1K2VN

E. coli periplasmic protein fhud complexed with desferal
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
262
structure length
262
Chain Sequence
AIDPNRIVALEWLPVELLLALGIVPYGVADTINYRLWVSEPPLPDSVIDVGLRTEPNLELLTEMKPSFMVWSAGYGPSPEMLARIAPGRGFNFSDGKQPLAMARKSLTEMADLLNLQSAAETHLAQYEDFIRSMKPRFVKRGARPLLLTTLIDPRHMLVFGPNSLFQEILDEYGIPNAWQGETNFWGSTAVSIDRLAAYKDVDVLCFDHDNSKDMDALMATPLWQAMPFVRAGRFQRVPAVWFYGATLSAMHFVRVLDNAIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrichrome-binding periplasmic protein
publication title X-ray crystallographic structures of the Escherichia coli periplasmic protein FhuD bound to hydroxamate-type siderophores and the antibiotic albomycin.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal transport
total genus 80
structure length 262
sequence length 262
ec nomenclature
pdb deposition date 2001-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 1k2vN02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 1k2vN01
1G20A 4WZBA 4FKMA 3AESA 1PQ4A 3MWGA 4WZAA 1M34A 2AFIA 4BBPA 4B8YA 1L5HB 2R79A 5M2QA 5AFSA 3AEKA 2AFHA 2O1EA 1XVLA 3TNYA 1KAHA 3R5SA 5JJ5A 3U7QB 2R7AA 5BVHB 4G09A 2QI9F 4PAGA 4LJSA 2XDQA 5KOJB 4TKVB 2M6LA 4WN9B 1ESZA 3PSHA 4OVKA 2RG7A 1H1LB 1N4AA 2YNMC 4FNAA 1N2ZA 3AETA 1G21A 1QH1A 4NNOA 1M1YB 2WI8A 5BVGB 3K1AA 1QGUA 3AEUB 3PSAA 4UDNA 5M29A 1KAEA 1K0FA 3MINB 2PHZA 4IRMA 2MINA 4H59A 1G20B 3GI1A 4PM4A 5JPDA 4WZBB 2XV1A 5KOHA 5I4KA 3AESB 4WZAB 1M34B 4XPIA 2AFIB 5CX1A 3ZTTA 3ZK7A 3AEQA 5HDQA 4K3VA 3AEKB 2AFHB 1TOAA 3EIWA 3PDIA 2OGWA 3LI2A 4ND8A 4WESA 2PS9A 1MIOA 4GICA 4HMOA 4WNAB 3HJTA 3AERA 4TKUA 3CX3A 2OV1A 1QH8A 2XQVA 4LS3A 4HMQA 2XDQB 3G9QA 4INOA 4HN9A 1EFDN 3UJPA 2PRSA 2X4LA 5GGYA 2M6KA 2OSVA 5CR9A 3AETB 1G21B 1QH1B 1FP4A 1M1NA 3K1AB 5FLYA 4OXRA 1QGUB 4M7OA 4INPA 2MINB 4CL2A 4H0FA 5KOHB 4XPIB 3TLKA 4DBLE 5CX1B 1K2VN 3AEQB 4FILA 1N2CA 3BE6A 2YNMD 3ZK8A 5B58T 3NU1A 3PDIB 5KHLB 4WESB 2Q8QA 1MIOB 4TKUB 3AERB 3BE5A 4HMPA 2XH8A 1QH8B 4UDOA 1L5HA 3R5TA 2OV3A 4MX8A 5HX7A 3LHSA 3ZKAA 2ETVA 1KARA 2PS0A 2Q8PA 2WHYA 3U7QA 5BVHA 3EIXA 1FP4B 1M1NB 4NNPA 3HH8A 4WNAA 4TKVA 5KOJA 4WN9A 4OXQA 5M34A 1H1LA 2PS3A 4G07A 3MFQA 5GGXA 2XUZA 4FI3F 1M1YA 3TEFA 5BVGA 4N01A 4MLZA 1K7SN 5M3BA 3AEUA 5JG7A 1N4DA 1PSZA 4ND8B 1K75A 3MD9A 3HXPA 3MINA 1N2CB 4UTOA 3ZK9A 3MWFA 4UTPA 4MO9A 5JOQA 2XY4A 4MDYA
chains in the Genus database with same CATH superfamily
4RL4A 1TZJA 2HAEA 2ODTX 4D8WA 3JQ8B 4B9AA 2EU8A 2IDJA 2IBMA 1UZMA 1X7ZB 5AOVA 3C3KA 3F2VA 3NBXX 3BBLA 1JMVA 2DFPA 2OORA 3KELA 2QQGA 3IMEA 5LQRA 3BJRA 1XRJA 3KFXA 3KZOA 3ZWQA 3NNDA 3CO5A 4PYLA 1VE1A 1HNZB 1FFWA 2HNBA 1UQTA 5LFAA 2UKDA 1KEKA 2AW3A 2CUZA 2OO5A 3AZPA 3KE9A 3R3HA 3WJAA 3ZQJA 4IZOA 1EA7A 1Z4KA 1XXHB 4MO2A 3WLIA 1TL7C 2QEQA 2I2FA 2BLLA 3NHZA 3H6HA 4KW7A 1Z15A 1ZJ4A 2XUJA 4FCTA 4BKQA 1SXJC 4MKXA 3RAFC 4GZLA 4OB8A 4LXYA 3R5XA 4DVGA 5KB3A 3TYXA 2PY6A 3ME5A 3UWDA 3D8SA 3CW8X 2XIQA 2CT8A 1KZ9A 2QTBA 1F3OA 1GVHA 3EVZA 3IP1A 1HYQA 3LMKA 2HA2A 1U9JA 2XOKD 3A27A 4IHAA 4K3UA 4N7RA 2ZRLA 3HHPA 4J03A 4U2GA 3K0CA 3JQFA 4BB0A 9GPBA 1YT5A 3QVXA 1NJFA 4HNRA 1QYWA 2NIPA 1VJTA 3MCWA 2O2SA 1QQTA 1U0HC 3OLYA 1PGOA 1URPA 5HVNA 2WQ6A 4JLNA 4HNVA 1W36B 3DE2X 2G28A 3W5CA 1FMLA 2OHHA 4G5RA 3AW8A 4IBOA 1KIMA 4M98A 5IAOA 1FTGA 3ZJVA 4MA4A 2OUKA 4OL0A 1XWFA 5E1OA 2AJ8A 2VHUA 5SZJA 3HA3A 2DBVO 2JVKA 5I9SA 2I5PO 3GXBA 4UHCA 4BX9A 3T5GA 4DA0A 4GGOA 3FSEA 2P6NA 5TB5A 1X2BA 3EGDA 3ZDFA 3C16C 1TUBA 3FZEA 4Q00A 3MS4A 4MNTA 1KMMA 1T13A 4S2EA 4OM8A 2JIRA 1U8ZA 1G98A 2MR6A 3I12A 1IQ0A 1Z0FA 1CJMA 1YRBA 3LVBA 3NPAA 4OB6A 3KJNA 5CRIA 3WLMA 3E6AA 1CK4A 5K6TA 1I5RA 3QFHA 4BFCA 1DX4A 4LZNA 3MCUA 2DY0A 4WZZA 4DJFC 1IOWA 2WJAA 2VL7A 3F47A 4IIYA 4JQZA 2XVZA 2HRQA 2PUCA 3VZDA 2WKRA 3K1TA 1K6MA 5E4JA 3PV0A 4JDUA 4KH1A 3R7BA 4YCBA 4JVSB 2PX4A 4MH0R 4MQEA 3DO5A 4MR9B 4G5XA 5EL0A 2ZZKA 4UM9D 4YXWD 1MC8A 3KPYA 3QMVA 3SM9A 3FAKA 2P40A 2IKQA 5JBIA 4EKYA 4D0SA 3EA4A 5D87A 3TOZA 1HXHA 2XMZA 4RK5A 3P9KA 3VNQA 4A7PA 4ZHQA 3NH9A 3IT0A 5DGXA 4AF7A 1RKVA 5I7OA 4HQLA 4W1QA 3DKIA 4TL6A 4QGGA 4UD2A 1ZZGA 3PD7A 4DWJA 4FEYA 1KDZA 1Z3CA 1J49A 4BQSA 1PGPA 4JI0B 1DT5A 4DCOA 3SYKA 2AMYA 3ZE8A 1JQBA 2BTQB 3BJMA 1X1CA 4TMXA 3V3TA 2BMDA 3FKJA 4BEBA 1D2CA 1G3QA 1WMSA 4A0SA 5F35A 4O2AF 5ECGC 1NVFA 3KXDA 3STVA 1YKGA 5BWNA 1QBKC 1B0ZA 2FTKE 3C3PA 1OXXK 3WBFA 3ZV5A 3DW3X 3HNOA 4IIJB 1XZ8A 2K87A 4MYDA 4OYYA 4XGIA 2IY7A 3SXPA 1CNEA 2WB4A 1W4ZA 3R24A 3BH7A 4W9NA 1UK9A 2R00A 5HF8A 3T5MA 3COJA 1MB0A 4KQ9A 1RZUA 2I03A 4NBRA 3SXUB 2RCNA 3QV2A 2BWJA 3VAAA 3CXRA 3INTA 3VAYA 3CCBA 5CVEA 1M6VA 5FR1A 4OTZA 1LB1B 3PSHA 1VE5A 1VC2A 1FXSA 2ORED 3DA8A 3G8YA 3N0VA 3NBFA 4AK9A 3G17A 4D4KA 2CZCA 2QX4A 2YNMC 4UEQA 4A8JC 1G21A 4B8WA 1D8TA 4GKJB 1NXVA 2WI8A 4WY8A 3CPSA 1QP8A 2PG3A 4CTKA 4GE3A 5FLKA 1ZIPA 3DZFA 4WINA 1OXMA 4YV2A 1VCOA 1Z8HA 4A23A 1D9ZA 5K8TA 1XTJA 1G42A 4L16A 4X5OA 4HAZA 1HSZA 4GVXA 1J0CA 1HLPA 2EGHA 4M76B 2P79A 3OM0A 2PL1A 4C2AA 2NADA 5LQNA 2P6RA 4KDCA 1Z06A 3GRKA 3SBOA 3CG0A 3QEMA 4IDAA 4XFDA 4F4HA 3E7PA 3PKIA 2Z5GA 2IF2A 4TQAA 4PGMA 3A4YA 1N0VC 5TC4A 1T8UA 1COWA 1XYYA 3RO7A 4DHEA 2G25A 