3OFSA

Dynamic conformations of the cd38-mediated nad cyclization captured using multi-copy crystallography
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
236
structure length
234
Chain Sequence
WRQTWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLADTLLGYLADDLTWCGEFDTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLDGSRSKIFDKDSTFGSVEVHNLQPEKVQTLEAWVIHGEDSRDLCQDPTIKELESIISKRNIQFSCKNIYRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dynamic Conformations of the CD38-Mediated NAD Cyclization Captured in a Single Crystal
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords ADP-ribosyl cyclase 1
total genus 79
structure length 234
sequence length 236
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.99.20: 2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase.
pdb deposition date 2010-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 3ofsA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ofsA02
1LBEA 1HEUA 1PGJA 1N2SA 3HZZA 2VT2A 3C1TA 3TF5A 2RAFA 3L9XA 2HLPA 4ITUA 4BNXA 1QYVA 1ZSVA 2AG5A 1C1DB 3QSGA 1JVSA 1YQDA 2PD3A 3GOHA 3NTOA 3RUEA 3A28A 2C2YA 5FF9A 3WGIA 4QECA 4YAIA 4L74A 1OMOA 1PX0A 1SZJG 1WVGA 4YR9A 2ZTUA 1GEEA 3I3OA 4B7UA 3HWRA 1X1EA 2JAHA 5CEFA 5TGDA 1VI2A 2CMDA 1U2GA 2DAPA 1GFSA 4RF4A 4F3YA 4Z9XA 1LDBA 3BMNB 3SX2A 3AFMA 2D5AA 2X1HA 2IEDA 4R3WA 4MVJG 1Y8QB 1X0XA 3QQPA 3WWZA 2P2SA 4J7UA 5CDGA 4CODB 3CH6A 1PJ4A 3RUIA 4IS3A 1SCUA 1Q0LA 1Y81A 4BO7A 3D4PA 4HNHA 5KVSA 5AYVA 2W90A 5BT9A 2EF1A 4D3FA 4OXKA 3ROKA 4D3DA 5JE8A 2VYND 3Q2IA 3A1NA 5KNLA 3DOCA 3IIEA 1DLIA 4YTEA 4BB5A 3LDHA 3HSKA 4UUOA 2P9EA 4ZQGA 1Z6ZA 4CLRB 1P33A 5A5FA 3DBHA 3HDYA 1HXHA 4CV2A 2BRUA 4Q3AA 1T2CA 3I23A 4BO8A 2PWZA 2CNBA 4K6CA 2R00C 2WJPA 2JHFA 4OKIA 3WYBA 2EW8A 3S2FA 3I9KA 1R0LA 1Z82A 4BO3A 1R16A 2NTJA 1CF2O 1H2BA 2AQKA 2LDBA 4EGFA 4ZQBA 1ISHA 3KSDO 4QEDA 4DBZA 1BXGA 2YZ7A 3ONEA 3G0OA 4ZQHA 4TMFA 2ZB3A 4MKRA 5JCJA 1VL6A 1E3WB 1K6IA 3ZU5A 1Q7BA 3DZJA 2CF6A 3ICCA 1PZFA 4IGEA 2VWHA 3GNQA 5DCYA 3NJ4A 3SBOA 1B15A 3DB2A 3KRTA 1F12A 2VCYA 4FCCA 2E37A 3DONA 3A06A 5AOVA 4CLHA 3AM3A 1ZZEA 4B4WA 4TZKA 1E92A 2Q50A 2X0IA 2C82A 1BSVA 1EVIA 4OXYA 1IZ9A 1NVGA 3R3SA 2NQ8A 3EUWA 5I8WA 2QZZA 3SLKA 5B4VA 3EZYA 4CMAA 3GY0A 4CMJA 5A9TA 3WGTA 5KVQA 1QYWA 3WS7A 3FBTA 2Q4EA 3NYWA 1TEHA 1T1SA 5H81A 3D3EA 3LT1A 4XIYA 3RWBA 4DUPA 3KUXA 3WLFA 2VHVA 3DOOA 1PL8A 3ROQA 1QV6A 4X54A 4OAQA 4DIOA 1B8VA 1B16A 2YQ5A 1T2EA 1E7MA 5JY1A 1VRWA 3WGGA 1T1RA 1HWYA 3GG2A 1J5PA 1PL6A 5JAZA 3ROPA 1KVQA 4I9NA 2B83A 2IDZA 3BAZA 3N58A 3KZVA 5I8ZA 2BELA 5B1YA 4KDFA 3BTUA 4GPD1 1U9JA 1XSEA 4Z9YA 2UDPA 4FFRA 2NVWA 3L77A 2Y1CA 4JBGA 1V8BA 1LSOA 2G1UA 2O3TA 3ROMA 2FR1A 1DDOA 2AA3A 3BMQB 4NI5A 3K6JA 1PR3A 1EBUA 4ND5A 3B1JA 4K28A 4Q3CA 4NJOA 2AQ8A 4IS2A 4MP6A 4I5DA 4IIVA 1P0FA 5JAMA 4FJ0A 4BHTA 4RPKA 2NU8A 3M1AA 2EGHA 5C7OO 2X5OA 3H2SA 3RUFA 1MV8A 1LI4A 5IDQA 3VH2A 2NSDA 1Y1PA 3OF2A 3F9IA 4BIIA 4CQLB 2JJYA 4FFOA 1LDYA 4JJIA 4XYBA 3LT4A 4MVJA 2AG8A 3DFZA 4KZPA 2F00A 4Z0HO 4UVHA 1CEQA 1UP6A 2E82A 2HMUA 2CDAA 2J3HA 1R4NA 3WGZA 3K2BA 4JLWA 1XKQA 3AOGA 3GN2A 4CQMB 1ISJA 4MPDA 3GK3A 3GQVA 2DTDA 4MVJM 5L51A 3KM0A 3PGJA 1KEPA 3RBZA 3ZCXA 5A02A 4NU5A 3N74A 1Y8RB 4U5QA 3CEAA 4CJXA 2GN6A 4EJ0A 2O3QA 3JQAB 3H65A 4I8XA 2WYVA 4M1QA 5IDXA 2C5EA 1O6ZA 1NM5A 1U8XX 1GZ3A 4HP8A 2QYTA 1X14A 3D5TA 3IJPA 3G1TA 1KYQA 1VE9A 4B4VA 5JDIA 2FZEA 5EERA 2I76A 4U8GA 1E7WA 2VT3A 4D41A 4OIMA 3OBBA 1X7GA 2QHXA 2E4AA 3I9MA 4JIGA 2Y1GA 3NTQA 1E1KA 1BMDA 2ZK7A 5L45A 3FPCA 3HB4X 2J6IA 2WD8A 3LLSA 4EZBA 2EP5A 3NEPX 4FJ2A 3DZHA 1PJCA 5L3ZA 4XJSA 3OJFA 5DNAA 2JD2A 4XA8A 2GO1A 2NACA 1H9BA 3GVHA 4QSMA 3RC1A 4H16A 3WQQA 3PJGA 1H9AA 4B79A 5JAQA 9LDTA 2BGKA 3GGGA 5U4QA 1AXGA 2VZ0A 3UN1A 1YOVB 3NUGA 1GYRA 1HDYA 5TQVA 5G2OA 2O50A 4YCAA 1EVZA 5C7IO 4C4OA 3O38A 4YXFA 1VJ1A 3DHYA 4BNIA 1YB4A 2DQ4A 3BMOA 2BMAA 5GZ6A 4MJLA 1PGNA 5DOZA 3UHAA 4BO0A 1RKXA 3WYCA 2PGJA 3AI3A 3K30A 1A72A 3TOZA 4ZN6A 3HDHA 1ZXLA 5JNLA 5L4NA 4W4TA 3VHRA 2X0JA 4RPHA 4D45A 5CG1A 1UXKA 1YKFA 3F1KA 3QW2A 2ZB4A 4E6PA 2VRCD 1Z74A 1ZK1A 2BGMA 4RGBA 4WLUA 1QYDA 4CM9A 5BQFA 1BDMA 3H2ZA 3F1LA 4II2A 1FDWA 1C1XB 3QWHA 1ADCA 1RWBA 3E1KA 3IUSA 3F5SA 4GMFA 4HADA 1M67A 4BB6A 1E7QA 3VZQA 2FPPA 4BMNA 4BO9A 2VZ9A 4U7WA 5A06A 2I65A 3WTCA 1C0LA 2NTVA 4M89A 5BSHA 1BVRA 1YBVA 1NASA 1DEHA 2PNFA 3PQDA 3GVIA 1I30A 3ZNPA 2R2GA 4LCEA 4BGUA 4E2ZA 3S2GA 1U4OA 1J49A 3JD4A 3EHEA 4WUVA 5U1PA 5JW6A 5BNIA 1UXJA 4XR4A 4R3NA 4HXYA 3T4EA 3VPXA 1LLUA 4L8VA 4RF2A 4GX1A 2IRWA 4IDDA 5IFLA 4LMPA 3QWBA 1CDOA 4TWRA 1IL0A 2TMDA 3W8EA 4YEDA 4DLAA 3WGOA 3VH1A 2I6TA 1A4UA 3SC6A 4TQGA 4BNVA 4BNKA 2BI8A 2Y99A 4Q39A 2YV1A 1WPQA 3PIIA 4B4UA 3FTPA 5G0VA 1FDUA 3HB5X 3DZIA 3NRCA 3O9ZA 1EQ2A 4DIBA 1PJTA 4WEQA 3VTZA 1PQWA 2RH8A 1MC4A 3GF4A 3RU9A 3E9NA 2Z5LA 3HQ4O 1DIGA 3CMCO 2YUTA 2VHZA 3ZWMA 1HSZA 2VOJA 1TI7A 1LEHA 1PJ3A 2ZCVA 4R5MA 3EMKA 1C14A 4BKOA 2HDHA 2P4HX 4ND2A 4CR7A 4GMGA 2NNLD 6ADHA 2OGUA 2DVMA 4OSOA 5ENVA 5CDTA 1LC0A 1KVRA 4AFNA 4CLOB 1PJBA 1P44A 4FJ1A 4LISA 2PLAA 1Z45A 2Y67A 2FSSA 4RVSA 3KVOA 5B4TA 2NU7A 1YONA 2GLXA 3QVSA 3TZKA 3PEFA 4DRYA 