1K2VN

E. coli periplasmic protein fhud complexed with desferal
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
262
structure length
262
Chain Sequence
b'AIDPNRIVALEWLPVELLLALGIVPYGVADTINYRLWVSEPPLPDSVIDVGLRTEPNLELLTEMKPSFMVWSAGYGPSPEMLARIAPGRGFNFSDGKQPLAMARKSLTEMADLLNLQSAAETHLAQYEDFIRSMKPRFVKRGARPLLLTTLIDPRHMLVFGPNSLFQEILDEYGIPNAWQGETNFWGSTAVSIDRLAAYKDVDVLCFDHDNSKDMDALMATPLWQAMPFVRAGRFQRVPAVWFYGATLSAMHFVRVLDNAIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrichrome-binding periplasmic protein
publication title X-ray crystallographic structures of the Escherichia coli periplasmic protein FhuD bound to hydroxamate-type siderophores and the antibiotic albomycin.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal transport
total genus 80
structure length 262
sequence length 262
ec nomenclature
pdb deposition date 2001-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 1k2vN02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 1k2vN01
2WI8A 5FLYA 4WNAB 4LS3A 3K1AB 2AFHA 3HXPA 4BBPA 3TEFA 4UTPA 2PS0A 2OV1A 3MINA 1G20A 1QGUB 4G07A 5B58T 4NNPA 5CX1A 4MO9A 4OXQA 5HX7A 1H1LB 4TKVB 4G09A 3BE6A 2YNMC 1G21A 1FP4A 3MWGA 5M2QA 5GGXA 4INPA 2YNMD 1M1YB 3AEUA 3CX3A 3U7QA 4ND8B 2Q8QA 2WHYA 1KAEA 5AFSA 1QH1B 1L5HA 1N2CA 2XQVA 4B8YA 5JJ5A 1MIOA 4HMOA 3MD9A 4WZAB 4XPIA 2OGWA 3MFQA 2MINB 2XH8A 2OV3A 2R79A 5KHLB 1N4DA 2M6KA 1KAHA 5BVGB 3AESB 3GI1A 1EFDN 5BVHB 4HN9A 3AERA 5BVHA 3EIXA 4FNAA 4GICA 4INOA 4PAGA 2AFHB 1M1NA 3MINB 1G20B 4WESA 5KOHA 2PS3A 3PSAA 3AETA 3AEQA 4MDYA 4WZBA 5CX1B 4FKMA 3AEKA 4WN9A 4CL2A 4M7OA 3R5TA 5CR9A 1G21B 1FP4B 4HMQA 5M3BA 1ESZA 1TOAA 2XDQA 4NNOA 3AEUB 3MWFA 1M34A 4FI3F 4UDOA 2XUZA 3U7QB 2RG7A 3HH8A 1KARA 5KOJA 1L5HB 4OXRA 5GGYA 3TNYA 1N2CB 4DBLE 1K2VN 1MIOB 3ZK8A 2AFIA 2QI9F 4TKUB 5HDQA 2M6LA 3LHSA 4XPIB 1QH8A 4LJSA 4HMPA 3PDIA 4TKUA 2PRSA 2PHZA 4WNAA 3K1AA 5M34A 4K3VA 3TLKA 4UTOA 1QGUA 2Q8PA 1N4AA 2XY4A 1PSZA 1N2ZA 3AERB 3HJTA 3PSHA 1H1LA 4MX8A 4TKVA 1XVLA 1M1NB 4H0FA 4WESB 3LI2A 5KOHB 1K7SN 1PQ4A 2O1EA 3ZKAA 3AEQB 1M1YA 3AETB 4WZBB 3ZTTA 3EIWA 2PS9A 2X4LA 4PM4A 3ZK9A 3AEKB 4IRMA 2R7AA 4ND8A 4WN9B 5JPDA 5JOQA 1QH1A 2XDQB 2ETVA 4WZAA 1M34B 4UDNA 4FILA 5JG7A 2OSVA 2MINA 1K75A 3G9QA 4H59A 4OVKA 4N01A 5KOJB 3ZK7A 3NU1A 3UJPA 2AFIB 2XV1A 3R5SA 3BE5A 1QH8B 5BVGA 5I4KA 3PDIB 3AESA 5M29A 4MLZA 1K0FA
chains in the Genus database with same CATH superfamily
2N3ZA 1D09A 3DXXA 3KELA 1Q2XA 3EQZA 3QSYA 3P2IA 2O5VA 3T7AA 3Q9UA 4O8CA 4N3NA 1FFHA 3HA3A 2OL4A 1XEWX 2CEAA 2PXCA 4GP6A 3DAOA 1VKRA 2QUBA 1QR6A 3ZGNA 2OOKA 1NQOA 4PZUA 4H1UA 4TXMA 4BO1A 1CBUA 3X0DA 4IJ6A 2IYEA 5M2QA 1QYRA 9GPBA 3PUKA 1O0CA 4ERXA 4CTKA 3SKYA 2YS6A 3IL2A 1FP2A 1P7ZA 1AT1A 3EF3A 3ZWWA 5HUHA 3BZWA 3PI6A 2FJ0A 3DLCA 4KIGA 5AKHA 3QEBZ 4GWKA 3KZKA 4UUMA 3WV4A 4OQFA 4KXXA 1XWIA 3JPWA 4H6XA 4HTFA 3RS2A 1K08A 3A3NA 3PC8A 4UEKA 1USWA 4BX0A 5GVSA 1G5HA 1R6VA 2YQ4A 1G4HA 4JGGA 4OJMX 2VTEA 3H18A 4P2GA 4Q1AA 1HUQA 2IEGA 1THMA 3O9ZA 4BIMA 1ENOA 3IH5A 1Q0SA 3UUEA 4BQQA 1UMDB 2D2IA 4DIBA 1IY0A 2IXDA 1TIPA 1IUOA 1DLIA 4HDOB 3HDGA 3ZZ0A 2VLBA 2J41A 1EFUA 3K92A 1R7RA 1GZSA 3JY6A 5KTPA 3S2GA 1U0HC 3QBVA 4PZDA 2OCGA 1KMQA 1RYDA 3CVOA 5GP1A 5KTSA 2SBTA 2XT0A 4BTLA 3MCWA 4WBXC 5EGNA 4HV4A 3D9QX 4E7PA 4DCCA 1N3LA 2YINC 4IFIA 1GZVA 3MGCA 4MWSA 1WA5A 2YX1A 4JI7B 1OJLA 3LCMA 4MP6A 4AUMA 4XPZA 1Y7HA 1T5BA 4C0KA 5KBYA 4KHPB 3Q8LA 4OGWA 4MQ5A 5AOCA 3D3JA 5E6SB 3FWKA 3QKRB 2AN9A 4QDXA 2GOYA 3K0BA 4YLGA 5M5BA 3U60B 2HA2A 3AQIA 1TZCA 1AE1A 2WYVA 1ZNQO 2UYGA 1C14A 4WXYB 3RG8A 3AHJA 5M34A 2O8NA 4JITA 4UTRA 5KSYA 3ZY5A 1XZPA 3TJRA 3PL5A 2Z0MA 4IILA 3WK6A 3PFGA 3PGVA 3JAWA 5DRYA 4U9HS 3CM0A 3LY9A 1J07A 2UAGA 4KHZA 3VR2D 3G13A 1XTUA 2J3IA 3GZNB 4CM3A 1T2UA 2QJWA 1EHCA 3CX6A 3PKZA 5AXBA 3KXIA 2BHTA 4LBZA 2CDAA 1HDXA 4OMUA 2JIZD 1O5IA 4YMWA 3B1WA 4R41A 4QLBA 2ZBQA 1VCOA 1O9GA 1BQEA 1M2KA 1YONA 1XYGA 2JCGA 2WM9B 3U9LA 4EY8A 5JVDF 1RKBA 1ENZA 4B3BA 1JEAA 2FW0A 4J90A 4Z2YA 2QU7A 3QUCA 3F2VA 2VDMB 1K9VF 3KKQA 2VPZA 1C7QA 5TRTA 3ROXA 3SZMA 4PYJA 3HA5A 1TM4E 3FYUB 3LUFA 3GEHA 2YH2A 2VXCA 3HFGA 3NPMA 1M2EA 4RMNA 5DWDA 4MVJI 3B8EA 5M29A 2N75A 4II3A 4E22A 5FLYA 2Z2YA 3B1XA 1CLEA 3C3PA 3N76A 3BFVA 4JI6B 1DV2A 1FU4A 3R75A 3VH1A 2ZE7A 3G8BA 3RKUA 4PG4A 3HUEA 4MI6A 4BWVA 3T7IA 4ARBA 3S5UA 3T5AA 1EZ1A 1FLVA 1SCUA 3V32A 3GQBB 4HNQA 1JT2A 2X7JA 3BM5A 2NZWA 2Q1TA 2WSIA 1WZNA 3EMVA 5C80A 2RGYA 5EIBC 3CWQA 2YJ4A 1QS0B 3R6WA 1AHIA 3PUHA 1TMOA 3KJGA 2QTMA 1ZNZA 4K8RB 3HJBA 2BFOA 3FY4A 4D4LA 4ENSA 4PYRA 5F78A 5L4LA 5JSKA 4RA9A 1BS2A 1JLRA 1F8UA 4CMHA 2DQSA 2WIBA 3CIFA 3WL6A 5JISA 4OM8A 5FWXA 2BEVA 3KJEA 3VV3A 1CUYA 4CKWA 1QORA 1E59A 4DE5A 1XKXA 2H2AA 5C9ZA 4XASA 1NDQA 2DE0X 1EX9A 1FQJA 3WRXA 3QFTA 2L0XA 3L9WA 2Q2QA 4R2WA 2Y4NA 3B53X 3OCVA 1U8ZA 3BQNB 1RM5A 4D45A 3OZEA 1CF9A 5B3LA 2JBAA 4KU4A 1CF2O 1IZ0A 2Q0SA 4WVLA 5CA0A 3T3MB 4BGIA 2QJFA 3LP8A 4AZSA 3FJOA 4IKPA 3TSZA 3WNVA 5GONF 1QCCA 1ZH2A 1NNUA 4NJOA 4JOCA 4M4SA 2AEFA 1TK2A 3CY6A 3GJZA 2CT8A 4NP6A 1T5HX 3ILYA 2QNRA 5JEDA 4IUCS 2I6XA 4R6WA 1XRNA 4IDAA 3TMKA 1CZUA 4ND1A 2H57A 1J5PA 3CJRA 5I51A 2IU4A 3SIRA 