4OYHA

Structure of bacillus subtilis mobb
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
163
structure length
148
Chain Sequence
FPIVQVVGFQNSGKTTFIERILEKASEQGLNLGCLKHHDRYQAAGADVTAVEGAGVLQLTARRLWDLTRLIELYQFLETDCLLIEGFKKAPYPKVVILSEKEDLEALKTVNTIAIIYRKKEHMTEHQGLPIFHADDPVAVDLVLSQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Molybdopterin-guanine dinucleotide biosynthesis protein B
publication title Bacillus subtilis MobB
rcsb
source organism Bacillus subtilis subsp. spizizenii (strain atcc 23059 / nrrl b-14472 / w23)
molecule tags Biosynthetic protein
total genus 35
structure length 148
sequence length 163
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03205 MobB Molybdopterin guanine dinucleotide synthesis protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4oyhA00
2FGKA 3SFVA 3TQCA 5KNDA 4B34A 1JECA 3OIVA 3CRRA 3WP0A 4DKXA 4ERNA 2G1JA 3R9XA 1JR3D 2QI9C 1ZCBA 3B6EA 5J4YA 3PIRA 2O8FA 4I1SA 3T5GA 1XPUA 2XZLA 4JSYA 1N3BA 1S4QA 2CCKA 2WSSA 4BLPA 2D2EA 2FNAA 4GI7A 4PR0A 4N0EA 5AR1A 5KSZA 2YWFA 1CU1A 2XZPA 1U0JA 4NKRA 2Q0HA 4WZAE 4EQ6A 3O8DA 3GLGB 5HTKA 2ZITA 1SZPA 3M6AA 4JLJA 2KWIA 3LRPA 4MKHA 4NONA 3DOEA 4PHGA 4MGYR 3KQNA 2ZSDA 4B76A 1FNMA 4DHEA 2WJVA 2K5UA 1JR3A 3LBIA 4QRHA 4HZUA 4RZUA 3QVVA 1L8QA 3C15C 4KSBA 1ZUIA 1JALA 1MV5A 3OIUA 2FN4A 3FDIA 2P6UA 3T15A 1TF2A 4FMDF 4MDFA 2ZI3A 5C46F 3I73A 1ZM7A 1N5KA 2C04A 5IRCD 2GRJA 5FOXA 2P3SA 4RKFA 2VSFA 2ZJ8A 2DCUA 3B1XA 4M22A 4TQUS 1T0JB 2JEOA 5JJKA 1JPJA 3VHLB 1NVXQ 4QJ3A 4B73A 1MOZA 5AJWA 4CEHA 4LV6A 2YC2C 2ZVPX 2WMOB 1KSHA 4O25A 1E2HA 3B7GA 3DVLA 4IOJA 4ILEA 2C99A 2V6IA 2RGDA 4CDGA 1JXOA 4LHZA 4LSGA 1NL3A 2OE2A 5B64A 4WXRA 4KFUA 1OXVA 4EPRA 1GRQA 3CWQA 2OLJA 3GJ0A 3R7WB 4DSOA 4ZCLA 1G64A 1IAQA 3MJHA 1GITA 3A1VA 4O0MA 1MO5A 3RS2A 4V0ME 3C41J 3RRYA 3UKDA 1KI8A 3QKRB 1G8FA 2VPPA 1VYTA 1RFLA 1O87A 2P65A 4Q4AA 3FMFA 3CONA 3PEUA 1A5TA 4Y0VA 2WSMA 1G8PA 5FOVA 2IYRA 3RRZA 1KZ7B 4D82A 2IHYA 4XOIA 3A6PC 4EIWA 4H9GA 1KDRA 1G5TA 2FPKA 3QXSA 1BYUA 2AWNA 1T4GA 5G3ZA 2W58A 4Q03A 2YINC 3QIAA 2BJVA 4NCJA 4FWIB 2IYYA 3EZFA 4XSHA 5AWFC 2WWGA 4A0FA 1W46A 1KAOA 2E87A 2YWGA 3C5HA 2IYZA 3AF2A 4IOKA 4DLSA 2QEQA 3GPLA 1G4UR 2RGXA 1J2JA 2BCGY 4BWYA 4LGMA 3AVXA 4UKDA 3T35A 3RWOA 4BUJA 3KZ1E 2ZANA 1XCMA 3HWSA 1KO4A 4ZPXA 4MKIA 1W4CA 4Q1BA 5L3QA 1NLYA 4FI3C 2W6JD 3BFVA 2JAQA 5TMPA 1A7JA 3K0CA 4EPYA 2HF9A 4URWR 1OH6A 3N5CA 1ELOA 1OIWA 2HLDD 3LV8A 3VU9B 4ZI3A 3H0KA 2F3RA 3FKQA 4GL2A 4POAA 1T0HB 4V02A 4NU0A 4NL4H 3B1WA 3B60A 2V1UA 4B6FA 2CL6X 3EZ6A 3GLHE 4IDPA 1H8EA 1KDOA 4D81A 1SVMA 4WW0A 1KMQA 1NI3A 4HYYA 1PLJA 3AGPA 1JR6A 4C0KA 3VX4A 3QG5A 3ZS9A 4OHVA 1NJFA 4PAOA 2W0MA 2HYDA 2JATA 5JWRA 1ZNYA 3ASYA 2IUTA 1UKZA 1Z3IX 1AZTA 5HZHA 3TBKA 2HLDA 3S1AB 4JVMA 4TZ6A 1ZP6A 1TQ4A 2QQ0A 3KKPA 4NYIR 1ZD1A 2DB3A 4Q4JA 2WKRA 2KBEA 2O0HA 3TSZA 1AGPA 4Q5IA 5J5CA 1RRPA 3BB3A 1R5OA 5A4JA 2XNDD 4RKEA 4Q1EA 4A4DA 3I3SR 1MO6A 421PA 2VEDA 3IUYA 4N1AA 1N6LA 3W6PA 2PT7A 5K8IA 3LQRA 4RSGA 1UAAA 1DADA 2WWWA 2ORWA 3W5JA 5JSZA 3U44B 3WY9A 1DO0A 2QQEA 3ADDA 1NVVQ 4GSYA 2CNWD 2IF2A 1M74A 4JJKA 4AD8A 4HEJA 2QAGB 2IW3A 2QORA 3W3AA 5CK5A 5EE1A 5GJWC 1SVSA 1RKBA 4BQSA 4LYJA 2ZE7A 3ZGXA 1E0JA 5CB8A 2ZS7A 1VCIA 2ZQ5A 3OIWA 2C96A 4GMDA 3ADCA 1AA9A 4C2UA 5KYKA 1NBMD 3PQCA 3V9PA 1T8UA 1SKQA 2XNDA 4HDQB 3U7GA 3VHXA 4KI0A 1DEKA 1VCOA 2ZRBA 3QPWA 2WJGA 2GCOA 4Q02A 3GJ7A 3EXAA 4MRSA 3RLFA 3JZMA 4AWXA 2WVJA 2A5FA 5CK4A 4BECA 1QDEA 3L43A 3CPEA 4IXMA 3I5YA 2FSHA 2CNWA 5JCZA 3WMFA 3BH0A 1E2GA 1S3SA 3FMOB 1QHNA 4GOJA 4M1TA 4RD2A 3THYB 2QUZA 4PX9A 1JNYA 1Y3AA 2EFDB 3DMNA 4GMXA 4A82A 2JA1A 1ZNWA 3CNLA 1E3MA 1G18A 1NBMA 2F7SA 4WVFA 3BE4A 2ZR9A 1AGRA 2CL0X 2YOGA 1N6KA 1YZTA 5AJZA 1XEFA 4EKDA 1NKTA 3HP1A 3N70A 1PVOA 2KJQA 3IPYA 1EWRA 4C9BA 2QBYB 2DWPA 1MR3F 4BRUA 4DDWA 3LAWA 5FUYA 4ZV4A 3KKQA 4M9QA 3R9IA 4ESVA 4FIDA 1Q0UA 5J40A 1N0WA 3AUYA 1ZBDA 5TVKA 2E9SA 1Q21A 4C3ZA 2H18A 2H5EA 2ZJZA 1OH5A 2ZRGA 3GJ3A 4UNSA 2ZAMA 1F2TB 4R71A 4JBYA 2CEAA 5CLLA 3FTQA 2ATVA 1FQJA 1PLLA 1KDPA 2GXUA 4I81A 3AP3A 2ZRIA 2IL1A 5EE0A 3QENA 1J7KA 2JJ8A 4D0NA 2BMDA 1OKKD 3WYGA 3A1UA 2O8FB 4MYTA 5AK0A 3ZZUA 4MRRA 1JI0A 1G7SA 1LVGA 3IIKA 3UANA 1OPXA 1BS1A 2Z83A 2BBWA 4TYPA 1Q3TA 1U90A 3SS8A 3X1DA 1YJ5A 2OESA 4PPFA 3LA6A 2ZREA 1H8HD 4EFMA 4JLBA 3VR1A 4BLSA 4TZ0A 1T3SA 3AVUA 3VQTA 1FP7A 1M7GA 2GEDA 3A1SA 4Q9HA 4BRWA 2BBSA 4E03A 1CS4C 3NHBA 3BC1A 2YWEA 3VFDA 3KJHA 1OXUA 3IQXA 4QC2A 3X2SA 1S0UA 4YC7A 1M6NA 1OKKA 5GVRA 1OB5A 4LJ4A 4HZUB 1P2UA 4NE2A 4MKGA 1V5WA 5FBVB 2W0SA 4LYHA 1E2PA 3F5FA 1ZM2A 3W9YA 3M4YA 2XXAB 4QNRA 2ZI6A 3BGWA 1XPOA 1M1YE 4BE7B 4RCZA 3ASZA 4HAWA 1X86B 5E3HA 3LQQA 3UWKA 1E9BA 4OHYA 1DELA 4A6PA 1DAFA 1H8HA 5KOYA 2QP4A 1GUAA 2VHCA 2ZROA 5L3RA 2NPIA 5E7IA 2WWIA 