4OYHA

Structure of bacillus subtilis mobb
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
163
structure length
148
Chain Sequence
FPIVQVVGFQNSGKTTFIERILEKASEQGLNLGCLKHHDRYQAAGADVTAVEGAGVLQLTARRLWDLTRLIELYQFLETDCLLIEGFKKAPYPKVVILSEKEDLEALKTVNTIAIIYRKKEHMTEHQGLPIFHADDPVAVDLVLSQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bacillus subtilis MobB
rcsb
source organism Bacillus subtilis subsp. spizizenii (strain atcc 23059 / nrrl b-14472 / w23)
molecule tags Biosynthetic protein
molecule keywords Molybdopterin-guanine dinucleotide biosynthesis protein B
total genus 35
structure length 148
sequence length 163
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03205 MobB Molybdopterin guanine dinucleotide synthesis protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4oyhA00
4EJSB 4D4KA 4HLDA 1SGWA 3FKSD 4XH9B 1PLJA 2OFXA 3GP8A 1DEKA 2OXRA 1GP2A 3UWOA 1TF2A 1NMZA 2PZFA 5JI2E 4KJZA 3NVAA 1N6NA 1NL3A 4DC9A 4BLSA 1D6JA 2XOKD 4QNMA 4QJ4A 1N0UA 4M0LA 4B3DA 4LJ5A 2FDCA 1Z22A 3MD0A 1WDTA 4B2PA 3RNLA 1A2BA 2HF9A 4BLQA 4B6EA 2HV8A 5FOTA 4Q4JA 3K0FB 2HXYA 4RD0A 1NMYA 1NY6A 2JAQA 5G3YA 2DR3A 1KK3A 1IN7A 1RYHA 4GOXA 3TKLA 5JEEA 1OH7A 1Y63A 1TQ6A 4P33A 5JS7A 1MABA 3LY5A 3Q8XB 2JASA 5EXSA 4GSYA 3REFA 4PSKA 1EK0A 3TJZA 4B76A 2ORVA 3I72A 4KHZA 1KMHB 1OIVA 2RKOA 1N25A 2PLFA 5JBQA 2WWYA 4Q7LA 2J7KA 5DO9A 1WP9A 3ICEA 4CEIB 1KI8A 3VKHA 2VQSA 2ZJOA 1CEEA 2REBA 1E9SA 2W6ID 4TMKA 2ZR0A 4Z8XA 3RRZA 3EG5A 2R6DA 3EW9A 3OIWA 2ECKA 5AJZA 5FPHA 5JI3E 4KBGA 1PUIA 3RC3A 3SI7A 5JFGA 3HJNA 3K0EA 4D0LB 2FFHA 3J81k 3W8NA 3GLGA 2QAGC 2IYXA 2QAJA 1YZNA 4JS0A 2JIZA 3I5YA 5GJWC 2IWHA 3C16C 3QE0A 4HLQB 4F4IA 4JVNA 5DHAA 5CITA 3DMNA 3HPQA 3O8RA 1QG4A 1KAGA 1X8KA 2ZSFA 4L15A 4F4JA 4HAWA 4YMWA 3K09A 5FI0B 4MH0R 4KFTA 3IIJA 2A2ZA 2XTNA 4FI3C 1JEEA 4MRRA 4EKDA 1OF1A 1X8LA 4I81A 4C9BA 3VMFA 2PBRA 3GLIB 3G5UA 4D2IA 2J59A 2V8OA 2PZGA 3KX2A 4R7ZA 3SJZA 5EP4A 4DDWA 1E2FA 1P2TA 4HDCA 1JAIA 2KJQA 3CPJB 1OIXA 1WQ1R 3TIFA 2GTPA 3RLFA 1GOTA 4Q4JB 3K70B 1RPZA 2CE2X 1KJZA 4N0EA 5KUTA 2BV3A 3ZIAA 2RGDA 3KKQA 4DB2A 2AWNA 4MDFA 2I1VB 2FSHA 3CRRA 1MH1A 2GDJA 4F91B 4I4LA 1XZQA 4C0LA 3KQUA 2C9YA 3BORA 4N0DA 2NTYC 3TAUA 1SXJC 3X1ZA 2FN4A 1KMHA 1YZQA 4IHQA 2WM9B 1E79D 1G6OA 4IDNA 1T91A 5FPTA 1JPJA 1XEFA 3AKYA 4LJ9A 4ZDIA 2CK3A 2GRJA 3FYHA 2O52A 5JSZB 1RYFA 1AKYA 1TPZA 1Q57A 4OK6A 3NTUA 1Z47A 2JJ2A 1E94E 5AWFC 3EWAA 5P21A 5KYKA 3A36A 4TWZA 5JJIA 3TNFA 2RCNA 3DEFA 4UNRA 3DKPA 3IQXA 5J4YA 2JDID 5SZIA 1XF9A 2BEJA 1E1QA 1G3QA 4O0MA 4Z54A 1R0YA 3SHWA 4DWJA 4QBHA 5TMPA 3EPKA 2DCUA 1NBMD 1HV8A 4V0MA 4FWTA 4LBZA 3PUZA 3PEWA 5A4JA 3L0SA 3NHBA 1T6NA 5DH9A 4U5XA 2C78A 3T1QA 1S3SA 4KVGA 3RSLA 3VHLB 4A2QA 4H1UA 4OQFA 1NI3A 2ORWA 3KKOA 1KSJA 4E09A 4RD4A 1XJQA 1A82A 1W1WA 4K8OA 1AIPA 4OHZA 1E9CA 1Z2CA 4O25A 4Y0AA 2WWGA 2EW1A 1WF3A 4TLCA 2XX3A 2J0UB 5J4HA 2J7PD 3VR4A 1ESNA 1KO5A 1TNDA 2XJ4A 2CL6X 5CJPA 3QXHA 1B0UA 2BBSA 2V6IA 3QSYA 2GXQA 3AB3A 4QBIA 4XVUA 5FL7D 4L5BA 3K9GA 2JJ1D 4HZUA 4KSBA 4DCVA 1DO2A 2ZXUA 4A1FA 3WP0A 8OHMA 2G0NA 2CEAA 4QBGB 1F2TA 2ZTSA 2IW3A 3PEVA 2JDIA 4A6PA 4ZO4A 2KBFA 4MQBA 4XWAA 1RRPA 3CX6A 3Q5EA 1EFCA 4FWIB 1G8YA 4RKEA 4A0RA 2OE2A 1I4LD 4JLAA 4L9SA 1UPTA 1JQJC 2BMDA 3M4YA 5L8VA 2YV5A 4Q1EA 4Q03A 3MWJA 1QHXA 1YR9A 3UK6A 3VNUA 2NZJA 5E7JA 4DCSA 1NMXA 5JCZA 3ASZA 4B3FX 1E1RA 4TL9A 4ESVA 3OEED 2YJTD 2HT6A 3B1ZA 3RYTC 3DL0A 1V5WA 3WNCA 2RGCA 5KSPA 1U98A 4LJ4A 3U7HB 2VLIA 5FOWA 1XFAA 4DZZA 4OL0A 1QHNA 4MKFA 4R9UC 2OEPA 5E7IA 3VX4A 2ZJ8A 5FH9A 4A36A 4RD1A 5H1YA 2JEOA 2J0VA 2WOOA 2F1RA 2JLQA 2JJ2D 3MWKA 2WOJA 4JZKA 1VKJA 1DBSA 1UBCA 1ZP6A 3SEAA 1LS6A 1SKYB 5EXPA 1US8B 1XTIA 3AF2A 4P4TA 2JJ1A 5K8LA 2GVDC 1KI9A 4GI7A 2P5SA 2VA8A 3R20A 1YRBA 2G3YA 4DIDA 1CLUA 4DKXA 1OB2A 4XJXA 2JLSA 1KDPA 4MGKR 3WRYC 2F43B 1OXUA 1E2LA 4XWOA 4Z51A 3WMFA 2VHUA 3VR6A 3CR8A 2D3WA 2J1LA 2UZ3A 3PQCA 3VKGA 4IDQA 1AS0A 2NO0A 4RKFA 3THWA 2REXB 1GL7A 3CX7A 4W5WA 2FNAA 2HDNB 4IKEA 4A0HA 5FBLB 3MRSA 4PTLA 1XEWY 1KDOA 1Z6GA 4RZ2A 1ZNYA 1N2CE 3U4QB 5EXXA 5CJ2A 3KXKA 2BJVA 4HUTA 4UNNA 1G20E 4ZDWA 4MUAA 4ZKDA 3MWLA 2WSMA 2QTVB 3EARA 1HT1E 3SS8A 3R7WB 4MGYR 3C4JA 1LB1B 2GZAA 3LBHA 4LC1A 1HURA 4NH0A 4CVNA 4WW0A 4MYUA 5GADl 2PT7A 3IDQA 4EPXA 2YYZA 4RSGA 1W4BA 3CF2A 3CNLA 3ETLA 1G7CA 1OB5A 2OO7A 1VCMA 4NYMQ 2ZREA 2NO9A 4BE7B 4OQLA 5DSZA 3E70C 1ZD1A 1C1YA 4RCZA 1W46A 1YR7A 3B13B 2XXAB 4Q9KA 1M7GA 1EWRA 2OBLA 3DHWC 3NH9A 4QG7A 4R2IA 3VQTA 1IY0A 2D7CA 1S0UA 4ZIRA 1G19A 2ONJA 5BYKA 1SVSA 4IRUB 4XOIA 1OH8A 4D81A 4NPHA 4URYR 4RFVA 3ZVNA 1VG8A 2P6UA 2XNDA 3NIBA 2OILA 2ZRKA 5KNDA 4OI4A 4LPKA 1H8EA 4AIIA 3BJIC 2N42A 2IF0A 1TQDA 2L0XA 1XEXB 3WMEA 3TVTA 4BLRA 5KDOA 3WNDA 1FX0A 2ZRBA 2D2EA 2Z0MA 1R2QA 2R62A 4PFSA 1J70A 4DHEA 1EFRD 1X1RA 3S1AA 1XEXA 4A0GA 4KITB 4V03A 2ZAMA 5TARA 5EE1A 3W6PA 1YJ5A 1IXZA 1JI0A 5HE8A 3FHTA 5FPKA 3VTKA 2CBZA 5JSZA 5CDFA 3AVOA 3ASYA 4TLDA 5EE3A 1XTRA 1VIYA 4JLPA 4QHSA 1ZW6A 4CW7A 1MOZA 4I99A 5D3MA 5SZJA 2IYTA 4A15A 2X8AA 1W5TA 1HEIA 3W6NA 4ASUA 3PUYA 4Q1BA 3QOFA 3L82B 4HATA 1CR1A 5E7MA 3KJIA 3G0HA 2LKDA 3X1WA 4RVCA 821PA 4XTCS 3B1XA 1XTJA 