3LFUA 4TYYA 4P7GA 3T5CA 1KARA 3M1YA 1S3SA 2X76A 1E5VA 4Y9DA 3CUUA 3HLYA 5JJIA 5D3KA 3RJ5A 2I2XB 2LKDA 4ITVA 4QXQA 4NG5A 221PA 3RCBA 4CV1A 1HI9A 2VT2A 2JLZA 2IT1A 5EC8A 1WQ4A 2PO7A 3LDFA 4DVJA 2EDCA 5JXWA 4F4HA 3DWGA 3MS7A 4Q39A 3TWOA 4DRXB 4L5YA 4H6PA 3U40A 4JC0A 4AY2A 1MX9A 1UT8A 2JH9A 2COUA 3UMVA 3T99A 3VH2A 2AXEA 2C5AA 1TT5A 2FKNA 1DP4A 2PU5A 4G97A 3I58A 1HE3A 4EZIA 1KXZA 2D1SA 4R83A 4ON9A 2Y9MB 3E48A 3WG9A 1E63A 3TCKA 3TQFA 5LOVF 5KSWB 3WWEA 2ZAYA 1PT6A 1KL7A 1KZ1A 1EFRA 3FGOA 4GG1A 3U7IA 3SF0A 3O94A 1H93A 5H59A 5IU6A 3F9CA 2OC9A 3ZTTA 5DGHA 4ECEA 2PIAA 3SDSA 1J99A 1DUVG 2MSDB 2V6BA 2HLHA 2O7NA 3WXMA 4F8JA 1GRRA 3ZJ4A 2I78A 4GQBA 5CMLA 4TL7A 4QKQA 5AM1A 2PLRA 3D8HA 5EXSA 3D6TB 4BNXA 3LQ4A 1EHIA 3FMOB 4DQLA 2GVZC 3BJRA 3ZDBA 2Z8YM 2IBSA 1ISRA 1P0FA 1VDMA 1KC3A 2IYYA 1EVJA 2ZCUA 5LIPA 4BGVA 3W5CA 2BBWA 4BCBA 2C1XA 4EJSA 4XD2A 5GTDA 4L8WB 1ID1A 1VXOA 1MXHA 2PIDA 3B5JA 3KPJA 4EG1A 4H3HB 1QG6A 3LBIA 4AS1A 1PZMA 3EHEA 3LPDA 4ZO9A 4AU1A 4YCNA 2A0FA 5EWMB 3IUMA 3PCTA 3E61A 1WNTA 4X71A 4Y7CA 1YZTA 2ZYIA 2Q99A 9ABPA 1U2GA 3TB6A 3S4YA 4K86A 2FEPA 3AJ8A 1AO0A 1N5LA 2L19A 3EWIA 3FTNA 5G0VA 3S5JA 1NMEA 4KFUA 2X3FA 3VKFA 4WADA 3CX3A 2VSFA 2XIJA 3CF0A 4MJXA 2AFIE 1X1BA 2DBQA 3H83A 3EB9A 4LZNA 3AOGA 1PO7A 2ZI5A 3EK2A 2Y4OA 1W5EA 4KYIB 4M8IA 5E4FA 4JQYA 4KE9A 4UPEA 1CRWG 1NAIA 1OZGA 3SGLA 2P2DA 5L3SA 3CE6A 4AWXA 4F12A 2GBLC 4DR7B 1DEAA 1EWRA 5C37A 2VJBA 3N0VA 2FPKA 3KVVA 1S4QA 4KDEA 2A78A 3HCRA 3D2AA 3ANYB 3NCTA 3EY9A 3PXDA 2WDZA 4U9UA 1QWOA 3KAJA 3OBIA 1Q1QA 1WG8A 4KAXA 4ZOCA 3FTPA 5BN5B 1GKUB 3RF6A 3THRA 1OGJA 1KH1A 1SEVA 3R5FA 1KMIY 5B12A 3U1BA 4E3ZA 2Q4BA 1KYTA 1Y0BA 2I34A 1N6RA 2NLOA 1J2YA 3CFYA 4JOBA 1U6KA 1QMPA 1P2UA 3UANA 2J9XB 3R6TA 4F9GA 5ITVA 4RYLA 4W9RA 1BKDR 1LY1A 3VSCA 3BMNB 4D6XA 4EUFA 4CEHA 3HDVA 1T2CA 3TE6A 3WDMA 3WWYA 3FMVA 1L4KA 4B2YA 1CRQA 2WK1A 1AKEA 4CM6A 4O4HF 2AOUA 3QUTA 2R11A 2BM9A 4ITUA 2PUTA 1C3JA 3R9IA 4CTMA 3NDRA 3GBSA 2H00A 3SYTA 3M6WA 1H22A 1EGMB 5DT2A 3CNHA 1BTOA 3HB5X 3KZNA 5GVRA 3VR2A 3WDKA 3ZY2A 1RM0A 5LWHA 2B94A 1U4OA 5TF4A 5AK4A 1HXHA 1U5AA 4DMFA 1VIDA 4EGFA 4YBZA 4EIWA 1LS6A 3HDQA 2HDOA 1NHWA 3K9NA 1LC3A 2F90A 2RCNA 1YKFA 1AQUA 1UC4B 1Y4ZA 3JQ8B 4K9DA 3EGDB 1FSZA 1JMYA 3T06B 3H4VA 2NM0A 4X1YA 1SC3A 3EJWA 1P61B 4LRYA 3SF8B 2FUNB 2WWXA 3R41A 4I6JA 4KX5A 1M1NB 4YDHB 5DXFA 5JMOA 4H3SA 2WZDA 4X60A 4RIHA 4IO0A 2YUIA 3VPHA 4DEYA 1E3EA 1MX1A 4S2UA 3R7BA 3NWJA 3P0FA 4ZAVA 1N2CE 3B2EA 1E60A 1UBSB 1UPCA 3BZBA 2PS9A 2X4LA 3I01A 3ICPA 4HQKA 4N0QA 3UMSA 1JZQA 3EQ2A 4OHBA 4BLTA 1GHTA 1TLFA 3P5SA 1AGPA 1FTQA 2O2ZA 2EJUA 1JU9A 4ZRMA 1Z5OA 4HDKA 5BO5A 5B2EA 3HR7A 4JVNA 3F67A 3B85A 3OZIA 4PAWA 4PNZA 5AHWA 4AIRA 3DC7A 3N7UA 1E79D 1GGVA 2DM6A 2O2YA 3T94A 7ADHA 3BA1A 4NH0A 4DJDC 1M7GA 1LXCA 4OHVA 3UC5A 3HJAA 1NSYA 4KCGA 1KJWA 1PT9A 4M9XA 10MHA 2Q6LA 4DMMA 4OCZA 4HUJA 3ESQA 4CM4A 3EOAI 1D2EA 3I28A 3LZ6A 1C81A 1HM5A 3GP5A 1DO8A 4RZXA 1ORVA 2OENG 2BLLA 2X9LA 5I5EA 2CXUA 4NICA 4UDYX 2E1RA 3NOVA 1H2XA 4LAFA 1YIOA 2C00A 1QK4A 3E4DA 1GAJA 2QRUA 1A98A 1DOZA 2A2ZA 2YHBA 1BMTA 3QW4B 4HLUC 4EB8A 4MO9A 4NR0A 1XAIA 5HE9A 3G2QA 4QYWA 1B0UA 2A5DA 2H54A 3I2YX 3PXAA 3QYJA 2V6GA 5J43A 4C0XA 3A1DA 4OHXA 4D9KA 5B4VA 3OCWA 3UEOA 3H4MA 1PG5A 1EINA 2IDKA 4XGNA 2FOXA 5IKMA 4I9FA 1BWRA 1T0PA 3WGQA 1XLWA 5KMGA 1G18A 5BSFA 4MGHA 2Q8QA 3GHYA 2GNAA 2WTBA 4I9GA 4YRRA 4NBLA 1XF9A 2Y1GA 2FN9A 3NDBB 5CX4A 3TVYA 3RQSA 1AKMA 3V48A 1NTOA 1EM8A 2FDCA 3VU9A 2OV3A 5DSXA 2VDOB 1OXTA 1P1JA 2DJIA 1VLJA 4IFTA 4IJVA 4RPHA 4ABYA 5JROA 1UFRA 1PR9A 5H3HA 3UA4A 4ODIA 3OE7D 4TTPA 1GKKA 2NTYC 3JYOA 5IFLA 1TZJA 3TOZA 3ZCSA 1BYUA 4JL8A 4MAMA 1HYGA 1ZXBA 2CJXA 4IY1A 1XD2A 1Y3AA 1W2WB 1S2OA 1U6IA 3I0ZA 1K5DA 2V8BA 4U7WA 1Q92A 4BMZA 2YV4A 4X6LA 1Z4LA 3GNTA 4WY2A 4P80A 1LNSA 3KV3O 5KQRA 4LG1A 1XDGA 4DBZA 2O07A 2XITA 3BIFA 2Q5HA 4ZI3A 1LS1A 3C3CA 3I6ZA 2UXDB 3VX4A 3B8HA 5A9SA 3LP5A 1OXBB 1WUHS 3OPNA 1DEOA 4X7MA 3TUIC 4J0GA 1ZHHA 1UDRA 4NBSA 3ZWOA 4JEIA 4KLZA 2P3LA 3EGCA 3TGPA 2VZLA 1P77A 1G42A 1DWQA 1BVUA 3DR5A 1X7XB 3ASVA 1VPEA 1XV5A 2BGKA 2Q21A 4N4AA 5LJLA 5KHAA 3H0CA 3L1IA 3RVLA 1XTZA 1F0NA 3EW7A 1R64A 4I55B 4JEMA 4C4XA 2EX0A 1WUTA 3E15A 3SSAA 4DILA 1NP6A 1NW9B 3GVXA 5REQA 1EX6A 1A9PA 1W1IA 4QGGA 2ADFA 2QM3A 4RM3A 1TQ2A 2F8SA 2ZYSA 3D5EA 3GD5A 5EE9A 3TDNA 4DIKA 5JQGA 4XLZA 2H1OA 2WMDA 1Z75A 4RTJA 2PRJA 3AY7A 3KLPX 1OHHD 2VZ0A 4V0RA 4ROSA 5EHXA 1PJ2A 3OURA 3TRJA 4OBXA 4X3CA 5BR4A 2Q6OA 4HEA1 4MUYA 3MJDA 1U0JA 2P2ZA 3H99A 4PGHA 2VXYA 3DBVO 4L4ZA 3NHZA 3F6EX 2QIPA 4MRMB 2ZS9A 3C6KA 1X7WA 1NIJA 2MSNA 3P9YA 4LF5B 1FLNA 1YJCA 1U98A 5CK5A 4J2HA 3IJEB 5KOJB 2QMZA 2WFLB 1QWSA 3ZK7A 4I1YA 3PGLA 1T9BA 2AS0A 3JD4A 4KV7A 3R5SA 4KXLA 1L7RA 2WTNA 4G8JA 1L5NA 1UKBA 1SUCA 2E18A 2IIBA 3PCXA 5A06A 3OEED 3FKSD 4XRRA 4MLZA 1YFKA 4CIVA 4EHJA 2VF7A 3EIFA 1X7ZA 3BF8A 1R0KA 4WD3A 1V3UA 3OTWA 1P1KA 2CB9A 3OX1A 5K6RA 4MB6A 4YJHB 1G5QA 2RAVA 3L01A 1E3JA 3QG5A 4G4JA 1ORRA 1WTAA 4ZO4A 3EZ2A 1AB5A 1TAQA 3C5VA 4N7BA 5CGQB 3STXA 1W0KD 5IKPA 3ZDDA 3KQUA 4OEHA 4NRDA 3UK1A 1OLOA 3SYRA 1X13A 4YJ3F 2JAQA 3AY3A 1G5PA 1QHYA 4UOEA 4MLDA 4REQB 2ZS7A 3RW9A 1UEJA 1X8LA 3KSDO 