1K2VN

E. coli periplasmic protein fhud complexed with desferal
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
262
structure length
262
Chain Sequence
AIDPNRIVALEWLPVELLLALGIVPYGVADTINYRLWVSEPPLPDSVIDVGLRTEPNLELLTEMKPSFMVWSAGYGPSPEMLARIAPGRGFNFSDGKQPLAMARKSLTEMADLLNLQSAAETHLAQYEDFIRSMKPRFVKRGARPLLLTTLIDPRHMLVFGPNSLFQEILDEYGIPNAWQGETNFWGSTAVSIDRLAAYKDVDVLCFDHDNSKDMDALMATPLWQAMPFVRAGRFQRVPAVWFYGATLSAMHFVRVLDNAIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrichrome-binding periplasmic protein
publication title X-ray crystallographic structures of the Escherichia coli periplasmic protein FhuD bound to hydroxamate-type siderophores and the antibiotic albomycin.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal transport
total genus 80
structure length 262
sequence length 262
ec nomenclature
pdb deposition date 2001-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 1k2vN02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 1k2vN01
1FP4B 2AFHA 3PSHA 2OV1A 3ZKAA 1KARA 2WHYA 5M3BA 1K2VN 4WNAB 2MINA 5GGYA 2PS0A 3PDIA 3BE6A 4LJSA 3R5SA 4WESA 4WZBB 4WZAB 5GGXA 1XVLA 1K7SN 4OXQA 5HDQA 2M6LA 5M2QA 1QGUB 2AFIA 4FKMA 1MIOB 4PM4A 4UTOA 1PSZA 4FILA 2OSVA 3ZK7A 4CL2A 4NNPA 5KOJA 3MINA 3TLKA 1QH1A 2AFHB 4HN9A 1QH8A 1PQ4A 3AERA 5BVGA 3TEFA 1N4DA 5JJ5A 3K1AB 2XQVA 2ETVA 4TKUA 4HMOA 4UTPA 4FI3F 2AFIB 1M34A 1KAHA 3TNYA 4MO9A 5B58T 1M1YA 2PRSA 4XPIA 5JOQA 4HMQA 3MINB 5KOJB 1QH1B 2RG7A 5I4KA 3EIXA 5M34A 1G21A 1QH8B 2OV3A 3R5TA 2O1EA 3AERB 4UDNA 1L5HA 3PSAA 5BVGB 5M29A 3AETA 4NNOA 4ND8A 5AFSA 4TKUB 3AEQA 1M1NA 1M34B 2WI8A 1N4AA 4MX8A 5CX1A 3MD9A 1M1YB 3ZTTA 5JPDA 4XPIB 2MINB 3G9QA 1KAEA 2PHZA 3PDIB 3CX3A 4WESB 3UJPA 2XH8A 3U7QA 4OXRA 4MLZA 4K3VA 3AEKA 4ND8B 5KHLB 2Q8PA 1N2CA 5KOHA 3AEQB 1M1NB 2R79A 2YNMD 5HX7A 3GI1A 4G09A 5CX1B 2XY4A 3AESA 2YNMC 4GICA 3AEUA 2Q8QA 4UDOA 4TKVA 2OGWA 5BVHA 4N01A 3EIWA 3MFQA 2PS9A 2M6KA 1TOAA 3NU1A 4WN9A 1G20A 2R7AA 3AEKB 3BE5A 1ESZA 2QI9F 4BBPA 3MWGA 5KOHB 4INOA 1H1LA 4DBLE 3MWFA 3HJTA 2PS3A 1K75A 4IRMA 4MDYA 1G21B 3AESB 1L5HB 3AEUB 3AETB 4TKVB 3K1AA 4FNAA 4PAGA 5BVHB 2X4LA 2XDQA 4G07A 2XV1A 5CR9A 1K0FA 1FP4A 1EFDN 4WN9B 1G20B 4OVKA 3ZK8A 4H0FA 4WNAA 4H59A 4INPA 2XUZA 4M7OA 1H1LB 3ZK9A 4WZBA 4WZAA 4B8YA 4LS3A 5FLYA 3U7QB 1QGUA 5JG7A 3LHSA 3HXPA 1MIOA 3LI2A 3HH8A 1N2CB 1N2ZA 2XDQB 4HMPA
chains in the Genus database with same CATH superfamily
5KWIA 2I6XA 1UMCA 1B4DA 4QT0A 2OEPA 4YRDA 1PJAA 3MGCA 1MO6A 4QUAA 3ZWXA 4X8OA 2G06A 1VRVA 1W2HA 5E4FA 3M6XA 3W3AH 3WYCA 1EJ2A 1PK7A 4JKYA 5AVQA 5L4NA 1C30B 4KUHA 1CY0A 5JVDF 4MPRA 1MDBA 3L7YA 4MULA 4EABA 5AW6A 3NHSA 2AQHA 2ETXA 2FPPB 2RKOA 3AB7A 3NFRA 1WX1A 1WU7A 4K81B 4YJ2F 4KE7A 3EEFA 3BQ9A 3KQHA 1N33B 3LXXA 1OLOA 1T1RA 2YH2A 1O87A 2CLLB 4R1OA 4GX5A 5HM8A 3CLTC 4B6SA 5ELXA 1EX6A 4HDNA 3BEDA 4S2UA 1U90A 5K0JA 1SY7A 1C1YA 1CU1A 1N4DA 1YCGA 1UBCA 1WUJS 1BCRA 2QORA 3HJAA 2AJDA 1N7GA 3EUAA 5JY6A 1X7HA 1PS9A 5IM5A 2VDRB 5DNCA 1ZMOA 5G0VA 2WD9A 3CF0A 2NU9B 3P4YA 1T5OA 3ZGVA 5ENDA 4IP0A 3EARA 3SM9A 1JHPA 4O2RA 4BWYA 4PTLA 1AT1A 3D6NB 5KU1A 5EHIA 1KDPA 1L7DA 4NZZA 1P0QA 5KTPA 3C15C 4MVJI 4YBZA 5DISB 2PS1A 5AJHA 3EQZA 2QTWB 5C8VA 4UFOA 4MA4A 1DT3A 3WL5A 4XIFA 1M54A 1FEZA 2NXNA 3AWIA 3QKIA 4CV0A 3P2KA 1R16A 2P8JA 2VDNB 4JB8A 3FCAA 421PA 1LSSA 4H7JA 3GJSA 4ZGWA 3PRHA 5JPDA 4QGBA 4M1WA 1O77A 3KFVA 4JLWA 2QBYA 1E8MA 2RAFA 2QNIA 4MUMA 2XMSA 1L5KA 5FBRB 1ZRMA 4WOPA 2VLIA 3PQ8A 5FUWA 2CSUA 1STOA 3JQAD 2RHWA 1SZDA 1H9BA 3PNLA 1RMQA 1DQZA 3RWMB 1RAFA 4PRKA 3AF0A 4ZCMA 1RMYA 4PGMA 3ZVRA 3KHUA 5LKRA 3NM4A 1PJRA 2BW0A 1HMYA 4X64B 4HQLA 4GI2A 4MQ4A 4IS3A 4QASA 1D6JA 3QIAA 4CTNA 2Q0SA 3DE0X 1L7PA 2P2LA 3P2YA 5EKUA 5HIMA 2GF9A 4FYVA 3OT1B 1DRKA 3NETA 4L8YA 4PSCA 1ES9A 3QLJA 3KQUA 1BRTA 1Q1AA 4NU0A 1W5FA 1G59A 3TKAA 1NQVA 1HMPA 2JLSA 3TW8A 3IUBA 3UA3A 3OZBA 1IUKA 2PXAA 4NEHB 1C7FA 2X8JA 3H97A 3PPYA 1U0OC 5ED0A 3SVZA 3KR0A 2WU4A 3G0IA 4HS4A 4JYCA 5TEVA 4AMUA 1SN7A 5ECWA 1RPZA 1A9RA 1JSZA 1IUNA 2IOYA 4PYQA 3E7FA 4PBRA 1Y33E 1Q1BA 2ZYAA 1DRUA 2PRYA 1Q6ZA 2YFHA 4MGYR 3HC7A 3SGLA 2VJKA 5C34B 4DN6A 4TYNA 3PPWA 2JLYA 1OBVA 1RFLA 1S1MA 1D2EA 1CNMA 4YT8A 2CXHA 4P7GA 3TPFA 3L0PA 1MQ8B 1T6NA 1UK7A 3JQBC 1R4NB 1PFGA 2J3EA 2Z6VA 1WWKA 3TTSA 3JV7A 3QWBA 3OCCA 3EW7A 1PGNA 1NM5A 4EGSA 4LJSA 1N2XA 2X22A 2IYFA 5CFNA 2ORWA 4GSYA 3FIJA 5E9JA 4ALKA 1KMQA 1WCXA 1S3IA 4FILA 3IS3A 2UZ0A 3EC2A 4M1OA 4FE4A 4DNOA 2G7ZA 4FWBA 1HKHA 2I8LA 1BH6A 2ZVDA 3HN6A 3L0CA 4TS4A 1DUSA 4G23A 4OO3A 1X7ZB 2I55A 4N4AA 4U1RA 3TB6A 5IW8A 2QU8A 3VVBA 4C3OB 1OH8A 1HDGO 4NV1A 2I2XB 1FMTA 1OX4A 4IGKA 2FA9A 3SXUB 1YZKA 3O0TA 3PNKA 4BRWA 2Q6VA 4DLPA 3I2KA 4E3ZA 2RGWA 4KR6A 3MD0A 4FX2A 2O5CA 2EWMA 1C8KA 2B2XA 2AUNA 2E1PA 2IYNA 5BOVA 2I3BA 2JHFA 3UMSA 4JWTA 3L7BA 3IELA 4P08A 2FPSA 4JDPA 4PZUA 2XZPA 2ZSAA 3VHLB 1E1MA 2HV8A 1AKMA 5GM1A 1UKBA 1W1WA 2AMLA 2FMHA 2K87A 2ZRPA 4PAWA 1EXMA 2OHGA 3G7UA 1JH9A 2A7XA 4TVKA 3AUFA 3V2GA 1A76A 1NFFA 2NM0A 4ZXFA 5LOVB 2JBWA 2NYAA 2LCQA 1AXGA 3D0KA 1GZ4A 3KUKA 3MG9A 4LX0A 4BO3A 5IN4A 1T5SA 3F9CA 5EEHA 5HWSA 3SDZA 1VGRA 1GN9A 4ZREA 4QOJA 1YH3A 3GLKA 4P0TA 4N41A 