5F9HA 2AK2A 1GTVA 2V7QD 4II7A 4DLTA 5HE9A 3PENA 3TR5A 5JRZA 3K9LA 4G5RA 3GEIA 1QHIA 2QTFA 4JBWA 4B3DA 1Q1EA 2PX0A 4V0NA 1E0AA 3K9HA 3ZQJA 1Z0DA 2QTVB 1M7BA 1COWD 1NVWQ 4WIAA 4IVQA 3SDZA 2XJ9A 5SZHB 3SYLA 2Z4SA 1E1RD 4YXWD 2ZRLA 1KNXA 5JZVA 1CR0A 1XD9A 2ZRDA 4PC3A 1RYHA 2QP9X 5FL3A 1C4OA 1B23P 1T3LA 3RAPR 4Q4AB 2QNRA 1Z6AA 3WRYC 1OFHA 1WRBA 4W9MC 3KJIA 4PPQA 2QMEA 2V7QA 4V0KA 1CJVC 5KNCA 3A1TA 2WZQA 3PUYA 5JI3E 5CJPA 1GRRA 2RGCA 4YDSA 4OI1A 2X8AA 4MGIR 4RZ3A 2REXB 4NMMA 1AS2A 1NY5A 2R6DA 2Z4RA 2OFXA 2EFHB 2OV2A 1EESA 3F3YA 4QM6A 1F5NA 2VP0A 1N5LA 2P5TB 2R62A 1E1RA 4YXWA 1GNQA 1HYQA 1XF9A 2QGNA 4GZLA 1W2HA 1T91A 3O47A 3SHFA 2AKYA 1K5GA 3FOZA 4JYBA 1G8GA 4LHVA 2GF0A 1KZGB 4RD0A 3B1VA 4P32A 3T1QA 4WAUA 1P9NA 5TDHA 4HAZA 4LX0A 4I1OA 3GLHB 4QGAA 5L3QB 1N6PA 1W4BA 4MYHA 2ZI4A 2HT1A 1J70A 5EUMA 3GP8A 2WJHA 4OJKA 2GDJA 4M1OA 2QPAA 1KTVA 3A4NA 2PZGA 2CCGA 4LJYA 5KU1A 2CHQA 3PUZA 2P0EA 4U7DA 1NNEA 1BOFA 2IS4A 2R44A 3X1YA 3O8CA 1OXTA 4BLQA 2VP9A 1E6CA 3BWDD 4US1R 1L7VC 5DI3A 1XTJA 4NBSA 1X1SA 5EZ6B 4L9SA 2AD1A 2IYWA 3QPVA 1G21E 2B8TA 1W4RA 4M4SA 1O3YA 3L8YA 2F9LA 3EW9A 5FUXA 2CDNA 3E1SA 4LJ6A 4BFWA 2DBYA 2DY1A 5SZJA 4DLYA 4PHHA 2ZU0C 4DSTA 1NMXA 4DC9A 2H8KA 5HCIA 1MRNA 1W1WA 3D6TB 1PLKA 2RKOA 1QRAA 1ZD8A 4O2RA 3KTAA 2GK7A 5TB5A 4E5UA 1UBGA 1OH8A 4A6XA 2QA5A 3KQUA 2F6RA 2DWOA 3IQWA 4NPHA 4Q4JB 2XTNA 5CDFE 2QU8A 3BAFA 2BM0A 2GEUA 3IPXA 1EFUA 3NBYC 4GZMA 4Z8XA 2JGNA 4EJSA 1TU4A 4R2HA 2RH5A 2ZVQX 1C1YA 1KI9A 1JQLB 3NVAA 2ZXUA 2NTYC 1JJVA 1ZU5A 3K8YA 4C4PA 1QHGA 4LK2A 1KAGA 4ZKEA 1GDDA 2DR3A 4JLDA 4TMVA 3RRMA 1DAMA 5FPSA 2GXAA 3LVRE 1H65A 2LKDA 2ZSBA 4FCVA 2EFCB 4XH9B 1G3MA 3ZIAD 3LVQE 5UKDA 2VP6A 3CR8A 4C2TA 4C7OA 3U3RA 1G9XA 3VMFA 3THXA 3NC1C 1IONA 3TW4A 3T5DA 1T6NA 3SR0A 5CJ2A 2EWVA 2WBLC 4L8GA 2ATXA 3OESA 1X3SA 4AKEA 1IOZA 3K09C 1JXMA 2WIBA 4DVGA 3BFXA 2FEOA 1G7CA 2DYKA 5JWHA 2GCOB 2PLFA 1G7RA 4M9SA 2A5JA 3H84A 3P1JA 5H70A 1F2UB 5BYJA 2ZUBA 4OHZA 1J90A 5IDVA 4DDUA 5JBQA 3MWLA 2FFQA 3GLFA 2W6ID 2I3BA 4JZKA 1KI7A 4HLUC 4E07A 3OE7D 4RY2A 4AKHA 2EWWA 2J87A 3ZIAA 3NH6A 2G83A 2VP2A 2C8VA 2C9CA 3U6KA 4U02A 2WMNB 1G16A 3MRSA 4JLOA 3WYAA 3CRQA 3GJ5A 5FPKA 2ZRNA 3DKPA 4NH0A 2V1XA 2XTZA 2CJWB 3UIEA 3WBJA 2F43A 2O0JA 3DKVA 4DIDA 3FB4A 2GJSA 4CW7A 3H86A 3CH5A 4ZO4A 5BN5A 2ZETA 1ZIOA 1ZUHA 1IQPA 1M8PA 5FI1B 4C30A 3AV0B 4OQFA 3RC3A 1ZCAA 3B85A 2W6IA 4DLUA 1IXSB 1TNDA 3OE7A 4CEIA 4PAMA 1FP6A 2ECKA 1T3HA 2IXEA 1CEEA 1N25A 1SXJC 2I1VB 2BC9A 5F9FA 1S96A 4LJ5A 3AVYA 2GXSA 2QG6A 1SHKA 2DHRA 4A0GA 2BHRA 2QT0A 2Q9AA 4QKQA 5L8VA 2ZJBA 3MWKA 3CB4A 5A0FA 3L0OA 1AKYA 1S9DA 1UKEA 2ERYA 2GK6A 1KK2A 2GAOA 2Q3FA 4DEXA 3TAHA 1XXHA 4YMUA 2IC5A 2QTHA 1GL9B 2NZJA 2RHDA 2IUSA 3CM0A 3K0FA 5FTLA 2ZRHA 3VNVA 4A1FA 4XD7A 5HCNA 1RZ3A 2QP3A 5M04A 2ZM5A 4QBGB 4B43A 5LD2C 2JLQA 1E9CA 5BYKA 4HLQB 1HQYE 1KK0A 1R5BA 1XJ0A 3CLVA 5EP3A 3T12A 4CT4B 5DNYB 1NP6A 1VG0B 2RMKA 3FHCB 4DXAA 4LC1A 3K0EA 4M21A 2Z43A 1G1MA 2ZJ5A 3A8TA 2GZAA 3VR6A 2PCLA 2RAPA 1WB9A 4JL8A 3KXKA 4C0BA 1JEDA 3LFUA 4F4IA 1HTWA 1PV4A 3DL0A 4NP6A 3W6NA 4D80A 4HAVA 2DPXA 1N6HA 5KO2A 3CPJB 1D6JA 4D4MA 3NC0C 3PFIA 1IBRA 4HLDA 4LDJA 1LTQA 2IYSA 4X8OA 5DIFA 3T1TA 4ITRC 5E95A 3EPKA 4Q7MB 3W6OA 3WNDA 1D9XA 1TEVA 1GL6A 1NIJA 3W90A 2CHGA 2VIIA 3KFVA 4GT1A 2NIPA 3AM1A 2BKEA 1Z6YA 3THWA 3C8UA 5D3MA 2A5GA 3AB3A 4PSKA 4DZZA 3B78A 4OBEA 2H57A 4OYHA 5IK2A 5K8LA 1Z29A 2IYLD 3FKSD 1KDTA 4IDNA 1E0KA 3IBGA 4C0SA 3WMEA 2O0KA 2CHVA 5CLQA 1NSFA 1IXZA 2W2TA 1OYYA 3HYTA 4LHXA 3BH6A 3VTKA 2J0UB 1E9RA 2AN9A 4PQYA 3MSXA 4Q9KA 1XMIA 3QY0A 4GRAA 4PXAA 1J8MF 1QG2A 3TGPA 1S2MA 1XTQA 3L8ZA 2OSBA 4UNPA 5E4FA 3AF0A 2WKPA 2BIFA 2ZR7A 4PO1A 4UNQA 2VP4A 1NN3A 1A4RA 2HT6A 221PA 2QN6A 1NVVR 5EE9A 2ZUDA 4MYCA 4WOPA 2V55B 2FWRA 5JLJA 3SN6A 4XWAA 1RRGA 3BB4A 5A5GA 721PA 1EFCA 1U9IC 1YZNA 5FFMA 2C9YA 2CE2X 3FKSA 3PUWA 3CF6R 4FCTA 2VL7A 4YMWA 2UKDA 5GJCA 3UG6A 2J0VA 1UBCA 3UMSA 3D8BA 1OSNA 3NEJA 5DH9A 2ZRAA 3DZ8A 1M34E 4JLKA 2VLIA 3REFA 2FOLA 5FTNA 5EXTA 2OXCA 2ANCA 4M53A 4A92A 1R8QA 3JZAA 2OILA 3ZVLA 1JR3E 4L5BA 1QF9A 1QVAA 4L4UA 1L2TA 3FHTA 1TTTA 1ZC3A 1TPZA 2W00A 1W36C 3ZDQA 3SHWA 4UQOA 2GF9A 4L9WA 1E9DA 1KMHA 4H1UA 1XJCA 4HAXA 2HDNB 3LXXA 1NSTA 4GNKA 3K0AA 3WNCA 3HR8A 1KI6A 3I8SA 3REGA 1TQDA 2P6RA 2ANBA 3PUXA 1G5PA 4I4LA 4S2EA 2VO1A 821PA 5DI3B 4CF7A 5KPJA 2HCBA 4HATA 1FUUA 4NCIA 4TT3D 4BLTA 1G3IA 1P62B 5JFGA 4NYMQ 1OJLA 4Z1MD 1VDZA 4OHWA 1TQ6A 2GWHA 3BS4A 1E2LA 4QBHA 4ON9A 2J5XA 4AG5A 4LUCA 1E99A 3ZZTA 4Q48A 5AJXA 2VHTA 2CLDX 3QXHA 2PJZA 3KTAB 3KQLA 2YWHA 2QY9A 1WE2A 3EA0A 5FBWB 4Q7LA 1E4YA 2WJJA 3GJ4A 4V0LA 1WCV1 3K09A 2R65A 1GILA 1IJFA 3PR1A 4B3CA 2H17A 2IS1A 1G17A 2IEZA 4QBFA 3QG1A 3QSYA 2GZDA 3PEYA 4PC2A 3IHLA 4ZCIA 1Z8FA 4LY6A 4EJSB 5EE3A 2V6JA 4TT3A 