4QGFA 4G5OA 2UZIR 4RZUA 3I4LA 4JKYA 4EPWA 1WBBA 3AVYA 4V0LA 4JT4A 5CK5A 4PC2A 2GCOA 4M8NE 4QBFA 2IX3A 2ONKA 3KFXA 1E9AA 521PA 1U99A 5DGXA 3N2IA 1L4YA 4PSAA 4HYYA 4PQYA 4AKHA 4E03A 4POAA 3OFND 2GVZC 4B75A 4X8OA 3EZ6A 3T5GA 4KU4A 2BMEA 2WJIA 5SZHB 3GJ7A 2GBLA 2OCBA 4G1UC 3TR0A 1F48A 2VHQA 3FMIA 4Q7JB 4AK9A 1KDRA 2WJJA 2ZITA 2J0UA 2X1VA 3GJ0A 3ZJYA 1OSNA 5FTKA 1COWD 3MWYW 3D6TB 2WTUA 2BM1A 2RMKA 2CNWA 2A30A 4AYTA 1R4AA 2R6CA 3AP1A 3PCRB 1T0HB 1Z83A 3GJ4A 3NDBB 1E2IA 3ZQ6A 3JVVA 4URWR 2RGGA 4BWYA 3M0EA 4Q21A 3AKEA 3I8XA 4XVRA 4HAXA 3VR3A 3T15A 1Z6TA 2CVFA 3AVXA 3W5JA 3EPHA 1F60A 3K9HA 3GLIA 2YINC 3U3KA 3T35A 1XPOA 1AA9A 1XMVA 4CZ2A 3RABA 2R44A 3GFOA 4P4UA 1FW6A 2OFOA 3ZIAD 3GJ3A 4EQ6A 3V9PA 1W7AA 1K8RA 3P4XA 1J99A 5J47A 1J90A 2ZS8A 3TQFA 3PIRA 2GHIA 1Z8FA 2ANBA 3CRW1 3L8YA 5E95A 4GL2A 4MYHA 1S96A 1YE8A 1VCOA 4JL6A 1DTSA 4TT3D 4Q1FA 3T5DA 3OHMA 2GCNA 4A2PA 1OW3B 4ACBA 1G5RA 2BIFA 3PUXA 3FFBA 1LY1A 4KFSA 3R8FA 1GRQA 4MGIR 1UKEA 3WY9A 1SVLA 3LNCA 3NBYC 1Q12A 1VPLA 2QUZA 3FGNA 3HWSA 4GPTA 2VEDA 1ZRHA 3FKQA 4PAOA 2NOAA 2H5EA 2EFGA 3MMPA 4ON9A 3HP1A 3RWOA 5B57C 4Q02A 1KIMA 3GLFA 3TSZA 2NIPA 1ZU4A 1NVXQ 1R5NA 1E2HA 4PC7A 1Z63A 2RGBA 1XBTA 2IS4A 1CBUA 2DFTA 4BZQA 1G8HA 2ZE5A 1E2GA 1P9NA 2GAAA 5KU1A 4TSFD 1N5LA 4URUR 3TH5A 3TLXA 2C98A 2F3RA 2B92A 2Z4RA 3SHFA 2QP9X 2H17A 4DBLC 2XJ9A 5JWOA 1DG3A 2ASEA 3UANA 4TYYA 4Q5IA 1LFDB 2GK7A 4TN1A 2AHOA 3GQBA 3SJCA 4LGMA 3U4QA 4X8HA 1SVWA 3A8TA 4R2HA 4RD6A 3SFVA 3BRWD 1FP6A 1OXTA 5HZKA 2GJAA 1GRNA 1G3MA 2VYFA 4F38A 1S1MA 1NJFA 5CLQA 4PO9A 5EQTA 1XWIA 2ZETA 1AK2A 3LVQE 2P6RA 1EX6A 3IUYA 3IBGA 2ODEA 4C0JA 4TMVA 1RW4A 4B33A 3Q3JB 2X19A 3EZFA 5CB8A 4B74A 3R9XA 4LJ7A 2NG1A 2XTZA 2IF2A 3ZYCA 2Z43A 3FKSA 2JLXA 2FZ4A 3HYTA 1P5ZB 4OQMA 3RS2A 2XXAA 1GL6A 2GETA 4MA4A 4MKIA 4NCHA 2VF7A 3HDTA 4PC3A 3KB1A 5DI3B 5EXTA 4YXWD 4ZCIA 4M9QA 2N46A 2IC5A 2AKYA 2Y8EA 2O5VA 2EFCB 4L9WA 4WXRA 3DVLA 3I61A 1E2QA 2F1JA 5DYGA 4DLYA 2NMVA 4P4SB 1P2SA 3SNHA 3EPLA 3GLIE 2DFNA 2ZJAA 4NMMA 5K8TA 1JXMA 2QGZA 3F8TA 3GLFB 3LAWA 4D4MA 1EG7A 4HAUA 4BFZA 3I92A 2RGAA 2VSXA 1E32A 3B8HA 5LDDC 4U7DA 4C7OA 1X1SA 4M1WA 2Q9BA 2FFAA 2CL7X 1WE2A 1U0LA 3NDPA 3U44B 2VHCA 3GLHB 5C4MA 2IXFA 4LSGA 1NJGA 2EWWA 1LTQA 1Q1BA 4GOJA 4EJSC 4TYWA 1JR6A 2MSDB 1KO1A 1TEVA 3K0FA 3OEHD 2AK3A 2EWVA 2VH5R 2AL7A 2R65A 2VIIA 2XNSA 3QEJA 4M1KA 1U94A 2PMKA 1QG2A 4HZUB 4N1AA 1E1RD 1VYTA 5LD2C 3I1FA 2QSYA 4RZ3A 2ZU0C 1E2EA 5B2ZA 2Q9CA 3BD9A 3QKSB 1CR2A 1OPXA 1SQ5A 2GESA 4LJYA 2NO6A 2Z4SA 1MT0A 1KJWA 1GWNA 4BFSA 1NIJA 1CTQA 1XB2A 2J45A 2GAOA 3KKMA 3BFXA 3QVUA 4LX0A 3QI2A 1DAMA 3L0PA 3SU8A 4IJMA 2IUSA 1BIFA 5DIFA 2PL3A 1DADA 3QIAA 4C0SA 1TAGA 3ADDA 5LBIA 2BBTA 2WHXA 2WBLC 4OBEA 5JWRA 5FUYA 4BEBA 2W00A 1XMJA 3LO5A 5C46F 4WIAA 1AQUA 1MRNA 2GCPA 3CH4B 3W3ZB 5ELXA 1XCGB 1CXZA 4PPFA 3BC1A 3D3QA 2QT0A 2FG5A 1IN8A 2A5FA 2J41A 1Q44A 5HZHA 5FUWA 5AJXA 4CT4B 3KB2A 3T1OA 3I32A 1N5JA 3HU3A 3MSXA 3AV0B 4BLPA 5JHHB 1WBDA 3PVSA 3RWMB 5CM9C 2ERXA 1XP8A 4ZCLA 1IN5A 3PENA 4JLKA 4M22A 2OLKA 4AURA 4B44A 3EZ2A 4JLOA 4QFMA 3AF0A 5BN3A 5BQ5A 3BB3A 5IK2D 4AC9A 3GJ6A 3QNUA 2FE4A 3L8ZA 1ZUIA 2RAPA 4JVSB 4B3GA 1E98A 2OXCA 2B7CA 4EFNA 3NC0C 1KDTA 1XX6A 2QPAA 4KLZA 4LJAA 2RGXA 5L3SB 1WXQA 4ESHA 5LB4A 2WKPA 4LYJA 1GITA 1GSIA 1LW7A 2IYVA 2VP2A 2ZR7A 4U02A 4BGDA 3ZD7A 3CPEA 5JCPA 1U0HC 3A6PC 3RRNA 1AM4D 3K0AA 4FCVA 2OV2A 4HAYA 1NNEA 1BMFD 1KOFA 1Q1QA 1UKYA 3DZDA 1NBMA 4QJ5A 4TMZA 3W34A 4YMVA 3THXB 2G83A 2Q9AA 5BW8A 2ZSDA 1KJYA 1ZMXA 1GM5A 2QSZA 1G4UR 5JLJA 1IXSB 1M7HA 2EFEB 2ZU6A 4C2UA 2B21A 4AY2A 2CHGA 4C2TA 1W4RA 1E2MA 1SKYE 4LV8B 5KNBA 2ZS9A 3DKVA 3LW8A 2BM0A 4DT1A 3Q7QA 1Z0JA 3K1JA 1OYYA 4QGAA 1G5PA 4M1MA 3LLMA 3QENA 1UBGA 4PZZA 2GJSA 3CRMA 3I5XA 3THXA 5L3VA 1F3OA 3KJEA 1JQLB 3I62A 5CIWA 1SKQA 1T9HA 2ZI4A 1IHUA 2VBCA 2ZRCA 5FTMA 5JJKA 4V0KA 2C99A 3IHLA 2YKGA 1QDEA 4Q7MB 5AUQA 1VTKA 4CIDA 4PZYA 3NXSA 4PC6A 4KXFB 4XIGS 1DE0A 3C8UA 2MMGA 2ZJYA 1DVRA 1Q1ZA 3B5JA 1N5KA 1GNRA 1F2UB 3OIYA 1XTKA 5TB5A 2OAQ1 2FEOA 4IW3B 3P26A 4OJKA 3A1SA 4Q4AB 5EZ6B 3GFPA 2I4IA 2XEXA 5AJYA 4P31A 1IN6A 2WVJA 4FD2A 5FPYA 2O8CB 4LHXA 2W83A 1KSGA 1HT2E 1II0A 1HH4A 2UKDA 4A92A 1P4SA 1Q21A 4YMUA 1P62B 2FZLA 2N1BA 2CLCX 4DDUA 1XJ0A 2VP9A 1U9IC 1D2NA 3KDSE 3UG6A 1FOEB 4WXPA 1N0WA 3A37A 5ANRB 4DUGD 5J4LA 3B7GA 5HPYB 1XU4A 4RJLA 1CRPA 4QKQA 4PPQA 2ZE7A 3LD9A 1EWQA 4HLUA 3AH8A 3Q5DA 2IK8A 4DLWA 2O8CA 2DBYA 2G88A 4Q1AA 4NCKA 4CDGA 3IIMA 1T8TA 3NG1A 4D0NA 2Q3MA 1WRBA 2AFHE 2K5UA 3A1TA 5LPNA 2H8KA 5J4VA 5DI3A 1KNQA 1NP6A 1W4CA 2FWRA 1P2UA 1GKUB 3SJAA 4PAQA 4Z8YA 4NCIA 1JPNA 3AGPA 3MCAA 3TUZC 3EAQA 4NU0A 5B30A 2GA8A 4XD7D 4QM7A 1W36C 1ZM4A 1Z0AA 2OSBA 1ZC4A 3FFAA 3LRPA 4EPYA 3LV8A 1JAHA 1Z0FA 1XPUA 4Q4HB 3THYB 2DWOA 1JB1A 1Z0KA 3SDZA 5EP1A 1NVVR 1R8QA 4HI0E 4OQXA 4NKRA 1DOAA 2VP0A 1OLOA 1O87A 3FDIA 4CT5A 1ZUHA 1G8FA 4Z1MA 3TVDA 4MDEA 2ZSAA 3QPUA 1OT3A 3EC2A 2W6IA 3FHOA 3KTAA 4BZXA 2O8DA 1J8MF 4D26A 4AWXA 3GJXC 2VP5A 5IRCD 1G5TA 3KUCA 3F3YA 4AKGA 1CJUC 1ZIPA 2R6FA 1U90A 4BZPA 3BH6A 1T5LA 3EXAA 2IYQA 5EUQB 2A5YB 4EFMA 3VAAA 2MMCA 5DLQC 1SHZA 2J7PA 3BBPA 2WMOB 1DAFA 2PZEA 2F6RA 