1A5ZA 2AEEA 5LSAA 4PHCA 3UKJA 1KPHA 1WCYA 2CLKB 2CUNA 4PBTA 4CMGA 4CWAA 1EPUA 4N5IX 3RUFA 3U3MA 1E2EA 5CXSA 3EZXA 2F6RA 2GUWA 2P2YA 4O8ZA 4RH1A 4XGRA 1DCFA 1X1BA 2WIJA 3ADBA 1YZYA 3VUEA 1Q2XA 2EQ5A 4EBFA 2FMKA 1GG8A 1E2IA 2OCAA 1LRJA 3HGTA 3QVTA 3QVLA 1DKUA 3AM3A 4IS2A 1GWNA 1YMQA 3BIJA 2H1VA 3LT5A 1SBTA 1WMDA 4RV4A 2JGDB 2IH4A 3ER6A 5AVZA 3TNDA 4H17A 4IQ4A 2TECE 3FPBA 4UZEA 5DTJA 4AY2A 2X5OA 3IUEA 4XE5A 3M4YA 4JLDA 4CM3A 1F2DA 3Q0TA 4CMIA 3PDHA 5B58T 4FGWA 3AF5A 1VRCA 3MYYA 4Q19A 3B85A 1LNSA 4IQ0A 4Q66C 5E0KB 5HDBB 3UMFA 2BUCA 3WIVA 5CMLA 2ZBDA 5A7FA 5IBCA 2WD9A 1QQ5A 3NNNA 3HYRA 1KZ6A 3LHSA 5IS2A 2C4TA 1LWOA 5JFOA 5JZMA 1YL7A 2P91A 1PG5A 1I6WA 2GF2A 3EHDA 3LUAA 5A4AA 2AL7A 3L6OO 3D4BA 3DMTA 2CXSA 4MCJA 1NF2A 1PR9A 2KBEA 2W2NA 2Z2ZA 2P77A 3HN7A 4OH7A 3T5DA 2ZYAA 1VHDA 4CDMA 4E2ZA 1TK2A 3ANXA 3OUUA 4B82A 3WWDA 1NMQA 1G2PA 1U5CA 1UDRA 2LWIA 4CKCB 1CRLA 3GROA 3A6EA 1PZHA 3DYIA 1TVKA 4IYJA 4DEXA 3QLUA 4L28A 4QULA 4JQSA 4TRJA 1OPRA 2I3AA 1GKUB 1U3CA 3K9NA 3H5TA 4FQ7A 4QUEA 1P4HA 4BV3A 4HRAA 5LOVB 1O3YA 3EUFA 1CR0A 1U7PA 3COSA 3I9MA 3ZVKA 4OFBA 4UTOA 4OATA 2CWDA 3O3NB 1GADO 2JZCA 2ONCA 4IJUA 5AW2A 2DC1A 3EXG2 3OH8A 2ZRJA 1MDBA 3PLRA 2Z2YA 4HFJA 2MSNA 2B7BA 4FYWA 4YRJA 2JFPA 4OMDA 4AG5A 3C2QA 5M2QA 3RYCB 2R96A 5EI5A 1YDHA 5CH8A 5FORA 1NSTA 3SQNA 2O8DA 1CWUA 4D3DA 1VPTA 5FUYA 3OQMA 4O08A 2NUAB 4MUJA 3HWX1 4DA4A 2A9VA 2X9LA 4I5GA 5TT0A 5SYMA 4Q03A 2KSQA 4ROTA 4C0HA 3OCYA 4M0MA 3LO5A 3RVSA 3BXPA 5BW8A 3DEJA 4MQ4A 1ZVVA 2XPCA 3A1FA 2C0QA 2E0IA 3S4YA 4YEDA 5JDIC 4DV6B 1JLLB 5AOBA 2ISQA 3GAFA 2XNKA 4UATA 2OCGA 2JLYA 3R6DA 3AUFA 4UE3S 2PV0A 4OOFA 3PE4A 2FMFA 4ZOBA 3V7NA 1VLLA 1K8YB 1F6WA 2JI9A 4L9AA 1GNTA 3AUTA 4Y2PA 4DBLC 2D6FA 2GERA 1EESA 4OXNA 1Y4DE 2C96A 2V3WA 4P92A 3S0JA 5A0VA 1G8JA 1UK8A 2AOTA 4BMZA 1BKSB 3QWHA 4MYSA 2XWPA 3W78A 1JXAA 1GEGA 1WCWA 4G36A 4UARA 3N9IA 4X7PA 3UJNA 2X23A 2YY6A 3KD2A 1S6YA 1QVZA 4QTTB 4B3HA 4TKMA 4DZRA 2QTFA 2CFCA 1MTOA 3AV0B 5AKEA 2EKPA 3ABIA 1C9MA 1YH3A 3QE2A 5CR9A 3IAM1 1POWA 5DNWA 4PE5B 3EQ9A 3PKZA 3UOAB 2JFXA 4OLFA 1LF5A 3OIWA 3MSXA 4GPD1 3GJ8A 5H1YA 1OPXA 2HNKA 4Q3BA 5JSHA 1J42A 3U3OA 3GLFE 3CUYA 2WWHA 3NGLA 1BDBA 4I7EA 3RCBA 4Z4IA 3GOHA 1FFDA 4K9MA 1YAHA 2GJ4A 5DNDA 5TMDA 2I4MA 3WG9A 4ZPJA 1GUDA 3Q11A 2AGVA 4G26A 2C83A 3AL0C 1J06A 1BMFD 1JR6A 4BNMA 1E99A 4QSMA 3UMYA 2QRVB 3GMTA 4MJ3A 2DPMA 3K9FC 3FFWA 1PYGA 1Z5WA 1UP4A 1HE8B 3K30A 4IW3B 4OJYA 4L75A 4YO8A 3THYA 3GVCA 2NMVA 1ZI9A 2V6JA 1WXEA 3ZIDA 3F4LA 1CG6A 3HKDB 5BR7A 2F90A 1HT0A 2HMSA 2WRZA 1SK9A 1T0JB 3FVRA 5F77A 3KLMX 4CM8A 1OLXB 4MVCA 2P8JA 3DMHA 1A9OA 1J21A 3GT0A 3TW8B 5EP1A 4AWBA 2ABWA 1Y5LA 1FQOA 2V9PA 1JR2A 1L7DA 2V7GA 1CY2A 2V3VA 2P7HA 3LVFO 1KRHA 1L8XA 2YL2A 4RETA 3VPGA 4A0HA 4GOOD 3BMQB 3DS8A 4NDAA 3ANNA 1XQ1A 1W0JA 5CBKA 1XMQB 1X7HA 3T1QA 3WLQA 3ONFA 1OYWA 4C9BA 1UIMA 2RHTA 3SYRA 1Q0LA 4L27A 2PSEA 3P96A 2Z3VA 3QX9A 2YR0A 1KQNA 1K75A 4POAA 1N5JA 5AT1A 5T6MA 2Z1DA 3QA9A 3TH5A 1BQ4A 2D2XA 3QKIA 3I5XA 4GKKB 1IVSA 1QNFA 5D5HA 2YOFA 5ED4A 4XWOA 4F6RA 3QFSA 4NOKA 4XYGA 1OGJA 1CF2O 2QRQA 5B1YA 1ZUIA 2BBOA 2G9QA 4EMSA 3O2JA 2W22A 4LFAB 5DH9A 5IAAA 2ST1A 3EB9A 5AXCA 3TEJA 3ZHYA 4L8YA 1HKHA 4BLQA 1RWVA 1UK6A 1V6AA 2H8KA 3QU2A 4E08A 2QD1A 3NC1C 1ULSA 2PBLA 3WNBA 1RWQA 4LOJA 4A15A 5LMNB 3AJEA 2CDNA 4R7TA 3VPDA 1K4YA 1XBTA 4B4VA 3Q3IA 4UXHA 3NTOA 4R2JA 1VA5A 1U31A 4FFSA 3H9EO 1M0WA 3NC4A 3HFSA 3RFTA 3EAGA 5DIZA 1KAEA 1ZISA 1V5GA 2GBLC 2Q8NA 2WYOA 2JLZA 1BMDA 2CNNA 2V7QA 1GG5A 3PNBA 4YYEA 2RJ3A 4IUYA 1R3DA 5LYJF 3CEMA 2CLCX 1E2QA 4OL9A 4LMRA 4RSHA 3CFYA 5IYZF 4UZSA 5TMPA 2AN5A 2E3JA 2E9SA 3B13B 5CVCA 1CEYA 1PR2A 1U7ZA 1ABBA 3P2EA 3KDPA 3JPWA 2IXDA 2OCYC 4GX1A 4XWTA 3RT9A 3TX2A 1R9GA 1ACMA 2LP4Y 4EQZA 2RHLA 2I6TA 3EARA 3OEEA 3G02A 1G9TA 3NXKA 1P7CA 3OECA 5CNMA 6PFKA 4NE2A 2DH6A 4LVNA 3DW1X 1GNRA 4IWXA 3O9MA 1MB9A 4JGIA 1N33B 3IL2A 2GZDA 2P9ZA 2PX0A 1X86B 2RARA 3VKFA 2I4LA 4AROA 4Q34A 1MZPA 4R1LA 1G5QA 5C1BA 1MABA 1PR1A 3D3JA 3FGPA 4L3WA 2FW6A 4M7OA 4RVGA 3WV5A 4WEOA 4WK4B 2XB8A 4B7AA 3PLNA 4MYRA 4K9QA 4Q82A 5B12A 2P2SA 4IVPA 3RANA 4XB2A 3NWJA 3QI2A 3GAZA 4RDIA 3IPLA 1I7SB 2VEOA 3N87A 1QFZA 2EJCA 3OZCA 1CP2A 4DXDA 1BXZA 3JQ9C 2CDBA 3Q15C 3Q5DA 4AN0A 4DR2B 5DYIA 4F84A 2R1TA 4W99A 4BYGA 2DLDA 1JKJA 4E94A 2YTZA 2ZW9A 4EFMA 1YS7A 1DJNA 1PLJA 1XDDA 1XQVA 3JQEA 2OHJA 2BGJA 3ZDXB 2E55A 4JMPA 5HJ2A 2EARA 2ZE7A 2ZJ0A 3QJGA 2IIVA 4JVLA 4K9OA 5BVHA 2HLPA 1Q0RA 4ZZ3A 2NZVG 5ED0A 4MLDA 4H08A 4PX5A 2HYIC 1BFKA 3LP6A 1RWNA 4RIHA 4Q1BA 4L5AA 5I7WA 3KJEA 3V33A 2XQIA 4EY8A 5JANA 4GMDA 3FVQA 3D1LA 1A9XB 4G4GA 4X92A 3MBIA 2CNWA 2ZBFA 2DUUA 3USES 4GPBA 1C7EA 5E9AA 5BN4B 4EHFA 4N18A 1JQJC 3RVRA 1IUKA 3NO4A 4HBGA 4DG8A 4M1QA 3WYCA 5B4VA 2JD1A 5H59A 1P31A 1OZGA 2EWVA 2Q45A 2ZCVA 3C3XA 4LBWA 1ZH2A 1FQJA 2JCXA 3F90A 3ZI4A 4L2IA 4B8YA 3OM9A 3PWSA 2VDKB 4D1YA 1PVOA 1T36A 4UUBA 2C7RA 1G8GA 2FSGA 2I4TA 2E1PA 3CZCA 3OBIA 2VK1A 4MQLA 3V8VA 5AVQA 3L05A 3QEAZ 1P3Y1 4Q47A 3I01A 2K7ZA 2ICAA 2Q21A 4POOA 3PEVA 3JQDA 3CBQA 1EI9A 2G9ZA 3VXKA 4XVHA 5BNTA 3VR0A 5KOJB 2QRLA 2FSVC 2YJ6A 4M9QA 3CINA 3M5WA 1YRYE 2OILA 3NV9A 4YMGA 3BYZA 3PUVA 4IIGA 