3E27A 3OIDA 3Q72A 5JTTA 5AJYA 1AKVA 2ZUDA 3AF4A 3FOAA 1ORWA 2XKBA 1QP0A 2FZCA 1B8VA 3D3EA 5CVTA 4V1CB 1R74A 3FOCA 4KUGA 4YP5A 3I9FA 2WUGA 1QLJA 1RCFA 4GOXA 1VQ1A 1KERA 2A5YB 1BGVA 4JUFA 4DLUA 1BRTA 2HM7A 7REQB 4HQNA 4HQLA 3ETLA 4OKIA 3TBKA 3U17A 1GXSA 2V7UA 4NS4A 3BSFA 1XMIA 2IEIA 5CHYA 2O2EA 2JJMA 4ZCRA 4ZCTA 3ZZ1A 4JQCA 3EIXA 3VKGA 3QOWA 2EJBA 1AK9A 1C3EA 2YWFA 3LKZA 3M6MD 4P3PA 1IG0A 2R8YA 3L04A 3QEOA 2GZ3A 5EZYB 3I76A 5LQRA 4DANA 1FX0B 2VR1A 4ZZ2A 4C4ZA 5I6DA 4DMRA 4U2GA 1YRAA 5AOAA 5I7WA 2M2IA 3NIWA 1QGZA 4WERA 4G56A 1R4NB 3LLCA 5G0UA 4N5HX 4XUCA 4AN4A 2PGOA 3INGA 3HNRA 3CPSA 3MPUA 2VWGA 2EJCA 2GASA 1ZGGA 3OD1A 3ROFA 2F6RA 4OBEA 2XCRB 1AGYA 2VAXA 5KAMA 5DP2A 4UREA 4B3XA 4FYJA 5HGJA 3RF7A 3SNHA 4BNIA 4EB0A 5JJBA 2I1WA 4YV7A 1NOIA 2DR2A 4WKGA 2PVPA 3JAMA 2K7ZA 4DYDA 1BW9A 5KJFA 3KOYA 4IJ5A 4ILKA 1SG6A 4PXAA 3AHFA 1V39A 2K6GA 1E79A 3G6KA 2FQYA 2JIOA 1IG3A 4LMBA 4KQJA 5HKKD 3GGJA 2FFHA 4FQ5A 1J8QA 2I7TA 1JXOA 1V9LA 2C2KA 4P81A 4R7ZA 4NKRA 1WXXA 1KOJA 4FHFA 4C7JA 5IDYA 3EXIA 2Q5CA 2XVAA 1ADJA 3CT4A 3F5DA 4JASB 2BGIA 2FYTA 4GS5A 2CNDA 3X1DA 1R27A 1W35A 3L4JA 4XM1A 3T1VA 1DEKA 3EF1A 1AS3A 3I53A 4OOFA 4Y7DA 3STHA 4TRMA 3FDZB 4AJPA 5BNFA 1RBQA 4OVKA 3P97A 2P79A 3RANA 2GA8A 2GAIA 4KN6A 3O1IC 3RC3A 4BHTA 4B17A 1AKQA 1RI4A 4BQNA 2HF7A 1CJVC 1C41A 2HB6A 3TLBA 2F1RA 1EWQA 4FQ8A 2FGKA 3RYHA 4TMFA 2D8AA 3LX4A 1AOXA 4N6OA 3JYPA 3IBYA 1HDOA 3WO0A 1AH2A 1OUMA 3IHKA 3DEIA 2JJQA 2C5LA 4GGOA 1XKQA 5AVYA 4CTNA 1NYTA 4S24A 2D1FA 3R0VA 3GPDG 2DY0A 4PQEA 3VNBA 2XCTB 2IV2X 1D2NA 2P0YA 3LIIA 2ZRDA 2ZYRA 3OE7A 4LMAA 1V11A 3MT8A 4LRUA 1FDVA 1M1YB 3DMDA 1PT5A 2PRIA 2ZGVA 3PJGA 4IVQA 4ND3A 2GLUA 5J5CA 3T5TA 4Y1RA 3AR3A 3WDLA 4HX5A 3LYUA 4M0FA 3UJHA 2B7BA 1E2DA 3E7PA 1S2IA 2H3EA 1N5OX 4K9RA 1PWEA 2B2XA 2RAPA 4YRFA 4DQXA 2IH5A 2JCXA 3ZE2B 1QYIA 3O1HB 1DEHA 3I1YA 3FAKA 1OBFO 1ZD1A 2EIHA 2ZJBA 3K8OE 1M2VB 3H42B 4R5HA 4GP9A 4EI9A 4N8DA 2HMWA 5FPKA 5D6OA 3BL6A 3TVDA 1JHUA 5K8UA 4QYTA 2BR3A 2RGWA 5ALWA 4IIGA 3NHWA 1KRHA 1THZA 1ZBQA 2FZWA 5BNZA 3LQQA 3CKKA 3SQMA 3RFUA 4KXNA 3PLAE 2JJ8A 2P40A 3D6FA 4MVJG 2OCAA 2R9VA 3O8OB 3DO5A 4UASA 4MZXA 4F9TA 3OLVA 1U8FO 3OG9A 5LA6A 3EAQA 3O6VA 4US1R 4II2A 3I04A 1NKVA 3KPYA 4TWAA 4DGSA 5CT8A 3W5JA 1JKIA 1HEIA 3TPCA 4YV1A 2PXHA 5CDHA 3HNPA 3G1WA 1HEUA 1NVXQ 1RRGA 1QHEA 3C14C 5DN9A 5G2OA 3MD0A 5I9BA 4DDKA 5JNSA 5JYDA 4ZKDA 3C24A 4PWZA 1VYTA 3O1JC 3AK4A 3WMRA 4PG8A 3GA5A 1UCFA 2Y66A 2GK6A 3EXHB 5JWHA 4C0BA 4LSZA 1PLLA 2A59A 4KWEA 2F1JA 4DCVA 2G5GX 3RIMA 2PMFA 4H0CA 2POQX 1WU7A 5KNCD 4NOLA 3BGDA 1OHHA 3HKEA 4QNMA 1KFBB 5CFPA 3QWFA 3CKYA 1SURA 4FMCB 5K99A 4C76A 1OREA 1G38A 4NZYA 1VB5A 3DQQA 1LDNA 1QFJA 1CJTC 3P2EA 4LXQA 3SZ3A 4D97A 2E85A 2ASVA 1YJQA 2O7QA 4UM5A 2HPAA 1ID8A 1JEEA 4LJ6A 4PZCA 4Q7JB 2VT6A 4Y2TA 4K46A 2QRQA 2ZEJA 2DR3A 3KDAA 3GIDA 4ALIA 3ICEA 2H2WA 4IPTA 1XGKA 2YMPA 2YWRA 2XHZA 3D4IA 3O7WA 4BE4A 1NI4B 1W1UA 2FFQA 2VWHA 4HVCA 1SUSA 5KQSA 2ZQYA 5D7NA 2WG2A 1EIWA 1SQSA 3OEEA 2PZEA 3FKSA 4Y9UA 3K0KA 5A9RA 2C04A 2EP7A 1VL1A 3V6LA 1OIXA 4XD7A 1G5RA 1R4ZA 1K6XA 3HXKA 1D1PA 2DWOA 3KQHA 1E2EA 1V45E 2QJTA 3MVEA 1QGOA 1TKAA 3D0QA 4NAUA 1I1HA 1GWNA 2ZVDA 3FCXA 1W0KA 4ZT6A 2QVLA 3NASA 5K0SA 4I6EA 2KYRA 2OZVA 1YWGO 2ZR9A 3HKCA 4ER6A 1CY7A 2W8BA 4PONA 4G81A 1NMXA 2QXUA 4DIDA 4DC0A 2QHXA 3D8RA 4HF7A 4I1RA 3UH0A 1MJ5A 3EULA 1WXFA 3GEIA 4JN6B 4KDCA 4N49A 2V65A 2F17A 1SUAA 2GJ4A 3SEQA 3R0XA 4OJNA 5KTOA 1BXKA 3DBIA 4OQNA 4UVEA 1C9EA 3WDSA 3TIVA 1SXJB 1CUBA 1VKHA 2H4YA 2NYUA 3BXPA 2Z1MA 4NBVA 2IZZA 1DB3A 2F3PA 2IZOA 3D4OA 5C2JB 4P4SB 3LVFO 1DAMA 4OLFA 5J2UF 2NZUG 4QATA 1JJFA 2PYDA 3FPGA 1A2OA 2P6OA 3JVIA 4EUEA 1F0PA 3CS3A 3IMGA 3FKQA 5ENZA 4X1KB 5HQ3A 2OPHA 6GPBA 3K09A 4Q9LA 4FWBA 1Q21A 1QH1B 1WOYA 4LOJA 2ZM5A 1NVTA 4C7OA 4JC8A 2BMJA 3ADKA 2BEUA 1T8YA 4QNNA 4ZTBA 3RT9A 1I6WA 1ZM2A 3BJIC 4M6WA 3PITA 1GL3A 2UZ1A 1T0IA 3L7JA 5ALIA 4HO1X 2UYHA 1IATA 4Q7LA 1T1SA 4P7BA 2QX7A 1TF2A 2V98A 1C4OA 2C94A 5FH9A 3M5WA 1YQXA 1QVZA 5HNKA 1JECA 1LK5A 2BJWA 2VYFA 1MHTA 3E2MA 1EFDN 3R3SA 1AUPA 1SCKA 3FB1A 2YWDA 5E2AA 2YASA 3TZBA 1HQCA 2I6UA 4OQEA 3CYFA 1C5KA 4IUDS 4EEZA 1R15A 3P9XA 1N8KA 3A11A 1DLJA 1P29A 4KRGA 1NNI1 4FC6A 2C1ZA 5G4LA 5IDWA 2CSXA 1C8KA 4F6RB 2Y0CA 1PWXA 4P34A 3USZA 1HKUA 2J6BA 3A6LA 1L3BA 2C3UA 4L16A 4RMJA 4A8PA 3L2OB 5JS8A 1T2FA 4LEIA 1PHPA 3L7OA 2ZSFA 5JXHA 4E30A 4GOND 3AV0B 3DEYX 1DJMA 1L4UA 3OZAA 3VTKA 3MIZA 2WW8A 3QPUA 1LW7A 1IB0A 2PFKA 3KQMA 2Y0BA 3OUTA 4XWWA 4AP5A 2X9VA 3L1KA 3OFJA 1TM1E 4C4AA 5HKKA 1IJFA 1QH8A 1YI1A 1DV1A 4Z99A 2GHQA 4EHLA 3TR6A 1ZEMA 1CUEA 3CLSC 3KE8A 5DYTA 4I14A 1BRMA 3KAKA 2IXFA 3HY4A 1EK5A 1VYVA 3LUPA 3N8IA 2DH5A 4MYRA 4AK9A 1Z39A 2WMNB 2WD8A 3KJNA 5AOVA 3UQZA 5CG2A 3KP1A 4J16A 3RPEA 2RIRA 5JAOA 2PLFA 1A7AA 3W9YA 5C1PA 3BAZA 4PIPA 3UHFA 3EPLA 5HE8A 5IYZA 4P33A 3K2BA 1WXIA 5IC5A 1N3IA 1QMGA 1MBZA 2HQOA 2ETXA 2ZULA 1WP9A 2G70A 1ZK0A 2Z4SA 3HN7A 3DFZA 3KQTA 3KYDA 3VDRA 3V4RA 2OECA 4ZANA 1L7BA 4O3FA 3ZK9A 1BCRB 3QE2A 2QMYA 4Z9YA 3FPFA 1YVDA 5CUQA 4BWGA 4NDNE 4FINA 3EAGA 4C0WA 5GY7A 3B9QA 2OD7A 3M6LA 4ZO7A 4YAEA 3GWGA 4D5EA 4DR5B 4U4AA 1L4NA 5JG7A 1HFJA 2ZJOA 3L84A 1Q0UA 