3ND9A 3FMPB 5HTKA 2WWHA 5F9FA 3QF7A 1QHSA 1E9EA 2PT5A 1NN3A 3BERA 4GRAA 2DY1A 1ZINA 2I3BA 5LB2A 5FTJA 2HYDA 3F0TA 1S3GA 1E0JA 1OJLA 2CCJA 2JLWA 2QBYA 1ZCBA 2ZSEA 2ZRFA 2GJ8A 4DLSA 5FR1A 5JRZA 2V1UA 2R2AA 2WAXA 3SOPA 3H0KA 2A7QA 1K6MA 1VCIA 5FUVA 1HQYE 3N5CA 1XJCA 2QPOA 5FUXA 4FIDA 1SXJB 3LQQA 3WP1B 1RC8A 1KI1A 1ZIOA 5BN4A 2FSGA 1N6HA 1XD9A 3SC3A 1EFRA 4MRPA 2W6JA 1RJ9A 4PHHA 1CU1A 3EIEA 2YC2C 5JJLA 2IBMA 4M21A 2DPXA 2JIZD 1JR3A 1VG1A 2JJ8A 2KBEA 4UXIA 2BCJQ 3BIFA 1M6NA 1RRGA 1VG9B 2BMJA 4DSNA 3VU9B 1Q20A 3SQXA 1DS6A 3CZQA 3L2OB 4QHTA 1T8UA 1K5DA 1IY1A 1KAOA 3N70A 2BVNA 1FNNA 2LWIA 1XTSA 2BHRA 3LVRE 4P0TA 4DVGA 1EFHA 3ZZUA 3WYFA 1GIAA 1SZPA 3NKVA 3RS5A 4TTRA 1R0ZA 1E2NA 2WWFA 3KQLA 2OFWA 1N3BA 4UXHA 3EA0A 4DEXA 2FPKA 2QZ4A 1CF4A 3CH5A 5EJEA 5TXGA 2HUPA 4K81B 3CB4A 1KK0A 2GWHA 3AF3A 4DEYA 1RVDA 3X2SA 3ZGXA 2AR7A 2IS6A 2QRZA 4WZ6A 5FTNA 4H9GA 5TV2A 3RC8A 2AD1A 2GEVA 4Z1MD 1YZUA 4A6XA 2BBWA 4KAXA 4MKHA 3NWJA 4B47A 2R9VA 3SR0A 4EAQA 2WKRA 1TTTA 1S4QA 2O0HA 1IN4A 1XCPA 3B1WA 4FMDF 4QNRA 5H68A 4EPTA 3VFDA 2D4HA 2G6BA 3H1TA 3D31A 1GDDA 1N6KA 1YKSA 1P75A 4Q7KA 4D80A 4OK5A 4Q47A 2RGEA 2ZSBA 1GNPA 3PJRA 3D8BA 1G7RA 1MV5A 1GKYA 3WMGA 1DAEA 2IUTA 4FN5A 4G5RA 3R7WA 2JLYA 1X86B 3B78A 3QJYA 1F2UA 5FOSA 4M2LA 5KPDA 5A5GA 1W44A 4Q00A 3TQCA 3C5CA 2PCLA 4L8GA 1A4RA 4JJZA 3LFUA 4AYXA 3E5HA 4I1OA 2DFKB 3WRXC 4Q18A 1Z07A 4EQ6B 1L7VC 4G5SA 1FP7A 1LVGA 3LA6A 2H92A 1E1QD 2ZROA 4E22A 2G1JA 1ZD9A 2O8DB 5GJVC 2O8EA 4M1SA 4XSGA 4LJ8A 1E9FA 3GFTA 4GNKA 3GJ8A 2FSFA 2BBOA 2V1XA 1KI2A 4CEJA 4WVFA 1J7KA 3CNNA 3PITA 4TLAA 4B3CA 4BEJA 1U0JA 4CYMA 1W36D 1R0WA 3IKJA 3CO5A 4JMPA 4N3NA 5BYJA 4BFTA 4BECA 1GTVA 2IYRA 2YHSA 4CEHB 2ZPTX 3TUJC 2HEIA 1NVVQ 5C4GB 2QN6A 2QP3A 3CBQA 2P6NA 3EZ7A 2WJGA 5AUNB 3OAAA 3EA5A 1UADA 4HSEA 2FFBA 4FMCF 3PFIA 1QHYA 2W0MA 3TW4A 3DMDA 3K0CA 5JEDA 4D0GA 2QU8A 1II8B 1GAJA 4TL6A 2V4ZA 4M1YA 3U7GA 3B82A 2EYQA 1I2DA 1G7TA 2IYLD 2XTMA 4LBVA 4I1SA 3TSWA 3ZS9A 4G0NA 3K0CC 3QG1A 2OESA 1E2PA 1VMAA 3LWNA 3VR1A 3UG7A 2XSZA 2CLDX 2P3SA 5UKDA 5LD2B 3RAPR 4P3YA 4BUJA 1RJ9B 1W2HA 5DN6A 3SN6A 3T34A 1EESA 3T61A 1D8TA 5C1BA 1R6BX 3LBNA 4ZIRB 1KSHA 2WMNB 1ZM7A 1N6OA 1TUEA 4F92B 4HEJA 4W9MC 2HCJB 4BFUA 2A9KA 2TMKA 5KSZA 3V00A 1E2DA 2PH1A 2CXXA 4TYPA 3RVBA 1TEXA 4M9SA 3LXRA 5EE9A 3ZS8A 2F1IA 1RIFA 1VECA 1E2JA 3SFZA 4UNPA 2QE7A 3O47A 2GNOA 2ZYTX 3KUDA 1Q3HA 2WIAA 1CJMA 5FR2A 4GZLA 3K9NA 5H8WA 4TTPA 2PEZA 3LX8A 721PA 1UBFA 1HQCA 2VP6A 4IXNA 2FH5B 4NE2A 3REGA 4WOPA 2OCPA 3LLUA 2FJUA 4B73A 4OKSA 4TMWA 4ZDJA 4D25A 4A9AA 5CYOA 5TY0A 2F1HA 1WA5A 3OF5A 2X2FA 4JYBA 4KI0A 1TUIA 4FMBB 1W5SA 4C0QC 1F5NA 3TGPA 4DLXA 4Q1CA 1D5CA 3RSOA 2ZRMA 2ZQ5A 5GJCA 1G4AE 2FX3A 1MRSA 2LKCA 2OM2A 5B64A 3PEUA 2XITA 4I1UA 1A5TA 2CHVA 2IEZA 4NBSA 4PHFA 2GZHA 5DHFA 4JLVA 2ZRNA 4KVAA 2BEKA 1ZVQA 2H1LA 1U2RA 3EIHA 3GPLA 3BB1A 3U2QA 1UKVY 3MGCA 2QA5A 2HXSA 4OYHA 4J0QA 4IEEA 4MRNA 5JECA 3L0OA 3U60B 3BGWA 4JBYA 1UEJA 2C04A 5KPJA 4EDHA 4DSUA 2XZLA 3H86A 4YQFA 2V9PA 1DPFA 2ANCA 1U8YA 2XNDD 1US8A 2ZYUX 1U8AA 3I8SA 3K09C 4LHVA 4X8LA 4URVR 1M74A 2QM7A 4DCUA 2BCGY 1KTVA 4B71A 221PA 2NZ8A 4NTZA 4KCGA 1W4AA 2YWHA 2ZJZA 1ZUNB 3SYKA 2D62A 3U44A 2IS1A 2KI5A 2WWWA 5D3QA 3QG5A 3CR7A 4PO8A 2XOKA 3T1TA 4NDZA 4C7OB 3U3OA 2IYWA 3GLGE 4CEIA 1JNYA 1QVAA 2BOVA 3SBDA 2GBLC 2ZM5A 4DLVA 2ZI5A 4PZLA 1Q0UA 1WMSA 3H4MA 3L0IB 2QG6A 3A58B 5L3QA 1MO6A 1S9HA 1XPRA 5FBVB 4V0NA 5JZVA 3DOEA 3IBYA 1OE0A 2YZ2A 2OG2A 1RFLA 2GCOB 1YR6A 1OFTA 2HLDA 4UNQA 3W8RA 1S1CA 2P2LA 1OXSC 2AFIE 3K70C 4OI2A 1E69A 3QXSA 5DE3A 1QRAA 1TF7A 3BFKA 3T12A 1ZC3A 2PLRA 4DLUA 3VHXA 4CF7A 1LNZA 1YZLA 2ZI3A 1T3HA 2RGNA 2VSOA 3LQRA 1UKZA 3IEVA 2C9OA 1WCV1 4TSFA 2J3EA 2EFHB 2ZYVX 2CLSA 1HA3A 4PHTA 4DSTA 4PQRA 3NBZC 4OJQA 2FU5C 4EIWA 3Q9LA 1HE8B 2J46A 1Z6AA 5DYIA 4ZKEA 2CHQA 5AR1A 1S9DA 1KYIA 3PV0A 1IQPA 3W3AA 5HCIA 1NIPA 3WBKA 2EVWX 4GOKA 3HU2A 4D4JA 1X3SA 2FFQA 3DDCA 1DARA 4JLMA 4YDSA 3VX3A 5IT5A 4C0KA 4XD7A 2IA5A 2F55A 1TF5A 1ZBDA 4ARZB 3S1AB 1LF5A 2P0EA 1NLFA 1MO4A 1SVMA 2JGNA 1PLKA 4MITA 4A8JB 4DB4A 1CS4C 1NSTA 4TL8A 1NBME 3B85A 5FOXA 2JA1A 3C7KA 1II9A 5AUOB 3CX8A 4IOMA 1Z28A 4M1OA 1ANKA 1GNQA 4YLGA 3NC1C 4C30A 4IFEA 3B1YA 2O8BA 2MSCB 4JSYA 3BXZA 4X8MA 2G1KA 3KJHA 1IJFA 2ZRJA 2QMEA 3K0SA 5KDDA 1YHNA 1GUAA 3K0AB 2ATXA 3FB4A 2JATA 3OFNA 4K46A 3KKNA 5CDFE 1RRFA 2YOHA 2AXNA 3ZVLA 3AUYA 4G3XA 5EP2A 2YC4C 3C15C 3KTAB 4OHXA 5FOUA 3UPUA 3U5ZB 3U6KA 3GMTA 1FMJA 1E79A 1ZAKA 1FTNA 1PLLA 3HR8A 3O8BA 1K5GA 3NHAA 4G01B 4LI0A 4LJ6A 4TLBA 4Q01A 4XSHA 2QEQA 2WJYA 1DELA 1COWA 1UBEA 1KO7A 5CIQA 4IFBA 4IVRA 2FA9A 2HLDD 4JVMA 4URZR 2HT1A 4US0R 1W0JD 2C77A 2V7QD 4IDOA 3BH7A 1MR3F 5HKKA 2ZRHA 5E4FA 5GJBA 1II8A 1H8HA 4B2IA 5G3ZA 3HR7A 3ZZ0A 3EASA 1RKBA 4NYIR 4CGZA 2F9LA 2FSIA 2VF8A 2QP4A 3TBKA 1YQTA 1W36B 3C41J 4ARZA 3FTQA 2W6JD 2ZRLA 3AP2A 5E3HA 4IOKA 2WZQA 2AD5A 3QKRA 4E5UA 1KK1A 2NO1A 2ZUCA 1P2VA 4C4PA 1VHTA 4RY2A 4OK3A 3ICQB 1TQ2A 2REOA 1OV4A 4LDJA 3WYAA 3R8CA 1ZM2A 3AP3A 2CL0X 4IVPA 4WBSA 1FMLA 1G9XA 2QTHA 3P4YA 2GK6A 3TW8B 1SXJA 5JHGB 2ODBA 3R9WA 4IDPA 4JYCA 2WAYA 2CJWB 4PAMA 3CRVA 2ZJ5A 1XDBA 4JIMA 1P60A 1QHGA 