3OFSA

Dynamic conformations of the cd38-mediated nad cyclization captured using multi-copy crystallography
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
236
structure length
234
Chain Sequence
WRQTWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLADTLLGYLADDLTWCGEFDTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLDGSRSKIFDKDSTFGSVEVHNLQPEKVQTLEAWVIHGEDSRDLCQDPTIKELESIISKRNIQFSCKNIYRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ADP-ribosyl cyclase 1
publication title Dynamic Conformations of the CD38-Mediated NAD Cyclization Captured in a Single Crystal
pubmed doi rcsb
source organism Homo sapiens
total genus 79
structure length 234
sequence length 236
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.99.20: 2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase.
pdb deposition date 2010-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 3ofsA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ofsA02
4CMCA 3NT5A 3U5TA 4ZQHA 1QYXA 2OMEA 3VH4A 2PZJA 4PCVA 2ZYGA 4UVGA 3GN1A 4AJ2A 1J4AA 4S1VA 5U1PA 3OJFA 1AHHA 5B4TA 5JAMA 1EQUA 1EZ4A 1HF3A 4A27A 2AQIA 4BNFA 2WYUA 1V9LA 1BW9A 1UXGA 3KXDA 3D0OA 2V6FA 3B6ZA 1IPFA 1TT5B 3IL2A 3I9MA 3E18A 2BGKA 2FY8A 1HDXA 4HY3A 3I1JA 1GTMA 4XGIA 4E5KA 4IDFA 3HFGA 3QIVA 1Z7BA 2B4RO 1LRLA 4FFNA 1PJ2A 2X0RA 2C82A 2C0CA 1LBEA 2QZZA 4GI2A 1QKIA 4ND4A 5FEUA 2DPGA 1WAMA 3BXXA 3H2SA 2O3UA 4JX8A 4IBOA 4BKUA 3DBLB 4Z0HO 5DN9A 4RPJA 4PLYA 2X23A 2VTEA 1MA0A 4B3IA 1U8FO 4RORA 3F5QA 4DTIA 4J49A 1GZ6A 3I23A 1FDUA 3R3JA 1T4DA 2VRCA 1H9AA 2AG5A 4BMNA 5DCUA 1LQUA 3PLRA 3WYEA 2IODA 1Z45A 3KVOA 1AHIA 4PZCA 5TF4A 1L1FA 4CLRB 5I9LA 3JQ7A 4A7PA 3JYLA 3PDUA 4IQ0A 1LTHR 5GMOA 1J49A 1PIWA 3HSKA 3AY3A 1BXKA 3PJGA 4NBTA 1F06A 3DMTA 1EVZA 3PDJA 3HN7A 4XDZA 3V1YA 3O9ZA 1PQWA 4FFLA 2I67A 4WASA 4CL8A 1UXHA 3JQCA 1U3TA 3FNFA 4Q3BA 1LLDA 2CF6A 4J2HA 5A05A 2EIHA 4YAIA 4RQTA 5DCWA 1JKFA 5JCXA 1GEGA 3JQEA 4ZU3A 3R1IA 4NBUA 4IXTA 5IN5A 4BIIA 3C7CB 4LSWA 4G2NA 3QRWA 1RM4A 1CJCA 3WJ7A 4ZICA 3AWDA 5AXBA 2O23A 2PZLA 4GKVA 4G81A 3ENKA 4WOJA 4OAQA 5JC8A 1BVUA 1NQ5A 1E7QA 3IP1A 2Y68A 5DP2A 5FI3A 2PWZA 4AG3A 3GGPA 3HNPA 3RC9A 2VQ3A 1X7DA 5BNTA 3ENNA 4R41A 2JKVA 1HZZA 3ZV3A 1CDOA 3N58A 3EUWA 5KJFA 3GR6A 3GQVA 3CH6A 3DBHA 4XYEA 1SOWA 3GNSA 1V8BA 2ZTUA 3I83A 1ZEMA 2FN7A 1Z7EA 4IGFA 1G1AA 1A9ZA 1EDOA 2DUWA 3H9EO 4LRSB 1A71A 5THKA 3IKTA 4E33A 2EV9A 3F5SA 2EKQA 2E6UX 3ZGYA 2VYVA 2J5QA 3ZV6A 1O89A 2RAFA 2O3JA 1N1EA 1Y7TA 2IDZA 4E5PA 1JU9A 1KC1A 3K9QO 4CM8B 4PG5A 3GVHA 1P1IA 4DMLA 4FFOA 3KM0A 3QWAA 4PN3A 2YV1A 1ZJYA 3K2BA 3FR8A 1Z73A 1PS0A 3Q1LA 2EP5A 3B20A 2B35A 3DC2A 4YPOA 4Y67A 3UCFA 1I2CA 3JQFC 3VHRA 1ZKMA 3S2FA 3NJ8A 2BI8A 2HO5A 4FQ8A 4EGFA 2HK7A 4JK3A 2NM0A 3ZW9A 1Q7CA 1U2GA 3MJVA 4FOOA 3TZCA 3DBRA 5F5LA 4BB5A 4RQUA 1QYDA 1C1XB 1K6IA 2HK8A 3DZHA 1XGKA 2C20A 3PJFA 3I52A 2DTXA 3IKVA 2NACA 3HFSA 3E82A 2X4GA 3GMSA 1HXHA 4ITUA 4XA8A 5CAEA 1PJBA 2HCTA 1EBFA 2OOSA 4IINA 1IPEA 2G82A 4E12A 5T6BA 1OFGA 5DBIA 5DBGA 1GDHA 1WZIA 3DR3A 1HDOA 5L7TA 4P38A 4TKLA 4F46A 4LCEA 2NVUB 3WQQA 1M76A 2AMFA 4HFMA 1HDGO 1TT5A 1C0IA 5DBFA 2AW5A 1N5DA 1KOLA 1A4UA 1VSVA 5TX7A 1DIRA 3WGYA 2B4QA 2D0IA 1M6HA 1Y5MA 3GOHA 1XR3A 1EFKA 1ZSVA 1YOVB 1HSOA 3WYCA 4HWKA 5DDIP 4L4RA 1E7WA 1HE3A 3LLVA 1F14A 1GYRA 4ONEA 3AU9A 3QHAA 5ITVA 1Z75A 1I5RA 3DBLA 2NTNA 4IUYA 4BNLA 1PL6A 2PK3A 3AK4A 1QR6A 3AOGA 3ORFA 4R9SA 3QE3A 1VL8A 3KEQA 4MVJH 4PIVA 2DTDA 4BKQA 3WB9A 3FNGA 4ALJA 4BO1A 3DTTA 4ZQEA 4IDBA 1DC5A 2JL1A 4TKMA 2CF5A 1DJQA 4J43A 4CV2A 5B4VA 3NV9A 2GPTA 4CLRA 4AL4A 3K2EA 1JW9B 3SLKA 1ADBA 1YONA 2P2SA 3I9OA 3LF1A 2X86A 3WLEA 3NJ4A 1UDAA 2I76A 2EG9A 4I1IA 2PLAA 4HKTA 1LJ8A 5THQA 4TWRA 3ZU3A 1QYVA 1Q0HA 2BFPA 1N7GA 2PTGA 2TMGA 4YACA 4ZQFA 3GG9A 3QVOA 2VWGA 3H9GA 3U4HA 3EVTA 3OICA 3ZDFA 4CQMD 5CDGA 3Q11A 4MP6A 2F00A 5DP1A 4BVAA 4HNHA 1QSGA 1XKQA 2QW8A 1I10A 2VWHA 5U4QA 1GFSA 2X58A 3NGLA 4GVLA 3OQBA 3GPDG 4BNIA 4C4OA 3AUSA 4I9NA 4DLBA 2B4TO 4ZGWA 4WLOA 1GUFA 3GRKA 1NNUA 1BDMA 1DIHA 3FWZA 4IM7A 2XOXA 3HE3A 4DQVA 4MP8A 1E6UA 4X54A 3OA0A 3NDRA 4RZIA 4E0BA 4XQGA 2B0JA 5G0SA 5JDCA 1NQAO 2JCXA 2PGJA 4O1MA 1TA4A 3AFNA 3WR5A 3SXPA 2G76A 3WQRA 4CLEA 1LDMA 2VYNA 5TQVA 2NTJA 1JKIA 3JD3A 2PKQO 4PG8A 4L74A 3ZCXA 2Q1WA 4D0RA 5IDYA 3M1LA 1I24A 3TF5A 3GAFA 3GC6A 1I2BA 1E3WB 3LF2A 2DKNA 2J3IA 2WJPA 4YEDA 5FF9A 1YRLA 1KVQA 3I4FA 4CM8A 2O7SA 2DU8A 4NZ9A 5GZ3A 4N54A 1DAOA 3O03A 3G79A 3A9WA 3PEFA 4WEQA 3VTZA 3DMYA 1CF2O 3OP4A 3VVBA 3GEDA 3L4BA 4RLSA 1PR3A 2GSDA 1EK6A 2WE7A 1ZH8A 4NIMA 4GL4A 5IAAA 4MVJG 1DFIA 3O8QB 2YDYA 5F1KA 1C1XA 2DBVO 2GASA 3BHMA 1DIGA 3RUAA 1QLJA 3HDHA 3JQBA 4CLXA 3Q9NA 1ZSYA 4NJMB 5AYVA 2Q2QA 5CP8A 2UAGA 2Y1CA 3CINA 1ZVMA 2P4HX 3UF0A 4EBFA 4ND1A 3GY0A 3RVDA 4J90A 2I65A 1GL3A 3C1OA 4XEHA 4A03A 1ARZA 3KSUA 4RVUA 1P44A 2NVUA 4BNGA 5KWEA 4NU5A 4I5EA 2C7VA 3E03A 2IE0A 4U8GA 3DAPA 4HBGA 1U3UA 1DBVO 2Z95A 3PHHA 1T2EA 4FOSA 4M8SA 4XYGA 2X9GA 4BGVA 4J7UA 3TRIA 4EW6A 4B8ZA 1E3LA 3PI7A 5JDIA 1VL6A 3U49A 1NYTA 1ZJZA 5IXYA 3JQAB 1PL7A 1YOVA 4UULA 3UXYA 1QV6A 2FR8A 1YL6A 2W2KB 4ESOA 4TRRA 2C07A 1NX6A 4TSKA 2EJVA 1UZLA 