5FTKA 3PEWA 3T61A 4MDEA 2ZIAA 3TJZA 4HUTA 1RC8A 4TYQA 4Z1MA 2VHUA 2VHJA 3FGNA 3Q7QA 3WHLA 1TADA 5IF9A 2WHXA 1KSFX 4HLUA 2F3TA 1N0UA 4QGGA 1N6IA 2EYQA 2IXFA 4JL5A 2A7QA 3I4LA 3KUCA 1SXJD 2PZFA 4WZ6A 4LV5B 5FBRB 4IVPA 2OZEA 2WPDD 2JCSA 2O8DA 4M8NE 1AZSC 3FMPB 4MKFA 5JCPA 4MGZR 4M1SA 4A15A 1OH7A 3CZPA 3QEJA 3BORA 4C7OB 3AP1A 2CLCX 5F98A 2RHMA 1US8B 5HPYB 3EPJA 4C0QC 3NWJA 1GVNB 3EZ2A 4PO8A 2ZE8A 1GOTA 1GP2A 3EC1A 2F1HA 5D3QA 4ESHA 3AKEA 1SVOA 1G41A 3N2IA 5K8UA 4P3YA 1CP2A 4ZKDA 1SHZA 3ONWA 1CIPA 1DG3A 4B32A 2IHBA 1NN0A 1YZQA 1DPFA 1SXJA 2IYQA 4AYXA 1FW6A 2W6JA 2WPDA 3GLFB 1XEXA 5CYOA 1W48A 5LDDC 1FOEB 5H8WA 1DO2A 1XTIA 3QXJA 2HXSA 4RD1A 1BH2A 4B74A 1CRQA 1GSIA 2NZ8A 4JKYA 3UWOA 3ZYCA 1R0YA 1ZMXA 4B33A 2FF7A 2F43B 2L0XA 4BLOA 3ICEA 3E2IA 2QMOA 3A37A 1OXXK 5KDDA 3X1WA 4XJXA 3W8NA 1S1CA 1UKVY 1XTRA 3QKSB 2CVFA 1OYWA 3VR5A 3DM5A 1LFDB 1HH4A 2G3YA 1R0WA 1R7RA 2MSCB 3B1YA 5KPDA 1IN7A 2ONJA 3U7FB 4HAUA 1PUJA 1YE8A 5EP1A 4Q1DA 4CEIB 1AKEA 3MCAA 3V4FA 3SFZA 3GQBA 3NDBB 3KJGA 4P4TA 5JS7A 4Q4HA 2B6HA 1RIFA 5FL7D 3PJRA 3CZQA 1UM8A 4XWKA 4BZQA 2G88A 3RHFA 4LYFA 4E22A 1W44A 4OQNA 4A2WA 4F93B 3ZVMA 3BD9A 3VX3A 4IRUB 1TMKA 1YQTA 1ZW6A 1XX6A 2FX3A 3EZ7A 3HPQA 4PPNA 1XXHB 3K53A 5JHHB 3E5HA 3SQXA 3K0FB 1W0JD 3DZDA 4HI0E 2OCYC 2VRWA 4MRNA 4C0JA 1GRNA 1ANKA 2ORVA 3T34A 2VF8A 3ZVRA 5DISB 2FU5C 2PZEA 4X8HA 3A4MA 3EIEA 4ZDWA 2ZI9A 1K5DA 2GJAA 5FL7A 1UDXA 2FJUA 1KNQA 4DIEA 2QL6A 5BW8A 2FFBA 2GTPA 4JT2A 3W8RA 4DCNA 1NN5A 3Q72A 1PZNA 2JLRA 1NF3A 2NO7A 4FD2A 1R6BX 1XTKA 5CYPA 3U61B 3ECCA 4B2LA 1ZNZA 2OO7A 3EX7C 4UJ3A 2B8WA 4HDCA 1W0JA 5FTJA 1NJGA 4LBZA 4O3MA 2ERXA 2YKGA 4A0HA 2LCFA 1E2NA 4EPXA 5DHFA 4D6PA 3U7HB 1JAIA 1N6OA 3A58B 2QMUA 1RVDA 3TRFA 3GD7A 3HR7A 2VF7A 4LCBA 1W36D 1J8YF 1NBME 1NIPA 2QENA 2VBCA 1Z08A 3BXZA 3NKVA 4KAXA 4MRPA 4KITB 4EPTA 1U9IA 2XB4A 2D74A 1XZPA 2TMKA 5C2JB 3K70B 5AJYA 1I2MA 3B1ZA 6Q21A 1G6HA 2FSGA 3R9WA 1XU4A 2OCAA 1WP9A 1J99A 4ABYA 4G1UC 3RC8A 2YHSA 3IGFA 4K46A 2P2LA 4P4SA 4B47A 4ACBA 1CR1A 4DJTA 1FTNA 3MGCA 3WBKA 4RFSA 3AKYA 3MG9A 5H68A 1HUQA 4KLNA 2AKAB 4KHZA 1G3QA 3H4MA 2MMGA 5SZKB 3N2EA 2O52A 1XMSA 4DLWA 1CRPA 1FNNA 4G0NA 4C0AC 3ZLJA 4FINA 3ZVNA 5GJBA 4EQ6B 1DE0A 3PCRB 3DHWC 3IILA 4BFSA 1YR9A 2SHKA 1WA5A 3I8XA 1AN0A 5F3WB 2N1BA 3D3QA 2A78A 3TSOA 2IS2A 2V4ZA 3Q9LA 3GMTA 8OHMA 2HEIA 1G291 4I1UA 1II9A 1T9HA 3MFYA 4OL0A 4WZBE 2ZSFA 4JKIA 3O8RA 1Z07A 3AGQA 3NG1A 4GOXA 3M1IA 4D4LA 4PC7A 4A0RA 1TQ2A 4TLDA 1E9SA 2ZRPA 4Q4LA 3CX7A 3C4JA 4D0GA 2N42A 5J4HA 2ZYWX 3U7EB 4MGKR 3SJAA 3EZ9A 3MAAC 5EXSA 4V03A 3IKJA 3V00A 2REBA 1Q20A 4Q1FA 2H7VA 5AUOB 4IDHA 2EFEB 4ACAA 3LO5A 2JLXA 4CEHB 3KB1A 1FX0A 2BVNA 4NDZA 4FWTA 4FMCB 2IS6A 1LNZA 1DVRA 1YU9A 5JMTA 1E2QA 4Q66C 1KMHB 1MRSA 1AQUA 2BMJA 1ZUNB 2GETA 2G9NA 3K0AB 3ZQ6A 1VIYA 5HR5A 1WBBA 2FA9A 1KI6B 2B7BA 1SVIA 2IBMA 2AFIE 4KO8A 2WWHA 4IFEA 4Q47A 1KI1A 2XGJA 3CW2A 1Z6GA 2NMVA 1I4TD 2YJTD 1M7HA 2MMCA 2NO1A 4NYIQ 4ZIRA 2REOA 4QG7A 1SQ5A 2BMFA 4WBSA 1KGDA 1NLZA 4M1MA 1GZSA 1CXZA 3VNUA 3Q7PA 2BOVA 4B3XA 5LB4A 5DLQC 1VIAA 1VHTA 3MJRA 3SBDA 1Z28A 4NHOA 5B58C 1AQYA 2XSZD 1R4AA 2JJ2D 4B3FX 1COWA 3LWNA 4KSCA 3LW7A 3RWMB 2KI5A 4LI0A 1A1VA 2CL7X 2DFTA 3TLXA 1EG7A 4TLEA 1OFTA 4KODA 3AVPA 2BM1A 5DI9A 1T8TA 3AF3A 2V3CC 4IHQA 1IY1A 3GLGA 3OF5A 1ZAKA 4LRWA 3FMIA 2W83A 5LBIA 4W7SA 2C98A 3LBNA 4TYNA 4YONB 3TUIC 2KB0A 4AYWA 1XZQA 1K8RA 2IYUA 3AKCA 1YR7A 5GADl 1SVWA 2O8DB 1VCMA 2X2FA 4JBXA 4LBVA 2WOOA 5AUNB 2XSZA 2BBTA 1IY2A 3W34A 3J81k 1NG9A 2JJ2A 4IDQA 2A9KA 2PJRA 4X8MA 2HJVA 2IK8A 4B75A 5B30A 1DARA 3NTUA 2PMKA 4EUNA 4DB4A 3CBQA 4URYR 2EW1A 5IT5A 2QPOA 3OHMA 1TEXA 2D7DA 2ODBA 3CX6A 2R6GA 1QHXA 5ANRB 1YKSA 4LBYA 2FH5B 1FPMA 3PV0A 2XITA 3UK6A 1SXJB 1CULC 3I1FA 1MABA 2ZI7A 1W5SA 1XEXB 4HUQA 2J9RA 4M1YA 4DT1A 4XWOA 4PANA 4RD3A 1HEIA 3OFND 3D7MA 4P31A 3PXGA 1XD8A 2HF8A 1KO7A 5JJIA 4PZZA 2ZR0A 4BEBA 3SYNA 5FI0B 5EP4A 3SBEA 2B21A 3AVVA 2D3WA 3IO3A 1P7CA 4EPVA 2BEJA 3AVQA 1UJ2A 2GZHA 3TK1A 2D4HA 3RS5A 2C95A 2IEYA 1KJYA 2GJ8A 1P5ZB 2ZRFA 2EQBA 1KKLA 1P6XA 5JS8A 5JSZB 1P75A 3TMKA 2QZ4A 3KDSE 2GVZC 1JB1A 4TQ9A 3GJ6A 4AURA 2R8RA 3MWJA 1VKJA 3OFNA 3P20A 4R2IA 3VR4A 3ZS8A 3RABA 1G3RA 2ZE5A 1TUEA 1WQ1R 3HU1A 3PVSA 1CF4A 3K9GA 4Q4HB 3FFBA 5DGXA 5JWOA 2J0QA 2FDCA 2PEYA 5GJVC 1KY3A 4AKGA 2H92A 2ZJ2A 3U3MA 1S8FA 5KDLA 5JJLA 2PMDA 4IOLA 4HSEA 3TR0A 3CF0A 3HDTA 4NYJQ 3KQKA 1NN1A 3I62A 4K8OA 4LOAA 1SVKA 2O5VA 4IEIA 2D06A 2VA8A 1IN8A 4EFLA 3OEED 3QF7A 1ZNXA 2OLKA 3EWSA 3EIQA 2WICA 4B6EA 1CR4A 3K0SA 3B2EA 2WIAA 5FBQB 1EFTA 5JECA 2DWQA 4MYUA 2OT3B 3C16C 2QROA 2A2ZA 3TVTA 2UZ3A 2ZUCA 2G0TA 2BJWA 1X8JA 3QF4A 4QJ5A 1EX7A 1D2EA 5FOSA 2F55A 4LV8B 2J3EA 2J45A 4BFVA 1HT2E 1LS6A 4DB2A 4QL3A 3CRMA 4LPSA 4N3NA 4JLPA 3I92A 3B9QA 4S35A 5BN4A 1CBUA 2CE7A 