3Q85A 1LV7A 2BKEA 1V43A 4ERNA 1D2EA 2GXSA 3U61B 5FL7A 1FQKA 4JVLA 4FCTA 3RRYA 1CULC 2GEDA 2PMDA 2J87A 4GZMA 4AKIA 2YWFA 1W0JA 1VDZA 2Q3HA 1KK2A 1E2KA 2V7QA 4NCNA 4YDHB 2H57A 4QGGA 1Z0IA 2C95A 1R7RA 4JLJA 1OXVA 4NP6A 1FZQA 2OZEA 3VKWA 3UWKA 4BASA 4Q66C 3WHLA 1PJRA 5F3WB 1CJVC 2VP4A 4IEIA 4LPSA 1HYQA 2GXUA 1F6BA 2WIBA 1AZTA 4B3XA 3P32A 3AF1A 5FPSA 3ZQJA 1AGPA 2DYKA 1TX4B 3QPVA 4WZAE 3IGFA 3KL4A 1QHHB 3B60A 4JT2A 4RCYA 4NL4H 4M1TA 1Z06A 1KKLA 4QC2A 4RFSA 1IY2A 4KFRA 1DG1G 5C18A 1E96A 4XWKA 5AJWA 2G9NA 4L16A 3DO6A 4ZI2A 1QZXA 4P4SA 4FCWA 5M04A 3FE2A 5AUPB 3OIUA 2UVQA 1NY5A 3THWB 1KI7A 5G53C 3QPWA 2ZRDA 1ZYUA 4US2R 3SBEA 1KO8A 4LYAA 4QGHA 5CLLA 3GLFE 1J2JA 1L8QA 1OFIA 1T3LA 5IDVA 1VG0B 1RZ3A 1T3SA 3DM5A 5DNYB 4RZXA 3BK7A 1G41A 1SHKA 3EWSA 1M7BA 3NEYA 1ZU5A 1AQYA 4BQSA 3SQWA 3MFYA 1G64A 2ZEJA 5EE5B 2WSSD 2ZANA 5KOYA 2PEYA 3PEYA 3VR2A 4B48A 2C9CA 1OHHD 3WYGA 3AQ4A 3U3MA 3TE6A 1G3RA 3TRFA 3IPYA 1NG1A 4BLOA 4HLCA 5KO2A 4JBXA 4YXWA 2R6AA 3OEEA 2IWRA 4BRWA 2IYUA 2QRNA 3CNOA 1JJVA 1E0SA 4PO1A 2RB4A 1KI4A 1D9XA 2QMOA 4Q9JA 4WAUA 3GEEA 2QI9C 1FFHA 3TAHA 1FUUA 2JCSA 2C2HA 3TK1A 3UMFA 4NHOA 1DAGA 1SXJD 4GFDA 4YMSA 4DT1B 1BYIA 1A2KC 1QHHA 2OHFA 3OE7D 1XXHA 3QKSA 1OFUX 1TADA 4ITRC 3GEHA 2Q0HA 621PA 1UF9A 2ZVQX 2E1RA 4HAZA 5DI9A 2D7DA 1TQ4A 4KYIB 4OI0A 2QENA 4MGZR 5CM8B 3FPAA 1XD2A 4LV6A 4HB3A 2DHRA 5CYPA 4MRVA 3UIEA 2JLVA 3B9QA 5EZ5A 3QBTA 4XTRA 5FOVA 3B6EA 3UMSA 3RRMA 1KMQA 4RD3A 4LBWA 5L3QB 1UEIA 1ZJ6A 2JLUA 1AS3A 3NBXX 4C0AC 1GG2A 1NRJB 5C2JB 3P1JA 3RS0A 2QY9A 3FOZA 2ZE8A 1GVNB 3Q72A 2D74A 4MKGA 3DOFA 3B2EA 2YNMA 5JS8A 1XXHB 5FI1B 1XMIA 5TDHA 1DO0A 3O8CA 4G5GA 1S2MA 3QUSA 4FW9A 3WHKA 2RHMA 2V6JA 1XRJA 4AG5A 4HLUC 4DCTA 2QMHA 1CP2A 3GCGA 1EFTA 3FVQA 1D9ZA 1QBKC 2B8WA 3C14C 4MUBA 1MKYA 2E9SA 3OE7A 4W5HA 2WJHA 3DZ8A 4JLDA 3UXMA 2MSEB 2F9MA 3WBJA 1L4UA 1G291 2AWOA 4W7SA 1M34E 2X2EA 2H18A 3MUFA 3AVPA 4D6PA 1R5OA 1XZPA 4HAVA 2WPDA 3ZVMA 1N6RA 3JVUA 3ZD6A 4HZIA 5F98A 2IL1A 2YOGA 4EUNA 1Q1EA 5CK4A 3AGQA 2Q6TA 4B43A 2EQBA 4HB2A 5JWHA 1ODFA 1T5IA 1BMFA 4DXAA 1GILA 4PQFA 4KV9A 1BH2A 2ZI6A 1KO4A 1ETUA 4PR0A 3IQWA 4QXAA 3RS3A 3AUXA 1R0XA 3ADCA 1A1VA 4LYFA 1JALA 2VL7A 4O2RA 3ADBA 1ZM3A 1E0KA 3GLGB 3IHWA 4JL8A 4V0OA 1GZSA 3X1XA 3AKDA 2A78A 1U8ZA 2O0KA 2J0QA 4M53A 2ZIAA 3KFVA 3BAFA 3CF0A 4URXR 2F3TA 5IK2A 3GLHE 1IOZA 1E3MA 4B35A 1XMSA 2O8EB 3CM0A 4LUCA 1GKIA 4AG6A 2Z5FA 3T1VA 3GJ5A 2QQEA 1G8GA 2W0SA 3IEUA 2C5LA 3L43A 3LBIA 3RS7A 4A2WA 3KJGA 3EX7C 3IILA 5EP3A 3VR5A 1HTWA 4GDFA 1MO5A 3LW7A 1YZKA 3NBFA 1H65A 3VNVA 3CW2A 1UAAA 1Q22A 3NH6A 1PUJA 1QVRA 1J8YF 1F2TB 3EPJA 2C03A 3B9PA 1TL7C 3QBVA 3MG9A 1XTQA 1UM8A 1KZ7B 3CRQA 1E4YA 1R8SA 4YONB 1W0KA 2B7BA 1RRCA 5G40A 2BKUA 4A0FA 4IXMA 1JEDA 3W90A 3ECCA 5KHOC 1UFQA 2W2TA 3N2EA 3U6BA 3HU1A 3K70D 4G5QA 2WKQA 4M9ZA 2CVHA 2GXAA 2BJWA 3GD7A 3R9IA 3OAAD 5FBWB 3MJRA 3PUVA 1KGDA 1LS1A 1SULA 3RANA 4QJ3A 5KSYA 1U9IA 2XB2A 2AKAB 2QORA 1CKEA 1FPMA 4PPNA 3WXMA 2W58A 3W9YA 3IIKA 1GFIA 4UNSA 4CEHA 3OESA 4BPBA 3KXLA 4R98A 2GF9A 4KLNA 4TTQA 4OHWA 1FL9A 2DFLA 4D4LA 2PX3A 2VO1A 2KSQA 4XVQA 1ZM9A 2IXGA 2OUKA 3FMOB 3X1YA 1HUQA 2VHTA 3ADKA 3A4NA 3JZMA 1LF0A 4JBWA 1QHIA 2XB4A 2IEYA 2IYYA 1P72A 2VSFA 3BS4A 4UQOA 3HPRA 3NEJA 3CZPA 5BXQC 1FNMA 3MLEA 5HE9A 1HY3A 1OYWA 4WZBE 4GMXA 1OFHA 3QXCA 3VU9A 5FTLA 2GEUA 3LX5A 2HYIC 1ZNXA 2QAGA 3TUIC 4TT3A 4IVQA 5FBRB 1P3JA 1YZGA 2QPTA 5TVKA 4NYIQ 3SE0A 4ABYA 2O8BB 4CEJB 4KFUA 3A1UA 4KODA 3CPHA 1G7SA 3KXIA 1YVDA 5L3SA 1E99A 2QE7D 3KQKA 3AVVA 1KZGB 4O3MA 4UXJA 2BMFA 1BKDR 4B2LA 1W48A 2A3RA 4BFVA 1N6IA 1X6VA 6Q21A 4TYNA 3AF4A 5B58C 2GJ9A 5EUMA 2QBYB 4BFWA 4C3ZA 1IONA 1M8PA 4M4SA 4QOSA 3QVVA 5F2EA 3A4LA 4QHYA 3QKUA 3V4RA 2NO7A 4GMDA 4TQUS 5K8UA 2NQ2C 1R5BA 1IJEA 1P73A 2PX0A 4JSTA 2FPLA 2B8TA 4LZZA 1AN0A 1N0VC 2XAUA 4A8JC 2YWEA 4LHYA 4BFXA 4DDTA 2X77A 3X1DA 1AGRA 3C5HA 1YU9A 3EIQA 3GEIA 2AN9A 4IOLA 1IXRC 1YR8A 4Q9LA 1Z08A 5FL3A 4F93B 3QEOA 4BFYA 3AM1A 2PCJA 1NN5A 3D7MA 4A8JA 2I1QA 5JMTA 3FWYA 1FX0B 4UJ5A 2IUUA 2ERYA 4B32A 2C8VA 2FGJA 3I3SR 5FBQB 1DAIA 5G41A 4ASUD 4F7WA 3PXGA 1E9BA 4IDHA 1AKEA 1CJKC 2RHDA 4LYHA 4NCJA 2ZJBA 3SJBA 2R8RA 2E87A 2FV8A 2OAP1 4Q1DA 2HJVA 2W2XA 1Z5ZA 1H8HD 2P65A 3QXJA 1ONBA 4E07A 1QF9A 2FEMA 1NN0A 4Q4HA 5SZKB 3THYA 4PX9A 3B1VA 3E1SA 5A0FA 1NKTA 2AXPA 5J5CA 3KKPA 1KSFX 2P67A 2ZUDA 3CIOA 2D06A 2PJZA 1M1YE 2R6GA 4DLZA 4ZCMA 4AKEA 2C96A 4DLRA 1NG9A 2DB3A 1I4DD 2WJVA 5F9HA 4LWZA 4MRSA 1RE0A 1G6HA 1P61B 3QF4B 1JR3D 1NKSA 3CKLA 1E9RA 3SYLA 3IPXA 1KNXA 2ZRAA 421PA 1UDXA 4W5JA 4Q9IA 4O2LA 2O8FA 1O3YA 1EGAA 2ZAOA 3ZVRA 2ZYWX 2OBMA 2CCKA 4S2EA 1NLZA 4ZPXA 1Q3TA 4GBMA 2CK3D 3E2IA 2BC9A 3PUWA 2LCFA 3BE4A 2XGJA 3O8DA 2CNWD 4C0BA 1E0AA 2WV9A 1EX7A 4DSOA 1KY3A 3BH0A 3P20A 5DISB 2QGNA 2ZUBA 4HB4A 2CJWA 2FPMA 4PXAA 1N5IA 1XD8A 1XCMA 1Z2AA 2KE5A 1R10A 4LV5B 5D3MB 4NONA 1U81A 1XXHE 3UATA 4DCNA 1G17A 1NLYA 3HYRA 4UKDA 3W6OA 2J0SA 3AVWA 2O8FB 5BN5A 1Z6YA 2ORIA 2ZRGA 1VCNA 1OH5A 4OHYA 2QQ0A 4QM6A 4U00A 1YRAA 4TMTA 1NSFA 1HE1C 2V55B 1PZNA 2Z6VA 1C9KA 2QAGB 3LDAA 4Q4AA 4DJTA 2RH5A 1BO6A 2G0TA 4LC0A 3KQNA 5HR5A 2HJGA 3K9LA 3WNBA 1N6LA 1OIWA 2YOFA 