2V7PA 1OPRA 4ZDKA 3WMGA 2XUJA 4Q66C 4RVOA 4CTOA 5F52A 4J6FA 2R751 3CVJA 5DZSA 2D0PB 1IY9A 3BKXA 1R0RE 4FR5A 4E21A 2R3SA 2Z3VA 1KY4A 2EHJA 5HJ5A 1AC5A 3O4HA 4Z9AA 3W5DA 5JSZB 3O47A 2QJOA 4G07A 3TTVA 4WK4B 3AHDA 2YHAA 3CURA 4XM2A 2PX3A 1RSZA 4S0XA 1MW8X 2DY1A 4P3YA 2BKLA 3CKLA 4TPKA 4BQEA 1XDBA 2X5OA 3ZS8A 2CN1A 3K05A 5K2OA 2GF9A 1X6VA 2O7RA 2ONYA 4V02A 4LNHA 3ZZUA 2Z3WA 4KP7A 4YX9A 9LDBA 1YR1A 2Y0PA 4UXIA 2Z57A 2HZBA 1QIGA 1TQ6A 4LOKA 1R5NA 2XH8A 1T5OA 2VDVE 4PCAA 3KAQA 2BBTA 2QAGB 3PJEA 4X84A 2R00A 5LNK6 5KZMB 1V43A 1Y48E 2OR3A 1NLMA 1T2VA 1KAOA 4GI3A 1IH8A 5MGBA 2J4DA 2PPVA 1A8UA 3PGA1 4O4JF 3DAPA 5AW5A 2D6FA 1NBMD 1CDOA 4NYMQ 4TZKA 4CM8A 4FSDA 5JVDB 1EXDA 4OSEA 1PNVA 2HF2A 4FCTA 4R51A 1H4QA 3T5DA 1OJ7A 2G71A 1X7YB 3T3EA 1UUFA 1PX2A 3OEWA 4MDYA 3ZIAD 4GI1A 1BE0A 1K6MA 4M8SA 1K4MA 2QAJA 1YBMA 2VUHB 2YC2C 3OT5A 4NU5A 5EFZA 5FF9A 4BVKA 1GTZA 2CJYA 4J4BA 3TTSA 5LBUA 2RIPA 4YXFA 1ZVQA 2WQZA 1XEXB 3LGAA 2QG6A 3U49A 5CB4A 2O19A 3I39X 3II6X 5ERGB 4OJQA 5JI3E 2WC1A 3PFWO 4UE2A 4CCSA 2XCUA 5KVAA 2QAIA 3H04A 4J7UA 4G6ZA 1P9OA 1MVLA 2CLDX 3AIOA 3VKWA 4ZCMA 3HU5A 3MXOA 4QT0A 1QKIA 5CYPA 1CERA 3LXXA 5LYJA 2R6GA 4BZZA 1JSLA 4F21A 2ZJ5A 1Z29A 3EDMA 2I8LA 3DCIA 3LHIA 3MYYA 3D6UA 4PXSA 2AFVA 4DIOA 4ZC1A 2ZWPA 3N0TA 5FOWA 4G0MA 2YXBA 4TTVA 2FR8C 3NJRA 5DTRA 3DVAB 3PGMA 4MWBA 5EUBA 3OQIA 1G16A 1O6FA 3S29A 2QVYX 4HPJB 1RIFA 3G49A 1U3UA 4LXYA 4TGLA 3WYAA 3TMYA 5CLQA 4YUVA 3O5AA 2BP7B 3O03A 3RRFA 4A15A 1AGXA 1T0UA 1GEGA 1KI9A 4GPAA 3HO8A 3ZWYA 4BNZA 4F6LA 1A9XB 3T12A 1CK4A 5FUWA 3HI6A 4KDRA 5H81A 3QXXA 2OCLA 3O95A 3PHGA 4KBFA 4CLXA 5JSFA 1SOWA 4X6YA 1GAEO 5JFTA 2O3RA 3ESRA 2J7PD 1H0KA 1AZWA 4CYMA 1G7CA 1UBRS 2WJGA 4FFNA 3L7MA 3H8JA 3M70A 1JEQB 2P2CA 3E9QA 4DDWA 3I01M 4TROA 2HGZA 4Q4DA 2HMTA 4OKSA 4EABA 1RFGE 5GONB 3D64A 2PL3A 2X9NA 1NVMB 1VHLA 4BAZA 2I3ZA 3VSAA 3HHPA 4FDUA 3QE0A 3G8DA 1E92A 2VFAA 2BTEA 2WHEA 2ZYDA 5FJIA 2HPZA 3OHSX 5AM4A 4URUR 5KO2A 2I8AA 1REQB 2AKAB 2PXAA 3CUYA 4P7KA 4YT2A 4H1WA 3ZJ5A 2XAAA 3U7EB 3RM3A 1AZSC 1CY8A 2JGIA 2JW5A 2X41A 4HQRA 4GX5A 1Z0FA 4IEIA 4R2MA 4GXNA 4XVUA 5HWSA 4F11A 4AKIA 4DT1B 3ZGXA 1S4MA 4HZGA 5JBIA 1MLDA 4MV9A 3REGA 1NL3A 1SBHA 3NMUF 2HRRA 1CUDA 1LKZA 1A04A 1DAFA 1PV2A 2X1MA 3GYGA 4IIJA 4BO9A 2A9OA 4IF4A 1P31A 1UMBB 1EBUA 2FZVA 4F2DA 1ARZA 1B8NA 1E6CA 1R12A 1PDOA 2W71A 3A6JA 1QRSA 5LIRA 1VE7A 1TL7C 2O3TA 2EGUA 1GTG1 5SYAA 4TSKA 2R66A 4B7UA 5A3SA 5LOVB 1VE6A 1EDBA 2JF0A 2BKVA 2XNKA 4L6AA 3K0FA 2JJ1D 1OXXK 2GAFA 3I2IA 5MHTA 1MGOA 4ZKEA 1XA0A 3D8BA 4HP8A 4KQXA 4MR8B 3KTDA 1GG2A 1NBIA 4HG2A 3WIOA 4DV1B 1FYWA 2Q6KA 4H77A 4ENTA 1OAOA 1ODSA 4AROA 2PNJA 2TYSB 3MS4A 3LDAA 5E4JA 5GJWC 5HIJA 5A1TA 4DR4B 2IU3A 1Z2PX 2EP8A 3CG0A 5AQEA 3DT8A 1RHRA 5EXTA 3KR0A 3W3AH 2J6CA 4B31A 5JD5A 5EKTA 2OPBA 1WHSA 4FQ7A 1L5FA 1QYXA 1ZBDA 3KPUA 4IX9A 3PB3A 1W73A 1NVVQ 4URHA 4EP1A 1KTVA 4YP6A 4ZGBA 5DXJA 3R3UA 4DVGA 4GOJA 2P6NA 3EVEA 1OLUA 4YRNA 1U2TA 1T4MA 3FG9A 4OXRA 4PN7A 1E2IA 1C80A 3DEAA 3Q6IA 4N7RA 4Z0TA 1Y8RB 5KX5F 3TKYA 5T6BA 2ZIFA 4N41A 3FR8A 1SKAA 1T2NA 2YDXA 2EW1A 3FE2A 3ZLBA 5IJ0A 1NXVA 3BXOA 1PVVA 4EYGA 2EKZA 5CG1A 3C7CB 5DVZA 4BO8A 4XQCA 1QTQA 3AU9A 4R1QA 5FAKA 2EBFX 2A1UA 2XKAA 1QQ6A 4TKVA 2QRVB 2RH8A 4PR0A 1TJNA 3IP6A 1MJFA 3COYA 3WRYA 1ZOLA 1OT5A 4JX9A 3ZXUB 2AHOA 3DH0A 4A8JC 1NOKA 1YZKA 4B6RA 4REMA 5DX8A 3U5ZB 4ALNA 2PAAA 2VYCA 3A2MA 3HY6A 3JATB 5FA6A 2Q29A 3PUJA 1V5WA 1ZS9A 2RHMA 5HRUA 1SHUX 1T10A 2TMGA 4N39A 4BFZA 3JQGB 5JRZA 4I1PA 1SBZA 2OC4A 2X3UA 3ISJA 2HMAA 3EZNA 3OZ7A 1P2GA 2BSXA 4LWZA 2WP8J 2Z6UA 4KIUA 3BMCB 4ZDJA 4NFSA 1XA4A 5KJ6A 2BSQA 1IUNA 2XJ4A 2X2FA 1XRMA 2OV4A 4HOYA 2WWWA 4OU4A 4YFYA 1MGPA 1WXQA 3QVJA 2ZRKA 1RXWA 3RIEA 3UFBA 5THQA 5CDFE 1N3BA 3HB7A 4E33A 2CFCA 4P35A 1P7CA 4JLUA 1CB0A 4MRPA 2FSVA 5AHRA 2J0UB 2QRKA 2FEXA 2JI4A 3MTEA 1G20A 1NXOA 4O4HB 5D01A 5I8ZA 3ER6A 3QLJA 4L08A 4YJFA 5K3AA 1PU2A 4KI0A 2P4HX 5TIIA 1OSNA 1X0XA 2PUWA 4BLOA 4DV4B 3IILA 1OX4B 1WXHA 3ZWKA 3JWEA 1J0XO 1VSUA 1TKCA 2SNIE 4V0LA 1IY8A 4JEUA 3SR0A 2AKEA 2YWEA 4LA4A 2EEZA 1NBMA 1FMLA 4RKWA 2R7NA 2H4HA 1TAUA 4JODA 1G3RA 1MIOA 5D6NA 5B55A 4LDPA 3DZKA 1CU1A 4Q6BA 1JRLA 2WT4A 4C21A 3JALB 3VFDA 3ZIAA 4DUGD 2OBFA 8OHMA 1RYYA 5IT0A 1K4KA 4Z3KA 1MC4A 3WS7A 2FWRA 4MB2A 1K8XB 1B3BA 1Q74A 1I01A 5J58A 5BVGB 1M0WA 3HC7A 1IL0A 1J7KA 3QLVA 3R76A 4ETIA 2JH3A 3RU9A 2C7VA 1GGEA 4XLLA 4F2HA 4O2AF 4QGSA 1AQIA 1MA3A 2B6NA 2J0EA 4AVYA 1WV1A 2X4IA 4U2CA 4GYJA 4NPAA 4Z4CA 2IH2A 1V5IA 3NEPX 2XX3A 3IURA 2FUEA 4D81A 1YS4A 4J8PA 4RGBA 5CVEA 3RTEA 5CDGA 4KKVA 5HF6A 2ZKIA 3FBTA 2V45A 5K8LA 1T5IA 2GAJA 2QRZA 1PFWA 4WXEA 4DQDA 5DB4A 2UVDA 2KM1A 2HXSA 1QRAA 1NDHA 2IHVA 3IQIX 1XMXA 2VPTA 3ZZTA 1CUFA 3HA2A 3IPYA 1UPXA 5HKLA 2P1DA 3MJHA 3NYWA 2IGBA 4MCJA 3KSAC 3SQOA 1W2HA 2ZRJA 2O8DA 1GSOA 2G5CA 2Z83A 5JS2A 1QIHA 3OLYA 1SKQA 2QP3A 2JDID 1NW8A 5JS7A 3EJ6A 3TM4A 1DJPA 2P5TB 3B6IA 4C2AA 3BJZA 3ZNQA 5JSUA 5KKNB 4F3KA 3AEZA 1QHXA 1YC5A 4O02B 1E5XA 2AXQA 3S1SA 1DX4A 1I5OA 2VRBA 2J7PA 3JPYA 3G2OA 3KEQA 4F60A 3BIWA 4A26A 1KMHB 4YACA 3SP1A 3AVVA 1DVRA 2O2IA 3L1JA 3N86A 5FXMA 3HV2A 3EOZA 4RV5A 3N6XA 3SZRA 5I7EA 4P0PB 4D82A 3L7LA 