 1TNDA 1Z5WA 4KXUA 3R5KA 3USES 3M1YA 2RSLA 3GLUA 2XQFA 1XMQB 3HCCA 1VZ3A 2Z3WA 5B3KA 2V7TA 2JGKA 4KYUA 4OHMA 2YV5A 4PRLA 2PVPA 2C99A 3C48A 5DYGA 5E4YA 4B0PA 4OHXA 1Q12A 4RTKA 3K1AB 3BQ9A 1RMYA 4DZRA 2J3KA 2CF6A 3AY7A 1LV7A 5KYUA 2Z8YA 1IAQA 2WD7B 4UTNA 2WWWA 5JAIA 1BE0A 1L1EA 3U16A 4QOEA 3FZNA 1I7PA 3QOWA 4YAOA 3W6NA 1B74A 4ACAA 4AY5A 2KS6A 3BIOA 4RO0A 1IHDA 1SXPA 5HMMA 2DCMA 2VTKA 1YCGA 1AKVA 3L43A 3VXKA 2A5DA 4RLFA 4N8EA 1W9MA 1EVYA 1ZOSA 3RBZA 1A72A 4YT4A 4U2DA 1MABB 5BRJA 2ZCVA 3HABA 2I54A 2YY5A 1Y89A 1QVAA 4HFJA 2B35A 3ZCVA 5C7OO 1PGNA 4J7CA 4KR3A 3FUUA 5HCIA 4OQYA 1PBNA 3WIVA 2J4DA 1O4VA 5LVAA 1JAXA 4OSEA 5EJMA 1GCOA 5EKUA 5F35A 1PQWA 1JG3A 4DV5B 1XJ5A 5JZMA 4BVAA 1QPZA 3G7UA 1A9PA 4EY6A 1KH3A 3NR2A 5AKYA 3O8LA 1GZ5A 2GBLC 5F3WB 1OT5A 3PIIA 4WESA 5CJJA 2YXLA 2IYOA 2O7RA 4PCLA 9ABPA 4PZEA 3G9XA 1NAHA 6REQB 3AVTA 1JB1A 2WSBA 5DNEA 3RSFA 2IYEA 4P4UA 1Z12A 3PI6A 1NWCA 1C7ZA 1KSHA 4CMGA 4MVJD 3QM1A 2WPDA 2H2AA 3F9RA 3MZ0A 3PNMA 4DY6A 3E5NA 4A8HA 4BS9A 1EFAA 1XNHA 4IHAA 2GD2A 4LOHA 2XLBA 3CSDA 2NADA 1T1RA 3KSMA 2FSFA 4YP1A 1HI9A 1XRRA 1USKA 3QPWA 2XT6A 2QRHA 3QVGA 1FRZA 3JASA 3FLBA 1V11A 2VAMA 1KI6B 3WJ2A 4CG3A 5K0CA 1KK2A 3LL4A 5JNSA 4XGIA 1GFZA 4KOAA 3UPUA 3K9LA 1N75A 2QE6A 4LV8B 5B1HA 2CLMB 1EHYA 4KNWA 4IINA 2AMLA 2RHOA 4CW7A 5A5EA 4M6WA 1W88A 3LZCA 3WQSB 2IU6A 2DETA 2C7PA 4QUKA 3NYRA 4LJKA 2QRNA 1DCKA 2O48X 1C8VB 1GZDA 3RRMA 3VAAA 2IS1A 3GP5A 4B46A 1LVGA 2R1UA 4C4AA 1H94A 2J9FB 2BE7A 4QOHA 3PPYA 3BFVA 1KMHA 4ZOLA 3ZJVA 4EAAA 1JSCA 1QV6A 3K6KA 2PSJA 4F4JA 3CX8A 2ZGVA 2F1OA 2P2ZA 2J30A 3H2IA 4YH1A 2Y6VA 5AVQA 1PWXA 1IVYA 1AS3A 1YQWA 2FVYA 2I2FA 2WKQA 4YRTA 3ZJ4A 5JWOA 3KHTA 4L5BA 3S70A 4MA5A 5FUYA 1Q83A 2BJWA 2GM4A 5CH3A 1OV4A 3D8BA 3KR1A 2PKXA 4ALKA 4G41A 1NQVA 3FBWA 3NBYC 3VVBA 3GXOA 1KS2A 2J7PD 4YQYA 4EW3A 4IYRA 3RS9A 3B7WA 2F8MA 2W2LD 3P9CA 1U65A 5JROA 4M9UA 4BX0A 3OMWA 2JASA 4UE6A 4GD3Q 3U4MA 2CMKA 2ZYTX 4D0GA 