1CJKC 4AC9A 1GKYA 2OAP1 3OEEA 4H1VA 1ZIPA 1P3JA 1EGAA 2R6CA 3OAAD 3TW8B 3GLFE 3SI7A 2O8EA 1Z0JA 2PCJA 1UPTA 1UBFA 3QKTA 2Q3MA 4OI4A 3GLIA 2QAJA 2WWYA 4GBMA 4QNMA 4D4JA 5TY0A 3UMFA 5K8TA 2WJYA 1U0LA 2EFGA 4NYMR 4P4UA 4HB0A 3CF2A 2QT1A 1DG1G 1JAHA 1N5JA 1W2GA 1P2SA 1XMJA 2Q3HA 3QXXA 4LPKA 3B13B 4KJZA 2QRNA 4F38A 1G4AE 4YDHB 1Z6TA 2VYFA 2JLYA 3GEEA 1PJRA 3EPHA 3TKLA 4OI0A 2OAQ1 1KI4A 4P4SB 1HE8B 4OK5A 1QVRA 4EAQA 4LJ8A 3OAAA 3P26A 1Y63A 4QHYA 3ND9A 1MO3A 2YYZA 1XEWX 4CEJA 4O2LA 3WNBA 5KUTA 1LB1B 3B82A 1GNRA 1MH1A 3EC2A 4A8JC 1OF1A 1W36B 4G5SA 1JQJC 3DMDA 1LS1A 2JLUA 2WWXA 1UBEA 3QQ5A 4HB2A 5FPYA 1GG2A 2JLWA 4EPWA 4AKIA 1CR2A 4DCVA 4BFXA 2ZYUX 4QBIA 2F1IA 4LJAA 1XXHE 5KSPA 4AIIA 3U3KA 4HAYA 1YZKA 4TSFD 3E70C 3NH9A 1OXSC 1VG8A 4FMDB 4PAQA 2RGNC 2FGJA 2IXGA 4BFTA 1EFRD 4DLRA 3CH4B 4PZYA 2MSDB 3EIHA 3WYFA 2C03A 2ORIA 2BKUA 5KTYA 3A36A 1ESMA 1N0VC 1ZM3A 1GAJA 3RSOA 1WMSA 1TX4B 5AUQA 2ZRKA 3LDAA 621PA 2KSQA 1DBSA 5CM9C 1QG4A 4E09A 4TMXA 2X77A 3H1TA 3ETLA 2JJ1D 3T1OA 1X1RA 4RFVA 1FX0B 2ODNA 2J46A 2RGEA 5FH9A 1P72A 2DFNA 4JVSB 2YNMA 3D31A 1IN4A 2FPMA 3GFPA 3Q5DA 1E98A 4Y0AA 2WSSD 1UEJA 4R98A 1XEWY 1M2OB 4FCWA 5AJVB 5DSZA 4PTLA 3O8BA 1A2BA 1G20E 1EFRA 3CPHA 2GJ9A 4TN1A 1Q1ZA 2OEPA 1AIPA 2NG1A 5FBLB 1C9KA 1E0SA 4DCTA 3IIMA 1EFHA 1ZM4A 4JVLA 3U5ZB 1D5CA 2FZ4A 1ZD9A 1II0A 4UXJA 1VYVA 3PUVA 4KXFB 1G7TA 1FTSA 4OQMA 1IJEA 4Z8YA 3VAAA 5J4LA 2JASA 4ZIRB 3C14C 5KNBA 4MITA 1UFQA 2JJ1A 2GVDC 2NGRA 5G41A 3T06B 1RYFA 1VECA 3CRW1 3AF1A 1OW3B 4MRVA 2QM8A 1HV8A 3R8FA 1QHYA 2GEVA 4U5XA 4UNNA 2A3RA 4NCHA 4Q1CA 3FE2A 3SNHA 5HE8A 2O8BA 4IKEA 2OCPA 3AP2A 4IJMA 1XDBA 4IOMA 1Q1BA 1OIVA 1TUIA 1UADA 2QMHA 3LD9A 4PSAA 1XB2A 2RGGA 1X6VA 5EE5B 2QSZA 4TQAA 5FUVA 3X1XA 3FPAA 3AH8A 1D2MA 3F8TA 1E79D 4XVRA 2GAAA 2WTUA 2CXXA 1Z6XA 3I72A 4KFRA 1ZJ6A 4BZXA 4KFTA 2J41A 2PLRA 2WAYA 3WMGA 1Z0FA 3B5JA 3SC3A 3UG7A 1U2RA 4CIDA 2Q9CA 1N6NA 1S1MA 2NPFA 4QM7A 5FOTA 1D9ZA 1RPZA 2AX4A 1QHSA 3QE0A 1E2DA 1R8SA 2XXAA 3B8HA 1ZU4A 1NY6A 4KU4A 3IIJA 3NBZC 3IBYA 4P0TA 1ODFA 3GCGA 2J59A 1DAGA 1HT1E 1G6OA 4OHXA 3QXCA 3TIFA 4TL8A 4RCYA 1RW4A 3U3JA 1XRJA 4ZDJA 1AM4D 4Q19A 4BFYA 4TYYA 1FMLA 4V0MA 2IX3A 4UXHA 3P4YA 4F92B 2HCJB 2BMEA 1E79A 3I61A 3KB2A 3IHWA 4Q18A 4KYIB 4Q9LA 5G53C 1GKIA 3UMRA 2PH1A 3LLMA 1KSGA 2WM9B 4DEYA 4TL9A 1ONBA 4MUBA 1KO5A 1KJZA 2C9OA 3CWZA 4TLCA 2QGZA 1OIXA 3LX5A 2J1LA 1RJ9A 3I5XA 1DAKA 1MABB 1RE0A 4HUQB 4QJ4A 3RS7A 4ZCMA 4WA7A 2OBLA 3CUEF 1Z5ZA 2XJ4A 4DT1B 4PFSA 2OBMA 1CJMA 4U00A 3ZJYA 2EU8A 5LB2A 1G19A 3RS0A 4DBLC 1E2EA 3HJNA 3NBXX 4Z51A 4PQRA 2ZYVX 2FG5A 4NCNA 3VKGA 1U0HC 2RGBA 2D2FA 1KI2A 2ZS9A 4F91B 3BB1A 1UKYA 1N2CE 3KKOA 4URVR 1SULA 2IF0A 5AUPB 4B3BA 1XD2A 4KBFA 4Q7JB 2HXYA 4DUGD 3A1WA 4L15A 4R9UC 1Z0KA 3SZRA 1OFUX 3ZZ0A 1YRAA 1Z2AA 1HA3A 1UDWA 3RNLA 2Z6VA 4JLMA 1U8YA 3AKDA 3U60B 3DEFA 4DSUA 1W7AA 4PO9A 2W2VA 4XIGS 1CJTC 2G6BA 2ZRMA 2G1KA 3THXB 4CGZA 1B0UA 2OCBA 1NVUQ 2ZRJA 5B2ZA 4F4JA 1H8ED 2A30A 2ZU6A 3SQWA 2ZPTX 4OJQA 3NDPA 4QGHA 4EFNA 2IUUA 2V8OA 2YV5A 3I32A 2RGAA 3GLHA 5KSYA 1XCGB 2HYIC 1IXRC 1WDTA 1NG1A 4M1KA 4DUGA 1R2QA 1W5TA 1U8AA 1XBTA 4OKSA 5CITA 3BBPA 4G3XA 1E69A 4NTZA 4DCSA 3AUXA 5EXPA 2B7CA 3HU3A 4TMKA 1WBDA 2O8CA 3AVOA 3SOPA 1DS6A 3BIFA 4AYTA 1F6BA 2UVQA 2XEXA 4W5HA 4MA4A 1JEEA 2MSEB 5IHPA 3BJIC 4BGDA 2ZJAA 1E9AA 1XNJA 1EX6A 3QF4B 1KO8A 1P4SA 2FE4A 5JHGB 1Q44A 1XJQA 1NKSA 3DOFA 3KFXA 2I4IA 4OI2A 1Z0IA 1XCPA 1FMJA 4IXNA 4Q01A 2R6FA 4DCUA 1Z2CA 1JBKA 2AWOA 3ZH9B 4M9ZA 4Q00A 2EVWX 3GEHA 1SXJE 1DAIA 4M2LA 1R5NA 4RZXA 4CVNA 2IYTA 2O8EB 4PPGA 3FWYA 4A8JA 4LC0A 5C4GB 3GLIB 4RJLA 4LZZA 5J4KA 3SEAA 2BDTA 1KKMA 1P73A 2Q6TA 2CVHA 1W0KD 1N5IA 4MQBA 2ZE6A 5E7JA 1ZC4A 1OFIA 4XTRA 2YOFA 4Q9JA 3RSLA 1E9FA 3X1ZA 4BZPA 1FFHA 1LV7A 4ASUD 1X8LA 4FXPA 1G8HA 2HV8A 5H1YA 3OZXA 3LX8A 5KSOA 1GKUB 2RGNA 3MLEA 1DTSA 3PITA 2C5LA 5DYGA 4ZDIA 4M9XA 1GL7A 2C78A 4P33A 4G5OA 2GJKA 2XZOA 3G0HA 2IWHA 4YMTA 3DO6A 4XSGA 4Q21A 5EP2A 5TXGA 5L3SA 1LY1A 4UNRA 2GESA 2OM2A 2ZYTX 4B2IA 4CEJB 4KLZA 1W0KA 1MT0A 1BYIA 2VH5R 4FW9A 1A82A 1II8A 2R2AA 2FPLA 4PZLA 4AK9A 4HB3A 4ASUA 3M0EA 5FPHA 3KX2A 4DLZA 3MWYW 3TH5A 2PL3A 3IDQA 5TV2A 1P2VA 4N0DA 1E94E 1E4VA 2UZIR 4QHSA 3EWAA 4IDOA 2J7KA 1IN5A 1F2UA 2GA8A 4EJSC 1FZQA 1AS0A 2FSIA 2H1LA 1VG1A 2ZEJA 3CO5A 2DFKB 4URXR 3U4QA 2AHOA 3THOA 1PUIA 5FTMA 3L82B 3TVDA 4CT5A 1KK3A 4Q7KA 1RRFA 4LYAA 2F9MA 4G01B 3WP1B 2BEKA 3UXMA 1BIFA 3TE6A 3QOFA 3IEVA 2GBLC 2E1RA 5DYIA 4L16A 1RRCA 2WJIA 2IYVA 1P61B 1XTSA 1ZINA 2OFOA 1KO1A 2CJWA 2GCNA 2PT5A 5GVSA 5FOWA 1U8ZA 1L4UA 3THWB 4PC6A 5D3MB 2V54A 4LBWA 3DDCA 4UJ5A 4Q9IA 3KKMA 2P5SA 2H16A 2J7PD 4BFUA 4TL7A 5G3YA 5B57C 1XFAA 4I1VA 2I1QA 4D0LB 4BEJA 1UF9A 1K6MA 5FR1A 2C77A 2XAUA 3OIYA 2WKQA 1KJWA 2NOAA 2VHQA 3TUJC 3AF4A 4TMWA 