4ND8A 4L78A 1ADBA 5ETJA 2WUWE 4OSPA 2DZDA 2HMVA 2E4UA 3HYCA 4RHUA 3ZWXA 4LCBA 4ZOQI 1E0AA 2IPLA 2P77A 3K0SA 1UQUA 4BQSA 1FS6A 3DD1A 2G04A 2RGUA 1QFZA 3HA7A 1CJSA 1NHGA 4ZYZA 2WUDA 2J9YB 3FVWA 5BPHA 4HDSB 3M3HA 4J03A 2W9XA 3FVRA 4L72A 4C0AC 2E89A 2ZU0C 3H9BA 5DJ5A 4QHYA 2X2EA 1M2WA 3Q8XB 2IYTA 3GFGA 3JV7A 3WWZA 4ZEWA 3RS5A 2J9ZB 3TEFA 4QEDA 1RXVA 3ML1A 5KB3A 2I87A 4N3CA 4FYMA 1L5KA 4UTZA 1RQXA 3GDHA 3BVPA 3IT1A 3SIXA 2ZAIA 4B74A 5CH3A 2PBZA 3KSZO 2O2HA 3K6KA 2P9QA 2D06A 3QFSA 2A30A 2V55B 4WEOA 2JJ1A 2ZG6A 3JQ9A 5IJ9A 2P65A 3UUFA 4AW9A 3QLUA 5K0LA 4NOKA 4E5DA 1ZGCA 2AMVA 3RC7A 3U7QA 3UMBA 1Q22A 3ZVLA 4AJJA 3GFPA 4D25A 1L5SA 2XWPA 3Q3VA 1AKUA 2GPJA 3HI4A 4TYMA 5CRIA 3JQ6A 2XCOA 4GD3Q 5EIHA 5IUKC 3SZLA 1NKTA 3PI7A 4MWZA 4O4LA 5A4FS 2ZJ0A 3BMQA 3EGXB 1QIKA 3FHOA 2QIOA 2A88A 5FOVA 5KDOA 1G9XA 1JAHA 3ZXXA 1UJ2A 2DUWA 1CTQA 2ZYHA 2OO5A 4GR4A 1U04A 1Y37A 1V7ZA 2WHPA 2C2HA 4IO1A 1A9TA 3DTVB 5EEHA 3HUUA 1KEKA 2PUDA 3CXRA 1XPUA 2Y76A 2H18A 4JLAA 1P1BA 4F71A 1LFDB 3BZUA 1ZLYA 1P4RA 4JMPA 2ET6A 4MDHA 4MCHA 5EUMA 3MTAA 5ALYA 4WSOA 2JFGA 1LD3A 1UXKA 2GN9A 3B1VA 1E1CA 1STOA 4KQWA 1TX4B 1Y80A 1IOWA 3KKEA 4LTMA 5EPOA 5TF0A 3T7DA 1BHQ1 1RXUA 2YQZA 5DBEX 5A7HA 4W4TA 2OORA 4FB5A 2J0VA 3RJZA 4YCMA 2B61A 2FR1A 3E7DA 2FPRA 4I50A 5ALNA 3O8CA 4WJLA 4MUBA 1NVWQ 4XFDA 4BDTA 1U4SA 3TKAA 3GGGA 3CNNA 4YRDA 5G0SA 3TTYA 3I04M 4FFBB 4LNUB 4CFSA 3SYMA 1RLMA 1L5MA 1NZJA 3L4EA 3E0XA 3FFWA 3K5PA 2EU8A 4DDMA 4KQCA 3I8XA 2YKGA 1N36B 5IH7A 3LL7A 5H1YA 4H2DA 4CLRB 2Y67A 2IQIA 1SPXA 3LPMA 3GJYA 1X1CA 3MWEB 3PC8C 3OT1A 3PA8A 4IGAA 4LQCA 4YJ3B 4B0OA 2AUNA 3H05A 4BXOA 3I9MA 1GCGA 1ZK3A 5F1YA 2IOYA 4EZEA 2GEFA 2P3SA 1UK9A 2BAGA 1DIAA 3N53A 5JO0A 1Z4NA 4MS3B 1PZGA 3DBHB 4CRWB 3RUDA 2OB2A 2YJNA 4JA0A 2QN9A 3RADC 1BAPA 2H5EA 2W6OA 2CZGA 1LPSA 1DRJA 4BV3A 4QGFA 3QE3A 1PR4A 3LZCA 4HSGA 3OM9A 4X9XA 3RVSA 1A88A 1DCMA 1Y3DE 2XADA 3RK0A 1OE0A 3GH3A 4Q9DA 2QENA 2J3JA 1B8PA 4IMJB 4OJYA 1PJZA 4NBNA 4Q37A 4BNTA 1DBWA 2G08A 3OIVA 4RVHA 2FWNA 5C1OA 1ZC4A 4IZHA 4CM1A 1A8IA 3VOBA 1DWOA 1PJLA 3K94A 3WX0A 4JMLA 1U8AA 2PANA 2Y1XA 3M9WA 5IVIA 5BRJA 4PHTA 4PIMA 3MIIA 3BL8A 2CNKA 2I2CA 1G8YA 1QIFA 2YN0A 3OFKA 5A7GA 3M4ZA 1J20A 4Q3LA 4Q12A 1LCIA 4Q3EA 1I6LA 1Z47A 2XMRA 4W8OA 3FNQA 4B3CA 5AVVA 5CNMA 3ORRA 2GNPA 2GXQA 3KFLA 4C06A 4GE3A 3OKPA 1YK0A 4C3UA 2RGNA 5EKXA 2JVIA 1GKLA 3SC2A 4JBXA 4DUGA 6ADHA 1FP4A 3CXUA 1IQRA 3BK1A 4Z0HO 4D0GA 2R6CA 3IEUA 3C3JA 3TTXA 3X1YA 1ISFA 3MWKA 3ASZA 3GN2A 3U3XA 3X44A 4C03A 5ADWA 1QQBA 5ICCA 3N0RA 2I7DA 3KXKA 4JUDX 1DL5A 1Q83A 5DI3B 2ZATA 2QX8A 1B15A 3MWLA 4YASA 2GS9A 3H1TA 3V2IA 2PD3A 1CQZA 1B43A 2BBOA 1U1CA 3OOHA 4OJTA 5U9CA 4HHEA 1ACMA 4I4TF 4UULA 4RJJA 2JEZA 1GDDA 1XNHA 3R7WA 4YAKA 2M6KA 4N48A 1S8OA 1GL7A 1ODKA 4FTWA 4M0KA 1T0HB 4XGKA 1F3OA 4MS1A 3IQEA 3IUQA 3VU8A 3SC4A 1FXSA 3LECA 1IZ7A 4MRAA 3NVKI 1Z6PA 4LMRA 1JDNA 4WUTA 4Y67A 2O52A 1KOLA 3UAOA 1TYZA 1E99A 4NDAA 3C97A 3GCWA 1JTEA 2Y77A 1O95D 2XDYA 2X15A 3QYPA 4MPJA 4UD6A 3AVTA 2IUFA 1XN1A 1I7DA 3LCRA 4BVJA 2VPPA 2UVPB 4BBJA 3CX7A 1VRCA 2JDIA 2XIQA 3HV0A 4NU0A 4ZTUB 1AZLA 2PGDA 3HL0A 4R1MA 4WLFA 3NYRA 2WP0A 3WLOA 4XR4A 4UHFA 2ZWIA 2FW7A 3J7AC 1GPLA 4R9NA 2IDMA 2EFCB 1UQTA 2ZI4A 3FSGD 5H4HA 1AMNA 4HNTA 2Q5OA 4M9RA 5ECGC 4CG1A 2NSLA 3PQCA 4RK7A 1EG7A 4S12A 3C74A 1ZL0A 4UE6A 5IAAA 1DU4A 1Z0DA 4RPKA 4UAVA 1I1QB 4UEOA 1X1RA 4L51A 2YZGA 1PS0A 2DWUA 2ZBRA 1PGQA 3PGXA 4FHEA 2NU8B 4C4SA 5IVKA 1KFJB 3EE6A 5TQ2A 4D8WA 4I19A 1YVEI 1N7IA 4B79A 2ZPTX 1Z4QA 3M2PA 2R2AA 4TLMB 3E5NA 3L79A 1SZDA 1U0EA 1V2HE 3KL2A 3TVTA 4ESEA 3ICOA 4ZOEA 3T52A 3T34A 4BMSA 2ZI9A 3A1EA 1NE2A 2XB8A 2BZ0A 4MHOA 1PHRA 2ACKA 1VGQA 2R68A 3VM6A 1O0SA 5LPNA 4KVGA 4YVFA 1JQ5A 3MCZA 4EA7A 4W6ZA 4WLOA 1M5UA 5CLLA 1FS5A 3RV4A 3KOXA 2R7AA 4XTCS 4H1VA 3GFBA 4YECA 3AEXA 1J9GA 4QJ3A 2G6BA 1JS1X 2P3OA 3O9MA 4G85A 2EF0A 3UIEA 3FDIA 2B99A 4NMWA 4JB0A 1JDUA 3QX3A 5FUMA 1PFGA 3UHPA 1AUVA 4HT3B 5BT9A 2K4MA 2WF7A 1U3GA 1T6ZA 1WW2A 4QYMA 4LCJA 2EQBA 2IS6A 3ASYA 3CKMA 1Y3BE 4JY7A 3HRIA 4BV2A 2ZTSA 5KIAA 5FI0B 1HYQA 2ECFA 2YZKA 3UAZA 4FIZA 1FL9A 1IONA 2ZI3A 4GPBA 2FFRA 4AN0A 2AI1A 4YAIA 5GIPE 2PX5A 5HHTA 4YJ2A 2P6PA 4MV3A 5T4FA 3ZIDA 3VISA 5JS1A 3A8TA 4DNFA 2YHIA 4XCVA 3LWBA 3LC7O 3PIDA 2ZJ1A 3W6UA 2OZLB 4QARA 1W5FA 3SJBA 2F8LA 1G3MA 3JVDA 2CL6X 2YFKA 3P9SA 5F2EA 5HBRA 2FUG6 2ZRAA 4MRVA 3QWAA 4DMGA 4FR2A 3SWWA 2R62A 1JSZA 1M73E 4Z5XA 3C7KA 5D5HA 1JSXA 2PBFA 4MUAA 2JBHA 4CMGA 1LSJA 2C1EA 2R6R1 1JNYA 2X0FA 1DG3A 1X1QA 4W1QA 1U0NA 4L2IA 2JLCA 2FLWA 3ZD8A 1Z5VA 5FADA 1FFXA 3GLIE 2CLCX 1D9XA 5AVRA 3PQ8A 2DFNA 1E4VA 1GQQA 1IAQA 2HBZA 2HZ7A 1XEAA 5F76A 1Z34A 1LDYA 4NBKA 3QY0A 4UNRA 3F8TA 4JCOA 1XVVA 1DAOA 1XLUA 2AWOA 2HRDA 4AXBA 2VG8A 3PWTA 4M38A 1OCEA 1SUPA 1YS6A 1J39A 1D6SA 1TZKA 4MINA 1GRCA 1WBDA 1UJ5A 3ZDQA 3AERA 1LW6E 4ZV9A 3RFFA 1CQWA 1JTFA 2IYUA 4EJSC 4KV9A 5EJ4A 1I3NA 2HIMA 2AFHB 2P27A 1S1CA 1NOJA 2JIBA 3MINB 4BNUA 1FFSA 1PYDA 2C8LA 3IEMA 5K45A 1RYBA 4MV5A 2PK3A 4F56A 4RENA 1FRVA 3LIPA 1TGYA 3C3XA 4DFDA 3UGTA 2H06A 2F8TA 5IULC 2H0QA 2E4AA 4E11A 4KC0A 3FWZA 1G21B 3BRQA 1YB5A 4XA8A 4IXNA 4X61A 1NPDA 2JAXA 1G8JA 1H69A 3OF3A 5THXA 