1BXRB 2GNOA 1CUUA 1OBOA 5LZ7A 3TK1A 4ARIA 3IX7A 3EFHA 2O3TA 4Z5XA 2W6PA 1MG0A 1IJFA 3WLEA 4MS4B 1XPRA 1DE0A 3SN6A 4AP9A 1CQPA 2XYRA 5JS1A 1L4GA 1JI0A 4NENB 1RYZA 4YR7A 5B3JC 3G7UA 4AMZA 3PHHA 1SVOA 4D9BA 2MINA 5IPFA 5L3RA 1SHKA 1T2VA 1W88B 2HGZA 3VPCA 4XVUA 4F5DA 1GPH1 3E2MA 3ZE9A 2FNAA 2QX6A 4YXFA 3VJKA 3ZLJA 2ZYIA 4FZ5A 4MGEA 4CXMA 3K9HA 1AMOA 1IJBA 1US8A 2N0SA 2VZ9A 3TM5A 2FWAA 1DTEA 1SXJB 3AY0A 4GPZA 3THOA 4A9AA 4U6SA 4A0GA 9ATCA 2IU4A 5AVRA 2C7QA 5ER9A 2X76A 4NBTA 5IYZA 3S29A 2F8LA 3PNVA 2FFJA 2XNDD 3AB3A 3RVMA 1JLHA 4EHBA 3BMNB 4JKOA 5EFOA 1KEEB 3C6BA 1IRXA 4HDRB 1ULAA 3CVJA 3VZCA 1ZONA 4FLMA 5BYJA 1YGYA 4C5AA 2PR2A 1O97C 2YVKA 1LGYA 4C4TA 4EUNA 1UM8A 1BVRA 1Z4MA 1M2WA 2FW9A 1SCBA 5EJEA 4KVGA 4H7IA 1D9XA 3IEIA 2VSNA 4DR6B 4IGFA 2FE4A 4MUYA 5TJ9A 1CUFA 1M1YE 3KAJA 1R12A 4HEJA 4IIJF 1EINA 3FDZB 4WNCA 3BHIA 5KU7A 1XAIA 2R47A 3LLMA 4QQNA 3PX3A 4YT8A 1PT9A 2ODAA 1ADFA 1VHTA 4FGLA 4H1HA 1WWKA 1UXIA 1MIOB 2BL4A 2GF0A 1XVAA 2AVNA 3JQ8A 3QNUA 1X7ZA 2UZIR 4OQLA 4PNZA 4RLFA 5ECYA 4F5WA 2DHQA 2PLWA 1IY2A 1NSYA 1RXIA 3BL6A 1YE3A 4I4CA 1JEQB 2B61A 3KFLA 3WI7A 4DMUB 5LKRA 2ONKA 3D5EA 1G41A 1NOKA 4PBRA 3IIJA 4LZAA 3IQHX 3ULKA 1REQB 3ZCTA 3AQIA 1DKMA 3EIXA 4XFJA 5IJ0B 3PEFA 2C5FA 4FT2A 5GMOA 3AY7A 4BP3A 3AUSA 1XXHA 1ENPA 3NTQA 4C7MA 4YQFA 4IWYA 1JPJA 3DLAA 2GZ3A 1YQTA 4GUAA 1KI4A 2GPSA 1AZTA 4W7SA 1PJQA 1M10A 2IZOA 2AKEA 1KBZA 1AQLA 2XUIA 4WECA 2CLIB 3FZYA 1V0JA 2TRSB 3DONA 3ZY4A 2AEJA 3FETA 4MP8A 5A4FS 4YT4A 3ELBA 1E9CA 1Y48E 3TQOA 4CGZA 4UXJA 4Y1GA 2R79A 4LVUA 3MHTA 1QMPA 4QDZA 3VC7A 3E0XA 2A0YA 5JZ9A 1SKMA 4WBSA 2W6NA 4G65A 2JLUA 4OP3A 2R87A 2HMAA 5EZ5A 4L5JA 3C74A 1V96A 2ZR7A 4QBFA 4BTLA 2GKSA 4RAQA 4NK4A 2QDXA 3WC4A 4A26A 4DMHA 1GG2A 4NBWA 5H8WA 2B4KA 1S3IA 2ZRKA 1A69A 1N2ZA 2J3MA 1TGVA 4HGYA 4QDXA 3AG5A 4AM8A 1L7MA 5G3ZA 2OHFA 3GGGA 3TZBA 4KO3S 5JHHB 2AI1A 3TINA 3PSAA 1GRRA 4ZYUA 1SVMA 3A3KA 1EE9A 4BU0A 1EDBA 1I0IA 1ZYUA 1V71A 4WKBA 4QOIA 5GVSA 3OE5A 3VYSB 4HP8A 4G89A 4RK6A 1UFOA 4YAWA 3DBLB 3RSZA 1FPQA 1XCOA 1YV9A 4QARA 2PQ0A 1X3LA 1UK7A 2C1EA 2RH8A 4GO1A 4BLOA 4Q93A 4EA7A 5FFFA 3F6PA 2G72A 3CNBA 3GJRA 1V3UA 5C4GB 3FZQA 3RLIA 4LJLA 1ZIYA 5AOAA 3O6VA 1RYEA 3CU5A 1J99A 4M9XA 4DM4A 3CY6A 1K06A 4MR9A 2C7GA 1X3SA 2IYEA 4ER7A 1RXSA 5EP4A 2A3RA 3UW3A 2QTTA 5EXEA 5BYBA 3BH6A 1VMIA 4YK7A 1QAQA 1YMUA 2HH9A 4HLQB 5LOVF 1U28C 2C3OA 3DP7A 2VJMB 3F8TA 1P1HA 3JZAA 4FFMA 2ZYRA 4OXRA 4E5YA 3P5SA 3RJMA 3U7RA 2J67A 5JC1A 1MEEA 3OLWA 1RHQA 3AINA 1AKQA 3L2OB 5CT4A 4GI5A 4UCFA 1K3UB 2BTQA 2QPTA 4H0NA 3V1MA 1CHNA 3FMOB 3KQVA 4KXQA 2P9YA 4FZ3A 1B0UA 1WABA 1C7QA 2PKWA 2M6RA 4R1NA 4C88A 1UXJA 3H0CA 2PUEA 1PNTA 3M49A 3UCXA 3VYVA 3HXOA 10MHA 5CUQA 1XJ5A 1AS3A 3H9QA 5C4MA 1ZEJA 1J33A 4IIJA 5EMLA 3MVEA 4WKOA 5FYQA 4U7DA 3WSWA 1VL8A 1H93A 2QKYA 1E9BA 4LISA 3KKPA 3SHQA 4J0QA 4Z3OA 1H8EA 2Q5OA 3DVRX 4WNYA 3RHSA 1UL1X 4GS5A 3SXUA 3GJYA 1NBMA 4XARA 1L4KA 5IARA 3ZCQA 3CIOA 4PX3A 5J2TF 3UBTA 2DMRA 1CUWA 2DTEA 2QYOA 3BTSA 3CJRA 3KZXA 2EJWA 3P0RA 3O8NA 2PCJA 1E3DA 4BO1A 1K66A 1QIFA 2HMYB 2GPWA 2WF9A 2ORYA 3DTNA 1R4AA 1ZN8A 3RV3A 4YAUA 1HYEA 4C07A 4G07A 4CG0A 4F71A 4XUEA 3W6PA 1OROA 4FYIA 2OL4A 3KTFA 4MLZA 1HEIA 1SRQA 1TVMA 1HWYA 1NP6A 3IALA 5DGHA 4C0AC 2AXNA 5IK2A 2GK4A 3GG2A 3H8JA 3EPKA 3H2IA 3WA7A 4DPLA 4CT5A 3ER9A 1IRIA 5FQOA 5K4GA 4LF6B 5I9NA 5DZSA 3SLGA 3PPWA 2X8BA 3DAOA 4AS3A 1WPXA 1OYVA 2REQB 3RS8A 4ERXA 2VXBA 2Z4RA 1BCRB 1HY3A 2EZUA 1AY0A 1ISSA 3BN3A 2AKAB 2R7MA 3U7QB 1KO5A 3PCRB 4DGQA 2ACEA 1N34B 3TB6A 1JG6A 5JLJA 4PO8A 4KQEA 2YICA 4JVNA 2J9YB 2I71A 3EZNA 4OVKA 2Z57A 5BWCA 1D6JA 1A2BA 2QTZA 1RTTA 4AI6A 3UG7A 3PNQA 4A4DA 5GINE 1QU3A 4OGWA 4AJIA 2CBZA 2ZG6A 3I4LA 2C20A 1SUPA 3EXHC 1C0IA 3UXYA 4ZT6A 5G4KB 3K70C 1GL7A 4IRMA 1DBRA 1PI3A 5BSRA 2JGDA 5KJ6A 4ZMSA 5J40A 2VJAA 1QG0A 2J0VA 4OLHA 1XTQA 1J20A 2QVLA 3PCXA 2ZXEA 5ALPA 3ZWCA 1G2OA 2D2VA 1XLWA 3TQQA 1OBFO 3UJ7A 4F4CA 1TD9A 3GEPA 3HSSA 1PHRA 4HAWA 1JIKA 2Q0SA 3DPUA 4PZCA 3UM9A 4DN6A 5FJJA 4ISBA 1UDAA 1LA2A 5EJ4A 3O74A 1EK2A 4FTWA 2HSJA 4NLLA 2OQVA 1P1KA 4D4MA 1A2OA 2I6XA 3BSYA 4ND1A 3UK1A 4DNOA 4DY6A 4QUDA 1MQSA 1UWLA 1R88A 1SBHA 3PPVA 5L3SB 3I8XA 1LBHA 1JNYA 3T3HA 1UJBA 3AQ4A 3GT7A 2AEMA 1O87A 4A5OA 3BDAA 2F00A 5KTPA 1RCUA 3K8QA 3W7BA 1JI3A 1KJYA 4YJGB 1GY8A 2Q9AA 1G16A 2QG4A 4LV5B 3SCZA 2DX7A 4I0WB 1SXGA 2IJGX 3FTNA 4F85A 2FOXA 3ZYZA 5LOVA 3SEQA 5J1SB 3B6KA 2VATA 4L9SA 5DOVA 1TFUA 4C2UA 2OCPA 3LZ6A 4NMLA 2PZGA 2ZJ4A 4FONA 4RJIA 2Q1XA 5EJ5A 1WXIA 2VDJA 1IN6A 3OOJA 4LNAA 2Z30A 4W1RA 1ODSA 4AMUA 1E0SA 2IODA 4TS1A 5JV5A 4I3FA 3RODA 1KORA 3ZDCA 2FZVA 5B53A 1L4HA 2B3DA 1QNLA 2FPLA 3WTBA 4FYMA 3WGZA 2NVOA 2ZP1A 3TKAA 5DRYA 2RBGA 1T1JA 1ZD4A 4ADSG 1V3VA 4B34A 3RYCA 3FMFA 1XU4A 4OJKA 3NRCA 4I6GA 3EBPA 4JROA 4N12A 2ZTLA 1CDOA 4MMXB 3VSBA 4EGSA 1FRVA 2BMAA 1IZYA 2EF1A 5HWSA 2OHGA 1UAYA 3FNEA 4M1EA 1H4QA 2J9ZB 1CNFA 3W6UA 4DMCA 4H6XA 2GN4A 2HK6A 5AK0A 1UBKS 1N2OA 3FCYA 5HK9A 2H07A 2Z2XA 2AN1A 4QBTA 1PZGA 2Y0EA 4AF6A 1HDOA 1GU1A 2GMWA 2HXGA 4HSEA 4AJOA 5J5CA 1OFUA 3BRQA 1JLLA 2PMCA 1G59A 5KVSA 3UUWA 5FH9A 2ZSAA 1XEXB 2DPGA 4FOLA 2IZZA 2WF8A 4ZVTA 5A9SB 4C7JA 2XQGA 1IOLA 5SICE 