2YCBA 1GU7A 5H7XA 3S7ZA 1XDZA 1CZLA 4KN9S 3IUSA 2P2SA 1R0LA 3OM8A 5LXTB 4PRZA 5AVXA 2OENG 3AM3A 4RSRA 1VSBA 5CLFA 3AHCA 4GHWA 5CVVA 3CVOA 5DN6D 1OA0A 2JCSA 2Q6OA 3ANTA 5KSWB 5C8YB 1EDZA 3PCTA 2FQWA 1K63A 4MTLA 2LKCA 5HCUA 2BCEA 1TCAA 3RVBA 3K35A 2O2IA 1DO0A 3RW9A 2RHLA 1RJFA 1NXQA 4FDUA 2ST1A 4G85A 2F8TA 2VDVE 4G1FA 4JL8A 5AOBA 3ZNNA 1T4CB 3D4IA 1W9HA 3IVXA 2JK0A 1W0KA 2Z8ZA 4IL5A 1PYDA 1FDIA 4B9EA 1NXWA 3BXOA 5KOHB 2QVCA 3CMCO 2B1IA 4E2XA 1BROA 5A5FA 3FKSD 2QG4A 2X4GA 3KZVA 1KAQA 4IXMA 2HIGA 3A4VA 2C4MA 4S05A 4R8SA 5IDQA 3NV9A 2WJWA 1L9XA 3WX0A 2VKTA 1Z4OA 4PX2A 4ZTBA 4PAGA 4PZPA 3V2UA 4K7JA 2O6LA 1E2BA 3CX7A 3KDAA 4G9BA 4G01B 2HC9A 2VVTA 3NIWA 4O8CA 3CZCA 2LKDA 4ID3A 1GGNA 3WL4A 2BI4A 4JYMA 1JDJA 3WXMA 1TMYA 3QEJA 4YJHA 1F6WA 5DOVA 3VJKA 4OQDA 1C1DA 1M6WA 1Z6AA 2WU8A 3STHA 4A4DA 4EFNA 2H0RA 1QIFA 4MGZR 4U6SA 4OLBA 1GSAA 2P62A 1JN0A 1Y8RA 2CE2X 3H1TA 1WL8A 3VQTA 1GL9B 1ZJYA 4MAFA 2XB9A 4QT4A 3NC4A 2XZTA 2BM0A 2BMFA 2H18A 2P5TB 2XOEA 2ZIAA 2AUTA 4D4GA 1EK2A 3OH8A 4Q4LA 5KSPA 2ZTUA 2WUEA 1L5ZA 1XF9A 4PFKA 3TUJC 3WGIA 2LE0A 4FFOA 3T1NA 1L5RA 4LXQA 1CPYA 4JL6A 4FEYA 2J3IA 1TM3E 3TLCA 4E2YA 5JJKA 3E9YA 3EIOA 3DL4A 4RK1A 5IXYA 1CZHA 1QIDA 2WIGA 4WNCA 1I9CA 2ZTHA 4L8VA 3RBZA 3HXMA 1VXRA 3IDZA 1Z26A 2XQJA 3QUAA 4HADA 4J4HA 4URYR 1W9MA 2BUBA 5AVJA 3TI7A 5JXHA 2NOAA 2YJZA 1WXDA 2QRJA 5K45A 4B7CA 3V4PB 5TMBA 1VLVA 1E60A 1HNZB 2G1PA 1RWKA 3NIFB 1YIOA 1M6NA 1OU0A 3TLGB 3ZGOA 3ZLVA 4EUEA 4ONEA 2IP4A 2WWIA 1YZTA 3GLVA 1X13A 1Q0TA 4KO8A 1IOVA 3WK5A 3PUKA 4A91A 1ZY2A 2XNCA 5IC6A 3UHFA 2JFQA 3DB1A 3NPAA 2PT6A 1IM8A 2HMWA 3SZRA 3V97A 1GPWB 4KMRA 1U3WA 2DBYA 3KAKA 3AU8A 3OQIA 4LWQA 1RVV1 5KDLA 4PC6A 3UBTA 2H7YA 2HI0A 1W0JA 1FYVA 4QC2A 1WOMA 1BWSA 1KQ3A 1DAEA 4LXXA 3V8BA 1NY5A 5JYEA 5J1SB 2JLWA 5SICE 2EKPA 4LTMA 2CNBA 4KC0A 3AINA 3FBTA 1KIMA 2Z5LA 1ZNZA 1QFMA 2W2KB 1ZD5A 5SZKB 2MINB 2FN7A 2G5CA 2PAFA 2OK7A 4MW5A 5F7OA 1M33A 1SZPA 4XWOA 2QB5A 4DUGA 4X6YA 4O4IA 5DYNA 1TQ4A 4HN4B 4Q7QA 2Z3ZA 3W79A 1NBWB 4BO8A 1A97A 1QFJA 4F5ZA 4B71A 4IFIA 1MC1A 2B7BA 1DG3A 4X6XA 2C5GA 4UXIA 1KSGA 3ADDA 3SEQA 3BFXA 4G09A 1IEVA 1OWNA 2HREA 2GNOA 1QNLA 1ZNYA 4RDCA 1UPBA 2IYQA 1M2NA 3BSWA 2DC1A 4U6NA 1JH8A 3X1DA 1AMNA 1UFOA 2C2GA 3AGQA 3FWYA 5LNK1 4OYLA 1H3FA 3H0KA 1BOFA 2F9MA 4DLYA 4L9SA 1JPNA 4I1PA 3OUTA 2JEOA 5ALNA 5DTEA 3RFVA 2Y6VA 5KTRA 3EA5A 2LBPA 1PT7A 1YASA 2X1LA 4MWSA 4RF5A 2AKEA 4X20A 5BQPA 1SU4A 3RGGA 3TG8A 1O58A 1MG5A 2ZOSA 3LKZA 3PHIA 1VG0B 3MQ4A 3CO0S 3UT5A 3II6X 3GL9A 4RLQA 1IWPB 3ND8A 2EKZA 2JDIA 3U3OA 3PLRA 1F8GA 1JJIA 3TBKA 3ZZNA 3ZKWA 3CBGA 3WWDA 2J0QA 2OY0A 3UAGA 1FNMA 2WA1A 5K6AA 2IEDA 3OPMA 1G19A 4TLDA 3K0CC 2Z1MA 1HDXA 1DBVO 1N2JA 4MUIA 1X1SA 1C3VA 1Z2NX 4G0ZA 2BE9A 4K1XA 3JVVA 4LGCA 3TGWA 4NG5A 3HTXA 1Z3CA 2RSLA 3R3XA 3FJYA 3HEMA 1RI3A 4MV8A 1DHTA 3ZUPA 6ADHA 2WVGA 5ELLA 4D99A 1L1FA 1W96A 3D5QA 3MJDA 5CHEA 1O9GA 1K7XB 2NTVA 1UT6A 3V5NA 2R7LA 3QI2A 1IATA 1RCTE 2ZQ5A 1QIJA 3JQBA 3PXUA 4HWRA 1M8KA 3NM5A 3T1OA 2GAFA 2PD4A 1JBKA 5SZHB 3DHNA 1XSEA 2ERYA 4NZYA 3R7FA 4DLKA 2NLOA 4E94A 1NHWA 3BJEA 3RUPA 3S2ZA 2AQ8A 3H13A 2V7PA 2O7VA 5JNUA 2H4YA 3CT4A 1GEEA 3WKCA 2HN9A 4BVEA 1VI6A 1N25A 5FUBA 3RH0A 2OVBA 1IZZA 2KMLA 1QX3A 2R7NA 3DCYA 3L8HA 4JA0A 4BE4A 4S04A 4RF2A 4ZKDA 1JFRA 3R4CA 3D3WA 3TBFA 3AT1A 2HMYB 4RZ2A 1IM5A 2OBNA 3DFIA 3AV3A 5EQDA 1KWGA 3K1AB 1YB6A 1HDIA 3EQ7A 3PF8A 4MPJA 4BU1A 5AKKA 1MJNA 3R7WB 4WBNF 1HX7A 1AKTA 1NQ5A 1NZFA 1I2MA 3DZIA 4HWGA 2QTTA 3B1FA 3C39A 1NWCA 3U2QA 2JK1A 4I1YA 1KZYC 4DBLC 1GVHA 4GRDA 3STUA 3O3OB 2I34A 1I2ZA 1KTIA 4PGFA 5IF3A 4LHXA 4D8WA 4FFNA 2ZYIA 4QJ4A 1UFKA 4LRYA 5BQFA 3B38A 3RQIA 3TLAA 3ZWAA 2SKCA 2VHZA 4CE6A 3ZPXA 3DKIA 5KVVA 4IIJF 1E1CB 2LV8A 2PSJA 3OEED 4MZXA 3NT4A 4RZ3A 5TVGA 3UOWA 2ZCUA 1UMDA 2NU8B 3DTVB 4NFLA 3U0BA 1A2OA 4TKLA 5EL0A 3KR9A 3TG2A 1Q1EA 1COWA 4E0BA 4LBZA 2ENWA 1A98A 2VXBA 5DGTA 4ZVUA 2ZTMA 3JD1A 2IHZA 2QUBA 3QEMA 2P1DA 4IH9A 2JJ8A 2HIMA 2BSXA 3MOSA 2I22A 4Q9KA 1NKTA 2QXTA 3KAPA 4RMJA 1Y0BA 4GR5A 1G5QA 3PDCA 3LP5A 4MYTA 4V2UA 2ATCA 5DWDA 5EP2A 1GUYA 2EHDA 5C3UA 3ZI7A 4BS9A 3O8DA 4H0CA 1M73E 1O6GA 3Q9NA 3TCNA 2HW8A 4O2LA 3W77A 1QYCA 1C7ZA 3QKRA 1Q6YA 4HB2A 5DX1A 3KQOA 4J76A 4YWHA 3E05A 4MR9B 1W73A 5CYPA 3LGSA 1LBHA 2QR2A 4R6WA 4F21A 1U8CB 4UTRA 1NT4A 4AF8A 3QFTA 2FPWA 2NAFA 4BQFA 3OE7A 4Q7LA 4EO4A 5JZMA 4C2BA 4GKJB 4INAA 3WYDA 1G4AE 3H5VA 1AGXA 2G5PA 1R0ZA 4G0WA 1I33A 3PYMA 3PGVA 3O26A 3UKDA 4BNLA 4PHHA 1PJLA 4BNJA 4GL2A 2HY7A 1EUYA 4Q93A 1X7YB 3UV7A 3FH0A 1NBEA 2PDAA 2BP7B 2C54A 1MKYA 1QYRA 4A73A 3GWGA 1UFQA 1XZPA 3GDFA 3HHEA 2Q1XA 3VSBA 4XWWA 2EXXA 3GLHB 3QUBA 1TLTA 2HRBA 2IYVA 4U7JA 1KP9A 3O1HB 4UUOA 5LP1A 3MELA 5F3RA 3UC5A 2AR0A 1D9XA 2VJCA 2ODWA 4PPFA 4IDBA 1VHTA 3I12A 4DPMA 1U80A 4W7IA 5EIOA 4Z2YA 2JD1A 2O0HA 4BDTA 3BRSA 3HABA 3OA2A 1GLGA 1PQWA 1WE2A 2CDNA 3PT9A 4I3FA 4OLAA 5FUXA 3VC3A 3ZTTA 5C7YA 2EZTA 4P4LA 3UJ7A 5KNLA 4L57A 4FKMA 3PR3A 3PXXA 1M2OA 3AMVA 1BDHA 4N5IX 1U2TA 2WJZB 4YJGB 2CV1A 2QJFA 2PV0A 3KKOA 3R0QA 3SMQA 2VBCA 5GJWC 3DMPA 4XYGA 5BQ5A 1URPA 1YJXA 2FTKE 2J5QA 4ZVOA 2ZDHA 2JIDA 3NDJA 3C7CB 3NASA 5IX8A 4QVIA 2C7OA 1E5VA 4II3A 2C3OA 