1K2VN

E. coli periplasmic protein fhud complexed with desferal
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
262
structure length
262
Chain Sequence
AIDPNRIVALEWLPVELLLALGIVPYGVADTINYRLWVSEPPLPDSVIDVGLRTEPNLELLTEMKPSFMVWSAGYGPSPEMLARIAPGRGFNFSDGKQPLAMARKSLTEMADLLNLQSAAETHLAQYEDFIRSMKPRFVKRGARPLLLTTLIDPRHMLVFGPNSLFQEILDEYGIPNAWQGETNFWGSTAVSIDRLAAYKDVDVLCFDHDNSKDMDALMATPLWQAMPFVRAGRFQRVPAVWFYGATLSAMHFVRVLDNAIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Ferrichrome-binding periplasmic protein
publication title X-ray crystallographic structures of the Escherichia coli periplasmic protein FhuD bound to hydroxamate-type siderophores and the antibiotic albomycin.
pubmed doi rcsb
source organism Escherichia coli
total genus 80
structure length 262
sequence length 262
ec nomenclature
pdb deposition date 2001-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 1k2vN02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 1k2vN01
2R79A 4TKVA 1KARA 4XPIA 3HH8A 3PSAA 4NNPA 1KAHA 1G21A 1XVLA 4WN9B 5FLYA 3TNYA 3AEUB 2WHYA 5BVHB 3NU1A 4K3VA 4LS3A 4MX8A 3MWFA 1N4AA 2OGWA 3K1AA 4WN9A 1N4DA 2PHZA 1PQ4A 4TKUB 3LI2A 3AERB 1QH1B 3ZTTA 1TOAA 2PS0A 5M29A 3ZKAA 5GGYA 5BVGA 2AFIB 4OXQA 2XQVA 3BE5A 4UDNA 5KOJB 2XH8A 2OV1A 4LJSA 5CX1B 4WNAB 1QH1A 3AESB 4TKVB 4HMQA 5AFSA 5KOJA 5JPDA 1G21B 5M34A 5M2QA 2PRSA 2XDQA 1M1NB 3AESA 3R5TA 1H1LA 4B8YA 3K1AB 5CR9A 5B58T 4CL2A 3TEFA 1M34A 5M3BA 4MLZA 2ETVA 1M1NA 4OXRA 2PS9A 3HJTA 5BVGB 3G9QA 4PAGA 5HX7A 3ZK7A 4UTOA 1M1YA 3PDIB 2XY4A 2Q8PA 4WESB 4WZBB 4BBPA 1MIOA 4UTPA 4GICA 2XDQB 1QH8A 1H1LB 3PDIA 4WESA 4WZBA 1M34B 1K2VN 2Q8QA 3CX3A 1L5HA 4NNOA 3ZK9A 4INOA 4DBLE 1G20B 1FP4A 2WI8A 4ND8B 3LHSA 4G07A 2PS3A 4MO9A 2AFHB 1G20A 4G09A 1N2CB 3GI1A 1M1YB 4INPA 4ND8A 1QGUB 1MIOB 2OV3A 2YNMC 1K0FA 2AFHA 2R7AA 1QH8B 1N2CA 1N2ZA 4FI3F 4H59A 5KHLB 1KAEA 1K7SN 3AETA 1QGUA 2YNMD 2OSVA 4MDYA 1L5HB 4N01A 4FILA 2O1EA 4M7OA 1FP4B 3UJPA 4HMOA 5JJ5A 5I4KA 2X4LA 4OVKA 3MWGA 5HDQA 3AEKA 1PSZA 3R5SA 1K75A 3MD9A 2M6KA 4IRMA 2XV1A 5KOHB 3MINB 2QI9F 2MINB 3AEUA 4UDOA 5BVHA 3U7QB 3AEQB 2XUZA 5KOHA 3MINA 3AETB 3ZK8A 1EFDN 2MINA 4FKMA 4HN9A 1ESZA 3EIWA 3MFQA 3AERA 3AEQA 4TKUA 2M6LA 2RG7A 4WZAB 3U7QA 4PM4A 3TLKA 3BE6A 3PSHA 2AFIA 3EIXA 4XPIB 4HMPA 4FNAA 5CX1A 5GGXA 3AEKB 3HXPA 4WNAA 4H0FA 5JG7A 4WZAA 5JOQA
chains in the Genus database with same CATH superfamily
1UBHS 1IPFA 4XPIA 2XNDD 1XVLA 3V1LA 3C5VA 1EWQA 4ZEXA 2C9DA 3L8FA 5A7HA 4B8WA 2WSMA 5CXSA 3V5NA 4BLSA 2QAGB 2PRIA 2GRAA 1GIAA 3ZE6A 3OFJA 1U3VA 4CDGA 4EQ6A 4GQIA 2ZRHA 3EZFA 4QC2A 4W7IA 3A14A 2DJ5A 1CZOA 5DTEA 4GBMA 1L5VA 5HRUA 1SNYA 1GPKA 1UFQA 3QIAA 1G6OA 2XWJI 3QMPA 2OR3A 3R4CA 1D2EA 1X42A 3UH0A 2ZSBA 1X80B 4DLTA 1RADA 2FFJA 2WAXA 2ST1A 3NEAA 2D0DA 3GUVA 4I0WB 2WE8A 5HCNA 5IYZB 1B2LA 3ZX4A 3C1AA 2AMLA 3KB2A 5AKXA 3TW8B 3N6VA 1GGEA 2MSWA 2WWIA 4M98A 4R3WA 3DKVA 1Z12A 2XKBA 3DCYA 5DGTA 1A82A 5IW8A 4BVBA 1YRLA 4V0QA 3RS7A 4BNFA 4X71A 1NVTA 1VYTA 1H8EA 2XOEA 2ACWA 3K1TA 4AYXA 2BV3A 4FYXA 3H1AA 4R1LA 4X97A 4Z2YA 1N5DA 2IUSA 4B6PA 3DOOA 4ZHQB 2YWHA 3WZMA 5FAKA 3TRIA 4IZHA 1UJMA 3SS7X 1RXIA 2EEPA 2P2DA 2QROA 2WG2A 3OT1B 3SXPA 4EBBA 1SBNE 4ZAWA 2PAAA 4C2UA 1YIOA 2XY4A 5CYGA 2CY0A 1PG5A 1T5TA 2H51A 5M04A 2VT6A 5CYOA 4FGLA 4PZLA 3WGQA 2BFDA 1UFVA 4QWMA 4I99A 4ZOLB 5HPYB 1Q1ZA 3G8DA 2IS6A 3VUEA 4WERA 2QL5A 5ALYA 1G38A 1B8NA 5DX1A 4M0UA 4ID3A 2DFNA 2IX3A 1I5EA 1NE7A 3DZCA 4YRRA 1X3LA 3RHZA 1VM6A 2FKAA 1QV9A 4ND4A 1QGAA 3QPCA 3WNZA 1E9DA 4JT4A 4XVCA 2O1SA 4K1XA 3KLOA 5F4ZA 5LQAA 3F8TA 1UQUA 4E2XA 2JLXA 5DCUA 1EM6A 1L4LA 3V4LA 5B3LA 5FEUA 2I29A 2ZCVA 5HCIA 1SB9A 1EB9A 1E3EA 3B48A 2GJAA 4DZZA 1JPVA 5JNRA 2VPXA 1GITA 1NVXQ 4X1OA 3IULA 2CJPA 3ANTA 1QBKC 1ONNA 2XTZA 3NBUA 1RBQA 1WLYA 2FX2A 4C1NA 1TA4A 1OZ0A 2P4QA 2CUZA 2PD3A 2ZBPA 1D8TA 4RENA 4QOIA 2YMQA 4ND7A 5DBGA 3AUFA 1NQOA 1MDBA 1XTIA 2BMVA 2ZCUA 3E84A 5DHAA 1VPTA 1OXSC 2Z6VA 4BWVA 1BOFA 1QOZA 2YXDA 1UBJS 2QZZA 3VYRB 2H1RA 4QDOA 1SWVA 4RM3A 2HNAA 2I9PA 4DSUA 1G291 1VI6A 3LVRE 2G5CA 4BGIA 3G5UA 1FPQA 2WHPA 3WIUA 1SCUB 4KX3A 5HKOA 3SQMA 4AMZA 4F96A 1XTKA 2FJ0A 2I7DA 3FWHA 2ISSD 1VZ3A 4BJHB 1CLUA 2XODA 4RVGA 1JAYA 1MVNA 3EEIA 2GI4A 1N9KA 2C0QA 2M1XA 1PFGA 4I3GA 5AVVA 4CQLA 4IDDA 2ZYWX 4D3YA 3N0VA 2DX7A 5LA6A 5DISB 3O8CA 2RGCA 3ZG6A 3DD5A 4YXFA 1K7YA 3EY9A 4FD3A 5A5EA 3VPHA 3UKJA 4QUEA 2Q8NA 4QJIA 3U3MA 1HC7A 1N4DA 1X1QA 4X7PA 2PRYA 1U7PA 2HTFA 3MPUA 4L4SA 4RBNA 1KEPA 2EYQA 2QP3A 2WZQA 3HCBA 4N4AA 1N7IA 2V9CA 1EHCA 3WIVA 1U28C 1JWAB 2HJ9A 3C3WA 4Y6PA 2HU8A 3GMSA 4C7JA 1DFIA 1FJGB 4EYOA 4EIWA 1AA9A 5HKLA 2NVOA 4NZZA 1TM5E 5L3VA 4B32A 4BQFA 1GGNA 2WP8J 1QXSA 2OQ2A 1HUQA 2FPMA 3VNQA 2GZSA 4J03A 4FZJA 1P62B 1R50A 3R7AA 4RQUA 3IUQA 4UVEA 1WB5A 5BOSA 4JEIA 2B35A 2IT1A 2HK7A 2G77B 4CKEB 4AMYA 4IXDA 2HMWA 4RSRA 4WMLA 3KT0A 3EPRA 1PR2A 1EK1A 4OI1A 1I1HA 2H3EA 4WI1A 2PJDA 4KPYA 5F3DA 2GF9A 2VT7A 4FWBA 5AHXA 1GTL1 1U0LA 1GDHA 1UPCA 2G5GX 1FDWA 3THSA 3ONNA 1ZNYA 4C78A 1CSEE 3CA8A 4WVLA 1DRUA 2VJCA 1U1GA 1T3GA 4OI2A 5AKLA 3V1UA 1IB0A 3NAZA 4H3VA 2J3IA 3OJOA 4NU5A 2NZJA 2P4SA 1TKBA 3LT2A 4UUPA 5I8PA 