1QYCA 3V8BA 1GQQA 2OP0A 3ASUA 1WDMA 3H65A 4O5OA 4UUOA 2JFGA 3TL3A 1PR9A 3RWBA 4ZN6A 3GFBA 1BXGB 1QXSA 2I3GA 3QWFA 3RFXA 3MWEB 4CUKA 2JJYA 2QQ5A 1PQUA 1VE9A 2P91A 1U5CA 2Y93A 5CDSA 1PGJA 4IMRA 5C5IA 4FN4A 1AE1A 1E7YA 2VNSA 1D1SA 1KIFA 4BNYA 3KZVA 2AA3A 1R66A 5DF1A 1W73A 4GKBA 2GZ2A 2CD9A 2JFFA 4IJVA 3PQDA 2D5CA 3UICA 3ETGA 1ISMA 1KVTA 4TVBA 4LSMA 3S1LA 3HN2A 3GHHA 2GF2A 4M49A 2ZJ1A 3OIFA 1YQGA 4Z9XA 3HUDA 3WMWA 1IB6A 3SJUA 2HQ1A 1R0LA 1N7HA 4RZHA 5JMPA 1IULA 1ZK2A 2OO5A 3VC7A 2ZK7A 4XQ9A 3AJRA 1NP3A 3W8DA 4OKNA 5C7LO 1WNTA 1Y81A 2X6TA 1A7AA 4AJNA 4MVJA 5KJCA 3NEPX 2R00A 3GVPA 4BO7A 1YE3A 4F45A 4D45A 4OYRA 1T25A 3GDGA 4HUJA 1E7SA 1N9GB 1GQYA 4QT0A 4GWGA 1DB3A 1KETA 1WW8A 2Y1FA 3PQFA 1P1JA 1T2AA 2QG4A 1ID1A 1IUKA 4FJ0A 1X7GA 1B8PA 1ZO8A 4J1TA 2OL4A 1ZFNA 1LDEA 3N7UA 3C1TA 2D4AA 3X2FA 3P2YA 1EVJA 2CZCA 2P9CA 1WPQA 2PKQP 1YXMA 2FSSA 2Q50A 3QWHA 3C3XA 4DC0A 1SBYA 4XYMA 1VJ1A 3F1LA 5JBIA 4E13A 1QMGA 1XCBA 3DOCA 5C3MA 1E3WA 3FNHA 1FK8A 4DPLA 3I6QA 1O0SA 4HX5A 4YCAA 2JD0A 5L51A 1NWHA 4J2OA 1YDEA 1RYEA 3JQAD 5BSFA 2EWMA 5FI5A 2VN8A 3EZLA 3RKUA 2D5AA 2C29D 4CJXA 2O3QA 4FBGA 2BFOA 3E9NA 3BHJA 2C2XA 3LT0A 4ND5A 4DXHA 1VKNA 3F9IA 2UDPA 3NT4A 4YT8A 4CM9D 2X9VA 3O8QA 2H63A 3JQ9C 1WVGA 2PGLA 4WE3A 5EPOA 3W8FA 1DRVA 1GU7A 5DULA 5LC1A 3HJAA 4BV9A 4CPDA 6LDHA 3LLSA 1EEHA 3RROA 1IY8A 2V65A 4NJMA 1C0KA 1C0LA 1ULUA 1XU9A 1T2CA 3IDSA 1TXGA 4ALMA 2NUAA 1ZK3A 4B3JA 1AUPA 5T8KC 4DYVA 1DXYA 3ONFA 2CDAA 2DPHA 3DHNA 3ETDA 4CLHA 1CERA 3RC7A 1N8KA 4KWHA 4CV0A 1ONNA 1PS8A 4R1TA 4U6SA 3AU8A 4BQPA 4A5OA 4EJ6A 2HMUA 2YQ4A 2PR2A 3F4LA 4CMIB 3OIGA 2FZEA 5HA5A 4R5HA 3UKOA 1HRDA 1Z82A 1HYHA 4YJGB 5F21A 2OGUA 1YL5A 4WCFC 1U7HA 2W2LD 3CMCO 3ITDA 4XB2A 2Q2WA 3UGKA 2W2KA 2HRBA 4RF5A 1QP8A 3WQSB 4QSMA 2EKPA 3C7DB 3RUIA 1OZAA 2GCGA 4AICA 4AJEA 2D1YA 4XYLA 4MKRA 5L95A 3D7LA 1O6ZA 4YYZA 3L9WA 5A4DA 2HSDA 3KYBA 4TMFA 1NBOA 1CRWG 3M2PA 4LMRA 3ZU5A 2RHRA 3AI2A 3JYQA 1BXGA 5BR7A 1EVIA 1WXDA 1YQDA 2NV6A 3HB4X 2XF8A 1QRRA 2YYYA 3BMOB 4ZHSA 1NASA 4UVHA 4E5MA 1B2LA 1DLIA 3RBXA 1MC4A 1GYPA 1HSZA 4EITA 3S8MA 1I01A 2CVZA 1B8VA 2A92A 1EUCA 2J5RA 3GGGA 5ENDA 2HK9A 2J8ZA 4EYEA 5JCJA 1DFGA 4MIEA 1NAHA 4E2XA 3JQDA 3FTNA 3HADA 4Q39A 5A3JA 1Y6JA 3DFUA 5G0VA 1WP4A 2V6MA 1GCOA 3MZ0A 1NVMB 3NT2A 4WJZA 5G0TA 1IHXA 4XX0A 4OQZA 1LX6A 4PLFA 4DYDA 3FBGA 5JSFA 4BNVA 1HDCA 5KTKA 3EC7A 1DPGA 1SCUA 5HWSA 1CIVA 2BELA 5AOVA 1A7KA 4FGSA 4IJWA 3GA0A 1B3BA 1JTVA 2YW9A 1N9GA 1RKXA 4F6LA 5A9SB 3D4PA 4GLLA 5LCXA 1NM5A 3GDOA 1VSUA 4BNUA 4EUHA 4NQZA 3FCOA 1GV1A 1ISGA 4UAGA 5EJ2A 4DBZA 4WKGA 3TNLA 4U7WA 3F1KA 1MB4A 2IEDA 3K8ZA 3WBBA 1EBUA 3H5AA 3S55A 5JY1A 4JBGA 2OP1A 1CETA 3ZU4A 1B7GO 5IXSA 3MJCA 4FDAA 2Y0EA 2GLXA 3LVFO 4BGEA 3PHLA 1HDRA 2VRCD 7ADHA 1IZ9A 3MJSA 5CG1A 2FZWA 4BNXA 5TS3A 4MOWA 4NBRA 4HXYA 3LT4A 3JQFA 4MIYA 5CDUA 4ROSA 2C7GA 1FJHA 1A4IA 1CYDA 4YBZA 4CMEC 4DQUA 3GPIA 4LRTB 3PLNA 1DC4A 2QRLA 2ZJ0A 4M54A 1NTOA 3C8MA 3CZMA 4WEOA 1L7EA 4I5FA 4O63O 4WECA 2CDCA 3OEWA 3PHJA 3WX0A 3I9KA 5EIOA 1H2HA 3VVCA 4AJIA 2DFDA 2I6TA 3PPIA 3F4BA 4M89A 5BQFA 2FWMX 3VPGA 3IAHA 3G49A 1K2WA 1T26A 1LC0A 3ROMA 4R3WA 3RC2A 3W8EA 1LEHA 3LDHA 8LDHA 5JS6A 2X5JO 3ROQA 5JO0A 3GN2A 3M2TA 5JC1A 5H83A 3KB6A 1R37A 1FXSA 3ZNOA 3D5TA 5C37A 4P4GA 4QQRA 4CMIA 1YWGO 3RIHA 1ORRA 1ZK0A 2RBEA 4B79A 2DC1A 4YJGA 2Q3EA 5U9CA 3CE6A 2I3AA 3L0DA 3R0IA 3DL2A 3I5MA 3F47A 2WMDA 3OF2A 1XELA 2X0JA 4G65A 3KOUA 1LDYA 2YFHA 4NJOA 1PGNA 4FCCA 2F1KA 3RUFA 5T67A 5KKAA 2OZPA 3CKYA 3H9QA 2VYVD 5KJ1A 1JA9A 2Y1OA 4PLCA 4NBWA 3BTVA 2BHLA 4XQCA 4FS3A 3SVTA 1JDJA 3L6EA 3H9UA 4BB6A 1LA2A 3RKRA 3FRJA 4D3FA 1LI4A 4RVGA 4N7RA 5BT9A 4KDFA 3ROPA 2C5EA 3WMXA 4CL3A 4J16A 3BHIA 1LUAA 1RWBA 3MJ4A 3PRJA 4IS3A 4XWYA 3FN4A 3HHPA 1ENOA 2IXBA 1UH5A 3QVWA 2X22A 4BO0A 2ZYAA 2GD1O 1PJ4A 3H5NA 4DIBA 1OBFO 2FOIA 3HDYA 2YHUA 3KYCB 3HB5X 3I9LA 3PGXA 3BMOA 4DMMA 2J3KA 4Q3DA 3TSCA 4JBIA 4IMPA 3GEGA 4IS2A 5AVOA 3IUPA 5IFLA 3DAFA 3GNTA 3QLJA 2RH8A 3QY9A 2B5VA 3S2IA 3L6DA 5KJEA 1HE5A 4II2A 1DFHA 2YQ5A 5B4UA 4OOFA 2UV8A 1TI7A 1SPXA 1CWUA 1TLTA 1NFRA 4IGEA 3ROKA 4J0FA 1NQOA 1E5QA 3PZRA 5F1PA 3W4KA 4G5HA 3K6JA 2E82A 3NKLA 2PH3A 3OQ1A 4W9NC 5TJHA 2G5CA 4YVFA 2X0IA 1NPYA 2GNAA 5A9SA 2UYYA 4LW8A 3TN7A 5KOIA 4ALLA 4ZD6A 1H6DA 3C1AA 3WWYA 3EGOA 1C0PA 3AM4A 4MINA 2BI7A 4I9UA 1GPJA 1Y8RA 1HLDA 2Y1EA 3CUKA 3WSWA 4J6FA 4WNIA 4BGIA 1T1RA 4XCVA 3ZWOA 2IZZA 4Y6PA 5EINA 3RU9A 5CDTA 3H3FA 1HKUA 2WD7B 5K0ZA 1HL3A 1LRJA 3ICPA 2BRUA 3H2ZA 1HYEA 1QYWA 1LLQA 5BSHA 1MP0A 1U4OA 3AOEC 1P1RA 3VPSA 5L7WA 2DBQA 3GNQA 4A26A 3H7AA 4L4SA 4MVJF 4Z0TA 2EJWA 2UVDA 2FR1A 2DBRA 3AI3A 3DWFA 2ZTVA 4DWVA 4ZA2A 4ALKA 3MTGA 4YJHB 4QECA 5F1OA 3GAZA 4DUPA 1H6BA 5EERA 1ZK4A 3IP3A 2FRDA 1YBMA 2VTDA 5ER6A 3VTFA 2VHZA 4UREA 3TZQA 1W4ZA 3WNQA 3V1TC 1JKJA 2E4AA 4WLVA 1XEAA 1DAPA 4CLOB 3EHEA 2DTEA 3V1UA 1Y5RA 4JP2A 3WIDA 5JMWA 1ZCJA 1NR7A 5I8WA 2AEMA 3L6OO 4FFMA 5CFZA 3JD2A 3LQFA 1M66A 4L0QA 4RF2A 4W4TA 2FSVA 4UEOA 4KP7A 3WGZA 1V3TA 1JVBA 4URFA 3UCXA 4N5LA 3X2EA 1SB9A 1IL0A 2WYWA 2ZTLA 3DHEA 3GUCA 1DEHA 4DPKA 4GAEA 3CIFA 3D5QA 2I9PA 1PJTA 3F3SA 3ZWWA 4E31A 3WDSA 1I36A 4UUNA 1V3UA 1PJCA 1DIAA 