3FTQA 2QX4A 4TMKA 1A88A 4BAUA 1MPTA 4ND5A 1GDDA 4NOJA 1USKA 1BDMA 4OU5A 4TKUA 1R15A 2X0DA 2AI3A 3IJ5A 3N9IA 2NXEA 3TDKA 1Z5WA 1US8A 3EEQA 2XYRA 3DCJA 3FWHA 3OFJA 3P2EA 3VBEA 3QYPA 3ZXXA 3MINB 1I30A 3WWYA 5ALJA 4L0DA 2XD4A 4R16A 1W1IA 2XZDA 2V45A 4A6DA 3IIMA 3PSAA 3FVRA 4RSMA 1UQUA 2A0WA 4ZC1A 3HCFA 4DIOA 1YBFA 3G68A 3I62A 1E2IA 4HB3A 5J5CA 3OLCX 2VDJA 3HWRA 4W6QA 1AZWA 3K4HA 2XVAA 5DTMA 3S1AB 3E35A 2YY5A 2K2QB 2O1XA 5CGZA 4B33A 1UEIA 3ADCA 5EY5B 1BU8A 4UJ5A 3WGZA 4BNYA 4CKCA 5DGXA 4BLTA 2VNJA 1G3QA 1WVIA 4QAQA 2H3HA 3MJSA 4GW3A 3U61B 4XGNA 2HRDA 1G3UA 2FJPA 2J41A 3FI9A 3R41A 4GNKA 4XDYA 2NVBA 2BKLA 3HA7A 3ICQB 3D3JA 1LJ8A 1J5XA 3CGWA 3Q41A 3SJZA 3DR5A 3LSYA 5IUJC 4KGDA 4CG3A 2VHXA 3OIFA 1R66A 1XAIA 2IDMA 4PQRA 5DW3A 5ULLA 4GP6A 4CLOA 4YHHB 3TD2A 4D42A 3H86A 3WMRA 2QRPA 1CF9A 3KVYA 4NONA 1WVMA 2J46A 1ZGBA 4NX2A 4MGHA 1UXJA 1P1JA 2WY2D 2QNBA 1IZ0A 2AGVA 2UVPB 2Z3VA 4FDMA 1CUIA 5HBRA 5ICGA 4I4TF 3FZGA 4WLVA 3F4BA 5DM4A 1OHHD 1SCAA 1ESZA 3LBHA 3O8QB 1G21E 3PUZA 3LY8A 5TARA 2ILVA 1GCIA 3EBPA 1GCUA 2IZ1A 4BB9A 4X66B 2R5FA 2I99A 4RTOA 3OKAA 2GBFA 3FF4A 3HY6A 2L2QA 2ODPA 2ZB4A 2A30A 1XMPA 4DJJA 1GPMA 2BFOA 5DCLA 4MV0A 3O4IA 5FWYA 1DFHA 2Q41A 3D2CA 3KVVA 3DDHA 4F2GA 3UJDA 3FWKA 3GFFA 5KWJA 4D96A 3DYBA 2VPTA 3A10A 4F93B 2ZI6A 3CR7A 3GJ7A 3L1VA 4CUZA 5BY2A 4P93A 5KAMA 1MN6A 5HKAA 5KYXA 3VVCA 3R9XA 6CHYA 1Z4NA 1ZR4A 2BTEA 1EBUA 1NVKA 1WTAA 4JBYA 1KJ9A 3CLSD 3QU5A 2B25A 2XOKA 3EGDA 3HU3A 3ZVLA 1QS0B 4CRWB 4E7PA 3KSAC 4JNCA 2IYUA 4QO8A 1GQYA 5AJVB 3OZVA 1NQXA 5DBHX 3WV4A 5CBKA 3EIHA 3MT9A 2JAXA 1JR6A 1FUEA 4KV7A 4B3JA 4Q12A 1MTOA 2XB2A 3QY9A 4C0XA 4Z6KA 1BAPA 3QE4A 4ZAZA 2G9VA 3LG2A 2L17A 4HEJA 5E0KB 4JD5A 3NWPA 1YS2X 1C41A 1L4EA 1JHMA 5J5AA 4CM5A 3CKYA 2XCUA 4JUCA 4MVJP 1O6FA 2VYVA 1R3UA 3IUJA 1JVNA 5ECGC 4DT1B 4EA6A 3PQCA 3K7EA 4EFKA 2OSVA 3A9SA 3NHMA 2IUSA 5HRUA 4C4YA 3COJA 1SEPA 2MSEB 3SIRA 3VPCA 3QJ5A 1JVSA 5LZ4A 1XD9A 1W5TA 1W4RA 4UU0A 1EVYA 1P1FA 4UMDA 2PAAA 1I4LD 1QVWA 2ZSFA 4PSVA 3TFWA 1MOPA 2FG6C 1YS9A 3BF7A 5EGNA 1PT8A 1CZRA 2WU3A 4DLZA 3ZHVA 2QNRA 4IW3B 2P2YA 4RFSA 2RCYA 3DONA 3FZQA 4MS1A 3K0KA 3PT5A 5CA1A 2REBA 1RQGA 2IHYA 5FQOA 3VH2A 1OIVA 1TUGA 4B9AA 1DE0A 3FGOA 4PO1A 4EY7A 5AVKA 5BVGB 2HQ1A 4HXYA 3U1TA 3AETA 2ET6A 2R44A 1L5MA 4FSDA 2GTPA 1BHQ1 4UU7A 3UMVA 4EIWA 4NJEA 1X0XA 1E2HA 3A6HA 3D43A 3P2OA 3CNNA 3LZDA 3HNPA 4PQFA 4W5WA 1WZIA 1CY6A 2TRSB 3NTQA 1Q1NA 3AKCA 5LMNB 5E7JA 3H9GA 3FHTA 3EH2A 2NUTA 1M8PA 2F2TA 1KSFX 4K2HA 5HIAA 5KDDA 4LKOA 1DDIA 4GBMA 4H1HA 5FBZA 5HP4A 4PAMA 1JR3A 2C9ZA 3ZHOA 2ZYGA 5ALVA 4FFRA 1WB5A 2G36A 2IU6A 3AEQB 1U7TA 4CG2A 4E15A 4C0JA 1TFRA 1DPGA 3PRJA 4GI3A 2PUFA 1IMJA 1EWQA 3FHOA 4GM4A 4HYQA 4JJZA 3WWZA 2Y1WA 4A16A 2FW9A 5J47A 1BZYA 1PNTA 2VH1A 3E5NA 2G0AA 1ORTA 2O1WA 3IEUA 3O47A 4K1LA 1BYUA 1E79A 3Q3IA 4KJXA 2CF5A 2FSFA 3UXHA 4A3SA 1G8GA 4DDMA 4B1FA 1XTTA 4UE3S 3V6LA 2FP4A 4S1NA 2IQIA 4RA9A 5HDBB 1PL8A 1R00A 2AJBA 5KPDA 4I4IA 4K5QA 4I50F 3IB6A 4JT8A 1F9EA 5EZSA 2F8MA 3DOJA 3EDYA 3GEPA 3GH3A 3OEYA 3S1LA 2XODA 1HYEA 1OJLA 5CCEA 4OI1A 1WXXA 3H6HA 2AUMA 3UXEA 3OE1A 1K98A 1OLUB 4YMTA 2R60A 2C8VA 4D4LA 1GQQA 4B84A 2JAPA 1KZHA 4YCCA 4L2IB 4WKPA 4DGQA 2Q9CA 3KWFA 3UJHA 1O94A 2WSMA 2XV1A 4MDFA 2BISA 3AHFA 3TZCA 2DXIA 1Y7IA 2D7JA 4C0QC 4BPBA 2ZUVA 1YXMA 3PEEA 5AVRA 4PYJA 5JADA 3OZWA 4BO7A 2C8JA 1JW9B 3BXHA 4H1VA 4R0NA 5K4AA 5REQB 4B6JA 5KYTA 4KXFB 4DWJA 2I3GA 2I3DA 1J49A 3UGKA 5J43A 1FRZA 4PFJA 3EZ2A 4H17A 1Q3HA 2IIQA 3NIDB 2GBCA 3DO6A 2LZ0A 4JODA 4C6TA 5KQMA 2JGDA 3IOCA 2CFCA 1FQKA 1KBZA 3A6ZA 4C6HA 4Y1FA 4JZKA 4EY4A 3K30A 3KOYA 4RJIA 3T38A 5KJ1A 1WU8A 4CI0B 5IZCC 5LPNA 1CR0A 3IKVA 3PQFA 3L1UA 4M9RA 5COQA 4AO6A 4BWFB 3LZCA 1G4HA 1IHPA 5B6JA 1EFVB 3W6UA 1MCZA 4EHLA 1TIPA 5BSGA 4FMBB 4JOCA 1JI0A 5CLHA 4DS3A 2H57A 5AT1A 3Q8XB 3VX4A 1Z73A 2VF5X 4DDTA 5C5IA 3WNBA 2QZSA 2BHRA 4ZQCB 1QNFA 4Z3DA 1AQYA 1EWVA 2DQYA 3GROA 3QUTA 3EFOA 1VRWA 4EUSA 2YWGA 4MEAA 4NPAA 1KF0A 4ZVVA 3QBJA 3K0AB 1Z0IA 2BGMA 4JC8A 1R9MA 1GL6A 1MRZA 2WSIA 3WISA 7REQB 4ALMA 4N5DA 4C4XA 1JLHA 2CL5A 2X42A 3QOYA 4G56A 1KVTA 1P75A 3KTDA 1L8OA 3MN1A 5DP1A 3NJ8A 4KVFA 4DBVO 4Z5XA 1YKGA 4G0VA 3JZFA 3KX2A 2NTJA 3K1TA 1R64A 1TTTA 1HLGA 1RU3A 2FOXA 1P0MA 4IMPA 4B3BA 3OFVA 1SD1A 5K0TA 3PHLA 3O2JA 2OV3A 1SKQA 1RWMA 2BMAA 2G71A 3C4QA 5ER9A 1SA0A 4R8MA 1QK3A 3FLAA 1F8FA 2FVYA 3WIOA 4GZ6A 1HWYA 3ZW9A 5AFSA 2QLMA 4AYWA 3THWA 1CVRA 3HKDB 4WCDA 3RU9A 3AR8A 1IG0A 3L7AA 2Z5GA 3H9BA 3T3PB 3OKCA 4KQGA 2C3PA 1HE4A 5CX1A 3GLIA 2AOTB 3WZ2A 1G6KA 3UT6A 1Z28A 3BULA 1F12A 1BQ3A 3GN1A 3QX9A 3U3KA 1CE8B 1LPMA 2Q2VA 2PUJA 2X23A 3RAEC 1E1DA 4UD2A 1MO4A 1FFAA 5THXA 3UJ6A 5D86A 1PKEA 2FEPA 1ISFA 3L6EA 4NZ9A 4RV4A 5AKEA 5H82A 2X0IA 1ORIA 4QELA 5ISMA 3I2IA 1QE5A 3EVBA 2W2LD 1AB6A 1DDOA 1NI5A 4KACA 4KE9A 3OLXA 4QQ8A 2P6PA 4TVOA 1NFRA 2D54A 2JZCA 3ZJ5A 3H2JA 2PLRA 2PBZA 4GOLD 2DWOA 4A2WA 5HNKA 3PUJA 3H7AA 1S4MA 3B9QA 4KBFA 4RACA 3VNQA 3EDMA 3NGXA 3G8DA 4NFHA 3TOVA 3UB2A 3UMFA 1RYNA 2H4XA 4HQOA 4OQYA 5JNWA 3T61A 4YRCA 1UBOS 4IIBA 4X92A 4ZXPA 3GCZA 2E1RA 5D3QA 4AF6A 5D1NA 1I24A 1JEQA 4WVLA 3WR5A 3UWMA 4DARA 2FN8A 3QH4A 4D9CA 2IEYA 2FE1A 3N75A 