4OYHA

Structure of bacillus subtilis mobb
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
163
structure length
148
Chain Sequence
FPIVQVVGFQNSGKTTFIERILEKASEQGLNLGCLKHHDRYQAAGADVTAVEGAGVLQLTARRLWDLTRLIELYQFLETDCLLIEGFKKAPYPKVVILSEKEDLEALKTVNTIAIIYRKKEHMTEHQGLPIFHADDPVAVDLVLSQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Molybdopterin-guanine dinucleotide biosynthesis protein B
publication title Bacillus subtilis MobB
rcsb
source organism Bacillus subtilis subsp. spizizenii (strain atcc 23059 / nrrl b-14472 / w23)
total genus 35
structure length 148
sequence length 163
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03205 MobB Molybdopterin guanine dinucleotide synthesis protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4oyhA00
3ZH9B 2FGJA 2Q9AA 4V0MA 1D9XA 2W00A 3QSYA 1IN7A 4WBSA 3THWB 4TT3D 3PXGA 1RYFA 2PBRA 1GFIA 2OXCA 2CNWD 3CNOA 3GLIA 3ZD6A 1XEWX 2BMJA 2ZAOA 4KVGA 3E2IA 1XMIA 4DCSA 4FCVA 1T9HA 3F5FA 4GSYA 3U3JA 4PAMA 1Z0JA 4D4JA 4AI6A 4Q4JA 4D4KA 2ZSFA 4U5XA 1CJUC 3MAAC 1E4VA 3B1WA 1ZNXA 1T5IA 3ND9A 4GBMA 3BD9A 4JBWA 3CZQA 4DLRA 4BLTA 1S96A 1P2VA 1CU1A 2GESA 4Q1EA 4DXAA 1NKSA 3LX8A 1DOAA 2E87A 3NBXX 3I72A 3L82B 4MYHA 4TMTA 4C0QC 4HB4A 2ZSDA 3SYKA 1ANKA 4QGGA 5EZ6B 3VNVA 2QU8A 1XXHB 2GZDA 4U02A 3IEVA 2QG6A 5DO9A 4B33A 3IGFA 1NKTA 1NMZA 1WCV1 3UIEA 1NBME 3HYTA 4JL8A 4A0FA 2CXXA 3LAWA 4C0JA 5AJVB 3KDSE 3FMPB 4L16A 2QGNA 2I3BA 3AM1A 1T6NA 1N6NA 4PX9A 2IHYA 2PEZA 1KSJA 2ZRPA 3IO5A 5G3YA 3CWZA 4BZQA 1TEXA 3M0EA 2ZYVX 3LLMA 1KI2A 2IF2A 1AGPA 3DO6A 4NCKA 3BB1A 3CM0A 4BASA 5GVRA 2BM1A 3K0EA 2YHSA 4L9SA 1L4UA 2C98A 2BMEA 3THWA 1Y63A 4PSKA 1KSGA 1IXRC 1M2OB 2UKDA 3UPUA 4NU0A 1VHLA 1SKYB 3LFUA 3QPWA 4HEJA 3OIWA 5FTLA 1SVOA 5DSZA 1B0UA 1IJEA 1F6BA 1G5PA 3W5JA 4XVRA 4NH0A 4PFSA 2OUKA 1RFLA 3MUFA 4DB4A 4GPTA 3PV0A 1OFHA 1QHXA 1UDWA 1NIJA 2DHRA 3C15C 3DM5A 2X2EA 5DH9A 4ZPXA 1PVOA 1G6HA 1OXUA 4G1UC 3CF0A 1U0HC 1Z47A 2WMNB 3DVLA 3T5GA 4C0KA 4JVMA 4ASUA 4R2IA 4LRWA 4CW7A 3BH6A 4PC1A 3ZIAD 2WKRA 1AZSC 2Z4RA 2NTYC 1XXHA 1XTJA 4LV8B 4JS0A 1U8ZA 3H2YA 5B2ZA 2C2HA 2F1JA 1KJYA 2Z6VA 4PO1A 4R98A 4RKEA 1OFIA 5D3QA 4O2RA 1BS1A 1SKQA 1AIPA 1GAJA 4M1WA 2QA5A 5TDHA 3UWOA 3B13B 4B44A 5FBVB 2ZRHA 3W3AA 3ADCA 1D2EA 1ZCAA 1W0JD 2ZQ5A 3P4XA 4IVRA 3WMEA 3OZXA 2VP9A 4JLKA 2BEJA 2FWRA 2JDID 2QORA 1ZM4A 3J81k 5JJIA 1Z3IX 3IDQA 1E2HA 4MUBA 5IRCD 4H1VA 4BFZA 3L2OB 1P5ZB 1GITA 1W47A 1XTSA 4PAQA 4M9XA 1NN1A 2AK3A 2VA8A 1ZM9A 2JLXA 2W6JA 4G01B 4LK2A 1EWRA 2WOOA 5J5CA 2ZRAA 2R44A 2FZLA 3T1QA 4MKGA 5P21A 2O0JA 2VRWA 4RFVA 5EP3A 5FPYA 5DIFA 4QXAA 4HDOB 2G0TA 1VCMA 1XPOA 3SOPA 2VF7A 1OKKA 2RKOA 2YOGA 5JEDA 3AV0B 3W6PA 3PJRA 2NO0A 2FSFA 2ZYUX 5CLQA 3AH8A 3W8NA 2H16A 2XNSA 4QFMA 2P5SA 4LYJA 2JIZA 2V54A 3F3YA 3QF4B 2Z5FA 1X1SA 5DGXA 3RS3A 4TQAA 1MV5A 1E2MA 3FGNA 4DDUA 4LBVA 1NL3A 4PSVA 2OG2A 1XPRA 3CBQA 4EIWA 2QM8A 4ZDWA 4DWJA 3A1TA 1YZTA 4NONA 1SULA 1EFRA 2Q3FA 1DBSA 4DC9A 5KDDA 1ETUA 4FW9A 1TTTA 3KJGA 4BFSA 3M4YA 3N2IA 2ZJ2A 4XTRA 3GJXC 2VP0A 5F9FA 3PFIA 5CK5A 1F2UB 3MWJA 1G19A 1HY3A 2IUSA 2XSZA 2REBA 3BFXA 1ZD9A 4JKYA 3RC8A 1KZ7B 5CJ2A 1RRFA 1KK2A 3B82A 3Q85A 1X6VA 4TTRA 3BE4A 521PA 1OH8A 3T5DA 3ZVLA 2WICA 2NQ2C 3TLXA 3EZ2A 2RGDA 2GNOA 1M34E 5FUVA 4TQUS 4ACAA 1E99A 5AUQA 1KI4A 3BXZA 1EFUA 2DWPA 3FMFA 1R4AA 1QG4A 1W2GA 5C1BA 3T1TA 2Q9CA 1KY2A 4XSGA 4C0BA 2BKUA 5CM8B 2WOJA 3TW8B 1NIPA 5J4HA 5E4FA 2QAGB 2PX0A 3C14C 5JLJA 3TSWA 4GZMA 4P4UA 5IK2A 5FUYA 1EFHA 1U81A 3ASZA 3G5UA 5BQ5A 4UNNA 4NP6A 1WF3A 3U3MA 3A58B 4LY6A 3QF4A 1XDBA 3JZMA 1FP6A 4DT1B 5HKKA 4EFLA 1G3RA 1P3JA 2QENA 4KYUA 1BYIA 2Y8EA 4RZ3A 2AXNA 3CRVA 3OFNA 3AQ4A 3TSOA 5AJZA 3T1VA 2F3RA 3W6NA 1UKEA 2XZOA 1E0JA 3MGCA 5LBIA 3ZQJA 1YZUA 2AK2A 5LDDC 2I1QA 3W8RA 3WRYC 2H92A 2VP5A 1YRAA 1XTKA 4UNQA 4B75A 2BCJQ 1ZW6A 4PHHA 5F98A 1WP9A 2IEZA 3WP0A 1F2UA 1Z6TA 4FD2A 2W0SA 3BJIC 2IS1A 4Q00A 3R7WB 3UKDA 1OW3B 1DAFA 2ZRIA 4DUGA 2V9PA 3QPUA 5JBQA 2ONJA 1GOTA 1N5IA 5M04A 1A1VA 2P6RA 2ZS8A 3OIVA 3DMDA 3D7MA 5FBQB 3VHLB 1KOFA 3ZZTA 2ZITA 1SXJC 4AK9A 2PMDA 5G3ZA 3QEOA 2OSBA 2HF9A 3PEWA 2X19A 4JLJA 5C2JB 3K0CA 3TVTA 1ZNYA 1Y3AA 3QBVA 2XTZA 1C1YA 1T3HA 1M7BA 2NZ8A 2QAGA 5FTKA 5JHGB 4M4SA 1DTSA 5KSPA 2BM0A 4KVAA 4TZ0A 3RC3A 3QVUA 1VG0B 1S9HA 3KKQA 4ASUD 2EWVA 1Z0KA 2BBOA 1UM8A 1PUJA 2ZXUA 2DYKA 2LCFA 3RRYA 4BLQA 4DT1A 2WBLC 1E96A 2FN4A 2ZJ8A 4PPQA 1OXVA 4QJ5A 3WNBA 4B48A 1GZSA 2VF8A 1RW4A 3TW4A 4XOIA 4NCNA 2B92A 2FFHA 2V6IA 1T8TA 4LV5B 4XD7A 2GJ8A 3OIYA 1VIAA 3GPLA 2ZSAA 3SJAA 1WQ1R 2OCPA 2X77A 3QE0A 5GVSA 1UFQA 4Z8YA 4HZUB 3RWOA 5JHHB 5J47A 3K70D 2QTFA 2VP4A 2ZRDA 3KUCA 3B85A 1AN0A 2A30A 2ANBA 3R7WA 1L7VC 2BKEA 5DHAA 1YZGA 2J0VA 4TYPA 2O0KA 2XX3A 2ZAMA 3QXSA 1NN0A 2D7CA 2ZTSA 4XWOA 1S1MA 3BH7A 3NIBA 4TL9A 1CBUA 4C9BA 2OV2A 2QMHA 2W6JD 2P65A 3Q72A 1VTKA 2CDNA 1KDPA 4M9QA 3B5JA 2QSYA 1Z0AA 2A5JA 4A6PA 1CRQA 1P72A 4ITRC 2G88A 4M9ZA 4DIEA 1Z6YA 2IYQA 5DI3B 4TMXA 1YE8A 4Q1AA 1EFTA 3SFVA 3QG5A 1XTIA 4PPFA 3TVDA 4DLWA 2HYIC 4KFRA 1TUIA 2W2VA 3I8SA 3ZGXA 4URXR 2JIZD 2C9OA 4V0KA 4V0ME 4WW0A 3CRRA 3SYLA 5L3SB 2ORWA 2JGNA 3RAPR 3IHWA 5EUQB 3V4RA 4L4UA 