3VR3A 2ZJOA 4GDFA 3NEYA 2RB4A 4JMPA 1FUKA 1Z06A 2FFHA 3TAUA 3SJZA 2F1RA 5BWMA 3KXIA 2Q9BA 3EG5A 2QRZA 1DAEA 5BQ5A 3K1JA 2XNSA 1BO6A 3DM9B 2D7CA 4NCKA 2J7PA 4DWJA 4BFZA 1W47A 3SJCA 1I4LD 4GP6A 2O8BB 3FYHA 4KYUA 2ZI5A 1KI3A 4KFSA 4KV9A 4YMVA 3C7KA 2ODWA 3DPUA 4LJ9A 1IY0A 3H2YA 4IFBA 3SU8A 2YZ2A 2AR7A 4NYJR 2KBFA 4PHTA 4WXPA 4ARZA 1SKYE 3VKWA 1W4AA 1Z22A 2P6NA 1MO4A 1T5IA 2R6AA 3ND8A 3TSWA 5JEDA 2QAGC 4JYCA 5C4MA 1KHTA 1VPLA 1JJ7A 4Z54A 4US2R 3L2OB 3GJXC 1P2TA 3G82C 3T1VA 3V4RA 3GFOA 1NMZA 4JLVA 2KE5A 3IO5A 1GM5A 1MKYA 4LHWA 1OHHD 4F7WA 2ZRCA 3ADKA 4D25A 3L0PA 1EWQA 2HUPA 3LLUA 3NIBA 3EARA 2Q21A 3TNFA 1JPNA 4TLBA 5C1BA 3MUFA 2VQSA 2VSOA 2WV9A 2ZS8A 4HLCA 2JIZD 1D2NA 2A5YB 3KQHA 5EUQB 3WHKA 5DE3A 2PX3A 4JVNA 1QHHA 2ASEA 1XMVA 4DRZA 4HZIA 3A4LA 2GNOA 4TTRA 2NO9A 4A2QA 5J47A 2FZLA 1GFIA 2GILA 1RJ9B 1VMAA 1XPRA 2Y8EA 1BMFD 2YVUA 3LW8A 1UEIA 3C5CA 1CTQA 1OHHA 2QPTA 2AD5A 1U98A 1F48A 1GIAA 3BOSA 2XOKD 1CLUA 1DAHA 3WRXC 3BH7A 2J0UA 1VYUA 2ZSAA 5DN6D 1HE1C 2JIZA 3JVVA 1BKDR 4C0LA 1I4DD 1KOFA 5EZ5A 2GKSA 1OV4A 3GFTA 4RD6A 3HPRA 1Z83A 1EXMA 4J0QA 1P60A 3TUZC 1R0XA 2DFLA 1TU3A 3WXMA 1XD2B 2LWIA 2BCJQ 1ZM9A 2XTMA 1F60A 2X2EA 3L0IB 4YMSA 3K70C 1BMFA 1VCNA 3NXSA 4DDVA 3QJYA 2IT1A 4F4CA 3SYKA 4URZR 1CKEA 1LW7A 5JRJA 2XOKA 2FV8A 1F3OA 3CR7A 4TMTA 3W5IA 2OXRA 4RZ2A 5SZIA 2AXNA 3P32A 3BERA 2NQ2C 2NO6A 4QHTA 5DN6A 4Q1AA 3GLGE 5L3VA 1E1QD 1VTKA 3EAQA 3JVUA 4TTQA 2JLSA 1OLOA 1TF5A 3QUSA 4TTPA 5DO9A 5CM8B 3R8CA 3LXRA 2XX3A 2N46A 1NRJB 2A5DA 4US0R 4GP7A 1AK2A 4JS0A 2JLZA 2OFWA 3ZD6A 1Z0AA 3HU2A 2WOJA 3CX8A 4FMCF 1KIMA 3Q5EA 4AI6A 4B44A 2O8CB 1S9HA 1ESNA 2XB2A 5TARA 2PEZA 3R7WA 4CRWB 4KCGA 2PBRA 2CBZA 5CB6A 1E9EA 2JDID 4DSNA 3U2QA 1E1QA 3QKRA 3MMPA 1KSJA 2BBOA 3QKUA 5CDFA 5FUWA 1Q1QA 4PC1A 1SGWA 3CIOA 1ZVQA 2AK3A 3TQFA 2B92A 3Q85A 5EJEA 3GJ8A 4HB4A 3R20A 3RANA 521PA 3K9NA 3Q8XB 4YLGA 4GFDA 4JT4A 4B48A 4D4KA 5LD2B 3QBTA 1KK1A 1G5RA 3CKLA 4M0LA 1YRBA 4A8JB 5BN3A 2P67A 2LKCA 3CNNA 1Z47A 2WWFA 3VKHA 1LF5A 2RCNA 3F0TA 3KJEA 4OQLA 4GOKA 1YZLA 4TWZA 3L0SA 1G8YA 4JJZA 4W5JA 1OT3A 2JDIA 1E2MA 2Z5FA 1Q12A 1Q22A 3LY5A 4MH0R 2AFHE 1U81A 3AQ4A 3U6BA 1XWIA 3U3OA 4A2PA 1GNPA 5HZKA 1YR6A 2FEMA 4W5WA 3BRWD 4TL6A 1KY2A 3G5UA 4B71A 3FHOA 1ZYUA 2GBLA 2IYXA 5F2EA 2ONKA 3P27A 5L3SB 2WAXA 2FMXA 2OG2A 4OK6A 1G3UA 4JLNA 2YC4C 1YZGA 2GHIA 5FOUA 4BASA 1DOAA 3VU9A 1TF7A 1US8A 3PG5A 1II8B 1R10A 4BLRA 1WXQA 2W2XA 4TMZA 2IA5A 1SVLA 4JSTA 121PA 4JL6A 1P9RA 2X1VA 4YQFA 2VSXA 5P21A 1ETUA 4QXAA 4KVGA 3QI2A 5ELXA 3P4XA 3OEHD 3W3ZB 1TL7C 2NO0A 1OE0A 5FPTA 1VG9B 2CK3D 5BXQC 5JI2E 5LPNA 1E32A 1E2JA 3U4QB 4AG6A 5EXXA 2Z0MA 1AS3A 1E2FA 4RVCA 4HDOB 3RVBA 2OUKA 4FN5A 1YHNA 2D62A 3VR2A 4C0HA 4PHFA 2EYUA 4XVQA 1EK0A 4R7ZA 5KHOC 2HJGA 1OB2A 3KUDA 2CLSA 1Q57A 2OHFA 3B9PA 1IM2A 4JIMA 2QE7D 4A36A 3LBHA 2YOHA 4LHYA 3S1AA 5HKKD 1R0ZA 4B3GA 3SJBA 4ZI2A 3K0CC 2VTKA 4PSVA 5JEEA 5E7MA 3RRNA 1T5LA 2C2HA 3LNCA 3CNOA 4KVAA 2CCJA 3OEHA 1CJUC 1WF3A 2QM7A 3QKSA 2CK3A 3EASA 5C18A 3MD0A 2JLVA 5J4VA 1E2KA 5FR2A 2ZSEA 4CYMA 4I99A 3GLIE 3QBVA 3UPUA 4AY2A 4XD7D 3U44A 2CMKA 1HURA 1ZRHA 4X8LA 1FL9A 2QSYA 3NHAA 4V0OA 4RFSB 3QNUA 4G5GA 4URUR 4A9AA 4D2IA 2QAGA 1KYIA 2GCPA 1X8KA 2ODEA 4FMBB 1I2DA 1HQCA 2QE7A 4MUAA 5HKKA 5CIQA 1U99A 4DDTA 1D8TA 3AVTA 4PQFA 4XVUA 2VP5A 2X19A 4XTCS 1TAGA 3KKNA 4ZDKA 1SKYB 3PEVA 1QBKC 3CRVA 4D26A 1U94A 1YVDA 4NZYA 2ZAOA 1IHUA 1S3GA 1QZXA 3QPUA 3QVUA 2IWRA 1YR8A 3ADBA 4TYWA 1HY3A 1GWNA 4RD4A 3RS3A 4OQXA 5G40A 4BPBA 3RS4A 1AJEA 2FFAA 4GPTA 3AEZA 4B2PA 4QFMA 4LJ7A 3THYA 1E96A 2F1JA 4ARZB 4TLAA 2ZJYA 1YZUA 5CIWA 3RDPA 2J0SA 3ICQB 3RYTC 1L4YA 3FFAA 3ZD7A 3K70D 1Z63A 2V9PA 3Q3JB 1XP8A 1P9WA 4DLVA 3KL4A 1LF0A 4UXIA 4B35A 4G5QA 2FSFA 2GXQA 2BWJA 4IW3B 1VHLA 5IK2D 3FVQA 3HYRA 4QOSA 1A2KC 2QBYA 3IEUA 3NBFA 1Q3HA 1V43A 3EA5A 3SE0A 1FQKA 4LWZA 4TSFA 5DHAA 2G0NA 1W49A 2BV3A 3BK7A 1NLFA 3LH5A 5KDOA 3BFKA 2R9VA 4KBGA 2G77B 2ZTSA 1N6RA 4IEEA 5EQTA 4CZ2A 3UATA 4K81B 3AVWA 3EPLA 4DLXA 2OBNA 1E2IA 4OK3A 4QGFA 1IN6A 2AL7A 2AXPA 3KXLA 1NMYA 3QEOA 1F2TA 4JLAA 4EDHA 4IVRA 4M1WA 1QHHB
chains in the Genus database with same CATH superfamily