3OH8A 1JWAB 1Q7CA 3LT2A 5JLAA 3WNQA 1LU9A 4WCFA 3VPGA 5DULA 4BO6A 3GGPA 4MP3A 4DQUA 1WZIA 3PYLA 4CLDA 1H0KA 3KYBA 1D3AA 1DHRA 3H9QA 1E3EA 3JV7A 3PTZA 5GY7A 4UVIA 4CPDA 3RKRA 4GWKA 4WJZA 4II3A 1IZ0A 1M6HA 4JBIA 4BNYA 4CUJA 3LU1A 1ZVMA 1XDWA 3JQDA 4ZQEA 1BXGB 3PJDA 3V2UA 4BVAA 4UAGA 5IF3A 2FPGA 2C07A 1WLYA 1ISIA 2X23A 2FMUA 2OBNA 2OHXA 2DTXA 4CQMD 1BHSA 2Y66A 2PV7A 1WMBA 1I2ZA 2I5PO 1XIVA 1YJ8A 3ZN2A 1A71A 2QYSA 3PI7A 2O3RA 2H6EA 5KVVA 3PIDA 2QX7A 3K96A 1VM6A 4IDBA 3ZWOA 3ZV5A 1B8PA 4FPXA 4FFMA 3I9JA 4DYDA 1DIAA 1XYGA 1GCUA 1I32A 2DT5A 1NXQA 3QWFA 5DBGA 4DC0A 5IDWA 3FNHA 3GGOA 4MIOA 4NU6A 3NDRA 4RVHA 3GNTA 2C7VA 1I10A 5HM8A 3RC9A 4JJFA 1FXSA 3DR3A 4NBUA 3UKOA 1O94A 4IBOA 2PTGA 1DRWA 1GQYA 4PIVA 4U0KA 1PJLA 3DAGA 3ASVA 2PKRA 3JD2A 3NGXA 1SEPA 2Q99A 4K26A 2Y1OA 1GCOA 3OMLA 4LW8A 1R12A 4E13A 4G2NA 1WW8A 4MP8A 1A9YA 1PJ2A 3EGOA 3GZNB 4ALNA 3JQ6A 7MDHA 3PZRA 2B4QA 3VPSA 3WIEA 1KEUA 2PZKA 4TRNA 1ZK3A 4A0SA 5F3RA 7ADHA 2JL1A 4MKZA 3FBGA 2O3SA 1I2BA 4JP2A 3RD5A 4M49A 1ZEJA 2VQ3A 4AVYA 1B3BA 5MDHA 4INAA 3E03A 4XYLA 1MX3A 2JFHA 5A9RA 3R6DA 1P1KA 2CUKA 4FFNA 3BHMA 3HHPA 1QP8A 4TZTA 2P9GA 2Y1FA 4RVDA 4A03A 3L4BC 4TVBA 3RJ5A 4PZCA 2FP4A 2X4GA 4GVLA 4WASA 4B7CA 1ID1A 2OL4A 1ZEMA 3LC2O 4U0JA 3KOUA 3ZGYA 2RHRA 4HX5A 5DCWA 1V0JA 1OI7A 2VYVD 3CZMA 3D0OA 3PWSA 1SPXA 4PG5A 4IUYA 3GEGA 1EVYA 5BSEA 4WECA 3F47A 4CM3A 4R5HA 3UF0A 3D5QA 1TT7A 2PD6A 1R4NB 2V6FA 3V2GA 2JKVA 5FWNA 3ZHZA 1HE2A 4E21A 3R0IA 1EFKA 3SJ7A 1GZ4A 3T7EA 2ZYDA 1P1JA 4BKUA 3PFWO 3WIDA 1N8KA 1JTVA 1BXKA 2WYUA 4IPTA 4XR9A 1FDSA 1I33A 3U3XA 4BS9A 3RC2A 3H8VA 1DB3A 3JQAA 4IZIA 4P22A 4WLNA 5HTOA 5JO9A 4IJWA 4NR0A 3U49A 3TZHA 5J23A 1PS8A 3H9UA 1GAEO 3WMXA 3JQ7B 4E31A 5I7SA 4FSHA 2QRLA 1OFGA 3ASUA 3WOHA 1JN0A 4HKTA 4FD3A 2VUSA 4P4NA 3PYXA 2GN4A 3TSCA 2UYYA 3ONFA 4EEXA 1YL6A 1NPTO 3JQFC 3P7MA 1NQOA 3ONDA 1I3NA 2H1SA 2OUIA 4K6FA 1ZJYA 4IINA 3DL2A 1QMGA 4CMIB 4XQEA 1GV0A 2A9FA 3B1KA 4MVJP 5HRUA 4BNWA 1YO6A 4PLGA 3NTRA 1KEWA 4XQGA 2DUUA 2JAPA 1O0SA 1BTOA 1U3VA 3H6KA 4RLSA 3GHYA 5TF4A 4KP7A 3I6IA 3LSYA 3GR6A 4GBJA 2YHUA 3CXRA 3PP8A 4DPMA 1YOVA 5DBFA 1HKUA 4MVJF 2C20A 1HLDA 4LVCA 1SBYA 4Z0TA 1EBFA 1X13A 3FPLA 4AJJA 3TFOA 1H94A 4A2CA 1ONOA 3AUUA 5L53A 1F14A 3IAHA 3NV9A 1LA2A 5ER9A 2NVUB 4GAEA 3DZBA 1I2CA 4I5EA 5FYDA 1HE4A 2PGDA 3X2FA 4WPGA 2PK3A 2X7HA 5CP8A 2IZZA 2WD7A 5ILOA 1TLTA 2XAAA 3MJ4A 1CWUA 4J0EA 1A4IA 5G4KB 1E6EA 3S55A 3VPHA 1LRKA 4Z6KA 3LC7O 1TA4A 2YDXA 3KLPX 4I9UA 2AE2A 4A10A 5EIOA 4GX0A 3GEDA 4ROSA 1YL7A 3V8BA 5EL0A 1T4DA 2O2SA 2Y93A 4Q3DA 1XU7A 1DC6A 3MEQA 2VHWA 1YWGO 3MWEB 1WDMA 4R69A 4IZHA 5EESA 5G4LA 3WICA 8LDHA 4DL9A 1HRDA 1YRLA 1NTOA 4BO2A 2X9GA 5AXAA 4MIYA 1U28A 4AJ2A 4L4SA 4IXWA 2AQHA 5T67A 3DMYA 4GL4A 1GUZA 2YYYA 3LVFO 2NU6A 3JQFA 3ZU3A 1B3RA 2OMEA 3LZ6A 1KC1A 4E2YA 2X8LA 4U6SA 4ALJA 4D46A 1QXSA 3PJEA 1LRJA 4OYRA 4R41A 3B1FA 4ND3A 2CY0A 3QWAA 3DBRB 1F0YA 2WE7A 4XDYA 4CR8A 1B2LA 4FR5A 4EBFA 1HDCA 2D5CA 2WSBA 4DMMA 5F5LA 4FFPA 4CM7A 3PQFA 4PZEA 4CL8A 3EY4A 1RYEA 3RBXA 2GZ1A 2W2LD 3OIFA 2EWMA 2Z1MA 2PKQO 3WQSB 3WYEA 1DAPA 1HF3A 5AQ1A 4HFMA 3FTNA 1XEAA 2WMDA 3AM5A 3UCFA 5L40A 4F46A 3E5MA 3PFFA 2BH9A 2UUPA 3R1IA 1R66A 5ICSA 1WDLA 2Y0DA 1M75A 3VTFA 4CM4B 1K3TA 1V6AA 3L6OO 4IDFA 3I9OA 2BKAA 3KYCA 3IL2A 4YAGA 4NFHA 3M2TA 3RAJA 4PN3A 3QRWA 4CLOA 1F17A 2HSDA 4DPKA 4YRBA 1K6JA 1KERA 4JNKA 1ENPA 4YJGA 4J4HA 3AOEC 4R51A 3KYDA 2WYWA 2C0CA 3ADOA 4ZQFA 5CG2A 1W73A 1ZK2A 2Z1NA 4IDAA 3DQPA 3GVPA 4YAKA 2PKQP 5I9MA 1E3IA 3O8QB 4LSMA 2PGLA 3ZNQA 2GF2A 2GASA 2DFVA 4BQRA 1WMAA 2CFCA 4BGIA 1MFZA 1YXMA 4IDCA 4NJMB 1FF9A 1MP0A 5IDYA 5KIAA 4YQYA 2Y1EA 3RI3A 4CMKA 3UAGA 4AJLA 4YYZA 2G76A 4OHUA 3FWZA 3A9WA 1P1RA 4YDRA 1LQUA 1ZSNA 4Q9NA 3GFGA 2HMVA 5KJEA 3VH3A 1Y6JA 2O2YA 1GL3A 4N7RA 2ZCUA 1DO8A 3AU9A 1Z7EA 3DBVO 3ZDFA 4F6LA 2G17A 2EEZA 1CJCA 1MG0A 2FR8A 3FWNA 1M6WA 4Y9DA 1JAXA 2BLLA 3NT5A 4UUPA 3AJRA 4AJNA 1ZMOA 4E2XA 3D64A 5K6AA 1E7SA 3IP1A 3BTOA 4IY1A 4KDEA 1F8FA 1ZIDA 1H6CA 3G3EA 4YWJA 5A3VA 2VRBA 4BQPA 3R3JA 2QG4A 4R1UA 1HSOA 1C0IA 1YQXA 1IY8A 1LRLA 2EHDA 3RUDA 4CV3A 1QSGA 4RCVA 5TNXA 3BZUA 4IIUA 4MVJE 3P5SA 2POQX 2ZKLA 1LDMA 4TKMA 4BKPA 5HS4A 2Q4BA 1YBMA 2ZQZA 4ND1A 4D79A 3JQEA 3LYLA 4XYGA 1K2WA 2ZQYA 3KO8A 4A26A 2V7PA 2YHIA 3OJEA 5C3MA 4J7CA 4HV4A 1ENYA 4EJMA 2GR9A 3WSVA 4KUHA 3ICPA 1PJQA 4YT2A 3WGYA 2YFQA 2NADA 1O95A 3ANNA 4WLOA 4OH1A 1BRMA 2Q1UA 4J7XA 4GQAA 2ZATA 3GHHA 4IMPA 3RVDA 2RBEA 5A9SB 4S3MA 8ADHA 2NWQA 3ENNA 4R68A 4ZRMA 4D0SA 4RLHA 1VSUA 3GZNA 5LDHA 4FQ8A 4ALLA 3CPSA 4GX2A 4RV9A 1DXYA 2TMGA 3MTJA 1BW9A 3DZKA 5EQDA 4BNJA 1SNYA 2FOIA 1H6AA 2DFDA 4MVJH 4W7HA 1C3VA 1O9BA 4ZICA 1NX6A 2EIHA 3ANLA 4BV8A 1NBOA 3STHA 1Q7GA 4OL9A 3LLVA 1GPDG 4N54A 2HK8A 4J91A 5JMWA 3VKUA 4DWVA 4B3HA 2B5VA 4E12A 1HZJA 2V6MA 1PS9A 3UICA 4QXMA 1B26A 2BFMA 2EV9A 4R1TA 4XCVA 4J49A 1LDEA 1H5QA 3Q2KA 3K92A 3CINA 3JQ8A 4DGSA 5F1OA 1VJTA 2CSUA 1L7DA 5DP2A 3T7CA 4ILKA 4EUFA 1J6UA 3IC5A 4A27A 2BFAA 3FNGA 4GWGA 2VN8A 3PZBA 3WMWA 2PZLA 3EZLA 4RF5A 3P2OA 1WWKA 4CM1A 3WTBA 1OBFO 1XELA 2VRCA 4YT5A 4DA9A 3RFXA 1KETA 3WXBA 2GN8A 2ZYGA 1CQJA 3TL3A 3ZZNA 1SOVA 5EPOA 1GD1O 4HFNA 4AJPA 