2GQ0A 3EXHB 3FBWA 2ATIA 3WISA 2JGNA 5LQRA 1OLXA 2ZWMA 4BU0A 3VKHA 2PL3A 1P7YA 3ZQKA 3ZX5A 2GUWA 4MV8A 3G2QA 1ZVJA 1SBIA 2WKPA 4QTUB 3NGXA 4DUGD 4HNHA 5CA0F 4AF7A 5KTRA 4GC9A 4Y2RA 1SXIA 1J0XO 4OJTA 3ESZA 4RL4A 5FNZA 2W11A 1Y3CE 5E4FA 4YREA 1SUCA 2J0UB 3OESA 4RPLA 1T8YA 1RXVA 4WK0B 4YAFA 1NUQA 3GJTA 4BYMA 5LDHA 2GN0A 3VSEA 1SUAA 3IEUA 5A2GA 1H8ED 1CR4A 4PSVA 10MHA 2D54A 4GRDA 3TOCA 3H1GA 1OWMA 1Y6JA 1DXHA 1RLIA 2VHWA 4CF3A 1MHTA 4UCWA 4AG5A 3O4RA 4GT1A 1RT9A 2O3TA 4URVR 4MUJA 2QMHA 3ZWNA 1HFWA 2G9NA 1XELA 2ZSJA 2FUCA 4MYHA 2QY9A 4GSLA 1C3JA 4PIMA 4BMDA 3NB0A 4BQSA 4PCVA 4EOGA 2JVKA 2DJIA 3D4BA 3U7QA 4NU8X 1G3RA 5AKJA 3EEOA 1MW8X 3C3EA 3WFJA 5ITSA 3KZCA 1CY7A 2P5UA 1IH8A 1WF3A 2WFAA 4MGEA 2ZANA 3ANSA 1LV8A 3TAHA 4DJTA 3AJAA 1BZYA 1A8HA 3ZJ4A 4B4OA 2IU6A 3WWPA 4Z6KA 1N6HA 2VDWB 1Q1AA 3HA5A 4JXJA 4Q5IA 1EWTA 1KQPA 5F2NA 5AOAA 2C92A 5CLGA 2RC5A 3HI4A 4DKJA 3PEVA 1BX3A 4JUDX 5DCWA 2FG6C 3GLFE 2C3OA 1Q7BA 4YV0A 4MUBA 3SIPA 5HF5A 1L1QA 1N7HA 5DT9A 4W6ZA 3V8MA 5ESRA 1BS2A 1TQ4A 4I55A 1TADA 1T4BA 3QHAA 2VF7A 4GYWA 4JQOA 3WAKA 4DEVA 4BMOB 4U39A 2YQ4A 1PQPA 4BVKA 2HPHA 1Y3HA 1M6VA 2BMAA 2WDZA 1G64A 2W9XA 5HMLA 2IIQA 3JTEA 1LDNA 3NEYA 2AKAB 3INGA 2ECPA 3EEFA 2QVLA 4KIFA 2HM7A 2JCVA 4U4AA 4UMEA 4KDEA 2B6HA 4DG8A 3C7KA 3X1JA 1DU4A 3K0KA 1EXMA 1B6RA 2DPMA 4TMKA 4YAKA 4YK7A 2WG0A 2W2KB 4FMBB 3VTFA 2XGSA 4C7VA 3H7IA 2YMLA 5ALGA 3U3JA 4YR9A 1AMUA 4TSFA 3TSWA 3G0DA 3ZWMA 1CUAA 5AW7A 1AIPA 1KR2A 4ZYUA 2X1VA 4ZO6A 1QLWA 4PC6A 2G82A 2IUYA 3GMDA 5DBOA 4MQEB 1DUIA 3WIBA 3C3KA 3HDVA 4IIBA 4DR5B 1MX5A 1SXHA 1VL8A 3DUFB 4XWTA 2HGSA 3Q41A 1PL0A 3RK1A 3VC1A 2RBEA 5KWSA 1XNJA 4QU9A 4WT7A 4WLFA 5FUXA 4M1SA 1CUBA 3IXMA 3WBFA 5KS2A 1J5EB 2DETA 1N77A 5FPHA 4JI4B 3V8VA 2VK2A 4LZAA 4X20A 4DJDC 4TTAA 3SS9X 3OZDA 1IJEA 2YIVX 1C0LA 3BRSA 3SPXA 4KN5A 1NBIA 5FBHA 2OCBA 1YL5A 3QU2A 5IEBA 3TZCA 4TLEA 1DCKA 3RPEA 3T34A 3F96A 3TZ6A 3WG9A 3WL6A 3IVMA 2FDXA 2DHEA 5GQSA 2QX8A 4L0CA 2YJ4A 2L0XA 2D2IA 4YS6A 2H65A 3UANA 1A5TA 3TLMA 4IHAA 1EK6A 4EQZA 1V0JA 3AMVA 3HP1A 1RR6A 4LWZA 3CS3A 3MGKA 1M2OB 4PLYA 4H7IA 2XVAA 4FJ1A 1UCFA 4B40A 1JH9A 1BX0A 1NVUQ 1IFXA 3FMVA 2RK4A 2HRZA 2RAVA 3T54A 5KSZA 2PYIA 2H9YA 2WKWA 1POXA 4OMCA 4MA0A 4R54A 2PH7A 3ZHYA 2IDKA 4KGVA 2PNJA 5HUJA 5I4KA 2UYHA 2B9VA 2UYCA 1GXSB 3NH6A 5LOVF 2VJDA 1I4TD 1M2NA 3IBTA 3OA2A 1C1XA 2PDAA 4TMFA 3I1FA 4PXAA 4R3NA 2FOLA 3FHLA 4ESOA 2IS4A 3F9RA 1F0PA 2EYUA 4KODA 1CDDA 2FE4A 4PS0A 4TS4A 2AX4A 4FHFA 2WNIA 1HRKA 1K3TA 4OP3A 1QRUA 3NAMA 4FFSA 5KQGA 1NXQA 3OD1A 4WZAE 1FFAA 1RWWA 3CR8A 3O6VA 2NU7A 4I4TF 1ZOIA 2EWMA 2DZDA 3HRIA 1W36B 4IJKA 2O2XA 3SHFA 2B4YA 2V65A 2WA2A 4IDCA 2Z9DA 1F3LA 2EJUA 1U5AA 4B80A 5E9QA 1ABBA 3F67A 4XIGS 1KTVA 1PJ4A 1IZ7A 4J0QA 1JHZA 1KGDA 2WIAA 1KFCB 3C6YA 4TXHA 1VHWA 5BN1A 1L8QA 1I32A 1QRDA 2EFYA 4IL5A 5JPCA 2FPPB 1FC0A 4HQFA 1VG0B 1Z0UA 3GJXC 2V7EA 4HH4A 1K6EA 2C04A 2P62A 4BYGA 1A5ZA 3GLFB 5MHTA 3K09C 2VF2A 4D81A 2QOEA 1QFJA 3GGOA 1I01A 4IIEA 2GCGA 1UFOA 2W4IA 4QTZA 4U7GA 3M83A 4YRMA 3NJRA 5AOBA 1KDYA 3QKRA 2E4VA 3A1VA 5CDFA 1W2WB 5AXAA 4EKGA 1MKYA 1VKOA 3ZLBA 3RWMB 4HB2A 1VKZA 2O07A 5F21A 1UP7A 3Q3EA 3UJ9A 1LK7A 1TZ2A 4HSEA 3AP3A 1QDEA 5B4UA 5BSEA 5JS1A 2CNOA 4TXJA 5I45A 1FMLA 4MHOA 3HABA 1OFIA 2QRVB 3LGSA 1ZG3A 4A73A 2X1LA 2FSHA 2OZLA 3OY7A 3NBXX 5E4JA 3FN4A 4MP6A 5CFPA 2Z4RA 3H8WA 4G1FA 2QD2A 1V41E 2PMDA 4OP2A 5LZ5A 1FYEA 2VAPA 4I3FA 4G5HA 2XHEA 1VE7A 1TA0A 4N3GA 2RGRA 1QFYA 1FP6A 4MW7A 2ZTLA 1NY6A 1Z0ZA 2WFZA 5AK0A 4POOA 2PUDA 1E77A 1KFBB 1QIMA 4HGNA 2E85A 2R3SA 1ZIDA 3FDIA 2H4HA 2VP5A 1OFUA 3ADKA 3P9PA 3QY0A 1SOMA 1Q21A 3B9BA 4BASA 2V1UA 2G63A 4RDXA 4J43A 3DBLB 2N1BA 2NLOA 3N05A 3KZOA 4JODA 1M2VA 1FXWF 3HCEA 4H7JA 3REOA 3C3XA 1CUZA 4MW2A 1ZM9A 5JD6A 3ZWOA 4CFZA 3ABRB 4XVRA 2N42A 2YRFA 2I2FA 2SCUB 2I3AA 5DP2A 1W9HA 4KXLA 1UK8A 3TAXA 4X00A 2YHSA 2YVQA 5E9AA 4UKDA 1M2KA 3VISA 3N28A 4CU5A 1G4HA 1X2EA 4B6GA 1F60A 4LMAA 4ZMBA 5GVRA 1DRJA 1O6FA 2XMZA 3EVAA 3ZHTA 2OAP1 4HDRA 5K8CA 2F8SA 2GKSA 3ILSA 4IXWA 1DJPA 3NYRA 4TSFD 2J9ZB 3I9LA 4NBSA 4UBKA 4IEFB 3W5UA 4HWSA 5U4XA 1YZ3A 2HDNB 4IMPA 4A6PA 1Y34E 4PRLA 2Q41A 1Z07A 2R6FA 3BWYA 2MYUA 2PZ8A 2ZT7A 4GSKA 4HDMB 1HDEA 3CX4A 1AQUA 3ADPA 3HKEA 1WO8A 4IZOA 1PGQA 4OLBA 3E2MA 4KQ6A 2CXQA 4JYBA 2P9GA 3BMQB 2BZ0A 3FSJX 1NFQA 3HFRA 4WFIA 5BN3A 1OI4A 3ZBPA 5C3MA 1E5XA 3EUAA 3C5WP 1ICIA 5AJYA 1KR5A 1Z4PX 2QW8A 3TH5A 1SVSA 1BEEA 4LQ4A 1CP3A 2WJPA 4WZAB 5ALEA 3ESBA 3M3DA 5KYNA 3BE6A 3B6ZA 1GTZA 3L02A 2AUNA 4O6VA 5EP3A 1JV2B 4LN1A 2FDCA 1Z6GA 4NV0A 2G6BA 3RRNA 4CF5A 5I8WA 5EPOA 1VIAA 1UDCA 2WYWA 3DUWA 3BH6A 2A4KA 4DNFA 4DV4B 5E3IA 2RAPA 3ONVA 2VH5R 3NU1A 4CG0A 3GEDA 1QTIA 1YJQA 3C7DB 5JS7A 5FTLA 1AXRA 5KPJA 3KIPA 2FSSA 2QD5A 4F12A 3O4IA 3B12A 3IDQA 2Y0DA 3RT9A 9LDTA 3RUEA 1DFHA 1NW6A 3MAJA 2UU9B 3SQWA 4PCUA 1E2IA 4QDTA 4PIPA 2ZFUA 4DMLA 2Z6UA 2AOXA 2QV7A 5AKKA 1F7UA 4U2GA 2Q6VA 4MVYA 3U44A 4IXMA 5CFOA 5T5QA 2R2GA 3PF8A 3AHDA 4TPKA 4F8EA 5KMGA 1WDMA 3C45A 2UZ0A 3K0FB 4UCQA 1Z4LA 3VC7A 4C6TA 2VAXA 3UV3A 2BP7B 3Q5EA 2P77A 3L1VA 2O8DB 4RD3A 1O5TA 4MI1A 4HNTA 1G3MA 3SAJA 3Q3CA 4IDNA 4F2PA 2IUUA 3UGKA 5G2OA 3I5XA 4FHDA 5IF3A 2YIMA 