1CIPA 1DAKA 3AVQA 1D2MA 2OT3B 4GT1A 1CJTC 2H16A 4MYCA 4CRWB 2DWQA 1JXOA 4KYUA 4OHVA 1OKKA 2YVUA 1SVOA 1Z29A 3I73A 1KKMA 4PSVA 1VYUA 2A5DA 4IOJA 4V0ME 4I1VA 5AK0A 1L2TA 1W49A 1Z0DA 4FINA 5GVRA 4DRZA 2OLJA 3DPUA 3OZXA 1ZNWA 1ESMA 4H1VA 2FOLA 4LBYA 2QTFA 1I4TD 3QXXA 1I2MA 3CONA 1OXXK 2OCAA 3V4FA 2PJRA 1NVUQ 3K8YA 1MO3A 2VRWA 2IYSA 4Y0VA 3AEZA 4P32A 4YC7A 3K53A 4TLEA 4LCBA 1P9RA 4RFSB 1PV4A 4L4UA 4LK2A 4DIEA 3OEHA 1AJEA 2WSSA 3TMKA 2D2FA 2GKSA 3QY0A 4TQ9A 4TZ6A 3SYNA 1NN1A 2KWIA 1PVOA 2AK2A 2NPFA 3Q7PA 3PG5A 2EYUA 1ELOA 2OCYC 4US1R 4F4CA 2G77B 3QQ5A 2QT1A 3BB4A 2O0JA 4GP7A 1VHLA 2QL6A 3MJHA 2ZR9A 2Q3FA 3MAAC 4ZDKA 5IHPA 1XNJA 4QL3A 2A5JA 2GILA 2XZPA 3T06B 1AZSC 1E9DA 1E6CA 4TL7A 5L3RA 3THOA 4BRUA 2GF0A 3ND8A 1VIAA 2B6HA 1JECA 1CR0A 3RS4A 4ACAA 1JJ7A 3CWZA 4LRWA 4B3BA 1Y3AA 2HF8A 1G3IA 1KHTA 1AS2A 1SXJE 3FHCB 2HCBA 1CRQA 1T0JB 3U7EB 5HKKD 1JBKA 1A7JA 1TU3A 2QMUA 4Q48A 4JJKA 1SVKA 2H7VA 4HUQB 3SZRA 4JLBA 1G1MA 1G21E 1BOFA 2Q21A 1EXMA 1E4VA 3ONWA 3P27A 1P7CA 5J40A 3W5IA 4EJSA 1G18A 2KB0A 5DN6D 1JR3E 1Z6XA 1WB9A 3F5FA 2IS2A 2ZRIA 3CWQA 3H84A 5HCNA 4A82A 3AKCA 3G82C 1ZD8A 3LH5A 1DAHA 3UMRA 4HDQB 3QKRB 4ILEA 4V02A 4HDOB 4EPVA 3CUEF 2EU8A 4LHWA 2F7SA 3KZ1E 2P5TB 2ZI9A 2W2VA 3BWDD 4GP6A 4FMDB 2JLZA 5H70A 1VYVA 2IHBA 1P6XA 2NPIA 2WWIA 1IM2A 1ZCAA 1IAQA 2CDNA 2WWXA 1OH6A 5EE0A 1KI6B 3OIVA 4TMXA 4JLNA 4NYJQ 2A5GA 4EPRA 1OKKD 2ZVPX 5CB6A 5K8IA 2CMKA 1ZNZA 1C4OA 3M1IA 4WA7A 2ZRPA 2FMXA 2IHYA 4FXPA 3ZDQA 2FF7A 5J4KA 1EFUA 4D82A 2XSZD 1FQJA 2WPDD 3A1WA 3FMFA 3GLHA 2F43A 5KDLA 2EFDB 4BLTA 2Z83A 5KNCA 4HUQA 1G16A 3A1VA 1GL9B 3U3RA 3BFVA 121PA 3IO3A 5KSOA 4KBFA 4DDVA 2ODWA 4Q19A 4PHGA 2AX4A 2YWGA 3DM9B 1KI3A 1P9WA 4JKIA 3ZLJA 3AVTA 2BWJA 1N6PA 5IF9A 1S8FA 4UJ3A 3KQHA 1B23P 2ZJ2A 4YMTA 3A4MA 3AVUA 1G3UA 4NYMR 4NYJR 2CE7A 2IT1A 2J5XA 4QRHA 4M9XA 4Q9HA 1W47A 2ZS7A 2NGRA 3IO5A 4EFLA 4TYQA 2QROA 4ZV4A 1W2GA 3QF4A 3QKTA 4JL5A 4PPGA 5KTYA 1XD2B 4OI1A 2GJKA 4KO8A 5AJVB 1XEWX 4LY6A 3ZH9B 3CF6R 1BYUA 4FMCB 4RD2A 1TMKA 2ATVA 2ZE6A 1H8ED 1UDWA 2BDTA 3BOSA 4S35A 4A4DA 3UKDA 4PANA 4Q4LA 4C0HA 1G8PA 4HB0A 1KY2A 3EC1A 4OQNA 4AYWA 2WICA 3TR5A 4B6FA 1FTSA 4MYTA 2GZDA 2ZI7A 1GRRA 4TZ0A 3RDPA 1X8JA 2J9RA 5GVSA 1SVIA 5FFMA 3EZ9A 1W0KD 2CCGA 1FUKA 1Z3IX 4TQAA 4B34A 2V54A 1OHHA 2ODNA 3M6AA 5JRJA 2QNRA 2XZOA 1NVWQ 3ZZTA 1KI6A 4II7A 4NZYA 1IBRA 4R71A 4PC1A 2DWPA 3TSOA 4DLTA 1YZTA 3PR1A 4AD8A 2QM8A 3H2YA 1BS1A 3RHFA 2FGKA 2VHJA 5BWMA 1M2OB 4AI6A 2VPPA 2SHKA 3JZAA 4LHZA 2OBNA 1CR4A 1TU4A 2IYZA 3CLVA 4LOAA 3LXXA 4ZI3A 1UJ2A 2IXEA 2V3CC 1T4GA 1NF3A 4DUGA 2JLRA 4KSCA 3U7FB 1MABB 3U3JA 2VTKA 2RGNC
chains in the Genus database with same CATH superfamily
2CXHA 1KZ4A 3NP9A 4ER6A 2FEAA 4I4NA 4XDGA 2X1HA 3LECA 3QVGA 3CLTD 4XH9B 4OTZA 1PLJA 5H3CA 3PCTA 4PFJA 4B17A 4BN0A 1JU3A 1RQNA 1T6ZA 1GP2A 2HNBA 1RKXA 1TF2A 2IYEA 2PZFA 2XWPA 1KYTA 2WYHA 3FWPA 3RKSA 2GTIA 4WKPA 5ICCA 1YFZA 1B42A 4REQA 3WMXA 1V45E 1N6NA 1NL3A 4ALKA 3LL4A 1ZDMA 1X0VA 4M3NA 1N0UA 2NU7B 3DAOA 4RLHA 4B3DA 1K6IA 5JSQA 3LIIA 2H2GA 4D0SA 2WZCA 1MX1A 1SA0A 2J3LA 4IY1A 3S6JA 4AZTA 4BIIA 2HF9A 3DG9A 3GEMA 3ZDFA 3C3YA 2HV8A 3VNAA 4Z4HA 4FLEA 1PSWA 1K8QA 1V8OA 2IPAB 4KAJA 4IXWA 4E4TA 1JMKC 2JAQA 2VH2A 4TTTS 3WRWA 5KJCA 3G2HA 4K0KB 1RYHA 2VJDA 2Y0CA 5E9AA 3D1JA 3KYCB 4JB2A 4CKCA 5I51A 1MABA 4G4SP 4Z9XA 1L3BA 3LY5A 4G89A 1T43A 1Z5PA 5EXSA 1WNFA 4BBPA 3W0LB 3E5RA 1YSCA 2C4TA 1DKNA 1J00A 2Y0PA 4KHZA 1OIVA 4YJ2B 1Z5GA 1E2BA 3T8YA 4NBUA 3F2IA 4WVLA 4RPIA 1PP4A 4YGXB 4L4YA 3LDUA 1ZO8A 2DLNA 3CHYA 3EYWA 4BO9A 2FZEA 2X6TA 1JPUA 2ZJOA 4J0EA 5BYAA 4JGBA 1CEEA 3LQFA 3D43A 1QNFA 1E9SA 2W6ID 3ZWPA 1P3Y1 3RRZA 3UJAA 1SBQA 2O07A 3EW9A 3HL4A 4GX0A 2MYPA 1YL6A 1XAGA 3GW8A 3KQMA 1TQHA 4JJ8A 3M1YA 5A4FS 1KAHA 2FP4B 3DVQX 5JFGA 1RAEA 2FFHA 5KCMA 3W8NA 1A0OA 3C85A 3GLGA 2LZ0A 1YZNA 4XGNA 3TQHA 3D4IA 4OXKA 4QDUA 5DGHA 4I2NA 1J0BA 2C1XA 5JNRA 1ZVKA 2E4VA 3K4HA 2AJ8A 1PDVA 5IAJA 5CITA 3I01A 3KPVA 3NAMA 4YUXA 4MKXA 4R3UC 3E6AA 5BW6B 1Z0UA 1KAGA 1PFVA 1JSXA 1JXAA 4F4JA 4YMWA 3GLRA 3FROA 3ETDA 1TO6A 4BMOB 4LY9A 4G1CA 4Z86A 3VHXB 4NBWA 1BH6A 2XTNA 5CLJA 4W99A 3LP8A 4NWIA 4KZKA 4MRRA 1D6MA 3P5SA 3VC3A 1XTZA 2M2IA 2GEJA 1RRVA 1X8LA 3IEIA 5AW4A 4C14A 1SD2A 1JHOA 3ECSA 4QPNA 2BKLA 4RTNA 3KTFA 4KIFA 1B7GO 4D2IA 5F77A 2Y4OA 3KX2A 3SJZA 1KEEB 1E2FA 1SQFA 3RKUA 2OD7A 3CPJB 1WQ1R 5F76A 3EFHA 1GOTA 1DWPA 2CLKB 1JV2B 3K70B 1RPZA 2LVBA 4FVTA 4JT9A 5IJ9A 4IH4A 3QX8A 1N2ZA 3V55A 1GTSA 2QT9A 2FW9A 2W9XA 3ADPA 1W73A 3KKQA 4HWPA 1V8PA 2JFWA 1SIWA 5TQVA 3CXRA 4UBJA 2FSHA 4PX3A 3CRRA 4UUPA 1MH1A 1X13A 3N2GB 4FFNA 1Z4IA 2CNKA 2CUZA 1XZQA 3HDJA 4GVPA 4ARAA 4C0LA 2C9YA 3BORA 1MW8X 5ETJA 4AP6A 3X1ZA 3GPBA 3VRHA 5HWSA 2NPOA 5CX1A 2WM9B 1GZDA 3FPGA 3H1AA 1QOZA 1L4BA 2PKCA 1G6OA 3EGIA 3O8OA 2AOVA 2X0FA 5JANA 5FPTA 3K16A 1ZEJA 2DUMA 3AKYA 1P19A 3RKRA 4CKWA 4ARCA 1TW2A 3GG2A 5CNIA 1H22A 1AKYA 3BF7A 3GWZA 1N8TA 3AXTA 5ECGC 2GX6A 2JJ2A 4YTEA 5P21A 1N1EA 3AMVA 5CXXA 3NNDA 2RCNA 2D5CA 1OWOA 1YMVA 1Y6JA 1XF9A 2BEJA 1RM5A 4N76A 1WMAA 4Z2YA 5IUNC 1PFYA 2HY7A 1BXZA 4TKMA 3SHWA 4QBHA 2X4GA 5BVGA 2DCUA 4I8DA 2EQ5A 4DMRA 2YRFA 