4DMRA 1SUWA 4NXNB 1Z74A 3WO0A 5D3MB 1QV6A 2GCIA 4URVR 4HBZA 1WETA 3TZLA 1NW3A 2AT1A 2SKCA 3MS7A 3W0LB 3G1WA 3REGA 4UTZA 4I9UA 1X1SA 2Q1TA 3H75A 4Z49A 1Y8AA 1CPYA 3DE3X 3W4JA 3MOIA 3A11A 2GBFA 1S2NA 3A32A 1W7AA 1Y7TA 1ZOPA 1NXWA 5KDOA 1JFSA 3TI7A 2R68A 4AKTA 4XM0A 1ODFA 3LBNA 1SD2A 1XDGA 5DRTA 3TI9A 3ZDAA 2NW6A 3GLHE 1XDBA 1DFIA 4R8RA 1JDPA 1ZN7A 3L1VA 1U0JA 3A7EA 3DC2A 2FHPA 3GEBA 5LDHA 3SDBA 1EE2A 3L7LA 5F7ZA 2C42A 4FHZA 4GKBA 5GZ6A 3L0PA 4EHNA 5K8UA 4AKSA 2JLCA 4QGAA 4TTIA 1RI3A 2JJQA 4DZZA 1EWQA 3BRWA 1PQUA 3N6XA 4DV7B 4TM8A 4Y2SA 2JFBA 3NHUA 3THRA 3L5OA 4NPHA 1Q5PA 1XCBA 1KZ4A 3RIHA 1CD5A 4U6NA 5IUKC 2NO7A 3PGMA 4IVRA 1JSRA 1U7UA 3GV0A 1J24A 3O26A 2QRHA 2OBFA 4JOSA 4KMOA 1T9KA 4RFVA 5HZGA 2D0IA 4MMYB 5L7YA 4TN1A 4NDNE 1E5TA 3G2IA 2QRVA 2H92A 3I6QA 3ND5A 3R6TA 1IHDA 2EC5A 3L7IA 4OK5A 2CLSA 5AJVB 3MWJA 5JVDA 3F3KA 1JA1A 1DNPA 5TPZA 3RFFA 2HLDD 4CHGA 5JJKA 4RNCA 3NCHA 4O8CA 1O6BA 4OB7A 3RADC 1Y1KE 2HRRA 1PK7A 3D7SA 3HKDA 1KJWA 1NR5A 2VJNA 1ZUNB 4PPYA 4XVQA 4YRQA 4DQXA 5HCNA 4A6EA 3B1KA 1OLXA 4FWIB 3TW8A 3TJRA 1JIVA 2ZJBA 3L0BA 5FTLA 4HDOB 5D2CA 3PXUA 3AM5A 4DT1A 4GQBA 1KAGA 1TUIA 1TF5A 3GFBA 3A58B 5JAIA 3BMQA 1EGMB 1R9JA 2Z9CA 3VYRB 1DZIA 2I4RA 3DOJA 3TD6A 4JYAB 3B12A 2VJLA 3PXEA 4HYTA 4XPIB 2F1HA 3DO8A 4MVJD 4OBWA 1LVHA 3OETA 1F7VA 1BW9B 1F9AA 1NJ5A 2C2MA 2V7PA 3PPIA 4KQXA 1C9JA 1Y82A 3C0KA 3EY9A 4I6EA 5KU1A 3E18A 3QP9A 3LXXA 2C2OA 2WJJA 4MICA 4MX8A 2YRWA 1W19A 3AUKA 3GNTA 4FGKA 2GFHA 2I7VA 1U3FA 2GRJA 5H3CA 3ZD8A 4QYWA 1DVRA 2II6A 2UYGA 3GAAA 3FGNA 1BD3A 4OQYA 2M6SA 4ALKA 2O8CB 1AIPA 2NYUA 2JHFA 3H4IA 3NVMB 3OKPA 1BWSA 4BQRA 2XCUA 4NBUA 2WSYB 2O1WA 4PAWA 3PTAA 4KDEA 4Z4FA 2J48A 3VZRA 2FMXA 1F14A 2PFSA 4IDGA 1VIAA 3ASUA 5JZSA 2FPSA 4IJKA 2IWRA 2RKWA 5DM70 4YMVA 2PD3A 4C43A 1GA4A 1H6BA 4OXXA 6CHYA 3K0BA 4ZQGA 4X7BA 4Q05A 1KH3A 1ODIA 4EG4A 3ZU2A 4G5GA 1SVSA 3FVTA 2I67A 4PPFA 4F86A 5AM5A 2J7PA 1R6TA 3KWMA 1LS6A 5BUSA 4IQGA 1YRHA 2ECQA 3Q5EA 4U2BA 1VJRA 3ESBA 4RKFA 2QRMA 3BIOA 2JRLA 4I2NA 4HY3A 5FCDA 5JMWA 3GRRA 4QD3A 2VJBA 3AV3A 2JASA 3HXKA 3NHBA 4YAEA 5B5SA 4M0EA 2W6IA 4JITA 3UBMA 1GZ5A 1VLVA 1YR1A 1YVPA 1VA4A 4KIUA 4PCAA 1VMEA 3JVUA 1ESZA 2ZAOA 4YAIA 2FUEA 3S2IA 1TM7E 2XUGA 2Y76A 4F4JA 2FUNB 1ENYA 2WV7A 2PJZA 4GSLA 4JQYA 3SVLA 1E79D 1RFLA 3AR6A 3CURA 3FWNA 3GLRA 4EYSA 3ANSA 1HLGA 5DLQC 1ZRSA 4ER5A 2ZSKA 3NJ4A 3PC6A 2G5PA 2L2QA 2RGAA 4RSGA 2HMVA 2GCEA 4TMKA 2LE0A 2OBBA 4BUCA 3WOHA 4RVNA 1YJ5A 4RS4A 5EVJA 4MVJI 2AEFA 3A6HA 3ZWVA 1X1TA 5LDDC 2FWRA 2P69A 4BWVA 2HV9A 2VN8A 3HJUA 3TS1A 1WUIS 3TXXA 3DV0B 1ML3A 2WWIA 1KZGB 4BMNA 4ZWNA 1G7SA 2GM9A 4K6HA 1WG8A 4I9GA 4MVJH 4TT3A 3NIBA 5B7PA 4WNAB 5HEKA 2H7CA 3MSCA 3CF4A 3SIWA 1B1CA 2R11A 3T7AA 2RAUA 3A9WA 2GILA 3MWYW 4K8RB 2C1ZA 1RPAA 4XB1A 1K5GA 3EZYA 3MUNA 2CF6A 2MSEB 4BO4A 1RCTE 4D02A 1EFVB 1QHSA 1QZUA 3LQFA 1PU2A 4R6WA 4R84A 3U7FB 5AYVA 5SZHB 4RY8A 4US2R 1QTIA 4INAA 4E5KA 1SZDA 3UWOA 3WK8A 2O3RA 3DE6X 3OTGA 4D3FA 1OBHA 1OXUA 4CQNA 4IDNA 2CV1A 4O3MA 3E0QA 4WHMA 2I6UA 4EJ0A 2NO1A 4ZYZA 5KTYA 2IPAB 1DAIA 4N47A 3P4XA 5LNK1 1NVUQ 2P0AA 4OQPA 4QPJC 5C46F 1A9XA 1IULA 2AOWA 1NQAO 3MG9A 1XHFA 2HK8A 4N7JA 5CHYA 4C6TB 4PQFA 5JFTA 4DSUA 4PLGA 4XX1A 3U3ZA 3GLGB 5BN4A 3AX6A 4GKVA 2C4VA 3V6MA 3V7YA 2RHGB 3IHKA 3PJGA 1H3FA 5AJYA 1AK1A 1ODLA 2JKVA 4JUDX 2AG8A 4FDAA 4PLFA 3K0AB 2ZBUA 1FDWA 1PR6A 3K2BA 2POQX 5CM8B 1EAMA 3ZGXA 2CXOA 3OTHA 4H9GA 3RFCA 3S6JA 4LY9A 1CZNA 4YUVA 5IHXA 3WR5A 2X9GA 4HPWA 4MEAA 5DLYA 5A2GA 4GSKA 3QITA 5T3UA 1OV4A 2NTEA 4RCYA 3IFSA 5BPHA 1J9EA 1WNTA 2FB9A 3HLKA 3E9CA 4HGPA 4HNQA 2IS2A 1L7RA 2MTBA 3ROTA 1EVYA 1KYIA 1TYCA 4M1OA 2J33A 3A2LA 1E89A 3BIXA 3L43A 4P93A 1N78A 2NYAA 4XQEA 2H4FA 1N5KA 1Y0BA 2BM9A 3ONVA 3ID6C 4OHWA 1FXWA 4JJIA 1BXRA 4P38A 2XW6A 2O2DA 5CVUA 4BFLA 4U2DA 1Q0QA 1KEZA 1W0KA 3OBBA 4MS4A 4IS3A 1JVSA 1E2FA 3LTEA 4NMXB 4PZDA 2FW1A 5K1ZA 4NENA 1GIAA 1VYUA 4R2WA 1KH2A 3OTIA 4O2BF 3H9UA 4HWPA 1FZQA 3ZWNA 4C4RA 3MWLA 4HQRA 1W88A 3ZWKA 4DJDC 1D04A 5AUNB 3L8HA 5AHXA 1IZZA 4CQJA 5HFJA 3TUZC 3B3GA 1BA2A 1AJEA 1JNXX 2UAGA 1Z0DA 3GGSA 1YWGO 3AC0A 1AVTA 1O2DA 1SXJA 3A3PA 3CNQS 2NU8A 5KQLA 5L4SA 1ZL0A 2GD6A 3C3AA 3HJGA 3DLIA 2XXBA 5BN1A 5IAKA 4P0PB 1M2KA 3Q0IA 4BN4A 1QGZA 1RHKA 5EXDA 2NV0A 1Z6YA 1ZQ1A 3DGEC 4PYQA 4WN9B 1DJLA 4FM9A 2OOSA 3BMNA 1QJCA 1KEEA 4HDRA 3FSGA 2P5YA 5KNCA 4RENA 2O8EB 3IRVA 1I2BA 1E2LA 3E8MA 4NAVA 5JAQA 1OZHA 3NTVA 2SICE 1N6NA 4IMJB 1TKCA 4JYZA 4PLCA 1P9WA 1SVKA 2A5LA 2MMGA 1B26A 1ORHA 1RXWA 3KXLA 5TT1A 3BRCA 1WE2A 3PFCA 4QIHA 3X3HA 2PJDA 4J29A 4G0MA 3LWDA 2Z3WA 2H17A 3ROMA 3UT5B 1WSWA 1LV8A 1AXEA 2COKA 3DDCA 1I33A 2O14A 3EDCA 3FBWA 3FDZA 3WMFA 4ZK6A 3ZU5A 5AVJA 2HIMA 1XJQA 2OCDA 4L72A 1DO8A 4L51A 3IBTA 4FSXA 4U5QA 4K8OA 4KWIA 1K1EA 1MIOA 2V55B 3HGQA 3X1DA 1HMPA 4QGHA 1Y1TA 2FK7A 1IQPA 2HREA 1NN0A 1NVMB 3DMYA 3E9NA 1TO2E 3PHJA 5G3YA 2G1KA 1IL0A 4TV8B 3QEOA 2CHEA 1JEQA 1J70A 4TKLA 3V4PB 2FQ1A 2BHNA 1KE2A 4BX8A 1F8FA 1WHTB 2OSVA 2VBFA 4K6OA 4LRUA 1REQA 1WW3A 2F3RA 4FDVA 4N5DA 5IJ0A 3CF2A 1N0HA 2GK6A 3AVVA 2DSNA 5JIBA 1OWMA 4RHCA 2IHJA 1NYQA 3RKSA 2JI8A 2V7EA 3PQ4A 3L0CA 4GLBA 4QA9A 4I19A 5KAMA 4OI2A 4AQ7A 