1BG6A 1GTVA 2OFPA 1FNMA 4CLRB 3KV3O 1SUFA 1N6LA 3WLAA 5LIPA 3ETHA 3CV3A 4RFVA 1H23A 3T1NA 1NZFA 1QR2A 1EJ6A 1RZVA 5HX7A 5LP6F 1H9CA 1ZGHA 1H0KA 5AVQA 1GUZA 4KSBA 3EXG1 2KM1A 1OLSB 2EIXA 5FQNA 4ZO9A 4E5UA 5B64A 5T4HA 3GFTA 3SEZA 3BXPA 1JR4A 3VNSA 2XMRA 3AEYA 2IVFA 4I1VA 1W6RA 1B76A 2ZKLA 3E48A 2GO1A 3IJRA 1PGNA 4G9GA 1XI2A 4J7CA 4LSMA 3UW3A 2I3GA 4E03A 1S5PA 4N49A 4WBNB 4UMFA 5K09A 1TQ6A 1JFLA 1AMOA 3HPRA 2XXAA 3FPKA 4QAJA 1KZYC 3ROZA 4HFRA 4KPUA 4EF4A 1TUBA 1S4MA 2RGXA 4RKFA 1T8RA 4E46A 2J7KA 2D5LA 3V8PA 5C8DA 1N92A 4HADA 4ARSA 2H1SA 2GXAA 3OG9A 1MD9A 3GB9A 2IV2X 3R7WB 5HUHA 1ONOA 3PHCA 5DP1A 3DOJA 1TA9A 3BXZA 3D9QX 3ZH9B 2P6OA 5BMVF 1QIGA 2R4QA 4KUHA 3JQAB 4RABA 4AN1A 1FFXA 4Z0HO 2QBYB 4FGSA 3QENA 5DXJA 5T3YA 2BGWA 5AWFC 4RSMA 3ZCTA 3TRKA 2HPVA 4F9GA 3DTNA 1JSLA 3F9CA 1SUIA 4ZO8A 1SOVA 2Z3WA 5B58C 1KZ9A 3I1JA 4FOLA 2ASEA 1YZTA 4JJIA 4IUYA 3H9UA 3BEDA 2E21A 3AEKA 1T0UA 3PZRA 1IBLB 3IP5A 3FTCA 3IA7A 2F17A 2VSNA 2ZSEA 1ZK3A 1JDVA 1OXUA 2NU9A 4Y1GA 3D6HA 3B1KA 1HQDA 2H52A 2V6MA 2DBQA 3BCRA 3M5WA 3MWLA 3NEJA 3OZEA 4FE3A 3UMGA 1HTWA 4M0DA 1WM1A 5ECGC 3WK6A 1E1QA 2ZJ8A 5LQJA 3IODA 1C7QA 5LYJA 4MQFA 3GCWA 1SBZA 4RHYA 1WCWA 2FQXA 3UICA 4YV7A 3B3JA 4J7UA 2B4TO 2LR0A 1OV4A 1B15A 1YR6A 2H4XA 2HY7A 2IZ1A 4DDVA 1ULZA 1Y4AE 2AYZA 4JLPA 3EIXA 3OU2A 1WV1A 4BB5A 3QHQA 3T5TA 5THXA 4EGQA 4BMXA 3RTCA 1AV7A 1TM3E 1Z4JA 4ZEOA 4K6FA 1KAHA 1KYWA 4U2CA 3HU2A 3R7SA 1L6IA 4JLWA 5FFMA 1RQNA 3CWZA 3BCUA 1IXRC 2KMLA 1QZ3A 5TGTA 3U5ZB 1VBFA 1CQZA 4N7BA 2I99A 4ZODA 1LI7A 1WHTB 3HKCB 3WJ1A 2QYOA 3A2LA 3LPLA 4EJ0A 3KYIB 5ICFA 1TYEB 1E1CA 2FPKA 3HKBB 4XRRA 5BO5A 1E8MA 3IR5A 5C1BA 4FHGA 1NN1A 3IT2A 2HIMA 5DPMA 1EGQA 3V2UA 3TX6A 4UDNA 1GTG1 3RUIA 5KC9A 3NDIA 4LJ9A 4HDKA 4JVLA 3ZBQA 4KFRA 1SCNE 3B1FA 4YVFA 3R5HA 3QQPA 3TJZA 5KOJA 5IPFA 2C0PA 1A1SA 4OLFA 4DQXA 3FB1A 2EV9A 1P81A 9ABPA 4UD2A 1XD8A 2JAQA 2C9OA 1O6CA 1VYUA 4OA8A 4FR2A 1JIIA 1UPBA 3GLHE 2VDOB 1IY0A 5EZYA 1TJ3A 2ZTVA 5JJIA 4FGZA 1BXZA 3IXLA 3G8BA 1JEDA 3RFUA 3SDZA 4WCFB 2CEAA 1DWOA 1PO7A 4Q12A 5LU9A 4MMYB 4MTCA 5IU6A 2V7BA 2ZQ5A 4WNCA 1MC4A 1W87A 2O8EA 1U90A 4ZGBA 2HW8A 3X0DA 1SD5A 2LD4A 4MGKR 4R9NA 1ZP6A 2NTVA 2YDYA 1JSXA 5HXAA 1MMFB 1VIDA 3O4GA 5LYYA 4YIHA 2UYGA 2R7KA 4QUDA 3UCFA 2HSZA 1W85B 1G4UR 2I76A 2QE7A 3DC7A 2OBNA 3PFGA 1QJ4A 2OLEA 3A4NA 1W8IA 5DN9A 3U4AA 1R8QA 4QT0A 3SIWA 4COKA 3L8EA 1A5SB 2VHCA 4RK1A 4YLEA 3RSCA 1QYWA 1I2ZA 3KVRA 2B69A 3V1NA 1XMXA 4G0OA 3WICA 3WZ2A 4YRAA 3QYFA 3VMFA 1AQYA 4OEHA 3UTCA 3UOWA 2IXDA 4N41A 3GLIA 4CEHA 3OPQA 3E81A 4BTLA 3U16A 3V80A 1FW8A 5G02A 2ADMA 1JHXA 2AEEA 3JW8A 4A8TA 3K9GA 4K9RA 2PZMA 5DTMA 1NHWA 3GRPA 3CJRA 1ORHA 5SY9A 1TJPB 5LZ9A 3L9XA 4YHHB 5C7OO 3TBHA 2PX4A 3ESCA 2Z43A 1YA4A 2FRDC 4O3FA 1YGYA 1CIPA 3GHHA 1USGA 1ZN9A 3KWMA 4MW6A 2D0PB 4DXAA 2GEKA 5H9VA 3W2GA 3JQEA 4HD8A 3KS9A 3SEAA 2QTBA 3SLKA 5BW8A 2XE7A 3TIXB 2E82A 2JFGA 5A71A 4R3UC 1EFVB 3ZLTA 3SDBA 4Z4CA 4MKFA 2OTCA 1V16B 5GP1A 3BS4A 4WECA 1LV7A 5DX8A 2AJTA 3ZXIA 1XZJA 3QW2A 4OB8A 3VBCA 4ZIRA 4OREX 4KGDA 4QDJA 4Z7JA 3TFWA 2NSHA 1WTCA 5KSPA 1NYRA 5EGNA 5IVIA 4PEVA 5HRAA 4TQ9A 2WUGA 3I9MA 4DLPA 2RGEA 3RUCA 3HWSA 2GCEA 2JLWA 1YRBA 1N6IA 4GKKB 2IXGA 3O74A 1Q7GA 1C80A 2ODWA 4FQ8A 2C8KA 1PEKE 4RIHA 1XZGA 1AZWA 1VPDA 4Q3EA 5GONA 3HKDB 1IWPB 2V5VA 3KUDA 1CZHA 1IXZA 2HK6A 3L7MA 1TTTA 1QNLA 3TLGA 3LQ2A 3VOSA 5DSTA 5BY2A 4DMKA 4NEQA 4R8MA 1VP3A 1Z6TA 4BN4A 2HA0A 2YHIB 5LL6P 2FSVC 2B5OA 1JZQA 2DHCA 3FZYA 1GLGA 1LCIA 2X9QA 4X64B 1JIKA 3I92A 3ITEA 2WZCA 1H9BA 1KI9A 4IV0A 2H8GA 4RTSA 2HPZA 1NJGA 4JEUA 2R47A 4KACA 5CH5A 4F5YA 5DN6D 5JW6A 1DC8A 3RRYA 3KHUA 1BGXT 4NV1A 1E1QD 1G2PA 2G70A 4LI3X 1ZH0A 2VJKA 4RTMA 4BKRA 1B74A 2VS1A 5JSZB 3DL7A 1DLJA 4HWKA 1BWPA 1DRWA 2BMJA 1FTNA 3PC3A 3KHTA 4LSGA 3SSNA 1FUEA 3SS8A 5BV0A 5J4YA 1C50A 4EVQA 5IYZA 3HJTA 3TRHA 1D0IA 1AGRA 1OAKA 3LCJA 3GLHB 1OH5A 5CEEA 1OILA 2JHAA 1B6TA 1UMDB 1H4SA 2C00A 2OHIA 4DV6B 1YE5A 2G0TA 1BW9A 3GVPA 1SEPA 1C9JA 1DBWA 4JVMA 4CM6A 1HETA 1A97A 3IELA 1JB9A 2CN1A 4Q1BA 3M7IA 3PGMA 4WA8A 2W2TA 4DQDA 1Z13A 1G2QA 3GZ4A 1YRYE 3TTSA 1HDOA 4ZVSA 2Q8QA 3Q15C 2VWPA 2G83A 1KJZA 1XVVA 3IAS6 3OOYA 3UA4A 4BO0A 5JFGA 1TO2E 1HE1C 1YR7A 2JGDB 4RZSA 1ZH4A 1GNQA 3PE4A 4BQQA 3QP9A 1SVUA 1MO6A 3ABIA 1LPMA 4GO1A 2W6ZA 3P4UA 1PK7A 1RQ7A 1XLWA 3FOZA 4KHPB 3SOPA 2HWUA 1LC3A 5HFNA 2B2NA 3CHYA 1XTZA 3NLLA 1OT3A 4YB8A 5TGDA 3B53X 1RQGA 1YV9A 1ZMRA 4ML3A 1JAIA 1TT5B 2BI4A 4YCCA 4S1PA 2YN0A 1XEWY 4N5MA 3GEEA 3VXKA 4E11A 1UKBA 4N65A 4KN9S 1XCJA 2PUWA 1RLMA 4V39A 5EIHA 2C96A 2DR0A 1KMIY 3GRAA 3O7MA 3EOAI 4ZQFA 3RVPA 3WGJA 4JKYA 1ZAKA 1HORA 2QQ5A 2WJ4A 2QMEA 4MMZB 4M0CA 4O8ZA 1QZTA 4Y6QA 4CF4A 5KTKA 3EBLA 1NMSA 4UHCA 2ON6A 1CZKA 4DQKA 3SBEA 4QHYA 1LB1B 4AAYA 1FF9A 1T8SA 3L43A 3A10A 5AVWA 3ZWBA 1CQPA 1ZNXA 4F11A 1IHYA 3ROPA 1RW4A 1SXPA 3GFQA 2X42A 5DTRA 2ZI5A 2UV8A 3IUPA 4JLUA 4OM7A 1XWWA 3SZMA 2FXVA 4D9GA 4V0SA 1TGVA 4LF6B 1FX1A 3K16A 1NOJA 4DPMA 1KA9H 2J9YB 3HYRA 4IDAA 5JHHB 1KYZA 3LP5A 1NVGA 1RXWA 2YXNA 1VXRA 1E61A 1EUCA 2ZETA 4D4KA 4JB2A 3NGLA 4LDJA 1UJ2A 4BLQA 4C01A 4GEKA 4YT4A 4BFTA 4BMYA 3LOQA 1WRBA 2QM0A 1V8PA 3QPBA 4IFEA 4HXGA 5K4AA 