1JQBA 2EGGA 1ZUD1 2XXJA 1XA0A 3DOOA 3PK0A 4OSOA 4WCFB 3V5NA 1H2BA 3VH3A 1VKOA 4CMBA 4AVYA 2VRBA 4JN6B 2VYND 1ONOA 1UXKA 2UUPA 5GY7A 1HT0A 4QXMA 4RVHA 3TDKA 4BNMA 1KEWA 3DTYA 4RPLA 1R16A 4RV9A 4B3HA 1DLJA 2OXIA 2ZQYA 1IZ0A 1BMDA 5CEFA 3QSGA 1YS4A 5H82A 3TZKA 4ALNA 1W6UA 4RDIA 5DOVA 4CUZA 5ILOA 1E7MA 5IDWA 4Z6KA 2EKLA 3UH1A 1ZXLA 5DCYA 3VOSA 2QRJA 2B37A 2O7QA 3GLQA 1Z74A 2QZ9A 4GX1A 4OL9A 2Q49A 5CPFA 3KLMX 4R68A 1KEPA 1HWYA 2VWPA 2Y99A 2ZATA 3ZWVA 3KRTA 2GDZA 4N18A 3ZNPA 1GV0A 5LDHA 4GPD1 1PZGA 2CMDA 3KYCA 3PWKA 4TZKA 4XR4A 1ENYA 3IQDB 4YA6A 4B4OA 5AXDA 5B12A 3LT1A 4J9VA 1GADO 4FC6A 5DT9A 5KCZA 4D7AA 1JWBB 3WLFA 1L7DA 5F3RA 5DNAA 1GUYA 2JCVA 3NTOA 1FDSA 4RF3A 2B69A 3EDMA 1YKFA 4B4WA 1Q1NA 3BMCB 4B4VA 4AJ1A 1P31A 2J3JA 1ISIA 1O9BA 4CM6A 3P5SA 3ZWAA 4D0SA 3L9XA 4E30A 3HWRA 4YAGA 3MCVA 1C3VA 2AQ8A 2PFGA 3QWIA 3RFTA 3FR7A 1E1LA 4MVJM 1CQIA 1BRMA 3BZUA 3JV7A 4E21A 1ENPA 4IQ8A 3WICA 3HG7A 1E1MA 4UVIA 5A5EA 4JP3A 2A94A 2DBZA 4NI5A 3PJDA 3DZFA 1J6UA 1O5IA 3LC7O 4CM1A 4WPGA 3E1KA 4TVOA 3EZYA 3B1JA 1P1HA 2BGMA 4RF4A 2IZ0A 4GSLA 3DO5A 2WD7A 5BNFA 4OKIA 2JAHA 3LC1O 4W82A 2Q46A 3K31A 3AW9A 3NTRA 2X9NA 2JHFA 4PLTA 5ENVA 1VL0A 4IDDA 3VDRA 2FPIA 3UUWA 4YRBA 1LDGA 4AJLA 1IYZA 5BSGA 1E92A 1O95A 1LLUA 2QIOA 1UZNA 2WM3A 5MGBA 2VUUA 4YJHA 4BUCA 1I3NA 1ZSNA 2HMVA 4YRAA 1FMCA 4CQLB 3D3EA 3JQ9A 4JIGA 3TOZA 4B7XA 2YZ7A 4LGVA 5JYDA 2CVOA 3LT2A 3I9NA 1KY5A 2NTVA 3OH8A 3MOIA 3AM5A 3Q2IA 1MV8A 1PGQA 4NPCA 5A3VA 4CLOA 4I08A 4YDRA 3QP9A 5T8KA 4PGFA 3DBVO 4O0LA 2X0NA 1MUUA 5JXWA 4NDNE 2Z1NA 1LLCA 3HZZA 1DDOA 4AFNA 1MXFA 1ZW1A 4MVJD 4J1SA 4R3NA 1U3VA 1HE2A 3FF4A 3RCBA 1ZMOA 4CM5A 1ISFA 1PTJA 1TB4A 2J5KA 3WGOA 3K92A 4J7XA 4OIMA 3SEFA 4BO3A 3W1VA 4R4JA 2NU7A 1VLLA 4OXYA 1BDBA 3W4JA 4ALIA 4IIVA 3I4CA 1ZMTA 2VZ8A 4RLHA 4WCFA 3E48A 4ZJUA 3U09A 4R16A 1B15A 1HE4A 1O8CA 2JD2A 5FFFA 2HLPA 2O4UX 3VZSA 3WG9A 2A9FA 3PWSA 4L76A 2GN9A 4BKPA 2BF7A 1RM5A 4KWIA 4YWJA 2O3SA 1P45A 2EGHA 3ZWXA 4EJ0A 1LDNA 4GWKA 2GERA 4J0EA 3RJ5A 5IZCC 2V6BA 1DOHA 4UVEA 2ZIZA 1EFLA 5JPIA 2GZ3A 2ZCVA 3PFFA 1OC4A 2R6JA 2IXAA 4J7CA 3ST7A 3MWDB 4R01A 4RVFA 2H5LA 3KSZO 1HETA 5B37A 3E9QA 1EUDA 3AY6A 3OBBA 4L73A 1R0SA 4CLDA 3VH2A 1TT7A 1O94A 1ZBQA 3OJEA 3WOHA 4U6QA 4PVDA 1I0ZA 4WLUA 5TT1A 3QA9A 1BWSA 4OJNA 4R1SA 3JTMA 3PGJA 4CMJA 4IDCA 4FB5A 4RDHA 1X1EA 3NX4A 1SB8A 1VPDA 3EMKA 5IF3A 4N5NA 1LSUA 1XDWA 4PLPA 3PIDA 1I30A 1I8TA 3V2HA 4O59O 4IDGA 3F6YA 1PWXA 3ETEA 3WFIA 4QUKA 3BMCA 4KOAA 3ONDA 3INGA 4YJDA 4Y8VA 2GYYA 3V2GA 2NU6A 5G4KB 2AHRA 4NFHA 3K5PA 1I3MA 4HFNA 2Q1SA 4YT5A 1BHSA 4DIOA 3ANNA 5COQA 1NFFA 5EN4A 3WYBA 1XQ6A 3FWNA 3VZPA 5K6AC 3NTQA 3WTBA 3Q9UA 3ZNNA 2B36A 5CHEA 4KQWA 1YH3A 3A28A 4Y9DA 1E0DA 5K9ZA 1B14A 3ADOA 3Q6IA 4QEDA 4BNHA 3OETA 4GMGA 5G4LA 2LDBA 1BTOA 4K6FA 3ZWBA 4XYBA 2HDHA 5IDQA 3TOXA 4CUJA 2Q45A 3PYXA 2EF1A 3RBVA 4CR6A 3GVCA 1WMBA 4N5MA 1LDBA 3EY4A 1HDYA 4E32A 1PL8A 2HRZA 3DXFA 3T7CA 1MC5A 4CMEA 5HTOA 3KYDB 2O2SA 4PG6A 3E6AA 3GHYA 3UOGA 1HYGA 1LRKA 2Y1GA 3L77A 4OH1A 4YB8A 1P1KA 2QHXA 1KS9A 2YV3A 1AGNA 3KEOA 4D44A 1HLPA 5T64A 1PZFA 5CEEA 3KLPX 3Q2KA 1DO8A 4A0SA 1Y9EA 4IZHA 4CQLA 3ASVA 3E8XA 1FDTA 5TRTA 3RFVA 5ICSA 4YQYA 1RJWA 3UVEA 3EAGA 3UHAA 1JAXA 2H6EA 5HS6A 4DGSA 5JCJD 1PJSA 1BGVA 2CDBA 2GN4A 2NWQA 4OO3A 5KVCA 1NAIA 4DPMA 1R12A 1S7CA 1B3RA 2WE8A 3QQPA 5A9RA 3EW7A 1ZK1A 4MDHA 3TJRA 4RPHA 3TZHA 3U4DA 3DZKA 4IDAA 1U7TA 2AE2A 3ZV4A 4NNJA 2NQTA 4KZPA 4CMAA 4CV3A 3GK3A 3QV1A 4Q3AA 3JCZA 8ADHA 4MPDA 3G0OA 3EK2A 4GH5A 2VHVA 3BA1A 3PIIA 4WLEA 1M6WA 4D3DA 1YGYA 5KNLA 1WMAA 4WOKA 4P8RA 3JD4A 4U5QA 3N74A 2GZ1A 2PD3A 4BO9A 1XQ1A 5COBA 2VNAA 1YJ8A 3SBOA 1QLHA 3ICCA 3A1NA 2CFCA 3GZ4A 4RVSA 1EE9A 4XQEA 1XHLA 3FPCA 3T4XA 4AJ4A 2CNBA 3FNEA 5DZSA 1UUFA 4XDYA 3WGTA 4NMHA 5G2OA 5KVVA 5A04A 3ZHBA 3CTMA 3AFMA 4NK4A 3PTZA 3PJEA 2NU8A 4BO5A 4NFYA 1ZIDA 2DFVA 2IRWA 4BMSA 3ZWPA 4MKXA 4E3ZA 4QFCA 4KQXA 1EK5A 4C7KA 4WLNA 1UJMA 1YL7A 2AQHA 4Z0PA 2PD4A 3NRCA 2DUUA 2W90A 1I2ZA 4Y6RA 2X1HA 3KO8A 1BVRA 1DHTA 3H4VA 5I7SA 4PLZA 1UR5A 2OUIA 2PKRA 1G0OA 3AUAA 4FJ1A 3JD0A 5BNIA 2DLDA 4B8WA 1XIVA 5A02A 2IYOA 3QW2A 5A03A 4PG4A 1X7HA 4UUMA 1PZEA 1P77A 1NPTO 3ZN2A 1U1IA 2YY7A 1DC3A 1FDVA 4IQGA 1Y8RB 4W7HA 5IN4A 1ZZEA 1NVGA 3KUXA 5EMHA 4BV8A 2BH9A 1DSSG 3TL2A 2WSBA 1KC3A 2NSDA 1K5HA 1V6AA 2PNFA 1C1DB 1N2SA 1X1TA 3U62A 4BNZA 4CR7A 4J1NA 4CODB 4GX5A 1WDLA 2C2YA 5A1TA 5G4KA 1SC6A 1MGOA 3RSHA 1Q2XA 3OMLA 5EQDA 4ZRMA 1E77A 3OHSX 4XJTA 2V7PA 3BAZA 2FHSA 3ANLA 3BMNB 4ZRNA 1Y8QB 2RCYA 3GDFA 2O50A 2PZKA 2VHWA 4U0JA 2IZ1A 2A35A 1E6WA 1J5PA 2P9EA 3MJTA 1PQPA 3VPFA 3OEYA 4FD3A 5MDHA 3G3EA 3VDQA 4KUEA 3VPXA 5KJ6A 1SMKA 4H15A 4GX2A 1NWCA 4UUPA 2G1UA 4A73A 1ULSA 4BKRA 2PD6A 5GZ6A 1JVSA 4MKZA 2D59A 5ILGA 4L8VA 2P5YA 4WNCA 1Q0QA 4BQRA 3OJLA 1B0AA 1X0XA 3PP8A 4I5GA 4FIZA 2Q1TA 4J91A 3ULKA 3IC5A 2Q1UA 3ZHYA 4FFPA 3KYDA 1P9LA 1QV7A 1T24A 4RL6A 1E1NA 1IHYA 3JYPA 4BGUA 4JQCA 1KERA 1OI7A 1U3WA 2JD1A 1R0KA 1MLDA 3FTPA 4HP8A 4MO2A 4JLWA 4ND3A 2AG8A 1NXQA 4PLGA 1X14A 2J6IA 1YBAA 2ZCUA 3DZJA 4Z3KA 3GFGA 1J0XO 3H6KA 4IZIA 3CXRA 3FI9A 1PJQA 4XZ3A 3ZWMA 4JJFA 1U28A 4QFDA 1D7OA 4RO0A 5HRUA 1GUZA 2A4KA 4OHUA 