1PJQA 4ZYWA 1PW5A 1Q0HA 3TQCA 4E14A 1WPXA 4OXXA 1I7QB 3CMMA 1JECA 2I80A 1MX3A 3CRRA 3IT1A 2G1JA 1GPMA 1Y3HA 1JR3D 4J75A 1K63A 2EDAA 1P6UA 5GONB 5MN6A 1UM9A 3ANSA 5J4YA 3PIRA 1T9DA 2J9XB 3MMXA 3IOCA 4I1SA 3NB0A 1VB3A 1N3BA 1S4QA 1SOVA 2PANA 2WSSA 4A2CA 2HNKA 3UPUA 2FNAA 3FAKA 3H4TA 4W6ZA 4YPOA 2A1UB 2BUAA 1QONA 2XRYA 1D07A 4OHKA 2BY4A 3C7AA 5CD1A 4Z7JA 2NYAA 4P82A 3FETA 1CYDA 1YB2A 1CUUA 4Z1OA 1WVGA 2Y1XA 3GT7A 3H19A 2P9HA 2Y1WA 3V33A 1YAJA 3JQ7B 3UM9A 4RIGA 2KHZA 4NR0A 1U0JA 2F90A 3E53A 2BGGA 1GV1A 2Q0HA 4MWSA 3IQDB 4DE5A 4GI2A 1QVWA 3BRCA 3GLGB 2ZITA 2XVMA 5KTPA 4MKHA 2KWIA 3LRPA 4MCHA 2OP1A 4NONA 4PHGA 4UHJA 3NNSA 2D00A 1JG2A 3GGOA 3LVFO 3NWEA 1DTEA 2ZSDA 4XB1A 3R5HA 2WJVA 4N54A 2K5UA 3VDRA 2FYTA 2EP5A 1AGNA 4HZUA 5H3LA 5CBKA 4IIDA 1T9ZA 9LDBA 3KZXA 1G63A 1MV5A 3C7CB 3OIUA 3OOEA 3UMMA 3FDIA 2PZAA 4HKTA 3JZDA 4FMDF 4XM2A 4C03A 4PLWA 1V37A 3I73A 4MJLA 3FVTA 3QYJA 1JZQA 1N5KA 4WRRA 1AK9A 3N05A 2P9ZA 1VHQA 2V5UA 3DE6X 3N7UA 2J4DA 4RKFA 2X76A 5HEKA 4M22A 1OAKA 3GFRA 2ATEA 1DKPA 4TQUS 4F4UA 3RVMA 1F0KA 3O9VA 4TUYB 3WWCA 4QJ3A 4ZI7F 3TECE 2GZRA 4JV5B 2YC2C 4B4VA 1G21B 3DEZA 2FPIB 2A1TS 3P2JA 1CUFA 1G55A 1KSHA 2PFGA 4FHEA 4LE2A 2V65A 4EHIA 4AUKA 3B7GA 3V80A 1VMDA 3DVLA 3BMCA 4YFVA 3DKRA 2VTBA 2V6IA 1CY7A 1YH3A 3DFKA 1JXOA 1PGOA 2G07A 4XUGB 3VSEA 5L6LB 1NL3A 2OE2A 5B64A 3ETCA 4KFUA 5IMSA 1AUQA 1OXVA 3IC5A 4EPRA 3AJEA 5L45A 3GJ0A 3R7WB 2PUAA 2O4CA 1ZD4A 2H54A 3K0KA 4ZCLA 3MOGA 3DMRA 1F12A 4O0MA 1A9ZA 5DNWA 5AK6A 1KEUA 1K7YA 3C41J 3KJFA 3UKDA 2H7CA 2B37A 5L95A 4XDGA 3QKRB 1VJGA 4KTTE 4I1YA 4F71A 2VK4A 3VYWA 4Q4AA 1C3OA 2A0YA 3FMFA 2JJQA 4J16A 4B87A 4Q16A 1RKVA 2A9RA 2PQ2A 1KJJA 2VPYA 3IBCA 2TECE 4JBGA 5DXJA 4LF7B 3A6PC 1A4IA 3Q1KA 1C1XA 3PD1A 3QXSA 2CXUA 1GGNA 3PPIA 1XMOB 5LU9A 2AWNA 1T4GA 1WEKA 1Z7WA 2PH5A 3AOEC 3U4IA 5G3ZA 1DWOA 5T3UA 1YJ8A 4NCJA 1PNVA 4PZCA 1U04A 1O54A 1FU8A 2IYYA 2ST1A 2YH2A 1USIA 3T99A 4EVIA 5PNTA 3G8AA 1U2PA 4A0FA 1RMTA 2W4QA 1WXGA 3PX3A 1Q1GA 1KAOA 1V48A 1W46A 1E5QA 2YWGA 3C5HA 4L28A 4OA8A 5FF9A 1PZXA 1JSLA 2B35A 1XA4A 3JQQA 4LY3A 4WHMA 4WWHA 3UA4A 4DCOA 2JK1A 1G4UR 1J2JA 2BMAA 3H1BA 1Q2UA 3L7KA 4LGMA 4BWYA 2X6TA 3RTGA 3AVXA 1O1YA 2FQYA 3V6MA 5LDGA 4BUJA 3KZ1E 1D1SA 3KD3A 4MZDA 4AJ9A 1O7JA 3ETJA 4ZPXA 2BPOA 4Q1BA 1J2RA 2JI6A 3OSZA 3I4FA 4KP7A 2H1WA 4RPHA 3EG9A 4FI3C 1MPTA 3C7DB 2D0IA 4QARA 1XTTA 4UHHA 1R66A 3BFVA 1TCBA 3HLYA 4EPYA 1F0YA 2E85A 2HF9A 4URWR 2XCUA 3N5CA 1ELOA 4MVJA 1OH6A 4IGIA 1QFMA 3C3JA 2VRBA 5FI3A 3VSAA 3GDGA 5LQSA 1XQ1A 3C3EA 2DKNA 2L18A 3H0KA 2F3RA 3QELA 4WVLA 3RC1A 4D6YA 4ZI3A 1T0HB 4BNIA 3LKDA 5DV9A 4NU0A 5EUBA 3B1WA 4ER6A 1WV0A 3L4KA 2Z2YA 5ALYA 4JEUA 2RSLA 1S3FA 1H8EA 1KDOA 4MWBA 2R68A 4TWJA 1O94A 4EQZA 3PEEA 1L3CA 2UVPA 4WW0A 3TPZA 4DV1B 4F2HA 2O4UX 1NI3A 3SYMA 2P75A 2OBXA 2P2SA 4C0KA 3QVMA 4OG2A 1PWZA 2CZCA 5BN4B 3OE5A 5T5QA 5IAGA 3VYRB 3VX4A 2J3IA 4BP1A 4EHAA 4YJGB 3T7EA 2ZUUA 5ADWA 2HA0A 2JATA 4PZAA 1NA5A 3UFBA 1NUHA 2H2DA 3ASYA 1TTPB 2F67A 1UKZA 1Z3IX 3W3AD 2QL9A 1WZ2A 2ORED 5HZHA 1XPJA 1RU3A 1M33A 2H4FA 2HLDA 3JQ8A 4G9GA 3BMNB 3S1AB 3EWIA 3KKPA 1TQ4A 2QQ0A 3KLBA 3NV7A 3P2EA 4HGOA 2Z57A 4NYIR 2DB3A 3SX0A 1WMBA 2KBEA 3NAMA 3HCPA 1NXQA 4YECA 2FSPA 2YYYA 3HZOA 1UKBA 1KDZA 4KTVE 5J5CA 1RRPA 1FS6A 2A88A 2XNDD 3AILA 4RKEA 1IOWA 2C2OA 3QUCA 1ZVKA 4OIFA 4QQRA 4QELA 3OZUA 2YCLA 5EIHA 3W6PA 5BSMA 2PT7A 5FULA 3G9ZA 3LQRA 1QUEA 1CUEA 1U0BB 4ZTZB 2WWWA 3W5JA 2J5KA 3IR5A 4IRXA 5CA1B 3P0HA 1GQQA 2M1ZA 2JB9A 4KYTA 4TVBA 4D4GA 2VT7A 5FLYA 3ADDA 1XU9A 1Z45A 1V3TA 3ZX5A 4FYXA 3ANXA 2CJXA 4LEIA 4W7IA 4ANFA 5ADHA 2QAGB 4N3AA 4D9NA 2IW3A 2O1SA 2V7UA 2B5WA 2WJZB 1TIKA 1NR1A 2HRRA 2BFFA 2ZE7A 5CB8A 1N7GA 3AERA 4M0CA 4WOBA 4DMGA 3DUFB 3OIWA 1USKA 2PA3A 2GX6A 2I33A 4MQFA 1D1PA 1OROA 3STUA 4D9KA 3PQCA 5KYKA 3WWOA 1WD7A 1SKQA 5CDYA 4IYJA 2VP3A 3VHXA 3LFHA 1DEKA 1VCOA 1WXDA 2HRBA 4RWZA 5ERXA 1N32B 3OPXA 2WJGA 2GB4A 3SSMA 3EXAA 4EJ6A 4Z9AA 3RYHA 5J2TA 1HDCA 2EF0A 2OCIA 5CK4A 4YLYA 2H2AA 4BECA 3L43A 3CPEA 3V1UA 1OU0A 2XOEA 2FSHA 1MV8A 2CNWA 2YZGA 3FYUC 4ITVA 9LDTA 5KOIA 1XN1A 4MZXA 1GPDG 1S3SA 4QTUB 5K3FB 5KSWB 3TKYA 4AVYA 4P3XA 3PXEA 2GA9A 1M8JA 2LR0A 4NRDA 4PX9A 1M73E 1JWAB 3IOEA 4CNQA 4ZYLA 5LQJA 3S0JA 5EYPA 2HDHA 3BKXA 2C4HA 4G0VA 4TXLA 2B1IA 1EDOA 1U7ZA 1V8ZA 2R6ZA 3BE4A 4QJIA 4WVFA 5CW1A 1N6KA 4MCJA 1DKQA 3GF4A 3NTLA 2VXYA 1C3LA 2CDBA 1NKTA 3EXEA 3LC1O 2NSJA 3N70A 4L0DA 5K1ZA 1PVOA 1J1IA 2QBYB 4MPTA 2WFLB 2DWPA 1GZUA 4NIMA 3WLSA 4BRUA 1CUBA 3BD6A 2OR3A 3ECSA 5CTAA 3IMGA 5L3ZA 3VR5H 4C0XA 4DDWA 4UTVA 1PSWA 3PQFA 1Q0UA 3AI7A 1MIOA 4GXQA 5J40A 3I5UA 3AUYA 1E7WA 1ZBDA 3OM9A 3PTAA 4C3ZA 4BGVA 2RG1A 2GN6A 3T7TA 1ZSYA 3BTUA 3N76A 2AJLI 1GGMA 1Z12A 2EKBA 2UVDA 3R24A 1P2GA 2A0UA 5DJ5A 1K1EA 1F2TB 3AR4A 3QQPA 4ESOA 3LKVA 1XAJA 1XRQA 5BVHA 3WGIA 2H2WA 4TZTA 1JDTA 2XQGA 3AP3A 3JWHA 2NZYA 4KMRA 5J59A 2RGYA 2XVZA 4WZAB 1J7KA 1WQ4A 2XHEA 4D0NA 1YRYE 3ZDZB 4PCAA 1E5XA 1OKKD 3LCRA 3HJHA 1UM9B 3GDOA 3I9KA 5T4BA 1HG0A 2I55A 4UUOA 5AK0A 5K51A 3ZZUA 4CMIA 4E5SA 3RUFA 1FRVA 4MQ5A 3MOSA 3O03A 5SY4A 2J08A 4HEA6 1GPKA 3UANA 5IU6A 3PL5A 3IRVA 4MHSA 4POOA 4JSRA 5FNVA 3R0QA 4TYPA 4DQXA 1EVJA 1VZ2A 1OOEA 4UUBA 3X1DA 3PNLA 4PPFA 2WYWA 4X84A 4BO5A 1LPBB 2Y66A 2ZREA 3DFZA 3LA6A 2DETA 1QIHA 3D7RA 3WTCA 1KP3A 2IPMA 2OFFA 4BLSA 3VQTA 1FP7A 1M7GA 4BRWA 1TEZA 2BBSA 2PPVA 4H60A 2G4CA 1CS4C 1NMQA 2JFNA 2XDQA 3GMDA 1OXUA 4DRXA 