3DXZA 2X2FA 4Z9BA 2A9KA 4PWYA 1H5NA 1R0BA 4RYLA 1YOBA 4YLYA 1XHLA 3SN6A 4FP9A 4HJRA 1T3HA 3CGGA 2PHZA 3BQ9A 4DLWA 5IH7A 1E4YA 2I03A 3OLCX 4GZ5A 3KE8A 5AKYA 1MHPA 4S04A 1QJCA 1W2HA 4KGXA 1O2DA 2G7ZA 5BQPA 4BTVA 1ZFNA 5ICGA 3DE1X 3QFRA 1M7GA 3UW1A 1WVIA 1DC5A 1XF9A 4EPTA 4BLVA 5EZQA 5KEIA 2O2CA 2FKNA 2W6QA 4P36A 5TNXA 5LFAA 1DNPA 1UAYA 3FLAA 1DAIA 4NYJR 4RO0A 3JRNA 1HE3A 2A1UA 3OQIB 1KKMA 6Q21A 2A86A 3CZMA 3ASVA 3PFNA 2JIQA 4YXWA 1J0AA 4DB2A 1JDBC 3Q9LA 4CEIB 2G08A 1F2DA 1KBOA 1E8NA 3CVVA 1RAIA 3VC2A 4UM7A 1QCZA 3TGWA 5JS2A 1N5OX 4H4DA 2OHXA 3G7NA 3GN2A 1Z2PX 3OPMA 4PICA 1U7UA 4WFKA 1HYQA 2W0MA 3G5TA 4NHOA 3SMVA 2VJNA 1X8LA 3EASA 4G1MB 4OQYA 4E6PA 2OK7A 4L2IA 3AM1A 4B7UA 3W8RA 4NYIQ 4WGGA 1TYBE 4JP2A 5EVJA 4FQ7A 4QUIA 4Z3DA 3DHVA 5JNVA 4INZA 1MB3A 5A9SA 5JD5A 2B8TA 5AVKA 2W48A 1EUDB 5IM4F 1F2UA 4NYMQ 3C3AA 1SZDA 2B34A 2QSZA 4QE3A 3G88A 4RD2A 5K01A 1FFGA 1WUIS 4NF2A 2W2NA 4DIUA 1MB0A 4GL4A 4TMZA 3RF6A 6REQA 4DA8A 1SVOA 2WOOA 1NATA 3B3FA 4ONEA 1CUSA 2AYXA 2AWOA 2FFRA 4XZ3A 1T9ZA 3ZWDA 2PIAA 4WJLA 4UVGA 5JYDA 4HGOA 4CUKA 4MYTA 1F14A 4YUYA 1HLGA 2Q3HA 3MTGA 1ZK4A 2VF5X 3M9WA 3UF0A 2Q3BA 3STXA 2AN3A 4Q1EA 3GFOA 2YNMC 2VQSA 3W2IA 1REQA 5C31A 4EMBA 2O54A 3JWGA 2GEDA 5CB4F 1YVUA 3KTDA 4MGHA 4XM0A 3V8QA 1IB6A 5B3JC 1P2BA 3SXUA 2JI7A 2BH2A 4B31A 2OPBA 4BKQA 2HUNA 3RDPA 1WCV1 3GN1A 3N74A 2EW1A 1XMVA 3Q3JB 1E1NA 4BDSA 3QXXA 1G1AA 3D0QA 1YS1X 2D1FA 1CV2A 2FGKA 2IH2A 1NBOA 2PH1A 3QGMA 3QVXA 4HG2A 3UT6A 2I2AA 3JD0A 1YRWA 4OHVA 1XXHB 3LTEA 4JVSB 4TWJA 3MLAA 3UGQA 1IM2A 1NY5A 1R8XA 3SFZA 2PCLA 4EKEA 2HJGA 5C8XA 4J2HA 3TG8A 4FSXA 3ZV5A 1ZMXA 3TLCA 3E9ZA 2O4CA 4X45A 3V00A 4J7XA 4KG7A 2O3JA 5IWAB 1KIFA 3Q7RA 3H7AA 2GEVA 4A7PA 2CYCA 2R1VA 4MYDA 4UCXA 1YRAA 3IX7A 5FWNA 1O0BA 4EI9A 4L50A 3E9RA 2LV8A 2MDTA 1USWA 3I9NA 4LG1A 4P38A 5GGXA 5H5JA 4I4IA 2OAGA 2XVZA 3MVEA 1P2UA 3AZPA 3OIWA 3R2JA 5ALHA 3JY6A 5FA5A 2IYLD 2YHAA 2C20A 3PQ5A 3WHKA 4J0FA 2ZOSA 1U7XA 3NHRA 4BV2A 5IJ0A 2GPJA 4QOSA 2ONYA 4Y6GB 3MWFA 2LNDA 4WLUA 3ACDA 4ARIA 4BCBA 1F9EA 5BQOA 4S05A 2CVQA 1XSEA 2QJRA 3M49A 2Q4DA 4GNRA 4IF4A 4M99A 4AJEA 1Z38A 3OZUA 4P7BA 5KQMA 3HXMA 5ALWA 1HLDA 1NXVA 5FWXB 2VCHA 3LBYA 3GQBB 2Z08A 1AOXA 2CLSA 1FL9A 1MQ8B 2I7VA 2XH8A 3PDHA 4GM4A 5E9WA 3A25A 3FFAA 1JAZA 2RI6A 3NTVA 4BQEA 1JJVA 1TTHA 4ZEVA 3H5RA 4E08A 1E98A 4EKNB 3PKIA 2O05A 4JMLA 5K6AC 3BSFA 3CKKA 2OPHA 3GGJA 3K1JA 1I5OA 1B16A 3ND7A 3SYNA 5M2QA 1Q17A 1ZDMA 4IF6A 1KI3A 1WIWA 3NTRA 2OCLA 2JIRA 3FYCA 5FAXA 3FYSA 5G0TA 4X93A 4EK9A 1BFUA 1MIHA 2BSXA 3BOSA 2G07A 3KLBA 1U6KA 1P0MA 2R6GA 2BCEA 4NV3A 1JLHA 2R1UA 3AF1A 3KO8A 3S6JA 3CNBA 5KJ1A 2V03A 3F90A 2DXIA 2QIOA 1OOEA 4LYDA 4D6XA 4OXIA 3ZKWB 5ECWA 5HIKA 2TRSB 3BTSA 3HJCA 4P4TA 1V8BA 1GV0A 4LX0A 4P4SA 4KOEC 1YFZA 2HSWA 4HHEA 4Z7OB 1JEJA 1GCGA 1K7FB 4DUPA 3EF1A 2AF4C 3L6BA 4CIAA 2P7HA 4L5BA 4FN5A 3Q5GA 2BBSA 4G67A 3W77A 4DRXB 5JAOA 2ONJA 2OENG 5FCDA 1P5FA 2ZDGA 2AVDA 2XA1A 4PPGA 1KZ7B 4WK2B 1TU0A 3RIXA 4CVNA 3FPBA 5J3JA 4QM7A 4BAUA 2KQUA 4QU8A 2FSVA 2PKQO 4CDMA 3D59A 2YY6A 1PU2A 1SWWA 2Q4RA 4KW7A 3E03A 2BFMA 1GFSA 2BL4A 3PJFA 4B4UA 1N2BA 1WNFA 2PYZA 4INPA 5KJEA 1XMIA 2HRCA 5C4GB 3UQZA 4KXUA 1EX7A 1ZOSA 4MWTA 3U56A 1IHXA 1T91A 3IO3A 4YXWD 3NHUA 1HEIA 4A2QA 3WKAA 1KJ8A 2G9QA 3K9WA 2D6FA 1VKHA 4DTCA 3FOFC 2DQZA 5GJCA 2C07A 2VKQA 1Q7TA 2IV3A 2JH8A 4AKTA 4YO7A 1O9HA 1Z9BA 3UATA 1MABA 4MULA 3NQ41 3D3QA 1M1ZA 1Z35A 3DMNA 3RVDA 3ENKA 2FFHA 2ZROA 2XCSB 2HF9A 1WD7A 4EUHA 4JKOA 2OHFA 3I2JA 4MUEA 4BO4A 2H5LA 1YBVA 1G18A 1H1DA 2FWBA 3P2MA 3GOQA 5JQWA 3I1IA 3PEYA 1TCVA 2C84A 1EVYA 4QBKA 1UZUA 1PZXA 4F21A 3V6MA 1NONA 1C1DB 1SGWA 3M3HA 4NQZA 4TYYA 3TBKA 3FNIA 3AEQA 2M6LA 2AMFA 1VB3A 1W5AA 2FEOA 3VZQA 3L7IA 4Z0PA 1VHDA 4A8PA 3QFSA 3GYBA 3TRJA 8LDHA 1H42A 1AN9A 3A6GA 3E53A 2RH4A 3GPDG 3O2QB 5IF9A 3ZDAA 1G42A 1PR3A 2B0CA 2P2SA 2WJGA 3QXCA 4MK4A 5JD4A 5CYPA 5GINE 3Q7EA 1UEXC 3TXXA 4ZTBA 3FFXA 4JSRA 4PLFA 4D4HA 1GPWB 1AKWA 2C7BA 5EP4A 4A2PA 4CM8A 1IYZA 1EZZA 4KXXA 5L3QA 2C2YA 4L7VA 2I4IA 1FTWA 2YV3A 1X9IA 2VQDA 4M7PA 4ZJYA 3U4QB 1S89A 5FI1B 4Z54A 3D4PA 1QG0A 1VRCA 3BBPA 3O8QB 5I7WA 2I22A 1CJUC 3B2NA 3CNNA 4RW0A 1LWOA 2OO3A 3JQ8A 1UPFA 2GK4A 4TRMA 4KZPA 5DTJA 5U1PA 4DMFA 5L3SA 3I61A 3JASA 1F4PA 3SQNA 4FGKA 2VK4A 2PUAA 5JPDA 3NVMB 2PCJA 2EJWA 3B6IA 3DDHA 3KYDA 1BNCA 3R3SA 5BYBA 3RASA 3EIUA 2AMJA 5BV7A 1PZMA 3JD3A 4H0NA 2Q3EA 1RBMA 3QU9A 3OZSA 1KZHA 5HR5A 5JBNA 5BSTA 3IUNA 4NZ9A 3P27A 2WICA 4YCBA 3K35A 8ABPA 2Q1YA 3IUBA 1STOA 1GSIA 1VYVA 4DSTA 4J49A 4FIZA 1O54A 4HSGA 1WP4A 3DFZA 3JAWA 2FXIA 1ORWA 1NULA 1XWFA 3OC0A 1GPAA 2O2HA 5DK4A 5DOVA 2I6SA 1G8YA 3K0HA 1Z4MA 4PHHA 2AN4A 2NVUB 1BX1A 4CLHA 3IE2A 2ZJ5A 1YMVA 1G6Q1 1N2HA 1SXJA 4IMIB 3MNFA 4MAAA 4N5NA 1WB9A 3DCJA 3TUJC 4UEJA 4YR7A 2ORIA 3C43A 3JYPA 3NHJA 5HFAA 3UUEA 3LPCA 5DBIA 1YT5A 5SYMA 1S8NA 2ODNA 5MGBA 3MTDA 3ENWA 4W1PA 1QQAA 5TT0A 5IEJA 4HAOA 2IGBA 3QPVA 4POAA 2IRWA 1CRLA 1C2TA 2BPOA 3B6EA 3UWMA 3K5IA 3MLBA 5FWDA 3MB8A 4H17A 3SX4A 1QIDA 5ICEA 1P9RA 1YAJA 3I8SA 3U19A 1QHHA 5CA1B 1R2QA 3T7EA 4IYJA 2CFRA 1NR7A 2OV2A 4TTIA 3ODGA 4ECEA 5JWOA 2PEZA 3WIOA 1RM4A 1UOQA 2CD7A 3LL7A 3OZTA 5E8RA 