4QXQA 3FD8A 1ZK1A 3UFXA 5CLIA 2A0FA 4QFCA 2EJVA 1N3YA 1AQJA 1XCBA 3T1QA 3DEYX 3JTMA 3SP1A 1DKRA 1Q16A 3H5RA 4HLNA 3V2UA 4YCBA 4G4SO 3AFOA 3GF4A 1BFKA 3KBOA 4RGBA 2CNBA 1G8JA 4KGXA 1L5OA 4EM6A 2HDHA 5FAKA 3KEGA 3RTCA 1U0FA 1UOOA 1A1SA 3W6UA 3F9RA 3KU4A 4K8OA 3GVPA 3FUVA 1Z2CA 4F8JA 1X3LA 5EQFA 1KQOA 1WF3A 4E3ZA 1NPDA 2K2WA 3C98A 4TLCA 2XX3A 1IE3A 2J0UB 3ZDRA 4EB8A 5B4UA 3GT0A 4P84A 2DT5A 3RIYA 1TNDA 5J4HA 4X45A 3DAYA 1H0HA 3TXYA 3QXHA 1LPOA 4KYVA 1EA5A 1V39A 5AIAA 5C7OO 3EB9A 1HDCA 5FL7D 2NU6A 4R1TA 3FRIA 2JJ1D 2GPSA 3I5UA 2Z2ZA 3JQAA 3OPYB 4J16C 5I9TA 4A1FA 4EY7A 8OHMA 1U31A 5EHZA 1W1IA 2K7FA 2CEAA 1Y7LA 2W2NA 1PEAA 1T9CA 2ZSKA 2CNLA 1GXSA 2ZTSA 4FYMA 1LRLA 4LSWA 4GZ6A 2HSWA 1F38A 3DBLA 3CX6A 3Q5EA 4N3BA 5C4IA 5C7LO 3E58A 2DHEA 1N2OA 3GUVA 3ICQB 1BWSA 2BMDA 1JDPA 5L8VA 4X90A 4Q03A 1JYFA 1O03A 4G8JA 4ZA2A 2TSYB 2IBTA 2H2AA 2DH5A 4PZ0A 1TFUA 4LFBB 2O2IA 3VNUA 1N0HA 3FBGA 5E7JA 3AR7A 5FBKA 1NMXA 5HFNA 3L0ZA 5JCZA 5LXTA 1YHYA 5C1IA 2YNMC 5AOCA 3AR4A 3K35A 5T57A 1PEDA 3VYTB 1UBMS 4UAJA 2ZUFA 4ESVA 2UUAB 2FYTA 1R9MA 3B1ZA 1VJ5A 2SBTA 4HXEB 3RYTC 3DL0A 3EXEB 5BXYA 1V5WA 1T1JA 2EL7A 3U7HB 2VLIA 5FOWA 4K86A 3OCJA 4R1MA 4DZZA 3QV2A 5MN6A 4MKFA 4R9UC 1X7ZA 4PV7A 4NZ9A 5FH9A 2AB0A 5H1YA 3EIUA 3NPAA 3WLNA 4J90A 2J0VA 1NAIA 1JQ5A 1WKCA 4LKRA 4ODIA 2J4FA 2WOJA 4JZKA 4Y1RB 2G1UA 1DBSA 1UBCA 1DQRA 3SEAA 3QOWA 1US8B 1XTIA 3AF2A 4M55A 4UUOA 4HV4A 5A5FA 4EW3A 4ABTA 2B1GA 4MS4A 1PG2A 3ZIDA 1Z37A 2GVDC 2YV4A 2CMFA 1CG6A 4BKRA 1KI9A 1J20A 2VA8A 3DWEX 3OURA 3R20A 5THXA 2BTEA 3NHJA 4LI3X 4DIDA 4YRKA 4R69A 1M6YA 2GD0A 3HBJA 4UD2A 3WRYC 1QCDA 2BEVA 1OXUA 3PCXA 4XWOA 2RJ3A 3PQCA 2PBZA 1KP9A 4U7WA 5TF0A 3GFSA 3HADA 2NO0A 3M2PA 4KDCA 4RKFA 2J5KA 4X6LA 1GL7A 1E1DA 2O48X 1DRWA 3HYCA 3LOUA 4B81A 5K4AA 1LBTA 3PD1A 5FBLB 3BWYA 4TVSA 1GFZA 3RSFA 4D7AA 1XEWY 2O2HA 3B1KA 1E7RA 3IP3A 3MS7A 1KDOA 3HEAA 1WSBA 4RZ2A 4UHCA 2W6ZA 3PF9A 1ZNYA 4YXFA 2P91A 5FAXA 3BD6A 4GQBA 3HDYA 1S2NA 1A9YA 2FMUA 4HUTA 1DKUA 6ADHA 1JG3A 3ME5A 4UFPA 3FVRA 3MWLA 2WSMA 3EARA 7ADHA 4KPYA 4U7GA 4LYYA 4QO8A 1VB3A 1JSCA 4EMBA 4I5GA 4LYDA 4UTRA 3R7WB 3KYCA 4MV5A 3AK4A 1Q6ZA 3C8HA 4M37A 2GZAA 5HILA 4KOEC 5DTQA 2VNIA 1H2AS 3BXPA 3S2UA 5F1OA 1QQ5A 1B0AA 2F3QA 1OWLA 2QYTA 4WW0A 3IDQA 4EPXA 3DQPA 5KNCD 4DV5B 3CF2A 3ETLA 3CV3A 3R74A 4GNRA 2JH3A 4YRBA 1WU8A 1L5NA 2DU8A 6REQA 4XYLA 1Y7PA 2GFHA 4AICA 4KR7A 4GLBA 4BE7B 4UU7A 1ZD1A 4CCYB 4RCZA 3VU8A 1G38A 1W46A 2NV0A 2WVHA 4Y2UA 5EIFA 2QLBA 3DCNA 4ZVOA 4BVJA 3GFGA 3FOAA 1M7GA 2OBLA 3FM9A 3PZRA 3LC7O 4KN8A 1OI7A 1IY0A 1VLHA 1S0UA 1Z17A 1CUHA 5J1SB 4I9NA 3GPDG 1D4FA 4RQUA 1WCWA 2NZ2A 3DE2X 3CVYA 1YS2X 1POXA 4ZAWA 2IXTA 2O2JA 4AZSA 2NZXA 3R6TA 5JAZA 1UXIA 3EVAA 2ZIUB 2DX7A 1C4WA 1CUEA 1NJ2A 2H9AA 2VRCD 3KAKA 4JC8A 4KXLA 3BD7A 4M0EA 1TT5B 2V7BA 5DN9A 3U7RA 3ZVNA 2QUIA 2OILA 5EL0A 3EZYA 3GC6A 4YGYA 1R8JA 1YU6A 1FRVA 3ONDA 5IBRA 5C51B 3LCCA 2FUNB 4OI4A 5KNDA 1ZRNA 3NVDA 4OQYA 4Y6SA 2D6FA 4KRFA 1LC0A 4QDJA 4K28A 2N42A 2IF0A 3L6DA 2YMPA 4FYVA 4DMCA 3DAPA 3WNDA 1KAQA 2ZRBA 1HDZA 2D2EA 1R2QA 3KR1A 3OJWA 4PFSA 4PNHA 2N75A 3SXUB 3ZR4B 1G8MA 4HOYA 2AR0A 3S8MA 5A7GA 2GT1A 4BNLA 3S1AA 1RM3A 2VVTA 5KYXB 4DRYA 2XRMA 2QK4A 1NVDA 3L7LA 5TARA 1W6UA 1IXYA 5IH7A 3HP7A 1EDOA 3FVWA 5SY6A 4PYQA 3RHSA 3U16A 2CBZA 3I09A 1Q0ZA 1OY1A 3QYPA 1VGVA 4J0FA 4PZDA 3ASYA 4LK3A 4TLDA 2XGGA 2QTTA 1VIYA 2I4NA 4JLPA 5EE3A 5EIHA 5HIJA 3P45A 5IDYA 4BJHB 2HDOA 1ENPA 1VRCA 4I99A 5D3MA 2IPNA 4DA4A 2NACA 3KQSA 3TZQA 3WLRA 4A15A 3KOMA 2X8AA 2Y92A 4FLFA 1H93A 4CKYA 1UH5A 3AETB 1DWUA 4Q1BA 4B6RA 4BNYA 5E1BA 5CNJA 1JT2A 2VKQA 1YMUA 3L82B 3NRCA 4Q3BA 1FXUA 1WABA 3I2YX 4UEWA 4ZO7A 4CL2A 5KYWA 3G0HA 1C7EA 3E7DA 3B6JA 5DWVA 3HL0A 4EYKA 3A0RB 1MHPA 4BO2A 2PM8A 2YY7A 4F2DA 4G5OA 2UZIR 2EDAA 4YMLA 2CZCA 3AEUB 2UVPA 5J1TB 2B4TO 2R97A 1L8AA 4HQ6A 2QLTA 3H04A 4KMSA 4PZAA 2Z1DA 5KTOA 3CUYA 4TLMB 1HZZC 1SZDA 3F6EX 4JT4A 5CK5A 3SC2B 2Y76A 1CUDA 1KYVA 3I2GA 3C24A 3N8HA 2CUNA 3HWWA 4QBFA 4R7TA 2IX3A 1ODKA 3R0ZA 3V8BA 1TZBA 3N1UA 4F8EA 1L5QA 4DARA 4PSAA 4HYYA 1KY5A 2FW1A 2PMEA 2AA3A 3P5BA 3SY8A 2QTVA 5B7NA 2GVZC 2J3DA 4X8OA 4PLYA 6GPBA 2XTJA 4G81A 2WG1A 4ZCSA 5BVHA 5TQ0A 2WJIA 3UJDA 2KPOA 2ZXEA 5GGYA 4DRXA 2RI1A 4MCIA 1T13A 2NUBA 2VJKA 5IVIA 1KDRA 2WJJA 2BEWB 2YASA 2HLNA 2YX1A 2VZ9A 4LOJA 3X2EA 1PO7A 2X1VA 2ZUVA 4ETNA 2OOKA 2C7RA 1COWD 3GPCA 3MWYW 1L5GB 1LEHA 2CNWA 4B0OA 3PCRB 3GJ4A 4EKEA 3WK7A 4D45A 1ZH6A 5EYPB 3JVVA 4MQ4A 4FFPA 4BWYA 2XVMA 4EY4A 3V8QA 1GYRA 3I8XA 2HR1A 3T0IA 4IXTA 4JEIA 4CKXA 1JG7A 2VHWA 3T15A 4CQJA 4RMGA 5K8JB 4LDNA 1FQWA 1STOA 4J7AA 3AVXA 1T6BY 4E7OA 3K9HA 4YDRA 3DW1X 3NV7A 1FXSA 1U7ZA 1AA9A 4S1NA 3G8BA 1RI3A 4CZ2A 1EAYA 1YRLA 3GFOA 2PY6A 4BRWA 1V2GA 1ADFA 3OTQA 3ZIAD 3GJ3A 4L8YA 3NBMA 4MQEA 1EBBA 3V9PA 4C89A 4ARVA 3OY7A 2J07A 4KPFC 3RF6A 2MR5A 1J90A 4F4HA 1TCVA 2ZS8A 1XZAA 4J7XA 1EFVA 2AN5A 4MEAA 1KA9H 2HJRA 3GWGA 3HB4X 4BJ5A 2P90A 1AKQA 4GL2A 4QD3A 1BG6A 1V47A 4A2PA 1DTSA 3UH1A 4DR5B 3ZU4A 1G5RA 4BFLA 4WLVA 3PUXA 3RT9A 2WC1A 2Z09A 5JCXA 1DDOA 3HC7A 3HEMA 1LY1A 1PEYA 5CX1B 1JJBA 2HW8A 1GRQA 3GG9A 3P2YA 2B2XA 3NRBA 1LPAB 2NUTA 3PFCA 3JAKA 