1KY5A 1ZW1A 2DBVO 4PVCA 3GC6A 3H9EO 3D7LA 1FDVA 1FJHA 4NDNE 4UVDA 4PLVA 1PS0A 4E5PA 4J1NA 1UZNA 1NFQA 3INRA 2GDZA 2EKPA 1S6YA 4RQUA 2GD1O 4RPGA 5F21A 2GRAA 4YPOA 2PFGA 5TSDA 2QZ9A 4QFDA 2VHYA 4FS3A 3OSUA 2B5WA 5ICMA 2FRDA 3KXDA 1R0KA 1H6BA 2D4AA 3FR7A 1R37A 3BYZA 3I5MA 3JQ9C 1AHHA 2QW8A 4FW8A 5JPIA 3AU8A 4C7JA 2BGLA 4AJHA 3H5AA 1G0OA 5L7TA 2DC1A 1CQIA 2HAEA 4L76A 1N9GA 4YRDA 5CDUA 2GSDA 4W7IA 3OJLA 3AOEA 3DFUA 3IUPA 3CTMA 4QQRA 5IN5A 2ILTA 4K1LA 2VWQA 4O6VA 4PLWA 1RM4A 1V3UA 1YS4A 4B8ZA 1D4FA 1QRRA 3PPIA 2W4QA 2JFGA 4PG4A 1ISGA 3OEWA 1ENOA 3PXXA 2CD9A 2H63A 4OGWA 2B69A 1QLJA 3WQRA 5CDSA 3BTSA 3WBFA 3DHEA 4IXTA 4MVJI 1X0VA 1W8DA 2FHSA 2OP0A 3KHUA 4NMHA 4J6FA 2FR0A 1MGOA 3GNSA 5COBA 5K0ZA 1JAYA 4JQCA 3VC7A 1X7DA 2BHLA 1ZBQA 1HDXA 1LSJA 3W8FA 4ESOA 1U3TA 2D8AA 4XDZA 1A7KA 4WGGA 4I9HA 5BNTA 1EDZA 2WEKA 4CM5A 4M86A 3GZ4A 3FI9A 1HYHA 4UEKA 3OJOA 4IQ8A 3Q9UA 2IZ0A 1Y8QA 5JDIC 1DIHA 2DLDA 5KJCA 4YACA 1HZZA 3PLRA 1MUUA 3GVCA 3TPCA 2ZIZA 3JQGB 2JCVA 5JS6A 3V1TC 1CYDA 1PL7A 3ZW8A 3OIGA 3IDSA 3KEOA 3O03A 5ES3A 3E18A 5G4KA 1UDAA 3TFQA 3ZV6A 4BGVA 4FIZA 3JQ9A 4CM8B 4KQXA 1GQ2A 1BGVA 5T57A 1OZAA 2X9NA 1JLLA 4DIFA 2G5CA 1PR9A 2NM0A 2XOXA 4NBWA 6LDHA 5GZ1A 3ZWVA 3B70A 3BA1A 3DAPA 1GTMA 1X7HA 3GG9A 1LSSA 3VOSA 1OOEA 4PRKA 4MOWA 4Z3KA 5JDCA 1GADO 2DUWA 3C85A 1NHWA 1DC3A 1DLJA 5TS3A 4IM7A 4GI2A 3S8MA 1LX6A 5JY6A 1IPEA 5CDYA 3PHHA 3HJAA 4L75A 3DZGA 1ZSYA 2HRZA 1A9ZA 1GYQA 3SC4A 2I3GA 1E3WA 3P19A 3ZHBA 3H3JA 1AXEA 2QRKA 2HQ1A 3DBRA 4AL4A 1G1AA 5JBIA 4TKLA 3GVXA 3AUAA 5EN4A 3ZWWA 1U3WA 2O7SA 3KSZO 2YW9A 2GERA 4E33A 3DBLB 2C59A 2R6JA 4D0RA 2X0NA 4NPCA 4WLVA 4N5LA 1YH3A 4PCVA 1K0UA 5AVOA 1U8FO 1EE2A 3ZHXA 1KS9A 2X86A 3GUYA 3DTTA 4JN6B 2XXBA 1ORRA 1AGNA 1FMCA 1ZXBA 1LDGA 2J8ZA 5IZCA 3G17A 1HTBA 3ZWNA 3U9LA 3M2PA 1M76A 4BKQA 3NAQA 1GUFA 4TSKA 4W99A 3AY7A 3DC2A 3BMCA 1QYCA 2GYYA 3IKVA 1T2FA 3C7DB 5K6AC 1LSUA 3D3WB 3QP9A 5H82A 1DIBA 3DAFA 1HETA 2VWGA 3T4XA 4NG5A 3W1VA 1DRUA 2HCTA 1QG6A 3ST7A 4PRLA 2P5UA 3W6UA 3F6YA 1DJNA 3A14A 4J2OA 4WNIA 3E48A 1D1SA 3KSUA 1QYXA 1BXZA 1F8GA 1LLQA 4J1SA 2O3UA 4RZIA 3GPIA 2X9VA 1BWSA 4TRMA 4KUEA 3JQBA 4NJMA 3LQFA 1DJQA 3RIHA 1LTHR 1DOHA 3BMQA 3F4BA 3JYNA 4O63O 4DREA 3H9GA 2NUAA 3GEMA 3AUSA 3KLMX 3F5QA 1IYZA 2FY8A 4XQCA 5TIIA 1RM3A 2GGSA 4OOFA 1XG5A 4D7AA 4NIMA 5CAEA 1UR5A 1UH5A 1TVEA 3Q1LA 3RC7A 2DBRA 3NJ8A 4U6QA 2CVZA 3GMDA 4GSLA 1ISMA 2Y0CA 4BO1A 1C1DA 3HNPA 1XCBA 5I9LA 1ZJZA 2G0TA 3TNLA 1E3JA 1NVMB 4IQ0A 5IJZA 4YAEA 1VC2A 1V3VA 3GLQA 1NFRA 2O48X 4CQLA 5L4SA 5L9AA 1AHIA 4R16A 3GFBA 2Y05A 3PWZA 4HY3A 4DPLA 4HFJA 1NVTA 3M1LA 4L73A 2D1YA 1LJ8A 4YT4A 1NPDA 3BMNA 2I66A 3ITDA 4RDIA 2J3IA 4L4XA 4B7XA 1EE9A 2HMTA 3KV3O 3LC1O 2D0IA 3GUCA 4YT8A 3L4SO 3G79A 5BSGA 5G0TA 2Q1TA 3AM4A 1NFFA 4RORA 2ZJ1A 1Y8RA 2EP7A 2W2LA 1TXGA 4PLYA 3WGQA 1JKJA 5I9NA 5HA5A 4XGNA 4UEJA 4DLLA 4G65A 1PZGA 4EEZA 5TLSA 4MVJD 4AJ1A 1VPDA 3AW9A 4HUJA 4CLEA 1PTJA 1DPGA 2W98A 2ZTLA 4CLRA 4GSKA 5KJFA 4WCDA 5GMOA 1PWXA 2O7QA 1Z75A 1V35A 4XGKA 3V1YA 4D44A 1NHGA 2NU9A 4L4RA 2BFOA 2HJRA 3AY6A 5ITWA 2Y1DA 4N5NA 4LGVA 3JCZA 4NBVA 3JYOA 2FN7A 4IJUA 5BR7A 3IKTA 4IDGA 3FCOA 1E0DA 5IZCC 1N92A 4XJTA 4CUKA 4E4YA 2Y68A 4CM6A 4LVUA 4PLCA 3CKYA 1IE3A 3U0BA 5G0UA 5I7VA 4K9DA 1PU2A 1N5DA 2D2IA 1RM5A 3CIFA 3QLJA 3K9QO 1EK5A 2EKQA 2X5JO 3JQ8B 3SXPA 2ZJ0A 2GZ2A 4M55A 4GGPA 4DMLA 4E3ZA 2EW2A 3I6QA 4J0FA 4OKNA 4UREA 4WE3A 3ZH2A 5JAIA 3HDJA 3JYLA 4XB2A 3WDSA 3ZV4A 4CL3A 3JQAD 4RQTA 3W4IA 4FB5A 3OHSX 3ZWBA 5CEJA 4LCJA 4ALMA 5B4UA 4YA6A 3L6DA 1SC6A 4EI2A 3TZCA 4O59O 3GDGA 2EG9A 4CV1A 1LUAA 4KQWA 4W6ZA 4C7KA 5C5IA 1KC3A 1U4SA 1O8CA 1B0AA 4UULA 3RBVA 1EFLA 5K9ZA 3E8XA 4OQZA 2DBQA 3O26A 3ZV3A 1NYTA 3KEQA 1VJ0A 1E7YA 3ON5A 5T64A 2HUNA 4RVFA 1P74A 1LC3A 4ZA2A 1AE1A 3ZWXA 3VVCA 3GAZA 4OM8A 1M2WA 2J5KA 3WWYA 3PHJA 4BNZA 3AWDA 1ZUD1 1VSVA 1XHLA 2DTEA 3OQ6A 1W4ZA 4KTTE 1UDCA 2X0RA 2B0JA 2C29D 3C1AA 5B12A 1DAOA 3H5RA 2O3JA 4JJGA 4O1MA 2HRBA 1NWCA 3VDQA 1DBVO 3DXFA 3OICA 2RCYA 2AEMA 4BO5A 1MB4A 2UVDA 4MIEA 4TRJA 1N9GB 4RL6A 2NTNA 2X5KO 4BNMA 1X15A 2D59A 2Q49A 5KCZA 3NGLA 2R00A 2Q2QA 3F4LA 4B3JA 4DQVA 2I99A 3D1LA 1W0CA 3DTYA 3RSHA 1T4BA 3ENKA 1I0ZA 5I7EA 1EDOA 3NX4A 1P45A 3COSA 4RPJA 1GZ6A 4AJKA 3HN2A 4KOAA 4J4BA 1JQBA 1DC4A 4NK4A 1NQAO 3ETDA 3VVBA 4E5NA 3RQSA 4OQYA 1YB5A 1I3MA 3WLEA 3RJ9A 4I5FA 3IMFA 5ILGA 4WCFC 2YY7A 1ENZA 3AFNA 1YVEI 4RZHA 3H4VA 5DN9A 1ZH8A 3OM9A 3QVOA 1Z7BA 1PIWA 1K89A 2JCYA 1GV1A 3N7UA 2C5AA 3QVXA 1W6UA 4WEOA 4DQXA 4J3FA 3ADPA 4L0QA 4LSWA 4PLPA 1H6DA 4G81A 4BV9A 4ZD6A 4AJ4A 2GPTA 4CQMA 5I7FA 3JQGA 3ZU4A 3GAFA 2DKNA 1GEGA 2O4CA 5AXBA 3GRKA 1IOLA 3ORFA 3ZWAA 2GCGA 4YRAA 4CR6A 4E0BA 2A35A 1R0SA 3WJ7A 4A5OA 4LK3A 4DYVA 1YDEA 1ZKMA 1X1TA 1Q0HA 1O5IA 5THKA 1NNUA 2Q46A 4M8SA 1PQPA 2IODA 4WCFB 3IP3A 1QV7A 5EJ2A 4UEOA 4E2WA 3ULKA 1HDRA 3VZPA 1P3DA 1QKIA 3UH1A 3EVNA 4Q3NA 2J5RA 3PRJA 3ZWPA 5JSFA 2A94A 4B3IA 1TT5A 3GA0A 3SLGA 1HDOA 1JW9B 1XGKA 4Q3BA 1KOLA 3S2EA 3L4BA 1OC4A 4EYEA 1T26A 3IOYA 1XQ1A 3V2HA 1WZEA 3HE3A 4PFJA 3G49A 2Q45A 2RHCA 1RM0A 2B4TO 4JCOA 3DHNA 1A7AA 1SAYA 2ZB7A 3DEYX 3OA0A 3WJAA 4ND4A 2GUGA 4ALIA 3W4JA 5DT9A 2CZCA 