4XIJA 4BNWA 2BD0A 4GLOA 4ND2A 2WYVA 3RUEA 1N1GA 3BIOA 1QG6A 2PY6A 1KEUA 4PLHA 3OSUA 2PH5A 3IOYA 1R4MB 2P9GA 2OORA 5G0WA 2Y05A 3FPLA 3INTA 3VKUA 5ER9A 2JFHA 2EERA 3ZV5A 1MG5A 4Q3EA 1MG0A 2W8ZA 4IJUA 2OBNA 3WSVA 4BS9A 2WTBA 3WBFA 1QORA 4LVCA 3C7AA 4A2CA 1XG5A 1RYDA 2PV7A 1ADCA 1PJLA 4P4LA 1PU2A 1E1KA 1UAGA 3PHGA 2XAAA 1OMOA 1AXEA 5JAQA 1SOVA 1RPNA 3ADPA 3H9JA 4FR5A 3UCEA 2HJRA 3A14A 3IJPA 3PZBA 3DZGA 1U2DA 2R2GA 3TWOA 1DHRA 1KVRA 5TIIA 1V35A 3R6DA 3Q0EA 2FR0A 4I5DA 3JQ6A 4FSHA 1F0YA 4OSPA 3VKVA 1D4FA 4MVJP 3LU1A 1H6CA 4OOEA 2ET6A 3OM9A 4YXFA 2I5PO 1KYQA 2G0TA 2GR9A 4WLFA 3STHA 1ENZA 4YT2A 1KY4A 5TSDA 3WXBA 5CEJA 1ZEJA 4JNKA 4PRKA 1SEVA 3F46A 3IIEA 1ADFA 1A72A 3RBZA 1LQTA 4BO4A 3D64A 3IS3A 5CDYA 2DQ4A 4CR8A 4E5NA 1XU7A 1OOEA 4II3A 3NYWA 2IYPA 5BSEA 5I7VA 5JAZA 2AEJA 4D42A 2RHCA 2RIRA 2AE1A 3E5RA 3G1TA 4KTVE 2X8LA 1U8XX 4FFRA 1OAAA 3AUUA 1C1DA 4UEKA 1HEUA 1F17A 2HMSA 1WWKA 2P5UA 4MIOA 4WCDA 4JGBA 2TMDA 2VZ9A 1HTBA 4CQMB 5L45A 2O3RA 4ID9A 1G0NA 4YT4A 1UAYA 4JJGA 3I6IA 4EJMA 1NHWA 5KVSA 3BMNA 1Y8QA 4TRJA 1I33A 2AEFA 1D3AA 4J4TA 3B70A 4HADA 4RVDA 3RQSA 2VUSA 2OHXA 4NR0A 3I3OA 2DAPA 3EVNA 4K9DA 4UVDA 1ONPA 2W98A 4YAKA 2C59A 3V2UA 4TROA 1U4SA 3DONA 3GRPA 3JYNA 3DOJA 3KSDO 4YTEA 3SC4A 3OJOA 2V6GA 2YUTA 2QYTA 2JHGA 1HDZA 1LXCA 1EUZA 5T5QA 4EEXA 2WWRA 3DZBA 3FSRA 5TT0A 3DQPA 2CVQA 4KUGA 4R69A 4S3MA 4W7IA 5HS4A 3LSYA 4PFJA 1WLYA 4Q3CA 1PS9A 4GGOA 4RPGA 1LSOA 1NQTA 5F5NA 1UZMA 2FPPA 4NFSA 3SC6A 2BFAA 1B8UA 3DDNA 4M1QA 4XD2A 1NVTA 3OJ0A 3BTSA 3WNVA 1V0JA 3LK7A 4K26A 4YJFB 1XWFA 6ADHA 1VC2A 5I7FA 1BSVA 3MJEA 1AN9A 1GZ3A 4XIYA 2OFPA 1P3DA 1YDWA 3W6UA 1Q7BA 1CEQA 3LYLA 3DZIA 3KTDA 1E3SA 4B7CA 4XKJA 3RD5A 4AJHA 4CM4B 4J4BA 1P33A 3HDQA 1JLLA 4WGGA 1P0CA 2Y0DA 4FJ2A 1A9YA 4JJIA 4IPTA 2VUTA 1PGOA 4BHTA 1R4MA 5A5FA 3O26A 2J3HA 3DMTC 4EUFA 4K6CA 4M87A 1AXGA 1JWAB 5CPBA 4ZVVA 2VOEA 5I8ZA 4H7PA 3RJ9A 4AJOA 3QJ5A 2VHYA 3D4OA 5J23A 4O6VA 1P1FA 4GGPA 3K30A 1GD1O 4GBJA 1H94A 3GGOA 1SAYA 1EDZA 5L4NA 1W0CA 5IJZA 1LC3A 4MVJI 3KETA 2X5OA 4R51A 3SLGA 3CMMA 3GEMA 4OQYA 2EHDA 2BMAA 3DB2A 4XGNA 5IZCA 3MEQA 2I99A 4M55A 1UDBA 3T7EA 4AJJA 1GR0A 5TLSA 2UUOA 1PGPA 1RM3A 3ABIA 3I9JA 3TZ6A 3CSDA 1N92A 2IEBA 3G1UA 4LISA 2VOJA 3T4EA 4Q9NA 3WIEA 4F6CA 1YB1A 3NUGA 1E5LA 4P22A 1MX3A 3W4IA 1UXIA 1SO8A 1X15A 3TFQA 5JY6A 3S2GA 1IE3A 4LVUA 3ZWCA 3WTCA 2ZB8A 1BG6A 2BFMA 4PZEA 1XYGA 4TRMA 3EYWA 3U4IA 1PJ3A 1VJ0A 3U4CA 3RAJA 3P19A 4DIFA 4BNKA 3B1KA 3UFXA 2QX7A 2Q4EA 3VAZA 1PEDA 1DJNA 5H81A 3ZHXA 2EW2A 4CM7A 3AI1A 3GG2A 3H5RA 4EI2A 5IDXA 1R4NB 4EDFA 2Q2VA 3NDIA 5JE8A 3KV3O 4BNTA 3ZWNA 1PZHA 2Y0CA 4IY1A 1ML3A 4BO2A 4IJKA 3HQ4O 4P4NA 3DAGA 4TQGA 2X7HA 1VJTA 3PWZA 5HM8A 2GRAA 1DRWA 1C14A 2NQ8A 2GN8A 3DEYX 1KBZA 3VPHA 4EEZA 3E5MA 5K6AA 1MXHA 4BO8A 2EW8A 2HMWA 1NFQA 4OMUA 2Y1DA 4R1NA 1E7RA 3BTOA 4R1UA 4Z3DA 1R6DA 2W4QA 3NDJA 4CQMA 1DRUA 1WDKA 3AY7A 1E6EA 1X0VA 1EMDA 3BMQB 4BO6A 4Y98A 5L40A 2GUGA 2ZB4A 3ZHZA 4YQZA 4R54A 1T1SA 2G17A 2ILTA 4KMSA 4PVCA 1PSDA 1F8GA 4E4YA 4AJKA 5G0UA 3OFSA 4CMKA 4KTTE 1HZJA 5L4LA 2VWQA 1GPDG 4J1QA 4NU6A 4D43A 3D3WB 3ZZNA 3H3JA 3GMDA 5C7IO 1LU9A 3H8VA 1GAEO 2ZTMA 3JD1A 3O38A 4B4UA 3OIDA 4DQXA 2H1SA 2PGDA 3GZNB 5ITWA 1X13A 5JW6A 3K73O 2P68A 4L9RA 2VZ0A 1VRWA 2SCUA 4W99A 3JQ8B 1ISJA 4YJFA 4ILKA 5FYDA 4BNJA 1GY8A 4F3YA 9LDBA 4GQAA 4K28A 1GQ2A 1FF9A 2BKAA 2NADA 3IUSA 3QVSA 1P0FA 1W8DA 2LDXA 1MFPA 1K6XA 2Q99A 4PZDA 2NLOA 2QRKA 2EEZA 3WGHA 2AXQA 4E2WA 4XRGA 4CM4A 3OQ6A 3COSA 1H0KA 3SJ7A 5AXAA 4D79A 3ZW8A 2B83A 5EQFA 4TRNA 3WGGA 3BTUA 2NU9A 1Z6ZA 5AXCA 3P7MA 3S2EA 5ICMA 1SNYA 3G17A 5L7YA 1Q0LA 2OBYA 1H6AA 1UP7A 4JBHA 1B26A 2YDXA 2ZB7A 4J9UE 5JFOA 3PVZA 3DFZA 4HFRA 3AUTA 3ZNQA 1TEHA 1M67A 4YAEA 3NAQA 5ES3A 3IJRA 3LZ6A 1XSEA 1VM6A 1YJQA 1V3VA 1K6JA 2YFQA 4DLAA 4MJLA 4L4XA 1RM0A 1UP4A 1IOLA 5HBRA 4D46A 1S6YA 1WZEA 4R5MA 4U0KA 4PRLA 1KEVA 2EXXA 5TJ9A 3WS7A 1ZXBA 4XJSA 5L9AA 2D8AA 4GVXA 5COAA 4D3SA 2GN6A 3D1LA 3RI3A 4TZTA 5JDCC 4XR9A 4H3VA 2I66A 2HAEA 5EL0A 1CQJA 2QYSA 3L07A 5A9TA 3FBTA 3VZRA 1F8FA 3GF4A 4MP3A 5FWNA 1MFZA 2HUNA 5T57A 4K1LA 4WUVA 4AJPA 3ITKA 3KBOA 4OGWA 3FHLA 4DA9A 2YV2A 2NVBA 1A5ZA 2FMUA 1UP6A 2HJSA 4JCOA 1ZNQO 2BLLA 2O3TA 1Y1PA 4Y6SA 5GZ1A 3JQGB 4DLLA 4MVJE 4R9RA 2WEKA 5JNLA 3CZRA 4QO8A 3E9MA 2ZQZA 1R4NA 2BGLA 5JYEA 1EQ2A 2CY0A 1EVYA 1F12A 3OA2A 4XB1A 3MTJA 4HV4A 3ZI0A 5JAIA 1GCUA 2DVMA 2DM6A 3GUYA 5DOZA 2YHIB 1H9BA 1B16A 1Q7GA 4INAA 1P74A 3PFWO 2ZB3A 2GGSA 2HU2A 7MDHA 3L4BC 4UEJA 3VZQA 2C5AA 3ZU2A 4YAJA 4KDEA 3C85A 2HMTA 3RUDA 1BXZA 1EE2A 2O48X 4HFJA 5KKCA 3NGXA 1A27A 1JAYA 1LSJA 2Z1MA 4CV1A 4DRYA 5KVQA 3L4SO 1BW9B 1LSSA 3JQBC 5C7OO 4WK6A 1G6KA 1ADGA 4GSKA 2X5KO 2ZKLA 4Z9FA 3TQHA 3FD8A 1I3KA 4Z9YA 3M1AA 2CUKA 1XLTA 3BMQA 4OM8A 2E48A 4QTZA 3INRA 1UXJA 4FC7A 5A06A 3QWBA 5LDGA 4PLVA 4FPXA 1SEPA 4M86A 3W6ZA 4YRDA 3ANMA 2WD8A 3WJAA 2C54A 4NK5A 1T2DA 4RJTA 1YB5A 3PYLA 2RH4A 1NPDA 3TPCA 5JDIC 2XXBA 4NG5A 2O2YA 3R3SA 3D3WA 1T2FA 4LCJA 1GEEA 4EUEA 4LK3A 4RCVA 4CMGA 1TVEA 1KVSA 4XRRA 5L53A 3RU7A 5I7EA 1NR1A 4XGKA 1DC6A 4YR9A 4QO7A 2POQX 2JAPA 4OXKA 3VH1A 1U9JA 2PA3A 5KIAA 3UN1A 1T4BA 3GZNA 4HNGA 3UW3A 4A10A 