5EJ2A 4ZT7A 5CYOA 3TZQA 3C98A 4Y6LA 3ONDA 4MA5A 3ZV3A 3AFMA 2UZAA 3PXUA 3PIRA 1SUEA 1VYUA 2VQEB 1ZK2A 2VPXA 3WHLA 3VNVA 2FPIA 1N6PA 5BWNA 2A1TR 4LZJA 3AR6A 2BFEB 1BXZA 4L7QA 4D96A 2DBRA 2NQTA 2HPVA 2G1JA 3RHZA 2FPXA 4NYIR 4I5FA 4TXJA 2WDPA 2X14A 5J2UB 5A1JA 2Q27A 1KY3A 4PQYA 4YP0A 4HN4B 1UAYA 4OXNA 1A72A 1M8GA 2PV0A 5HKAA 2ERYA 1Q0ZA 4QDJA 4ZO8A 2AZMA 3VYSB 4DR1B 3G8AA 2XDWA 3LVRE 3TOXA 1KHTA 4FYWA 3ED5A 4F84A 1I0LA 3TFOA 3GVPA 3UGJA 1DAIA 1PR3A 3MTQA 4L07A 5JDCC 4ESOA 1YO6A 2QKYA 2VJAA 3LOUA 4J9UE 1OD6A 4KXQA 4L0MA 4ZEMA 4EVQA 1HQDA 1YULA 3OX3A 4K6HA 1OIWA 4P4UA 4BZXA 1ACLA 1XTQA 1MC1A 2EXXA 4X3PA 5DLQC 4BMNA 1C0EA 4CMBA 3N2GB 5CNIA 5CIYA 1NRXA 1CF4A 3F6SA 5KVCA 2OM6A 1IUKA 5K8JB 4ARSA 1KY2A 3HN2A 5BV2P 2QZPA 3AHGA 5HCIA 5JNUA 1OTHA 2ZB4A 2G9RA 1TF7A 2E5LB 2BI8A 2NV2B 3F5MA 1ZOPA 4KGZA 1L6IA 2I0FA 2QM0A 3HWSA 1IJBA 3CEAA 3OIWA 4G5YA 1T4CB 3SHFA 4EEXA 4CIAA 2BTQB 2WFAA 2Y1LA 4NEHB 2QTWB 1E9AA 2O2CA 2QXTA 2XWSA 5JAHA 5BVHA 4D4GA 1RJ9A 2OP1A 1CEXA 1ZVKA 2R60A 3ZBPA 2LE0A 1F5NA 2K2QB 4HEA6 5DEIA 1LPBB 1ZWKA 3MTJA 1H85A 3PD1A 3D6MA 3GDGA 1XCMA 1CNMA 1IU9A 1SRRA 2YY6A 4TUYA 5AMXA 3WB0A 1PGNA 1FYXA 3KKMA 1IAVA 3RUFA 3BCHA 2AG5A 3DNMA 3ZEAA 4WBNA 3J81k 1SZCA 3KK0A 4Y2UA 4R4JA 3BDIA 1GGJA 2H17A 4W7HA 1C1YA 2OXCA 3E3MA 3ZBTA 4C4YA 1Z22A 3WL7A 1CZRA 1L7PA 2EP5A 4IIUA 4OUKX 3ZY3A 1LF0A 4AY4A 5I7HA 1VPWA 1E3WB 1LNZA 4L3VA 2RSLA 4E70A 3KYBA 4DTCA 2RHJA 4LMPA 1ZUNA 1D1TA 3ONNA 4G0XA 4UARA 3D3WB 1C50A 3QXJA 5D7BA 1G9TA 4AMGA 3K15A 3VBEA 3HTXA 2YTZA 1Z6AA 3BXFA 2OGWA 1GFIA 1QTNA 1O95A 2JCSA 2PH5A 3REQA 3TAXA 2VZ8A 4QXOA 3BBPA 3WADA 4MLPA 4JD5A 5KYUA 2BR5A 1WD5A 1JBEA 2NYVA 2YRFA 1KBOA 2FPUA 1KKUA 5EIOA 4JC4A 1YR3A 3LLUA 2IYXA 3UKJA 1T3LA 5ECYA 2ZAMA 1E7SA 3BJMA 4EW2A 3H2JA 4ZGGA 1YI0A 2CFRA 8GPBA 3WP0A 5KYYA 4W5TA 3AZOA 5FPYA 2JFFA 3QU7A 2EC5A 1U3VA 3BHJA 3FSGA 3P4YA 3RV3A 3HXOA 1M7BA 1PUXA 2I4TA 2JHAA 4CKZA 4LRXA 4TL9A 4MVXA 2RB5A 3ZZMA 4NAVA 2SCUB 4OHUA 1LBSA 1JQEA 1SQGA 1E69A 2E49A 2NU6B 2P75A 3C7DB 5F9MA 2E4YA 1TMKA 4I36A 2ID7A 3HCWA 2H2FA 4L8LA 4RKEA 3AUTA 4MJLA 1ESDA 4RORA 4OREX 1XZCA 4U7FA 3YASA 3NNNA 4K9QA 2D2XA 1RKVA 2C84A 3E3AA 3E9MA 1A9YA 1FRFS 3EWSA 4GC9A 5CLFA 4MKRA 4WECA 1FSFA 1GG5A 1RPTA 1RRKA 2HD4A 5ED0A 5F4ZA 2F9MA 4U5QA 2PMWB 3U3DA 4V38A 1L5HB 2MTBA 4AY5A 3RD5A 4DWWA 3A0RB 2B69A 4RQTA 1Z83A 1QOQB 1SXQA 4ARCA 3B1KA 2Y9PB 4HR7A 1HMPA 2FPPB 4E94A 1L5GB 4GKJB 1XZEA 1B8OA 2E0IA 4EHKA 5FYDA 4PCVA 1LB1B 1T9GR 1O7JA 1OILA 3VAZA 3IAEA 1WQ1R 4LOAA 4KRFA 1KRWA 3HFRA 4EKIA 1KEZA 3CB2A 4BFTA 1FBNA 2GVDC 4RA6B 5C51B 4LXIA 1GUBA 2EX4A 2WFMA 1IC6A 3B13B 4QUAA 1HRDA 3C8HA 5HF8A 1T5LA 4RPGA 4IEFB 4QYXA 3AIKA 3OIUA 5EE3A 1P2FA 3PFNA 3NIDB 2OYSA 2RJ3A 3AHCA 3AETB 4WZBB 4F5WA 1DCFA 3CZAA 5DLDA 3PLNA 5H16A 1OZ0A 3K73O 1NULA 5K3FA 4HK4A 2P5YA 4YREA 4FNOA 1DBIA 2Z5LA 1II0A 1ZUHA 2QYSA 1NVAA 4O4JB 1T6YA 5IAEA 3KOWA 1FQOA 4Q05A 3DFUA 1NMSA 3DMNA 4MV4A 1XP5A 2IYSA 1K68A 3V4LA 1RLUA 1FQWA 3AUJB 4B45A 4AUNA 5IT9A 4EHDA 1JZSA 1HOTA 1XTTA 1W4AA 4MEAA 4LOHA 4MGKR 3JQRA 5B2FA 3L1HA 2J3DA 5FPTA 2H92A 4WAUA 2ZBDA 3JARB 1SD2A 5K0BA 2H1CA 4PTZA 1ZCZA 4NXNB 1X94A 4L8VA 4MCAA 3KQYA 1SVIA 1RD4A 1OBCA 3HGQA 3IXQA 2WJJA 3SR4A 3WLMA 1R6BX 3AR4A 1I36A 3L8EA 4FGJA 2OZEA 4FEAA 3NUZA 5TQVA 3VJMA 2HK8A 2AG1A 4CL3A 2WHQA 2ZT7A 3Q8MA 2QTRA 2YRXA 5CX1A 1CFZA 721PA 4HYYA 4WKPA 1UR5A 3U31A 3RUPA 2C8VA 1ORDA 2Q3FA 3QKTA 1V1MA 2QMHA 4HAYA 2BGMA 2OFXA 3RJTA 1WCYA 4ZVKA 3W78A 1I10A 5IS2A 4B87A 1PLKA 3OMWA 2BELA 1B6SA 2QQFA 4Z0PA 3L4BC 4QQRA 3W7VA 1E0JA 4U2BA 2Y1WA 3QHPA 3I05A 4BP1A 3FTDA 5DGTA 1T8TA 1YRWA 3LT0A 3AOEC 4PYOA 4UEWA 1RWKA 2BHLA 2B20A 1XVUA 1Y9DA 2BFNA 1JA9A 4KRXA 5EKDA 1VP9A 1G59A 1T15A 3QE4A 2CFIA 5TV2A 4BLQA 2LIPA 1N2OA 5BSWA 2GFIA 1SA0B 4Q7KA 4TQAA 1OXKB 2GTIA 3ZLJA 1RWQA 1P7PA 4EO9A 3B36A 3QF7A 3KT6A 3G7UA 4IYRA 4WMLA 4FYXA 2AA3A 3E8MA 4C4TA 1CP2A 2YJZA 3EEOA 1Y6GA 1DOHA 3PNQA 1ONBA 2QGZA 4F91B 3GT4A 2QYHA 3BWXA 2UZ0A 1C0IA 1SD1A 3OLCX 4Q3KA 5D86A 5BORA 2FGJA 2W93A 1OYWA 4BX9A 3EG9B 2AOTA 4F7DA 2EWVA 3PSAA 2NSYA 4IOLA 3ZXSA 2JAWA 3MBKA 4D4KA 1Z9BA 2BSAA 1Q1ZA 1YZVA 1JBQA 4MUGA 1S9HA 4OG2A 4OQYA 4Y9RA 3S7TA 3WLNA 3ZU3A 2W4QA 4ACBA 1V16B 3ITNA 4AZWA 4ZOLB 4AKHA 4R5MA 2QRHA 3T15A 5ALSA 1G9SA 4WOPA 1ZPDA 1RWBA 1RC0A 3QELA 2B1QA 3DTYA 1MRNA 3HMKA 4RY0A 2IUEA 1F2UB 1XZJA 4OGKA 2QSUA 3IE0A 3M83A 4UE3S 1CHDA 3VPDA 4F86A 1QDLB 1Y82A 2GPNA 1Y9ZA 3X3HA 4H7IA 1N75A 2R1ZA 4H3KB 3HJFA 1TAGA 3QPCA 1ECCA 1B73A 2EEPA 3FN4A 5FBWB 4Z9BA 5C4IA 2PV7A 4OB7A 4P54A 4C88A 3QVTA 3SVZA 1O1YA 1GA1A 1RYHA 4TTAA 5K0CA 3KPVA 3T1NA 3VYTB 3KZ1E 4MI1A 3OJWA 4QBGB 1FVOA 1OWMA 1DAGA 3ZI7A 2CXXA 3NHPA 1GNRA 2B5VA 2NO7A 1AK2A 3O38A 2C2YA 2EW2A 4B6EA 4YLYA 5MDHA 2V3CC 4IIHA 4QBFA 2WFZA 1VE5A 2QEQA 2R8PA 2ZRQA 3QLTA 4OXYA 5FIUA 3ZU5A 2A3NA 4KB5A 4NEGA 4O2LA 4AZ3A 2WYHA 4F7WA 3OPYB 5JZVA 1EUZA 4EENA 3T7JA 3TX6A 1AHNA 3TD2A 2J5RA 3QSGA 4D46A 3AMVA 3GK3A 5FR2A 2QNIA 3QVKA 3I1IA 5J4VA 3BWBA 1SG0A 4UM9D 4HNAA 1DT5A 821PA 5F2NA 3B9RA 1C3OB 1PJQA 5BWOA 1SOVA 5AICA 3KQSA 3W8FA 2QMOA 3IC5A 3M4YA 3Q3CA 1ZLXA 5A3JA 3EZLA 3T5GA 2ADMA 2QRGA 3FZYA 4Z1MD 5GJVC 3PR2B 3SOPA 