2F3TA 1TQ2A 2GCOB 4OHZA 4FWTA 1E9BA 4ZO4A 4OI4A 1EFRD 1Q57A 1SXJB 3PITA 2OLJA 1YZNA 3AVWA 4LJ9A 5JECA 4MDFA 1II0A 4DCTA 1S1CA 5JRZA 2WJHA 4RFSB 1OIXA 3A4LA 1OIVA 1XNJA 4TLDA 5L3RA 3NVAA 2RAPA 2XSZD 1NVVR 4XIGS 1SVSA 2XXAB 4C3ZA 2B7CA 1K5DA 4F92B 3B9PA 2KI5A 1U9IC 4JSYA 3LH5A 1GG2A 4G5RA 1N6KA 3GJ8A 1S9DA 1XBTA 2B8TA 3FHCB 1A2BA 3MMPA 1NLYA 4Q7MB 1NRJB 3R8FA 3AF4A 3K09C 5EXXA 3N5CA 1BO6A 1HA3A 4GOXA 4HAYA 3BS4A 4UXJA 3ZZUA 3BOSA 5J4KA 4F93B 4BECA 3IIMA 2V3CC 1M7HA 1VCOA 1D2MA 2G0NA 2ZSEA 4QKQA 2QT0A 2ZE6A 2QGZA 1R0YA 4LPKA 3GFTA 2WMOB 4RD6A 1L4YA 3UG6A 2FJUA 4DSNA 1VYVA 3U3OA 5HE9A 5IK2D 2AHOA 1E9AA 3KQHA 1BMFA 5TARA 4BZXA 1GILA 1ESMA 3GLHB 2V6JA 1VG1A 2JA1A 2P3SA 2VHCA 3MCAA 5HKKD 5L3SA 3RS2A 1NVWQ 1OFUX 1SHZA 3IQWA 1UKYA 1OJLA 5B57C 3U5ZB 4JBYA 2EFHB 2GCOA 1P61B 5G53C 1KI8A 4YC7A 1SXJA 3EZ7A 4IOLA 4US0R 1HQYE 4LDJA 3QVVA 1OB2A 4IDPA 1P73A 5FPHA 2F1IA 2GWHA 4M22A 4URZR 2AFHE 3TR0A 4Q4HB 1L2TA 1GDDA 5D3MB 4MKHA 1ZVQA 4RFSA 4WAUA 3E1SA 2XXAA 4DSTA 4W5JA 4E09A 3Q9LA 4KBGA 1N3BA 5EE3A 2FE4A 3AKEA 5CDFA 2CNWA 4M1YA 3AF3A 4A82A 2BIFA 2WV9A 3FMOB 1QHHB 1XXHE 1YR6A 4Q1CA 4EFNA 1LW7A 4E03A 4A0GA 1IBRA 4QBHA 3ZYCA 4B73A 1EX7A 2KJQA 1Z28A 2NO6A 3TUJC 2CLCX 2WWFA 1E9SA 5KNDA 1Z08A 1CXZA 3SJBA 2EFDB 4IOMA 2ORVA 4DCUA 5CIWA 2UZ3A 3C5HA 3EG5A 3GEHA 3FMIA 3K8YA 4OI2A 4YDHB 5JJKA 2I1VB 3LBHA 4UQOA 3VR4A 2FSGA 3TK1A 4OQFA 2CVHA 2FSHA 4HDQB 2VLIA 4US2R 2GXUA 2RHDA 3GLHA 4HAZA 2ZI4A 1ZM3A 4JLDA 1KAOA 1VMAA 2R9VA 1A4RA 3U7HB 3A4NA 4AKEA 5EXPA 3A1VA 1Z5ZA 4ZCLA 1ZIPA 5J4VA 3D31A 2YNMA 1JR3D 4FINA 3KX2A 1KO5A 1FTSA 3ICEA 1NSFA 2C9CA 3U6BA 1SKYE 5ANRB 2GJAA 1FOEB 4IVPA 3LRPA 4RD2A 2VPPA 4A6XA 3DZ8A 1W4BA 3U7EB 3BB3A 3MWLA 5FR2A 1RRCA 3PQCA 4V03A 1E4YA 2FMXA 2FGKA 5D3MA 2XB4A 3AF0A 5EP2A 1DEKA 5JWHA 3DMNA 4XWAA 5B30A 1R5OA 1EFCA 3RRZA 2VQSA 1XZQA 2F9MA 2J9RA 1QHHA 3C7KA 1E2IA 2ERXA 4A8JB 4M1MA 2QUZA 1LY1A 3AVYA 4BFYA 4GNKA 3NKVA 3BERA 1XU4A 1VHTA 1S3SA 2XJ4A 2BVNA 2VH5R 2JLVA 1HYQA 2TMKA 2ATVA 1JQJC 2ZEJA 1CTQA 2NMVA 1TQDA 2QP3A 3T34A 2H5EA 2HDNB 3AKCA 2A3RA 1XZPA 4AURA 4XVQA 4JMPA 2MSDB 2CBZA 2ZI6A 2PEYA 1SVMA 1H8HA 1JXOA 4POAA 2AD1A 4W7SA 2GAAA 5UKDA 3K09A 1JALA 1AJEA 2QN6A 2DFNA 1WBBA 4H1UA 3HR8A 2FG5A 2C78A 1FP7A 5TXGA 3AVOA 4MQBA 3DOFA 1WB9A 2DFTA 1KKLA 3CPHA 1EWQA 2WJYA 3WRXC 3WNDA 1VCNA 3MWYW 2VTKA 5K8IA 4TLAA 2IYSA 4R2HA 3PVSA 1JEDA 2JDIA 4NBSA 2R6FA 3ASYA 3CKLA 4Q18A 4EAQA 4KBFA 1CKEA 2FH5B 5AUPB 3O8BA 3SEAA 2BBWA 1OYWA 2ZVQX 3P27A 2ZRGA 5DLQC 5CITA 2Z0MA 4ESHA 4V0NA 2NZJA 1G8GA 1XTQA 4D82A 4QBFA 4ZDIA 1Q22A 4PANA 4A8JA 5BYKA 4C2UA 3AVXA 1RKBA 1LTQA 3RHFA 1BKDR 2REOA 2QRNA 3NC1C 3ICQB 2R2AA 2GILA 1OH7A 1DG1G 1ZBDA 2OFOA 4DLVA 8OHMA 1XPUA 3L0IB 4RJLA 2SHKA 2ZR0A 4FCWA 4JT2A 1UADA 2ZE8A 4CEHB 5A5GA 1BMFD 2HT1A 4NYMR 5EE9A 1ZUNB 4XWKA 1FTNA 1X8LA 4Q5IA 1E1QA 2EU8A 1KO8A 3HDTA 2OBNA 4RD0A 4J0QA 4B2IA 3CPEA 3B2EA 1X8JA 2ODWA 1G6OA 5EE1A 2UZIR 4PQYA 2FZ4A 3IPYA 4NKRA 1HUQA 1G4UR 4HATA 2DFKB 4BLOA 1QVRA 3U61B 1SXJD 3QY0A 2WIBA 1GP2A 3AUXA 1R0WA 4HLUA 5FOWA 3VR3A 3A4MA 4RVCA 3H86A 4BUJA 1G17A 1HURA 1XCGB 2QPAA 1KZGB 5JMTA 1W0KA 3MRSA 4A2PA 1EX6A 4KLZA 1G7RA 1QG2A 2NPFA 5C46F 4TN1A 3T12A 3L0OA 5DYIA 1J90A 5CB8A 1NJGA 1ESNA 1Q1BA 2VP6A 3I61A 4Q9KA 1ZD1A 3FFBA 3K9HA 4WZBE 4Z54A 1HH4A 5IHPA 5LD2B 4AKHA 1BYUA 3S1AB 3A6PC 3T15A 3CRMA 2IT1A 5DN6A 2EWWA 2ODNA 3LX5A 1DADA 2JLRA 4LJAA 4EUNA 1I2MA 5TB5A 1DAKA 2ZRFA 3JVVA 1JR3E 1I4DD 2PJZA 1IN5A 4IDOA 4AYXA 4P0TA 2ZRNA 3WYFA 4PHFA 5E95A 1Z0IA 3MJRA 3A37A 4AYTA 1DE0A 1COWA 1ZIOA 4DSOA 1E2DA 1FFHA 3DKVA 4M9SA 3GLGB 4BGDA 2R6CA 3WMFA 2BC9A 4LWZA 4CEHA 1QHYA 1KI6B 1VECA 4HDCA 4LJ8A 4C7OB 1MRSA 3BC1A 2YINC 1Q20A 5H8WA 3EPLA 1N6RA 3B7GA 2QZ4A 1ZMXA 4QRHA 2KBFA 1H65A 5JCZA 2CHVA 3HWSA 2C9YA 4KFTA 1G20E 2ZIAA 621PA 2CHQA 3TQFA 4ZKDA 3HR7A 3NDBB 3U7GA 2JLWA 2GZAA 4BLSA 2AR7A 2BDTA 2XOKA 3K70B 5AUOB 1E2QA 4TL8A 3SYNA 4BRWA 1W36B 5FI0B 1DAMA 3DKPA 4RSGA 4B3XA 2EYUA 1G8FA 2WAYA 3H84A 221PA 1DAIA 5AJWA 1Z6GA 2QQ0A 1LF5A 3CIOA 3H4MA 4JSTA 4Q21A 3S1AA 1MO5A 4TTPA 3R8CA 3M1IA 2HXYA 2D62A 4WZAE 4QNMA 4S35A 4EJSC 4KAXA 4OQMA 2PJRA 6Q21A 4M8NE 2PZFA 1CJTC 4PPGA 2VHJA 4EPTA 1CJKC 3REGA 3A36A 3MJHA 4GZLA 4JL5A 3PEYA 1C4OA 2GXSA 2MMCA 1CJMA 3GLGA 4X8OA 4FMDF 2O8DB 1R2QA 1KJZA 1KI6A 2QMEA 3EZFA 5FI1B 1W44A 1U98A 2HV8A 4C7OA 1OPXA 4JVLA 1R7RA 3HPQA 1TMKA 4K81B 1H8HD 5FPSA 2LKDA 4G0NA 1IN4A 4YMTA 3QG1A 2OFXA 3OEEA 2ZI3A 5FL7D 4Q1FA 1HT1E 3NBFA 3ZS9A 2OXRA 4ABYA 5AK0A 5HZHA 1JPJA 4QGHA 3REFA 3TNFA 2C5LA 4LJ6A 2CEAA 3FDIA 1P4SA 1M74A 4X8MA 1DG3A 4ARZB 5JWRA 4TTQA 3NG1A 3NWJA 1FX0B 1XEWY 4LYAA 2OEPA 4PHGA 5DE3A 1QZXA 3MD0A 4Q4LA 3SI7A 3C5CA 3K9LA 5A4JA 1DPFA 2ZE7A 2ZRLA 3IHLA 4IHQA 1RC8A 3AVVA 1KNXA 2V4ZA 3KQNA 2BV3A 1E2GA 1KKMA 4KITB 2FU5C 3OF5A 1SHKA 4WA7A 4PZZA 1KO4A 4NYJQ 1SXJE 2NIPA 2G9NA 2WM9B 3GJ3A 4D0GA 5L8VA 3O8RA 1AS3A 1U0JA 3I32A 1LS1A 5HCIA 2W2TA 4D0LB 3T06B 4IW3B 5CJPA 2Q9BA 5H68A 1J99A 1KI9A 2ERYA 2O8DA 4CVNA 4DBLC 1E1QD 1P7CA 2J1LA 4WOPA 3VAAA 3MFYA 1UKVY 4EPRA 4M53A 5CDFE 4US1R 5FFMA 2E1RA 2ECKA 4ILEA 3TAUA 2N1BA 3QBTA 3QKRB 3I1FA 1E9DA 4BFXA 5FTJA 2DWOA 