3QE0A 4RHXA 4C06A 2H31A 1C9DB 2HHAA 4Q1AA 3C8ZA 1RWVA 2H63A 2OECA 1ML4A 1G9TA 1XRJA 3RU7A 4E4RA 4BIMA 5AW3A 4P4UA 2WVAA 5CLQA 4AUEA 3JYOA 2FFAA 1WZCA 2IF2A 3ZWQA 3VR4A 3I76A 2P11A 1SHZA 3BRCA 3DQZA 4FZ3A 5A6SB 1KVTA 3DF9A 2AFRA 1CE8A 1II8A 1KORA 2IP2A 1L8LA 1R6TA 2XSZA 3MJFA 1JPNA 4WE3A 3ZGXA 4TYWA 1LXCA 2BI7A 3T9BA 1T9CA 2YXLA 3F6BX 4E1BA 3KJXA 3OPNA 1TUIA 5HVNA 1C7EA 2KWIA 1X9HA 5HYVA 1E0SA 2DTDA 5C1IA 2Z5VA 1NT4A 2YY5A 3AUKA 4GI3A 2JFYA 3OTWA 3EAGA 2VJYA 3PSHA 3VPDA 1SZJG 3K9LA 1WUHS 3WLFA 1U2RA 4WFJA 5A5GA 3GEMA 2XVMA 3B13B 3V2GA 5AJTA 1OI3A 3SR0A 2XUGA 1C4WA 3M89A 5E6SA 5LJLA 1TKCA 1WPQA 3LHIA 5IBQA 5LXTF 2KLHA 3VX4A 3P0IA 2X3FA 3AHEA 3HYTA 4S2EA 2VQEB 1PNOA 3I34X 2F1OA 2PX5A 5CM8B 4A0QA 5T57A 3FPLA 3NDRA 2D06A 2XDYA 2BEKA 5EWLA 2ZBGA 1NJ5A 4YRKA 5IJWA 1Q83A 1PWEA 2WHPB 2PT6A 2YZ2A 1U8EA 1N8TA 2VWQA 1FRVA 3WKCA 1J70A 4ROSA 4XYLA 5JJBA 2E89A 3ZW7A 1E66A 3SBDA 3RIEA 1GARA 4PO9A 3TTXA 1GPH1 2R86A 3U3XA 2C57A 4FT4A 4WOKA 2VHZA 3AZQA 4G8JA 2B4AA 2ZXFA 7MHTA 5LA6B 4YJ2A 1PCXA 5DXFA 1JG1A 3DE6X 3P2YA 3M6FA 4OXKA 2IPNA 3UJAA 3RI3A 1EIZA 1QVWA 3AESA 3BFPA 4EPVA 1WS6A 1YS7A 3JAKA 3W5IA 2F55A 2OM2A 1PEDA 1QX4A 4MB0A 5DMXA 5I3CA 1RFLA 3QXGA 3RWOA 1QDLB 4XX0A 4F1WA 3W0LB 2DECA 2JH9A 2WDPA 1LX6A 2I2XB 1SC1A 2FUG6 2HJSA 4PQEA 4UU1A 2O0KA 1F2TB 1Z7WA 4XQGA 2VBGA 2HI0A 2ZUFA 2BJWA 2OCIA 1BC5A 4OKIA 3PHJA 3PCTA 3VDMA 4R8KA 4TXLA 4F3YA 3WGNA 4BX9A 4AKIA 2OYCA 4YC7A 2XIQA 2VAMA 3EQ2A 3EUFA 3H11A 1J8FA 3G2LA 3I9V6 1KNXA 4Q93A 3DMTC 4QRHA 1JZTA 4RZ3A 2O8BA 3C6ZA 2UUOA 4REQB 3VVBA 4C14A 1M66A 1D2AA 3WWDA 4F4DA 1F7VA 1J99A 1MENA 3IESA 3KEMA 4R2IA 1SKYE 2VP9A 3RUDA 2OV8A 1IM5A 1X0VA 4L07A 2YIJA 4R8SA 5DM0A 5BOSB 1A98A 1KU0A 4KWEA 5FUBA 3C8UA 3AFGA 5EMNA 2OUKA 5T64A 2DHRA 2RHCA 3K2BA 4OOFA 3OJ0A 2WW8A 4BB6A 4BQIA 1HTTA 4CM3A 3PK0A 3EARA 3UAVA 1CDOA 4HF7A 3ROTA 1ABFA 4XEUA 1T0HB 3GGGA 5TQ2A 2GJ8A 2XYHA 1T8WA 3C6BA 4W9RA 2XBMA 3AT1A 2VTDA 1NI4B 4RNDB 5IYZF 2ODQA 4JI0B 1PJQA 2ECQA 2JHGA 2C54A 3SHVA 2ID7A 4W1QA 4D92A 2OXTA 3PQ6A 2XKKA 4RGQA 1KXJA 4Z3KA 1P60A 3S5JA 3HCRA 3K6JA 4AKHA 1JG4A 4ZHQF 1G8KA 1V3VA 3GRZA 3ICPA 5KO2A 3I2HA 4KH0A 3GGDA 3NG1A 5NLLA 4QREA 1EFPA 2ZM5A 3ZR4B 3DVLA 1TQ2A 2O4UX 3N0TA 3H5OA 3QUCA 2ZWAA 4C6RA 1P2VA 2Z09A 3KSZO 4RZUA 4YALA 4KCGA 2X40A 4TLLB 4ZOLF 1KE1A 1ZSNA 1OFHA 1UDXA 4R2JA 4ZJZA 2EQAA 3WYBA 2A0KA 2JFFA 1S02A 3TSCA 4UAUA 2DUJA 4LNUB 3U3OA 2FETA 3HYSA 3ROGA 3ESAA 2VRWA 3WQBA 4BXOB 1ORVA 5CK4A 4BO3A 3C2QA 1JZSA 3L7KA 4I4NA 1JALA 1UFRA 3PUZA 1XZBA 1G3UA 5AUNB 1A8UA 1KJQA 3R3WA 3CG0A 5JMPA 4WGFA 1VCOA 1VQ1A 3FCEA 4M6WB 2XT9A 1QIFA 3HZOA 1CEXA 1J2TA 4BO9A 5JC8A 2V74B 1HDIA 1JIQA 3L7NA 2AX3A 3UMBA 2DCMA 4A8JB 3WVNA 2AXNA 1FFDA 3PPWA 2HCTA 4M2LA 3VR4D 4JI7B 1TECE 4DIKA 5AW8A 2WJYA 1EDEA 4U6SA 2PWZA 2FMFA 4ANFA 2XSZD 1Z6PA 3P9XA 2ZIVB 4NMMA 3ED1A 1YA8A 1F5NA 3C1UA 3ICQB 2J41A 3QBDA 3L2OB 3EDMA 2UUAB 1XDGA 4TZKA 2PMWB 1NVVQ 3RV3A 5AUOB 4GKBA 1BWSA 4I55B 4JMPA 3RKSA 3H3JA 4EGAA 3JPYA 4HZUB 4IDPA 1PJRA 1M6VB 1LVGA 3NAQA 4P5DA 3FOBA 4QUAA 2IYZA 5J5CA 4ZA2A 3IP1A 5FJJA 1N6KA 2J9RA 3DDUA 1YDGA 3CTMA 3DOIA 5HQJA 1NFFA 4UXJA 4AO8A 1ODLA 4MR7B 3PS9A 4HAZA 5KVVA 2WMDA 1H6AA 1AZSC 3N2IA 4NPHA 2F1HA 1ONPA 4ZEMA 2PL1A 4U7FA 5EJ4A 4J76A 1QK4A 3PF9A 1MP0A 2AHOA 2BGMA 3AY0A 2I2BA 1DIAA 4FW9A 5AM1A 5C9ZA 1HL3A 1Q19A 2YS7A 3NHFA 4HXEB 2C3YA 3WKDA 2W4MA 3BJRA 4AMVA 4QQ8A 4BATA 3IKTA 3P0HA 4HC4A 1IY8A 5TMPA 3T1HB 2P68A 1E1KA 1GVNB 2OC9A 3GDFA 3IT1A 3NT5A 4L4RA 4MLCA 4S1VA 4DEXA 1MOZA 2TECE 1SVNA 1WJGA 1E2UA 4KVZA 3KZMA 5SY6A 1RJEA 2CB0A 2P4HX 1JW9B 2HJRA 2PLFA 1KI6A 1YE8A 3FDFA 4HNAB 4NZMA 4Y2VA 3IKJA 1CLEA 4O4IB 1PFQA 3HVIA 5KVSA 5C3UA 3GR6A 4AXXA 1Y4UA 3WLPA 1T3LA 4G9EA 2JBHA 1EE1A 1GRQA 1TQHA 4AP5A 3AVWA 1JLRA 3G13A 3RVOA 2RAUA 3L8YA 3O91A 2IWHA 3PGA1 4YGYA 3U61B 2ZRFA 4URZR 4N9WA 4ZZ2A 1I3CA 2A94A 2G6TA 1S3IA 2FQQA 1XT6A 1G5TA 4H1UA 2ZBQA 1K27A 4KO1S 2ODBA 1ZW6A 4D8VA 1GAJA 2BGLA 2H4JA 3S99A 2JBWA 5B7NA 1AGYA 1RAFA 4GMDA 5DM70 1JSZA 1QIKA 3NTOA 2V9ZA 1E3JA 1RMQA 3ZK8A 4BUCA 4CCAA 4NBWA 4P4LA 4DHWA 3UJ7A 5JO0A 1D04A 4JB8A 3QFTA 3QEMB 5AQ1A 3CSUA 5FOUA 5DEIA 5TQ0A 4LF8B 4FBGA 1G8HA 1KI4A 4BHTA 2XA9A 4NMWA 5C52B 1N8SA 4BRSA 4P3NA 2DWUA 1PHPA 4WXHA 3DAHA 4MVJP 4OU5A 3RFXA 3OJWA 5I4CA 5KQRA 1MU0A 3U09A 2Q2VA 2WJIA 4BZXA 2DKNA 3ASUA 2BKAA 4RFLA 3L4KA 3MELA 4MEBA 1MBZA 3GJQA 1BDHA 4IZIA 4WADA 5CYFA 4G9BA 2YR0A 4GBED 3ANXA 4FEAA 3H1EA 4DBZA 1G0NA 1E2QA 2P9FA 2VAWA 3OCXA 4K9DA 1J56A 4E2YA 4GXQA 2YWFA 4G4IA 2C5SA 1SHLA 3T1QA 3ADCA 4JYPA 1E5TA 3W34A 1N36B 4U9UA 1UODA 2HSEA 2Y0EA 2CCKA 3B3QA 2FFBA 1QH1A 1T29A 3G79A 4ZOBA 3RAPR 1QE3A 4RJ2A 3TOXA 4AWAA 2B25A 1PN3A 2GEFA 5EQFA 1RP1A 3LZDA 4AECA 4B3FX 3AVXA 1AKYA 1TCUA 5ALUA 3E82A 4NP6A 1XD2A 5JRDS 4KYUA 7AT1A 4TVKA 1YDHA 4YJKA 5JATA 4ZI7A 5LWHA 5FNVB 1I6WA 2PGAA 4GZ3A 1M34A 3RU3A 1FMFA 2P3OA 3LF2A 5T8KA 1I3KA 1CHNA 2YN2A 4YRCA 2HNBA 4AJ1A 5BV1A 4UFNA 3U3DA 2CXSA 4EABA 3F4BA 1HDZA 4GGOA 3TDKA 5BWCA 1YQWA 4DR3B 3QTTA 3Q8KA 1RYHA 4J29A 4QPZA 3GDHA 5DIZA 1IVSA 1JX6A 1YJXA 3A31A 3L92A 5EWJB 3URKA 1ODIA 4FB5A 2MSNA 1E5LA 1KP3A 4RKWA 3JQFA 3D6VA 1LDGA 1FW6A 3SEQA 4N8SA 