1QPGA 1E2BA 3FTDA 5EMJA 3PGLA 3URMA 5AJXA 3V1TC 1FMCA 2DWPA 4S35A 3W5UA 1QRTA 3O4HA 3LLCA 4RORA 2UUPA 1WCIB 1G5HA 4YQEA 1GQFA 1MFPA 2BHSA 2OR3A 2GZ2A 1OT5A 3D31A 3EA0A 5JS8A 5KYUB 2XSZA 1YK0A 2PFKA 3VGPA 3IV6A 3NUQA 1E9SA 2V59A 3PB3A 5MGNA 3TX6A 4PYRA 2DB3A 3S1LA 1MQ8B 4LZJA 4BB5A 1C29B 5BQ5A 3PLAE 3RC8A 2RJOA 4LJ4A 4F3RA 3EGOA 1AZSC 3AF1A 1QV7A 3C8DA 2A0WA 3ACDA 3HB7A 2AFRA 3LDAA 3OA0A 3QRWA 1Y3HA 1RZ3A 1OSNA 3H5VA 3MTAA 4L8VA 2C1XA 2JIBA 3P9NA 4M53A 4P80A 4PSVA 3S1AB 2OD7A 3V9PA 1EJBA 1C3VA 2NO0A 1JG3A 4CEIB 2VJOA 2X0IA 3CX4A 3OY2A 3AH8A 1N8NA 1DPGA 4Q37A 4X24A 3TZKA 1Y1SA 1D0SA 1SQ5A 1GZ4A 4D4HA 3T7SA 3DL7A 5BORA 4L74A 1O96B 1OVMA 2DQZA 5D5PA 1NVDA 2CWWA 1CIVA 4TLAA 4ZMRA 1LTHR 5HHTA 4IJ6A 2XNSA 3PE6A 2VP5A 4UQLA 2OVBA 2H31A 2WUGA 1GQYA 4AD8A 2BCJQ 2B99A 1SCUB 3GRUA 3DFZA 1NW9B 1TMKA 3DBLA 3WRYC 4ACBA 1ECFA 1B43A 4K5QA 2Y05A 4Z1MD 5AW0A 3JQ6A 2YNMA 1P33A 4R41A 1Z4QA 2AG5A 2XB6A 4TRRA 3VOTA 4D45A 4BQIA 4B3SB 2XDAA 5LIRA 3RC9A 2F8TA 2WOJA 1THMA 3OX1A 5LLSA 3L5KA 4EEXA 3B3QA 1CYEA 1VMAA 4MUMA 5AK3A 3TZ6A 4LBZA 4A8HA 4IDBA 3UB4A 1RQNA 1NUQA 3M8KA 4RZ2A 3N7AA 2QM0A 3BMCB 1V9CA 1QIHA 3GVHA 3OAAA 4NHEA 1W47A 1ZNQO 2NXNA 2RK3A 4L4SA 4MV4A 1V35A 2VJMA 4IUCS 2AN3A 2YWJA 1D2NA 3KK0A 1SU4A 3M4NA 1BA3A 4N03A 5DBEX 2D4HA 2HF8A 1R0CA 1FS5A 4G2NA 3T34A 1Q1NA 1GRCA 2Q5LA 2YX1A 1MU0A 2HDHA 3HHEA 3QXJA 4OAPA 2ZBPA 1I2DA 1SCNE 4PG8A 3EFBA 4LTDA 4C7VA 4TLMB 1LSJA 4BTVA 2GF9A 5KREA 1G4HA 3EIWA 4KMSA 4OIFA 2FFHA 1HDEA 3PVCA 1KFEB 3IKMB 3LSTA 2B7LA 2A8YA 2D4AA 5DYYA 2DHDA 3EXHB 3REQB 3UT0A 3K70B 4ZZ0A 4HRVA 1GGFA 3KSDO 3C39A 1EM8B 2ZVPX 4D25A 4ZDKA 1GPWB 2HADA 2JFQA 1H23A 1GFZA 2FMIA 2VCEA 4YB8A 4RJ2A 4C1BA 1E0JA 1G4UR 5DF1A 1ECLA 4ON9A 4P83A 4S24A 4KUGA 5EHIA 3NWOA 2CSUA 1CF9A 3PXDA 1GZUA 1TM4E 4OGFA 3TQRA 5JY1A 3L82B 4OQXA 5FNVB 1GUBA 3UQZA 4JY7A 3H3JA 1EWTA 1A9TA 5J43A 5JCXA 3QBDA 2TSYB 1B1AA 4KBGA 1S01A 2WNHA 4AL4A 5JCZA 4BVEA 2VF2A 1AQUA 1Z8NA 2YQZA 1QB8A 3DDNA 2Q9BA 2F9LA 3OJXA 2B1JA 3OURA 4ZVPA 3ZK8A 3NEJA 3L07A 3KUKA 4E7PA 1E92A 2OK7A 1GJRA 4RGBA 3Q5GA 3VR4D 5CFMA 4BNUA 3QX3A 2H0AA 3COVA 2I8LA 2REQA 2FX2A 4LEIA 4QU0A 3AHCA 3QOWA 5U1PA 4EF6A 3M6WA 1QZZA 1BCRA 2I2BA 1U7WA 3FLEA 3KZKA 3GK3A 4BVHA 4RX1A 5L40A 1VL2A 1NTOA 4CMJA 4IDHA 3K5IA 4PZYA 3U7QA 1GYPA 4EG3A 2V1UA 2X9QA 4HX2A 5EWLB 4M7PA 1GPNA 3PA6A 3QG1A 5BRJA 1E2HA 3IAFA 1BGXT 3D7KA 1K7XB 4B6PA 1WOMA 3E8XA 4ZCSA 1SVIA 2IYQA 3C6QA 2WMNB 4MHSA 5I7HA 1Y4AE 5L95A 3T7CA 1JAZA 5BV1A 4J91A 5HG0A 2HJWA 4YRBA 2K7FA 2OFWA 2JIQA 4TRNA 1WDTA 1L5WA 3FXAA 3QLTA 2Q7DA 5EZYB 3WL6A 3MCVA 3FOEC 5G4KA 5AM2A 5LKAA 4BKRA 3F6CA 3NBYC 3UICA 2ATVA 2H7YA 1KY3A 2Z1MA 2QUJA 1CIJA 1ZH0A 2O7VA 3CE6A 4GU5A 2Y1GA 2V7TA 1N0UA 4MROA 1X15A 4NF2A 4YJ2F 4KSCA 3R3VA 2FZLA 4JL5A 2IELA 2QTVB 2CV2A 3FRHA 3CF6R 7GPBA 2QY9A 2QTNA 3DZDA 4NHOA 1E6LA 4CI0B 2ZUBA 2P75A 3GJZA 5H83A 2WKWA 4QU8A 4X9XA 5LXTF 2ZJ2A 5JDIA 3MD0A 1GDDA 2A86A 4DCNA 3CPHA 5IKMA 5IKXA 4ZAGA 3DAYA 3ONDA 4FJ0A 4NE9A 5KTRA 3OM8A 2GXQA 4W5NA 1L1RA 5F1OA 3LCVB 5GV8A 2FPMA 5L3SA 1OTHA 1YRLA 4YRDA 2NAPA 3R0ZA 3RYHB 4F8YA 3CT4A 3C1UA 1CC1S 1C2YA 3D2AA 1GN9A 3LT0A 4WOKA 4CKXA 3FPCA 1FJXA 2D5IA 3DL4A 9ABPA 1NNI1 1QVAA 1RKUA 3PGA1 5DCUA 2O7RA 4H4DA 4TL8A 4MI6A 3ACBA 2HMTA 4ZVKA 5K0NA 1Y1PA 2GH1A 5JAPA 2PXCA 4H77A 2QROA 4WL0A 5K6AC 3W04A 3BFJA 3EXIB 1DIGA 2YFYA 3VDMA 1KWGA 2A5FA 3AVXA 3KB8A 4HMOA 4MR7B 1R8SA 3UGQA 3DNPA 4CKCA 1FQKA 3ZHQA 2IL1A 4KREA 3VR4H 1G6Q1 1X0VA 3AR5A 1DGQA 3BKWA 2JGLA 3MJCA 3BGWA 1X7WB 4EI8A 3D4LA 4NAUA 1M9NA 1C14A 2WZCA 3DHVA 3OPXA 4DXAA 1Z2AA 2QORA 4F5YA 5E3JA 1PS8A 2J31A 3A9UA 5IH3A 2ID8A 4M1SA 3SXJA 3UWMA 5HKOA 4MRSA 2XEXA 4AICA 1XGKA 2VH5R 3BHMA 3ST7A 4M8KA 1U1GA 4YQZA 3PYMA 1GDTA 2HHCA 3EFEA 3O1JC 3O3MB 4CKYA 3H65A 1H2FA 1XEXA 4H16A 5ALTA 5CFLA 3EUWA 3N2KB 2IPLA 4RDHA 5B2ZA 3L0SA 4F9EA 3L0DA 4OHCA 4PU0A 4O4HB 2AMLA 4QYXA 2OHOA 5D3MA 4NJEB 3CMCO 3O7MA 4IMRA 1LZKA 3WSVA 4EF5A 3PYLA 3CTMA 2NTNA 3EUAA 1JLSA 1H0RA 1U7HA 2CXUA 1M0TA 4MVJE 1VCHA 4JOQA 5C3UA 2FRVA 2IHKA 1ATZA 3VV3A 3ZS9A 1RAHA 4KGDA 4WD3A 4UPEA 1GCGA 3F96A 3EPHA 5F5XA 3ANTA 3F5MA 2FCAA 4V0NA 3ZLBA 5E8JA 5MHTA 1TADA 4L4RA 4KJXA 3ZHUA 5HCUA 4BJ3A 2X2OA 1WJGA 4IXDA 3B36A 4TLBA 5JS2A 3RHZA 5CB8A 8ADHA 1TLTA 3W9UA 1NXSA 4HADA 1ONBA 5CDYA 3JS5A 3OZEA 4DLUA 2FV8A 1WLYA 1S1CA 4HNAB 1U9IC 1Z6QA 1E1LA 2FFQA 4MV1A 4LK2A 4YDRA 5IM5A 1IZ0A 3DC7A 4AC9A 1J8FA 3WGVA 3C45A 1Z35A 3ZE1B 1YFJA 1T9CA 3ES9A 4QECA 1I13A 4EEZA 4M36A 1Z2PX 5SY6A 5AUOB 1HEUA 2ET6A 2G17A 1JG7A 1D07A 1NLYA 1I80A 2VRCA 3L0OA 4YAJA 5SYAA 2HC9A 2C61A 4FZVA 4E21A 5FDFA 4JN6B 1ZIXA 2Y77A 4TX1A 2YRFA 4NCBA 2YWXA 2IQIA 1R6VA 4GDFA 1GTG1 4IJMA 3WOVA 4MGKR 2WUVA 3O84A 4M0KA 5ALHA 2WY2D 4IV0A 1DOHA 5LBTA 1C30B 1ZPDA 3VNRA 2IU6A 2XVYA 3UV7A 3ZHXA 4R5MA 3FFBA 4R3NA 3RYTC 1MGOA 1WZ2A 3I5YA 2GBLA 3DHNA 3G79A 1A2QA 1KL7A 1B6GA 3IUNA 4IX1A 4NMHA 1N1GA 5EHNA 4IIBA 4M8SA 1AUPA 3ITKA 3OFJA 3VDRA 4DTIA 1DBQA 1NR7A 3K31A 4JBXA 1ZUNA 1XTVA 2AD1A 3F1KA 5EHQA 4KC0A 4K6MA 4NOMA 4OQQA 4I08A 3MT9A 4GOMD 1JAYA 2FA9A 3MGBA 1FU4A 2AX4A 1TMOA 4C0KA 4ARAA 1Z5UA 4NEQA 5B1EA 4MRMB 2ZYVX 1EJ2A 1N5MA 1VG9B 6Q21A 2ZETA 