5F9HA 2VL7A 4HI0E 2OILA 1GUAA 1OHHA 2VYFA 1OYYA 1F5NA 1W5SA 2IYUA 2QROA 2CLSA 1Q3TA 4IXNA 1W0KD 4IEIA 2OT3B 1W7AA 2FA9A 2GVZC 1CR4A 1Q1ZA 1MR3F 1K5GA 2A5GA 4LHZA 3KQKA 4LV6A 3K9NA 3DHWC 1MT0A 4JL6A 2H1LA 3ETLA 4ARZA 4OJKA 1ZJ6A 1FX0A 2P2LA 5A0FA 4AKGA 3ONWA 3GLHE 3RWMB 4PR0A 1KK3A 2QP9X 1G8HA 1XF9A 3F0TA 5DN6D 1G41A 4KSBA 1QF9A 2JASA 1XP8A 2JJ2D 1P6XA 4GOJA 2Q6TA 4JLPA 3QXXA 3RANA 1QRAA 1J2JA 5SZIA 3RSLA 1JNYA 1Z22A 3CLVA 4LHVA 3FOZA 2IUTA 3PR1A 1COWD 1O87A 1GSIA 1J8MF 1ZRHA 4Q9HA 4BQSA 5GADl 1D2NA 1RIFA 1KI3A 1W5TA 4K46A 2BJVA 3PEVA 4PTLA 3TSZA 2CK3D 3WXMA 1SQ5A 2BMDA 2RGNC 5E7IA 3QENA 2GCNA 3RABA 2KE5A 5B64A 1G7TA 4B34A 5G41A 3ADKA 3RRMA 5JSZB 2QM7A 5KPDA 4OQXA 3TQCA 4A2WA 3PUZA 2V55B 5H70A 5LB4A 4B3CA 4C30A 4KHZA 3QKSB 4YXWA 3QKRA 4E07A 3IKJA 1WE2A 3W90A 1GM5A 4C0HA 4EDHA 2D7DA 3AVQA 2XOKD 2PLRA 4MGYR 4U00A 2V1UA 3EC1A 4LX0A 1OXXK 5HE8A 3EX7C 1Z63A 2WJGA 1AS2A 1CF4A 4RZUA 1G8YA 4LOAA 5FBLB 2ZVPX 3PG5A 4ZCMA 3EPJA 5KYKA 4YDSA 4HAWA 3CNNA 4B2PA 3LY5A 2JLUA 4UNPA 4Q4AB 4URUR 3U4QB 2ZANA 1KK0A 4QBIA 2FOLA 2ODBA 3EPKA 1RPZA 2CCJA 4JVSB 2FF7A 1UF9A 2QY9A 3TE6A 5C18A 3PUXA 3D3QA 3GD7A 4IDHA 4RY2A 1T3SA 2C04A 1MRNA 1O3YA 2EFEB 1FNNA 2HF8A 1RZ3A 3OHMA 1E98A 2QBYB 3BBPA 1A2KC 2WSSA 4LHXA 4OK5A 4MRRA 4LYFA 4GP7A 2GEUA 4DKXA 1XCMA 2ZJZA 4PO8A 4YLGA 4W9MC 3EA0A 4A15A 1G21E 2HUPA 1JR3A 3BWDD 3VR2A 1R5BA 1X3SA 2GJKA 3FKSA 4LJ5A 4B71A 1TPZA 4OK6A 5JSZA 4ESVA 2F9LA 4LI0A 4NZYA 4EFMA 3X1DA 4QJ4A 3OEED 4NYIR 5EE5B 3ZVRA 4F4IA 3RVBA 2GBLC 3QKSA 3C8UA 3RDPA 1YQTA 3SJZA 2WPDA 1AQYA 1X8KA 1IY2A 1W49A 2IA5A 2WHXA 5FBRB 3SZRA 3AVUA 1N6IA 2ZJBA 4PHTA 1W36D 4Y0VA 2G83A 3B1VA 3I8XA 1P9WA 3HU1A 1WMSA 4P33A 4TYQA 3RS4A 3THYB 1N6OA 1G4AE 2MSCB 2QMUA 2RGGA 4EPWA 5CM9C 2ZUBA 4Q4AA 2C77A 1CR1A 3U4QA 1VYTA 3X1XA 4WZ6A 2F43B 2ZRCA 4GT1A 3QKTA 4BLRA 1HE8B 3O8DA 4JLMA 1HQCA 4WXRA 1YJ5A 3EIHA 3VX4A 5FPKA 3FTQA 4OK3A 4JJKA 3U7FB 2R6GA 4PC7A 2JATA 1NN3A 2IXFA 3D8BA 4ZKEA 5KHOC 2C95A 2QPOA 4U7DA 4QM7A 4CDGA 5DISB 5DNYB 3VFDA 1P2SA 3SHWA 2XITA 2GDJA 3WBJA 2QBYA 2C96A 3AB3A 4JLOA 3K0SA 2XTNA 5BXQC 1II9A 3LXRA 4NCIA 2IYXA 4DLZA 2YV5A 1JECA 1XJCA 4L5BA 3U3KA 1QHNA 1JQLB 5CIQA 1JAIA 1NN5A 1TUEA 2YVUA 4PC3A 1X1RA 4URYR 4IOJA 5BN5A 2D4HA 4P4TA 2FDCA 1KY3A 2J5XA 4LC1A 4EQ6B 5AR1A 1DS6A 1IONA 2CE2X 1OHHD 2J87A 3KB1A 4HLQB 2GF0A 2KBEA 3T35A 4EKDA 4HZUA 1GRNA 5JWOA 4MRVA 4URWR 3GCGA 4I1OA 2IEYA 1FNMA 1GL9B 2F6RA 2D06A 4BFTA 5K8LA 3KKOA 3B6EA 2YWEA 2C03A 4RZ2A 2F1RA 3TMKA 4CF7A 1MABB 1LNZA 2B8WA 2LWIA 2IYTA 4NHOA 4V02A 2VSOA 4UXIA 2CL7X 5FUWA 1KSFX 2KB0A 4TSFD 3QKUA 1IAQA 2F43A 4GFDA 1RYHA 3LVRE 1VG9B 1JR6A 3Q7PA 3NDPA 3W5IA 1SVWA 2QPTA 1ZM2A 5K8TA 3AF1A 2WKQA 5FOUA 2V1XA 3LNCA 2Z4SA 3UXMA 5DI3A 2GAOA 3IBYA 4QJ3A 2O8EB 1FUKA 1KYIA 2HEIA 5TV2A 3QJYA 3TJZA 1IN6A 2HLDA 1BIFA 4C0SA 2NO9A 1E2EA 4TLCA 1KDTA 3TR5A 2QP4A 3ZVNA 2P67A 3SC3A 4LJYA 4P32A 1P62B 4QGAA 4BFUA 1ODFA 3EZ9A 3G82C 4A92A 1MOZA 1XD9A 2JCSA 2Q21A 3VQTA 4ZDKA 4KODA 5EE0A 4TMZA 3Q8XB 2ZETA 2HYDA 2LKCA 2NGRA 3TUZC 2IYLD 2Z83A 4JLVA 2RH5A 2ZPTX 3H1TA 4IOKA 2MMGA 1JI0A 1VDZA 3DOEA 4PO9A 4YXWD 2P5TB 3AGQA 1VYUA 4JT4A 2IBMA 2GTPA 1UKZA 2YC4C 1YR7A 3P32A 4EQ6A 1TEVA 1JBKA 4D2IA 1E2JA 1G3UA 4FCTA 2CHGA 4F4JA 1HTWA 1U94A 5IF9A 2MSEB 1JJVA 3I5XA 2XGJA 5FOTA 2CVFA 1VKJA 1W48A 4GMXA 3GLGE 1MO4A 2DCUA 4QNRA 3K0FB 4I1VA 4Q9JA 4YQFA 4RKFA 5C4MA 2GRJA 4BFVA 3ZD7A 1MABA 4QG7A 2ONKA 4D0NA 4D4LA 3K9GA 4O25A 4NE2A 4EPXA 2B7BA 1PV4A 4DZZA 2O8FB 3QPVA 1PLLA 4XVUA 4KJZA 4HAXA 2VSFA 4KV9A 4P4SB 4DJTA 3EZ6A 2O8EA 3BGWA 1GVNB 4Q48A 1IOZA 1RE0A 3X1ZA 1T0HB 4HLCA 1HT2E 1G7SA 1AKYA 4Q7KA 2G1JA 2WSSD 3A1UA 4A4DA 4YONB 3IIJA 3IPXA 4LPSA 5BN4A 1QBKC 2N46A 1SZPA 1N5KA 1SGWA 2J41A 3V9PA 4MITA 1XMVA 3EW9A 1G5RA 1PJRA 4P31A 2ZRMA 3FKSD 2X1VA 3AUYA 4LYHA 2EFGA 1AQUA 4DEXA 2V7QA 5FOVA 1Z0DA 2ZE5A 4E5UA 4Q4HA 3KFXA 2DR3A 2GK6A 4HAUA 4LJ4A 2WPDD 3KJIA 4M21A 2DWQA 1Q21A 2VEDA 2X8AA 3GJ0A 4FN5A 2CCGA 3SE0A 2R62A 3FWYA 1KO7A 1JXMA 4N0DA 4F4CA 3AGPA 1YKSA 4B2LA 4UKDA 1N0WA 2XNDA 4V0LA 2L0XA 3BFKA 3K0FA 1WRBA 5L3VA 4IFBA 2H7VA 1T5LA 1AA9A 1CIPA 4YMWA 5JS8A 2EW1A 4A1FA 2O8FA 4B76A 3RSOA 4UJ3A 2AFIE 2GHIA 2Z43A 4AC9A 3CW2A 1E2PA 4P4SA 5IT5A 4DLXA 3I62A 1IM2A 1Z6XA 2OBLA 1XD2B 2CE7A 4TMKA 3ZZ0A 4M1OA 4IDQA 2ZYWX 1U9IA 3BRWD 3KB2A 4B3FX 1T3LA 2R6AA 2GETA 3GLFB 2C99A 3CO5A 1TQ6A 4UNRA 5FL7A 3FKQA 4IDNA 3V00A 1F48A 2ZJ5A 2GEVA 1OH6A 1G16A 2XAUA 2WIAA 5GJCA 1GNPA 3GEIA 1HV8A 5AWFC 3QEJA 1PZNA 3PUVA 3C16C 4RCZA 3MG9A 3GQBA 1D9ZA 1OB5A 1TQ4A 5FL3A 4ZCIA 4XJXA 3FB4A 3NXSA 1XB2A 3BAFA 1MO3A 1TF5A 4C4PA 2P6NA 4D81A 3GFOA 5KU1A 2CJWB 2ZS9A 4Q47A 1CR0A 4R9UC 1E2KA 2JEOA 3QI2A 1FQKA 4BFWA 1D8TA 1OSNA 2GXQA 3SR0A 3QF7A 2IYRA 5GJVC 4D6PA 2IX3A 4BPBA 4KI0A 2PH1A 1TAGA 1JAHA 3NC0C 5BW8A 2PZGA 4O2LA 5EXSA 1ZINA 3CF6R 4AKIA 1XJ0A 2GKSA 721PA 1IY0A 1FUUA 1D5CA 3LQQA 4WIAA 4I81A 1RVDA 1B23P 1XTRA 3B1XA 4ZIRB 1A82A 1KK1A 1XD2A 2HLDD 3U44B 4TL6A 3LVQE 4Z8XA 2WWYA 2QQEA 3DZDA 2DFLA 1U99A 3CPJB 4TMVA 1XEFA 3QIAA 3GLFA 3NTUA 1G3MA 3Q5EA 2J7PA 1JEEA 3UATA 1KDOA 4BWYA 1U8AA 4L15A 1WA5A 1NLZA 2FFBA 2YWHA 3BB4A 3R9XA 3VR5A 