1RPNA 4MVJA 1ZKMA 2FY8A 2NN3C 1YJQA 2P90A 3PC4A 4JLMA 1D0IA 5B58C 1A8HA 4KXVA 3AVUA 1G17A 2GN4A 2FCRA 4TVBA 3IJRA 5L6MB 2QD5A 2AD1A 2RONA 3K1YA 4M38A 1T1SA 1KJNA 1O7JA 3M6MD 4LMBA 1H2BA 4KYTA 1KKMA 5F5LA 2BAGA 4OI2A 2FPPA 5A1TA 3W06A 4PWYA 4TMFA 1U2ZA 3FYHA 3U7GA 2XNDA 4MUAA 2IUFA 3C5EA 3EF3A 4FFPA 2XDQB 2F62A 4AP5A 3PP8A 3FFAA 3JPYA 5G3YA 4BAGA 5FTMA 4HVCA 1PQYA 5CVEA 1C4WA 1Y8QB 1A5TA 3KQLA 2BUAA 1Z6TA 2CL0X 3ZWBA 1LDEA 1HOTA 3MERA 5H80A 1N8KA 3GUZA 3GNQA 4C87A 4LX8A 3Q8MA 2VSNA 3ZHYA 3DOFA 1DIAA 2QTCA 3L7KA 1U8UA 1XKQA 3DDNA 3EXFB 1V0JA 3KQPA 5D84A 3ZTYA 2XWSA 1SG6A 3H65A 3M33A 1VPDA 2FK7A 2NU9A 3E22B 4MV6A 4MMXB 4NZMA 4KITB 1TT5B 2CBXA 4X1OA 1TZMA 1CYDA 4R1QA 2W48A 1XZNA 3DE2X 2QD4A 5IKPA 3I8XA 3RC8A 5IARA 2OFFA 4TYPA 1U9JA 3WQBA 3QEBZ 3DLBA 4HOYA 3R44A 3DMFA 4RX1A 2Z2YA 1H2ZA 2XDYA 3K5WA 4OFZA 3HXKA 1WY5A 1DX6A 3QVXA 1NDQA 4BGVA 5CH8A 2QD1A 3QVGB 4PCLA 1VOTA 3ZDXB 1W76A 1ABFA 3A37A 4HMQA 3ZOZA 2YMLA 2BTQB 3U60B 2RK3A 3RUHA 1ZGZA 1Z5OA 3A3NA 4BUZA 1PS8A 3H5OA 4Q3KA 5JWRA 1UKVY 2WUWE 4YV7A 2OVFA 4DDWA 2A1TS 1R5NA 1SHKA 1XTKA 3GLGE 4BUCA 2AR7A 1VL1A 2GRUA 2QVGA 4DR5B 2BH2A 1EQUA 1ONNA 2BEUB 2GF2A 2JATA 1H5NA 3C98A 1SWVA 3PJEA 5FOTA 4EG6A 1XRMA 2WM9B 2GUWA 5IH7A 4EBFA 4CCSA 3CBQA 1JECA 1XPJA 5GY7A 3W0LB 3AR5A 3FGPA 2BDUA 5BWMA 2JLRA 4M0EA 2D4HA 4O2AB 2CXUA 5K8IA 1SNYA 1Z5NA 5FPKA 4URZR 4BBZA 5H9WA 2OMKA 2DHEA 2FUG1 3FRIA 4K0RA 1ODIA 3IP3A 4MUJA 4Z0TA 3GWZA 4PO3X 1UJMA 5A0FA 1RYZA 3HBMA 1R4MB 3K4QA 3HJGA 3PE6A 3VZCA 1DQSA 2IHTA 4F8YA 5LVAA 1ZSYA 2C9OA 1KO4A 3FPFA 2D2IA 2PBLA 4UOQA 4OYHA 2HBZA 2ZSJA 4IUBS 4MV9A 3SXPA 1NDUA 1QHNA 1SUDA 1KE2A 2YX1A 1B8VA 4X7BA 2V9ZA 4FB4A 3DMTC 2JGRA 4CFZA 1BDJA 1L8QA 3RCBA 3STXA 4QNNA 2R3SA 3KP1A 3RPEA 2YWEA 5FCDA 4YR9A 3GMDA 2AN1A 2CLMB 1XTUA 1QCYA 2JFWA 4LHSA 3R9KA 1L5SA 4EL0A 3NWBA 4TWBA 1SU7A 3LOUA 1JP7A 1UDCA 3KHTA 4FDVA 3TW0A 5IEJA 2FFBA 4ZVRA 1LCIA 5BR4A 4C3UA 2YY6A 5IDYA 3RLFA 2G1AA 1APBA 1R4NA 1TM5E 4BBJA 2OO7A 1YGPA 2Q1TA 3BWCA 4GZMA 3M9LA 2VFAA 1YQUA 4POAA 4KW7A 2ZRDA 5IKMA 1RWBA 3ZZTA 1Z6PA 1ZC3A 1N9KA 2QX9A 4B6FA 2UYYA 3MXTA 3T5DA 1XZQA 3MEQA 4EHIA 1UAYA 3E7XA 2V9CA 4RHEA 1JKMA 4I9HA 1FP7A 3CIFA 3LZ6A 4CFSA 1HM5A 3DPSA 2DBZA 4C21A 2DWQA 5T57A 3IQXA 4DPKA 4YV1A 2PWZA 3WIVA 4NICA 5LB2A 5J3JA 3CQ9A 1X7ZA 2Y1XA 2ZAOA 2P3SA 4JQYA 1QVZA 4L3OA 4D97A 5IRCD 3PCXA 5HVNA 3RSCA 4EJSB 1YRAA 1E3JA 1PR9A 4IJMA 1ZVJA 1E2EA 1G3IA 1KK1A 1P61B 1MB9A 1X8LA 1U9CA 4MWOA 4MVJH 1E3EA 4M7WA 4MA0A 4V02A 5G1OA 2ATEA 2W2PA 4YCLA 1E6WA 5FPYA 4KK4A 4U9UA 1FLDA 3TVYA 1SQ6A 2W6NA 3N8KA 3T0FA 3KETA 2WA2A 3T5GA 3UGTA 4C5BA 3REGA 2GDZA 5C46F 3R2JA 3TCXB 1Z34A 1E61A 3IH5A 2CHGA 2JFPA 4B4VA 4EVRA 2QZJA 4HV4A 1AQLA 3ADOA 3WQHA 3U81A 4EO9A 1NSTA 4OFXA 2VUHB 4M88A 2AXPA 4HAOA 4LNHA 1W48A 3MTBA 1DTEA 3KU4A 4XJXA 2QN8A 2WDZA 3PFBA 2FFHA 2UYOA 3W8DA 3LPLA 3MCAA 3IIIA 3H8SA 1VB3A 2VHCA 4X90A 2DHDA 4YV0A 4DAOA 5LXTA 4NNOA 3ICEA 2WM3A 3T52A 1XMSA 4CODB 3KEMA 4E1BA 4JLPA 1K7FB 4HH3C 3V7NA 3I1FA 2IV7A 4CCAA 4AJHA 3HKBA 1YE8A 3C6MA 3OCYA 4PF1A 3V7UA 5C53B 4ZYUA 4EW3A 1V2HE 1L5VA 1V1MB 2ZBVA 3EHEA 4JEMA 2CLCX 1C3OB 4KWEA 4Y8VA 1QK4A 4HNQA 1U4NA 2COKA 5FWXA 1Q0LA 2FOIA 3INNA 1AK1A 4CIXA 2HF8A 4K9NA 3O4RA 3CX3A 3KEGA 4U2KA 4ZT7A 5EE1A 3V00A 3VOAA 4AVYA 3I92A 4L75A 2ZJ6A 2KB0A 4RHXA 5JH7B 1T4CA 3GAZA 5JAPA 5IVDA 1FDOA 4FIDA 5JFTA 5A4DA 3ZLJA 1WXFA 5G0SA 2XE4A 1RYDA 4IIYA 4L5AA 5KOHA 1M1NB 5TT1A 4WECA 1Q3TA 3WV5A 1FXUA 1Y5IA 1M7HA 2NQ8A 1A5AB 1N5KA 1O54A 1ZGHA 2B82A 3JYOA 2Z8YM 2XQGA 4CLHA 2JLXA 1K97A 5CTJA 1W1UA 3TQIA 2QTRA 2RHMA 2Z04A 3ORSA 4MHOA 2FMKA 2ZBUA 3FOEC 1DJOA 4S24A 1E59A 1TUBB 4HJRA 1M2KA 2VYNA 3R8XA 1WMDA 2C8LA 2KYRA 2RJNA 2WPDA 4LCEA 3FYCA 4ZJPA 3CSUA 4OQZA 3ZHUA 1N5MA 1VYVA 4BP8A 4UEWA 1CY8A 5AW7A 3OSZA 1ZD9A 3M2PA 2ODBA 5TMDA 4L5CA 4DIBA 1V7CA 1J8FA 3Q5EA 1KYYA 4KUEA 2VSXA 2VAWA 1CZUA 1U0EA 4XJSA 2CNOA 2L18A 5LLDA 2JJMA 3FMGA 1TMKA 3TLXA 5F3WB 1K0FA 3TTVA 2I4TA 3H0EA 3H1GA 3QLEA 1WLYA 5H16A 1VYHA 1EB8A 3JAWB 1N0VC 4X60A 5KNDA 4LZOA 1X86B 4KO4S 4LSMA 3PPXA 1XTBA 4YB8A 2AHOA 3WYGA 4DSNA 2QMEA 3GT0A 2C78A 5T4BA 1ETHA 2WB4A 2WG2A 3OQ6A 3BCRA 1YQGA 5MGBA 2PLAA 3CR3C 1WHTB 1ZESA 2A88A 2HOQA 5DNEA 5JVDB 4CR6A 4LRSB 1YRWA 1A96A 3RG8A 3BGIA 4LGVA 4US0R 3W04A 5M3BA 2HTFA 3VGPA 5BR7A 3CH4B 4NJMB 2GJSA 2VWPA 3ROGA 4PYLA 4GUDA 4JY7A 5TGDA 2IXBA 3M9XA 4YJ2B 4Z51A 1ZD1A 3GZTB 3TLGA 2X0JA 3AUSA 4WBSA 1KI4A 5F73A 1ILEA 4C0HA 1EUDB 1SVIA 2JVIA 1OKKD 2QLLA 2I7CA 2LP4Y 4I14A 1RZRA 2PZ8A 5LP6F 4B76A 4MV3A 3DEIA 3T4UA 4LOLA 3T7EA 1FK8A 4CCWA 4UFPA 4XOUA 2XVMA 2PBRA 5ALPA 5C18A 4ZOLA 3GFGA 3RFFA 1GLVA 3HN2A 3K9WA 4YASA 3GZNA 2C3UA 5T4FA 5F64A 5BO5A 2XADA 3IV7A 5F35A 1FNDA 2B36A 3GIDA 2XCTB 4CPDA 3D0RA 3ZDDA 3F0TA 1XMOB 3MJ4A 1E4EA 1UK8A 2C95A 1DINA 2HF2A 2HHJA 3MJEA 4MWEA 4WXPA 3CUSA 2PLWA 2W2KA 1ZNXA 4IQ4A 4RS3A 3L2OB 4X41A 3LXMA 5KOJB 4LF7B 4OH1A 1Y9EA 3M4NA 3W8FA 1VSUA 4RJTA 4P86A 1Z4PX 4BC0A 2AR9A 5EIAA 1B73A 1ISSA 2DKFA 2YHAA 3Q2OA 2GBPA 1POXA 1SGWA 5HK9A 2O9JA 1KTVA 4PLHA 1P6QA 5EUBA 4WK4B 5JCJA 3LM8A 3OFNA 3FWPA 1YVEI 2P2NA 4E08A 5EG5A 1FXWA 2A9JA 2YR0A 2B7LA 2GETA 2FDRA 1QHXA 2NXCA 