2C4MA 4JR0A 4TWRA 2GCGA 1CSEE 1MJHA 3AMVA 3N8DA 4XPIA 1NAHA 3VR6A 1J8MF 1G1MA 1V5FA 1UBOS 1L7VC 1VYHA 2PN1A 2QYHA 3AEKB 1MUUA 4FK8A 4IFTA 1NW8A 2LIVA 2RHHA 1TECE 1BW9A 4ETMA 2BP7B 1OXKB 2QSYA 5G1NA 2J9RA 3CJTA 4H3HB 2FZ4A 3OWXA 4NMWA 3WB9A 3CJQA 3FMPB 1M72A 2JH3A 1Q57A 3LGAA 2LW7A 4HN9A 5GY7A 3S1SA 3H2BA 1YNOA 2CFSA 4O1MA 4Y6LA 2C5BA 4NFLA 4DLNA 2J4CA 1DEKA 3RTEA 1ZGCA 2O8CA 2YVQA 2AD5A 4YLYA 4U2EA 5KPJA 1Y3FE 3NBMA 3GDGA 4RTNA 2L0XA 3L8EA 1W2GA 1SEPA 2CVFA 4YECA 1ZD5A 3JQ9A 3H2KA 5MDHA 1AGNA 2GEFA 1YF3A 2QXYA 3C7AA 2I66A 2UV8A 5EE1A 3QXGA 5I5GA 4GWLA 5J4LA 1VL1A 2WHEA 3VDQA 2RKBA 3KHKA 1CUXA 1G21E 1VKJA 2CUKA 5I8PA 4E5VA 1GGEA 1Z6PA 2WUWE 3LZDA 3S28A 1O7JA 2IXEA 3O9ZA 3UJDA 4D44A 1YRWA 4CNQA 1KQ3A 2AW5A 3B9QA 1Y4ZA 3CC8A 1UP6A 1SC1A 4XUGB 2DE0X 1IXZA 2FR8C 1K89A 3NTUA 2P9GA 3NHMA 4GPEA 4QODA 5EN4A 2QUKA 2CLEB 5HILA 1PZEA 1PFGA 5UKDA 3ZKAA 1TJPB 2Y9MB 2YVAA 4RM2A 3E9DA 5BUZA 5B7QA 1GGNA 1UF9A 5B58C 4OXIA 4NEGA 3CB2A 3NT5A 3P27A 4UHEA 1DBPA 5DNCA 2NQ2C 1PZMA 4AJ2A 4K03A 4DM3A 5EKXA 3SSMA 4ID3A 1W4CA 2XA2A 2QVBA 1YQEA 4NFHA 2OYRA 3ZDBA 3UPDA 1UC5B 3M6UA 4MPRA 4A16A 1Q0HA 3GFVA 2GEBA 1GTVA 3S2FA 3UHOA 5F5NA 2MSKA 3IKLA 4UHBA 2XY4A 1X70A 2I7XA 5IABA 1UFRA 4XDGA 2X1HA 3G13A 2FSVA 1QOQB 2QMUA 1FFGA 4TV8F 3F49S 3MAJA 4J9UE 4R1MA 3DV0A 3STWA 1KI7A 3B60A 4TZ0A 4QSHA 1IN5A 3KYIB 3DYVA 1F60A 3OEHD 3DVAA 1M5UA 2KPOA 4PAGA 5B3JA 3OQOA 1LCIA 3HM9A 3G9TA 2ZCUA 3QFCA 4N4AA 3B7GA 4W7HA 3Q40A 3E9RA 3L8ZA 3RFUA 4J3FA 3GLFB 3FYUC 2F8SA 4K9RA 3EGVA 1EFVA 3LECA 4GLJA 4GZ5A 4V1CB 1OH7A 1XHLA 2WWTA 3BXEA 1AX9A 4TMVA 1H65A 3GLKA 4Q0MA 2X41A 4GMHA 4K40A 2E5LB 1FOEB 4CL8A 1Q0TA 5L4LA 1YI1A 5G0VA 1SURA 3FCSB 5IK2D 3JQQA 5G4LA 5EKSA 1JJFA 3PGJA 4IOJA 4R8LA 4WZBB 3TJZA 1IYZA 4PNPA 5JCJD 4C6TA 5HOQA 2ZYTX 2DY1A 2IUEA 4HD8A 3HU2A 2ZJOA 3MJEA 2F1OA 3GLGA 1V8ZA 3C8ZA 4I5IA 4EARA 4G0ZA 4L9RA 2ISCA 4ND8A 2CHVA 4RMJA 2NWQA 4HXFB 4MITA 3P52A 3K0AA 1BAPA 4TMTA 3QMMA 1LBQA 3A4LA 4Q9IA 1C7JA 2NPOA 5E2AA 3ZCPA 4BNWA 1JXMA 1H3NA 1OFIA 3PUJA 3FKSD 5EEGA 5KWSA 2O8VA 1MAAA 4M9ZA 4RIEA 1T5BA 3QXXA 2GN2A 3KAQA 5CT9A 5C7LO 1FZTA 2QW1A 5HPYB 1O89A 1MXFA 3OJOA 4P7GA 5FBRB 4DR3B 3F6YA 4Z0TA 2ZM6B 2GRAA 3DE5X 1DAPA 2H3HA 4MHOA 3DEZA 3VSDA 3OCCA 3QZUA 2X22A 2JFZA 4P8RA 2Z8YM 2C3PA 3MA0A 4V0RA 3WWEA 5JNVA 3B7PA 2PXHA 3UWPA 2C2GA 3FF1A 4ZVVA 3B48A 1I6LA 3CNLA 4Y9UA 4W4TA 1MO2A 5LQSA 4MP3A 2IV7A 1TF7A 4EJ6A 3IUQA 3W8RA 2IWHA 2WTXA 4OMFG 4DADA 5DN9A 3ELYA 4CIXA 2YWFA 5HKKA 2CFIA 4O2RA 4FC7A 4O4IF 5EC8A 1GYRA 1L4UA 2IUFA 3SJBA 4F12A 5CIYA 1U1CA 1GITA 5DHSA 5C2JB 3OEYA 1LI5A 4IXNA 2RHBA 1DX6A 4PANA 5B3AA 1IVYA 1PAUA 2ACVA 2W83A 2WSSD 3B6ZA 1I94B 2C9DA 2GNAA 4U39A 3E27A 1ZI6A 1EB8A 4EGQA 4JCCA 1T5LA 2ZSBA 3VNAA 3TRKA 1E3WB 5A0FA 4WN9A 2GGSA 3DVQX 4GECA 1GLGA 5TY0A 5JZVA 1MX5A 2O8EA 3WA6A 2PS3A 4UNPA 1CJTC 1CULC 4J3JA 2I54A 1IDOA 2GN9A 2NSDA 2XUZA 2CJWB 4BAGA 4JBHA 3RVLA 2LRHA 3SOZA 3SS9X 3TZCA 1SCKA 4DCTA 3OC6A 2PRIA 2HIAA 4MVJP 2CXRA 3NRBA 3ZS8A 1EWKA 1GD1O 1PSZA 2RBKA 3BAZA 3U4AA 1XO1A 4KFRA 4AUEA 1Z5GA 2HA5A 4KG7A 4OP1A 4L78A 2W0SA 1SXIA 1T4CB 2L18A 1DOAA 1FMJA 3UT5A 4DG9A 5KPDA 5AHRA 221PA 5DGIA 4QG3A 2I6QA 4QM6A 4QNRA 2CVZA 5E4TA 1AZWA 3EVEA 4UBLA 4DA9A 4IIDA 3AJAA 3RIMA 5DHUA 3DP9A 1Q91A 2BBSA 3HPQA 3I34X 1USIA 4XAQA 5IASA 1KS2A 1XTRA 4DQVA 2DOKA 4TV8A 5E8RA 5GM1A 1KJJA 2OENG 1NI3A 3HJCA 3TTXA 4I1YA 2YY5A 5FNVF 3O2QB 4KO1S 1V9SA 2X6TA 3DE1X 3RHTA 1WHTA 4M83A 5EKDA 2VUIB 3BREA 4KAAA 1UC4B 1N6HA 2FZCA 1VMKA 3DSRA 3OHMA 4URWR 5TR9A 2SKDA 4RTJA 2PAFA 3ESYA 1M2HA 3DZJA 1R6BX 1W9HA 4GD3Q 1VBKA 4QASA 4G81A 4IXWA 1W87A 3T35A 2KHZA 4RTLA 3HCOA 4JJKA 4ZT5A 1WF3A 3OU6A 5BQFA 1XVUA 4JENA 1QIEA 3AHIA 2CJFA 1XQYA 3V3KA 1J2JA 1GLNA 2H5EA 2V4ZA 3FSJX 1WCIA 2C94A 4J4TA 3SNHA 4BFWA 1QUEA 5TLSA 1FUEA 3IB6A 1P18A 3T3PB 3VR1A 4PZZA 1HFWA 3DBOB 4I50F 2A6PA 5KYUA 4XUCA 1USUA 1QLHA 1U28A 2ZE5A 4OI1A 3VO8A 2IHZA 3CZRA 3AB7A 2WLTA 4IEIA 1BH6A 1M6HA 4GZ3A 4QQFA 4R9VA 2ZJ3A 2OWDA 3GUVA 2OAGA 1Z36A 3WQHA 1HDIA 4D6YA 2O3QA 3NP7A 2D74A 1Z22A 3FCUB 2IF0A 4FZJA 4IY1A 1F0YA 5HFNA 1V48A 3R76A 4R0VA 3WWPA 3O4JA 4CM5A 4EFLA 3KVRA 2FSFA 1FY2A 2IPMA 4II3A 4P35A 3U9SA 3D5TA 3AKZA 3S1AA 3VU3A 4HH1A 4LHZA 1FTSA 3HR7A 5ARBA 4CEIA 1XTSA 4EX7A 2H1IA 1YOVB 2WF6A 4AP6A 4LRXA 3VU8A 3EVAA 2WSBA 4K28A 2GZ1A 1XJ0A 3JD1A 3R20A 1O96A 2XT6A 4K81B 2JCVA 5ILGA 3CZ4A 3GFRA 3U7JA 2IYWA 1EKXA 1GHTA 1I1OA 1GUFA 2RAVA 1MW9X 1L7QA 1E8NA 1Y8RB 1NJ6A 2HF2A 4HHEA 4HS4A 4M0CA 4UVGA 1DQZA 5HE8A 5JYCA 5KQGA 1KEWA 1SCUA 3I05A 4U7FA 3PIIA 3T0IA 3T5TA 3ZXYA 5JUWA 3GP8A 4ESOA 1KMHB 3W3AA 5E7JA 5AHWA 2VAVA 2O07A 1XFAA 4PC3A 2HBZA 3OPQA 1KU6A 5C5IA 4ZI7B 3HZRA 4UQPA 3H2ZA 3M4ZA 3CLVA 4KUEA 4ZYYA 1W30A 1DEHA 3Q72A 4HQNA 4KHZA 4N65A 4BVAA 4YRNA 2YS6A 1FDOA 1M67A 4DS3A 1ZJZA 2GT1A 5LQJA 5COQA 1IZ9A 5P8WA 3SNKA 2HRBA 2P2LA 3K8YA 3DT6A 4DLTA 2QUZA 5BSKA 4LI0A 1E9DA 1Y98A 2O6HA 3BMCA 2W43A 3H3XA 4HH4A 1R8YA 4LAFA 2R4QA 1XDSA 4JHLA 4MAMA 2GI4A 4U2KA 3UA4A 4D8XA 5IEJA 1EFAA 3RRZA 3WAGA 5J59A 4KQGA 3OCWA 3TKLA 4KQCA 2AK2A 2NSJA 4GYWA 5FA5A 3IOMA 3SIXA 1IWBB 1UFKA 4FCVA 4PVDA 2Q2WA 3U3KA 4DA6A 3IHLA 2IH2A 4RKYA 1EP9A 