1OF1A 2GCPA 3CH4B 4YMVA 1R8SA 1FL9A 2VP2A 2F55A 2BMFA 4QM6A 3TRFA 5CB6A 4HSEA 1DELA 2G1KA 4Q9IA 1NVVQ 3HU3A 3P26A 1G3IA 3CB4A 4DCNA 3GP8A 4ZDJA 5HR5A 4QBGB 1N0VC 1FW6A 1NVXQ 2PLFA 1F2TB 2CJWA 4OL0A 3I73A 2J0UB 4B6EA 4GOKA 3W6OA 5EJEA 4DEYA 4LGMA 3EAQA 1E69A 3KKPA 1R0XA 2B6HA 3E5HA 2ZI5A 4FIDA 5AUNB 2W6IA 2JJ2A 4LZZA 4EPYA 4CEIB 3UMSA 4A9AA 2QL6A 3K53A 1DARA 4NTZA 1QDEA 4JJZA 4LBZA 3SNHA 4DIDA 1ONBA 4IRUB 4QHYA 3VX3A 1ELOA 3WHKA 3OE7A 3AVTA 4X8LA 3KQUA 1E32A 1OXSC 5EP4A 3CNLA 4C0LA 1CR2A 4ZIRA 1MO6A 2PT7A 1QHIA 2OM2A 1GNQA 2CK3A 5C4GB 3U44A 5E3HA 4Q01A 2EYQA 1NP6A 2C8VA 2BOVA 3HYRA 3RS5A 4TZ6A 3HP1A 1DAGA 4HUTA 2DPXA 5KNCA 2WWXA 2YWFA 3HU2A 1XD8A 3CR8A 1SVKA 1UBFA 2QE7A 1AK2A 5TY0A 3GJ6A 2PX3A 1KGDA 1P9NA 1KSHA 2OAQ1 2V7QD 4G5OA 4PPNA 1IHUA 1YVDA 2HJVA 2CLDX 3D6TB 4NCHA 1K6MA 2FFAA 2AKAB 3RS7A 1QVAA 4BRUA 3C4JA 4AWXA 4HLDA 5KNBA 2XZPA 3MLEA 3B78A 4HAVA 2HXSA 5FTMA 3OEHA 4W5HA 4JLNA 1EGAA 2R65A 2ZUCA 2O5VA 2Q3MA 3VR6A 2QNRA 2X2FA 3DDCA 4D26A 4DDWA 4OI1A 1F2TA 2BJWA 2XNDD 1G8PA 2IWRA 2AKYA 2FNAA 4B6FA 1TF7A 4DVGA 1TU3A 4CGZA 2QI9C 2J0UA 4KSCA 4CT4B 4ON9A 1S2MA 1ZUHA 1D6JA 3EIEA 4K8OA 2WKPA 3HJNA 1ZM7A 2I4IA 4CEIA 4FXPA 3NH6A 3Q3JB 2RGAA 2ATXA 4MA4A 3UK6A 1YR9A 4DLSA 4IXMA 4QHSA 5SZJA 1KMQA 5HPYB 3SBDA 4YMSA 2AXPA 3FE2A 5SZKB 1GRQA 1R0ZA 2BEKA 1YZQA 4L9WA 1CP2A 3PUWA 1E3MA 1CULC 2YC2C 1NG9A 5CLLA 3V4FA 5J4YA 2ZJYA 1W2HA 5JI2E 4IEEA 4R71A 4MDEA 2WWGA 3FHTA 4G5QA 4Z51A 1KNQA 2ORIA 1S3GA 2P0EA 1P2UA 4Y0AA 2VHQA 5IDVA 4GRAA 2J0SA 4W5WA 2OBMA 1GTVA 3HPRA 1UDXA 3B1ZA 3B60A 4DHEA 2F7SA 2J7KA 2XEXA 3ZVMA 3SN6A 4Q19A 2QTVB 2G3YA 4QOSA 1DAHA 5AJXA 2HT6A 3R20A 5E7MA 1WDTA 2YOHA 1YHNA 2H57A 4BLPA 1ZNZA 1E1RA 1ZYUA 2D3WA 3G0HA 1E79A 2W2XA 3K0CC 5G40A 3GMTA 4QC2A 1E0SA 3K0AB 1JB1A 4M1TA 4ZI2A 3ADBA 2QAGC 2EVWX 1C9KA 2Q3HA 4DDVA 1NJFA 5J40A 3FPAA 3IQXA 1FZQA 2RCNA 3OESA 1US8B 4I1UA 3CF2A 2RGEA 3ZLJA 1T91A 1NVUQ 2CL0X 5LPNA 3VKHA 2IYVA 1ZP6A 1OV4A 5JZVA 3DL0A 4JZKA 4RD3A 2WJIA 4ZI3A 1G18A 2O8BB 4A2QA 2ZROA 3NBZC 2YZ2A 3W34A 1I4LD 4F7WA 1W46A 1M7GA 4PC6A 3WYAA 3LBNA 2J3EA 3TGPA 1H8EA 1WXQA 4AYWA 2GJ9A 1EESA 3C41J 1G5TA 1VG8A 3LBIA 4B43A 3U6KA 2J7PD 5EUMA 1Q1EA 1E2FA 2IUUA 4EJSB 4FWIB 4JBXA 3P1JA 3CRQA 5TVKA 2WAXA 3ADDA 4GI7A 1M6NA 5BYJA 2O8CB 2QAJA 4R7ZA 4KFSA 4FMCF 1Q0UA 1QHSA 1U90A 1U8YA 1YZLA 1WBDA 5JEEA 1E0AA 3P4YA 1UBGA 1W4RA 2VSXA 3LWNA 1DO0A 5KSZA 2IYWA 2YOFA 3ZDQA 5JI3E 1A5TA 2YJTD 1E9FA 3K0AA 1GIAA 4PQRA 4GMDA 2WWHA 1R5NA 2RGXA 3I3SR 5FH9A 4Q7JB 4RZXA 1P9RA 4TSFA 2H8KA 4PXAA 3SQWA 2AN9A 2PCJA 4MGKR 2YKGA 1ZAKA 3A1SA 1VPLA 2W6ID 1U0LA 1US8A 1Z29A 2FPKA 4MGZR 3MSXA 2ZM5A 3IEUA 1L8QA 3KZ1E 3H0KA 2ZREA 4ACBA 3QXHA 3BFVA 4JLAA 4B74A 1E9CA 3W9YA 4C2TA 5KOYA 1NF3A 1R10A 3OE7D 4FMDB 3KQLA 3QXJA 3LQRA 4NYMQ 4Q02A 2O8BA 4TYYA 1F60A 2JJ1A 2CMKA 2A5FA 3NHBA 3GEEA 3RLFA 3LXXA 3B9QA 5B58C 1G64A 1Q44A 2RHMA 3LW7A 4GL2A 1PLKA 1E94E 4OYHA 1XJQA 2AX4A 3F8TA 3K1JA 3Q7QA 2V8OA 1N6PA 2IC5A 4XTCS 3EIQA 2QE7D 4JKIA 4EJSA 3QQ5A 4M0LA 2O52A 3AP1A 2IW3A 3THXB 3RYTC 5TMPA 4NMMA 2JLYA 3WNCA 2ZR9A 3SQXA 2O8CA 3DPUA 5K8UA 1OLOA 2CL6X 1Z8FA 3OEHD 2J46A 1ZUIA 3SHFA 1N6LA 2AWNA 4Z1MA 2VBCA 1IY1A 1TU4A 3SJCA 2N42A 4KU4A 1UPTA 3T1OA 1N5JA 3A8TA 4LSGA 3I4LA 3CONA 1MH1A 2GZHA 2ZR7A 5KSYA 3EASA 2H17A 3W3ZB 3FHOA 4JYBA 3NEJA 3WP1B 2ODEA 4LCBA 4TLEA 3AKDA 2FPLA 3P20A 2IWHA 1IJFA 2PL3A 4LC0A 5L3QB 1R8QA 3GJ4A 4MGIR 1LS6A 5JRJA 3ECCA 3OAAA 4TMWA 3X1WA 1N25A 2A7QA 1LB1B 3DEFA 4I99A 4A0HA 4CT5A 4GDFA 3VNUA 1Z07A 3U2QA 1E9RA 3VMFA 1UJ2A 3KXIA 3I5YA 5FUXA 1NMYA 3QXCA 4I4LA 5EXTA 1A7JA 3TAHA 4E22A 1OH5A 1IN8A 1Z2AA 2OCBA 1GNRA 1XCPA 4PQFA 2OFWA 1Z83A 3CX8A 5KUTA 2ZRBA 4KYIB 1E9EA 4NL4H 4BEBA 1X86B 4MRSA 1LF0A 4Q9LA 4N1AA 1P2TA 2FV8A 2RGBA 3THXA 2RGCA 5CK4A 4FMCB 3ZS8A 2IYYA 4AG5A 2IS2A 2VIIA 4MKIA 3KXKA 1E1RD 4F38A 421PA 2IL1A 3AF2A 1E79D 2B21A 5SZHB 3ND8A 4MYUA 1GL7A 4DLUA 1KI7A 5EQTA 5JFGA 1G291 1KMHB 1FPMA 1LV7A 3GLFE 2FEOA 3JVUA 5KPJA 3BORA 4UXHA 3MWKA 1UBEA 2CCKA 3EARA 1ZU4A 1KDRA 2WJVA 1J70A 1EXMA 2FFQA 4KLNA 4N0EA 1EK0A 4PZLA 4B3DA 4PSAA 2IF0A 2GA8A 3CX7A 3SS8A 4A36A 4OHXA 5L3QA 1NBMA 1Q3HA 2KWIA 2WSMA 2BBTA 1XWIA 1GL6A 2VO1A 2BHRA 3N2EA 3LLUA 4B35A 4OKSA 1OE0A 2R8RA 1KIMA 3NH9A 4CIDA 4RD4A 3R9WA 1V43A 1XEXB 2D2FA 2OESA 2PT5A 3QOFA 4OQNA 1T0JB 2JLSA 2PCLA 3CR7A 1H8ED 4O0MA 2ZJAA 3ZJYA 3GJ5A 2G77B 4LUCA 3CX6A 4D4MA 4KFUA 2J0QA 1OKKD 4M2LA 4AD8A 4CEJB 1P60A 5CYPA 1HEIA 1J7KA 2BCGY 2ZUDA 5H1YA 1RRGA 3T61A 3EWSA 3LW8A 1S8FA 4HB0A 4JYCA 1W1WA 5KO2A 2A5YB 1AZTA 2PZEA 3KJHA 4FI3C 4GP6A 4XH9B 4M1SA 4B3BA 3FFAA 1IQPA 2REXB 5FOXA 1TNDA 3GLIE 4N3NA 4NDZA 4MRNA 1N6HA 2Q0HA 3FVQA 3THYA 4DRZA 4UJ5A 3O8CA 4AY2A 3KXLA 1E0KA 3NEYA 2RGNA 2GJSA 1XMJA 1HE1C 3RS0A 1RJ9B 1G1MA 4AG6A 1KMHA 4G5GA 1AKEA 4TQ9A 5EP1A 5JCPA 5FR1A 1RRPA 3RRNA 3IIKA 4MYTA 4V0OA 3EWAA 5F3WB 1CRPA 3PUYA 3LD9A 3O47A 3TUIC 3A1WA 5HZKA 1MKYA 4PC2A 1NLFA 2IK8A 4MYCA 3L0SA 4OHVA 1UAAA 5FOSA 1E2LA 2NOAA 2DBYA 2GVDC 4II7A 3NBYC 4LJ7A 2UVQA 2F1HA 2ZJOA 4QL3A 1G3QA 1BOFA 2JJ1D 5KDLA 821PA 1XX6A 4OHWA 4D80A 1SVLA 3VU9B 1XEXA 1EG7A 1YRBA 3WBKA 5E7JA 4YMUA 2A2ZA 2EQBA 