5B1YA 4DC1A 3GVIA 3B1FA 3M6IA 3MOGA 4I9HA 3RC1A 4JROA 3JQ8A 5CG2A 1I32A 3JQ7B 3A4VA 4RGBA 5L4SA 1D8AA 3CPSA 1KVUA 1PWZA 1DIBA 3JQAA 3D4NA 3LC2O 1FDWA 2XPCA 3OECA 5EESA 4BL5A 3IMFA 4IXWA 1VI2A 3GH3A 3GVXA 1M75A 2VCYA 4CMHA 1GZ4A 4C7JA 3PHIA 2NNLD 3A06A 4I8XA 5ADHA 3HDJA 2NVWA 4DL9A 3WGQA 4CM9A 4EZBA 4ZQBA 2Z5LA 2FP4A 2H9IA 4JXKA 1E3IA 3K96A 4Q3NA 2VT2A 2VT3A 2DT5A 4RPKA 3BYZA 1GYQA 1UDCA 2GO1A 3QVTA 4PG7A 2CSUA 4E2YA 4IIUA 4FGWA 3QVXA 1K89A 3ONEA 2O4CA 4LN1A 4NH4A 1OC2A 4OXNA 3WFJA 4DREA 2VHXA 4J4HA 2AQKA 1I3LA 4J3FA 4D41A 1YQXA 3KHUA 5I9NA 3CEAA 2B5WA 3Q3CA 1K0UA 4E6PA 1E3JA 3UAGA 1ISHA 1K3TA 2D2IA 2R00C 4NHEA 2HKIA 4E2ZA 5IZ4A 4NBVA 1U5AA 3PQEA 1R15A 3TFOA 4ZQGA 4PLWA 2Y67A 3DBHB 3PXXA 3ZH2A 1Y9AA 5JLAA 1M2WA 1LNQA 1YO6A 3U9LA 2WDZA 5TGDA 3AM3A 4GX0A 2Y66A 4L75A 2W2LA 4BKOA 1H5QA 4LMPA 3C24A 3P2OA 3ZWYA 2EP7A 4BNNA 3ON5A 3PYMA 5IG2A 3WWZA 4W9NA 4DVJA 3WGIA 1D1TA 2E49A 4IDEA 1YVEI 3RASA 4B7UA 1JN0A 2YJZA 4H16A 5L3ZA 4DBVO 5JO9A 2E37A 2FPGA 2JCYA 4QX6A 5AQ1A 4W6ZA 5TNXA 3SX2A 1PX0A 3JQGA 4BMVA 3U0BA 4BOYA 3O4RA 5TC4A 1E3EA 1YBVA 4GMFA 2ZYDA 3DHYA 4FW8A 1NHGA 1YB4A 3JSAA 2PZMA 9LDTA 3GT0A 3U3XA 4CM3A 2D3TA 3DBRB 1SZJG 3RUCA 2Q4BA 5I9MA 1H93A 2P4QA 2YHIA 4KUHA 4E5YA 3JYOA 3AOEA 3RUHA
chains in the Genus database with same CATH superfamily
2CXOA 3K15A 4NEGA 3U5TA 3T5CA 1FNSA 1VE7A 3VH4A 3D8SA 3D8UA 4GI1A 2ZYGA 1U8ZA 2HA5A 4S1VA 1BXRA 5U1PA 1AHHA 2UYGA 1EZ4A 1HF3A 5DIFA 3K70C 4CEHA 2X1VA 2AQIA 1XFAA 1PNQA 2AXNA 3MPUA 2UXCB 3VYWA 3PQ5A 1TJNA 3KXDA 2RONA 2O8BB 3PHCA 1XQ9A 1TT5B 1AKUA 1N9ZA 1KMCA 2JAOA 3IL2A 1NZJA 3E18A 1HQDA 2FY8A 2NUTB 1J0EA 1U0NA 4F5ZA 5LJIA 1M1YE 4ZOAA 4FFDA 4E5KA 3SM9A 3A6EA 2PRIA 3QIVA 3T5AA 4ZEMA 3DL7A 4M83A 5DWQA 1PJ2A 2PWBA 1CJSA 3PIRA 2TS1A 1KJWA 1QKIA 2ZIXA 3DH0A 4ND4A 5FEUA 3IIKA 4W1RA 1L3BA 3ENWA 3H2SA 1TM7E 3PL5A 4NRDA 4P34A 1PR1A 4EI9A 4KXLA 5A7GA 2AG6A 5DN9A 3C97A 4RPJA 2AC4A 5IC6A 4X6YA 2X23A 5H5JA 1EA5A 3ML1A 1U8FO 1ZCAA 3H1EA 4RORA 4NE9A 2C3YA 4WASA 1WXWA 3I23A 3M89A 1VMIA 1W34A 1FDUA 3M81A 1T4DA 4KQMA 2VRCA 1BDJA 2OHFA 2QTAA 4DHWA 4Y2JA 3O7MA 4BMNA 3TPZA 5GJVC 5F3WB 2WNSA 4PZCA 5TF4A 1R0ZA 4IF6A 2QM3A 1XCOA 3JYLA 4ZHQB 1KI7A 1Z2OX 3FYHA 4BQQA 4CCYA 4UOQA 4HDKB 1EIWA 1BXKA 1J2UA 5LUAA 4DIEA 4G85A 3ZZ0A 3SEAA 4DSZA 2HDOA 3PJGA 5C3UA 2QD2A 5AVSA 2H7XA 1EVZA 1M54A 3HN7A 1OX5A 2UZAA 4XDZA 3O9ZA 4HI0E 1KR5A 5AM1A 2Q5IA 3UTCA 1WU8A 4A0HA 2H59A 1P91A 4RH0A 4KR2A 3WDMA 5JD3A 2FOXA 2JFBA 4J2HA 3RF7A 3SF8A 1E3MA 3GT7A 2PLNA 2QD3A 3OURA 5BPFA 1OWLA 1QS0B 5CFLA 2FYTA 2XB9A 4NBUA 3GO4A 4KQ9A 2XCOA 4BIIA 3C7CB 1V8FA 3QRWA 1TYEB 4ITRC 3B1ZA 4M2LA 3WJ7A 1QRAA 4ZICA 3AWDA 3NP7A 4ZYLA 2ZVQX 4HHEA 4TUYF 1SBNE 3ZI4A 4LOIA 5B6JA 3D6MA 3ENKA 1WUTA 3NETA 4KPYA 2XYQA 3HCOA 1XNHA 3IE2A 3K16A 1QH8A 1WE2A 1UJCA 2I34A 3CE9A 3D8NA 3IH5A 3IP1A 1RCFA 2BFEB 3P0JA 5A0FA 1NX9A 1T8TA 2ZI4A 5KTOA 1WBDA 4DLSA 5BNTA 2JGIA 3T4PA 3ENNA 4R41A 1SBCA 3R9XA 1DBSA 3HVKA 4EH1A 2JKVA 1HZZA 1I0LA 3ZV3A 1CDOA 4AROA 4CT4B 1XV5A 3EUWA 3K05A 2VO1A 3DEJA 4ZWNA 3CH6A 3V7YA 3NEAA 5KJFA 3DBHA 2RBGA 4ZI3A 5F2NA 4P84A 4TWIA 2AW3A 1YT5A 3S7TA 3WLJA 1QQBA 1G1AA 3C87A 3SHOA 2OGWA 2J3QA 2Q4OA 1V3QE 3E5HA 5C8YA 2HNKA 1T5DX 1K9SA 1A71A 2B20A 2X77A 3WYGA 1YAHA 1NF9A 2EV9A 2W4MA 3F5SA 4KQEA 4AKHA 1RRMA 1WTAA 2WM8A 2E4XA 5AI6A 1IDOA 1O89A 2GVDC 1EAYA 1N1EA 1IH8A 1JU9A 3OZIA 3JZMA 4AIRA 4PG5A 821PA 1AKNA 1P1IA 3IUJA 5DGXA 3KM0A 1AY0A 5B3JA 3WQHA 2CWWA 5HG0A 3BRSA 1NIPA 2B35A 2OZVA 1QANA 2JW5A 3IX7A 3UCFA 4QOHA 2IP2A 3VHRA 1ZKMA 3S2FA 2Z6QA 4FQ8A 3RS4A 5NULA 4WVFA 2HK7A 2NM0A 1Q7CA 1U2GA 1W6RA 3MJVA 1GXSA 4MHSA 3KVNA 4RQUA 1EPUA 1UEXC 4HB4A 3CRZA 3UY4A 3DZHA 2IUFA 2ZB2A 2C20A 4F9GA 5H59A 1P9WA 3QVJA 5IAJA 2I6QA 1V43A 2NACA 3GFFA 3E82A 4G5QA 4HGYA 5DHPA 3T0GA 3GMSA 2YS6A 4H60A 1JQKA 1PJBA 2OOSA 2PXCA 4AD8A 1J2JA 3RYHB 2G82A 1BWPA 1KKUA 3L8ZA 1L5RA 4BQIA 1Y42X 1W36D 1VP3A 1NIJA 5JADA 3DR3A 2VA9A 1LPOA 1FYWA 4F46A 1GTJ1 4X5OA 3WQQA 2NPIA 2AMFA 4HFMA 4W5NA 1OA1A 2QF7A 3DVRX 2C03A 3VISA 4AWAA 2C2OA 2HPAA 4LHEA 4TSRA 1SD2A 3OY2A 9GPBA 1L5VA 4BTLA 4C2BA 2GK4A 4K03A 3B1XA 1A4UA 4Q48A 4JP1A 1VSVA 5DU2A 2GPYA 2DXIA 3R0VA 4R2MA 2B4QA 2QRQA 1DO2A 2V5AA 2YX1A 1RE0A 1B74A 1BQ3A 1GSHA 2BN4A 2YCLA 1Q1EA 3AVPA 1IMOA 2O5VA 1ZDMA 4H6VA 2CCJA 2NTYC 3LLVA 2ZDGA 1OZGA 5TQ0B 2ZSUA 4PNZA 4PZ0A 4ONEA 1JIIA 3AU9A 4H27A 3BE4A 2NTNA 1PL6A 3PNOA 5BQ5A 4HZUB 5KHAA 3U44B 1QR6A 4C04A 1VCIA 2A3RA 2B2CA 2ZWOA 2AGVA 3ORFA 3SS9X 1W88A 1Z18A 4MVJH 4NXMB 4EHFA 4PC6A 3FROA 4OI2A 1LPMA 3FNGA 3O8CA 4BO1A 1J97A 1VE1A 3DTTA 4WN3A 2RHMA 4CTJA 4P54A 2EQBA 2CF5A 5AHRA 4J43A 4ITVA 2JASA 3M49A 4U3JA 5HKKD 5IAOA 3LO5A 3NV9A 1Z7YA 4AL4A 1GPAA 3TDMA 2FSGA 1Z36A 1OXUA 3TQSA 3RFCA 3ZY6A 1YONA 4KGXA 4MWGA 3UTDA 1E1RA 2FVXA 3IESA 2I76A 1J1ZA 5IARA 4AURA 3A8TA 4DA8A 4HKTA 1GO2A 1XJ0A 2PLWA 5TE9A 2OCXA 5LB4A 3X1JA 1QYVA 4B3BA 4AZ3B 1N7GA 2PTGA 3CV3A 3RYIB 2TMGA 2Q21A 5LOVA 2FRVA 4M8LA 1ZU4A 2WP0A 1ESMA 3HKDB 2NSLA 4QAQA 1HMPA 3T1OA 3OICA 3NNNA 2I4NA 4CKEA 5CDGA 4PPFA 1BCRB 1A9RA 1AQNA 3V1MA 4MP6A 3H5VA 1RLTA 5DP1A 4BJ1A 3BDIA 4PFSA 4BVAA 2VQ6A 4HNHA 5CH3A 3CVWA 4QRHA 1U2DC 