3RASA 1K6XA 1PWZA 4RPLA 2Z95A 3WNVA 3WR5A 2PD4A 4BNLA 5A3JA 1DIRA 4Z3DA 1OAAA 1SO8A 3DBLA 1PEDA 2NQTA 3AUTA 3KBOA 5JFOA 1F06A 4UUMA 1I5RA 4XD2A 2GNAA 1QORA 9LDBA 4E5MA 1YB1A 2X6TA 1ZNQO 2PH5A 3O4RA 4H15A 1Z73A 4L9RA 4EW6A 4NBRA 3VH4A 2H5LA 2Q2WA 1NQ5A 4CV0A 3M6IA 1YJQA 1UXIA 2C54A 3BMCB 3LT0A 2BF7A 3UUWA 1CERA 5C37A 3JD1A 2UUOA 1GYPA 4ZU3A 1NAIA 4QO8A 1EMDA 4GKVA 1PQUA 3X2EA 3CSDA 1N1GA 4AJEA 5DF1A 1C1XA 4BNHA 3TJRA 4J1QA 1HE3A 5JXWA 3RROA 1J4AA 5MGBA 5G0SA 2JD0A 4JP3A 1I8TA 4E5YA 1E1MA 1U7HA 1YL5A 4O0LA 3NDIA 3QWIA 4ZJUA 5KJ6A 1UAYA 1UXHA 4BMSA 1P0CA 3CE6A 1JKFA 4R01A 4HWKA 5F5NA 1XWFA 4NZ9A 4J9UE 5KKAA 1XLTA 3FNFA 1N1EA 1C0PA 1P77A 4WNCA 5FI3A 3MJVA 3BHJA 2DU8A 1EEHA 1IHYA 2VZ8A 4WOKA 3MJSA 1I36A 4Q3EA 2CDCA 3QIVA 3AK4A 1E6UA 4B4OA 3MOGA 4B8WA 3WFIA 2IE0A 3PHLA 3QVWA 2WDZA 5IG2A 4J16A 1IPFA 1NR1A 3FR8A 3FRJA 1VL0A 4XEHA 1KIFA 4PVDA 1RYDA 5LCXA 1Y9AA 3H9JA 3PK0A 3TRIA 4CLXA 3GPDG 2W2KA 5KOIA 4KTVE 1I3KA 4IMRA 3C8MA 4YJFA 4AG3A 3U09A 1CETA 4LN1A 2I67A 3FN4A 4BOYA 3W4KA 1LLCA 3IS3A 1B14A 5CEEA 1SB8A 3B6ZA 1R15A 4JX8A 2JCXA 2NLOA 3MJCA 1E1NA 4QT0A 2QIOA 1T2AA 4URFA 3QY9A 3NT2A 2WWRA 1K5HA 3DO5A 3TZ6A 4BMVA 4JBHA 3TOXA 2P91A 4Y6PA 4N5MA 4YJDA 1MXHA 2J5QA 5T6BA 5KKCA 4W9NA 1H93A 1MXFA 2ZTMA 3WB9A 4N18A 1ZK4A 2YV3A 4UUNA 4YAJA 1HL3A 4J43A 4FGSA 5ER6A 1M66A 3VZSA 5JC1A 4QUKA 1DFIA 3U4CA 2ZB8A 1U1IA 4GLLA 3ETGA 4IGFA 2AHRA 2HU2A 3TN7A 2CVQA 3I1JA 4EJ6A 1ADBA 3PYMA 2OFPA 3ZWCA 2V6GA 3WFJA 3LF1A 4PG7A 3ETEA 4GKBA 4OOEA 4CMGA 2VUTA 4KUGA 4EUEA 4OO3A 3K31A 1Q1NA 4EUHA 1T25A 3MOIA 2JHGA 1E7RA 4RO0A 1JU9A 2IEBA 2O4UX 2AMFA 4PGFA 4F45A 1MC5A 1U5AA 3LF2A 4CMCA 5AXDA 4ZVVA 2SCUA 3JD0A 1KVTA 1LQTA 3QVTA 3INGA 3I52A 1GQQA 2GN9A 3Q0EA 1VKNA 4NHEA 1PGQA 4P4LA 1YGYA 1G0NA 3CUKA 1EUCA 2UAGA 3UCXA 4IDEA 3EC7A 4I08A 3RU7A 1VKOA 5IN4A 4ZRNA 1J0XO 1SOWA 1IHXA 2CVOA 2YDYA 3RCBA 3NKLA 3OA2A 4FFLA 4CMEA 3ZI0A 2DM6A 4D3SA 1ADFA 2ET6A 4YQZA 4J2HA 1ONNA 5ITVA 4RDHA 1N7GA 1UXGA 3KB6A 1WNTA 2VNAA 3PWKA 2OOSA 3QJ5A 2AXQA 4PG6A 3UFXA 5A5EA 2B35A 1SEVA 4Z0PA 2B36A 3DMTC 1BVUA 4HNGA 2QRJA 3DWFA 4FOOA 5C7LO 1R4MA 3JD3A 4Y6SA 5L95A 1QLHA 4BGEA 3IQDB 4DTIA 2VTEA 3W8DA 4Y8VA 3I83A 5U9CA 5DP1A 4KWHA 2FZWA 3P2YA 3TL2A 1I3LA 2C7GA 3ZWYA 1ULUA 3U62A 1ZK0A 3S1LA 1WP4A 3BXXA 2VOEA 3GH3A 3RUCA 2YFHA 2C2XA 3C24A 3JTMA 3UCEA 1ZFNA 3I9LA 4NH4A 3K5PA 2Q3EA 4XWYA 1P31A 4D43A 1RPNA 2BFPA 4FN4A 4I1IA 5CPFA 4W9NC 1XU9A 3DDNA 3GT0A 4XX0A 5L7WA 2HK9A 1MA0A 4HBGA 4EDFA 4YJHA 1JKIA 5EQFA 5CPBA 1IUKA 5EINA 2VYNA 3K8ZA 3U4DA 1E3SA 2P5YA 1GUYA 3RFTA 3B20A 5T8KC 1ARZA 3HG7A 4QTZA 2OP1A 5DBIA 3ZNNA 3OIDA 1DFGA 1XA0A 4M87A 4WK6A 1Q2XA 1UDBA 3PQEA 4DC1A 1AUPA 3H7AA 2VUUA 3E9MA 5TT1A 4BNFA 4UVGA 3L0DA 1T24A 4I5GA 4QX6A 4S1VA 5FEUA 4AJIA 2DBZA 3H3FA 2RH4A 4ONEA 4XB1A 1PZHA 4IJVA 3H5NA 4XRRA 4NBTA 3ABIA 5H83A 2PA3A 1GPJA 3PDUA 2PZMA 3RUHA 3VAZA 2WM3A 2WE8A 4XIJA 3WBBA 1ADGA 4IJKA 1PGPA 4YVFA 1BG6A 3CMMA 5JCJD 2AW5A 2IYOA 3KYDB 3MJEA 4A73A 3GMSA 4JXKA 1RJWA 2CF5A 2DPHA 2BD0A 3O8QA 4NK5A 4PZDA 4ZGWA 3DMTA 3JQ7A 3UXYA 3AI1A 2D3TA 2VYVA 1EUZA 3PDJA 1U3UA 1KVSA 3UGKA 3OQBA 4H7PA 3PGXA 5KJ1A 4G5HA 5JDCC 1EK6A 3V5NA 2F1KA 3FD8A 4GX5A 3UW3A 1TT5B 4OXNA 4XKJA 1UZMA 3E5RA 4JROA 3QE3A 2W8ZA 3TDKA 1NPYA 4KMSA 2EXXA 4CMIA 3HDQA 4R54A 4RF3A 4O5OA 1ONPA 4PG8A 4FBGA 5G0WA 2A4KA 1YBAA 4PLHA 3RUAA 4OJNA 3SVTA 2XXJA 3G1UA 4CMEC 1ZMTA 2AE1A 4R4JA 1LDNA 1UJMA 1Y7TA 2VNSA 3OECA 3MZ0A 4BNGA 3L07A 5A05A 4E5KA 1PJSA 5HBRA 1JWBB 1SMKA 3VKVA 1ZCJA 2AEFA 2JD1A 2XF8A 2PY6A 3U4HA 1R6DA 3SEFA 3KTDA 3SJUA 3ZNOA 1B7GO 1H2HA 4RVUA 3PHIA 1YQGA 2NVUA 1P1IA 3JQCA 3HFSA 4Y67A 5A4DA 5B37A 4WKGA 2WD7B 2OZPA 5BSFA 2A92A 3WX0A 3GDFA 4FC7A 5TRTA 1L7EA 5TJHA 1I24A 2NVBA 1E77A 1GDHA 4WOJA 4BL5A 3AI2A 1YDWA 4EITA 3DOJA 1VL8A 3U5TA 2WTBA 4AJOA 5COQA 4XGIA 1LXCA 3NDJA 5A9SA 5FI5A 3DBHB 2G82A 2P68A 5EMHA 2EJWA 2PR2A 5CHEA 2OORA 1P1FA 4QFCA 4MKXA 4GVXA 3C7AA 2V6BA 1OC2A 2X22A 1JDJA 1A27A 4Z9FA 3CZRA 2YJZA 1UUFA 5HS6A 3VDRA 5IAAA 1LNQA 1MLDA 3EAGA 4OMUA 2ZYAA 2UV8A 2AEJA 4GH5A 5GZ3A 2IXBA 1LLDA 5A1TA 2Q2VA 4RVGA 2FPIA 3JQBC 1UZLA 3Q6IA 2EJVA 2ZTVA 3RKUA 1ML3A 1PZEA 3EW7A 1A5ZA 4LRTB 4AICA 2P9CA 3OFSA 2J3KA 3QV1A 1PSDA 1GU7A 3ZU2A 2B37A 4WLFA 4OSPA 2HO5A 5L7YA 4J9VA 3EK2A 3INTA 3OJ0A 3FF4A 2GZ3A 1FDTA 1XR3A 2HMSA 1T2DA 3VZRA 1L1FA 2VTDA 2OO5A 1HYGA 2W2KB 3F46A 4BNTA 2OBYA 1MFPA 3OEYA 3FHLA 1QR6A 3JSAA 4NQZA 1NAHA 3L9WA 4TVOA 4YJFB 3EDMA 4FDAA 2FSVA 1V3TA 3I4CA 4YBZA 1UP4A 2HMWA 4XYMA 3S2IA 3C3XA 2E6UX 1E6WA 1C0KA 3A4VA 4CM4A 4E32A 4LMRA 4TROA 1E3LA 3AY3A 3C1OA 3KYCB 4XYEA 5A04A 1UP7A 1G6KA 2P4QA 1HE5A 1I01A 1NQTA 1CRWG 3EVTA 3GRPA 3GN1A 2Y0EA 4ZHSA 3Q9NA 3WG9A 2EERA 3UVEA 4XRGA 3PHGA 5FFFA 1D7OA 4YJGB 3BIOA 1SB9A 3QHAA 2IZ1A 1HYEA 5TT0A 3PJFA 3E6AA 1WAMA 1EUDA 2VWPA 1N7HA 2EKLA 2HJSA 2Q1SA 4LRSB 1B8UA 2HKIA 4GLOA 1U7TA 3VPFA 2QQ5A 1GY8A 1DSSG 3Q3CA 5IZ4A 4MDHA 3JYQA 5JMPA 1NR7A 1KEVA 1U5CA 2XPCA 3UOGA 5L4LA 5LDGA 4NFYA 3V1UA 4FGWA 1IB6A 1Q0QA 2H9IA 2LDXA 2OXIA 4D42A 2Q1WA 2EGGA 2J3JA 3FNEA 4ID9A 1DFHA 3Q11A 1E5QA 4DVJA 1IULA 2E48A 3F3SA 3TQHA 2V65A 1NP3A 4J90A 1KVUA 1WDKA 4W82A 1ISFA 5AXCA 5HWSA 