3IQXA 3X2SA 1S0UA 4KKVA 4DREA 1M6NA 1XVLA 5GVRA 4E7PA 5KYTA 1SIWA 4HZUB 3D3JA 1A8SA 4JQOA 1KIAA 2BTEA 4MAFA 1W5FA 2O6HA 3JYNA 3FHJA 4RIEA 1B8VA 1YQ9A 2PMFA 1E2PA 2QQGA 3BX1A 4TPKA 1ZM2A 4IH4A 4YRIA 2FP3A 1Y4ZA 4PG8A 3D6NB 2C4MA 3DOCA 7ADHA 5JXHA 2F62A 1XPOA 5BRNA 1KFBB 4DMRA 1M1YE 4BE7B 1X15A 3EIUA 4WY5A 2MT9A 3LQQA 3VJMA 3UWKA 3ODPA 1RXVA 4OV6B 2QVGA 4QXQA 1UJCA 3FWNA 2AFIA 4O0LA 1EFDN 4YJ3A 4E30A 1GUAA 3H0CA 4H31A 2NPIA 3QIVA 4B5KA 4IUCS 4ZAXA 3VVCA 2V7QD 1NXTA 4II7A 4DLTA 5IDYA 3TR5A 3PENA 5JRZA 1OWNA 1PNTA 1YR3A 1JH8A 1P3DA 1IL0A 3K9LA 3ZCTA 3N1UA 1QRSA 2O3RA 3F78A 1QHIA 3GEIA 1AN9A 3K9BA 4N5HX 1W2WB 4B3DA 2CXPA 1W35A 4B40A 3K9HA 4G0XA 2CJYA 2Y0BA 4DMCA 5TJHA 2CNNA 2XMPA 1POXA 1S2OA 1PFGA 4O5OA 4U7WA 3ZWPA 1T5OA 1Q1NA 5SZHB 1LUAA 3V4ZA 4AP5A 1EBBA 2ZRLA 1KGSA 3PJFA 3WJ7A 1XD9A 1ZLXA 4K3UA 5JZVA 4PO3X 3AINA 3B3JA 1OREA 2VXBA 3OKFA 4X71A 1HSZA 2I5PO 2ZYIA 4YO7A 3T0GA 4Q4AB 3X3HA 2QNRA 1P2FA 3WYCA 2Q46A 3VPSA 5LZ8A 2OWDA 2HQ1A 3EB9A 4PPQA 2QMEA 4MICA 3AESA 4V0KA 2AFVA 3IV9A 1ZJ5A 1C1XB 2WZQA 1XDWA 3PGA1 3QY9A 1ZPDA 3ILSA 2RGCA 3G49A 3F3SA 4MGIR 4XYBA 1L5GB 4D92A 4UNIA 4NMMA 4ZJUA 1ID8A 1AS2A 5FLXA 4JX8A 2A6PA 2W11A 4KIFA 1RYDA 2N47A 4PAWA 3TCNA 2WUGA 3CZAA 2AH5A 3NRCA 5IDQA 5JCOC 2OFXA 2P2CA 3CEHA 1U1CA 2A0KA 2EZ9A 1OWLA 3ESRA 3F90A 4S0ZA 5AHOA 4OFXA 1EAMA 1Y6RA 2R62A 3DZHA 2Z2ZA 2AF3C 1NXXA 3PHLA 2WQ6A 3LUDA 2I6FA 1J2EA 1HYQA 3NUGA 4GZLA 4MJXA 4FHCA 5G2OA 3FZYA 3SHFA 3O47A 4Y2SA 3LQFA 1K5GA 1CUAA 1QMPA 1SXGA 4H0NA 4X91A 3Q4GA 1DBVO 4JYBA 3PU6A 3HP7A 1G8GA 4ISBA 1LLUA 4MK4A 3IBFA 1KZGB 3MN1A 2BLLA 3D8SA 4RD0A 2CLKB 4G09A 4YVFA 3SHOA 1JW9B 3QEMA 1A95A 4LX0A 1SCNE 3GLHB 1L8LA 1N36B 1WOYA 5IARA 3UXYA 2WWTA 5K9ZA 1G8JA 1N6PA 1NJ1A 3EG9B 2BZ1A 1NVFA 3T9FA 2ZI4A 4JUDX 3UT6A 1W25A 3Q12A 5EUMA 4A0QA 4RC9A 3MT8A 4OP3A 4M1OA 4WN9B 2OA0A 4MKZA 2V74B 2CCGA 3UK1A 1JJBA 1CUGA 3HBFA 3PUZA 3ZGOA 3B36A 4CODB 4EL0A 2ADOA 4AS1A 2V6BA 1BOFA 1YCHA 1XK7A 2IS4A 3FTDA 3PC4A 1H2BA 4TKVB 4BLQA 5HUQA 4GWGA 2VP9A 3QELB 4MXDA 3ZC3A 3GGPA 1L7VC 3P2IA 1A7UA 5F12A 5K0GA 1MDFA 5DI3A 2NU8A 3VBCA 2AJBA 5EZ6B 2AD1A 3D0RA 1G21E 1W4RA 1RLOA 4M4SA 4TN5A 4UARA 5I9BA 2UVPB 3EYWA 1K27A 4F3NA 5AESA 1YRLA 2R4TA 3EW9A 4JC0A 3TB6A 5F1PA 1C8VB 4IPTA 4BFWA 5SZJA 1JHRA 5ARCA 4DLYA 4F56A 2ZU0C 2BH2A 1NMXA 3G88A 1K88A 1X87A 5JZSA 1P17A 3N8KA 5IAOA 3C6MA 3V8RA 4J9VA 4MEBA 3WNVA 4MI3A 5I9MA 4KQ6A 3MJDA 3WSVA 2GK7A 4FB5A 4XDHA 1JAXA 4E5UA 4XQ9A 4RW0A 3CUTA 1OH8A 4K1LA 3HVIA 1ZSVA 4X1OA 3KQUA 5ALGA 1WXIA 2F6RA 1LEHA 2DWOA 3BDIA 4Q37A 3IQWA 4NPHA 1Z68A 3VZPA 4CLOA 3ZJTA 1CY8A 3ZQUA 2F00A 2EGUA 3UMJA 2Q3JA 1PN3A 1EFUA 3IPXA 1SA0A 4Z99A 4Z8XA 5EVCA 3JQBA 2RH5A 1NYTA 3LIPA 1C1YA 1F8YA 1KI9A 1XZAA 3IKVA 5ENDA 5G4KA 3RUDA 3T0IA 4DW8A 3KR0A 3R5TA 4C4PA 4CLHA 1ZZEA 3JALB 3ZDYB 1KAGA 3LG2A 1ISGA 2WUVA 4TMVA 4CMBA 4ZVPA 3RRXA 3DG9A 4FDLA 1FFCA 1USVA 3O75A 3OQOA 3UV6A 5KOJA 4G85A 1KYQA 2GXAA 4AO8A 1H65A 2ZSBA 1RZRD 3ZU5A 3ZIAD 1PR3A 2J6HA 3N39C 3ZQJA 5UKDA 8AT1A 3CR8A 3D8RA 3GUUA 4OREX 3VMFA 1Y6JA 3WHIA 2C5SA 4P7GA 3OECA 5ALJA 3D7NA 2OOSA 3LUKA 4MQFB 4S2UA 5GQSA 3NTQA 2ISQA 1YE5A 4IP0A 4PGAA 4QTZA 3VU8A 1W9MA 4QVKA 1IHPA 2Q0XA 3C3AA 3OESA 4YRJA 2EBHX 2WIBA 2V7VA 3BFXA 3NNDA 3HLKA 3VHXB 3Q3EA 3TZHA 2A5JA 2Z2IA 3H84A 2IE0A 1Z17A 2VWHA 3P1JA 3LCCA 5H70A 3RYHB 5AW8A 5J2TB 1BMDA 2Y4OA 5F7JA 2PA0A 2ZULA 3BRWA 1DKUA 1JLSA 1GLNA 1NUTA 4UDNA 1U0TA 4YV0A 1EB8A 2J3JA 4BGUA 4MR7A 5B3AA 2J87A 1RLUA 5JDCC 3NH6A 1QGZA 5JY6A 1Z7GA 1K6JA 3OZFA 2VP2A 2CMFA 2WQ7A 2WM2A 1LDGA 4U02A 1IK6A 3WYAA 1HTBA 5EYPB 1KZHA 2AZDA 3UMYA 4ROTA 1EE1A 2QK4A 3QEBZ 2AT1A 4ZICA 1G9TA 5DK6A 2XWJI 5KTTA 3P4UA 5E0OA 3TXXA 4ECEA 2XGOA 4MMXB 4HNSA 3F8WA 4DIDA 4LZPA 5FNZA 3S5UA 2QTNA 2PT6A 4Q39A 2XY4A 5I47A 2QN9A 3WL4A 5BN5A 1ZIOA 1FJ2A 4YRTA 1ZUHA 1RLIA 2ACEA 3REQA 4XASA 4ZK6A 2HSDA 3FI0A 4LMRA 4C30A 1MIOB 3RC3A 2O2GA 5BW4A 2FHSA 3HXTA 1ZCAA 3N58A 4CCAA 1XT6A 1IXSB 1NBOA 1KOLA 3Q2KA 3OE7A 2XQVA 4HRAA 4DC1A 2I4NA 4JIGA 5BO5A 1T3HA 5G0UA 1CEEA 4P58A 1N25A 1ZH2A 2NVOA 2PGOA 3NVDA 3ETHA 4JI7B 2GXSA 4QXRA 3TIIA 3UENA 5IBPA 4A0GA 4B7CA 5BVHB 3OPMA 1EWYA 3CB4A 3OY7A 4G89A 4PE5B 3LHIA 4R2MA 2HMSA 1AKYA 1S9DA 3IQGX 2VQ6A 5F21A 4X7RA 2ERYA 3TL2A 1T43A 1Z16A 3OWHA 5BY2A 3S68A 4DEXA 3TAHA 5DNUA 4CMIB 2XMGA 4J7UA 4YMUA 5IANA 3WAGA 1AV7A 2QTHA 3HJUA 3CN7A 3MIZA 4KDEA 2IPNA 3S44A 3UY4A 4BZZA 4UFPA 3JD0A 5FTLA 2JGDA 1GTL1 3KJNA 1KRWA 1D2GA 5FNVB 2ZM5A 3ZWDA 3BSYA 4B43A 1V95A 3GEBA 5AI0A 3IMCA 3BFJA 5AP9A 4BYGA 2X7HA 4FE7A 4CKYA 4JI0B 4TSKA 4CT4B 1XJ0A 2HLNA 4FR0A 5EP3A 2YJGA 4EYOA 3HKCA 1VG0B 1PS9A 1JS1X 1YIDA 3GUYA 3CVVA 3HUEA 4HNHA 2YFQA 2Z43A 3GFGA 2ZJ5A 2XDQB 4P0QB 2QN2A 5A4KA 1WB9A 1PL7A 2OM6A 2GTHA 2WYOA 4KUHA 4F8YA 1BZYA 3GGJA 2ZWIA 3M1AA 4NZNA 