4DHWA 2GI4A 2JBWA 4HZUA 3PDIB 3ODPA 2REQA 1O0BA 3LFHA 2HEIA 1B6TA 1POXA 5LXTF 2BZGA 1J21A 3RSGA 1ZIPA 3PRJA 3T4XA 1JG7A 3D7NA 3R3JA 4J75A 4OU5A 2A6PA 4RD0A 4KMMA 3DZHA 2FPSA 2RH5A 4EATA 3IAM1 1Z12A 1P8AA 2PNFA 4LTDA 1SRQA 4I2NA 5EP3A 3U26A 5KX5B 4ZYTA 5L8VA 1MX3A 2XZTA 1E9RA 3ESXA 3S68A 5JH7F 1N6IA 3FKJA 1U7DA 4CFZA 1BXGB 5CM2Z 3AB7A 4R9VA 3DUFA 2I29A 2REBA 2AF3C 1Z13A 1R0LA 1KR2A 2FPOA 2IVZA 2WIAA 1F9AA 5A6SB 1DXYA 1Y3FE 3Q0EA 2IS4A 4DHEA 1FJHA 4U2FA 3B5EA 1XKLA 3SIWA 1X9GA 1D0SA 2IYFA 3GCZA 3B7WA 1E3SA 4WOBA 3FHJA 3QFCA 3C3MA 4DV6B 3F4BA 5HBGA 1E6EA 1RABA 2QTTA 3OJFA 3N3AC 3GB9A 1ZL2A 1LLDA 3C6XA 1F8YA 3MCVA 4YH1A 4L8GA 2P9BA 4LBYA 1A27A 1CUSA 3U4DA 4TZ0A 1Z45A 1BOOA 1FY2A 2OFWA 3KLNA 4GOOD 4W5HA 1JR3D 5JAQA 4PLGA 4F5EA 2ZR8A 4BE7B 4XTRA 4KQ6A 2EVWX 1DFIA 1B0PA 1UEIA 3OFVA 4GECA 4ANFA 3GUCA 4EQ6A 4YMUA 3TQCA 5JYCA 3PEFA 3WTBA 3R6GA 3UXEA 2WD7A 1JQJC 3ID6C 4HDMA 4II7A 4KEAA 3WFZA 2AR7A 1UMCB 1OWPA 1VCNA 1J25A 4D8UA 1K6JA 2CMDA 1DBQA 3A1FA 1U5BA 4DTIA 1SUBA 2C9DA 3UOGA 2MSLA 2BW0A 3HU2A 5FO1A 4YMLA 3VO1A 4UMDA 1EUCB 1PWHA 1FDOA 1M8JA 4KUEA 4D9CA 5K3OA 4RTSA 3CMCO 3FVTA 1BCSB 4ZXFA 4DCMA 3PEVA 3IPCA 3UB3A 3TGWA 1LTHR 4QOHA 4DA6A 3OJXA 3K0AA 3ENKA 4I3HA 1L4GA 4L4SA 1NG9A 4HNSA 2VSQA 5KU1A 4GX0A 2Y1FA 3OOJA 5L7YA 1YUBA 1DTWB 3VI4B 1KI1A 5B4UA 4LF8B 2I1LA 4OTZA 1MEEA 1MF7A 4MVYA 2GK3A 1V1JA 4YRPA 2BFCB 3KSRA 1ST3A 3BMOA 1EA5A 1ZK4A 3TKLA 3K5IA 4RDCA 1QAOA 1Y3CE 2DTXA 3RTCA 3PDWA 3KQKA 2WTUA 1CE8B 2CSUA 4Q4JB 3VPXA 4YTEA 1KK3A 1AHHA 4MW5A 4OI0A 2ZUVA 4RVUA 4IDFA 3DFMA 3TRHA 1VJGA 3C5CA 4TQ9A 1JIQA 3R74A 2I8CA 4B2IA 4E4YA 5TPZD 1U9YA 3SPXA 4E2FA 4BS9A 4P0QB 4BUZA 2P5SA 4LXHA 4QWMA 4GE0A 3H2GA 5D3MA 5DM0A 5F12A 3R3YA 3NWBA 4O2AB 3D1LA 4LTNA 3ZCVA 4Y6QA 4C1BA 1KI2A 1T8UA 3FTCA 3OQPA 5DMHA 2PYZA 3OMXA 3RRZA 3AH8A 3UMYA 1ISPA 1WE2A 3QNUA 4CLOA 2XV1A 1XPOA 4TSFD 3QV1A 1E7RA 3GG9A 5LBIA 2J0QA 1VRVA 3IBSA 2EG5A 4JLSA 4EY7A 3FVVA 3TTTA 2G5PA 1MPTA 5JV5A 3VYVA 4UAUA 3U9TA 4FNGA 4JT4A 2GX6A 1MQ9A 1D2MA 2IVFA 5J47A 4AQYB 4DUPA 3JD0A 2JHFA 1IIBA 1WX1A 3E23A 3LV8A 4CQMD 2W2VA 1QV7A 4NZNA 2R86A 1NY5A 2H5IA 3ZCQA 2O54A 3H2YA 5B1HA 3D3KA 3HCBA 3K9HA 4BP8A 1M3SA 1CW2B 4YK7A 3CTMA 3RYIA 3PFFA 1KY5A 4GF5A 1PL6A 3O82A 4EI8A 1ZJZA 4G1CA 3DQZA 3O93A 1KO4A 1F4LA 3CW8X 4G5XA 4ID9A 1AQYA 4ENPA 2IXAA 3ABQB 1BGXT 4GSYA 4C22A 1ZISA 2GPBA 2P7HA 1CEYA 4PYMA 3FIJA 2A5FA 2A8YA 4B3TB 1PEYA 2YZMA 3L8CA 4TLAA 3MFQA 3QPWA 3WLRA 2R87A 4L0DA 1T1GA 5HOEA 5HR5A 4HEHA 1H3EA 1MOPA 1SU6A 2DCUA 1K5PA 3CRRA 3A36A 3ELDA 1P3DA 1ECFA 2ODNA 5EVJA 3H1FA 4IH9A 4OSOA 1H8HD 4O0MA 1CDZA 1VLVA 4MVJD 2IPXA 3R77A 3W1WA 4RMIA 3KJQA 1L4LA 5EHNA 1FK8A 4F3YA 2CY0A 3I0NA 2Q41A 5K8CA 3P71T 3C3AA 3PYMA 5EMJA 5L3QB 3E5RA 1I9GA 1B00A 3WJ1A 2QBYA 3Q1LA 3DOUA 1A77A 4R3NA 3PWSA 3A6DA 4UZEA 5CEJA 5T8KC 4RTNA 2UKDA 3LQKA 5CVDA 2FTKE 3ETDA 2GLXA 1TYBE 2GZRA 4GO1A 4B8WA 4CN8A 3KBBA 4JLJA 4Q1DA 1UBEA 5CR9A 2UYCA 2OE2A 4TRJA 2ZSDA 1NXSA 4HH1A 2IPAB 2HJGA 4ZT2A 4U5XA 4OLBA 5DEOA 4RLFA 3ELUA 1XYYA 2YWXA 3EC1A 3FOFC 4FJ1A 1BHSA 3CCBA 5ESXA 3BGSA 1NI3A 1SG9A 4H4CA 4YI3A 4GYWA 2Q9CA 4J07A 2HA0A 2ADOA 2QI9F 4X1IB 4DR3B 2QTBA 1HORA 3A2LA 5AVZA 1Q7CA 2HU8A 3JQAB 1G20E 1GUDA 3QF4B 3IIKA 4GMGA 1ENPA 1U3WA 4EJ2A 1J4AA 1X42A 1E4YA 2HO4A 1M9NA 2ZSAA 3GJQA 4UU1A 1U9IC 4XIJA 3U09A 4XDGA 5FNVF 3SD7A 5BYKA 4XB6B 2ZE6A 5L3RA 4DXAA 1MG0A 4B7XA 1UZUA 2J45A 1SQFA 2C5HA 2J5XA 3O4GA 2QUJA 4EL5A 4MX8A 4DUYB 1AJEA 4HJXA 1LV7A 1XVTA 4DREA 4AI6A 3IIJA 1CEQA 1L7VC 5CP8A 1NBME 5EWLA 4Z1MA 3ZKAA 3AXTA 5IARA 3R7SA 2JAPA 3HDYA 1B26A 4Z3DA 4K9NA 1PQUA 1E2MA 4CF3A 3NBKA 1LLUA 1CNEA 3SEFA 4ZYXA 2R8EA 1XTIA 4LDQA 3SNKA 1G63A 5IH3A 4NENA 3PQ4A 1BX1A 5DBHX 2A67A 2YWCA 3GLHA 2GRAA 1MAHA 1TW2A 2G67A 4KLAA 1J8VA 2XF8A 4B5LA 1T3SA 2VEOA 3UJPA 4FCCA 5IN4A 2APJA 4ZT3A 3CONA 4R7TA 4TMZA 1GVNB 2AZ4A 1DADA 4H3VA 1IYZA 4RADA 4V0KA 4Z49A 3PEWA 2BM1A 1M2OB 1YAHA 3OLWA 1KK1A 3QIAA 4B33A 3K32A 5G1OA 4PRYA 3PUZA 2BGNA 3KYCA 2C9CA 5HM6A 1Z2DA 2MR5A 2JGFA 1MZVA 4I5DA 5L4NA 2GCNA 2JFQA 1W29A 2VHCA 5EJEA 2ESRA 3GLFA 4K2HA 3GFTA 1ULBA 3QOFA 3IP7A 4PHGA 2O8CB 1QF7A 1WXWA 4IJMA 2HWXA 3FUWA 2FZKA 2ZK7A 2IHKA 4P98A 1O54A 3KB8A 1XBTA 2WYOA 2WNSA 3ZX4A 3QNMA 3W8EA 2V7BA 2CWDA 2GN2A 3HE3A 2XSZD 1JR3A 3N2KA 2FR0A 2HLNA 4GOLD 4IDGA 3JRNA 1PFKA 1KQ3A 1V0JA 2OBMA 1SZPA 2PS1A 1WMDA 4CQNA 4PYNA 2Q2NA 2W83A 4NHEA 4QBHA 1ZH6A 4W7IA 3T3GA 4Y6GB 1B14A 5FNZA 4KN9S 5JNVA 4Q19A 1GZ3A 3QOXA 1QNFA 2QN6A 4G0PA 1XE3A 2B4AA 3N2YA 4FOPA 3E9NA 3FRJA 4IIYA 4DCJA 3IJPA 1Q91A 6AT1A 1VKJA 2WAAA 4P7FA 1RXIA 4UHBA 3FLAA 1JA1A 3GQVA 3OA2A 3DBLB 4YYZA 1AV7A 1CG6A 3CSSA 1KEEB 1RQPA 5KWIA 4UNIA 3TSCA 3AEQA 4DDTA 4F92B 2E3JA 3SLRA 4IDCA 2WAYA 5BSHA 3C3KA 4P3XA 2P9CA 3EX7C 4WQMA 2H7XA 2Q3DA 2HBRA 3ZN2A 1RHMA 1PD1A 2DRIA 4QDOA 1PJAA 3MELA 1F2VA 4PSVA 3RE1A 3SXJA 1SIUA 3N8DA 2NO0A 2IYWA 2X19A 3IAHA 5F1OA 2OVBA 1N78A 3NOOA 1VP3A 1N8SA 2P3QA 4FFMA 2VNIA 4JA2A 5I4BA 1RYFA 4LF6B 2G09A 1R0BA 3AL2A 2PEYA 4TXHA 1GNVA 2Q0HA 1IQPA 5BPFA 2Q4DA 2B4KA 4CHTA 1L7QA 3G0GA 4UOQA 2VDLB 4EARA 2WIKA 1H94A 1C9NA 1HT3A 1T6NA 1UADA 4HNUA 5L7WA 4WNAA 1QP7A 1GRQA 2BGUA 3DA8A 