3T9FA 1E61A 3DTYA 2W4IA 3C6MA 2JD2A 2CLFB 2Q62A 1SN7A 4D82A 2ECKA 4OU4A 3JRNA 3I1YA 5EIOA 4TTSA 2XD4A 2XRMA 3DFUA 3FGOA 4KZPA 2R7AA 1JTVA 1RXEA 4E51A 3EXHA 2DQKA 3M4JA 3M81A 1VXOA 1WM1A 1HE2A 4LK3A 3REQA 3RRNA 3TIVA 3TOSA 1L3BA 4QGBA 3ZJ4A 2I4OA 2IT1A 2Q4EA 1EM8A 2WIKA 4LDAA 3INRA 3WQBA 4Z7JA 1NYLA 3HCNA 4JZKA 4JXXA 4LJ8A 1M1YB 4XASA 4PW0A 2FPGB 1PSDA 1W6RA 2FMUA 1UT5A 1OF1A 1A8PA 2A4MA 2C9CA 1L5FA 3G2NA 5FNVA 1DAMA 1UBFA 1YC2A 4KQ6A 4AMGA 5CDTA 4RNDB 1YD7A 1FJHA 4O4HF 1JQ5A 4G1BA 3VPAA 3W8NA 1D2AA 1L1EA 2YV3A 3TRIA 1WXXA 2Q50A 1NRWA 2WWXA 3ZY2A 2B1IA 5EWMB 5CYPA 4DMMA 3NM4A 2FEXA 2YJNA 3HWWA 1KR5A 3EH2A 2PJUA 4JSTA 4UHDA 4UBOA 3Q1KA 2LDBA 4QBKA 4IIFA 3LP5A 1U63A 3IILA 3OIUA 4R8KA 2BHLA 4RQTA 1Q14A 4YDQA 2GJ8A 2WJPA 5C5DA 3P2OA 1RACA 4IILA 2HM7A 4LS3A 2QAIA 2EZTA 2R8ZA 4EYQA 3DGFC 1ZRHA 4UM9B 1RYBA 1KSJA 2FUG6 2EW2A 3UW1A 1CDEA 1QE3A 4JUFA 5ISMA 3TLEA 1CUZA 3N0RA 3ENVA 5J4KA 4OUDA 3AGPA 3VSEA 3WK9A 2PYZA 4H1UA 3F7OA 1B4DA 2I2CA 3ZDRA 4BNYA 4F04A 3O8CA 1OV6A 4F5EA 1ZW1A 4FQ8A 3IPXA 1M6YA 1M2VB 1NNLA 3EUEA 5HF6A 1RLMA 3IVMA 2HDWA 3FUTA 2OZLB 5TARA 1ADBA 3S8EA 5EUQB 8GPBA 1E1KA 4YRLA 1XRRA 4ZKDA 2GM3A 1C50A 1O9BA 3IJEB 4X63A 1YIAA 2ZZNA 1NF3A 1PFKA 4BNLA 1QE5A 1Q1GA 4AJ1A 5JECA 4MYUA 4DC1A 3BE5A 1Y3IA 3T41A 2QTVA 1RXYA 3NONA 3N1UA 2C8VA 2GYWA 4R2IA 1EZZA 1MB4A 4PSDA 2DWOA 2V97A 1YE5A 3W6OA 4BATA 1JAIA 1RD4A 2XB9A 4A5SA 1HR0B 4RHFA 4UW9A 3SX4A 3CYFA 3OPYB 1PJ4A 2XKKA 3MT8A 1T9GR 4M7RA 4D81A 4JBYA 4WY2A 5EQFA 2ZJFA 2A9QA 2DKNA 3ICOA 1IZ8A 1MPTA 2EJTA 3ANMA 3WNQA 3OA2A 4OXKA 4C78A 4TYNA 1E3EA 4H27A 3L8YA 4NTZA 1XRQA 4GX0A 1RI2A 1S2IA 1U2RA 4B3DA 2WMDA 3Q6IA 4JC0A 4RTQA 1Q0PA 4Q4LA 1TRKA 5I01A 4ZGBA 3L0YA 2V98A 4Q01A 3KU4A 4BLPA 3P2KA 2QSZA 3QUQA 2W2OA 5EMKA 2ZR0A 1QUFA 4UREA 2OBMA 3MCAA 3RVKA 3L8DA 3EXIA 3KOZA 1KVRA 4AU1A 3OE4A 5AVOA 3OZIA 1RQXA 1JX6A 2V6BA 4LZZA 1ONNA 2BI8A 4M1KA 4MR7A 2IYNA 4JMLA 5C5EA 1A5TA 1P7YA 4G09A 5BWMA 3ECSA 4MWGA 4Y7CA 1YFKA 5J4YA 1KK3A 2B9VA 4GF5A 2ZJ5A 1R10A 3KOUA 4PWZA 5TJHA 1JHDA 1TZMA 2XADA 2JCGA 3I76A 4FX2A 1TKAA 3EODA 4M0LA 2BGIA 3GYBA 2O7NA 4IM7A 1GZDA 3MOSA 4QUIA 1PCXA 2A0FA 2X8LA 3NEAA 3VFDA 4ZAXA 3RVJA 1UBRS 2PGOA 4A03A 2AZTA 3O75A 4FOTA 1ESMA 3DEKA 3GI1A 3NDRA 4P5DA 1I4WA 1QZTA 1R5BA 2GO7A 3RVPA 4ACAA 1DAEA 2OE2A 5KNBA 4RXTA 1KQOA 3L7DA 3OZBA 4BQQA 5FWAA 3OLCX 2C9MA 4JUIA 1JH9A 2WJVA 2ZWPA 3N2KA 3KNZA 4LYFA 5KSPA 4O4HA 3V7UA 1YOBA 4EMTA 3WDLA 2K4MA 3DL0A 2QU7A 3P0IA 2G67A 4NJEA 4S3MA 3VPBA 4P3PA 3SWWA 2QZSA 1ZCZA 4HRXA 1XD2B 4I1OA 1P2BA 1DHTA 3CVXA 3DEFA 3AL2A 1ICEA 1Q0ZA 1RBQA 4UHKA 4L5IA 3IJPA 2KI5A 5DI3B 4FDTA 4EG5A 4W5TA 2VTBA 1CBUA 4KYTA 2I1QA 3FOBA 2ZSEA 3ADKA 4FS3A 1W1IA 1JQDA 3WLHA 3FNGA 3PPXA 2X8AA 1KYQA 1OWPA 1K92A 2C2BA 3QPCA 4JT9A 5AK4A 4XQ9A 4B75A 1Y6QA 5C7IO 1YTLA 1BRMA 4HNAA 5TGTA 3SEFA 4CL2A 1MOSA 4QFCA 2PWZA 3P2IA 2B4QA 1KYZA 2VPZA 4HNSA 4DLPA 3PQ3A 2RMKA 2H4ZA 5JT1A 4FILA 3VMFA 3QVVA 2I8AA 4BY9E 2RG1A 3FLMA 1U3DA 4QFMA 2IC5A 3R23A 721PA 3M7IA 2WYUA 3NQ41 2BJVA 2HEIA 2QR5A 3IO3A 4F8JA 2PUGA 2JDID 1NMEA 2AJLI 2BKXA 1TUGA 3K9BA 4L95C 1BX0A 2AZXA 2R48A 4EF4A 4EKNB 1C30A 1SPXA 2XWSA 1WB6A 3E3MA 5CHEA 2BYTA 3PUIA 1N6KA 1ZC3A 3RFVA 1AHPA 3ON5A 1V8OA 3K9LA 2D5LA 3EY4A 4NZMA 3ZDQA 1G5TA 3MTJA 3TCKA 4B5KA 4LZLA 4ZTBA 1WXFA 2K5UA 5AIAA 1LPBB 4QDUA 3U40A 4U7TB 1QRUA 4Q1VA 3TRHA 4KLRA 1TEHA 1LQUA 1NLUA 3ETGA 3PQDA 1QIDA 3EQ6A 1JJIA 2P27A 3A04A 3C41J 4UDXX 3H7IA 3FGZA 3MTIA 2EFCB 2QTHA 3OIGA 4PYKA 4E1AA 4DBZA 4Q5IA 4U7WA 5DGDA 3G2MA 4HAUA 1A9RA 2ZDQA 1HRKA 1NL3A 3KVNA 2EGUA 4MRMA 4MWOA 1MO4A 3W05A 4DQ0A 5L4NA 1ZFNA 1P45A 1T9GS 2BAGA 3SEZA 2SCUB 4YJ3B 4QTXA 4XIYA 3AEKA 3ZZMA 1WSDA 1U0TA 4JJ7A 1I5EA 3LQ4A 3CKMA 2P4UA 4CFZA 4C7OB 1RSZA 2PGNA 2OGUA 2BP7A 1HKUA 2Z5VA 4CL0A 2PL9A 3FH0A 3UJ9A 1RE0A 4I5DA 1JYEA 4BWGA 3L1JA 2PX5A 2DJ5A 4FYVA 3HO6A 4Y6RA 4J0EA 2X7JA 1H1LB 1T1IA 3LKVA 3ND7A 4YMIA 3S5JA 4BS9A 5JEEA 1P4RA 1A7KA 2Y1XA 3ZHCA 4FBMA 3B9BA 4FHDA 5FI3A 1YUMA 3JD0A 1B93A 4MQMA 2TMYA 4KN5A 3P32A 1S2LA 2B1RA 2FE1A 4RVOA 2W2VA 5CB4B 4E2XA 5KNCH 2X5KO 2C2WA 3B7WA 5DBFA 1JYSA 4X1IB 3V2GA 1OHHA 1ZCJA 2BZSA 3GRCA 1I9CA 2FW8A 2YXPX 3KM0A 5EP2A 4AJ9A 2ORVA 3FHLA 4RKEA 1RM0A 1KKUA 3Q41A 3VKUA 1QYDA 3FYUB 3LXUX 2MMCA 1O4VA 2Q4DA 3K1ZA 3ABZA 3IQDB 3IVCA 1QO0A 3G5TA 1YQ9A 2OGWA 4CM9D 1EU1A 2XGMA 2VDPB 1TCVA 3RARA 3M9WA 3DCIA 4GT1A 1C3OB 2HPHA 4L85A 4PZ0A 1Z28A 5FUXA 2G08A 3KEFA 4HMQA 3CSUA 4E32A 1GL9B 4YGXB 3MWDB 3RS2A 1LBEA 1Q3HA 2I1WA 3FNQA 2CLDX 5DHTA 2ILTA 4DF3A 1IN8A 3GL9A 4DLBA 3UH1A 4JDPA 4LF7B 4F3NA 1INLA 4LXHA 3ZZ0A 2A4KA 1E1RD 4MRPA 2O6LA 1QGED 1AK9A 1H69A 2BDUA 1P91A 4FYXA 1I36A 3TJMA 4ZOQI 5CXQA 3HUTA 3K7EA 1Y3AA 1WIWA 2JAXA 4L0CA 5CXXA 5JEDA 3DXXA 3QU4A 3GT4A 3NKFA 4AS1A 4E33A 2HSEA 5DBHX 5JO9A 2C9YA 4LI3X 4TMYA 3EC2A 3HJHA 4ZVQA 4C05A 1VKRA 2X9VA 3ZNOA 2QLTA 1O94D 5PGMA 2FGJA 2HRDA 3QHPA 4MVXA 4XA8A 2QG9A 1JU3A 1KRXA 3MTQA 4RF4A 3GJ0A 2QV0A 2IITA 2PTHA 1EUDB 1N9ZA 5DBOA 3UKDA 1FPMA 4RSMA 1JIIA 2YHUA 3LU1A 2MYNA 4LOKA 3SJCA 3N2ZB 2JI4A 1YB5A 2DPXA 3UT6A 5KYNA 5HS4A 4URUR 5F2OA 3SC6A 4I9NA 2GDZA 3G89A 3MJVA 1AKTA 1YQGA 3DMGA 2G6BA 1YS9A 3R7FA 