2DHEA 4RULA 4LFAB 1F6BA 1XEAA 3WLIA 4CV2A 4FOLA 5IKPA 4RPJA 1X7XB 1ZJYA 4F2WA 3I9V6 2ZTHA 1NOKA 1P45A 2VHEA 5CVUA 1TUEA 4YBRA 1ZWKA 3GJSA 3PX2A 4KGZA 4WADA 1NNSA 4BO4A 3I9NA 2IY8A 4TM8A 3RRFA 1N2CE 1PX2A 3HPRA 3QQ5A 4S2UA 5EWLB 1SK9A 1K3FA 5A6VA 5IJ0A 3UGQA 4MW5A 5U9CA 1H5NA 4CL0A 3AEYA 5A71A 5T3UA 2I22A 5IKXA 4KTTE 2J3HA 3G0GA 1ZUNB 3LZ6A 1KSFX 2IU0A 1C9NA 3CEHA 3I8XA 4YMSA 3VSAA 1VKNA 2NXEA 4K6CA 4GX5A 4C0QC 4RJTA 3NAZA 2GK6A 5AJWA 4F3NA 1Z35A 2V45A 3B20A 1UBUS 3E3LA 4B6FA 1QO9A 4RZHA 2Q6KA 3ZHRA 2FRDC 3HTXA 1ZMBA 4MS4B 5K3EA 2QQFA 3DTVB 5MFZA 1AV6A 3MPOA 2YQ5A 2I4TA 1XZPA 3BFKA 1ZZEA 2WAXA 2I78A 4QGGA 3ENQA 1AF4A 3SAJA 3PQ2A 1P9LA 4RY8A 3G2OA 1YMVA 3JQGB 2IPAB 1RACA 3HL0A 2FOXA 1KHHA 4HB3A 3QXXA 4AO6A 4O4JA 3I05A 4QNRA 4WBSA 5J2UF 1YB6A 3EEFA 3NS7A 3Q12A 4WEOA 1J1UA 4N3GA 5CM9C 2JJQA 1SUBA 4G9GA 3HR7A 3EUAA 2OSVA 3K5HA 3S99A 2LV8A 3KFLA 1NYLA 1YZUA 3WGNA 4CI0B 4PLZA 1TQ6A 1ULHA 3ZTYA 1RJ9A 1ZRMA 4LDRA 2F1KA 4KGDA 1E60A 1ZEJA 2GILA 3OT4A 3SC2B 3SCZA 4BE9A 4D02A 5AW3A 2WAOA 4TROA 4DJ5X 4U5XA 3BKXA 3L82B 3GN2A 4CM8A 4HQKA 2IYZA 2CT8A 1NXSA 1OXMA 1Y5MA 2G07A 4O2BF 1N2OA 3UAGA 1WVIA 3VDMA 1Z73A 1L5HB 1KO5A 3KXKA 1DPFA 4OXYA 2GBCA 3K9WA 2YQZA 3DLIA 3DMRA 4JHXA 4LAFA 4PEVA 5BQ5A 3UUFA 4KRXA 5M5BA 1PDVA 4EKNB 1E1RA 2EBFX 2FV8A 2AI1A 2R60A 4R69A 1GUYA 4MXDA 2BUAA 1UZUA 1TVKB 2FF7A 2JJ8A 4LRTB 2BGNA 2DRIA 4XZ3A 4ZZ2A 4KMRA 2J85A 2WF7A 3NHMA 4BGUA 3BAFA 4MV4A 1NYTA 4RVHA 1PUIA 1AUQA 3FOBA 3TLAA 4YV0A 1LPPA 3OX3A 5FNVF 1X7GA 2XVMA 4PYKA 4JI3B 5E4JA 4M0CA 4BP1A 4LYHA 3K0CC 3WV5A 4BNWA 1EI9A 4FIDA 3T8YA 2DPHA 2YOFA 3HKEA 2QTGA 2GEDA 2YNMA 5LD2B 1T36A 2PKEA 3O47A 3VOBA 1PFGA 1NW9B 1TCAA 3G1UA 1JKJA 2PN1A 4F4CA 1EPUA 2GTIA 4URWR 3SHFA 2J0VA 2Q46A 1MAHA 2AB0A 4MIKA 4PIPA 5BOVA 1CY7A 4MVJM 4ZZIA 1BHSA 4TLMB 5JSFA 2R1VA 4JS0A 4DBVO 4WZAE 1GARA 3QEKA 3CJTA 4PGMA 1KAOA 5JFGA 2YZ7A 3OD5A 1K0FA 4MUEA 2OGSA 4WQMA 4CM5A 4YRNA 5KVVA 1FUEA 3THWA 