4INOA 1JTFA 1IPEA 2WI8A 3HMQA 4GGPA 4FD2A 3RC3A 3TLBA 3CZAA 1GV1A 5DV9A 2JHCA 4ZXPA 4YCAA 4QU5A 1Y6RA 1PJCA 1V3QE 5IT0A 4Z4EA 2HAEA 5FWYA 4ZRDA 4PSAA 3OCWA 1PNQA 3DOFA 4EENA 4OHBA 4G0VA 1LPPA 3ENNA 1AGPA 4JLAA 4RS4A 4JXXA 1GLVA 4PAMA 4IDEA 4Z99A 5AKEA 4QPDA 2ATCA 2KS6A 5HS6A 1UH5A 4GLJA 3F6CA 3E9EA 1CF2O 1R9GA 1OA0A 4RK0A 1H6CA 3H4MA 1QZUA 3HO6A 5BPFA 3KZVA 4P1ZA 3KQWA 5CJ2A 2A92A 4JI6B 3BWEA 2EDAA 2XUDA 4U2BA 5JXGA 2VUSA 5H83A 3TI7A 5K5EA 2Q50A 2IYAA 5ALJA 4BAGA 4OHRA 2DPLA 2JARA 4QULA 1H0SA 3LXUX 3R7FA 3DMTA 2IH5A 3IEMA 1E59A 3OAAA 5JBIA 2AQ8A 4EUSA 1UPAA 4AWXA 2CJFA 4K40A 3RTGA 4R16A 1FLAA 1Z37A 3TQIA 3KBOA 3OWHA 2CWWA 1GTMA 1W0KA 3SX0A 3WNCA 2NP7A 1W5FA 3CEPB 4QTTB 4BLWA 4E22A 3N7UA 3PXUA 3MG9A 3R20A 5KNCA 2B9EA 1GRCA 1JNYA 1RWNA 5AI9A 3RVMA 3KETA 3T1VA 2CVHA 3FUUA 5JSHA 2IKQA 5L4LA 3H18A 5DTQA 1JJBA 4I19A 4B17A 2O9JA 3BM5A 4NE2A 4EZIA 1JLLB 4OSPA 4V0MA 2JKZA 2IHUA 4RTLA 1RHMA 1VG1A 1ZLYA 4RDIA 5GM2A 3VSDA 1W96A 3FUVA 1W52X 3I73A 2AJ8A 2VZ8A 4PVDA 3IALA 4EL5A 5K0BA 3P1JA 2XVXA 4DRYA 3BD7A 3C3BA 5FBWB 4ZPJA 5A0FA 1NKTA 3A3YA 4ZGGA 2G5TA 2NU8B 1K7XB 1IIRA 2X6RA 3W1VA 3S8MA 4BEBA 5KYKA 2VDNB 1EWRA 4I08A 1NVBA 5EMHA 2VP6A 3N9IA 4GBJA 2XCIA 2BBOA 4S1TA 1ZVMA 2FZ4A 2J7PA 4GUAA 3IIMA 4XQEA 1U0SY 3GVIA 3N75A 4ZV9A 2YW9A 3ZWVA 2XNKA 1KH3A 4IS2A 2AD1A 1X13A 2FPIA 5F23A 2QRQA 5D3QA 1II0A 1JFRA 2F8MA 2PWPA 2P6NA 5EL0A 2DWOA 2HDHA 1DAFA 5ALZA 1LJLA 3A4LA 3U44B 3NIWA 2WBLC 1BIFA 3A06A 4ZQEA 3TZQA 3D6JA 3JZAA 4W5JA 1IZYA 1Z88A 5KMGB 3COVA 1V2GA 4HUQA 1PJ3A 1VMKA 3O84A 3DFMA 4NCBA 2X5XA 3O3OB 2QHXA 4HWGA 4JA2A 4MCIA 4DOMA 4JASB 3LQYA 1PS8A 3RIHA 3L77A 4FDAA 2WM2A 5TPWA 3MAGA 4YT8A 1QRSA 4MV3A 2AKYA 1LS1A 1ZK0A 1G20E 4N54A 4LYGA 4QDKA 5EC8A 1RJWA 1BVHA 4J0DA 1W4BA 4DDTA 1E32A 3LPDA 3A11A 2JIBA 5KNBA 2YC4C 1PFKA 1DUSA 1AUQA 1UMCA 2ZLBA 4EFLA 4QTXA 3SJBA 1PJLA 3GFFA 5G1OA 1BO6A 2JLAA 1RWBA 1GA1A 3HDJA 2CDRA 4B71A 1XZ8A 2BFCB 1RXCA 1C0KA 4OQNA 1AJEA 2PGNA 2Z2XA 3U7IA 5BWMA 4NE7A 1U9ZA 5JH7A 1PVVA 3ITDA 4PQGA 3K2QA 5FDFA 1GCAA 2V7VA 1P1KA 4GPAA 2JVIA 2AR9A 1X7YA 2JA2A 4RZXA 4B2PA 5AVTA 5IKEA 4KPUB 5K3CA 2LP4Y 4MGZR 1KQNA 2QUBA 1X14A 3C3YA 1KFKB 4N0QA 5CH8A 4CIYA 1Y5IA 2GF0A 2VBIA 3K5PA 4G85A 4JT8A 5LUBA 3WDMA 2O7RA 5KTOA 3AVVA 2YXEA 3N70A 1KDRA 2FZCA 1K66A 3NVDA 3GLIE 2BMFA 5B55A 3PUYA 1ICEA 4IJWA 5JSUA 1O7JA 3D5EA 2P8SA 4D5GA 1P72A 2RKBA 3BB3A 1F9AA 1Q11A 4OGWA 2OBYA 1YQTA 3U81A 3HZHA 3DZBA 3EXIA 5CVEA 3NFRA 1D6SA 3OJXA 4FKMA 4DZTA 5K3OA 1XL1A 2ZIWB 4OIMA 4GRAA 4TKUA 4JBWA 5LZ7A 1F8FA 2IYPA 1SHTX 5I5EA 2ZVPX 5D1HA 2YRWA 1P9WA 2H16A 4MIKA 2NO0A 4LW8A 1H2YA 2CBZA 2AG6A 3AEKB 2OD7A 4IJ6A 1ENYA 1FDRA 2HMVA 2YYYA 4P0TA 1VPEA 2OXEA 2AXQA 2XWQA 3I9KA 2B2XA 3IV6A 4XJTA 1EE9A 3TIGA 1DJOA 2EJBA 2NU9B 3C6QA 3EGIA 2FYTA 3OFNA 1PGOA 3U6KA 2YZMA 4BPRA 1G9SA 1F4VA 1QDUA 2NSLA 1Y1LA 2VHVA 1PZEA 4BS9A 4EB6A 1P44A 1R0SA 5LYJB 4MIYA 3WDLA 4S1OA 5FTMA 2AW5A 1OWNA 4UE6A 1T8UA 1FUUA 3MA0A 4WXPA 4Q3LA 3IDFA 5AKHA 1AB5A 4R7ZA 3IAS1 3TS1A 1F0KA 1FU4A 3JWHA 3PNKA 4M0EA 3E61A 1UXHA 3PPIA 3GCZA 1H2WA 4LZZA 5DI3A 3P2OA 5IAEA 3KC2A 2MCFA 2OXFA 4I9HA 5FD8A 4BNDA 1ZU5A 1SRRA 2Z8YM 3IH5A 3GAMA 3IR6A 2LIVA 5I7EA 5MGNA 5F73A 1I10A 1OYYA 2C2XA 2NOAA 2YOFA 4MINA 3EOBI 4HDSA 4KRYA 5BSUA 4CR6A 4OQEA 2BCGY 5FULA 3K9BA 1UBRS 2VG8A 3OAAD 4HAUA 2PJRA 1LPNA 1JEOA 4N5IX 3ZDRA 4FXPA 4DMUB 4YUVA 3E9MA 1NDQA 1XZCA 3NZEA 1V5FA 5CX4A 1W0KD 3LF1A 5FA8A 3LBHA 3FGNA 2QTWB 4HDKB 3IV9A 1ITZA 4TUYA 1T1JA 4EKYA 5KNCD 3BF8A 4NBRA 4BKOA 3OEWA 5HBRA 4HZIA 3R41A 2X6QA 821PA 2QM7A 1S2LA 1UBFA 4PO3X 1SO8A 4HPWA 2AK3A 4YJHB 4QRDA 3IAM6 5J47A 3NEPX 1ZO8A 4F5EA 3SWWA 1XTRA 1YFKA 4Y1RB 5F2OA 3TFQA 1Z8FA 3LUPA 1G20B 1P9OA 2PE5A 1FP4A 1ZIYA 5EZYB 3OKAA 5LDDC 1TM4E 1SULA 2B7CA 3L7JA 3PWTA 5BW5A 1R6VA 3SSMA 3LSTA 4B74A 4F7DA 1MG5A 3OOHA 1TF7A 3IKVA 3I4CA 4IGKA 4V0KA 2OCGA 3W9BA 2BKUA 2WK1A 4OQQA 4RKQA 2DM6A 3KTAA 1N8KA 4ND8A 2V98A 3ZCVA 4GP9A 2DFKB 3NWPA 4OV6B 1E9BA 1GKUB 3CZ9A 3LW8A 1FSSA 2AOUA 2C9BA 2J7PD 2ZULA 3E5MA 1Y8RA 4I50B 6YASA 2DBVO 3A26A 2H59A 1OZFA 4D46A 1CP2A 3D6AA 4Q7QA 1I4LD 1ZD8A 2VYQA 3CX6A 3EUEA 4BVEA 5CFQA 2AN1A 2GTHA 5F7JA 4AI6A 3H05A 3GJ5A 2Q2OA 3TLZA 4D26A 4OGLA 2V3CC 2WPDA 4M46A 4ERXA 1GNLA 7REQB 1SCJA 1V35A 2XV1A 3DBRB 4U7HA 1X1AA 2VKTA 4KK4A 4TTJA 1ODKA 3VKFA 2QMYA 4JQYA 5KYXA 2ERCA 5CFNA 1WW8A 3NYQA 4PRKA 4UBIA 1FFSA 4CGYA 4EBFA 5KINB 2OBXA 1H93A 2H07A 5SYAA 4EA6A 3HFSA 1Z15A 1P1BA 2GX6A 1U3FA 2IYEA 3FY4A 3GVHA 4N3CA 3FOAA 4PAWA 4W1RA 2FP4A 4DCGA 2P2CA 1KPIA 3DVQX 3L40A 2ZREA 1O08A 3BKXA 4WBNF 4GXTA 3O2NA 3U31A 5KNBD 3PUVA 1O97C 1PJAA 3G9UA 4D4LA 4D82A 1A9OA 3H13A 5CTAA 4E3ZA 1IXSB 1AQ6A 3GVCA 3RFCA 3AL0C 3D2LA 5F7OA 1QC5A 4CG2A 5IN5A 4L0MA 4L5YA 2BGUA 3ZGVA 3EPJA 3I72A 3IDSA 5E1OA 3BRWA 2X0JA 3NNSA 4OTZA 4ZC8A 1LC0A 3OPYA 2VFAA 4G4SO 3TUIC 3QF4B 2DEUA 1MFPA 3LK7A 3Q4GA 1COWA 3F6EX 4DM7A 2QTLA 2WM8A 1PG2A 2NAFA 4IQ4A 4LYYA 1QFMA 1SOAA 3AXTA 4QPCA 3BE5A 4W9NC 2I2WA 2ZRMA 3B52X 4OQDA 2QRKA 5F33A 1LW7A 2FZKA 4EW3A 3FM9A 1NNUA 4D41A 4JL8A 3WSVA 4MS3A 1PLKA 5CBPB 3V4RA 3ZU3A 1DBVO 4DAEA 3TM5A 1Q20A 4ZAFA 6AT1A 1F6BA 2R48A 1J1ZA 1UZAA 1SUPA 