4XCXA 1HEIA 1PS0A 3SG0A 1KYQA 1U8XX 2D59A 1R6XA 3HPRA 4UM9B 4JJKA 1JZSA 4KYIB 4QUBA 2Q99A 1DWPA 4BE7B 2IX3A 4II7A 4F71A 5AI9A 2VP5A 2X3YA 3PHJA 4CM1A 3KU1A 4F5EA 4WDRA 9LDBA 3MHTA 4YWJA 3HMKA 4NZOA 2QJWA 3MJCA 1X94A 3PHGA 5JARA 3N3AC 5TRTA 2YYAA 4BX2A 3BBPA 1P1HA 3BQNB 1P6UA 5IWAB 1NHGA 5CDSA 4R1TA 1L7AA 3DE1X 3ME5A 1E0JA 2BM8A 3AEKB 5IK2D 4RZXA 2W4MA 2ON6A 2QVBA 4NP6A 5TR9A 4NKRA 4Q1AA 2R97A 2FFJA 3DMTA 2FR8C 2N47A 3GX1A 1L6RA 4K9RA 4FNOA 3CX8A 2QG6A 3HMQA 4UVDA 1YRYE 5JO9A 1PT9A 4KYVA 2H7CA 2YJ6A 4MPPA 2BYTA 1J8YF 1JG4A 1YA6A 1A4XA 3V1KA 1TEXA 1Y5MA 1VE6A 2P2CA 3NBMA 4JX9A 3AU9A 1RS0A 3G89A 3HBFA 4E5SA 2J87A 3UQZA 5EAIA 5L95A 4J9VA 3RC7A 1MOZA 5GOTA 3X1WA 4CCYA 5CXQA 4H08A 3TO5A 1YK1A 1LC0A 3RTAA 3UUEA 4EG4A 4D0NA 1M67A 1DAIA 1KH1A 5KUTA 1OMOA 4WZZA 1G291 1SMKA 5B3AA 4IKEA 4BMZA 1E6UA 1K5PA 3EQ8A 2R6GA 1L0BA 3KEOA 2MSCB 1Y1TA 2N1MA 2FKAA 2VPPA 3A31A 3AY6A 1ZDMA 1ZPDA 3OOYA 4CIYA 4I3HA 3ZDRA 2XD9A 4AO7A 1H3EA 3LPCA 4B8WA 1Y63A 3UB4A 1KZ6A 4GAEA 1JHYA 1N0WA 2PVSA 3R7WA 1LS6A 3ZLBA 4YCSA 2OV2A 3A2MA 4YGYA 1NVWQ 3SDSA 1E20A 4PY2A 2Z0MA 5JAHA 1IQPA 1UZAA 2WP0A 5FAXA 5K99A 4GECA 3VKVA 5ES3A 3C70A 1SQGA 1U7OA 1RIIA 3BGOS 3NBQA 4HEQA 5CDGA 3EPJA 2PFSA 5KNDH 2LXNA 2V7UA 4GGMX 3TTXA 2SNIE 3OETA 4Y6SA 1JU3A 1NTRA 1NBMA 4ON9A 5IJZA 3UHPA 1EINA 3GT4A 1LPSA 2IYXA 1YIAA 4OEHA 5IJ0B 2I7DA 3TRHA 2OHVA 1E1CA 2IZ0A 3FA2A 2WQ7A 2DQSA 3VV3A 3ZX5A 3RBXA 2Y05A 2ZJAA 3DTVA 3C3WA 1X7XB 1P45A 2PSFA 5ADHA 3CM0A 4B3GA 3ZVKA 1WXWA 5IKXA 1D03A 4FCTA 4ZDJA 4YXWA 4QUHA 5F1OA 5KTKA 3SVTA 1VG8A 4R81A 3LKDA 3FPKA 2IUEA 2NO0A 4LDNA 4WFIA 1BGXT 1KEVA 2XJ4A 1TF2A 3DUFB 3OU7A 1T9GS 1LH0A 2P6NA 1GSOA 4WLOA 3F5FA 1HT3A 4Z1MD 5JALA 2R8OA 5B4VA 1YDGA 4C4PA 1P1BA 3M4XA 4N0PA 3HB9A 3DOHA 3VYRB 4D02A 2PJUA 1M76A 3ZU6A 4K03A 4G8DA 4A92A 1KP2A 1ZVMA 2PGLA 3CG4A 1RP1A 1CEEA 2QQ0A 3PFIA 1Q0QA 2FWNA 4ZHSA 2GO7A 1VMDA 3N0RA 5B64A 1YR1A 5FV4A 4G1MB 1NYRA 1KAGA 4N7BA 4Q6BA 1ISPA 4G0OA 4M0CA 3GRAA 1TVEA 3M6UA 4II2A 1PWHA 4A10A 1GTZA 4GS5A 3GO4A 5AKXA 3O90A 1ODTC 5D6OA 1X7YA 3LV8A 1T15A 2I80A 1NWHA 4PSUA 2VXOA 5FQNA 3TQHA 4A27A 5KTNA 3PEYA 2VUSA 2XB6A 4OSEA 2NO1A 3GRZA 1IXZA 3G2PA 3NAQA 3W5UA 2VK2A 1NFQA 1GNVA 2GK7A 2NACA 2PS3A 4NHOA 4DWOA 5H3LA 5T3YA 3GLHA 3AKEA 2H1VA 1Y5LA 4O6VA 1Z8FA 1NQAO 5BWOA 3O7WA 3U7JA 2WTMA 4MUEA 3RC3A 3FMVA 3TSOA 3N8IA 3SC2B 5HQ3B 3MLBA 5IFKA 4K6HA 1E9DA 1WUKS 1Z15A 2OSBA 3RS2A 2V3CC 3TM5A 2PCJA 4URHA 1II8B 3DC2A 2QTZA 1ZJ4A 4MB0A 3O3NB 5GVSA 1IG3A 1QTRA 4H59A 6REQA 2VSFA 1MB2A 3BB3A 3OO1A 1T8YA 2ZAYA 4ND7A 3FSEA 1ZWLA 2A7QA 2IU4A 4B6OA 1LF0A 3R1IA 2O8NA 3I8SA 2CLHB 4A8JB 3EX7C 2A0UA 3G2IA 3HLYA 3EZYA 5CGQB 1TQDA 3AOGA 3ESAA 4LVNA 4C01A 1KR2A 1GU0A 1R7RA 3KUXA 1QMGA 5JCPA 2PX3A 3K05A 1FC0A 1K92A 1Z5VA 5HE9A 4B0OA 3PWTA 2F6RA 4IV8A 3VR6A 3KZ1E 5I9LA 4ZO9A 4HLUC 4XLTA 1RAAA 3UYLA 2PA3A 2C7QA 2XDWA 4HYYA 4YMUA 1USIA 2H1WA 3HVUA 2BN4A 4L0CA 2NO4A 4NH4A 4WZAB 4CWAA 1TTPB 2GOYA 1JT9A 2HJGA 5FOUA 2GM9A 4L1KA 3VKFA 1E9RA 2NTNA 2I03A 2SHKA 2C07A 3FWNA 3KALA 4B85A 2BKAA 2BMEA 1KEWA 3D6UA 4FGSA 1ABBA 2OD2A 3K70D 1AUOA 4NTZA 2Y8EA 4OV6B 3BOSA 3D8HA 5EP1A 3H42B 3W2GA 3MINA 4RUKA 4EZBA 2RHHA 4MWBA 3UMMA 1TEZA 3AQ4A 3DZKA 3JZIA 3O4HA 2Q7XA 2IHKA 5IC5A 3NBFA 5CCBA 3QI7A 1ONSA 2J9ZB 1UZMA 3I30X 5K0LA 3IDAA 4OMUA 2WJYA 3TAUA 6REQB 1U8ZA 3WOVA 4MV4A 4KNVA 2AFIB 3DQZA 2C1ZA 5E6UB 3S1AA 1DQNA 3KBBA 3L5KA 4FYIA 4QBHA 1P5FA 4ZA2A 5TPWA 4AC9A 5F33A 1DC4A 2XR1A 1MV8A 4Z9FA 3DVQX 4AL4A 1R6BX 2J8ZA 1ZN9A 2OQ2A 2ZDQA 5F77A 3JX9A 2AI1A 1FZTA 3O93A 4PXYA 3ABZA 2YWXA 4HNAB 5D7BA 3KSRA 1U3CA 1XA4A 1YS6A 4MTCA 4G97A 4YO8A 1TE2A 2B9EA 3WQSB 2P9JA 2OP1A 2B0CA 3ZTWA 3MB8A 5AM3A 4PZ0A 2Z4TA 2A6PA 2R0QC 2FEOA 2WUDA 1ZFNA 1Z13A 3VR3D 1BE1A 3ZZMA 1XWWA 5C37A 1NVMB 2BI7A 2TMYA 3UCEA 2UVPA 3PS9A 1XZFA 4RK5A 1EZ4A 2C9YA 3L8FA 4ZEMA 2Y3IA 1E3MA 1BEZA 3PFFA 2XMRA 2C9BA 3GEEA 2Z43A 3O8QA 1N2CA 3AR2A 1N5DA 4GWKA 4DG9A 1D2NA 2UXDB 1E3QA 3QKSB 4OAOA 2YC4C 1FF9A 3G9XA 1ADJA 3QYFA 3I2JA 3H2KA 2RIRA 3MYRA 2V7QA 3JXEA 3LQYA 2HUNA 1CUWA 3QPAA 1FFSA 1E9VA 4IFTA 1MLDA 4E5PA 1EJ0A 3FCEA 3GJXC 1S5PA 3HWSA 4R2WA 5HFJA 3PJDA 4UMVA 1ZOIA 5LQMA 1VGVA 2X13A 3DVSX 4A0SA 3NH6A 4B2LA 2X4DA 4QHSA 2CUKA 4KXXA 1OGJA 2JIBA 3DHWC 1CUHA 5TDHA 3RFTA 1UBUS 4GLBA 4E4YA 1L8AA 1M5RA 4ROSA 5EHGA 3OG9A 1N78A 3FOWA 1XNQB 1R8YA 3DOIA 4XX0B 1L3IA 1UBHS 2OAGA 2PTHA 4UMFA 4OMCA 1JZQA 4Y98A 5DT2A 5AXAA 2FR8A 2GKSA 2Y1KA 4MUHA 5LC1A 2WF7A 1QS0A 1EFCA 1TA4A 1ZI9A 5EUCA 3WBJA 3WGLA 1K86A 4NI5A 2IPNA 4XXHA 5T3UA 3D8SA 3OECA 2VDUE 1IDOA 4IG4A 2VZ0A 1KK0A 3BXFA 2NMVA 4F4IA 2WAAA 2G1UA 1S3SA 1ZRHA 2R4QA 4L74A 2V59A 3VOBA 3UC9A 1MRSA 2GZ2A 2Y67A 3UGJA 1WXQA 2JJ2A 1VC2A 1I3MA 3HL0A 1ORWA 1ZQ9A 5FJJA 2XTZA 4J7XA 4DT1A 2CGEA 1C7RA 2SKEA 1WJGA 1YCHA 1J2TA 2WWTA 3TNDA 3ZGNA 1J5EB 4WSOA 5FI3A 1WDMA 4R1UA 1S02A 2BKUA 2FX3A 1GD1O 3OLZA 4J0EA 4J3JA 4EDHA 1OTYA 1L1EA 5JS8A 3KOOA 3D7SA 3LDAA 3CLVA 5LIPA 2PQ6A 2XAAA 3L77A 4PZCA 3CF4G 1EK6A 3NANA 5EJAA 4A23A 4N39A 4G67A 3W3ZB 5JD3A 2ZDGA 4IDFA 4V0NA 1RWWA 3CLTD 4QARA 1M8FA 4C6SA 3R7DA 3HB4X 1V5GA 1ZICA 2AFHB 3FNQA 3LYLA 4K9SA 2WZCA 4RELA 3UMJA 3VSEA 4WBNB 4EL5A 