5TPZA 4MQFB 1QHHB 5KI6A 1XVIA 2HSZA 4HWTA 4G2NA 2FW6A 3RYCB 4UTOA 1KQFA 3OQNA 2Z6QA 3E35A 3WJ2A 2G83A 2BZ1A 5MGNA 1J0AA 2L82A 4EO4A 5L9AA 2C95A 4I4TB 3PPVA 3E22A 4NYJQ 1B7GO 4TSFA 2H1RA 2EFGA 5HZKA 1DHRA 1L4HA 4P58A 5TJHA 5IJZA 2PMKA 5F4BA 1OYYA 1SOAA 1ZA2A 4E7OA 3KHUA 3OCYA 1NUQA 3H7AA 2VHQA 3W3AA 5AKEA 4B73A 5HIAA 2G63A 2X8AA 4CQMA 6NULA 1ZVJA 3O8LA 1ZOOA 2NZVG 2G77B 3WGJA 1JIJA 1XQYA 1J2UA 4RK1A 2JFBA 1KFCB 4Q9NA 3BTVA 2HRZA 1RYZA 2AFIB 1TUBB 4LOIA 3Q5GA 4Q48A 2UUOA 4XDZA 4YJHA 1TDJA 1OGIA 4LYFA 1LUAA 3KEFA 4OOEA 4ZDWA 3UWSA 2XGJA 1DCKA 1QJCA 3RJMA 1H9BA 2WF9A 3QQPA 4GM1A 2V0CA 3ZDXB 1VG1A 1AX9A 3EGEA 1EFPA 5T7BA 3VGJA 3B5IA 3S2IA 1SCAA 4RJLA 1RWMA 2OK7A 4KO4S 1ICIA 1NU8A 1GNSA 1IZ9A 1T91A 4L5IA 4DA0A 1E8NA 4ZK6A 4BNDB 5A4AA 4LDJA 1SCBA 1U28C 1NBOA 1T1EA 3FNFA 4CUKA 4BE9A 1OH7A 2HCFA 1P17A 3JU3A 2P78A 3IEPA 3O2JA 4EI2A 2X8JB 1X19A 1E2BA 1H8HA 1OMOA 4N5NA 5DHFA 4LWPA 5DGCA 4MVJA 5H0IA 1BFKA 2PKYX 2F3UA 2L69A 3H5WA 4HAUA 4CLHA 4EHBA 2R1TA 4OXXA 7REQA 3AEYA 1BGWA 4RX1A 4KFCA 3T7EA 4PSAA 4RZHA 4F4UA 5CA0F 4FWTA 5KYWA 1FZTA 2WWFA 4I1IA 2WU8A 5L3VA 2AF4C 2J3HA 1NYQA 5IZCA 2WKQA 2IF0A 2E4XA 1RAAA 2F67A 1RLOA 1B0AA 2ARKA 2IHYA 1SBYA 5IP5A 1L4BA 1PUJA 2R47A 1NW4A 3ECAA 3LRTA 1H0HA 4A9AA 4F3RA 3LUJA 1RHUA 3CIOA 2HHCA 4RPLA 2CF6A 4DABA 5AOBA 2ZYGA 4LKRA 2X23A 3HB9A 4HUQA 4YGXB 1YFJA 3NT5A 2QTVB 5DBFA 1AO3A 4BOYA 3D6NB 4H16A 3O84A 3VZRA 1CWUA 2BM8A 4FZJA 1S8FA 4KXYA 3EY4A 1R4NA 1RQ2A 1UDBA 1ZGZA 1ZKMA 4XYLA 5KINB 4WN9A 4IHAA 5EWJB 4INJA 2W48A 5IJXA 5I01A 3UATA 1PS8A 3SDBA 4L5BA 5A5FA 1J9ZA 6Q21A 5KNLA 2VJNA 2GLTA 1J56A 3EXG1 3THOA 5K8IA 1HKHA 4LUCA 4M1MA 4HDNA 4QHTA 1N2CB 2PX8A 3QEKA 2F43A 4O2BA 4OHMA 4QOEA 5D3ZA 3RBVA 4AYTA 2O59A 1P7WA 1U2PA 4HDRB 2VDWB 4YT5A 3REFA 3RSQA 4OI2A 1Z4OA 1Y7TA 2V7XA 3EVTA 2BR4A 3HP1A 2VP9A 3AL0C 3ND8A 1DPFA 2QPAA 4HX9A 4PC7A 2IWHA 1QONA 5TGDA 1ATZA 2AYYA 1TFRA 1WM1A 2W2KA 3HDTA 4JC5A 5JE8A 2IYLD 1V9CA 3GUVA 4D43A 2IHZA 4FGLA 3L0DA 3U3ZA 3HVRA 3QMVA 2AJDA 3BREA 1NX6A 1L5QA 1TAHA 2RK4A 3NAQA 4BTVA 4AAYA 4YRBA 4G5OA 5JC1A 2FMTA 4Y2HA 1YHZA 1N57A 4FGKA 3G5MA 4MIOA 1OAOC 1ZSNA 4JXKA 3X1WA 2EL7A 4QLAA 1G6OA 1GZ5A 1HFKA 1WUJS 3KFVA 4LZPA 5KJCA 2ZYVX 2WM8A 3FM9A 3A2KA 2ZIAA 1ZGJA 3NBZC 4REOA 1NT2A 4JI3B 3LRXA 2HSDA 1PG0A 1KI6A 4B83A 2DBZA 3KOZA 4AULA 3R6LA 5AW9A 3HYLA 1YJ5A 1K27A 4BNGA 4WZ6A 3GMIA 4U2EA 4RACA 4CMEA 2A9JA 3I9KA 4M86A 2CMGA 5KSOA 3QHQA 5C1BA 3VNSA 4TYNA 3Q3EA 1T26A 4TKUB 3VQTA 4S1VA 1EK0A 4KJXA 4CV3A 1I6KA 1KDTA 3N74A 2RI6A 4WFIA 2ZUEA 4U0KA 1ZIYA 1RQNA 3W06A 1JLHA 3NWEA 5K09A 2EGHA 2XSZA 4EFNA 3THXA 4RJ2A 3CX8A 4G5HA 4M9ZA 3AVWA 4RHFA 5KDLA 4QM7A 5CLIA 1DKPA 1OZFA 3E9DA 1W76A 3RRYA 1GDHA 1ZIXA 2FPGB 2FZLA 3AX6A 4AZ0A 2PUVA 2AB0A 1OBOA 5FHRA 1EVIA 3VHXB 3F6CA 5CA1F 4WCVA 3ZVRA 3JAKB 3IEVA 1E77A 2Z6VA 4MCIA 2E82A 1C2YA 3LC1O 4AYWA 3UH1A 1U2ZA 4DLTA 4QUBA 2NT3A 3R44A 3CH4B 1DMSA 1KETA 2IZ5A 1U7XA 2HJSA 3EZ9A 1NVUQ 4IVRA 3EVFA 4JR1A 5FYQA 4YYEA 2J6HA 4YRQA 1Y6FA 4WFJA 5I4IA 1US8B 1J22A 1XLTA 4GRAA 1XZIA 4KWHA 4LJRA 1JV2B 1TCUA 3S44A 2BEWB 2E6KA 2FJPA 4KACA 4U7DA 1OLSA 4OYHA 4IMPA 3H3FA 3QNWA 1INLA 4INOA 3ZGVA 2IPOA 4W99A 3QGMA 1QO9A 3A1NA 3N07A 1XKTA 2H5JA 1NM5A 2D5CA 4H9GA 2GETA 4HUTA 4WINA 1E66A 1ESCA 1AG9A 3O8QA 4H6VA 3U7HB 3H11B 3TNDA 3NVMB 1C1DA 5AM0A 1R9MA 2ZXEA 4ZOAA 1ETHA 3MN1A 3AEKA 1IOLA 1KTIA 2BGGA 3SKVA 3ABSB 1O6CA 2H1SA 2QQ0A 4C04A 3FAZA 2CLEB 3K6SB 1Z8NA 3P1JA 4O4IA 4L74A 3A6EA 2XUZA 4RMGA 1IEXA 4IQ0A 3GYBA 3ZDEA 1Y5LA 1MIHA 1ZNYA 2OGUA 2V5UA 1D1SA 1JAIA 1XRQA 3NJ4A 2WG1A 4C87A 1E7YA 4WDQA 5AI0A 4M0DA 2C7BA 3NO4A 1L8AA 4IX1A 4MHTA 1X1SA 1J49A 2CCKA 3VC2A 3L7CA 4ALLA 5CAEA 2YMQA 4KK4A 5L45A 5K0ZA 3DV2A 3MGBA 3BGVA 4FW8A 1XCJA 3H5VA 3UMGA 1GUFA 1TQHA 3T7SA 1VM6A 5ILQA 3C5EA 1P1IA 3JXEA 3ZE1B 6PFKA 1A4UA 3IHWA 3BFXA 2RBEA 4QG3A 2VCYA 1Y9EA 2IWRA 5HFNA 1ZI8A 1UPAA 2PM8A 2XJ9A 4R8KA 2NTJA 1M6WA 3GRZA 1DO2A 4R69A 5AI8A 1JVBA 4GM4A 3U3KA 5IX8A 4PHCA 3THWA 5ALJA 2QD2A 2JFPA 1T8PA 4ARZB 4RD6A 4R8SA 4WE3A 1RWVA 4V0QA 1NJSA 3CLUD 1U1GA 3K20A 1M75A 1FW6A 2B9VA 4M0UA 5DGXA 2LNDA 3TI7A 5DBOA 5E0KB 1N2XA 4ICIA 3H75A 1GCAA 4AUEA 4KO3S 4D4MA 1CQXA 3DDHA 1GITA 3H6KA 2W90A 1IWOA 4HWPA 4R40A 4JYCA 2FH5B 2G7MC 4Y2YA 4ZI7A 2PJRA 2PTGA 2BGRA 3K9LA 1FXWA 3TZKA 2VPWA 3W4JA 1I6MA 3HBMA 1TM3E 1ODCA 3F3SA 3FDXA 4RGQA 4Y0AA 4YMTA 4BNMA 3B3JA 3NUGA 4LJ8A 3T61A 5L95A 3G1TA 2G17A 2RI1A 4YLEA 4J0HA 4EG5A 7ABPA 5F3DA 1OOEA 1ETUA 3DL7A 2KLHA 1WP4A 3QJYA 3WAGA 3VKHA 3TZEA 4M0PA 2VP6A 3TW8B 5FLXA 3FW1A 3LUDA 3BE6A 2YNMC 5HXAA 3PNVA 3DLHA 3FTFA 1T43A 4EA9A 3KUXA 2QLNA 4NMLA 4OHKA 5AK5A 4MS4B 1O9BA 2GBCA 1E1NA 1PJSA 3NPAA 1OBVA 4M1TA 3EXFA 3HCNA 5I7SA 4MMZB 1CZLA 3IXMA 3DUWA 4ZVRA 4EGJA 1G7TA 1SXGA 4U3JA 3H8VA 2GYWA 2XLCA 5SY6A 1N8NA 1NYLA 1U9CA 4I1SA 5FWAA 3ZVNA 4JP8A 3BH0A 1GZ6A 5HIIA 4BNFA 3PEYA 2JEYA 3A04A 1GUZA 1DTEA 1GSIA 1PT8A 2CLFB 4GBJA 1JVSA 4NMMA 4RY8A 4C6TB 2A94A 2H4ZA 1O5OA 5ADHA 5HZMA 2P30A 1EQ2A 4CZ2A 4Q00A 3DULA 5B7QA 3ANMA 2GJ9A 2BFAA 3OT4A 1ATIA 1WDKA 2VHZA 1GNTA 2XDAA 3Q7PA 1I4OA 6LDHA 2O5CA 2KBFA 4RYDA 2CHEA 2WAOA 1XXHA 4NJMB 4QOSA 4YAUA 5KOHA 3KBOA 3UCEA 3W2IA