4Y9UA 2HHHB 2DUUA 2GWRA 1XZAA 2OHHA 3G8YA 1KO7A 2A9RA 3TSYA 3U26A 1WABA 4PZUA 1KJYA 3DKKA 5F2EA 4ZVTA 4ZYVA 2Z2KA 1D2CA 5KOIA 4KUEA 4XFDA 3A05A 4LZJA 4OYYA 4KHZA 2UXDB 2ZK7A 3LXXA 2EG9A 2ZR7A 3I2FA 3DEJA 3C3PA 3HFGA 3CIOA 1S1CA 1JKJA 2OCYC 1JDSA 2J85A 4IH9A 4I1SA 4IHJA 4K26A 3RVJA 4GXRA 3SYTA 3U49A 3I32A 1FU8A 3U39A 1AKUA 5JSKA 4G37A 2WZBA 2GMWA 2XYRA 3PNSA 3I3SR 4NENA 3OQ6A 3MFYA 3PNMA 5SV2A 4OJYA 1QH8A 1OWPA 2WJHA 5ESXA 1RCTE 1RSZA 2V7GA 7ADHA 3CE6A 4BNVA 4TN1A 3ZJYA 3P9RA 4L6IA 3W9UA 4C29A 3UYKA 1CUDA 1DUVG 3V55A 2I3DA 4JL5A 5FPSA 3KQOA 3T1YB 1PHRA 4ZT6A 4CKXA 1D1QA 4PGFA 5JQGF 5ITWA 1E89A 1M76A 4NABA 3A6PC 1J0BA 2UUPA 2RHMA 2P5YA 3GK3A 3K30A 5DCLA 4E5VA 1KH2A 1IG0A 1QIEA 3MWEA 4RIIA 4RY2A 1Z45A 3O3CA 5HQ3B 4MHSA 3VHXB 4C4RA 4QT4A 2CV2A 4G23A 2G1KA 1BDIA 1JBQA 3LO5A 1KU6A 1PS0A 4RA6B 3M5PA 1NJ2A 4ZT3A 4JI3B 3ZBTA 1FLVA 4DV2B 5AVXA 4TROA 1VFPA 2O0MA 1JS1X 2REBA 4WOCA 3D3WA 4ENQA 1P5RA 2FE1A 1XHEA 4LTMA 1Z56C 3NTXA 4KRGA 3EZNA 1KRXA 4HZGA 4FEEA 1BXGA 1XRQA 1IE3A 4YEDA 5EXPA 1G60A 3AX6A 1MC5A 2WFLB 2JFHA 3EPHA 1ZRHA 3L0DA 3NFYA 3UAGA 5KYWA 1MLDA 3NAGA 4Y2TA 1VLLA 2B8JA 4DSZA 3DDOA 1YONA 3EAFA 4M60A 4ER5A 2MT9A 4CUJA 1HSZA 4GLFA 4BGUA 4CNBA 1SG0A 5FV4A 5TGZA 3KR1A 3BUSA 3CNHA 1WKBA 1LBQA 5AVYA 2OCDA 3SYKA 1DO8A 2AOVA 4N9QA 1FX0B 1WULS 2B36A 3GFSA 1R4MA 1YVDA 3D81A 3EMBA 4KI0A 2PYDA 1EVZA 4W7HA 3PSAA 1EUQA 2Z8ZA 3BB4A 3LY8A 4KBYA 3EFOB 1EM8B 1LF5A 2XQGA 4JDUA 3V1YA 1EA5A 4E7OA 2RI1A 2XB6A 2Q4OA 3CWQA 3P52A 2GR9A 4P54A 4ZWNA 1LKZA 3ZNPA 1RZRA 3KQVA 2QJOA 4PX2A 1HYEA 1UIRA 3VAAA 3CYFA 3HL4A 4LCEA 2L2QA 3DE3X 5BN4A 4IFBA 1M0EA 2QRLA 2ZSKA 3GWZA 1IRIA 2BMDA 3H9CA 1HSOA 4YCNA 3MGCA 2X2EA 4H7KA 5CITA 1E7SA 4UARA 1R0CA 2X76A 3MUFA 3H1BA 1PT8A 1PZHA 4CKWB 1JYSA 1Q0QA 1L3BA 4JBXA 4P5EA 4JI1B 2F3SA 1RRCA 4ER6A 5AR1A 3GT0A 3BBLA 3I2YX 5JAMA 3VMMA 1Y1RA 2YJ6A 1K7EB 3PICA 4KV7A 3WKEA 3T35A 2R25B 2YW2A 1KF0A 3NKFA 4JGBA 1CETA 3WYNA 3GUCA 1FSGA 1EHYA 3ABQB 3D4IA 3G8AA 5H4HA 4AG6A 2H1IA 5F7ZA 4D6PA 1RJ9A 4RE5A 4XLZA 2QRHA 1VMEA 1CJMA 1HDGO 1ISIA 1HPLA 1VJCA 1WMEA 3RS8A 3VHQA 3Q7PA 4DLKA 3CRNA 5K0ZA 4CEJB 2DG2A 2A1UB 3BRWD 3H1PA 3DBHA 3TR6A 4CV0A 4K86A 1XTJA 4R1PA 4RACA 3QFFA 4MOWA 2X8JB 1GR0A 1DRVA 4Q4HA 4O2AB 1COWD 3OTGA 3VNRA 1G8SA 4QHSA 4LDRA 2ZTUA 4NK4A 1WUKS 3HY4A 1XB2A 3MT7A 4LECA 3VYSB 3W8EA 1L5MA 4BMZA 1JDZA 1OA1A 3W5HA 1MC1A 2GJKA 3SYLA 2MYTA 2QTRA 5DU2A 3QPDA 1RXEA 3F2IA 3HWRA 4QUHA 2X8AA 4Y6LA 3WAGA 1KYVA 5E7JA 3HDTA 4L2IB 4JS0A 5F35A 3FVRA 4YRFA 1FNBA 4AQDA 2HSJA 2YICA 3JCZA 3QA9A 2P0YA 2AFHA 4CLOA 4GFDA 4I6JA 1AF4A 1KYXA 2FDRA 1UZMA 4GP6A 1FB5A 1FMJA 1WB6A 3S5UA 3AETA 5AJXA 5E6RA 3UTDA 2HD4A 5CEJA 1E9RA 2BW0A 1H4QA 2RHLA 1ND5A 1ESCA 3SF8A 6REQB 1RI3A 1T9GR 2Q07A 2VQ3A 3KLPX 2VNKA 2G0AA 4FDUA 3Q3GE 1JLKA 1I8TA 3BHJA 3KAQA 3ZWXA 3OF2A 3AFHA 2B1JA 2DPYA 2WJZB 3DZJA 5AI8A 2OD9A 3EZYA 4FYJA 4C0QC 2PWAA 3JYNA 4F3CA 3L1KA 3RF7A 1REQB 4LRYA 3JR3A 2LIPA 3NM5A 2I87A 2BR3A 3OQ1A 4K7JA 4EP1A 2ZE6A 3IQXA 5EE1A 4CKBA 3M6LA 4ADSG 3TAUA 2CUNA 1AF7A 4YQEA 2QL6A 4YRGA 4L6AA 3P19A 2PX8A 1DOAA 1Q74A 2WTXA 3V8NA 3TE7A 1TO1E 5D3MB 5T4BA 1F8YA 2B6NA 4MIEA 1D0SA 3AFMA 4O0MA 3MEQA 3PYLA 4EHNA 1ZCFA 3BIFA 4I5FA 3SNKA 2AI2A 3PR3A 3NBFA 4IDQA 2REXB 2WJJA 3EZ2A 1JQ5A 2INGX 3A2KA 3MCUA 2BEVB 3RYIA 4DW8A 4HCJA 4PYIA 4JHXA 1E0AA 1EXWA 5KKNB 4R5HA 3B5IA 1QANA 1U0HC 5ICSA 4RS3A 2W71A 1T3TA 1UBNA 4YRTA 2H48A 2K4MA 2I80A 1CXZA 5FTNA 1ZK1A 1Z63A 4O5AA 1KP2A 2PH5A 1A4UA 2H7YA 4H1HA 4L5AA 5I9IA 1O57A 1BVRA 2PKEA 5JJLA 2CYBA 2EJVA 4RUKA 4G0WA 1N25A 1VBMA 3EB9A 1TAQA 3G0IA 3M4YA 2PUFA 2I1VB 3DULA 1KC3A 1SA0A 2NNLD 1XQVA 5I9TA 4FZ5A 2WHRA 4NCKA 1P1CA 2APJA 2EKZA 2YZ7A 2BC9A 4MQUA 3TJMA 3BVPA 5L3ZA 1UAGA 4NAHA 4XSHA 3DTVA 3L8MA 4Q7KA 3KHKA 4JROA 4KE7A 4KO8A 1P0IA 4AXBA 3GEGA 1A9PA 2WWFA 3HJUA 1GFZA 3GY0A 4J94A 4O2BA 3PJDA 3ZIDA 1SXQA 1TK9A 3KYCA 1G41A 3EYAA 4Q19A 1S2DA 1G63A 3ZY6A 4KV9A 1BU5A 4AJPA 4K3UA 3HLYA 4E07A 4LBVA 5TQJA 2FW8A 3ZWPA 2FOXA 4R05A 2ZB2A 3WNVA 4Q3AA 2BGIA 4BBAA 3DYBA 2ODEA 3H2GA 3FVWA 2VZ0A 5CBKA 1OXXK 3MT8A 4BNLA 4WESA 4Q7MB 2GLUA 2Z2JA 4FDLA 3KT8A 4UUBA 4DIDA 1RZRD 2X14A 4Q00A 2II6A 3U48A 1OI7A 1Z3IX 3H9BA 2GILA 2X3YA 3KXDA 3R23A 1CCWA 4BFUA 1Z0AA 1E9FA 3K0CA 2CBXA 4CM7A 4KXQA 4CKCB 5HBGA 2JNWA 2OP0A 1KMNA 2H2HA 2RI0A 2ZT5A 3IAUA 3W4JA 5JBQA 4PINA 2ZYHA 4TYPA 3IOBA 4QVKA 4AJ2A 3HV2A 5JZ9A 2P6MA 1LLQA 3L4BC 3Q7QA 1GZ6A 4X84A 1EIWA 1KJIA 2C94A 4NI5A 2F8LA 5AW6A 2GTPA 4N1AA 3L8CA 2R6HA 4OBEA 4YY3B 4BVJA 5DCYA 4YLGA 4O4JB 2RE8A 4EO9A 3EQ6A 1VKRA 2ZYRA 3KB1A 1LPAB 1NNI1 1NW5A 1Q0ZA 4II2A 1IBMB 2C78A 2X22A 3MIIA 4LJ6A 1ZRMA 3CG4A 1J8DA 1GN9A 3OOJA 4LDQA 5SY4A 2Q1SA 3VAZA 3KSDO 5KOHB 2PMFA 5IC5A 1E79A 1JDNA 1PW7A 2QT1A 2X23A 3U17A 4G5XA 2PZBA 4QOEA 1H6BA 1SIUA 3PVSA 2I6FA 3OZFA 4GLOA 4DLVA 3EXFA 1Y5NA 1MNAA 1X74A 2A8YA 2PT7A 2C5GA 5F52A 3F5SA 4KQ1A 3SYMA 3WGVA 4G0YA 4O08A 4P4NA 4G0NA 1U5BB 1X0XA 3QU5A 4X7RA 1PUJA 4QBHA 5DGXA 4UDYX 2FUG1 3MRSA 4I1YA 1T36B 2IY9A 3G5LA 2YL2A 2ZSAA 1R3DA 4LXQA 4X1IA 2CSUA 4N3NA 4EB3A 1ZQ1A 3PHGA 1LLUA 2A1TS 1G21A 2GPSA 1F8GA 1A50B 1QYXA 2WHYA 3NT2A 4CETA 3OIGA 1IN7A 1V11A 1GZ3A 