3IUYA 5HTKA 2WWIA 5FBWB 1OIWA 4CZ2A 3GFPA 3AKYA 4QGFA 1PLJA 4CEJA 4Q1BA 1Z6AA 5DYGA 1GRRA 2AD5A 2OZEA 3NHAA 4Q66C 4B32A 3OIUA 1UBCA 2ANCA 3LA6A 4OBEA 1IXZA 4C0AC 1S0UA 3SBEA 2RB4A 3CH5A 1AGRA 1N5LA 5JJLA 2EFCB 2IS6A 3OFND 4JLBA 4QHTA 3TIFA 1JJ7A 4A8JC 1Z06A 1Z2CA 4IFEA 4RCYA 3X2SA 3SDZA 1K8RA 4Z1MD 2R6DA 3KUDA 3WMGA 4IJMA 3EPHA 2FEMA 2IXGA 2WZQA 1RJ9A 1ZC3A 4ERNA 3AP2A 3U3RA 1GKIA 3CUEF 3VR1A 2DY1A 4OHYA 1KO1A 3TBKA 4AIIA 5CYOA 1G9XA 4HUQB 2W83A 2QEQA 1N0UA 2W58A 2GBLA 2ZYTX 3KFVA 4PAOA 4TT3A 2H18A 4MKFA 3TH5A 3OAAD 1I4TD 4KO8A 3U60B 4MRPA 4DUGD 3SFZA 4B47A 3EC2A 2ZI9A 2WTUA 1SVIA 1PUIA 2OO7A 1N2CE 3PCRB 2NO1A 4HB2A 1ZU5A 1S4QA 5HCNA 5KTYA 2JJ8A 4HYYA 1TF2A 4HLUC 1NSTA 4B3GA 3VU9A 3X1YA 4O3MA 1DVRA 2ZU6A 2J45A 3BH0A 2XJ9A 4KXFB 1CLUA 3TKLA 2AL7A 5KSOA 1OFTA 1Q1QA 2ZRJA 3KL4A 4TWZA 4OI0A 2E9SA 4JIMA 2QRZA 1ZCBA 2AWOA 3THOA 4XSHA 3UMFA 4BE7B 5AJYA 4TYWA 4OQLA 3KKMA 1V5WA 4WVFA 3E70C 2XTMA 3PENA 3DM9B 2VHUA 4URVR 1Z0FA 1LFDB 5DI9A 3CWQA 4DSUA 2DB3A 5J4LA 3I92A 1E2NA 2WJJA 4XD7D 2NO7A 2XZLA 1JPNA 1AM4D 2D2EA 2QSZA 1NG1A 2PMKA 2OAP1 3LV8A 2IYZA 5LB2A 3QUSA 2OHFA 3BIFA 3EA5A 2NPIA 2FX3A 4G3XA 1CJVC 1TADA 1M8PA 2HCBA 3N70A 2WWWA 4Q1DA 4HZIA 4HUQA 2OCYC 5BWMA 2JLQA 3PEUA 4MH0R 4Q7LA 3WHLA 2D74A 2HJGA 5DHFA 1DAEA 1KHTA 1NBMD 4LBWA 4CRWB 4TYNA 2P6UA 5JS7A 5F2EA 1Q12A 1II8B 4P3YA 4DLYA 4H9GA 2GXAA 1ZNWA 1KAGA 3ZQ6A 4NCJA 3L0PA 3WY9A 4LBYA 4G5SA 4DDTA 3QNUA 3VHXA 3EXAA 3VKWA 1T4GA 2A5DA 4KCGA 4JVNA 4NYJR 2ZSBA 1J8YF 5KDOA 121PA 3KJEA 1KTVA 1ZC4A 4LHWA 4OJQA 4DB2A 1YR8A 4IKEA 4F91B 4X8HA 3RNLA 4DCVA 4NYIQ 1XFAA 5ELXA 1T8UA 2GEDA 3CRW1 3ZIAA 2QTHA 4CYMA 1NNEA 1LVGA 2GK7A 2YYZA 3B8HA 3KKNA 1M1YE 1U2RA 3GJ7A 5LD2C 3UWKA 2ZS7A 4MUAA 1ZD8A 2FPMA 3KTAB 4S2EA 4TLBA 4IVQA 1DO2A 4D25A 2K5UA 3UMRA 2ZI7A 1R6BX 1YU9A 2HCJB 2JLZA 1W4AA 1NY5A 4FMBB 4BZPA 3PIRA 1W0JA 3IBGA 1NMXA 2VHTA 1QHGA 4WXPA 1VCIA 2FSIA 1OXTA 3VTKA 2IXEA 4BEJA 2BWJA 2A9KA 3GLIB 1GWNA 3AP3A 2IHBA 3LO5A 2RMKA 1UEJA 2OE2A 4Q03A 2BBSA 2OLKA 2GF9A 1W4CA 1CS4C 1E6CA 1GKYA 5EZ5A 1II8A 1TL7C 1NI3A 3UANA 4Q4JB 3LDAA 1UEIA 2XB2A 5GJBA 3R9IA 4L8GA 1BH2A 1VIYA 3Q5DA 3M6AA 4I1SA 1FMJA 1CEEA 3WYGA 2ZU0C 3IILA 4HB3A 3K70C 1OT3A 3VKGA 5GJWC 3L8ZA 1W36C 5FTNA 4LHYA 2W0MA 2G6BA 4NPHA 1YZKA 3L8YA 1KI1A 4RD1A 3SU8A 5FPTA 1XMSA 2QMOA 4UNSA 2O0HA 1G7CA 1XRJA 2KSQA 2QT1A 2YWGA 5BN3A 2IS4A 4M1KA 4PZYA 2A78A 1I2DA 3L43A 2WVJA 1P75A 1NY6A 2J59A 1FMLA 3CZPA 3KTAA 4A0RA 2JAQA 2ASEA 3B1YA 2NG1A 1GKUB 1F3OA 2ZRKA 3JZAA 3UG7A 1KJWA 3IO3A 1TX4B 3AEZA 3AVPA 1IXSB 4TL7A 2OCAA 3FYHA 4DLTA 1AS0A 1FQJA 4ZV4A 4EPVA 3BK7A
chains in the Genus database with same CATH superfamily
2J8ZA 4DQXA 3N0XA 5KQPA 1D9XA 1PKEA 2DLDA 5JAQA 5EIBC 2CXUA 2X0DA 1Z4OA 3IE0A 2RH4A 4RF5A 4WBSA 3THWB 1SIOA 3U3XA 2PBRA 1HYHA 2ZOSA 3CNOA 4QECA 1LRLA 1T1IA 1VLMA 4RVHA 1BRMA 4ZRNA 1EZZA 3VR5H 1XMIA 5BVHA 4UUQA 5EJ5A 2VAVA 4LXXA 5ALKA 2HSEA 3D1VA 4NV1A 1LDYA 1U2DC 2W11A 3MAAC 4QTUB 1WX1A 1ZNXA 2OZPA 4GBMA 1X1EA 3M1AA 3I6MA 5HF5A 1S96A 3DZGA 1KIFA 1KJQA 1NKSA 3LX8A 3DQZA 3U26A 4MP8A 5LIRA 1K75A 3L82B 2OCGA 3OKFA 4FFDA 2FR8C 1KOJA 5EJIA 4C0QC 3MMSA 5HSGA 3M5DA 2VPIA 3SYKA 2I65A 1ANKA 2EP7A 3NGLA 4MEJA 4QGGA 5BSRA 3BRQA 5EZ6B 3VNVA 2QU8A 5CA0A 2DERA 2GZDA 4PRYA 2OXTA 2YW2A 5FHQA 4CQJA 4RABA 1Y6JA 1Y4SA 3PLNA 5IZCC 1A9QA 4QLOA 5HBGA 3JQ6A 1DKOA 1ZD5A 4GI1A 2WT8A 3F73A 1ZNQO 3LAWA 1M8KA 4C0JA 5BNIA 5AJVB 3A4YA 1DT3A 1TCCA 5ECGC 1EE2A 3HL0A 3BIWA 3PGLA 1I1NA 3CUUA 2AEJA 4M9RA 1YE5A 3DCIA 3OPQA 3R6DA 1T6NA 5A3QA 5ETJA 1TM1E 4DPMA 2XE7A 1N6NA 2HQBA 4C4TA 3HZHA 3L0DA 4EF5A 3IH5A 2ZWOA 1JHZA 1GLVA 4X66B 2NUTB 2YXNA 4LMAA 3QLVC 1K2WA 2VH2A 1T0BA 4BZQA 1XC7A 4I5GA 3E7WA 3JQCA 3E3NA 1U5BA 3V5NA 4GKAA 1UM9B 3N2GA 3CMCO 1DCKA 4EW6A 3LZDA 1MPXA 1ESDA 4L9SA 4P7FA 2C4KA 2I6GA 5IT4A 5KNCH 4KNYA 3EQ9A 4PSKA 1KSGA 1IXRC 4H3SA 3WTBA 2B1GA 1P9OA 3HVHA 3KWMA 3A32A 3LFUA 3WMXA 4BC0A 2TMDA 5JSHA 2NSHA 3ND7A 3OZTA 4WEQA 1CY6A 2IVFA 1Y8ZA 1IJEA 2VA9A 3H9BA 4LYEA 4J1NA 1P0QA 2FMHA 3JAWB 1GPBA 3R3JA 4PFSA 4RAOA 3ZHBA 4BVKA 1T25A 3RT9A 4GPTA 1NATA 3VZBA 1QUFA 1QHXA 1NIJA 2QMZA 2FDXA 2X2EA 3HBLA 3NANA 4PCLA 1G6HA 4ZPXA 5ICFA 2XT9A 3V55A 5LLTA 5ALJA 4G1UC 1Z47A 3DVLA 3T5GA 3GFQA 3T0GA 4C0KA 5AOVA 2C2YA 4UCQA 4R2IA 2X5JO 1ADBA 2TS1A 4CW7A 2FEWB 2B8NA 2QJOA 3IVMA 2Z4RA 4KWCA 1FYWA 2P90A 3SIRA 4CN8A 5JCJD 4OF4A 2F8MA 4MQ6A 4HFJA 2IGBA 3AOEA 3GGDA 4ABTA 4MI6A 2GNPA 1I5OA 4PO1A 1OFIA 4LF7B 3B48A 4CMJA 4O2RA 4GPEA 4E13A 2AVNA 5AKLA 2HLPA 3W7BA 1AIPA 3CX3A 3SC4A 3W2IA 3UWOA 3B13B 3LCUA 5HS6A 4B44A 5FBVB 1B74A 2NN3C 2NTEA 3CTPA 5E3JA 3ZJUA 1XUOA 3ADCA 4CG3A 1QVWA 3HABA 4LJKA 3RRXA 1T9ZA 1PGJA 5JSQA 4QREA 4B3SB 1VCHA 4GLJA 4DNFA 3OZXA 3GLKA 1ZI6A 4JLKA 3V7NA 5IUJC 2WD7B 4KIWA 5JUWA 1GA4A 3A70A 3LF1A 3IDQA 2ENUA 1KMIY 5B1HA 1DC5A 4BFZA 3UXHA 3P4UA 4L78A 2G6TA 5EMMA 3FCEA 1P5ZB 5K0JA 4PAQA 1JLLB 5AOBA 5B2FA 2AK3A 2FB9A 3WWZA 4BWFB 3C7AA 1EWRA 1Z68A 2JH8A 3MQ4A 4XE5A 2R44A 5P21A 5IUNC 2O0JA 2QDXA 1H2YA 5EP3A 4BAUA 3Q8WA 4ND7A 2ZCVA 3CISA 4QXAA 4HDOB 2G0TA 4ZA2A 1SH7A 2VDRB 3L4EA 2C5GA 1XPOA 5E2IA 1RAHA 4ZANA 2LV8A 2RKOA 