3H11A 2Q41A 2R751 3EIWA 3EQ2A 2WIDA 3GCDA 3E53A 1FUKA 3GNLA 3NGLA 4GVLA 3DJFA 3QXSA 1LVHA 2WZCA 2JGDB 1SU6A 1NI5A 1W0JA 2QA5A 3AESA 1M7GA 5HCIA 4C4OA 2C1ZA 4HNTA 1NYLA 1DWPA 4PZYA 4WLOA 1GUFA 1P60A 1L8AA 1FJXA 3AF6A 3IO5A 1QZUA 3KDSE 4IM7A 1KHHA 1H1DA 2XOXA 4DQVA 1S3SA 5K8VA 3OA0A 3W5SA 2JGEA 2BEVB 2P30A 2Z3WA 3L7AA 3R6TA 2YCBA 3HNOA 1KZYC 3LSTA 4N0EA 1YZHA 4XI9A 5TXGA 3VR6D 2H8GA 5DLDA 2YBDA 1O9HA 3HC7A 4B0PA 4W8GA 3AFNA 4NOJA 1ZCFA 4H4CA 4JC0A 4CLEA 4JI5B 3K9WA 5TQVA 3LWBA 1JKIA 3JD3A 1WXIA 3JRNA 4IMJB 4YRNA 4HX2A 4D0RA 2REQA 3SIXA 4BCCA 4EFNA 5EJ4A 3M1LA 1A7UA 4DA6A 4B31A 5LPNA 3GLIB 5A3SA 3AL0C 3KEMA 1GGKA 2DWQA 2X3YA 4AZVA 1QX4A 1EX9A 2J3IA 2WJPA 3GJ7A 3Q7IA 4DMCA 1WU7A 1N4DA 2ERYA 1YRLA 3DV0B 1KVQA 3DWEX 1MV5A 3ZXXA 2DU8A 4ZAWA 3ORSA 5GZ3A 2E4UA 3LLUA 1VCNA 5IYZA 4EYQA 4N54A 1WL8A 4W1QA 3BGVA 1DAOA 3O03A 3DXYA 3MRVA 4OJYA 3G23A 4QRIA 5EWMB 1NMQA 2IHUA 4WEQA 3C8UA 1J99A 3TRKA 3VVBA 4GOJA 1NUHA 1QGZA 1VKHA 5BN4B 1P72A 2XYVA 3RYFA 2RK6A 1ZGJA 4Z8XA 4GI7A 3RYCA 3C2QA 1NTRA 4TQ9A 1L4FA 1UC5B 4GL4A 4EO4A 4F04A 2K7FA 1RCUA 1DFIA 1RI5A 3KZNA 5E8JA 2V4MA 4BZWA 1D2AA 2Z30A 4GZ6A 1XKTA 1RZ3A 1KIAA 1CE8B 3KQMA 2BUCA 4P82A 3RB8A 4S0ZA 3OI7A 2BEWA 5AYVA 1NUPA 1VOTA 3EBOA 2UAGA 3F3MA 2NUAB 4YV1A 4B9EA 1VI5A 2IYNA 2P4HX 2JAQA 1IHDA 3UHFA 1GA6A 3EUEA 1TU3A 1VZ2A 2BDEA 2JJQA 3LKDA 5ALIA 4DLVA 4IDNA 1T3SA 4GR4A 2I65A 4J0IA 4MK4A 4B0OA 4XASA 5CNIA 3C1OA 3EFBA 3S2SA 5A2GA 3KSUA 3WLQA 4DAEA 1SHZA 2IUUA 4I5EA 1WKCA 5JSZB 5DXAA 2KSQA 3NHWA 4HNAB 4K6HA 4YI3A 3CVXA 1PV1A 3R2JA 4FOSA 4BGVA 3RAFC 4QFMA 1OVMA 1VCHA 3IO3A 1GG5A 5LVAA 2BEKA 1PR0A 3ELWA 1E3LA 2WHPB 1HNNA 2F43A 5HJ5A 4YV0A 2OB1A 1WVMA 3U49A 2EARA 4YUXA 4L51A 1TMGE 2RGNA 1SXJA 2W2PA 3SVZA 5IXYA 4AYWA 5J2TF 1YOVA 2PKXA 4OCZA 3FMOB 4M1YA 2X7JA 1YL6A 3NRJA 3ZIAA 1E58A 1YMQA 2FGKA 2FNAA 3NFYA 1W59A 3LKVA 1NX6A 1SUPA 3FCEA 2GZMA 1G38A 1E62A 4GU5A 2H1FA 1M0EA 1AZSC 5G40A 4KN9S 1QYCA 1DJLA 4OQMA 3ASUA 1WDMA 1BGXT 3H65A 2M6SA 2RK4A 2ODAA 4C30A 3WRXA 4C4PA 2Q0XA 1XWIA 2IQIA 2C5HA 2P0AA 3PD1A 4PR3A 4U5XA 3KDAA 3OMXA 2JFGA 2CXPA 1NSYA 3TL3A 1PR9A 2HOQA 1ZP6A 1AGXA 2ORYA 3KQPA 4EB8A 4RD3A 2I3GA 3V33A 3SCZA 3UHPA 4B1FA 4WBNA 1CP2A 1PQUA 1VE9A 1U5CA 2P91A 2O1SA 2Y93A 2VTBA 1K6EA 5C5IA 2WJGA 4DJAA 3BX1A 1E7YA 5FRDA 4BNYA 3P20A 3NC1C 16PKA 4UCXA 1XRQA 2GCEA 1KRHA 4GKBA 2JFFA 3T9FA 4QYTA 2XA9A 1SPBS 2D5CA 3K2IA 2RI6A 5JUWA 2G3YA 1KMHA 2W48A 4LSMA 5CM9C 1EUCB 4Z9BA 3FG9A 3HP1A 4OJTA 2GF2A 3GA7A 4M49A 3JASB 5JR3A 1YQGA 3S6JA 2H2IA 2IVZA 4ZEOA 1T2NA 2QAGB 1NG9A 1YQTA 4QE3A 5HFNA 1KEEA 3GJSA 1N7HA 3OHMA 3TLGB 3ENVA 4GFDA 1ZK2A 2FPWA 3OTIA 1C3OA 2ZK7A 4IO1A 1DO0A 1IEWA 2QT1A 2IYYA 5C7LO 2P27A 1Y81A 3C8DA 1A7AA 4PYMA 1BE0A 4MVJA 4R8SA 4RFLA 3NEPX 5CMLA 5KJCA 1YE3A 2Z5FA 4PGHA 4F45A 3TW0A 3ZJYA 4Q34A 3GDGA 2C9YA 3HBMA 4XUEA 2PMFA 1NBME 2X6QA 1N9GB 4KAXA 2JJMA 3G2KA 3ENQA 3HJRA 1E2IA 1KETA 2ZYUX 2X4DA 4GWGA 3U3JA 3QUQA 1T2AA 1E1QA 1G8HA 3ZE1B 4BLTA 1J9GA 1F3LA 1ZH0A 3KB2A 3AIIA 3QKSA 1B8PA 1YR2A 3A2NA 4J1TA 5EIBD 3U2QA 2IYSA 4CFZA 3Q3VA 3NVMB 1AKMA 2HRRA 3P2YA 1T5BA 2O2DA 3EMVA 3COJA 1CU1A 1ZR4A 3WO0A 2HIAA 3W2IA 4LYHA 4A23A 3QWHA 5ECGC 1HL7A 1PLLA 4UEQA 4XYMA 2EJUA 3T3NA 2F8SA 2C9DA 1V5IA 2BAGA 1KYYA 2PZ8A 3GPCA 3K3PA 3L8CA 1VXRA 4IGKA 3UXHA 4E13A 2XVYA 3THYB 1KYWA 1W4CA 3UAXA 3A6LA 1V95A 4BJHB 5C3MA 3NWBA 4WH0A 1NUUA 3R5JA 2A1TS 5KAPA 4OAOA 4X71A 1M1YB 2YJ5A 2W2OA 4TKUB 3G2JA 2P9TA 1N5MA 2OFWA 1UBJS 4PYQA 1EK2A 2WHEA 3WAGA 5AJUA 3T0FA 3GLFA 1IY1A 1ZM3A 2J32A 3F6EX 2BBOA 2OILA 2OSBA 2VN8A 4KB5A 3AUFA 3EZLA 2D5AA 2HQRA 2L18A 5CIYA 1ATIA 2O3QA 2ZYTX 3O74A 4FBGA 4HG2A 4YN3A 1Q3KA 1U1CA 3G8BA 4ND5A 2C2XA 3LT0A 4B6PA 4DXHA 2Q0SA 3D1JA 3QLUA 1X9GA 4TT8A 3WNZA 2GJAA 4KHPB 3AVXA 1MAUA 4CM9D 1FZQA 1FVHA 2FP3A 2H63A 2X9VA 2BTQA 3DL0A 3F3KA 1YQUA 3G0CA 3KC2A 3O8QA 3WOVA 3QEAZ 2QBYA 4UBNA 1ZMRA 3B3AA 1XK7A 1GU7A 3TJZA 4B6SA 2J0QA 3HJAA 3LLSA 5CA1A 2F3TA 3N53A 4HC4A 1T2VA 3NVKI 3QPVA 1PRYA 5C8YF 3OLYA 3L46A 5CT6A 1SGWA 2FG5A 1ULUA 1ZC3A 1XU9A 1T2CA 3IDSA 3OT1B 4G63A 2MJLA 1ZK3A 2PM8A 4J8PA 4V0SA 3SS7X 4B3JA 5EJ7A 2P5SA 2R0QC 3SEQA 5JVDA 1K0FA 4CLHA 1RPJA 3DHNA 4M6WA 4FEYA 1P6QA 1NXTA 4OQNA 3RC7A 4Z4HA 3E1GA 3ETCA 4XCXA 4DV2B 1AKQA 3BD7A 4U6SA 1MNQA 1X7WA 4PFQA 4UBOA 4UU0A 4B44A 4UTRA 1U3DA 5FLEX 3OT4A 3V4RA 4DARA 4HVLA 2O8EA 1Z8DA 1FUEA 1VA5A 5JJIA 2VBCA 2FZEA 4R0VA 1L7MA 4WZZA 1WJGA 5DYIA 3OTGA 1ONBA 3PUKA 3DDZX 1NVXQ 4TL9A 3AERA 1XAHA 3JWPA 3LECA 5L3QB 2OGUA 2Z43A 1J21A 3LUKA 4HNUA 1YL5A 2GTHA 3PNVA 1R6TA 1OTYA 1SCNE 1U7HA 2W2LD 3KS9A 3QMMA 4EHDA 1UPXA 1V2GA 1P2SA 1XVTA 4XB2A 3I45A 2HXGA 4PC2A 3UT6A 2W2KA 4ENTA 1YR9A 4RF5A 4DT1A 3GJZA 2OEPA 2IYQA 2I2FA 1QHSA 2EKPA 3N2GA 3OFND 1A9TA 1P8AA 1ZJ4A 1D2GA 2ATCA 3OIYA 4Q05A 3TLZA 5M5BA 3UWMA 2D1YA 2WYOA 1F6WA 5KX5A 3VZDA 1QHXA 1ZH4A 3RTGA 3OTWA 3DEZA 1SC3A 3N3AC 4B5KA 2G4LA 1Z8NA 2HSDA 3A6KA 3AUYA 5A4DA 2ZT8A 3B1YA 4KIGA 3TRJA 1ATZA 3AI2A 2WTNA 4FMCB 1SHLA 1U2EA 2R7LA 2QTMA 3TRDA 1YZFA 3ZOZA 4Z7NB 5BR7A 3SXUB 2IBTA 4CHTA 3SPXA 1WV0A 1QK4A 1YQDA 3LVRE 2XF8A 1E32A 1OF1A 2XDAA 1V4VA 2YYYA 4Q00A 4UVHA 2COUA 2C8KA 1EG2A 4E5MA 