4C0HA 1C3OA 3I9V1 2YHUA 3OLYA 3E58A 4TV9B 3N0XA 4F3KA 4OH1A 2IHKA 1DPGA 1IEXA 4XOUA 5AO9A 2YWRA 4KMRA 4A4DA 3H2SA 2PSEA 1DQPA 3Q6NA 3ICCA 5B6JA 1PDWA 3A9SA 5IDWA 4YP0A 1IN1A 2C4KA 1AXEA 3BICA 2CXPA 1IAQA 1J24A 4WPGA 3ZE7A 1WPGA 2COUA 3FYUC 2NN3C 1L4BA 1QO9A 4Q21A 1E2FA 4QA9A 2PU7A 1YNSA 2NNWB 2AG0A 3FSEA 2BMWA 4JOBA 4WASA 3T3IA 4E2ZA 5K9ZA 3U40A 4IFTA 3PTAA 2O2JA 4L8WB 4LQDA 3EULA 2B30A 1KH1A 2KE5A 1Z82A 1Z6XA 3MHPA 1XDZA 3N07A 1QX3A 4BO6A 4C6SA 2IEIA 3QMMA 4V0OA 2XBUA 1N9ZA 1BROA 1BHSA 1HG0A 5U9CA 3JQ8B 3JATA 5AK6A 1AKQA 5E3HA 1IC6A 2VWGA 3JASB 3UK2A 4M3NA 1NX6A 1U1FA 3FX2A 4EJMA 1NDUA 3SXJA 1BJRE 4G0QA 3LBIA 2ESRA 2QTMA 1AQNA 2NZ2A 1ECGA 4GXNA 5AHWA 3JQCA 3LD9A 4F9TA 5FO1A 1XCPA 2NUTA 1XJQA 2I78A 1XHFA 5KTSA 2UZAA 1EDZA 2H6EA 3UMYA 3RTEA 2W42A 2JFQA 2BWJA 1J9EA 2RG1A 3DZKA 3IQZA 4XARA 5JNUA 1ETHA 2H1WA 2HA3A 1S7GA 4KQFA 3KX2A 3KUKA 3LHKA 1TVCA 5H0IA 5B3AA 4DNOA 3JAWB 3O7WA 4F71A 1ORTA 2IPMA 5HDBB 2JBAB 3WRYA 2ONZA 1DTWB 3FUCA 4G86A 4DARA 4N0EA 4XR9A 1NAIA 5EP2A 1YQUA 2HV8A 1CUXA 2Q0XA 2VP4A 3R76A 4KVGA 5I7VA 5K0JA 3GLGB 3RD5A 3BIJA 2F43B 1IEWA 4LVCA 1EPUA 2ILTA 1DEXA 3VA7A 1CRPA 1W88B 1Q15A 3DYVA 2ACKA 4FBLA 2RHTA 1EBFA 3F98A 3JVIA 4IUDS 4PLWA 2PO7A 2ZI3A 3NTQA 1NW9B 4ZRNA 3RJZA 2NUPB 3WO1A 4XFJA 1O97D 3T9AA 4BCDA 2H9AA 4HP8A 2REQA 5TVKA 1LSJA 4JUFA 4AIRA 3K6RA 4K1LA 4PXYA 3WGHA 3LC0A 3JQPA 3JQRA 4NOLA 2A0WA 3ENZA 4RHUA 1UJBA 4XE5A 4CLDA 5AKGA 1IJFA 4UDOA 1XALA 4YJGB 1XA0A 1WHSA 2G36A 1JDBB 2NSDA 2NZ8A 1S8AA 2AEJA 2C9ZA 1U8AA 1GYRA 3FCSB 5HIMA 1JL3A 1YKGA 1QFSA 4X7MA 3U9TA 3VJLA 3OIUA 3I23A 3VTAA 3EH1A 2CLKB 4D4JA 5LD2C 2ZBDA 1F0YA 3IE0A 3GLVA 4ALMA 2J5BA 4XD2A 2ZRCA 1S9HA 2V5UA 3E7PA 3HXPA 5IFKA 3WV5A 1MGOA 4K2AA 1IN8A 2M6SA 2CVFA 2NYRA 2L18A 2IIVA 3DWGA 3K96A 4ER7A 2Q29A 2XR1A 3KPUA 4IKEA 4JB3A 3LUKA 5FOTA 1RQRA 1C9YA 3AXSA 4GLBA 4I1IA 3M70A 4E5PA 1EG2A 1DL5A 2PBRA 5EXSA 1P2SA 3LKZA 3UPUA 3JQ9C 1ODTC 2VPWA 1UXJA 1FYXA 2FI1A 2VHTA 1HWYA 1YULA 2O3QA 3NHKA 1ZSVA 5E4YA 2A5JA 1PBTA 4ENPA 3H5LA 2ASVA 1BKDR 2IYUA 2IELA 3CW2A 5BVGA 5JFTA 3KL4A 2ZIEA 4FFBB 3L04A 3KU1A 3O0DA 1QH9A 1DDIA 3H87A 3IYLW 4FFPA 4BMVA 1PEAA 1TO6A 4CW7A 3I3OA 2BKXA 2F67A 1YIDA 1E79D 4NONA 3EWSA 4YP5A 1OGIA 3QBTA 1KI8A 1WSBA 4URFA 5CW1A 1P7WA 5CA0A 3T12A 5AK4A 2QN6A 1NXOA 3WL4A 5A05A 1M10A 3E5NA 5DNVA 1OH8A 1J8MF 5EWLB 4HL6A 4OHCA 4G5RA 4I6GA 4EZEA 1GDTA 4KFCA 2OHVA 1ZN8A 3MK31 1UMKA 4K6CA 3VZSA 3VU9B 2G1AA 2JA1A 3O1LA 4BMSA 1L5GB 5CLFA 1B1CA 4M49A 1L7AA 2FEKA 3UFXA 1C8LA 3C97A 4NXNB 3P2KA 3BDVA 4FMDB 3KAPA 2XRMA 4EJ6A 5EGSA 5KNDH 4E51A 4DCJA 4DCOA 1ZICA 1W25A 3SJ7A 1NOIA 1ODJA 3KZXA 1MAWA 1PWYE 4TKZA 4AZSA 5KWEA 3JAKB 5A4AA 3RK4A 4AROA 1MW9X 4OF4A 1QMPA 3ESXA 4LRQA 2C5EA 1KY3A 2Y66A 4QG3A 2O8FA 4FHZA 1Q16A 1N3IA 3T5BA 1X1CA 4A1OA 4DA6A 5JRJA 2B8EA 3PENA 5CCEA 1U65A 5EMKA 4CDRA 2XIJA 1HT0A 1QS0A 1RRGA 3JWIA 4KK3A 4DQVA 3DB2A 3THYA 2OOSA 1PG0A 3ONFA 3ZWWA 3QBJA 4BAZA 3KQTA 3TF5A 5C51B 3UPDA 3NT4A 5TMDA 2D2EA 1NLUA 4ZYZA 1TEXA 1F8XA 4Y2SA 3D7LA 2CHFA 4UU0A 4FQ5A 3TBFA 3H11B 1C9EA 1N1DA 1Z0JA 3CR3C 1YS4A 4NLLA 2JJQA 4F2WA 1I7NA 2FPWA 4PQYA 4MDYA 4EFNA 3R8FA 4OX9Y 2VDJA 4NKRA 1WCIB 2J48A 5G3YA 3WTBA 2R1TB 2A0FA 4D79A 2GSDA 4Y2JA 4GECA 3GJ6A 1HNWB 2D5BA 1W1IA 2CE2X 2FWJA 3HUEA 3GMIA 1J49A 1XVTA 1NAHA 4EDFA 3DEFA 1HTBA 1SCQA 4KAFA 4NCJA 3FWZA 2C9CA 2BR5A 1R0KA 1R74A 1U9JA 1U9YA 2NXCA 2VUIB 3OLQA 5FORA 2Q5CA 1W75A 4ZT7A 4P33A 1I7SB 3EXEA 1I2DA 2I6UA 1XQXA 3CH5A 4G5QA 1LVHA 5ERXA 3PD7A 4D99A 1FDUA 3I04A 1YB7A 1Y1TA 4OJQA 1MUUA 3DSRA 4ZYYA 2BUAA 1J4AA 2V6IA 2IW1A 4BRUA 1WD5A 1C7IA 1UR5A 3FF1A 1KZ6A 3ERCA 3G2HA 1C30B 3EW9A 4QNRA 3UA3A 4X94A 1PD1A 4YUXA 4ZOQI 1E64A 5LDGA 5EWMA 4Z1MA 3LP8A 3QY9A 2QNBA 2OO5C 4LXGA 1XN4A 3VZDA 4JJEA 1EFAA 4OMFG 3HB9A 2VPTA 5EE0A 2H1FA 2OHOA 2QYHA 3RBZA 1XD9A 3UC5A 3RSGA 1KBQA 3FA2A 5CA1F 2ZR0A 5M5BA 5ED4A 3F73A 1V6SA 1XCLA 4W63A 5JXIA 3H3XA 5FL7A 3VJRA 3IV7A 3R09A 3BC1A 1U63A 4K6KA 1TMYA 4TRRA 1ZXXA 4MDHA 4BNGA 1E6EA 5DB4A 4HQNA 1EINA 2FA9A 4DT1B 1CUIA 4IFIA 3UWSA 5FEMA 3P96A 1V1RB 4Q66C 1F8UA 3C24A 4XSGA 2J5XA 4DSNA 4JB0A 4PY2A 4OSEA 1RYBA 2HIGA 1GN8A 2GN9A 3REQA 4EGCB 1JSRA 1T43A 4IOJA 1OXMA 2EL9A 4OHWA 3LU1A 3A36A 2GAAA 1AHIA 3FJOA 3GV0A 4JUAA 2E2WA 1AK9A 3P32A 1GZ4A 5F5NA 2ECFA 1KYQA 1WY5A 1BEUB 4LYAA 1I2MA 1BQ3A 7GPBA 1GPDG 1WETA 2J9XB 4HQLA 1M75A 4IH1A 5KTMA 3H84A 4B6EA 3HVKA 4N03A 2FW9A 1EP9A 1DZ3A 5B30A 5LOVA 1R9JA 3K6SB 4KR0A 4JJ7A 3VVCA 5BSKA 1NNEA 2Y0BA 4IQ0A 3KQLA 4EG3A 4X1YA 5CCXA 2VNJA 1VP9A 2JGMA 4R6WA 4XKJA 5CK5A 3W1EA 2FRXA 1IZ0A 3HG7A 1M34E 1T8TA 5AHOA 1KOGA 2IBTA 4YWHA 1NXXA 3QWBA 4LPKA 1VTKA 3PFCA 4YFVA 5F64A 4JJKA 4QFBA 1X7ZB 3ZV4A 4MS1B 4DBLE 3OVMA 4GYKA 4O33A 4RQAA 4B45A 3NHLA 2CLFB 4JVOA 5TIIA 2XB2A 2O7NA 2B5WA 1R4AA 4BFVA 1U80A 2HU2A 4J3FA 2JIOA 4ZMSA 3GEHA 3V7YA 5ER6A 3KVNA 1QGUB 4CQNA 2FX5A 4MUFA 2HFKA 3FYUA 3JALA 3GMTA 2GKOA 3DAPA 1T9DA 4KIGA 1A76A 4YONB 3M33A 1CYDA 3T3MB 3WP0A 4NFLA 2PKRA 5JLAA 5TXGA 4RAQA 4C20A 5B36A 1IL0A 3Q5DA 3GPIA 1RBZA 1T0IA 1GU7A 3K0EA 1F5SA 4XOIA 4ZKEA 4D9KA 1LSUA 5JSFA 4NCAA 3H5WA 1V43A 1FNSA 1YL6A 3M9XA 2OZPA 2Q4EA 4R9VA 1VJTA 4HN2A 1MQA