1HDZA 4BUCA 4JGBA 2IXAA 3C7CB 5DDIP 1FK8A 1D1TA 3FSRA 1P9LA 1YE3A 3NT4A 4E30A 3OETA 3MTGA 3U4IA 1EQUA 5DCUA 1D8AA 1HT0A 1KBZA 2IYPA 5T5QA 4PLFA 3ITKA 1ULSA 4HFRA 4NNJA 5TC4A 3PVZA 5F1PA 2X58A 3HADA 3ZHYA 4R1SA 2YHIB 1VLLA 5COAA 4CM8A 3HUDA 4TRRA 3MCVA 4F6CA 1V9LA 4RJTA 3DZFA 4XQ9A 4UVEA 4XZ3A 3HN7A 3JYPA 4BO4A 5A03A 3GDOA 5JYEA 5KVCA 1KY4A 2HK7A 4M54A 3BHIA 1CIVA 1BDBA 3WGHA 4DBVO 4ALKA 4P8RA 3MWDB 4CMBA 3E9QA 3W6ZA 4MINA 2FWMX 1UAGA 2B4RO 1Y5RA 5ENDA 1E5LA 2BI7A 1XQ6A 1BW9B 4DLBA 3ZW9A 4JK3A 1R4MB 3ANMA 5CFZA 4WLEA 3IJRA 2CDBA 5JO0A 2DPGA 4PLZA 5KTKA 4P38A 3EYWA 2PH3A 4H3VA 3D4OA 1U2DA 1JA9A 1Y5MA 4J1TA 4R1NA 1NWHA 2VHXA 4R9SA 2PZJA 1JVBA 3E82A 5ADHA 4Y98A 3QA9A 4NFSA 3PLNA 3TZQA 3D4NA 3RFVA 1WXDA 5THQA 4CM9D 1P1HA 2YQ4A 3BMOB 4BNUA 1AN9A 3HFGA 4YJHB 1O89A 3OP4A 1DHTA 1GR0A 5LC1A 1EZ4A 2JFFA 5JYDA 3LK7A 3WSWA 4QO7A 4A7PA 5IXSA 3I4FA 4R9RA 2I3AA 5JCXA 1DRVA 2NV6A 4IQGA 1MG5A 5BNFA 5IXYA 4KWIA 3TWOA 4P4GA 3L6EA 5TX7A 2E49A 3D3WA 4MO2A 4Y6RA 5JC8A 3I9NA 5F1KA 4CUZA 5DOVA 3BTVA 4BNNA 3K73O 5TJ9A 1Y9EA 3OQ1A 2I9PA 1S7CA 3KETA 1TB4A 3K2EA 4J4TA 1HDGO 5T8KA 1ZO8A 2RIRA 4PLTA 5KWEA 4CMHA 2O23A 2YV2A 4YB8A 1E1LA 4DXHA 5DZSA 3MJTA 4GGOA 2AQIA 1PGOA 4BKRA 1DC5A 4FC6A 1EVJA 4FOSA 1HLPA
chains in the Genus database with same CATH superfamily
4L0MA 3NATA 1TW3A 4QXRA 1RYNA 3S8EA 3HZZA 5CAEB 4RMHA 3COPA 1GZSA 2WP8J 3GBSA 1GGNA 4ITUA 5BV1A 3DXYA 4DLXA 2AG5A 1C1DB 3KDSE 5CJ2A 2YJGA 2XOKD 1U3GA 2PD3A 3FGNA 4LVNA 4M1TA 4PW0A 4QXAA 3G8YA 2C2YA 3LX8A 4UM9B 2WMNB 4WFKA 1GAQA 5EUCA 4QECA 3ZHQA 1KP2A 4EHKA 4EPRA 4FDVA 3T9FA 5CA1B 1PX0A 1B8NA 4OMDA 2P9HA 3ACDA 4AIRA 5LZ2A 4BEBA 1SZJG 3SZUA 3IEMA 1PV4A 3EX7C 1FJXA 1RLTA 2BVNA 4WKCA 3HWRA 4M7WA 5B1IA 2ZYTX 2F8TA 4KGVA 5HK8A 5TGDA 5J9FA 1GDDA 3W9BA 2DAPA 3SYLA 1GFSA 4E07A 1W76A 2PEZA 5EI5A 4BAGA 3AFMA 1II9A 2X1HA 4R3WA 5JMOA 3WWZA 5DRYA 1UMKA 4CODB 4YCCA 5KQPA 1PJ4A 1FLVA 1T8WA 2OR3A 4KRYA 5B6PA 2PUBA 1SCUA 2J0EA 3H84A 4MDFA 5BT9A 2W90A 2HREA 2O0HA 1JKJB 3UNXA 1L6IA 4URZR 1PVDA 3GP5A 2EFGA 2VKQA 2VYND 4BZPA 4ZK6A 2CNKA 3A1NA 3ABZA 1RHMA 4H9GA 4YTEA 5LBUA 2EL7A 5JHHB 5KNLA 3LDHA 4QOIA 3TR0A 4HT3B 4HNTA 4ZQGA 1N36B 1I6KA 2AR9A 2J85A 2CL5A 1Z6ZA 1M5TA 3BFJA 3G7UA 2C9BA 1NW6A 3P5BA 4L9AA 5BRJA 3HDYA 1E2UA 2BT4A 1CY4A 1A2OA 3OEHD 3IOBA 4XE5A 4CV2A 1OROA 3R4CA 4BO8A 4OGFA 2PWZA 1ZLYA 2CNBA 1ZI6A 4OKIA 2WJPA 4I3GA 1N2CE 2RGNC 4ZJPA 4I14A 1R16A 2C4VA 3SK0A 5BY2A 4E2FA 1CF2O 3O8BA 2AQKA 3D4LA 2HU5A 2F4NA 3CRQA 1TJ5A 1OREA 4D92A 1ABBA 3SAJA 5JJBA 4KRXA 5FL7A 1QTRA 1Q1GA 1LGYA 4G0NA 4H7KA 4Z1MA 1SG0A 3PDWA 3ZLUA 3GJ8A 5ESWA 3G0OA 3U7FB 5KSYA 3W04A 5JCJA 4KCGA 1VL6A 4W5QA 1K6MA 2C7QA 2QUJA 4XUGB 1E3WB 5AOCA 2I78A 4IGEA 3ICCA 1PZFA 1RAAA 2GD2A 4GYYA 4X1IA 1H8HA 4PEVA 2Q1XA 4LYEA 5EJGA 4CW7A 1NRJB 4N3BA 4RGQA 3W1EA 3ICQB 1I5OA 5ALHA 4B3DA 1NYLA 1ZCZA 3M6XA 4FCCA 2PMKA 4MULA 2ZGVA 3MTAA 3SEZA 4RZUA 1CUCA 1C8LA 3OFJA 3AM3A 4P9NA 2RC5A 1NC1A 4JT2A 2DZDA 2EJTA 2XLCA 3ZUPA 5REQA 4DSNA 4BQSA 3L6RA 3REQB 3H99A 5DGHA 1U3CA 3GGJA 1L4KA 4KGXA 1ZRMA 1NRXA 4JLMA 1M7GA 3EUWA 4AG5A 3L7YA 5F52A 2L18A 1L8LA 4CMAA 3G23A 2E85A 3WGTA 3D3KA 2DUMA 3HVKA 5ITZB 1QYWA 2HQRA 1XQ9A 3TIFA 3FBTA 4IZ6A 2I1QA 1YIOA 3KXIA 1T1SA 1XTTA 3PC8C 3DF9A 4LJ6A 4XIYA 3IH5A 2NO4A 3A0RB 3AONB 4Q37A 4DUPA 1NV8A 2HIAA 4M0MA 3WLFA 3SJBA 2VHVA 3UGJA 3DOOA 4G9EA 1PL8A 2ZAIA 4S1WA 4X54A 4Y2HA 2A1TR 1JFFA 2WUDA 3HJRA 5LZ7A 1B8VA 1QAOA 4DIOA 2YNMD 1K9SA 4P32A 4FE3A 3KC2A 5JU6A 1T2EA 3N53A 1E2DA 5BQPA 3K71B 4KPUB 4G85A 3BDAA 1AB5A 3G0HA 2R8PA 1JIJA 1KI3A 1PL6A 2A9KA 4OU4A 4U5XA 4YJ3F 3OJXA 2JFNA 1UMBB 2YINC 3D02A 1OGIA 2VAWA 3KZVA 3N58A 1CW2B 5I8ZA 4G4SP 5C51B 2IV7A 3ZVKA 4P0TA 3AEZA 5CA0A 1MB2A 1U9JA 1KO5A 4GUDA 5EKDA 3ZEIA 1P8AA 4B83A 1QQ7A 4IDPA 5JRZA 2UDPA 3WMGA 4ESVA 3S6JA 2NVWA 4NSNA 3TE6A 3UWDA 3B52X 4X85A 1V8BA 3NIWA 5KWJA 1Z15A 3SQDA 3AUYA 2G1UA 2LNDA 4BQEA 1KO8A 4NI5A 4DFDA 1I7LA 2DBYA 3R5KA 2QTWB 5DLQC 1JE0A 1BAPA 1EBUA 1PR3A 5EIWA 5IASA 2BDEA 1IQ0A 1YQWA 2ZYSA 3CLKA 1YZVA 3COWA 3FRIA 4DCVA 4DB2A 4ECEA 2J0VA 2JBWA 1OJ7A 3AHJA 3DOHA 3H1GA 1JBQA 1H2WA 1FE8A 3EWNA 1LBHA 4G0OA 4DC9A 3KUCA 3TUIC 2VBGA 4FJ0A 1NVBA 3W79A 3FETA 3JRNA 4EYGA 3D8SA 1W9HA 4Q4LA 5CIYA 3LY8A 4Z8YA 3RUFA 1MV8A 3LDFA 1F5SA 2FN9A 2W6MA 3N2EA 1V11A 1ZU4A 4GPEA 5IDQA 4CQJA 2XAUA 4LDRA 1KEZA 3STXA 2CUNA 3CZPA 5DTIA 1NMSA 1QFXA 1Z33A 2PXXA 3JPWA 3MUNA 4FFOA 5KAPA 3H6HA 4XYBA 3VJKA 4BWVA 1F1BA 5LVAA 4Z4GA 2AG8A 4MICA 1V5EA 1BD3A 4MKFA 2QRUA 1JDNA 2E82A 1GVHA 1UP6A 2EU8A 2J3HA 1R4NA 1P9WA 2XY4A 5C1IA 3ROEA 4F92B 2GBPA 1BS1A 2OO3A 3LY9A 3OY2A 1XKQA 4HC4A 4HNQA 4CQMB 1ISJA 1PLLA 1JDTA 1JDPA 2OY0A 3EW9A 3GK3A 4MPDA 5EJ7A 2J59A 3NW9A 3QX9A 2DTDA 1RPZA 4NS1A 4GLJA 1Y9DA 1DAEA 1QIEA 1Z6PA 3RBZA 5A02A 1X7YB 4RA6A 3WP0A 4C4RA 4NCNA 1U99A 2HMAA 4X1KA 2FPSA 3F7NA 2AMYA 5GGYA 3H65A 2GVZC 3D1VA 4M1QA 2JKZA 5IDXA 2C5EA 2I2DA 2VL7A 3A1WA 1GZ3A 4HP8A 3AKCA 3OWXA 4RM2A 5FOTA 4AZ3B 3L4JA 1Y6GA 3V2IA 1C80A 5CB8A 3IO5A 4RANA 1ISSA 2WB2A 5IC5A 1E7WA 4X20B 1TCVA 4FIDA 5AM5A 4P5DA 3OBBA 4LC0A 3C3MA 2VDNB 1X7GA 3RJTA 5IKOA 2FQXA 4ZODA 3RK4A 1SUAA 3PQ5A 2ESRA 4MQLA 