4FT4A 1VPLA 2QUZA 3B20A 2Y27A 3B12A 3D59A 3FGNA 4FBMA 4G8CA 4GPTA 3BCSA 3FX2A 4PAOA 2NOAA 3WL8A 5BSVA 4DR4B 4CMEA 1WW8A 3KT3A 2VHXA 5CNMA 4JENA 3RWOA 3UVEA 4QLAA 5B57C 2C7OA 4F3YA 3TSZA 3EQZA 3DC2A 4ZCPA 1N77A 1JVBA 4PC7A 1JDBC 5T5QA 1GPKA 2Q2WA 4BCDA 3ZCPA 1NF2A 5GV7A 5IDQA 4AMBA 3GGCA 1P6QA 2ET6A 3VBCA 1JL3A 4RK6A 4YUZA 1HT3A 1E2GA 2GAAA 2QLNA 2B0JA 3O1JC 4TSFD 5CCXA 1SO8A 3TINA 1MG0A 4WWHA 4ZQEA 3TLXA 4CF5A 3EZXA 1PGQA 3GEPA 1RRKA 2C98A 3PC8C 5D5QA 5KAPA 2Z4RA 3IAAA 1RWBA 3JQFA 3PXBA 4OAQA 2WTEA 3W7VA 4DBLC 4PVDA 1DG3A 2CVZA 2ASEA 3UANA 1LBSA 5EJGA 5HJ5A 2YVKA 1FU8A 4Q5IA 2J9FA 1P3DA 2LTAA 2AHOA 3IHTA 5GY7A 5WRFA 4D1YA 4X8HA 5DSXA 3OTIA 4KWHA 5LQJA 1XZEA 4U7FA 5CFQA 4BV8A 2IY7A 1GRNA 4DANA 5I7OA 5BR4A 3AFHA 2PU5A 10MHA 5FNZA 5LBTA 1CE8B 2WEKA 2ZETA 1SOWA 1CCWA 1AK2A 4FSDA 3RK4A 3LVQE 5C8XA 4QUHA 3P9CA 2P6RA 3I9OA 1EX6A 3IBGA 1BX1A 1O8BA 1KBZA 2XF8A 4RPCA 2GAJA 4TMVA 2Q0XA 4C0JA 1IBKB 4TSKA 2FRVA 3Q3JB 2P6PA 1KBQA 2EWMA 3EZFA 4B33A 4B84A 3A1NA 4YT4A 3AI2A 4B74A 2ZWIA 2UYQA 2J9FB 2NG1A 4WKOA 2Z43A 3G9XA 4AZWA 2JLXA 3HYTA 3TZ6A 1VSUA 4PBTA 3SXPA 2WSBA 1JSZA 4MA4A 1GGMA 1VRVA 1MB3A 3GFVA 3F6CA 2G71A 4DEVA 5CG2A 5A05A 3TEMA 2W7TA 5DI3B 4YUAA 5CTJA 1QK4A 3E5NA 4AUKA 2F62A 4ED9A 4F4FA 4LFAB 4AF7A 4L9WA 3BWXA 4U0KA 5DGCA 3ID6C 1T5SA 1E2QA 3Q41A 2NMVA 3PUIA 1P5HA 1SVNA 5HKLA 3SNHA 3EPLA 2I80A 3ZKWB 4ENTA 4NMMA 4RMJA 1TD1A 3F8TA 1KDZA 4HRAA 3LAWA 5EINA 1QK5A 4CF4A 4JT8A 4RNDB 4WKNA 3TI9A 4BFZA 3NAZA 1RWMA 3O8QB 1E32A 5EWJA 1THTA 1P5FA 3PKZA 3SIRA 2K2QB 2NU7A 2FFAA 2X9GA 5I9MA 5EHIA 4MVJA 1OPRA 1O57A 3HVKA 4DN6A 2L69A 4UEQA 3R0IA 1PZMA 3U26A 3LTEA 4RAQA 3GLHB 2VDNB 2Z30A 2XMZA 2EWWA 5ITWA 3L4KA 1A69A 1Q1BA 1XRSB 1GDHA 5BSKA 2W2LD 4Y9DA 1U7HA 3OEHD 3Q6NA 1OI3A 2B34A 2AL7A 5EJ2A 1E1YA 1L7AA 1J2RA 2VIIA 4M1KA 3VKFA 4A73A 4ETMA 1RXIA 1QG2A 3OUZA 4HZUB 2FWMX 1XZNA 5LD2C 2C2MA 3GJSA 1OU4A 4R8SA 4RZ3A 4YRPA 1E2EA 3GCZA 5B2ZA 1Z3CA 4RV4A 4Z6KA 5AOAA 1SQ5A 4B6PA 1N9KA 2GESA 2Y1GA 4M7WA 2FR0A 4R6XA 1GWNA 4YRFA 5DXAA 2B8JA 3F9IA 3MAJA 2HK8A 2GMWA 1MZPA 2MDTA 4GSKA 3HLKA 4LX0A 1YTLA 1DAMA 4D4HA 3ICWA 1X77A 2GCGA 4LMPA 2MCFA 4FZVA 4EHFA 1BIFA 5DIFA 2BD0A 2GR9A 1QC5B 3HKCA 4W63A 5JYBA 1JFFB 1NW4A 4RDIA 2I2XB 3G0GA 3UB2A 5LBIA 3ROXA 1KEVA 2BBTA 2XMCA 4WNIA 2AG6A 5JWRA 4BEBA 2CDRA 5C8ZA 2W00A 4B5LA 2CD7A 2X86A 1Z4QA 2FPIB 2O9JA 3PEEA 3RC7A 1MRNA 2A33A 3AR6A 3WGMA 5C46F 4DPKA 5ALGA 1XCGB 4WEQA 4DMMA 1CXZA 2QRKA 3N2KB 4IF4A 4K6KA 4F5ZA 1Z8HA 5C1OA 5I8PA 1CQXA 4IFIA 3PF8A 4Q05A 1Q44A 3AIMA 4NFHA 4Q3AA 3NS7A 4CG3A 2I91A 3DP9A 3T1OA 2VJAA 1N5JA 1UWLA 2AH5A 2QD2A 2M9MA 3HU3A 3O4IA 4UU1A 3AV0B 1QTNA 3LK6A 3NCTA 3PVSA 1I1HA 2ZJ4A 4ZI7B 5JHHB 1NULA 3ELUA 4LDRA 3WL5A 1QIJA 1YRHA 4JY7A 1FJHA 1FSZA 2O7QA 1XLTC 4GOMD 3A7DA 4WNAB 4AURA 4B44A 2PWAA 4U39A 4JLOA 3C7CB 3F6SA 3A7EA 3AF0A 1L7MA 3I83A 4QFMA 3O8OB 4M83A 1FSGA 2VPIA 5BQ5A 4AC9A 1F4PA 4DGSA 4RVNA 4H7DA 4ZXPA 5EJ4A 1O0CA 3U0BA 1Z5UA 1E98A 4ROTA 5EGNA 2R8ZA 2JBHA 4X93A 4YHBA 1AXRA 2WY2D 4BO6A 4HWOA 5A03A 5KC9A 4LSMA 5LMUB 4G1EB 4KLZA 3RGWS 1W52X 2NADA 3TLYA 1JZQA 1GSIA 1P80A 2IYVA 4B6QA 3KD3A 2QVGA 1W93A 3IQGX 2WYIA 3CPEA 5ALVA 1KPGA 1YZFA 5JCPA 3B3GA 2VT6A 3DTVB 3RRNA 2OV2A 4UBLA 2BGMA 3LRXA 4G56A 2D2IA 3HWX1 1MBZA 1YQ9A 4WNAA 5JCOC 1Q1QA 2HRCA 3DE6X 1TYDE 3DZDA 4QJ5A 2Y6VA 3Q88A 1U8FO 3THXB 3HV0A 4QUAA 2PU7A 1U0TA 1DBWA 1ECLA 1UMDA 1KVQA 3E9YA 5KYUA 3FDFA 5BW8A 2PNJA 3NB0A 2FSPA 5TEWA 1KJYA 5KYTA 3OQ6A 3ZWMA 1GM5A 4G6ZA 5J2TA 1J24A 1M7HA 1U9ZA 1QAQA 2ZU6A 4BVHA 3WB2A 2B21A 4OB8A 3TDKA 3QFSA 1DX9A 1W4RA 4QFBA 5T4EA 3UAOA 2HK9A 5BWBA 2ID4A 3C0KA 1E2MA 3D2LA 5TE9A 5KNBA 1C7RA 3RIXA 3B52X 2R48A 3IXMA 3UT5A 4ZTZB 2RJNA 4UU8A 1Z0JA 2HI0A 3QENA 3MM4A 3THXA 2GJSA 1UC9A 3CRMA 1U5AA 1BQEA 2PIDA 3EISA 5DYWA 4N49A 2I99A 5L3VA 1I4OA 2IE8A 2GPBA 3RO7A 4QRDA 1NXQA 1SKQA 3ZIUA 3VVLA 1VZ3A 2VBCA 4XQGA 4L27A 2GM3A 2QTWB 3OMXA 2VLBA 1XCLA 2IBSA 2Q28A 4QUIA 5DM2A 2VQEB 1D0SA 2FRXA 3SYMA 4CIDA 3VUEA 3NXSA 3OZ7A 3Q8MA 1EXWA 4W5QA 2GD6A 1ZMRA 4XIGS 4BKOA 2O59A 4OH1A 5AKLA 1XMXA 1N5KA 3B5JA 4RH3A 3MQFA 2GUGA 3PGLA 1F2UB 4YJKA 2HJWA 3DYBA 5TB5A 5IXJA 4IW3B 3P26A 4MI1A 4OJKA 4OKIA 3E2PA 5K6TA 3JU3A 2HOQA 4Y67A 4HR7A 1FYFA 4PG6A 3Q0TA 2WVJA 4M8IA 1ZN2A 4FD2A 4F5WA 4LHXA 3BJMA 4PU0A 2O8CB 1ETHA 3WO0A 4OEHA 3ZCTA 4CKWB 2W83A 1CQWA 3JWEA 4GOND 4O4JF 2HA3A 2UKDA 4L5IA 3P2JA 2OMKA 1P4SA 2YRXA 3TLAA 4YMUA 1JW9B 1M6VA 4KI7A 5AICA 1HDYA 5AI9A 4DWOA 2ZWAA 1OGIA 2PV7A 2VRBA 1D4ZA 5D87A 1U9IC 2AC4A 1D2NA 1VJ1A 4L5AA 2UYCA 4EP1A 3KDSE 3PHGA 3UG6A 4O4IB 5ANRB 1TUBB 4P4GA 2QRQA 1X7WA 4UU0A 3FNBA 4DUGD 2X3UA 1XU4A 1ZD2P 3TSYA 2FEWB 2YFQA 3TG8A 3LD9A 5E2AA 5KOHA 4WLOA 3ASVA 1EIZA 1HMPA 3H9GA 3AH8A 3I6QA 4DZTA 1J0XO 2IK8A 2ZXFA 2QIPA 2O8CA 5JNSA 4CDGA 3KUUA 1KMCA 4QICA 3ELWA 2WKWA 2Q4EA 2K5UA 2BZSA 5HZGA 2JD0A 3PNVA 1E66A 5M2QA 1GNTA 3W8EA 1YL7A 2H8KA 3OQ1A 3ZCVA 2EKLA 3LIPA 1A27A 2XHZA 5ENDA 1W4CA 3ZJ4A 2FWRA 2H1CA 1MGPA 1GKUB 3SJAA 4RWEA 1GR1A 1ZK4A 5EIOA 4TV9F 5BWOA 4NCIA 4PQEA 3I23A 4ZTUB 1A04A 1CJBA 3QU2A 3W5DA 3EAQA 3WNQA 4G25A 5B30A 1YC5A 3P0RA 4QM7A 1EJ0A 3MQ2A 1UCFA 2G5PA 