4DTIA 3PLRA 2W6PA 2NO0A 1N8TA 5BXYA 2AJTA 3CMMA 4FYIA 2XMDA 4HN2A 4QXMA 1ST3A 5DYNA 2P5SA 4Q1VA 1A77A 1FNCA 2B25A 2Z5FA 3LOPA 2ZUTA 2JLAA 1YCHA 1Z25A 4R81A 3U37A 1U0NA 3DWEX 4DDUA 1DKUA 4LBVA 1NL3A 2OHJA 1GTSA 2RIPA 3CJTA 1HNZB 1YJQA 1M2FA 4ZDWA 5KCMA 1NHWA 4BJ6A 1QU2A 2R4TA 3H3FA 1GJRA 2Q3FA 4Q7EA 1DBSA 1RM0A 2XTJA 4ZQIA 1ETUA 4DC9A 5F2KA 5EESA 3W4KA 3K05A 3CNQS 4R6XA 4BFSA 2QY6A 3CVXA 3B3QA 3B20A 3O95A 3L92A 3A9VA 1GQOA 5K0SA 1F2UB 2Z6UA 1G19A 1RWBA 2XSZA 3JZIA 3P0JA 4JKYA 1ZD9A 4X1OA 5T41A 1KZ7B 2W93A 4MHTA 4Z3DA 1GXSB 1WCIB 2H11A 1OH8A 4WJLA 3Q85A 1RBMA 4R8KA 1KFBB 4TTRA 1YRWA 2H4ZA 3WGLA 4YRIA 1AB6A 2CLKB 2WICA 3F74A 3TLXA 1J0AA 1L7RA 2WD8A 4BJ5A 1YWGO 2IDKA 3DE6X 4RZQA 1M34E 4U0JA 4N01A 1DC7A 3EC7A 2WYOA 5FUVA 2Q7OE 4DV1B 3S5UA 3T7RA 3LC1O 1E66A 2VT2A 4ACAA 3T5PA 1OYOA 1KI4A 3BXZA 3RFVA 3A4IA 5C1BA 1HNXB 4EG1A 3MSCA 1E5LA 1JTVA 4C0BA 4DV7B 5AW5A 3TW8B 1B43A 5J4HA 1SHLA 4QDKA 3ROFA 3CNBA 1P0IA 1V5EA 3HL4A 5JLJA 4CCYA 2AE2A 3OT1B 1U31A 2XMCA 4RKYA 5JYEA 5EIAA 4B7CA 4HWTA 3QXGA 3Q3VA 2FUCA 3O7MA 1T5TA 4I5FA 4J94A 1HYBA 1KC1A 4LI3X 2WFLB 3NKFA 5GMOA 1I7SB 4JV5B 3NAZA 2R1VA 1KQNA 4WZBB 3LC2O 4D41A 1ORDA 3KLMX 4JJFA 5BWBA 4EHKA 1ODKA 2G0AA 1PZHA 4HRVA 1XDBA 1FP6A 3H5TA 3V8QA 2P4EA 2V7XA 1NDQA 4EFLA 2OQ2A 2VNSA 2Y8EA 1FLNA 3EK2A 2VAWA 1PZGA 4L3WA 5KTRA 2L69A 1G8AA 5AJZA 3T1VA 4EABA 1NUTA 2F3RA 3IQIX 3GX1A 3T99A 2XZOA 1E0JA 5AVKA 1YZUA 1HDGO 2AK2A 5G4LA 3ZXIA 3K9QO 3W8RA 1WL8A 3G8AA 4UNQA 4RK1A 4AMBA 4B75A 5ABPA 2WJWA 1XCOA 1ZW6A 2IYFA 4PHHA 1U3WA 3I2KA 4PONA 1FP4B 3QVGA 5AI8A 3FZQA 2R1UA 2YYAA 4ME6A 4DM7A 1PJ4A 3MD9A 1Z6TA 1EE1A 4JGBA 5FWYA 4UTVA 2QUIA 1ISRA 4AVYA 4HX9A 4N3BA 5CNMA 3R7WB 3AJRA 3R5TA 1OW3B 1PJSA 3K2IA 2RHRA 4RY0A 1HE2A 4U8HA 3PFFA 2Q6LA 5D3KA 2V9PA 3UGQA 5JBQA 2ONJA 4BYGA 1P33A 3KWJA 3WLFA 1FSFA 1RQGA 3OJ0A 3DMDA 5FBQB 3ZDAA 1R0BA 1OYVA 3K9CA 3BJEA 3ZZTA 5G3ZA 1D4AA 2EKBA 2HF9A 2X19A 3JR7A 4IMIB 4JLJA 4X54A 3PEWA 1O57A 3EOAI 3IAM1 3KT3A 1Y3AA 3MEQA 3I23A 3NXKA 4ZD6A 3TVTA 1C1YA 4DA8A 1T4CB 4J0IA 1ISHA 3PFNA 4XYEA 1ULSA 3DAYA 4AX4A 5FTKA 5TMDA 2GN1A 2NVBA 3L79A 5I4IA 5KSPA 2BM0A 1RLUA 3QX3A 2PGXA 4K86A 1XIVA 5B36A 1FJHA 2V7VA 1Q7GA 5TQ0B 4M7WA 1AY0A 1YK0A 3CINA 1K88A 3TOVA 4H16A 2IYPA 3KRTA 1GTG1 1PUJA 1EDEA 1PFYA 2Q3DA 2QZSA 4DT1A 2OZLA 5KC9A 2WBLC 1CZOA 1E96A 2O23A 2ZYDA 4QJ5A 4U39A 3WNBA 4CWAA 4EMTA 1GZSA 2HJWA 1RW4A 3VKFA 4EY7A 5BVGA 3TW4A 4XOIA 2VF2A 1V5GA 5HKAA 3GC6A 4D43A 4YUYA 3KKKA 5I3CA 1TK3A 4XD7A 4E4RA 1Z7YA 2GJ8A 4U6QA 5CCBA 3T3EA 4FKZA 1VIAA 2G1AA 3OQ1A 3UKOA 2ZSAA 1KYTA 1GGVA 2Z09A 3QWIA 4Y7DA 2B4AA 3ED5A 3J7TA 3HM2A 4N5IX 1UOEA 1I14A 4C89A 4JFRA 4ZC1A 2R68A 1RR6A 1NXSA 3DMYA 4PWYA 5D87A 4O2AB 3RWOA 1RAAA 5JHHB 2DTEA 2QTFA 2VP4A 3MBOA 3KUCA 4A8PA 4F5DA 5JANA 3AYXB 3EFOA 4BDTA 1QOQB 1L7VC 2BKEA 4O5AA 1YZGA 5DN9A 2V59A 3R3UA 3KYBA 2ROQA 1NN0A 3P9RA 2ZTSA 2AZDA 4UAVA 5F7ZA 1S1MA 3PXEA 3UWMA 3BH7A 1DLIA 4TL9A 3MMNA 1RZRA 3DVAA 3P9KA 3R6WA 4AZSA 3BQ9A 2WJPA 2QMHA 4FX2A 2P65A 5JAIA 1Y1RA 3MINA 3UCFA 3LBAA 2PS9A 3B5JA 2QSYA 1M8FA 3BMOA 1P72A 2FX2A 2O05A 2NZUG 3W2HA 3NI2A 4DY6A 2IYQA 4U7PB 2A9OA 3OF3A 1YE8A 1EFTA 1PFKA 1QQAA 1B6TA 3S55A 3TXAA 4BGVA 3TVDA 4MR8B 2NAFA 4GI5A 4PBRA 3ZGXA 4K3UA 4ZT2A 2WHRA 3LXMA 1BGWA 4J6EA 3CRRA 4C6HA 1LI5A 3SYLA 3WWEA 3WSTA 1UK6A 5IN4A 4NOLA 5EUQB 4JEHA 4EMUA 2Q5IA 3W1EA 1CUDA 3ZI4A 1GGKA 2UXBB 3HU5A 1UBNA 1VPTA 4AZ0B 1E9BA 4AX8A 1P0MA 3PITA 4FFBB 1TIKA 2DHCA 2BKXA 2NZ2A 4GH5A 4C7KA 3AVWA 3PFWO 1ODTC 4KRYA 4YP5A 4UTRA 4ZHQA 4QYWA 4OQQA 4K7JA 4CLRA 1B7GO 4MV8A 1S1CA 1UPBA 2WJHA 1GG5A 1OIXA 2UVPB 1NP7A 3AFMA 3ZK7A 5IASA 3PJGA 1NW7A 2XSZD 2WI8A 2CXOA 4LS3A 1NVVR 3ZWYA 5LZ4A 2XXAB 1O08A 1PV1A 1K5DA 3IKMB 4MAAA 3HJFA 2KI5A 1QB7A 4JSYA 4YT5A 1EG2A 2PKRA 3GJ8A 1S9DA 2B8TA 3FHCB 4PZ0A 3ZQ4A 4PYKA 1BGXT 1NRJB 1VHJA 3EEFA 3QEMA 2B8JA 3N5CA 3WA7A 2JFHA 1QO7A 4H2DA 1I10A 4P7GA 4EI2A 3QX7A 2YWXA 1TKAA 4MW7A 3GEGA 3IIMA 1MA0A 2V3CC 1D2MA 2HQOA 3ULKA 4MQEB 3FPEA 3HA2A 4QQNA 1MIOA 2QT0A 2E4UA 2ZE6A 1R0YA 2ZBPA 4LPKA 3GFTA 4QVKA 5CU7A 3GLSA 4E32A 4RULA 3GG9A 2FJUA 3MGAA 5H83A 3JYLA 2JL1A 3G5TA 3IKTA 1I3KA 3FDFA 3VNRA 1M34B 5TARA 4DIUA 2YRXA 4BZXA 3B1JA 1QK5A 1GILA 4RNCA 3TQOA 4DNPA 3HFJA 3MJDA 2FF5A 3NHUA 3GLHB 1UK8A 2OBFA 4DANA 1E6WA 1V8BA 4MZDA 5BUCA 4EVQA 3TX6A 2JA1A 3MCAA 1G2IA 1P0CA 1TDJA 2P9GA 2B8EA 1NVWQ 4DCGA 3B5IA 2LDXA 3G7UA 1YOBA 3IQWA 3Q0EA 4AMVA 1OJLA 2JHPA 2PQ2A 1JZTA 3M3PA 1PNVA 1QIKA 1ENZA 3EZ7A 4ILKA 4Y9DA 3QVVA 3EZNA 1P73A 4B83A 1JTEA 2GWHA 3NONA 1WZNA 2E21A 1GDDA 2X0JA 3TO5A 4D8WA 1I32A 4MKHA 2X9NA 2QX6A 4UFOA 1JF8A 4TXJA 3P2EA 3OCVA 4R05A 1QTQA 4G5YA 3ZLUA 1ESCA 4W5JA 5FWDA 3WYBA 3ZU2A 1RRVA 4CMGA 4V1CI 2C5SA 3U1BA 4M1YA 2NV0A 4AROA 1KWKA 1THZA 1W9HA 4WJKB 2ZAIA 3WICA 2FUKA 3URKA 4EY4A 3MTEA 1V11B 2R48A 4TXNA 1NW6A 4J90A 4BJHB 2H3HA 4A0GA 4QBHA 3ZYCA 2JGDA 1WMAA 2B3DA 3OJEA 2BR5A 2WUEA 2Y71A 2H6EA 4FYJA 1KQ3A 2H1SA 2QTNA 1CXZA 3MWDA 4QXOA 3RVLA 4P84A 1QBGA 5IYZB 1LWOA 2ORVA 3AI3A 1M2NA 5AOAA 1DDGA 4R0MA 3K8YA 5DBEX 1GO2A 4L8VA 2Z56A 4V24A 4JJ7A 1JHAA 3VR4A 1CRLA 2FSGA 3NDIA 4EW3A 4Z5XA 3GPCA 5AQEA 4YUVA 