4KSYA 1O08A 2ZK7A 5L45A 3FPCA 3S2ZA 3TCKA 3LLSA 4MI6A 1DZ3A 2EP5A 2IX9A 4TUYB 1R1DA 1V9CA 5AJXA 1PJCA 1NA5A 3HI6A 3E22A 2A0WA 4XJSA 1A4RA 4PYLA 5L3ZA 3ZX4A 5JI2E 5DNAA 2JD2A 2GO1A 2NACA 4ZPJA 1WXGA 3PD7A 4C7XA 5EFOA 5F7JA 2XUHA 4YCNA 2W42A 4KIWA 4HLDA 4QASA 4R9VA 3L7LA 3T41A 3ZY2A 5HR5A 2FF5A 2B4YA 2LW7A 1VCOA 3T3PB 4DSZA 3KTAB 4JEIA 4N6NA 4Y2PA 1W88B 1YQEA 4A0HA 1O8BA 1MAVA 3B9RA 3HVRA 2ZP1A 2LV8A 1Z22A 5FLYA 3ZIDA 2DQYA 4NEQA 5TQVA 1GFZA 3HV2A 5BW4A 1GKIA 2YBDA 4CG3A 1RIIA 5B3JC 2SHKA 3QSYA 3DULA 4GNRA 2CNLA 1T3GA 2C2BA 1CUYA 3DEIA 4KQCA 1YB4A 1P81A 2DQ4A 1E0SA 2R1UA 1KTIA 5H8WA 3K1AB 5D84A 1U04A 2Z6AA 4PYMA 3OFKA 3S27A 2XNDA 3F3MA 1FEZA 2Y6VA 1T1JA 1OIVA 2DJ5A 2RGDA 4LVOA 4NMXB 3MG9A 3SM3A 2VRNA 4PSAA 2PGJA 4ZN6A 1A72A 1GLVA 5B7PA 1AK9A 2ZULA 2PX6A 1ZS9A 2X0JA 4RPHA 2LIPA 1INLA 1P4HA 1Z4PX 1RVDA 4ZTBA 5K3SA 5IVHA 4P4SB 4PNPA 3QW2A 2ZB4A 4MB2A 3SX4A 2VRCD 4HYEA 2Q5CA 5HIIA 1D6MA 1WUYA 1AD2A 5A0TA 1ZN9A 1L5FA 5I4BA 1BDMA 1FYVA 3PCTA 1WZUA 3OT4A 3E15A 4TT3A 3DP9A 4JLUA 2M6SA 2J33A 2C3PA 3E1KA 4BB6A 1O6FA 3F5SA 1OF1A 3LZDA 3Q3GE 4KO3S 3K5HA 1E7QA 4MRMB 2FPPA 4G0XA 4X9XA 5DTMA 3VZQA 5LLTA 1QP0A 2PJDA 2JANA 3SHOA 4X97A 4YO8A 5BW8A 3EBLA 1RWWA 3X2SA 3ZCSA 4GKKB 2UYQA 2VC2B 3DL0A 1C0LA 1RWKA 1P7YA 2NTVA 1AS0A 1R8YA 4L0DA 5BSHA 1DELA 4KVAA 2PSDA 3VR3D 2DFPA 1ORHA 1SQFA 3PQDA 1FTYA 4WK4B 5FPSA 2JNWA 3SYRA 4E08A 3SVLA 1C9NA 1I30A 1XLTC 3RS4A 1T5LA 1J49A 3O73A 4M88A 2W11A 3GUHA 1CRZA 1T4CB 2JIPA 3VPXA 3JS5A 1LLUA 3K5IA 1K5PA 4L8VA 4KQEA 3JAWB 3N9IA 4IDDA 1IOZA 2FFJA 3K0FA 4LMPA 1SHTX 4RKQA 5AH0A 1AKEA 2Q5HA 4Z9BA 3V6MA 2VQDA 4QODA 5B53A 3HXPA 5ESDA 1IN4A 1RJ9A 4TQGA 3SC6A 1SHUX 3VSEA 1OXSC 4BNKA 3A1CA 2BI8A 3R3VA 4R9UC 2QAGC 4TLBA 1FMFA 1WPGA 2X42A 3FTPA 4M4SA 4Q9HA 2ZSIA 3HB5X 2B34A 4DIBA 3HA5A 4KAFA 4YALA 3GF4A 1MC4A 3HQ4O 4ZZIA 4QJ5A 3U3ZA 2VDLB 4F5DA 3WDLA 3ZWMA 1Y3FE 1KU6A 1KRXA 3BB4A 4OQLA 3ETCA 4QFMA 2O7NA 3NB0A 3EMKA 5LD2C 2CFIA 1C14A 5FULA 5AKEA 2XRMA 1VGQA 2P4HX 1WXWA 2A9OA 4I6GA 1C9KA 2NNLD 1A9PA 4ND2A 4OSOA 4CR7A 3CN9A 4F04A 2VDMB 3RAGA 4MKHA 2VF4X 3C1UA 4KLCA 2VJDA 5JAPA 1RPJA 4QWWA 5C32A 3FCXA 1E9SA 3UQYS 3ENZA 3A6HA 4CLOB 3ILVA 3AB8A 4TQUS 2CFRA 2RHJA 2ERCA 4ZIRB 1VLZA 1Z45A 2FSSA 2OHOA 4HAUA 3TMYA 4D3ZA 3KVOA 2NU7A 1Z26A 2ZBPA 3PEFA 2UZ3A 1E2BA 1G9XA 2QVCA 2HA2A 4P6VF 2AFRA 2PLNA 4WK0B 4KR7A 3C4QA 3WNQA 1LU9A 2F17A 1C7RA 1LVGA 3CLRC 3PQ7A 5HUJA 2PUFA 4WCFA 4WZAE 1XWWA 1ZJJA 2V7XA 1GG2A 5LUAA 1KH3A 3ZBTA 3B5IA 3PYLA 3HP4A 2CC2A 3U13A 1OXKB 1DHRA 1PT8A 3LXMA 1W9MA 1WW3A 3H9QA 3JV7A 4RL4A 4RSMA 5K3CA 3R7BA 3BWMA 3RKRA 1L5YA 4OK6A 4GWKA 4PZ0A 1M6HA 3W6NA 3BRCA 3KQUA 1L5MA 4MYTA 1ZVMA 3MGBA 4DW8A 3DR5A 1XDWA 2CNWD 3JQDA 5G1NA 4ATNA 3V2UA 3G68A 3H1FA 4UAGA 4BVAA 4CCSA 1EXVA 1NLUA 2C4HA 2FPGA 4LY6A 4AJ9A 1VGVA 2FPWA 2FMUA 2R1TB 2XB8A 2ENUA 2SCUB 5AK3A 4YIHA 1WMBA 5JQGF 3RSLA 1JHUA 5IWCA 3CQ9A 3UAVA 3MCAA 2BFWA 4DAEA 5HP4A 1A71A 2XMZA 5IJ0A 1KJQA 4RD0A 5LJIA 2O3RA 3QOXA 2FNAA 4IIEA 2A0FA 4HMQA 1K88A 5KVVA 1W49A 5KTMA 3K96A 3DKVA 3DVRX 1N25A 4WVLA 2XLBA 1B8PA 1PNVA 1MOSA 1Z6YA 3LRXA 4YNBA 1S3GA 1XYGA 3RVPA 3GEHA 3ONVA 3HCCA 4J0CA 2IIVA 2LKDA 4MK4A 2PKCA 1B1CA 4EPWA 2YVLA 1YD7A 2OHFA 4M1YA 4F4CA 4AMUA 2GKSA 3R0JA 3UKOA 2VZEA 5HJ7A 1O94A 4IBOA 2PTGA 1DRWA 4NCBA 5KYTA 3P0JA 1QZXA 2E4WA 1FFGA 1PJLA 2FFBA 2VG8A 3ASVA 1DBPA 2B1IA 1Z5UA 2RKBA 3NCTA 4MO9A 1GNRA 4L08A 4OAPA 1V4NA 3NGXA 5E9JA 2OGTA 4CI0B 1J2TA 2WLTA 4RLFA 3H2IA 4I36A 2A1UA 2Q99A 4HSGA 4WBNF 4L8LA 3WRYC 1D4AA 3FHTA 1UT8A 1YJCA 1VFPA 2E9SA 2ZROA 4JUFA 4Y6QA 2ZPTX 1VIYA 2PUAA 4F2PA 3KQOA 2D1SA 1PJAA 1QGAA 4RV4A 4RXUA 1QYIA 1XXLA 1QTNA 3T9EA 4ALNA 3W3AH 3JYHA 3AO0B 4FEEA 5CCDA 3TFWA 3VPSA 5EP4A 3FUVA 3EWSA 1ZK3A 4ML3A 4A0SA 4B6EA 2EWVA 5F3RA 1MAUA 1VG8A 1YKSA 1A4XA 1Q19A 3AESB 1Q22A 1ZVQA 4MKZA 3W2TA 1VSQA 2XEDA 1QJ4A 1KK3A 2YWDA 4M49A 2BZ0A 3HVHA 3W34A 3BULA 3VKWA 3DHWC 4INAA 4XYLA 4JBYA 3MWGA 2VH5R 2JFHA 4J94A 3T99A 2C94A 1PNQA 1KR5A 1TJNA 2WU3A 3R6DA 5AKHA 4D3XA 4QDXA 3PC8A 3EGIA 2JDIA 4O4HA 1K97A 3HY6A 2J9GA 2R60A 3A05A 5F3WB 1P7WA 1M2JA 3R5JA 4N12A 2WM8A 1LPBB 1C81A 2P9GA 3QLUC 4ZXPA 1GTG1 1KMIY 2SKCA 4OFBA 2Y1FA 4UBMA 4A03A 3I1FA 4TVBA 3RJ5A 4F56A 2RJNA 4PZCA 4WW0A 1K8ZB 4DQLA 1H2XA 2F3UA 4WASA 2F9FA 1U8AA 3A9SA 4J0GA 4ASUD 4PFQA 1U3DA 3KOUA 2M2IA 3RRZA 1G7SA 3ZGYA 4MZXA 2VYVD 3AHDA 2VSFA 3ZLBA 3A9UA 5AKYA 2ZRBA 1SPXA 3NORA 2XRYA 2AL7A 1XVAA 1EVYA 3SF0A 3DQQA 5BSEA 5AI8A 1OE0A 2WWYA 4WECA 3HJFA 2KHZA 3ZCTA 2MMCA 4DV4B 3VJRA 3FUTA 4CEIB 3P2IA 3F47A 2HZBA 4BFVA 2YOHA 4CM3A 1QB7A 4FHCA 4Y2YA 3UF0A 3D5QA 4BECA 1R0WA 3IMGA 2MYUA 1AVTA 4B6QA 1GSHA 4ZI7F 1U9CA 1G18A 5ERGB 1Y6ZA 4ZVMA 3V2GA 1KK1A 3GRAA 5KEIA 1R9MA 1R27A 4DJAA 4MYCA 4UZFA 3MS7A 3ER6A 1EFKA 3P2MA 3NBAA 2P41A 1GZ4A 1HKHA 3PPWA 5EP2A 4RFSB 3RUCA 3SJ7A 4RADA 4DCJA 4UMDA 3WIDA 3VAAA 3A2LA 5CGQB 2WYUA 3P9NA 1FDSA 1I33A 4BS9A 3DLBA 1U4NA 1RI2A 2OB1A 3H2HA 3W6OA 4Q47A 5IAOA 3JQAA 4GXQA 2OC9A 3J7TA 1C8KA 4P7FA 2ANCA 3LTEA 5HTOA 3GLVA 3RR2A 1BEZA 3U49A 3TECE 1SCNE 3TZHA 3H9UA 4NZZA 5G3YA 3R7LA 1UPTA 2XCUA 3WMXA 1Y4DE 3VO2A 1RHQA 4C07A 4ZWNA 4BEJA 3R9KA 1G5TA 3F8TA 5ES4B 