2EQ5A 4YUYA 2BOVA 2W2VA 2O0MA 2XMRA 4GD3Q 5BWBA 2P7HA 1KQGA 3RBXA 2E9SA 3DM5A 3UATA 4D6PA 2HCFA 3AWIA 5JU6A 1O94C 1U11A 2NZYA 3H17A 3LX4A 4R8KA 1YDFA 2X13A 1I94B 2G04A 2J5RA 2HK9A 2J8ZA 2ZP1A 2ZYWX 1VHQA 2QTNA 3PGKA 5DYNA 2CMHA 3AT1A 3NIGB 2VP4A 1DKUA 2RGRA 2QL5A 4JEHA 5G0VA 1WP4A 3V2IA 3T06B 3A1UA 1NVMB 4R2LA 5EA2A 3DDUA 4OQZA 5CGZA 2OPHA 1VLJA 4TL6A 4BVHA 5ALSA 1AKRA 1G5FA 1Y98A 2PCJA 5JSFA 2XYHA 5KTKA 1O6FA 5DB4A 1ID8A 3MXOA 5AOVA 3V6MA 3EDCA 1ZJ5A 4E3WA 3GA0A 3BC1A 4H4DA 4JJEA 2GCIA 4EG8A 4I1UA 4PSKA 2GPJA 1G6OA 5AW6A 1NM5A 1NA5A 1QDLB 2P3QA 3C7KA 1PKXA 3GJXC 1J09A 3T5PA 3K8YA 3ROTA 4V3CA 3AQ4A 3R5XA 2ZIAA 4NQZA 3UJPA 3OE7A 4LJRA 3D02A 4N5IX 4DBZA 1KXJA 4S05A 1EBBA 3QKUA 3F1KA 1CR4A 1FFEA 3PC8C 4I50A 3K8ZA 1J20A 1ABEA 2ZAYA 4QU8A 3WBBA 2FQYA 5JY1A 5LOVF 1H2AS 1AMOA 3ZU4A 2KM1A 4KX3A 2PLFA 1B7GO 5AM0A 3MJCA 2O07A 2Y0EA 1E2KA 3Q8XB 4FDAA 5K3SA 2VK4A 3RT9A 2R8BA 1M8KA 3WFZA 2JI6A 1RKBA 1D2RA 4RDXA 7ADHA 3QBVA 2G67A 1IUNA 1XMPA 1Y7IA 1U8EA 4V0NA 5TS3A 1MENA 1VG1A 1YZTA 4MOWA 4EJSB 4HXYA 4BN4A 1CUUA 1CQPA 2UVPA 1QVWA 3JAKA 4X00A 1RLIA 1SVKA 1NXXA 3R24A 2XODA 1C30B 4DMGA 5T3UA 1FPQA 3BORA 3CCBA 3KCQA 3WL7A 4LF9B 3PFKA 4WDQA 1EGQA 3BGOS 4DLUA 4LRTB 5H3CA 4GDMA 2ZJ0A 4KXXA 1IK4A 4QJIA 1E1CA 1RYMA 2VHUA 4LI0A 1TU0A 2I9KA 2EX1A 1JGTA 4P6VF 1AH2A 3CLVA 3CT4A 2P78A 3OEWA 4KVAA 1NC1A 2OYSA 4UAVA 5BW4A 3LOUA 4XLLA 1Q77A 3FPJA 4EHIA 3BHNA 4H3SA 3RU2A 2WG1A 4H7EA 3W9YA 2VK2A 1X7XA 3RC8A 3F4BA 4LNHA 3DLTA 1TA9A 1US8B 3O4IA 1GKLA 4PU0A 3SHFA 3G49A 1T26A 1A1SA 1LC0A 1YJCA 4WV3A 2CMKA 2GOYA 3W8EA 1LEHA 4ABYA 2GNPA 3WK9A 2X5JO 2F8TA 3KVVA 3N07A 1SG9A 5ALHA 2EFCB 4BMCA 3E2MA 2QWXA 1EGVB 1ZGAA 2HC9A 4JUIA 1CZRA 4QG7A 5LWHA 3WIUA 2I29A 2ZM6B 4ZVUA 5I7UA 3RIHA 3GDHA 1SBHA 5FTLA 2RBEA 2WD9A 5U9CA 1W5TA 3CE6A 1G2PA 3R77A 1II8A 3GD7A 3I5MA 3ER8A 1CUFA 2IH2A 3PPXA 4AS2A 3ELYA 1T9KA 2OQ2A 1M1XB 2ORIA 2JF0A 3DZDA 4KNYA 3EGIA 2PBFA 4NJOA 1IQRA 1R9GA 4FCCA 2F1KA 3SIPA 1SM4A 3WK5A 4ZDJA 1V1RB 1IXSB 2QUAA 1N5JA 3DNPA 3B12A 1CB7A 4XQCA 1C9NA 1Z7WA 2R68A 4FS3A 1T91A 2R5WA 3H9UA 3SZRA 1QBGA 4UXIA 4D99A 1LI4A 4RVGA 2XNDA 2C5EA 3E8SA 1JIVA 4S1PA 2QK4A 5FH9A 3O1JC 3SJZA 3WJ1A 3OZSA 1JSLA 3V55A 4D82A 3EPJA 3MJ4A 1OTXA 3P32A 1XCGB 3L6BA 3HHPA 3GGCA 2QP3A 3MS7A 1Z4PX 5CVTA 2ONKA 5FX2A 4G23A 2H4JA 2MSCB 2FOIA 3IAS6 3JPYA 2YHUA 2NO1A 5CHYA 2A58A 3KYCB 3CNQS 5GQSA 3ABOB 1TD1A 3BMOA 3E35A 4TTAA 1YR3A 2CHUA 2PIDA 3EWNA 1JG7A 4D6YA 5MN4A 4HVTA 3VTKA 2C7PA 4UAJA 3HV2A 2I03A 4JYCA 3GEGA 4IS2A 1X38A 2L42A 4ER5A 3IUPA 2EFJA 4I9GA 5IFLA 1EJ6A 3VNAA 1O3YA 3ILSA 3AF5A 1A76A 2V3CC 1QK3A 3L6DA 4C29A 1NJ2A 5HKOA 2D54A 1ORWA 3DLHA 4F06A 1HE5A 3CWCA 3E9EA 1MCZA 2C92A 3K0FA 2H0AA 4LYEA 4JODA 1DFHA 3VGPA 4A82A 5C7YA 1OYYA 4HJXA 1LI7A 1H2FA 1YTLA 4G9BA 3VR0A 2CBGA 1ODJA 3NAZA 4KR6A 1SPXA 2DHRA 5CDHA 5KZMB 4IZOA 2VF4X 3V7UA 4N39A 4HAUA 3VU8A 1ZONA 3HR4A 2C7QA 2XMSA 3EW9A 5K8LA 5IULC 1E5QA 3PZRA 4UASA 4G5HA 1CQIB 3HBFA 1IJKA 2PPLA 4W8HA 4W9NC 4PINA 2HJ9A 2G5CA 3ZHOA 1KEZA 1NPYA 1ABFA 1OH5A 1OR8A 1Z5GA 4L57A 4Y0AA 3TN7A 3HP7A 3IXQA 4KE9A 5LP6A 3K53A 1Z12A 2WWTA 3C48A 2GPBA 3EGOA 3ZEIA 1C0PA 5K2MA 5BSTA 4LE1A 1D1PA 4I9UA 1G5TA 1HLDA 2Y1EA 1E2DA 3R8FA 2QUHA 4WNIA 3O1HB 3D3JA 4BGIA 2P9JA 1JMKC 4AF6A 4OBXA 5CDTA 3OQHA 2QM7A 3H1TA 1FMJA 3HGQA 3ZK9A 2WD7B 2OBBA 5FJIA 1M6VB 2FEKA 5LQSA 4QYXA 3KFLA 4MSUA 5BXQC 3G2HA 4BLVA 1LLQA 4QULA 5BSHA 5TQ2B 1U4OA 2ZEJA 3AOEC 1P1RA 2QZ4A 4OK6A 3VPSA 3B51X 3GNQA 2P0EA 2AMYA 3ECSA 1JH9A 4MVJF 1KEKA 2C9OA 4Z0TA 2R2AA 2FR1A 4MTCA 3FPKA 2H92A 4TPKA 2GCPA 1GRCA 3VO8A 1PEYA 3ZXSA 4E70A 4R40A 4ENRA 3KQLA 3JWIA 2X2OA 2Z5GA 4GZ3A 4Z3OA 3TQRA 1TIKA 3ZLBA 3L5OA 5CDFE 3GAZA 2XJ9A 1ZM4A 4GOND 3KEFA 1FSSA 2YXBA 1TGVA 4PBTA 4RNCA 2B4AA 4A1FA 4Q9HA 2JIRA 3S8YA 3RJZA 4MGZR 4ZVMA 2FRDA 2VJNA 2X15A 2VTDA 2GEKA 2R65A 1WS6A 3HFRA 4IVQA 1S02A 1JG1A 5B1DA 4XM0A 2HSGA 3ITNA 3LX8A 4IOKA 4NYIQ 5K0CA 4S1TA 4BRZA 2DTEA 5JMWA 4JP2A 1FYDA 2DQSA 4MHTA 1ZBDA 1NR7A 2QLBA 3I2JA 5I8WA 4IDQA 3LYUA 5CFZA 2GRUA 5CM2Z 4W4TA 1I13A 2YZMA 2C8VA 1P7VA 4JI7B 2C3MA 3E70C 1QX3A 5DLPA 1XRJA 3HBLA 5I9TA 3N2KA 1JJVA 1TQ6A 4G3XA 4N5LA 2AJDA 3D7SA 4OYLA 2ZTLA 4F21A 3MFQA 1PYOA 3O2JA 4LHXA 3KQHA 2WUGA 1QRTA 1IVYA 2F67A 4HXFB 3RIMA 1ZG3A 2EJCA 3EGDA 3DOUA 1IOVA 1JBKA 3F8WA 4INPA 3ZWWA 4TWZA 2A5DA 2IYTA 4DCJA 8GPBA 4XWWA 2O19A 4HD8A 2PMDA 3SXUA 1V3UA 1Z6YA 4RK5A 5CJJA 3E3AA 1DIAA 5KU1A 2O1XA 2W6MA 3QEMA 2OORC 4OSOA 2QAIA 1QF9A 1XA0A 4YRMA 1H2BA 4GKAA 2CLCX 4PSVA 3VH3A 4QYMA 5JATA 2WPNA 3OPMA 5CFMA 4WNAA 5K0LA 4P81A 4ZOCA 3ZX5A 5KVCA 4L0MA 1R9JA 2EDCA 3WGKA 2AT1A 1ONOA 2VYND 4FXOA 5GY7A 1FNCA 4C14A 1HT0A 2W6PA 1C81A 2Q3HA 5ICEA 2E55A 4IGAA 1VDMA 4RPLA 4L4YA 4IJMA 2VF5X 3DDHA 5F78A 5H4GA 3UBTA 1NJ5A 3OCYA 3FKSA 4IFIA 4TYQA 5M2QA 5LMZA 4ZT5A 3BRCA 4RZUA 5BWOA 4I4CA 4TYNA 3ZGVA 3TZKA 1M9NA 1YS4A 2J87A 3FUUA 1W6UA 2C00A 2ZAOA 3LA8A 1WHSA 3TOSA 5CBPA 1IM2A 4GPAA 4ES6A 3Q3IA 5ILOA 4BFVA 5JVDF 1B0UA 5DCYA 5KHLB 3PEWA 2WZBA 2O7QA 3AONB 1F6BA 1PO7A 1VZ3A 1GPUA 4M76B 4EA9A 1EUDB 5A71A 5CPFA 3KLMX 4R68A 1KEPA 5EE3A 4Z49A 3LLMA 2DJIA 3ZWVA 2KMLA 3EQZA 1ZGGA 1EI9A 2QTBA 3O9MA 