3ZVLA 4B1FA 2VHTA 3NYIA 2ZK7A 3LXRA 5KDDA 1QQAA 3P20A 2J41A 3QPDA 3GLFA 5EPOA 5G1PA 5IKOA 4EHLA 1TCUA 2ZYGA 1SZPA 3ILVA 1RC8A 2XUQA 4UU1A 3QE3A 5FTWA 3DT9A 3OCJA 4AXXA 1H1DA 4J0HA 1G5FA 2GTPA 2QZ4A 2ZSDA 1IEWA 1P0FA 1W2HA 1WR8A 3EQ8A 1QF9A 3TAXA 5AD1A 1PNRA 1FP7A 1CJSA 3FY4A 3HDTA 3KB1A 2C3MA 5TV2A 1PWXA 1OIXA 3DJFA 1A4XA 1H85A 1GNVA 3ED1A 3GVXA 4EM6A 4X66B 1U3WA 1G8SA 1YR7A 2ONYA 4MGHA 4WZBA 1BWQA 3GJ6A 4XKJA 4KI7A 4MOWA 5EIBD 4AZSA 1ZH6A 4WJLA 4X95A 4IDEA 3GFGA 4FFRA 1Y80A 4JUCA 4TMZA 4EZEA 1BGVA 4L0MA 4WOBA 4M89A 1H6AA 1YR8A 1W4AA 2ZUWA 3O3OB 4RDCA 3H05A 4KAXA 1XQ6A 1N6LA 1TF2A 3DPSA 1CP3A 1FVHA 4FMBB 3F9RA 4KN8A 3RVDA 1X1QA 1RZRD 4PS0A 2IYFA 3PYXA 4P32A 2O4UX 2TS1A 4WFQA 2XZTA 5TQ2B 1MG5A 2C4KA 1OD6A 4M38A 1GCOA 1JLMA 4RD3A 1CJVC 2RG7A 4YH1A 3S2SA 2QN7A 2Q4TA 5EJ7A 3D81A 4FE3A 1HFEL 4ZQBA 3S2ZA 4AURA 4KQWA 4BEVA 3CF4G 4IINA 1EDEA 1NQUA 4LJAA 1S2GA 4W1SA 2IEAA 3M83A 4QNMA 4BLRA 3OF3A 2VS1A 2WTUA 1CXZA 5AW9A 4PV7A 3VUFA 1H05A 1P5ZB 3K0SA 3L7BA 3BA6A 4US0R 1A4RA 3JYNA 5I9MA 1Z4JA 1T2AA 2HPVA 2J3DA 4FJ1A 4BV9A 1J2EA 2YDYA 3S2GA 4EY6A 4UUQA 1JEYB 2BSQA 1MGPA 1X77A 1IM5A 1XVTA 1I0ZA 3C5HA 3HDJA 3NHPA 1AF7A 2QLNA 4O5AA 4W1PA 2FK8A 2G77B 5IX8A 2B36A 2DG2A 1FRZA 4WOPA 1JV2B 1V8FA 4GM1A 3DBHB 4Y18A 5DNVA 4EI2A 4ZI7F 4HATA 3CEJA 5GP1A 4M9CA 4TRMA 2LBPA 2XAAA 5FPHA 3P26A 3D8UA 5HUJA 2CMHA 1QOZA 5FOVA 1Y4UA 1YULA 5B1IA 3HVUA 4Z3DA 2XD9A 3TOCA 5KYTA 1P1JA 2XNJA 3JWJA 3WVNA 1TEXA 3I61A 5KWJA 3U1TA 4A92A 1FUUA 1JDVA 4RTMA 1DFHA 4TVBA 5ES3A 2VJKA 2W42A 1OZAA 2SECE 3O0TA 3RBAA 2RAPA 2DT8A 3AHFA 5A5GA 4P3YA 2PJRA 5DSZA 4QZVA 1M0EA 1ZWLA 3CHYA 1YJAA 3KWLA 2HFKA 4K26A 1EFHA 3K96A 4ZVMA 3RVBA 3G6KA 1O8BA 2ZT8A 4N3GA 3ITEA 4OOEA 1SU6A 1JPNA 3ODPA 4Q1FA 1W59A 2XT9A 3UXEA 3GEIA 2C0CA 2H1HA 4GRAA 1T1GA 1T4CA 1YACA 4A6DA 3ICPA 4JLOA 3ILHA 3LQ1A 4GHWA 5ELLA 4PCVA 3IQIX 5I45A 1J2UA 3CCFA 3RC3A 1U8TA 3BXOA 4JLUA 3TLCA 1O08A 3P45A 4YIHA 1COZA 1EEXB 1ZVQA 1NNSA 2DCMA 4B47A 4NU5A 4B6FA 5D85A 3MTEA 5SY4A 4G5YA 1ZITA 4PLVA 3P7MA 4ZKEA 3D3NA 2P2GA 2GETA 4FGZA 4UBMA 4ZO7A 3U7IA 4BGDA 1HDCA 1ZJ6A 2XYHA 3V55A 1T8WA 4JELA 1U7XA 5T4EA 3WRYA 1ZOSA 5AW3A 1U0OC 2EFYA 3ROZA 3KCQA 2NZ2A 4UEKA 3SY8A 2ZQYA 3LIPA 1NBHA 2PEYA 1XI2A 4HZGA 1Q22A 4Y2JA 5I48A 2KM1A 2PX8A 4YJHB 2WILA 5JU6A 5JWHA 2CNKA 1L5VA 2WNSA 1JKMA 1ETUA 1JZQA 5AW7A 4TZ6A 2C9ZA 1RLOA 2ZWAA 1JLRA 1W49A 4KRFA 5FL7D 1NQOA 3E1GA 1JU4A 1LPAB 2QM7A 3Q88A 3V1NA 2GZMA 1U8YA 2CXHA 4HG2A 3OPVA 3QPVA 1E6KA 4J1NA 1SC3A 1Z25A 1G8YA 2HA7A 4LF9B 3B6MA 3LFHA 3VJMA 1GPYA 4JJEA 1FFAA 1NLMA 2V65A 4QQ8A 1OLUB 4UTNA 2J3LA 3LJKA 4ZC8A 4C0JA 3MUEA 3SE7A 1ODCA 1YDWA 5LUBA 3JVIA 5CA0B 1M33A 2Z8YA 2O4CA 2JKZA 4K7JA 3KHSA 1HFKA 4P4TA 2H2HA 1CJKC 1D2EA 1KY4A 2X8WA 2VUTA 4EATA 2FJUA 3VYUB 5G02A 3CLSD 4DV4B 5DN6A 4K46A 1YOVA 4TZKA 2J5RA 3H1GA 3BEDA 3WO1A 1PJRA 2AJCA 4B79A 5EJ8A 3P9QA 2GM4A 1MJGM 4YCAA 1PTKA 2PKCA 3I2IA 4MPJA 5I4KA 5IT0A 1E1MA 1YB2A 2VBIA 4DV3B 4FR2A 1Y8RA 4CGYA 3A2NA 1R4NB 1JFLA 5JSYA 3LHKA 4FDMA 4DMFA 2IXAA 3WB0A 2GPAA 4BC1A 1VGQA 2PMBA 5M04A 1GA6A 2P62A 1KMHA 2CB0A 3Q9SA 5LC1A 4ER0A 1R4MB 4KXYA 2NXEA 5F4BA 5JRDS 1II8A 3FUUA 5AI5A 2QHXA 4MV6A 4ZI7A 2HU8A 5FA6A 3ANYB 5IMBA 5IT5A 1C8LA 2P1DA 1ZR4A 2PX6A 1QRSA 2W2TA 2P2CA 3E9MA 3G0OA 2ZXUA 3LRTA 2F17A 4ALLA 5K3CA 2HSZA 2IRWA 2WMYA 1TJ5A 4HB2A 2YXEA 4OQFA 1F17A 4PCLA 4D6XA 4F8EA 4CF7A 2R8RA 4TTQA 2HK7A 1L4LA 2O8FA 5HIMA 2Z3ZA 2PVPA 3MW8A 1PEKE 3STHA 1Z6ZA 5C51B 5IJAA 2XLBA 3TG2A 2XAUA 1OFHA 1PKEA 1ZLXA 5EUBA 3ESQA 2Q5QA 4W5QA 3GFTA 4PZUA 3I2KA 3HJAA 5JZBA 1XQWA 3Q2OA 4D8YA 3ILXA 5AW5A 3ZDYB 5EWJB 1A8HA 1PEAA 2WJYA 4B40A 2XOKA 2ZAGA 4IJ5A 4YN3A 3AERB 3DJYA 4M9RA 4LF4B 2JEZA 2AI2A 4O0LA 3ETEA 5ECWA 4ZVOA 2H16A 5KQPA 2JIPA 4OJNA 1EX1A 5E38A 4WBNF 1I2CA 4MGZR 4K6FA 3ROEA 2YFQA 3C5CA 3HVRA 4Q3DA 5FTKA 2PRJA 3SS7X 2MSCB 5AKKA 2ALJA 4A0FA 2H1FA 1ND6A 1IG3A 1XZQA 4OQEA 1Y1QA 1E5QA 4C06A 1U0FA 3G0GA 4P22A 3MWKA 2CNDA 4G6ZA 4LHXA 3RYIB 2VPIA 4FI3F 2J9GA 1M1YA 4HVTA 3TTSA 2XEDA 3B20A 2I99A 3FPFA 3SKYA 2FPGA 4Q7QA 3NB0A 4ML3A 3H1EA 3N7TA 1J7KA 3HB9A 3WRXC 1SUFA 1DXYA 2C99A 4PX9A 1A8UA 4N9QA 1F7UA 1DAHA 1RMTA 4WUTA 4YP6A 2RH4A 1QX3A 1KVUA 3X43A 5EWMA 4C7KA 3U16A 1W5EA 3Q8WA 3A1UA 3A8TA 3KSMA 2MHCA 3I0ZA 4DANA 2P2DA 5EHXA 5FWNA 3QFRA 3LPMA 5KYYB 2CMKA 2YMMA 3CUKA 1HDRA 2GVNA 1A27A 3U4MA 4XYLA 6LDHA 2QLFA 1F4VA 3UMGA 4DR7B 3CLUD 3OQHA 4Q6BA 5C34B 2JS7A 2BGWA 4YXWA 3D7NA 3O8DA 1NPTO 3PXCX 2GNPA 3L8GA 1BDMA 3ZBQA 3WGTA 2RHWA 2PM8A 4C3ZA 5HRAA 1SG6A 2W4MA 5K6AA 3KALA 4Y2GA 4PEVA 2WWFA 5C8YF 4MKIA 2QTGA 5C53B 3ZHSA 1ADGA 1E9EA 1YMVA 3LV8A 4KYVA 1USGA 4CZ2A 1CX9B 3SVZA 3WKDA 2VA8A 1T24A 1M2VA 1YRAA 3EAFA 2PL5A 1QFJA 4GUDA 1WZEA 5TQVA 2OZLA 1P0CA 3KL4A 4QRHA 3UEOA 1QB7A 2DECA 2ZRGA 4BP9A 3TTVA 4DCPA 3TZHA 5BUQA 4RK4A 1M75A 2DR0A 4AKGA 1R2QA 3P5BA 5CVJA 3PC3A 5FOWA 3CZQA 3RREA 3DEHA 2FP4B 3NKVA 2QP4A 1LZLA 1OAKA 1B2RA 3L8FA 2YJ3A 1B2LA 4R8MA 1CRZA 3VR6H 4K0KB 4OAQA 1KFBB 5BXYA 5KMGB 1H5UA 1SOWA 3CUUA 1MH9A 4IUDS 2EWWA 4Z9FA 4RPGA 5J23A 3K15A 1T3HA 2EAUA 2GRUA 2P3LA 3ORSA 3BS4A 2DFDA 1JDTA 4G4SP 2E1RA 2PRKA 4GE0A 2AWNA 3OPYA 4YT5A 1SXJE 5F52A 4AUMA