5FNZA 4ZZ3A 4FJ0A 4US2R 1QAQA 2GXUA 1OLUB 3OZCA 4N5LA 1ZM3A 3K4HA 4WCVA 3DQQA 4TWIA 4F71A 2Z8ZA 3A4NA 2IBTA 4KPFC 1U0GA 4CKEB 2AC2A 1WXXA 2CVZA 4RVSA 1Z5ZA 4Q3LA 1JTFA 2UYCA 1LQ2A 3VOAA 2J3LA 3T7AA 2ZJ7A 3OZIA 4UEKA 3KX2A 3QWFA 1FTSA 2NP7A 4W6ZA 4D98A 2Q0QA 1E6LA 5ANRB 4BEWA 4RD2A 2WF8A 3IYLW 2JZOA 1HC7A 1MX9A 2VPPA 4TXLA 4V03A 3PC8C 1U80A 2QRMA 4W9NC 1OWLA 2JK0A 4HT3B 4D56A 2MR6A 4RJTA 3CH6A 3HXMA 2E49A 5ARBA 2BEVB 3L7NA 3R7DA 4NEHB 2ON6A 4QUHA 3OQJA 5I7WA 3OG9A 4DDMA 1FIUA 4D5GA 1FQOA 2G17A 3EDMA 3EWIA 3LBYA 4GR5A 2J9RA 5AM4A 1QHHA 1RZRD 3C7KA 1U9CA 1WY5A 3DE4X 2FN9A 3A9WA 1O97C 1XQ1A 3DTVB 3IEKA 4L2IA 4BFYA 4GNKA 3RO7A 4NICA 1OVGA 3G6WA 3D7LA 4MO2A 2X6TA 4OQ4A 5G0SA 1ATZA 1XU4A 4HGQA 1VHTA 4KX3A 1RADA 4GPD1 1S3SA 2XJ4A 1FMFA 2BVNA 3FWZA 1DBVO 4WKOA 4Z1OA 1JFFB 2ATVA 1UMBB 2HA6A 2J5KA 3GRPA 3QE4A 2PMWB 5M3BA 3HDQA 3F8WA 2W2KB 1PGQA 1W9MA 1SOMA 1WHTB 4YCMA 1TQDA 2R4UA 4F56A 1V8OA 1Z8NA 1TZ2A 1QUEA 4XYGA 4DUPA 1XZPA 3CSDA 4XVQA 4BNYA 2I9PA 3NIWA 4HRAA 4MYDA 3OUUA 4OX9Y 4BVJA 1MJGM 1JALA 2RI6A 3M6MD 5LOVF 1Q84A 2ZIUB 4B0OA 3OHSX 3PUHA 3NR2A 2A9VA 1AXRA 2RI1A 1AOXA 2C78A 1FP7A 5T6BA 5CPFA 4IPTA 4MQBA 4ZHSA 2UZ1B 1R8YA 2VJBA 4PXSA 5AKGA 1WB9A 1EWQA 2MSNA 1BN6A 4R83A 2QXUA 4EMBA 4TLAA 1N8KA 5IPFA 1YBMA 5THXA 3B6IA 1OI7A 1JEDA 3PVSA 2AG0A 5TSDA 1DX4A 2FEKA 1C7QA 3CKLA 4AN0A 1XVLA 5BSKA 1LDNA 3PBKA 4XCQA 2HA5A 3AFOA 4HJXA 4HRXA 4Y6PA 3WBFA 4DW8A 1G21A 1SUSA 5AUPB 2VAXA 3O8BA 4X7RA 5TLSA 1OYWA 2YWCA 5IC6A 3HCDA 1ZGCA 1P91A 5ES3A 1NFRA 2V4UA 1I1OA 1ZHFA 2ZRGA 4Y2VA 1UK9A 1DI0A 1YFLA 2IIVA 4FE3A 1J0EA 2DPGA 1KYXA 2WIJA 3NO4A 3GVHA 3ENNA 1C1HA 4ZDIA 4XZ3A 3AVXA 4F2GA 4BUZA 4EX6A 1NZJA 1WD5A 3HZRA 3KEOA 3NC1C 1LTHR 4YECA 4YRSA 1DG1G 1ECJA 3TQTA 3V2UA 1ZXXA 3C70A 1HM5A 3L0IB 3DHYA 1Z16A 2BFNA 4IQ0A 1UADA 1WXWA 4L28A 4YMLA 2ZE8A 4NFHA 2ZTLA 3GRUA 1MU0A 1M9NA 1LBSA 1VHDA 4HS4A 5EE9A 2WZBA 4ETWA 5FI5A 2P6MA 3FDJA 4YMHA 2ZYIA 4Q5IA 4CQMB 2EU8A 2EARA 1KO8A 2XIQA 2OBNA 1R6XA 4K03A 2E37A 1X8JA 1I3NA 4L0DA 5E3IA 5ECWA 1W6RA 2L17A 4V1CB 1PP4A 4BX9A 2V7BA 5FEUA 1RLJA 2AJ8A 2NM0A 2D4AA 3ASUA 4GBJA 4WBNA 1E6MA 1MC8A 4LZWA 5LN1A 3OZGA 2DFKB 4BLOA 1D04A 3U61B 3ETJA 4N54A 2WIBA 4ISBA 1FXSA 5H7XA 3WZ2A 3Q8LA 3A4MA 4BUJA 3H8VA 1QGUB 1XCGB 3D7KA 4MJLA 2QPAA 2D1RA 3DMGA 4RVUA 1EP3B 4TV8B 5IJXA 4DRXA 1CNFA 1G7RA 3MJCA 4CEJA 3OFVA 4ZAXA 2XUKA 2FPIA 4X44A 4O5OA 1NI4B 1Q1BA 4KN8A 2GFHA 2C3MA 4GBGA 4NABA 3OQIB 4YROA 4CKBB 4A27A 2DBRA 4G1CA 2ECFA 1HH4A 5IHPA 2P2GA 1BYUA 3S1AB 3Q9UA 1KYWA 1U4OA 3AI2A 3AJ8A 4DXHA 1WEHA 2F1OA 2JLRA 2IXBA 4E70A 4R1PA 1I2MA 4JEMA 2F59A 4Q39A 4C04A 2XVYA 1LX6A 1FDTA 5FI3A 5ED4A 1L7EA 4IDOA 2XVAA 4FONA 3R9KA 4EW1A 3DLHA 3SR4A 5E95A 4LOJA 1Z0IA 5G0WA 3O91A 3N05A 4BN5A 3IC5A 4N7RA 2WP0A 3RSHA 1NW5A 1V3UA 2XCIA 1ZIOA 4DSOA 3DKVA 3VR4D 4RU1A 1P5HA 2R6CA 2BC9A 5DCYA 2H48A 1QHYA 1EKXA 3SEQA 4OCZA 4B2YA 3E05A 4CTJA 1J7JA 2L18A 3IMKA 4C7OB 4OM8A 4EGAA 1BH6A 4R8LA 2GSDA 1Q20A 3B7GA 1ZK3A 1CSEE 3OKCA 2BMVA 5CNKA 1JG4A 2P2SA 1ZMXA 4MR9A 4G4SP 3HWSA 3I28A 3ROMA 4LAFA 1DBQA 2XPCA 1SRRA 2J07A 5IDYA 3RVQA 5FCDA 5CBPA 3M4XA 1R4NB 2CHQA 3HCNA 3CLTD 3HR7A 1FUIA 2BGKA 4LECA 5CURA 4YRDA 3U7GA 3IQDB 4IWYA 3X0DA 2PVSA 1D1SA 3HCEA 1QRDA 4QUAA 1T9DA 1VKZA 2HSZA 3U4CA 4YAEA 3S44A 1W8DA 4G97A 2BL4A 4H18A 4B80A 3EVGA 1T2NA 2HRBA 3IMCA 4G0XA 3O74A 5A4KA 1DSSG 4IR7A 4L4RA 5DBHX 4P3KA 5AKZA 5KJEA 3FR8A 3DR3A 4MVJG 4EKGA 1NW3A 1CZRA 3MHPA 4UQLA 2CZCA 5ENVA 3UAZA 3UZUA 4DVJA 2R6ZA 2CD7A 2Q1WA 1DQNA 1PW5A 1ST2A 1V5FA 1O6CA 3HCFA 3HUUA 4MS3A 5JFOA 2C7BA 2P69A 3UW3A 2ERCA 4QNMA 3C1AA 4OKIA 4KAXA 2OK7A 2PJRA 1J6UA 2IXAA 4EA8A 3A2KA 1R3DA 1Z56C 4X3PA 1QC5B 1U0BB 3K72B 4INZA 5L4NA 3ZNNA 2CBGA 2IJGX 3H5RA 2AB0A 4MEAA 3PEYA 3E9YA 1C4OA 2GXSA 4RAQA 4B4DA 1Y8QB 3GLGA 4IJQA 5HM6A 4IZHA 2QMEA 1RXYA 5FQOA 3E15A 3R41A 4MW4A 2ATIA 2NSDA 2ZAGA 1OPXA 2ZQZA 1R7RA 2IU3A 3HPQA 5AK4A 4ZFNA 4BXOB 3G85A 1GT91 4K81B 3KS9A 2LKDA 3RASA 3ZGNA 3DLBA 2IX9A 3PDIA 1WTAA 1Y82A 4PFQA 2ZI3A 5FL7D 2VZ0A 1QGZA 1QU3A 2C8JA 1QOZA 1JE0A 3LDFA 1YJCA 1IPFA 4FM9A 2IUFA 2OXRA 4R1TA 2CBXA 4DLKA 1LPPA 3L7LA 5AK0A 3CR3C 5HZHA 5LWQA 3ZUPA 2CEAA 2NUTA 2HCFA 3FDIA 1P4SA 4FT4A 1IHXA 2EDCA 1QCDA 2BFWA 1M74A 2MSKA 3GRFA 3UV6A 5K0GA 3UJNA 4M7PA 1QP4A 3CLRC 3I5AA 2VBIA 3NWJA 5I7SA 4DQDA 4OP3A 4LYAA 2OEPA 1RWXA 3B52X 3M4JA 1JFTA 1RJFA 4X84A 2JGEA 3C5CA 2GPYA 2XUGA 4HWRA 5LQSA 3S81A 1OWPA 2ZE7A 2ZRLA 3IHLA 3OPYA 5LDGA 4YAFA 2JD1A 3BFJA 4L50A 4YAGA 3LL4A 3KQNA 5A5EA 2R8YA 3NWOA 3WYEA 1H1TA 1BKSB 2E0IA 2D8AA 2FU5C 4MW6A 2HU7A 4ZYXA 2EX0A 1JHMA 1ZZGA 2F8LA 3E7XA 3H4VA 3KO8A 3PRYA 4HDSB 1OBOA 2AG1A 3R4VA 5GZ6A 1ZRNA 1J25A 1GV1A 2WA2A 1DIHA 3LZ6A 3QMWA 2EW8A 3RFTA 1GGMA 3CPSA 2PQ0A 2PRJA 4OFBA 4Q34A 3VC7A 1LS1A 2MSLA 2CB0A 4G9GA 1BKYA 1XRRA 1SQSA 1TGYA 1UMCB 3G5AA 4M8KA 4RPCA 5CJPA 5KYGA 5KX5A 3HB1A 4PLPA 2ERYA 3Q9NA 2O8DA 5C1IA 3ITDA 1U1GA 3V8NA 3BK1A 3V8PA 1UKVY 1EWKA 3KVYA 4LQLA 4M53A 2O5EA 1HG0A 3A1CA 1TYZA 2OPBA 1AV7A 3G1WA 4PLYA 3P2IA 1GU7A 5CP8A 5DXJA 3CEHA 3TXXA 1JPUA 4EVRA 4ENVA 1BHQ1 2ECKA 1GQRA 2JFXA 3HHEA 3MQFA 2DMRA 1GGFA 1MC1A 2N1BA 2W7TA 3QKRB 