4MW0A 5KQPA 4ID3A 4JSRA 4F60A 2G6BA 1EFVB 3FCAA 4RCZA 3C6BA 4MRRA 4XR4A 1NI4B 2DE0X 4YA6A 3A9TA 3RV3A 2F1JA 5FPYA 5TDHA 1W1WA 1N2HA 1LJUA 2WFLA 1QJ4A 1SBQA 3PR1A 4J9VA 4RE6A 3V3TA 4FC6A 1GHTA 3T3OA 4ZP1A 4BECA 1GG9A 2QLFA 5JNRA 2XGMA 3I8XA 4F1JA 2YRFA 3FJYA 1C2TA 1L7DA 4RUKA 1PVDA 1YVUA 2A1UB 5DNAA 1GUYA 2JCVA 3NTOA 4GPIB 3UUEA 3OQMA 4PY2A 3EDMA 3UJ8A 2Q9CA 1G21A 1Q1NA 1UBNA 1UMDB 3VVMA 1R50A 4LWZA 2AZ4A 4C3UA 4B4VA 2JI4A 1GZ5A 1JPUA 1ISIA 2D06A 2J3JA 4GO1A 4HUTA 4ZCIA 5K99A 4D0SA 3L9XA 4NQRA 3GCXA 3PU6A 3O91A 5FR2A 4DEVA 3DP7A 1CNMA 3IELA 2AQ8A 3QWIA 3F6BX 4JQSA 1YR6A 1HQCA 3GT3A 3RFTA 3BJEA 4FOTA 5JH7A 4YIKA 1BRMA 5K51A 2AOTA 3NJRA 5FHRA 3MWYW 3AVUA 4MI6A 5EMMA 3V8PA 3IDZA 3U1TA 3R20A 2GPWA 3QHPA 4RAQA 3TECE 2X8WA 5HEKA 2BCJQ 3N8HA 1AOXA 4JP3A 5ERXA 5FUQA 1DAIA 1KF0A 2IP1A 3L7MA 4NI5A 3PJDA 3IPAA 3RIXA 3LC7O 3UIEA 5EVJA 4CM1A 1CUWA 3W2GA 5D85A 4YCCA 9ABPA 3EZYA 3HB9A 1D07A 4KQKA 4RF4A 3X0DA 5BNFA 4OKIA 4OHPA 4N12A 2LTAA 2IBSA 1QC5B 2Q7XA 3OOYA 2G36A 3P96A 2YS7A 4NZYA 3L40A 3H5LA 3X1DA 2ZULA 4KXYA 2PKWA 2VHCA 2QT0A 3FE2A 4FBMA 5ENVA 1DCKA 5KKNB 1GNRA 4AT1A 5HXAA 5FPPA 4YRBA 4INOA 3W6NA 3NHZA 3VSCA 4EHHA 5BSGA 2ZI7A 1XTVA 1ZJJA 1E92A 3EY9A 1Z63A 4O2BA 2VSFA 3GA5A 2B99A 3IQIX 4FNAA 4YJHA 5ALTA 5P21A 3ZCTA 1DKLA 4JWTA 4UPVA 5EY5B 3TQOA 4BUCA 4BUJA 1I6MA 2JJ1A 1GR1A 1REQA 2K7ZA 1FFWA 4MTLA 4RTRA 4EB0A 4XDHA 2ZIEA 2AZDA 2QDKA 1W5EA 3OAAA 1R8SA 3TG8A 2NTVA 4KBGA 3MOIA 4TXJA 1YUBA 3UUFA 4WCFB 2GYUA 3CUVA 3FGPA 4HEA6 4X97A 3VU9B 4B3RB 1UJBA 2C4NA 4R2KA 4EUSA 2F1HA 4PGFA 3A6PC 2OOKA 2QEQA 4F7WA 2XD4A 5LR6A 2VYCA 4FMDF 4JB2A 3ADCA 3HZZA 1DT3A 4AFNA 4K46A 2WG2A 3GEBA 3M5WA 1D6MA 1U3VA 1ZZGA 2ZBGA 2CJXA 4S12A 5FUWA 4HPJB 1QGUA 3O8BA 1TB4A 4GUDA 1HY3A 3QLEA 4RHXA 5FOQA 4OIMA 1EFHA 3SEFA 4BO3A 3TUZC 1DARA 3W1VA 1VRVA 3QYPA 3QKRB 5C4MA 3W4JA 3ZQJA 3KJIA 2OCAA 4RLHA 4M0LA 2QR2A 3QUCA 3OLQA 1O8CA 1SCDA 2JD2A 3KSRA 3L7NA 1UKVY 3KIPA 1S2IA 4I3GA 1QGDA 5AKYA 3TQIA 4YWJA 1RM5A 2ORED 3FJOA 1ZITA 1BJTA 3EXG1 3VHXA 3OIWA 4G84A 4OQXA 5EWLB 4PX3A 4UTXA 4AW9A 3QUSA 4I55A 4HDSA 3LGAA 3O4FA 3NOVA 1ILWA 2HYIC 4X3CA 3RJ5A 2B8TA 3A1TA 4NCJA 1EKXA 1Y7HA 3SJAA 4DUGD 1KU6A 1EVLA 1WB4A 2QJFA 2ZCVA 1GL7A 1OC4A 1YDHA 5TMDA 2B8EA 2QG9A 2P4EA 3THXA 4NCAA 3AY6A 2MINA 2Z3ZA 4ZGGA 1QLWA 2IYAA 4RGVA 3KG2A 1TT7A 2G9ZA 2JFUA 1XF9A 4ZT4A 1ZBQA 4OHFA 5K3OA 4BPRA 1ML4A 2NPFA 4DIDA 2ASEA 4LQDA 1W47A 4NYMQ 3U56A 4LZAA 4PVDA 5JOQA 1I0ZA 3IRUA 2GM9A 2NUPB 2IWHA 1BWSA 1CNEA 1GNLA 3MCZA 1WXHA 3DO6A 5LP1A 5J5VA 3K70D 3EZ9A 3CZ9A 2I2AA 3AZPA 1T9GS 1J2YA 2Z8YA 1SB8A 1EQAA 3NX4A 4BLUA 5IF3A 3SC2B 3HACA 1XDWA 3FSEA 3CNBA 4TLEA 2VRWA 1V25A 3L0PA 1JIUA 4KDCA 1X94A 4LVNA 4JYAB 4Q1FA 1DXHA 3HCRA 2ZANA 2XE6A 3GB9A 1OI3A 4QDXA 1NVFA 3N5CA 1P2FA 1N0WA 4D02A 2BZ1A 4AKGA 3DO8A 4KOAA 4YJDA 3QNWA 3V4FA 2AR0A 1WNFA 1A5BB 4AMZA 1IEXA 2WSYB 2GYYA 3V2GA 4LF5B 2NU6A 4QPDA 1H2YA 2AHRA 4XCQA 3QITA 3R4CA 4O4LA 1DG3A 1W9HA 4S24A 2Q1SA 1WCWA 5HUQA 1A8IA 2J9RA 3U60B 2C9MA 3GJ3A 2LIVA 1RE1A 3SYKA 4DR1B 2R1ZA 4YRRA 3WYBA 4NZMA 1R88A 5JYBA 3ZE7A 2FKAA 4O08A 1RVV1 3WWCA 5EP3A 2HQOA 3AEXA 3SZ3A 4TTIA 5B7QA 4Y7DA 1TIBA 1C1YA 2R6CA 3L8HA 4YAWA 3IAS1 3A28A 1NJ1A 3UW1A 2H4HA 2HRCA 5EMKA 1GZSA 3UWKA 3WBKA 4EQ6A 3Q6IA 1PQYA 1NDUA 1NVEA 1S8OA 1G98A 1BX1A 2ZZNA 4PYRA 4YY3B 1R1DA 2IIQA 3BCSA 4GMHA 5K0BA 1GAJA 1QQ7A 4ZVLA 5LXTA 4XYBA 4BTEA 1SKYE 5IDQA 2WJJA 3BWYA 3QU9A 1OH8A 3TOXA 2EF1A 2JLUA 2QU7A 4CR6A 3WGLA 4N5MA 3TR6A 4KLRA 1H22A 5DYYA 2DQKA 2HRZA 4E32A 4DM3A 3UV3A 1QVVA 3OO1A 1RQLA 2DR3A 4EK9A 3OSZA 1H8HD 2YXPX 1I4OA 2QSZA 3G2LA 4W5HA 5FJJA 4CMEA 4G5SA 4PAWA 2F1RA 3QVVA 1N6OA 1ZAYA 3HXQA 4H7KA 3RODA 1LRKA 3BH6A 3WE7A 2D62A 4D44A 2QHXA 1KS9A 1N3LA 3TK1A 2KLHA 3HI4A 1Y6FA 4FNOA 2JIZD 3ZGOA 1SD5A 1J2RA 1EVEA 3GLHA 1DO8A 1QFJA 3Q8MA 2C9BA 4JI6B 4IZHA 3C3YA 1FDTA 5TRTA 1Z0FA 2XEDA 2EFDB 1CHNA 2UZ1A 4YQYA 3GLUA 2WTUA 1E60A 1Y7LA 5AM5A 2JLCA 4MEBA 2VDJA 5HS6A 4DGSA 1U7UA 2P90A 3SLRA 1PJSA 4KH0A 2RC5A 1I6WA 2YR0A 4D4GA 1YC2A 4OO3A 1JHUA 4RH3A 3KAJA 4FLMA 1CQZA 2GN1A 3TAUA 3FDZB 4WK4B 3G5UA 2ZM5A 4KRFA 4TS4A 4RPHA 1JFRA 1P4RA 1RS0A 2FZ4A 2FFRA 1XAJA 1ONSA 4I46A 4IDAA 4MW5A 1GGVA 2PRZA 2ZAGA 4KZPA 2H3EA 4L5IA 4KE8A 4LECA 1HNXB 3LCRA 1XAGA 2FFQA 5A9SB 3KXIA 2A86A 2C95A 8ADHA 3TUIC 1OYOA 1JH8A 2BV3A 4Z8YA 4C4YA 2XY4A 3VNRA 5HCUA 1NN0A 1THMA 1OIVA 2CNLA 2J5XA 3EK2A 1KDZA 2IHNA 1XEWY 2IYFA 1WMAA 1UEJA 2EZ4A 2GBFA 3MSCA 4NJEA 1XMSA 5BPHA 2LZ0A 5DYTA 2CXUA 3G2NA 5LZ9A 3VOTA 4JVLA 1NRWA 2HYDA 3IIJA 4BFWA 2O1EA 5JNUA 4BO9A 1Q1AA 3SBOA 2IY8A 3PQ3A 2IBMA 1QH1A 2LKDA 3D2BA 3TMKA 3VKFA 2FJ0A 4NZNA 1T5IA 3GZ4A 4RVSA 3BIXA 5AIBA 4QUJA 3RRZA 3FVWA 2OD2A 1AQUA 3K1JA 3C3AA 1KY2A 3LRPA 1YACA 4MQMA 1SU8A 4E11A 3WGTA 5G2OA 3LBFA 1KL7A 3AFMA 4NK4A 1PEKE 2NU8A 2VK1A 4NFYA 5FXMA 3EEYA 3R7WA 1ZIDA 2IRWA 3AHDA 2FG6C 2J48A 1ORDA 1CLUA 2WKWA 1DEOA 3T99A 4KQXA 3T12A 4QNRA 4JKIA 1EVKA 3WGVA 2AUMA 4P7KA 3PS9A 4JA2A 2VCHA 1YL7A 1BC5A 2XLCA 4B43A 2GLTA 3DL4A 3UK6A 1JIKA 3L1HA 2DUUA 2O7RA 3UJNA 3LY8A 2A0YA 1DKOA 3N0TA 3PQ8A 5EHIA 5I7SA 1OLSA 1GJRA 2FF5A 1UR5A 1DJOA 3BZBA 2PKRA 1AB6A 4QGAA 2Q5LA 1NYRA 4V0ME