2XUHA 2C77A 3PGMA 2BRUA 2G0NA 1HXHA 5BVGA 2UUPA 1A5ZA 2C59A 4M49A 1GAEO 3AFOA 4MW2A 4LJ7A 4JUIA 4NXMB 2O5EA 1ID8A 4DV2B 4ZODA 3T1TA 3A4IA 4RK7A 5G0UA 4B2IA 2MCFA 4QL3A 1S9DA 2PKEA 3D59A 5BSFA 4GPZA 3A6LA 4HZIA 4GSKA 4FGJA 1EZZA 3VR6H 2ZR7A 2PEYA 1SC9A 1MGPA 1Y5NA 5ILOA 3IDOA 5IM4F 3H1EA 4LVCA 1NI3A 4PLTA 4P8RA 2IHUA 1I6LA 4QECA 4IIJB 4RO0A 3ST7A 2YZGA 5CT6A 4U0JA 5TXGA 4AIIA 3AEQA 4YGXB 3TS1A 4RULA 1QF6A 4H6PA 4DBZA 1IJKA 1OQAA 2OCXA 3GFTA 2BBOA 3SIXA 3ADBA 2VJMA 1U3TA 3B1XA 5DIZA 3UUFA 5JD6A 5EFZA 4JITA 2Z5FA 3MGGA 3VZRA 1NJGA 3IO5A 1FUIA 4RGVA 3ZU4A 2CHFA 2QRVB 3HCDA 2RB5A 4PLWA 3P96A 4JT9A 1M83A 4YJKA 4NS4A 3BTUA 4P4TA 4CDNA 4YFYA 3ROPA 5HX7A 2VH2A 3JQ9C 5GINE 4C2TA 1O96A 5KNBD 3M5CA 2XY4A 3MTGA 3FYTA 3IFSA 3AF5A 1V71A 1ZOPA 2J9YB 4L2IA 3ZH9B 1ZHOA 1WV0A 4RXTA 5A3QA 3FBWA 1L8XA 3UCFA 1ZCFA 5FI1B 1S8AA 3NU1A 3V32A 4F3NA 5L8VA 3NVKI 1Q21A 1AO3A 2GZMA 3P2JA 4HAZA 3U7EB 2YOFA 3F5MA 2B5OA 1BIFA 1H4TA 1Z6GA 5GJVC 3IPRA 2FRDC 3M70A 1QP0A 4B45A 1KAMA 2BONA 2W6ZA 4LVOA 1YB2A 2ZUCA 1XAHA 3BMOB 1E18A 1RQPA 1D4FA 3C3PA 3JSXA 4L0MA 5IFLA 3T3EA 4TRRA 3WK9A 1F2TB 1P0PA 1JFLA 3HZRA 4AWXA 1VHLA 3BWDD 3VMMA 4A82A 3RAGA 4D3FA 2GVZC 2ZR0A 2IW3A 1Q44A 4G84A 4NESA 4XYEA 2JFFA 3WLJA 4ZYZA 4EJSC 2EW8A 4MYRA 1EFVA 2JGEA 1D0SA 5TJHA 4FYHA 1SK8A 5JMTA 3O2NA 3ELUA 2HA7A 4W5TA 3BSSA 4W5QA 2Q4TA 4HMPA 5JLJA 3D5EA 2HBRA 5IP5A 2O7RA 2WTNA 4HFMA 1VIDA 3K0AA 2VZ9A 2JFNA 2YRWA 2OXRA 1ODCA 1SKYE 7REQA 5CYOA 3INRA 4HLUA 5FORA 3N2IA 5BORA 2ZU6A 5JSZB 2JI7A 3G0CA 3LRXA 1J00A 1P3JA 4CTMA 2VDOB 1L5WA 2Y92A 3KJZA 3VI3B 1NYTA 3ABSB 1VGQA 1CD5A 3LX4A 1SUAA 3GV0A 2UUAB 1RPAA 4I46A 5JC8A 4RCVA 1K7CA 1ZK4A 2QYOA 1P8JA 1SVKA 3JYLA 5EWLB 4CMKA 1TUIA 2IBSA 3VSCA 1G5HA 3HKDA 4QU9A 2QROA 3F8TA 4BTVA 1O0CA 4HAYA 3LTEA 3P71T 4C7VA 2ZRQA 4INZA 1DO2A 1QDLB 5C5DA 4QSMA 5TEWA 2H1IA 3FCXA 2Q6LA 2AOTA 5AW4A 4C20A 3ND7A 1IHDA 4J49A 3TM4A 1IY9A 1DXOA 1G4UR 1KO7A 2GILA 3WGMA 4EYEA 3OUUA 2CWDA 2H7VA 4CMIB 4D4IA 1CY4A 2C2YA 4U00A 4CV2A 1Y1PA 4L0QA 5GMOA 2QTVB 1I4DD 4GYYA 4EG5A 8ATCA 2R1TA 1LBEA 5BSRA 3ED5A 5KVAA 2VEOA 1GQOA 1T25A 3I28A 4XIYA 3TFQA 1HC7A 1T1EA 2X86A 1YL5A 3GVHA 4BQOA 2WHEA 3UN1A 3OM0A 1WSWA 1OYWA 5IULC 3A9WA 4PPQA 1E63A 5A5EA 4P4SB 2ZZMA 4S1WA 4NCAA 1EDBA 1LA2A 3AZPA 1W0CA 5ARDA 4XWTA 2WICA 2Y1CA 3DZGA 3JQRA 5DNUA 3PHHA 2ZVQX 3A4YA 3AKDA 4BLOA 2Q8QA 1C3EA 1XJQA 2OGWA 1KGDA 2KQUA 3TIGA 5C1DA 4KOAA 2QLJA 3ONDA 1RE1A 1IWBB 2O7QA 3NC0C 2D1QA 4KAAA 4XAQA 1PVOA 4CN9A 2IZ6A 4IVPA 4Z49A 2V6JA 3HBLA 3PFWO 1EBBA 4LJKA 4PU0A 4D80A 1XA3A 2GN2A 2HCBA 1SC4A 2YTZA 4X7PA 4UDYX 3TH5A 4IUDS 4CM8B 4ENWA 4L50A 4IWNA 1YK0A 1K27A 1E4YA 1R6VA 1MX5A 1W85B 4GLFA 4EAAA 4EB0A 5C7IO 3BREA 3NZEA 2MSKA 4N5MA 1QZUA 2XDQA 4PNZA 5AW1A 5KTTA 1RRCA 4F72A 2EOAA 3E3LA 1G20B 4ZVMA 5K3CA 2HNAA 2Q3CA 3DLTA 2QN9A 2NO7A 2GBGA 1HYGA 1ORRA 2I76A 3H05A 5ICEA 2CDBA 5SYAA 3T35A 1QFSA 2J5XA 1F2VA 3GLTA 3K32A 4G4SO 1E9FA 1HDZA 4MI9A 3U16A 1JYSA 5CNIA 1PFKA 3A58B 1YOVB 3EXFA 3SQDA 3THYA 1GTMA 2PG3A 3E22A 3MGAA 5JS7A 4Z4IA 4PGHA 1TT5A 5I7AA 2OZPA 3O75A 3OF5A 1PI3A 2X0FA 1NP7A 3AP3A 3KELA 5LYYA 2WUVA 2UYGA 3CNEA 4G0PA 4C4ZA 5JBIA 3T5AA 1KORA 2WEKA 4NYJR 5F76A 2W4QA 5CUQA 4HHEA 2PU5A 2AE2A 3IIKA 4M8LA 2XKAA 1SPBS 2JFGA 2ZIZA 3G5TA 5K0ZA 3P5SA 2IIBA 5EKTA 1JHAA 2WJ6A 1O97D 2GRJA 4GYJA 1QIMA 2ZBQA 3EGVA 2D74A 2BTQA 1NJ1A 1ND5A 3KLNA 3ONEA 1G2PA 1G8SA 2VTDA 5K3FA 3NIGB 1WSDA 4WY8A 3VTAA 2BWJA 1NIJA 2C83A 1EHIA 4AP9A 4QGHA 3GB9A 3HHPA 3LBYA 3WE7A 2QS9A 1A2BA 1K1EA 2VRNA 4MXDA 1S0UA 3EZFA 1JT2A 5IF9A 4BV2A 1P4GA 5J2UF 2BEUA 3SYTA 2K2WA 1XZLA 3AJ9A 4JHLA 3DO5A 4PONA 2POCA 2Q1SA 2BMJA 3BK7A 2H9YA 4BYMA 5AJTA 3EVCA 5AW9A 1B26A 1IZYA 1KOGA 4AMVA 3Q6IA 1J0EA 2WIFA 4XQ0A 3WWCA 1UJNA 1T0UA 4ZYYA 5I3ZA 4ZCSA 4E5UA 4BB6A 2A9QA 4O2AA 3WDMA 3FFWA 3ICCA 1F4PA 2ACVA 1U0BB 4QAJA 3ABRB 3TPZA 1V7QA 4BVJA 4ZZ3A 5A06A 1JSCA 4TVSA 3V8EA 3ZHCA 2D3WA 4HZUA 4HQFA 3N6VA 3CVWA 3MTAA 1DKNA 1E7SA 1R4MA 3UFXB 4FSHA 5EKSA 1U63A 2BR3A 3LBIA 4RD4A 4DA8A 1Q20A 3WLMA 1M2WA 1RI4A 4FE7A 1T8TA 3VDXA 1CR2A 5K8VA 4FLEA 3G9TA 3T1HB 2IHJA 1QU2A 2YVQA 5MF6A 2ZS8A 3RK0A 4TZ6A 1A2QA 1EP3B 1UDBA 4K26A 4EWLA 3I9V1 1FX0B 2XSZD 5JJCA 2D5CA 4I50B 1ZI8A 1E7WA 1M34E 2X2PA 2GXSA 2W8ZA 3C97A 2F00A 3M3PA 5DOZA 4JVLA 1F51E 4EHFA 3HU5A 3THXB 1IOWA 3WLKX 1QDUA 2NVOA 1YA8A 5F9FA 1WSBA 3WKBA 1ZP6A 3FOAA 1QC5B 1I1OA 1ONPA 3V9PA 2WFLB 4H7KA 4CMAA 3AOEA 3DHYA 1Q7CA 2HHLA 4XD7A 3VH3A 4F6LA 4EG7A 2F90A 1OB2A 1CERA 3LT5A 3G0HA 5FNVF 3PQ5A 1ADBA 1UUFA 3RJ9A 4DILA 5BPHA 1NSFA 2FOLA 4MRMB 3MNFA 1GTRA 2R8XA 3W05A 4RPIA 2ODAA 4YMHA 1TZKA 3RUDA 3EPLA 4MITA 4DR7B 5JV5A 2XOKD 1AX9A 4DTIA 2IS1A 4H0FA 3ZEIA 5JDCC 4LJRA 3R0IA 3D6FA 4HQ6A 5LDDC 4N8EA 1X1BA 3BB1A 3NTUA 4BLVA 3B7PA 1OT5A 2JVJA 2HK8A 3MQFA 4MEJA 4M53A 4ER5A 5KMGB 2QOEA 4EJSA 3NP7A 3SSOA 2FSVC 1ECGA 5JXIA 2CF6A 2GJ9A 5TF0A 1KFJB 4YQZA 4LF9B 4IH4A 3NHWA 3UK2A 3IKJA 3OZTA 2YJGA 2Z2IA 4DMGA 4K87A 3I5MA 3ZD8A 5BNZA 1MHTA 3QBEA 1RCUA 2KPOA 4GVXA 1LJLA 2P1RA 3IALA 4IM7A 1RT9A 2PXCA 2XNJA 3GLFE 2A5YB 1I5EA 5L3SB 2R86A 2VQDA 4KR2A 3QNMA 3WLEA 4TPKA 2H1CA 1XNRB 5EZYF 3BICA 4C3ZA 4UUQA 4H3VA 1K5HA 2CFTA 