3G02A 3PQ5A 2N3ZA 1XFDA 3UW3A 5K0ZA 1Z0AA 1L5VA 3K6SA 1L4FA 4B6SA 2A6PA 3MCZA 4W5NA 4EPYA 3FLEA 3CVWA 1Z0FA 5B1EA 3THYB 2ZUEA 3MGAA 4IX9A 3IQZA 1Z0KA 5EP1A 1NVVR 5ADUS 2GFQA 4O8ZA 4QYIA 4CUKA 3BMCA 1FPQA 4F60A 2G70A 3N0RA 1MP0A 1YDWA 3EXHB 5IU6A 1I36A 2B94A 4HPJB 3WS7A 3FWZA 4BZXA 3OIGA 1DBRA 2O1SA 1K75A 5ALFA 3T4XA 1GDTA 1DXYA 2VZ0A 1GTJ1 5CDHA 4MUIA 1H2YA 4K3UA 2C1EA 3TRHA 2BFPA 2W2KA 4EA6A 2ZB8A 1CNEA 1ZIPA 5DVZA 3ZVKA 1KRXA 4BZPA 4CCSA 3O8QA 2E7ZA 2JGEA 2NLOA 1T5LA 3SBOA 2IV7A 2A5YB 4H77A 1FC0A 2J9ZB 3RREA 3U9LA 2PX8A 3OPQA 1USKA 3KKZA 2J7PA 3BBPA 3BMQA 3VR4D 2ZM6B 1TB4A 4RHFA 3UY4A 1KR2A 5F9FA 5ICMA 1AD2A 3GUHA 4INZA 1EB8A 1KVTA 3T0GA 5JTTA 4EUEA 3EYAA 1NN3A 1QGYA 4RKYA 3H2SA 2I3BA 3MXOA 5P8WA 5FTJA 2HYDA 2I3AA 2PJUA 2DUUA 4PYMA 3WZ2A 1KARA 2CCJA 1E0JA 2C61A 3AZPA 4MA5A 5BQXA 1AQLA 1ZCBA 5K03A 5KVVA 4C88A 1AC5A 2R2AA 3AIOA 3A9TA 2FZWA 3O8LA 4PS0A 5J2UB 1EHYA 8MHTA 1APBA 3VI3B 4PGHA 1QO7A 2OHJA 3CWCA 3MT0A 2PE5A 4FIDA 2OYSA 4UPEA 3COYA 4S1WA 1ZIOA 4BQEA 1HPLA 4MR7A 3ZWKA 1RYZA 3EVFA 2YXPX 4B3HA 2H7XA 4D9FA 3PLAE 4QBKA 1WCIB 3EGVA 1SC1A 2A0KA 1ACLA 4KSYA 3EIEA 4QFDA 1FFXB 3AJDA 1AU9A 2IBMA 4M21A 3ESCA 3ND5A 5CFZA 3K1AB 4MUKA 2XBMA 1E3JA 1FS5A 1CZNA 3A2LA 1M6NA 7MDHA 5KJ1A 3SQXA 3CZQA 5CBKA 2HU2A 2DBZA 1R00A 2OXIA 1FY2A 4AB1A 4JOBA 4HN4B 3JR7A 2P9HA 2O3UA 3ZWCA 3TBHA 4D96A 5JDCC 1USUA 2GUWA 2VAMA 3ZZUA 4P1ZA 1NW3A 3NKVA 4N40A 4EHAA 4MW1A 4TTRA 1BGWA 1M54A 2WWFA 1LTKA 3RSCA 1NFRA 3PI6A 5BV7A 4U6QA 1ZJ4A 1ZMTA 2W8BA 1TLTA 2QX7A 1WSAA 2ES4A 3EPRA 3KWMA 4I5FA 4QQFA 5EJEA 5I7SA 2IHKA 3R0QA 1DAPA 1KK0A 2GWHA 4GOLD 1RVDA 1RZUA 2ZCUA 1VBNA 2AR7A 3P9ZA 2QRZA 2FQWA 3RTGA 1M67A 5FTNA 5TV2A 4Q12A 2XIJA 4I66A 1I7PA 3DR5A 1XZHA 3ESDA 3K2IA 3OIFA 1YZUA 1B2LA 3B7PA 3DV0A 3IPCA 2YH2A 4BQPA 2I8LA 4KQ6A 3EDRA 3IAEA 3K94A 4AMGA 3L5OA 5AKGA 5IAAA 1S4QA 4TV8B 2XYHA 4OBWA 4HDKB 2X9QA 1CUVA 2D4HA 2QX4A 3FFWA 1FP2A 3TZKA 5IT0A 2BDEA 4IDBA 5E1DA 3ZD8A 2HRDA 1WDMA 1MVLA 4GW3A 1EM8B 1U7OA 4HH4A 4BKPA 4YAGA 5LOVB 4U4AA 3W5VA 2PAFA 3T5TA 1NNSA 1PVDA 3D8BA 3ZOZA 1G7RA 4IP0A 3L84A 3BUSA 2O7NA 2ZVDA 3L4BA 2IUTA 4MWEA 1DQNA 2G08A 3LA8A 3NLLA 1Y9DA 3PGVA 1BXRA 1F1JA 1L5MA 3TLEA 3QJYA 4Y1EA 3IQFA 1VA5A 1XZCA 4E11A 2ACEA 1YQQA 4M2LA 1POWA 5KPDA 3S2FA 5A5GA 5GWXA 1HC7A 3RARA 1NJ8A 2QMYA 4JJZA 4AYXA 4U2GA 1N1MA 4EQ6B 5H3LA 5KTKA 2C2OA 5FWAA 3CJRA 3LA6A 4W9RA 2H92A 5ECWA 1UQTA 3LQ1A 3EUFA 4GX2A 4P5PA 5GJVC 3W04A 1E9FA 3GFTA 1W85B 3NOQA 3DULA 4AJPA 1EQ2A 3QHPA 1CIVA 2BBOA 2JHGA 1KI2A 2PLWA 2V59A 3TRIA 1J7KA 3P9KA 3PITA 4TLAA 4BEJA 4CYMA 1W36D 3DBHB 3VJRA 2YMQA 2K6GA 1EWVA 2GZMA 1YR1A 2VQ6A 4ZHSA 2PUFA 1FMCA 4ND3A 3BGDA 4JMPA 2VDRB 1GTVA 1OXBB 4BFCA 2YHSA 1NTOA 1X7YA 1LXCA 3JZIA 1QKIA 2HEIA 4ZV7A 4F86A 1QIKA 2FN7A 4MLPA 5C4GB 2QN6A 2XF2A 3QFFA 2FP4A 3BTUA 4WY8A 4D3SA 2CKMA 5LKRA 3HKEB 4BN4A 5B4VA 1QHYA 3S40A 1CZRA 2FWIA 4D0GA 4C4YA 1C3LA 4WT7A 1TIKA 4EG3A 1GAJA 4RXMA 2OB1A 5EWMB 3HXQA 2V4ZA 5CA1F 4A10A 2VAVA 4BLWA 4LTMA 2VK2A 2XTMA 4RIFA 1K8YB 1UOQA 3OZIA 5HFJA 3TRJA 3TSWA 4CV1A 1HG1A 4G0NA 1Z35A 3O2JA 4JQZA 3V1MA 2PYDA 1TCBA 1J1IA 1E3WA 1YS9A 2BR5A 1O08A 2OESA 3PDHA 3C8DA 3QG1A 4D92A 3UG7A 1EB9A 1YS7A 1T2DA 1C9MA 1X15A 4Q3KA 1IWBB 4LNAA 2PH5A 3LNTA 4YUVA 1PWZA 3RAPR 3AI3A 4YR9A 3D9QX 5C8VA 2E0IA 1EK6A 4EO9A 4U8HA 5DN6A 1EESA 1OLSA 2ZBVA 3U09A 2VN8A 4O59O 4O4IA 1KSHA 1RACA 4UATA 4NG5A 2XMQA 1WW3A 5KC8A 3FB1A 2VC2B 2ZAGA 3GFFA 3PRKE 3PHIA 3WGKA 5KSZA 4PTZA 4H31A 4J0IA 1E2DA 2PH1A 2BCEA 3L4JA 3AG5A 4N5IX 1XQ9A 5H59A 5K3FA 4EI7A 1TEXA 1TO2E 2CEKA 3INGA 3L0CA 2FQ1A 4JBNA 4M9SA 4ZVTA 3IAS6 2OAGA 2O54A 2IKQA 3ZQUA 3DDSA 1RIFA 3HGQA 3WGYA 3TXXA 1F1BA 4U9IS 8AT1A 2FWAA 4RPGA 3O47A 3KUDA 3UJ3X 2WIAA 5GM2A 1IUPA 3UA4A 2JIDA 2Q1YA 1T8PA 1SUPA 1W9MA 1GADO 2MINA 1L1QA 1T35A 1JDZA 2G6TA 5EEHA 1HQCA 2OV6A 3KEQA 4HJXA 5AP9A 1E63A 1OZAA 1QGZA 1UBUS 3P2KA 4I4TF 2C2YA 4NBTA 4R40A 2OCPA 2HJSA 2FAXA 2PFGA 3LQ2A 4TMWA 4A9AA 4D25A 1QRUA 4NXMB 4G07A 4H1TA 3D3KA 1FB5A 4X1YA 4BVBA 1ZXXA 4JYBA 3C7DB 1FW8A 4C0QC 2E18A 4E5NA 1NQXA 1JNXX 4JUFA 2DERA 3V7UA 3HFJA 1KEPA 4HNHA 5KVCA 2ZQ5A 3F7MA 1RR6A 2LKCA 3DL4A 3OM0A 1EDBA 1A77A 1NATA 1TVMA 1VKZA 2J3HA 2R8BA 5JQWA 4BQNA 1NU6A 3X1KA 5D85A 3UFXB 1P29A 4L3OA 1XYGA 1M5UA 1SBHA 4YRTA 3AHDA 4KVAA 5FA6A 4H17A 4KPEC 1EVJA 1ZVQA 1HLGA 1U2RA 2VCYA 3BTOA 2RIPA 3BB1A 5EMMA 3CZAA 3PDIA 3U2QA 4OYHA 2HXSA 3L0OA 3BGWA 4JBYA 1UEJA 2C04A 5KPJA 3RYHA 1X14A 3AOEC 2PSJA 3GYBA 3ICVA 2V9PA 3KYBA 4EW2A 2ANCA 1U8YA 3KTDA 3WK6A 4S12A 1U8AA 4HC4A 4ITVA 5BV8A 4N6OA 2QM7A 4IZ6A 1SOAA 3NJRA 3ROEA 5JALA 1T5OA 4EY8A 3KZXA 1KTVA 221PA 2NZ8A 4UHDA 3N8NA 1W4ZA 1EKXA 1JUDA 5JBNA 4LJSA 1B8NA 3PPWA 1RTTA 2AI1A 4AY4A 2RGUA 2KI5A 4QGSA 4PO8A 1B26A 1Z5WA 3ETCA 3MMSA 3KAPA 3I64A 3T1TA 3I0MA 3KELA 1LBEA 2E4XA 2JHCA 1ZAYA 1QVAA 4HNQA 3SBDA 4CNBA 1K5HA 1N3LA 3LCMA 1ZQ1A 4HH0A 2O3SA 5K09A 4HGNA 4PZLA 1B0ZA 3ZLVA 4QPPA 2CXQA 2CFIA 5TR9A 1JIKA 1UWKA 4H7PA 1F14A 5CDTA 4R2KA 1EP3B 2IOHA 3DOEA 1JLSA 1QGAA 3DVAA 1G9SA 3C2QA 2YZ2A 1XLWA 3L02A 3LHFA 4RM3A 3KTOA 3V6MA 4BX2A 3E22B 2OG2A 1RFLA 1NP3A 3EVBA 1U2GA 4BUZA 3PQ8A 3TOZA 2BFDB 4B8ZA