1G16A 1P0CA 1H22A 2BELA 2KSQA 4U2KA 3I72A 3F90A 4E31A 4IX1A 4CKBA 4UU1A 5KOYA 1SCAA 5KNLA 4RSHA 4KPYA 1I4EB 5IVIA 2WIFA 1SC4A 2HNKA 4K9PA 4F0JA 5JAUA 1RRFA 1E5LA 5U4QA 3A6JA 1HE8B 3FSGA 3EXHC 5SZJA 3VDQA 3OE7D 2B3DA 2BKEA 1VLJA 3LWNA 3MFQA 1CEQA 2GLTA 3KCNA 4GGOA 1LLDA 4I2NA 1QHSA 1IN4A 4P7KA 4RYDA 5AVSA 4BVJA 5HQ3A 3NCHA 4HWKA 3HFRA 3ZE0B 3PRHA 2RGEA 3HCPA 4OX9Y 2J0SA 1Z4OA 1E5VA 2NZ2A 4F85A 4ND7A 1IHPA 2PY6A 2Q9UA 3IBCA 1UIMA 3EPPA 5JSZA 3PFKA 1D4AA 2QRGA 3FVQA 4GLOA 4Q4JB 3PWSA 2VZEA 4CTKA 3PDWA 2P8JA 1DBIA 2JFOA 4EMUA 2XRFA 2BFBA 3QK7A 3CC8A 4TZ0A 1V7ZA 4NBLA 3MWGA 3UH1A 4EG7A 4L16A 3KB6A 3ZZUA 2FE1A 4ZHQA 1C7QA 3V3TA 4OTZA 2ZJAA 2ECQA 5CA1F 1CQZA 3TBKA 1T2FA 3E1SA 5BQ3A 5I51A 2IIPA 2RBKA 3C1TA 4YCDA 4EB6A 4F06A 2KPOA 5KIAA 3OSUA 5I6DA 3HDJA 4LX8A 3JWEA 1EFRD 5AJYA 1G8PA 1E7YA 2QRQA 3INYA 5EZSA 2FUG1 3HCDA 5JZVA 4RDIA 1TLLA 2CFRA 3OA0A 4BX3A 4GKKB 5F76A 2HL6A 3UAWA 4KHPB 1G7TA 2JFWA 2Q1TA 4QDJA 1LTQA 3Q6MA 1T91A 3DFFA 4OJNA 4NXMB 1NLYA 1RHMA 3NB0A 3L7NA 4AJIA 1ADJA 2AR0A 2CNWA 2F9MA 2BBTA 5B3JC 7REQB 2H2WA 2JA1A 2W0MA 2XUKA 3VZPA 4FB4A 3LH5A 1P73A 3QXJA 1GKLA 2WHPB 4PVCA 1JT2A 1XFAA 3SZLA 2G36A 1Y1RA 3FD8A 2GVZC 3C6YA 5IRCD 2PE5A 2O19A 3PGMA 3CA8A 4O0MA 2PU5A 2JFYA 1XZLA 1FVXA 1GGEA 2G4LA 2GT1A 3AV0B 3CNQS 4JJFA 4KO3S 3QPUA 4MWEA 1YOVB 1Z2NX 2JCGA 1NF8A 3B9BA 3L7YA 4Q02A 4YBZA 5BMVB 3H42B 5KOHB 5JPDA 1XX6A 3ICWA 2J5KA 4TXJA 4WV3A 3PVCA 3LQQA 3DR5A 3OCVA 1MG5A 2OAQ1 3ZDEA 3X1DA 3WGMA 1GXSB 3B8HA 1C8BA 3BXGA 1YZNA 2QQEA 3CTPA 3GT3A 5C31A 3GA5A 4LRUA 3BILA 3JATB 3MUFA 5AW9A 3DBHB 5BNWA 2HCFA 5AK4A 3OP1A 1VGRA 2XYQA 5LWHA 2BKAA 1XU7A 2YQ4A 1UWLA 1F0PA 5JASA 3WB1A 5ADHA 1RKVA 5ALXA 5F52A 4FLFA 1YDWA 1M5RA 4R4JA 3W4KA 4B2IA 1P1CA 4TKVB 1F4VA 2O2SA 1MJFA 2IELA 5JXHA 1HY3A 1K7YA 4W5OA 3BRWA 1WIWA 3HRKA 1DJLA 4L95C 1ITZA 4TXNA 4MGEA 2R6GA 1OLSB 2WY2D 3BWMA 2PYZA 4C0LA 4AZ3A 1LNZA 1UXJA 1MZPA 1M0TA 4CEJA 4NPAA 4RGVA 2BI8A 3WYAA