4NCAA 3C8UA 4B3RB 4FSHA 2QRLA 3UHPA 3QYPA 3O8OA 2H51A 2CJPA 3KELA 1JN0A 3LCUA 1BYIA 2VUSA 3P32A 3PYXA 2UYYA 3FGZA 5K4AA 2Q2OA 1BQ4A 4YH1A 1I3NA 2HDNB 5D3ZA 3UAXA 4DJ5X 3THYA 2MCFA 3RREA 2OUIA 3NHRA 1NYQA 2V96A 3I6BA 1CJSA 1SVUA 4O29A 4OUDB 2ABWA 2V7QD 4Q93A 2P9FA 4QOFA 4XQEA 4KVFA 5K03A 4B9EA 1MJGM 2F55A 2WHRA 3AL3A 2BSXA 1TM1E 3G2PA 3I2HA 4JC5A 2FG7C 2GQ0A 3IE2A 4Q6WA 1JPVA 4DMKA 3M33A 2PFSA 1BTOA 1PW7A 1U3VA 3RYCB 4UDYX 3GHYA 1JWLA 3CR8A 4UBOA 1IIBA 2VYQA 1J70A 3GMTA 4GBJA 4IVNA 3K0AB 2XGSA 2VTKA 3MIIA 2D1TA 2XVMA 4O5AA 1W44A 3RVNA 3IILA 2DXIA 1HLDA 2CL6X 4KYVA 4LVCA 2AJTA 4XGRA 4W8HA 1EBFA 1KSGA 5A1JA 1NN0A 1GPBA 1JQDA 4B84A 5LFAA 5LP6B 3BXPA 4AJJA 4KFCA 3LA8A 2YIJA 4OHWA 5KTYA 5C35A 4JI0B 5FJJA 1EG7A 4Q9JA 1SVWA 2XHEA 3CG0A 3IAHA 1LA2A 5ER9A 1UPFA 2PQ0A 3BD9A 4GHWA 3YASA 3GLGA 1EXWA 1XYYA 2QI9F 3DZBA 1HE4A 2OXFA 2PGDA 1YQQA 4WPGA 4TSRA 1LWOA 1F2UB 1Z29A 2AN9A 3DGEC 4IXDA 2XAAA 3MBIA 4EPTA 1G2PA 4RMJA 4WKNA 3VMFA 2HBRA 3PQ8A 4WZZA 4LE2A 3GRUA 3HR4A 3OCCA 2B8NA 2OVFA 4NABA 2FW8A 5AJHA 4EENA 2DFKB 3FVVA 3LC7O 3PCXA 4I9UA 4KVZA 3TW4A 4Z6KA 4A10A 5EIOA 2C1EA 4GX0A 3V8BA 1QO0D 4HJRA 3ZHSA 1X2EA 3DW1X 4BV3A 2QQFA 1Z9BA 3KWJA 1CDEA 2BFBB 1YWGO 4MH0R 3MWEB 4ZVPA 2VJOA 3CUEF 1ESEA 1DEXA 3L6BA 5EESA 3WLAA 4DL9A 1HRDA 2H08A 1U8CB 3PC3A 2PSHA 4ZYYA 5E95A 5AXAA 5JAOA 1KEKA 2O8NA 4AJ2A 4L4SA 4GR9A 4C4XA 5KTRA 4R8MA 3DMYA 4GL4A 4MQEA 1GUZA 5TS2A 4G1MB 2YYYA 3JQFA 3ZU3A 3NEYA 1B3RA 1QR2A 3FG9A 1FZQA 3LZ6A 4KLRA 4E2YA 1WKBA 1XD8A 4U3JA 5KYUB 1L8QA 4ALJA 2QF7A 1QXSA 3FYHA 4JLVA 1LRJA 4R41A 2FPIB 3QXHA 2CY0A 1FNNA 1JX6A 3QWAA 4TTAA 1HK7A 1FMJA 1NRWA 5TMPA 4QGSA 1TD9A 1Z0IA 5FOSA 2RB5A 2EF0A 1HDCA 2D5CA 2WSBA 1J20A 4DMMA 1YA6A 2QAGA 2OENG 3AILA 3GT3A 4PPYA 3OQMA 2ASEA 1L9XA 1LW7A 2N47A 5I9IA 4E4RA 1JHVA 3BHNA 3WADA 2JARA 3QELB 3H11B 3L8GA 4QYSA 4F84A 4BGDA 4LFCB 1NF9A 2I7VA 1XMSA 4Q34A 5LKRA 3OIFA 3TRFA 1M0WA 2X4DA 1IZZA 2Z1MA 3O2JA 5TQ0A 3IJ5A 3KPVA 3NNSA 2DGDA 1DAPA 3O8NA 5AQ1A 4DSAA 4QLOA 3PNQA 3TLGA 3FTNA 3D2AA 3QUSA 5AJVB 2WMDA 5A4AA 1MOZA 1XJ0A 4V0NA 4GDMA 3THWB 3DE3X 3HACA 5EIBD 2QGNA 4RD6A 1SCAA 1GKYA 5E8RA 2ZRDA 2BH9A 1HY3A 1RWNA 1UMDB 3PVSA 1OBCA 2GXQA 4LGCA 3RRFA 1R66A 3I0MA 2X0EA 1EBBA 4EHBA 3SSOA 1QRTA 4MYRA 2ZZNA 2CBZA 4CM4B 3L6OO 1V6AA 3IQWA 4IDFA 3I9OA 1ZOLA 3BXGA 1UDWA 3KYCA 4GBGA 5DH9A 3D6NB 2ZBQA 4FHGA 3WP1B 1RXVA 4F72A 3M2TA 2BGRA 4EK9A 2O2XA 2HZ7A 2LE0A 2HSDA 2ZS7A 2QGFA 3OCUA 4BFXA 1KERA 4JNKA 2MSLA 1PJRA 1PTJC 1VZ3A 3NO4A 2P3QA 2P8SA 1WXHA 2OZKA 2WYWA 2C0CA 2H2IA 3CISA 1W73A 1ZK2A 2I2CA 2Z1NA 3FLBA 3DQPA 2ZYVX 4YAKA 3Q0TA 4FWTA 3DFIA 3O8QB 3WKEA 2PGLA 5BP7A 1AHPA 2RC6A 4YWHA 1UEJA 1WMAA 1Y7IA 2PSEA 4FNOA 4KGZA 1FFCA 3FFXA 2I33A 3PFBA 5KNCH 2ZUFA 4A36A 4YQYA 3C8DA 3PKJA 4M46A 4B0OA 3AC0A 1HH4A 3TEMA 1R0BA 1XMOB 3BWBA 3A58B 1G3MA 1XEXA 3UYLA 4YDRA 2BZGA 1I7NA 1ZSNA 4KYIB 2HMVA 4AK9A 4X41A 1JNXX 3WB1A 2O2YA 1FRNA 2LKCA 3M6MD 1XROA 2QAJA 3AU9A 4N7RA 1M2HA 5EHXA 2Q9AA 1XKLA 5FI0B 3VFDA 4F9FA 2H31A 3W7AA 2PGIA 4EHIA 1KJNA 1TEVA 2FR8A 1M6WA 2VHQA 3KWLA 1JAXA 4FD2A 3RC8A 3HEMA 4PRZA 4Q3LA 3CS3A 2W0MA 3CZQA 4NENA 3P71T 1UJ5A 4U9IS 4P5EA 1P0PA 8OHMA 4QFBA 4E2XA 3D64A 3ROZA 1TZJA 3BTOA 1Z38A 3CSUA 1F8FA 1ZIDA 2G9ZA 2QX4A 3LY5A 4KDEA 5A3VA 3D4BA 5JWRA 5BYJA 4L8FA 4DWWA 1T36A 3L0CA 2XA1A 4PZPA 3K9LA 3RUDA 5LKAA 2FPXA 2O8EA 3OO1A 1G6Q1 3BZUA 3HL0A 1C4WA 3DOEA 1O9GA 1IMOA 2ALJA 4FDTA 1YDHA 3T61A 4D79A 2QV0A 2AUNA 3DKPA 3JQEA 4EY4A 4XYGA 2ZQYA 4KPGA 4LZJA 3FGPA 1MABA 2V7PA 3MTBA 5DI3A 3OJEA 3KEFA 5C3MA 1TYEB 2FFQA 1NY6A 3SYKA 1RDFA 4KOEC 2QD3A 4KWTA 4MPPA 4TZ6A 4OQDA 1PJQA 3WGYA 1ZC4A 2B7LA 4Q4HA 1WQ3A 2YFQA 2CK3A 5AM3A 3ANNA 1OYOA 1WB5A 4OH1A 1Q3HA 1EFVB 2FG6C 4GQAA 4WIAA 5SZJA 1OVGA 3RVDA 5A9SB 2QBYB 1QLWA 4EGAA 1MIOB 4RLHA 5ALXA 1QTIA 3GZNA 4FNAA 1XNJA 2IQ5A 4FQ8A 2FPUA 3KZXA 4ALLA 5DB4A 5I3ZA 3CPSA 1QFZA 3EQ7A 1KO7A 3DZKA 2EVWX 1YDMA 4ARVA 1SNYA 5IM4F 2FOIA 1H6AA 3HU5A 3P94A 3NAMA 1R4ZA 3SM9A 3IAM6 2P35A 3UV6A 2EIHA 1ZMXA 3OIYA 5DHAA 3LLVA 1KI9A 4EO9A 1SHKA 2IXGA 4M98A 3X44A 1T9CA 2H7YA 3SNKA 4DWVA 4B3HA 4JKYA 4XFDA 3EPPA 3JQQA 3RDPA 2IHNA 2V6MA 3CRZA 5KYNA 1P3Y1 2RGUA 5K3DA 4JYPA 3ZU6A 2R8RA 5FAKA 4R1TA 3Q9LA 2PSFA 5C5DA 3HXOA 1JEJA 4J49A 3VR4D 1H5QA 3T9DA 3CINA 4G5FA 1B1AA 4FZ3A 1RBQA 1WPXA 1XO1A 4IOMA 5DP2A 3REOA 2FP4B 1U1GA 2ZRQA 5B5SA 4ZO7A 2IOFA 4DN6A 4GWGA 2VN8A 1Q0ZA 1G21A 1GOTA 4QU9A 3EZLA 1QOQB 4RF5A 5BURA 5FWNA 2WD9A 1OBFO 2VRCA 3LX5A 2FWJA 3WTBA 2IA5A 3ZDAA 1W34A 3UM9A 2E87A 1E4VA 221PA 5B1DA 1QZZA 3ECAA 4OMFG 2MWMA 3EDQA 5EPOA 5B1SA 3ZIAA 2P0YA 3BGOS 1NNLA 5FOUA 5AVUA 1GCIA 2GESA 3GRCA 1YRAA 3NXKA 2CXSA 1WM1A 1VHTA 4NDNE 4MRPA 3KU4A 4RFVA 3KQVA 5DHQA 1ECLA 3SSMA 2H9AA 1ST3A 1TKCA 4OLJA 3K9FC 1M1NA 1S6YA 3QPVA 2G04A 1T6ZA 4KV9A 4L4ZA 1W4BA 3M6UA 4IDQA 5LYJA 4P0QB 2AFHA 4FFWA 421PA 1F4VA 4QFDA 1RZRA 1RBYA 3U56A 1J99A 2QRGA 2FVYA 4FGKA 3FFTA 3FYUC 2VAXA 1NQVA 3HJGA 3P9KA 2QW8A 4FW8A 4FZJA 4JMLA 1J2JA 1FRZA 4AJHA 5JBQA 3TBHA 1UBHS 1G0OA 1VHLA 3OZEA 1YVRA 2QV7A 1ZOOA 2ROQA 3THRA 3TTWA 2DC1A 5H59A 1L5SA 5CB4A 1DBSA 3D31A 5FTJA 1N5OX 4A23A 3IAXA 4YRDA 5THKA 4UATA 1KSFX 