5TS2A 1JIUA 5C80A 3QJYA 1JQLB 4YK7A 3E70C 5DEOA 5A6SB 1QQTA 3QW2A 3RTGA 3SHTA 4HN9A 2IIVA 5DU2A 1JAHA 5DRTA 1YZNA 1D4ZA 4AJ9A 5TV2A 1RHMA 3BL6A 2CNWD 4IR7A 5KQPA 1BD4A 2Z6QA 4DMFA 2UYCA 3OCJA 1ZA2A 1AKUA 3DEHA 2DG2A 3FZYA 4B4WA 4GI1A 4EHHA 4JLNA 2BEWB 1D04A 1V1MA 4DREA 4DJ5X 1NZJA 1Y3IA 3HXLA 1X7GA 3HEBA 1TQ8A 1EK5A 1ULSA 2IDKA 3TX2A 1IK4A 4JJ8A 4FMCF 5TPZA 4XA8A 4OYRA 1TA9A 2P9TA 2VF4X 2E82A 4RH0A 5JH7A 3AX6A 4FM9A 2IBTA 4AJKA 1E1RA 3PZRA 4IQ8A 4XB2A 4PLCA 3WZLA 3MWLA 1M1NA 4IX1A 1GV1A 4OJNA 1QGDA 4Q7MB 3VO8A 2Q21A 1GZ5A 1WDLA 1UMKA 3HEAA 3VU3A 4H31A 2ERCA 1EVQA 4GPEA 2HQRA 3UWOA 1JR3D 3SEAA 3IHKA 3UA4A 1DRVA 4DLSA 2IYLD 4I8IA 2EJWA 2G1KA 3A27A 3J81A 5J59A 1XGKA 3OLYA 4RD0A 3T95A 1XO1A 4PX9A 1GPUA 4OL9A 1V8FA 1TUBA 1ZD4A 3BZWA 1N36B 4RD2A 1IIBA 3Q9SA 3AJDA 1E5QA 4QOHA 2IUYA 5IVPA 1A77A 3BWEA 3OPYB 1AXRA 1E79D 3SYRA 3GCGA 2B5WA 2GZHA 3LQFA 5KYKA 1ODSA 3F1KA 2BDEA 2HD4A 5GAJA 1WG8A 2EFDB 1OYYA 3OTGA 2PWBA 2XQIA 4TLLB 3HYCA 1FU7A 4ZVLA 1LNZA 1Z25A 4EW1A 2AMFA 3WIEA 2WAMA 3AIMA 5LFAA 4PX5A 4MCIA 2GN1A 4A0RA 3L1JA 1WBBA 4KQFA 5EJ8A 1S1CA 1QF7A 4FYMA 4RW0A 2CUZA 5FHQA 4DUPA 2GSWA 4ED9A 3WGQA 1AG9A 3JAWA 3DE7X 4PAOA 1B2LA 2UUOA 4PPYA 2VPQA 3FCSB 3IDSA 5AM5A 2RGCA 2PMCA 3TR5A 2QPOA 4BNMA 4CKBB 3FOZA 1AV6A 3SQWA 1P8AA 3FZEA 1JA0A 2P6OA 3L7CA 2R00A 1VBFA 1WUIS 2HO4A 5G1NA 4LA4A 3DHEA 3SNKA 5B36A 5JVDA 2XUOA 1X1TA 4RLSA 2RI0A 2YXLA 3PE3A 4ZU1X 3QX7A 1LSOA 5KAPA 3SQMA 4P3PA 5C8XA 3T3IA 5KIAA 2I0FA 2GN8A 1KQPA 4NJMA 1OZFA 1TAUA 1YAJA 1THMA 2QT0A 4G5SA 5DYTA 4YJ2A 2PSHA 1GA4A 4K9DA 2HU7A 1AS2A 3ENWA 4K6MA 4D25A 4PWZA 1D2AA 4G81A 1VB5A 2P8SA 4HRVA 1N2ZA 3LUDA 1ZUIA 2GZ3A 3SYMA 1FP4B 2ABWA 2G5GX 1A4RA 1CR1A 1MVOA 1YFKA 3PDWA 4N9QA 4V3CA 1Z0JA 1TF5A 1HFWA 3FKJA 3ZBUA 2X5KO 3MRVA 1Q14A 1YUBA 4AKEA 1LLQA 1M8JA 1TU3A 1Q95A 2CHEA 4N5LA 4B3HA 1CYEA 4BO2A 1C7EA 1WD7A 3HDHA 4NBSA 5K3OA 1K7SN 2V1UA 4JGBA 1JYEA 1UFRA 4IIEA 2P30A 1A1VA 3NEAA 4B82A 2O3SA 1TEHA 3QXJA 4IICA 4RJKA 5G3ZA 5CNMA 4CETA 5TNXA 2A9PA 4I9GA 5CB6A 2QGFA 1HV8A 3DG9A 3O1LA 5KOJA 2VZEA 4RZQA 2GXUA 3IVMA 1NAIA 1H4QA 1Q77A 2GYVA 1KPGA 4YRJA 1NLZA 4A6XA 4N3AA 1NVFA 1U2PA 3DV2A 5CFLA 1YBAA 4RDIA 4EHNA 1YZLA 4FD2A 2QMOA 2ETVA 1PEAA 1S2OA 1Q0HA 5EJMA 1U9IA 1DJLA 4ZCQA 2F4VB 9MHTA 5EUMA 2R751 2JCGA 3QELA 4NENA 2ASEA 3GRYA 1HDRA 1DKPA 1SBHA 1ODKA 3HUFA 3IPAA 4UFNA 5LYJF 4MRAA 1LFAA 3UF0A 1F5NA 1JEDA 2NVUB 1VE5A 5LMZA 2P9FA 5AJWA 1UXHA 1L5HA 1H8HA 3AERB 4GEGA 4KGZA 2X2OA 3ZC3A 2G63A 1DEOA 5ALYA 1JXAA 2A1TR 2JH8A 1CX9B 3VPHA 2EJVA 3LYUA 2H5EA 3DXFA 4ZOQI 5I7EA 4EPWA 3NRJA 2FW6A 1YZFA 3DE3X 1A9QA 4C7MA 4FHEA 5FLXA 2WVAA 3QJGA 1YQQA 2ZSKA 3TVTA 3O8CA 2GEDA 3GT3A 4GG1A 1VL6A 4NPCA 2DLCX 4WXMA 1Z62A 3J7TA 4R7GA 1ODLA 2NGRA 3GBPA 4PFSA 4W63A 4FWTA 1DWOA 3PYXA 5AKIA 1MT0A 3AEKA 2WZBA 1G9TA 3WKAA 4R31A 2NT4A 3WA7A 4QNMA 1V11B 2PFKA 4W9NC 3SS9X 2ZRHA 1WRBA 2Q4BA 1B8OA 1SUSA 3CZMA 4JUAA 4RIGA 5CPBA 5HEKA 2HSWA 5D2CA 1U1GA 1GKUB 1XMIA 3GA5A 1GYPA 3LX8A 4O59O 1JI3A 5JW6A 1UOEA 3LUGA 2I1QA 2HWXA 4Q1FA 5D01A 4P7BA 2IITA 1V41E 2HCRA 1BE0A 2I4IA 4DRYA 3B9RA 5BUZA 1P2TA 5E3JA 4Q3CA 1WLSA 3VTZA 1B7GO 1N3BA 1N9ZA 1VE9A 1W8IA 2P69A 2V5UA 2YOGA 1OT3A 4KX3A 4RPGA 4YRFA 2Y71A 4A7PA 4BO9A 3KKKA 3TRFA 3ZEAA 3VR2D 1KQNA 1VL5A 4BQNA 2DFKB 3S40A 3RRFA 1SUBA 3HU2A 2FX2A 2GVNA 5TQVA 3HCEA 3WNZA 4BGDA 3DT8A 1NDHA 2PLNA 2GHRA 3GVCA 1CY7A 3KTOA 4KQKA 1FJ2A 4OJMX 5CAEB 3C8MA 4DMCA 4PN3A 1K06A 4XQEA 1ZX1A 3OT4A 4PLYA 4ZDIA 4KQJA 1GLNA 1GGEA 2E89A 4PS0A 4D5GA 4H7DA 1XTJA 1YWGO 2XNDD 1PVVA 5LM3A 4BN0A 1RZUA 1GDHA 1QE0A 3HV0A 4EPXA 1HLFA 3V4RA 3H4MA 5FL3A 3S68A 4J1TA 2CUNA 1XMVA 5EIEA 1PJTA 3L4EA 3O3CA 4C4SA 1PWXA 3V4OA 1SU6A 4R8RA 4QJ3A 1XHLA 4RANA 4RAQA 3HVRA 4TN5A 1PSWA 4Y0VA 3LUKA 1CUZA 2FF5A 3TNFA 4YRIA 5KNCA 4C1NA 4QICA 3E18A 3B5EA 1DIGA 2QE7D 4LMPA 3F3MA 4WQMA 4AMYA 5T41A 1T9BA 3NHRA 4YUAA 4BNGA 3D6MA 3D02A 2WWVD 4J0DA 4HF7A 3STYA 5IJ0A 1HEYA 3CVYA 5FI0B 4DIMA 5AVUA 1QP7A 2ZBDA 1T5BA 3LY7A 2X77A 1H6CA 1C4XA 1X7XA 3OIVA 4NULA 2P5SA 3LWZA 1KZ9A 1KJZA 1F3LA 4K6FA 4ZYLA 2JFHA 2GI4A 2AVNA 3GJ5A 2OXCA 5FA8A 4DMUB 4OX9Y 3DUFA 3D4OA 3VNVA 3CG0A 3GUVA 3S5JA 1D6MA 4YALA 4KN6A 4BP1A 3E9DA 4U02A 1Q12A 1M0SA 4ZN6A 4MUXA 4LHVA 4V38A 4AZVA 4EFDA 4V1CB 1QQ7A 2TSYB 3DL7A 1F60A 4RA6B 3U9SA 4MWGA 4AECA 2PXXA 3ZQ4A 3HO1A 2A92A 3RIHA 1B3RA 2EKLA 4AQYB 5LQNA 1QQBA 1KP3A 2WJ4A 2PKQP 3O83A 3ZIAD 2AZTA 5CFZA 1EFUA 2Q5FA 1C3LA 2OESA 1IHXA 3NHPA 5LIRA 1LLDA 3GRRA 3QKUA 2DVMA 1V3VA 1IE3A 5CT4A 4BFVA 1V26A 2XXAB 1CJVC 4HAWA 2UYHA 2F3QA 4BNUA 4PHFA 2OLEA 5KS2A 5J2TF 3KHKA 3UW1A 4DA7A 3OAAA 4Q4DA 1SKAA 3UW3A 4UDXX 3VDRA 1NUAA 2V3WA 4YP6A 3ID6C 3R0JA 3R75A 5HXAA 3BXPA 1KS9A 3E9CA 4HT3B 3ZHSA 2ZJ8A 2R84A 3QVWA 1CSEE 1EZ1A 1I6WA 2FZLA 4HUJA 1NMXA 2GN9A 4EG3A 3BK1A 3N28A 3MWDA 1MQSA 1XX6A 3B20A 2OXIA 1V1RB 4MWCA 2RHOA 3ON5A 1Q2UA 2FN3A 4CF7A 2YQZA 5HQ3A 4EAQA 3A3YA 3I1JA 4KXNA 1I80A 5CB0A 4BB0A 3U40A 1K8RA 1AF4A 2ORVA 2QLFA 4R7TA 4BECA 1II8A 5KSOA 1MVLA 3VR0A 1UXGA 4UTVA 3FDXA 2CL7X 4F9EA 5A7HA 4BHTA 3QMPA 3KLMX 4CW7A 4OXNA 1U0JA 2C42A 5LBTA 5I7FA 2A14A 2FYTA 3DV9A 4A8JA 2NP6A 2Z1DA 1SH7A 1Q0ZA 3OD5A 5L9AA 