1I7QB 4AZVA 1U2DA 1UJBA 5IWCA 5ISMA 1I94B 1OR8A 3PEFA 1F5NA 1OTHA 4F4UA 1TW3A 5C1PA 5AVQA 3UGJA 4M7RA 1OOEA 2YXLA 1Y6QA 2HK7A 2OT3B 3I1YA 2DP4E 3N7AA 4KXVA 2C20A 2P0YA 2DLNA 2A5GA 3WQSB 1NDUA 4W5OA 1MT0A 1Q7CA 3ETLA 3G02A 3LC0A 1B8VA 4GE3A 5ULLA 3H5IA 3BVPA 3ZNPA 1FX0A 5A0FA 4AKGA 3N2YA 4HMOA 1MFPA 3RWMB 4UEQA 3VDRA 4CV0A 5IZCA 4IRXA 1MVOA 4D5EA 4MWBA 3F0TA 3WLSA 2P9EA 4G0ZA 4C4RA 4WN9B 2C5BA 4KSBA 2BDUA 1QF9A 2E18A 2H4FA 4ZOLA 3RTDA 3IVGA 4BO6A 1SUBA 3RHZA 5ER6A 2OC4A 2ZIZA 3RANA 2VCHA 4BC1A 5SZIA 1V1RB 1EDBA 3CCCA 4LHVA 1YJAA 1Q7EA 1ZCJA 3CUWA 3U0BA 1JN0A 2XDAA 3QLVA 1EUDB 3OA0A 3O9VA 4XUDA 4BQSA 4ZJYA 7GPBA 1W5TA 2EKPA 4PTLA 3TSZA 4CIWA 3UUGA 3HR4A 4I50B 2G70A 3WB1A 3CGGA 1JEAA 2UXCB 2EEZA 3EG9A 2BHTA 4IF6A 4J03A 4UNIA 2WHQA 3ADKA 4X63A 1BHSA 5D1HA 5JSZB 2H59A 4GVLA 2QM7A 3WRWA 1L4MA 1UQUA 3LDGA 1R88A 4L51A 4OQXA 4FZJA 5KNCD 1XDWA 2V55B 5LB4A 4B3CA 5KWSA 3JD0A 2W42A 4XQ9A 2WIKA 4E07A 2BGNA 2HPHA 1GM5A 3BILA 3W1VA 3LQKA 3DO5A 4J9VA 1OX5A 3ZD8A 2V1UA 4IS2A 3GLQA 3OJCA 5J2TA 1N32B 3ABIA 4OHOA 2JFWA 3HE3A 4QWWA 1OXXK 2YYYA 3DF9A 4NI5A 3EX7C 4C4ZA 1ZITA 2FEAA 2IYAA 1ILWA 4LRYA 2OV4A 2N0SA 1CF4A 1G8YA 5FBLB 1WVIA 3PG5A 4CIAA 4F1JA 4DREA 1FRZA 3U62A 1CZLA 3R5XA 4DMLA 3JQEA 4URUR 2JBWA 3ZDEA 1RE1A 1T2EA 1M5TA 3OJOA 4BZZA 1LBQA 5EIWA 2I55A 5EI5A 4JUCA 1MPTA 1YRHA 3U3ZA 4AJ1A 2QY9A 3OD5A 1Y8CA 1SAYA 1Z4KA 5WRFA 3SF0A 5DIZA 3GD7A 1VL2A 3QYPA 4CU5A 3T7TA 4JY7A 5KIAA 2QZZA 4JP5A 4DIMA 2PWZA 2V4MA 1O3YA 3PFKA 2AC4A 1FNNA 3V9AA 2GPSA 1F17A 2HF8A 4REQA 3A06A 3OHMA 1D4ZA 2WSSA 3HFGA 3H1AA 4FOSA 3N7UA 4WGFA 5FWNA 3AO0B 2FWAA 2GEUA 3D3WB 4EITA 3WLLA 3NUZA 5JMWA 2XECA 2P0AA 3EA0A 4WV3A 1PZMA 1G21E 1JUDA 2BKVA 4MCAA 3RUEA 1EUCA 3OM8A 1IJBA 4H08A 1JR3A 4MV5A 2ILVA 1MAVA 2V96A 1JYEA 5CXUA 3ORYA 2F9LA 4LI0A 3STWA 3FPSA 4ATNA 5JDCA 3JAMA 2Q7DA 1AU9A 4OP2A 2HFKA 3V8VA 3ZVRA 4F4IA 4CM1A 1JDBB 1AKMA 1GPJA 2Q46A 2DQZA 3C8UA 2PK3A 1LQTA 3QKSA 3RSSA 3IR7A 2WPDA 4PIMA 3SJZA 5ILQA 1WETA 3L8CA 4ROSA 3I6IA 3K6RA 3GNLA 4JB0A 1L5QA 3R74A 3SZRA 3KQVA 1N6IA 2XHZA 3PNBA 4GRDA 5FWAA 4HH1A 1M0TA 1YI0A 3JRNA 3I8XA 4HTAA 4YP6A 4I6EA 2MU1A 4RX1A 2AKEA 3THYB 3PQ8A 1G4AE 3OJXA 1RMTA 2AZTA 1K2VN 2MSCB 2RAFA 3V2GA 3EZYA 5CA1A 4EPWA 5LUAA 4I5IA 5AJUA 3W2FA 4EX7A 1UP4A 3AEYA 5EIXA 3U4QA 3CSUA 1FFCA 1VYTA 4IICA 3X1XA 2ZM6B 4ZQFA 3FUXA 1HE8B 3MT8A 4AM8A 3V1YA 4WXRA 4XDGA 5FPKA 2I7VA 3U7FB 2QL7A 1S5PA 2R6GA 4PC7A 4KXQA 1NN3A 3D8BA 1ZY2A 4N5NA 2JFOA 5K3SA 1YGPA 2NU8A 5DK4A 3LQFA 1A27A 4K9PA 3BGOS 1JHQA 3L1HA 4PCUA 4Y2SA 5DISB 2YJ3A 3PPIA 5DNYB 4OUDA 1FZTA 1P2SA 4NAVA 4DR1B 3KE9A 1Z2PX 4JAVC 2XITA 2GDJA 3NORA 4J9UE 4KVZA 1D6NA 2EF1A 2QBYA 4NNPA 1T43A 1YVPA 3K0SA 1J39A 2XTNA 1ZN9A 3ZHXA 4RDXA 3F6BX 4MAFA 3RUAA 2UUAB 4DLZA 4ONEA 1CJCA 3H5NA 1JECA 3KJNA 4RELA 1QHNA 1C14A 3GI1A 3OZUA 5DBIA 1JQLB 1JAIA 1I3CA 5CXQA 5AHRA 4NJEB 2AC7A 2B4QA 4I08A 2H9AA 3C6KA 2PHZA 5K2MA 2COKA 1EPUA 1JKIA 3BTOA 3HDVA 2D4HA 3HC7A 1QSGA 4GQAA 1SMKA 4IOJA 4TXHA 5BN5A 1PNRA 1UWKA 1KJNA 1WABA 1KBQA 2CE2X 2PA0A 2VZLA 3CG0A 3KB1A 4XKJA 2PUEA 1KVUA 1DEXA 1GRNA 1J42A 2Q45A 2IZ7A 2ORYA 3EXEB 1NE7A 1EXVA 1B0PA 1GL9B 4BNKA 5JR3A 4M8IA 1O95D 4INAA 3FZGA 4MMYB 3OVMA 5DLDA 3B6EA 4GNRA 5IKMA 3UMJA 1EWTA 4RZ2A 4IMPA 3AESB 4OXKA 4FMPA 3HJCA 3COVA 5E9QA 5A62A 1DQRA 2B8WA 5JVDF 1X70A 4V02A 1LJUA 2VSOA 4YJ2A 2CL7X 2PA3A 3N2ZB 4K2AA 1KSFX 2WF5A 4NPCA 4NULA 1IAQA 2PGIA 4NMXB 4YHHB 1TUBA 2PUJA 1RYHA 4O2BA 3VPSA 4BNDA 4UE6A 4RIHA 4R9RA 1JR6A 1SVWA 1XQVA 3OFSA 1T5DX 1JFLA 4QJ3A 4G4SO 4LDNA 4DPLA 1TCAA 2OECA 3N2KB 3HEMA 4O0LA 5M5BA 5EWJA 1KYIA 1VPEA 3D6AA 1E61A 4KDFA 3OQOA 2GHQA 3KC2A 3OCWA 4P4GA 5H16A 4DABA 2HLDA 1AMNA 1Y3DE 1E2EA 2A8YA 5AMXA 1N77A 2AT1A 3QYAA 4TLCA 3S2YA 3JQAA 2ZCUA 4KK4A 5GIPE 2HK6A 3EEYA 4ZVQA 3BJRA 2QX4A 4HMPA 1S2NA 4QLAA 5EKUA 1P62B 5CEFA 2ORED 4JWTA 2C2XA 2Q4RA 3BQMB 3G82C 1NRXA 1VLHA 2BRUC 4M49A 4L8FA 5HKBA 3IV6A 3O0DA 3DLTA 1DDOA 3FH0A 3Q8XB 1RXEA 4KPEC 2ZETA 3TUZC 2IYLD 1PJ2A 4B17A 2RH5A 4PO9A 4IOKA 2V0GA 4EB6A 4WESA 4BNIA 3KU4A 2QD1A 5CB4A 2IODA 1P2FA 4JT4A 1OLSA 4OAPA 3SAJA 3JVDA 1M1NB 2HH9A 5LQRA 1A9SA 5J5AA 3QVTA 2ARKA 2PUCA 2CHGA 1V1JA 1X42A 3MRTA 5ECYA 3OWHA 4RK7A 4F4JA 4C03A 3QPAA 2JG3A 3USCS 3HXOA 5FOTA 1Q0RA 3NYRA 2RG1A 2Q6VA 2Z98A 1VKJA 5JJCA 2QRQA 1CE8B 3B7PA 3GLGE 1EVIA 1MO4A 2DCUA 3EXHC 3PRJA 1MB9A 3ENKA 3IPLA 3K0FB 4L0CA 2BFCA 4QNRA 4A8HA 3OOYA 4OGLA 3RVMA 5HS4A 2V58A 1QNFA 1I0ZA 1UFKA 1H0RA 4XJVA 2JHCA 3TL6A 3P9IA 2G67A 5DULA 2H3EA 3MHTA 3R2JA 4O25A 1KC3A 1CUIA 2FHSA 2RH9B 3QPVA 1U3CA 4XCVA 4XVUA 1P1FA 1BHO1 5IDXA 5ICCA 4JB8A 4YI5A 4FNAA 4R8SA 4MGHA 1GUFA 2J9FA 1XHLA 3KV3O 4M76B 5LBUA 2O8EA 3BGWA 4OOFA 4CFSA 3ZW8A 1UJ6A 1SU4A 5B7QA 1RE0A 4HLCA 3A7DA 4D6XA 1BFDA 4LX8A 2GK3A 3SSNA 3WFZA 4PGFA 2WSSD 3AB7A 1A97A 1KEUA 4YO7A 4M37A 4A4DA 2PRSA 5CDHA 3IPXA 5AKIA 3TLBA 5BN4A 2V0NA 1SZPA 4N18A 2WNHA 3DB1A 2IY8A 4MITA 1XMVA 1E7YA 3EGEA 1DQZA 4DMRA 1YCDA 1F0PA 3T1NA 3EVTA 4LYHA 2I66A 5ALLA 3WS7A 3K5PA 1GPLA 2V7QA 2QLLA 4M0EA 1I3LA 1QIHA 3D6JA 3PF9A 4FGSA 4Q12A 1N9ZA 2AOUB 3FPGA 2ZE5A 3GQBB 3OY7A 1NR7A 2DR3A 4LJ4A 2WPDD 1CQZA 4D9EA <