1LY1A 1GG5A 1VRCA 3N76A 3PPXA 4TLLB 5EFZA 1VRVA 3UG7A 4V0ME 4ZCTA 1KI6A 3DFUA 3ANSA 1QH1B 3CTMA 1GA4A 3DUFB 2E4ZA 4QQRA 1M6VA 1UM9A 5KSZA 3I30X 3FTFA 4LRXA 4AB1A 2PCJA 2VWQA 1XXHA 2HFJA 5DNDA 1V3UA 5D5HA 3LVBA 2WF6A 4DRXB 2IKSA 1TVKB 4HEA6 4MVCA 4JBNA 2W4QA 4P3OA 2BUCA 4CIXA 5EZ5A 2XIQA 1ISGA 3OEWA 1EFTA 4LF5B 3BRSA 3HP1A 1OU4A 3GRZA 4MW9A 2QVYX 4RD2A 2IZ5A 1RRKA 1YMUA 1QLJA 2F43A 1Q0RA 1UBUS 2GHRA 1EFHA 1E58A 2FUCA 3DO6A 3OZWA 4IXTA 3G5TA 4Y1EA 2ZR9A 5GJBA 3EIFA 2CVHA 3GLFE 4WESB 4Z7QB 3FMPB 3KHUA 4NMHA 4OXXA 5EE1A 2G36A 4UTXA 4C7OA 3BXHA 5COBA 1GA1A 2AC7A 1RRMA 5CX1B 3A3OA 1YRBA 4JQCA 3TW0A 4N40A 1Z8NA 1OLOA 2FKNA 1P2TA 1X7DA 2BHLA 4PHHA 3QEAZ 2WJWA 3QKRA 4HDQB 3CKKA 5TMBA 1HDXA 1LSJA 4X64B 1JKMA 3FJ1A 3VKHA 1P39A 5C1BA 4XDZA 3Q7SA 1L4YA 1M2OB 1D6JA 3LTNC 1EDZA 2CXRA 3A1SA 4NZOA 4UXHA 1T35A 5AJYA 2IPLA 3AB7A 3QU9A 5D86A 1HYHA 4UEKA 5C1OA 3OJOA 3GFSA 4TPKA 2HF7A 2OO5C 2DLDA 1M0SA 2RHBA 4YACA 4AF7A 4D82A 3PLRA 5DBOA 5TY0A 1L5KA 3DVLA 4CDGA 5JS6A 1QRDA 1WUKS 4RD3A 3RIMA 1KF0A 3KEOA 3PSAA 4CE6A 4JBLA 4ESHA 1TMYA 1GKLA 4LSGA 1UOPA 1GL6A 3TFQA 3ZV6A 5CBKA 1S8AA 4FIZA 4HAWA 3EZ7A 1V5WA 1M2VB 3MCZA 5D6NA 5T57A 2O8DA 5E3IA 3BDIA 3NVMB 3N8KA 3UMFA 1PR9A 2XOXA 3DB1A 5EVCA 2Z2ZA 2RJOA 3QOYA 5B7GA 3B70A 3P9RA 1R5BA 2QMUA 4G4GA 1X7HA 2ZIWB 3VOSA 4C0BA 4OFZA 3LUFA 2OMKA 2CLOB 1YS1X 3ECSA 3PHBE 1I4EB 4Y2XA 1NHWA 2QS9A 3C41J 3COZA 1G8AA 1DLJA 4I50B 5D3KA 4A6XA 2V7GA 4IM7A 5JI3E 1YCHA 3CY6A 3S8MA 1SKQA 4D4LA 2GZMA 3DO8A 3DQZA 4O8ZA 3JZDA 1IPEA 1T1EA 5DXFA 2JFYA 2Z57A 1PK7A 1ZM4A 3PE6A 4OSEA 2J31A 1FC0A 1G5IA 1UWLA 5HG0A 3HTXA 3GZTB 2XBMA 1CVIA 3LUKA 3RS3A 2CLLB 4CYMA 1JUDA 3QJGA 3UMMA 3VV2A 2ONKA 2PS1A 4KR3A 2BTOA 3VTKA 2JI7A 1NUAA 4DS3A 1MEJA 5AHRA 3GVXA 3MIZA 3NXSA 3PG5A 1A8UA 1ECBA 4K0KB 2XB2A 2HPVA 2Y9PB 2VNKA 2O7SA 1NG1A 5ECDA 1IHPA 4OGKA 5AVRA 1YCFA 2NO7A 3OZRA 5GJCA 3RTCA 3UIEA 2R6JA 4NJEB 2QVXX 4WLVA 3SVZA 4BCBA 3CUSA 3A4TA 3VQTA 4Q9LA 1NVEA 1SUPA 4YV0A 1COZA 4KE7A 1QQ5A 1P2DA 2RCNA 1YU6A 4EB8A 3NBYC 1Z08A 2IUUA 5TGTA 3LOPA 1YC2A 4M0KA 1NVAA 1QGUB 1E60A 1QCDA 3ZWNA 3ETLA 4REQB 2QTAA 5FJIA 1RI3A 4AXXA 3ITNA 4YCBA 1QPBA 3DE6X 1PLJA 3K53A 3LAWA 4RBNA 1WBDA 1CP3A 1E2FA 1V1MA 1T2FA 3D8NA 4LTDA 2V4ZA 1H5NA 1AC5A 3D3WB 3QP9A 3AEXA 3RW9A 1HETA 2A84A 1U0RA 3W1VA 2JIQA 2TMKA 4QOGA 2BSAA 2JJ1A 5EJMA 2ZS8A 1QG6A 3PF8A 1W6RA 3IV6A 4KXWA 4LX8A 4V1CB 1JMKC 1NBMA 5KTPA 1JR3A 2XH8A 2I2XB 3T5CA 2QZPA 3USCS 4J2OA 5UKDA 4BX0A 4F8EA 3E48A 1E0AA 2ODQA 2QPAA 3W2GA 3QBDA 4G24A 5EIHA 2P2CA 1O87A 3FMIA 4TYWA 1SCKA 3HUEA 1Q91A 5K0CA 1F8GA 3ZZ0A 4DNQA 1E8NA 2FW1A 5DE3A 4ASUA 1QO7A 4J1SA 3GJ0A 4BCDA 2QNRA 5LQNA 3RFUA 4EGQA 3GPIA 3TSOA 4YMTA 3A9CA 3RANA 3LQFA 2H7VA 1O2DA 3F4BA 4O63O 4OIFA 4FFSA 3REGA 3WOVA 4IWXA 1HBJA 3H9GA 4OQMA 4ZP1A 4QDJA 3AUSA 3TAXA 4YR7A 1U1DA 2ZJ5A 2BBTA 4H08A 5L3RA 5BSVA 1ILEA 2FY8A 3GGSA 1RXYA 1ODKA 5TIIA 1RM3A 2GGSA 3QLUA 4OOFA 3U39A 5FLKA 4D7AA 1TVEA 2YZKA 5ADUS 2O8FA 5HX7A 5I9BA 2QQ0A 2CVZA 1DL5A 1XLWA 2CFOA 1NQWA 3GMDA 3O4FA 3FLMA 2FUKA 5E4YA 4DV6B 2V0GA 3FVQA 3MELA 5LA6F 2VVTA 4RJLA 1G20B 4FZ5A 4DZRA 2G0TA 1NSYA 3OZUA 1NXSA 1OA0A 3BWDD 3U4QB 1V3VA 1ZD1A 5CLQA 2I1VB 2FWAA 1IHOA 4J29A 5L9AA 3DE7X 4EG0A 1RLOA 3L0IB 3VTAA 1LH0A 2BEWA 2JFWA 2FXVA 3ZZUA 1AIPA 2GILA 3IR7A 1XZPA 2Y05A 3L49A 2UXCB 4OATA 4DQDA 2XTNA 3SP1A 4HFJA 3GELA 5IH7A 2IU0A 2AR0A 2WRZA 2D1YA 4XM1A 2J1LA 4L72A 3ZNNA 5DX0A 3ZZTA 3BMNA 8ATCA 2I66A 1QANA 4ON9A 4RDIA 4O2AA 5SY4A 2JIZD 3KV3O 5A4JA 2YW2A 3CX8A 3TXXA 2EX4A 5CXUA 3QKSA 1NFFA 3AR6A 1R8XA 4EYOA 3KHSA 3GQBA 2W2LA 2EP7A 2RGRA 4ENSA 2R6ZA 3WGQA 2PUCA 4PICA 1K7XB 1NBIA 3ZGXA 5HA5A 3UGQA 3TVTA 4YMGA 1JLRA 2IYFA 2HO4A 2WJIA 3FPEA 1AN0A 4G65A 4XPZA 4EEZA 1VPDA 4HUJA 2KE5A 2Y92A 4MAFA 3TX6A 4I1UA 5FUMA 2XD9A 1KHHA 3G0DA 3IT1A 3QTLA 3JWIA 1Y5NA 3UTDA 3WGVA 4EG1A 1FDRA 5GMOA 5F33A 2Q62A 4F97A 2O7QA 3PV0A 5EE3A 1OHHD 1CF9A 3W9SA 2FZCA 1X9GA 1B6TA 1NHGA 1P6QA 2PLFA 2RFLA 3TQIA 3PFHA 3SZLA 2BFOA 5CR9A 5IYZB 5ITWA 5J2UF 5BN3B 2AJDA 4N5NA 4LGVA 4MEJA 1SUEA 1ECGA 2OSBA 2ZSAA 4EB0A 3TSAA 3AVPA 3BCUA 3NBXX 3EULA 4ETMA 2Y68A 3O91A 1K1EA 2Y76A 4PPNA 3UK7A 3OOWA 4PYRA 1IE3A 3DOIA 3OPMA 3GJ5A 4G2TA 5G0UA 4XM2A 4RTPA 2GWHA 1PU2A 4LHXA 3ZJVA 3KQLA 4L50A 4ZVNA 1OGJA 4XI9A 1RRVA 2HWUA 3QI7A 4GGPA 1UC4B 4TMKA 1NUUA 2MSKA 2HK6A 4GOOD 3E5NA 3ZH2A 1Q0SA 4WE3A 3QFFA 3ZV4A 4ZEXA 4D97A 3I5XA 1XJCA 1UKZA 5I4KA 5E3JA 5BN4B 1S8FA 1QRAA 3OHSX 2O8CA 4C04A 3OEHA 4FXOA 2G4LA 3L6DA 4BRWA 2QN9A 2FGKA 3DMFA 1LUAA 2TS1A 3NBZC 4IL5A 5JR3A 1TYDE 3I5UA 4W6ZA 1ECJA 1X80B 2ZUTA 4C7KA 3V48A 1KC3A 3C4VA 1O8CA 1B0AA 2GYUA 4UULA 4U1RA 3E8XA 5FORA 3P9CA 1K66A 2Q7DA 2XCIA 4MTLA 3AKDA 3FMOB 2DPYA 3M4NA 1TEZA 2Q5JA 3ON5A 4TS4A 5T64A 1RXWA 2SKEA 2VHEA 3OUUA 1FP4A 1O77A 2HGZA 2PHZA 4OM8A 4YAIA 1RJEA 1VCIA 2PR7A 1XDBA 1VSVA 2BM8A 2RGAA 4IIBA 3ML1A 5EHZA 2C2MA 2IS2A 3T1YB 4HQRA 3BGDA 2O3JA 3OZTA 4HYYA 2HRBA 5DASA 3SS7X 2JF0A 2QRHA 3SKYA 1ULHA 4MR9B 1M83A 2O7VA 3HXKA 3DMGA 3H8SA 2QRMA 3KB1A 1TMKA 1LZLA 2ZWVA 4GP7A 5GM1A 3H2KA 5D7BA 2NTNA 3TJZA 3X0DA 3E9RA 4Q3OA 2X5KO 3MMNA 2NSHA 3T5MA 1VKJA 4OI4A 1SZCA 3VUEA 5LQJA 2MJLA 5KCZA