1AUXA 1OC4A 3WFZA 4DCMA 1VJRA 3O73A 1U0NA 5CB8A 5KYUB 4YR7A 2WFMA 2UZIR 5FJIA 3W4KA 4PYIA 3L18A 2WWWA 5JS6A 2BFNA 4KH0A 5DM70 2WJGA 1QVAA 1UBTS 2DPYA 2PQ2A 3GP5A 3I4FA 3I2GA 3NVAA 4WZAA 4MQLA 4YCJA 4NCXA 4XYLA 1C9YA 4OM7A 4JBNA 1N0HA 4QDKA 1WXHA 4IWXA 5BT8A 4CI9A 1Z3IX 2HM7A 4QYSA 4EITA 1GGHA 3NDIA 1ZJWA 4Q3NA 3ZUGA 3A6PC 1J09A 3CONA 3VPSA 3FMOB 5FA5A 3TOSA 4EP1A 3EF0A 2P35A 2L82A 5HTOA 4XUDA 4M4SA 2ZT7A 3NHFA 3GFSA 5LP6B 4OQMA 5CT9A 1SO8A 3HGQA 4JHXA 4D7AA 3SLRA 3CZ9A 1AKEA 1G0OA 3CZ4A 3G2HA 2NZJA 2RMKA 4RY8A 4FQ5A 1GGFA 1A8SA 1Z8NA 1OVMA 4YP0A 1UPXA 2AFIA 5E6UA 3WGYA 3OCVA 3AUJB 4UTOA 3B5JA 3DEFA 4FSXA 3RRXA 4OJTA 4KFUA 1LRJA 1X1AA 1XZ8A 3BC1A 5JS2A 1TAGA 1I1QB 3SYNA 4WDQA 1GRRA 3RJ5A 4GI7A 4JYPA 4XRRA 5EMLA 2Z9CA 1ZJJA 1I7DA 1P18A 1T2FA 3QPCA 1CKEA 5JBNA 3L6OO 1K3UB 3QLUA 1AN0A 4LYFA 4YPOA 2CCKA 4RFLA 3W7VA 2KS6A 2LUOA 1DV1A 3RASA 3KT8A 3DE4X 1KJIA 3FB4A 4OSOA 1K8ZB 2GNAA 2QQEA 3NT2A 4I66A 4PQEA 5LD2C 4JZYA 1N5IA 3GF4A 2P7HA 3V1YA 5KNCH 5F2KA 2RK6A 3M3DA 3UENA 3ZE2B 2PE5A 4NC9A 3FY4A 1KMHB 4OG2A 2NVWA 3U62A 3UOAB 1DVRA 1JDZA 2CVZA 4HXFB 1JQ5A 1NLUA 1AM4D 2ONJA 4KMOA 2HB6A 4TWRA 16PKA 3KSDO 3NQ41 4G5HA 1L5YA 1NUSA 4HSGA 2AYZA 4TTQA 2J4CA 1FNSA 3HS3A 2ZCJA 3DKPA 4UQPA 4MW7A 5M7EA 4NBLA 4FQ7A 5KQLA 4QEKA 4A0FA 2X1VA 4XE5A 3FUXA 3N0WA 3F6CA 3RVLA 1A4IA 2QENA 3B70A 3H4IA 4OP1A 4W8OA 5AUNB 5E2BA 1GL7A 3Q8LA 2ATXA 3FPCA 4J07A 5JAZA 1UDRA 3LX5A 3B7GA 3GI1A 2DBQA 4WGGA 3V4FA 4C89A 4EHKA 3JQ8A 3JD0A 3A4TA 3I42A 4QNRA 4XX0A 3L6CA 4P4UA 2E87A 4CKWA 1WPRA 3ZE0B 1LLCA 3PNOA 4UOEA 3IA2A 1FU8A 3PENA 3LWNA 2GFHA 1JXQA 2WKSA 2IOFA 4R40A 5CG1A 1V96A 2TMKA 1HZJA 3ROXA 3W6ZA 3U49A 4ZCIA 2E4WA 3WLSA 5E6RB 5GV8A 4Q1BA 2BKEA 3BH6A 1SVUA 3D7KA 1K8XB 1VKNA 2R2GA 4DC9A 3C3CA 5BXYA 2X3UA 3QVUA 5F78A 5LBIA 2JIMA 1U7DA 4KZKA 5HF8A 5IDVA 5FXMA 1NE2A 2IF0A 2YHBA 5A2QA 2Q5JA 2YMPA 4BL5A 4G1VA 2IUUA 5KNDD 1AMOA 3G6WA 3SICE 5TX7A 3F8SA 4TYYA 3EAGA 3QXHA 2ZQYA 1B42A 4F1JA 1O5IA 3MTEA 4I2VA 1OYOA 3A04A 2DHRA 3AM4A 2GTIA 5ER6A 1E9CA 1D6SA 5COBA 4IZIA 1ISIA 3QXXA 1UCFA 5CA0A 2DM6A 2XE6A 3P0EA 1XHFA 1T26A 2WZDA 1EB9A 2ECKA 1NNEA 2VDKB 2G77B 3BJMA 3OIYA 1ZWKA 3PXGA 3I6MA 2HK6A 3TCKA 1N1DA 2AFHA 3A6DA 4KCGA 3AKZA 1F0PA 1RZRD 3A7EA 1W36D 2I71A 1ZOOA 1G6Q1 4EELA 4QJIA 3F98A 2J45A 4DV0B 3WRWA 1WY7A 2J3LA 3BE6A 1JAIA 1U98A 1W44A 1XV5A 2BFCA 3QLTA 1KDTA 1XTSA 2QAJA 2G3YA 4OXQA 2C7VA 2QSYA 4K46A 5BN1A 2H1FA 1XNGA 3P94A 4NR0A 5EPEA 3C87A 3H2GA 2O8VA 1AZTA 1DI0A 2BF4A 3OCUA 1M0EA 2V6GA 3EIFA 4KIJA 4QXQA 3DAHA 4D0SA 4MHTA 2X2EA 3ETGA 1VXOA 1P5JA 5FYQA 5BMOA 3GRCA 4E2FA 3GPIA 4IIJA 1E1QA 3NHAA 1CS0B 1U7ZA 5BPFA 2H9IA 4FIZA 5DB4A 3NB0A 1ISRA 4UARA 2JBAB 1K66A 4L5IA 2FXVA 4RS4A 1NUTA 4YTEA 3BGWA 5PGMA 2F48A 3OM1A 2LDXA 1PZFA 2R8BA 3QX3A 3H99A 4QDTA 3JYHA 2WNIA 2BSAA 2QAGC 4BKRA 4OBEA 3TR6A 4B5KA 1OFHA 2GAJA 3AVQA 4BV9A 2HRRA 2QRVA 1P29A 3I45A 3JWEA 5F9HA 3QENA 3SBOA 5JQWA 5D1HA 1UPFA 1C0LA 4ZVKA 4DWVA 1PR0A 1SXJC 1V9CA 2RGYA 3DLPX 4D9HA 3JWGA 1JDBC 2EW2A 2ZREA 4NBRA 4NARA 4D0RA 2GYWA 1CEQA 2EW1A 1DUIA 3NGMA 2VA8A 4TL8A 1YC2A 2FGJA 4TKMA 3CE9A 1CRWG 2QWXA 3NV7A 1XF1A 1LJUA 2I9PA 2PZAA 4FFBA 4NZPA 4TWZA 4BMOB 1RQ7A 1H22A 2FDXA 2VRBA 1T0PA 3BTOA 1C1XB 1J0AA 2F1IA 1YNOA 2GCEA 2KX7A 2XH8A 4HO1X 4UEKA 1OH7A 4RYDA 2AEEA 4MLZA 2GK4A 4TQUS 1JUDA 4BVAA 2W6QA 4MVXA 2C31A 3H17A 4P53A 4DV6B 4N03A 1VL2A 2C2ZA 2FEXA 3FTPA 1YJBA 3EEIA 2A3NA 4F7DA 1RPTA 3PX2A 1NYLA 1V39A 1XALA 4KDFA 2Q2NA 2J85A 5JANA 4I81A 5J63A 4G0NA 2WKRA 2I7TA 2V3VA 3M6FA 3A4LA 1A0OA 1GRCA 1F2TA 1KE1A 6LDHA 1NW3A 1MNAA 5A7GA 4HAXA 4YMSA 3W8NA 4YMLA 3NMUF 5DX0A 3FWZA 1H8ED 4X8HA 5J5VA 1RWOA 4C7BA 4QBTA 1P1IA 5FBLB 2IWRA 3TSAA 3MT7A 4BJ1A 3DWEX 3LIPA 3HO6A 5FOXA 1TJ4A 3A8TA 3ELWA 1D0VA 3HGTA 3FAKA 1XZJA 4Q00A 1U5AA 3N53A 5C0OE 2FMFA 1E3WB 2GFQA 5CFMA 3T5PA 4DCGA 2HHHB 3JW8A 4JP3A 4Z53A 1NUQA 2PH1A 3JQ6A 3URKA 2IZOA 3WYFA 4O29A 3WLIA 3T12A 1NONA 3AFMA 5JSZA 3X1JA 3S8YA 1J2JA 3HXPA 4M1YA 5F1KA 4K0KB 1OIWA 1QPBA 1BXZA 2Y99A 2WD8A 4NAUA 4OK3A 4ZVNA 3CW9A 1KEUA 2TECE 4BNNA 4YIHA 5HOEA 5GOZA 3LHDA 1Q0RA 2PT9A 2I6SA 4PZYA 4QGFA 3VFDA 4CNQA 4IO1A 5A62A 5K0BA 5DNVA 1FFHA 4NXNB 2I3AA 2KHZA 1WXGA 4LMRA 4WACA 5EJ7A 2O8EB 2ZIGA 2HLNA 4IWYA 2UAGA 3BCSA 2ZIXB 3U3XA 1PK9A 4K9PA 5EWLA 1OXSC 1H2FA 1Y3BE 2Y0BA 3CRRA 4JVMA 4LI0A 1X9GA 4QU8A 3HLTA 4GC5A 2BGKA 1EA7A 4QPNA 1VMKA 4U2CA 3RKRA 2AFHE 5DI9A 5AVOA 3F3KA 4DMKA 1MFPA 1J9ZA 1PJ3A 3KJQA 2BZ1A 3CZ5A 4MW4A 1L4UA 3RAFC 4TMWA 4AS1A 2R6FA 4N8SA 3PR2B 1XN1A 3HZHA 5DM1A 3THOA 1B43A 2OXTA 1YZ3A 3IQIX 3C7TA 3A70A 1D2RA 3ZXSA 4G5OA 4B09A 1RE0A 4WKCA 4B3DA 2V54A 2QTVA 2E0IA 2C5FA 3KT0A 2ID8A 2C5HA 3EULA 3FETA 2OD7A 4E13A 5LQJA 4TT3A 1V8OA 1MA0A 5JEEA 1IJBA 2I87A 1SAYA 1LI4A 1JHUA 1NN5A 4R3WA 5G53C 1SOWA 1CR4A 1CUSA 1RI1A 1S8OA 2BGWA 1EUZA 1U3FA 2NU6B 2WMDA 2Z5VA 1DDGA 5IJ9A 4ZAWA 4H6WA 2Q6IA 1U7UA 3QGMA 5KC9A 3E6AA 4EUNA 4NEQA 1F8UA 4BO0A 1QWSA 3A4NA 4I4TA 3UGQA 3W2HA 4D9MA 4MKGA 3GFPA 1B3BA 2O2HA 1XRPA 1Z2EA 3N86A 2PHZA 4WNYA 4YLEA 5TY0A 2OOSA 1H0HA 1KHHA 4GH5A 1BG6A 2YW9A 1XEWX 2FPMA 4EB6B 1U7PA 3BE4A 4J90A 4TTAA 4ARZB 2F1JA 2XE8A 1QAOA 3THSA 1VPTA 2QTNA