5GGXA 4ZXPA 3H6HA 5AW1A 1ISFA 3TZEA 1L7PA 2QLTA 4B85A 4J0KA 2NSHA 3UKOA 1ST3A 3H8SA 1T9AA 4NP6A 4QLOA 3EULA 5ERYA 4D80A 3RSHA 4WECA 1XZFA 3BL6A 5KBYA 5LQUA 2BGNA 4CV1A 2Q7DA 5JQWA 1D6JA 3K9QO 3RKSA 4EY3A 3EW7A 3NC0C 4H59A 4LDJA 4YT4A 3N2ZB 3EDCA 2JW5A 4X8OA 2A4KA 1ZZGA 2JLCA 2O8NA 3ZGLA 3IVRA 1CVRA 3LWZA 3TTSA 3WNDA 3K1TA 5EHNA 5DSXA 3W90A 3ZV5A 2ES4A 2CHGA 4YJ3B 4DQDA 5E9JA 2CV0A 2NZVG 2WE7A 1P3Y1 4L0CA 4WL0A 3WGUA 2BKEA 5A7GA 1JQ3A 4JENA 3WX0A 2A5GA 4PONA 4DZZA 3B78A 5DXFA 3B3AA 3I01A 4UCXA 5H3HA 3WJAA 4D3ZA 3O38A 4O2AB 1YZYA 4YJ2F 1GGVA 5K8LA 3SIRA 4K9QA 5TT0A 3UEOA 2IYLD 3FKSD 5TNXA 3LT4A 4RAQA 1FFDA 4IICA 1EU1A 4RL6A 4YQZA 5H16A 5THQA 1L5MA 3HQ4O 3FWKA 4WACA 5I7RA 4JOSA 4JMLA 2O0KA 3JSXA 1NDQA 5E3IA 1NSFA 1FFSA 1RKXA 3OQPA 4FDMA 5JNUA 5D6OA 1YS6A 1E9RA 2LUOA 3HRKA 1J25A 4GRAA 1KDYA 1S2MA 3L8ZA 3GLUA 4UNPA 4ED9A 2WKPA 1O6BA 5DBFA 3DDZX 4PO1A 4COOA 3NEAA 4L02A 1A4RA 2HT6A 2YUIA 2R1VA 3AESB 2AMLA 4O33A 4IUYA 4GXRA 3RKUA 3Q7TA 2V55B 4WOPA 4QQFA 4X64B 1YJXA 4FK8A 5A5GA 4XWAA 3BB4A 4FSHA 1CZUA 1T0UA 1EFCA 1WUTA 2OHIA 3EMVA 4UTPA 1RAFA 4DDKA 721PA 1YZNA 1Q1AA 3OX3A 4IRMA 3PUWA 3IUMA 1MPXA 3KWLA 4KN8A 2D1TA 4FCTA 4K6HA 4CR6A 3TRKA 2JEZA 3ZKWB 1OILA 4DCJA 3E5MA 5I8PA 2X3YA 2C92A 3ZI0A 2Z9BA 1OSNA 1GCGA 3DSRA 3NEJA 1OWOA 2PWYA 1WUIS 3SLKA 4JLKA 4F06A 5IAEA 1MZPA 4XDYA 4AMBA 2V0GA 4QXOA 5EXTA 5CM2Z 1N8NA 1W88A 2FQXA 2OXCA 4JI2B 1QIKA 5F4BA 3PC8A 4B3HA 1XVTA 2NUPA 4NMLA 3BGVA 1E1NA 4R1NA 2OILA 2HLHA 2LCIA 1LVUA 1QF9A 1QVAA 1T4CA 4B3SB 2W9XA 4BWFB 1ZC3A 1TPZA 2W00A 1UPBA 3ZDQA 3ZDDA 5ITZB 3SHWA 3K9WA 3O90A 2GF9A 4AF8A 2I4OA 3F6CA 4N18A 4H1UA 1W4ZA 1IG0A 2COKA 1GPYA 1QG0A 1Z37A 5CA0A 2YMLA 3M5CA 6PFKA 2HDNB 4S24A 4LXGA 1DQNA 4IQFA 4N41A 3MK31 2CXRA 4P92A 3WNCA 1TQDA 4OAPA 4W82A 3WK4A 3ETNA 1V11A 4CKCA 4DCPA 3WGYA 5I9IA 4S2EA 821PA 3STVA 2XUFA 5DI3B 2NU8B 1CZNA 2R86A 1FUUA 2OO3A 4NCIA 4TT3D 1TO1E 3KTOA 1G3IA 5AVJA 4BX8A 5JFGA 5KNDH 2GFIA 2RHHA 1NONA 2R8PA 1UBNA 2VPWA 3NBMA 2OAGA 3FPLA 5TGDA 4CUKA 2JH3A 2V7PA 5DNDA 1N2CA 1XZEA 3HRIA 3K30A 1NQVA 4AG5A 4LUCA 4BO3A 4CF6A 5AW7A 1E99A 3H9GA 2VTEA 4MJ7A 1Y1SA 2PVSA 1C2TA 1PUXA 3B20A 4OGKA 4Q48A 3QXHA 1FNSA 2EGHA 5GONF 2OKGA 3UGKA 1GR1A 1G0NA 1UBLS 3L05A 5EEHA 2VJNA 4XJVA 4P36A 2XQIA 5AHWA 2EJUA 3GJ4A 4CG2A 1WCV1 2YS6A 4CLOB 1IJFA 2ID4A 3K0BA 2IS1A 2AJDA 3INTA 3KOZA 1EUQA 2IEZA 3QSYA 4YRCA 1P1IA 1R8XA 4PYQA 2D5AA 2ECOA 2N0SA 3EZYA 3OT1A 3QEKA 1L7NA 3NFYA 1Z8FA 1ZOOA 2PU7A 4JDPA 5EE3A 1JQKA 4ARAA 1PZFA 1TC2A 5G4KB 1R12A 1J33A 2Z30A 3OO0A 3P0RA 1J5XA 4PIVA 5JPIA 4Z1MA 4HUTA 1BWQA 4GI3A 1HKUA 1FFBA 1TADA 3ZXYA 1KSFX 5AVYA 2F3TA 4HNGA 1TCUA 4MV0A 3L18A 4F5YA 4QGGA 3IVAA 1DQSA 2IXFA 3GI1A 1A8PA 2AQ8A 1N33B 5HWSA 4WZ6A 3AIMA 1B4DA 1U8FO 3OPNA 4LV5B 2WPDD 5FBRB 2Q3DA 3AL0C 4YBRA 3D6AA 1D2CA 1DDGA 3DLTA 2B5VA 4FOPA 4MGZR 1ZOSA 1EDZA 2HU8A 1JFLA 3FPHA 4FMPA 4ZU3A 3OQ1A 3BORA 4BV9A 4GXTA 4HYTA 5FX2A 4ZRMA 2C7OA 1DJMA 1U2GC 5C3MA 1RXEA 2P9EA 2CLCX 1R6UA 1ZK4A 2R1ZA 2RHMA 2XPCA 3AP1A 3CY6A 3L8GA 3TTXA 4C0QC 3EPJA 2I03A 3NWJA 3VPAA 1E1CA 1VXRA 5DGDA 2Z3VA 1Y34E 5C81A 4I9FA 1V4VA 2ZJ6A 3L4BA 1BA2A 1WMAA 4OQDA 4LNAA 2OSVA 2QXYA 4REQA 4QPPA 4ML3A 4J7CA 3WO1A 2IEBA 2GSWA 1NN0A 3VR5D 2I34A 2RH4A 1EDDA 4NCAA 1DPFA 3CX3A 4H35A 4OQYA 1SXJA 2IYQA 5KQPA 1FW6A 2NZWA 4MVJE 4QWWA 2AZXA 5EKSA 3RODA 3L41A 2A94A 2JFXA 4GWLA 4MR7B 5HUHA 1N3YA 1YS2X 1M0WA 2ODPA 3QXJA 2QTAA 4GQBA 1MAUA 1TYBE 1Z4NA 2CKMA 1C4XA 3D9QX 1EP9A 3HZRA 3PR2B 1BE0A 4KPFC 4XWWA 3L1UA 1FSGA 4N5IX 3PXUA 1JSCA 3ZYCA 2RI6A 4EX7A 1I2BA 2Q1UA 3WLPA 4PBRA 2HQBA 1E89A 3WGOA 2HMVA 1ACJA 1PJTA 2C4NA 3A25A 5BN5B 4XJXA 3QKSB 5FEUA 2CVFA 2HRQA 3LRXA 1BU8A 4MV7A 2GZ3A 1GRVA 3REQB 1R0WA 3WMWA 3MQFA 1U0SY 3B1YA 2ONJA 4MPRA 3WWYA 3B5IA 3GN1A 2W37A 5B1HA 2G72A 1JR4A 3COWA 4UEOA 4QA9A 4ZODA 1UDCA 1OWMA 3CMCO 3SS7X 1S89A 3F49S 3SFZA 1M1NA 2EJTA 5JS7A 3R7FA 4UBIA 1YGYA 3DMGA 3WSWA 5BP7A 2X0EA 1L6RA 3C24A 1QJ4A 2FI1A 1VPTA 1U8UA 2KX7A 2G88A 3FNHA 4PRLA 1R0CA 1W44A 3NDIA 4UMDA 3ROEA 4BAUA 5JDIC 2I8LA 1ZSNA 3C74A 4A6EA 3M9WA 1XX6A 2FX3A 3EZ7A 5H3CA 2IY8A 2NP7A 1IZZA 3K53A 1BKSB 1Z18A 5CB4B 3PT9A 3B6MA 3R9KA 1UDBA 1PJ3A 4B1FA 1W0JD 3IVCA 1XALA 2H4JA 3LOUA 2QTRA 4GPAA 2JGDB 2OCYC 4LRSB 4Y8VA 4RTMA 2QRMA 3TRIA 1ANKA 3E9RA 2VF8A 4X20A 2VNIA 5JC8A 5DISB 2FU5C 2QDXA 4KRXA 3PLRA 4P4NA 1O6FA 3G85A 1TAQA 2B8EA 2EERA 3PGJA 4O4LA 3VKUA 4YI3A 2Q5LA 1B73A 2ZI9A 5BT9A 3FNRA 3EK2A 3HKCB 5DOZA 4QULA 3WLKX 2O5CA 1SBHA 4ZYXA 1SKUA 1MFZA 4HH3C 1G66A 1ODTC 4ZAZA 4L5IA 3N8IA 5TS2A 3ZHVA 5IJWA 2CZGA 1B1AA 3M5DA 1M1ZA 4DCNA 1IUOA 1PEKE 1TB4A 2NT3A 3IESA 5E9WA 4MNTA 2WYUA 1AC5A 1R6BX 1XTKA 5CYPA 4CL8A 2A0FA 3DZBA 2VOJA 2QD3A 2XWBF 2B8WA 4H1HA 4HDCA 1NR7A 3T9EA 4EKYA 2F8SA 3WLMA 3W06A 1HLFA 2YKGA 3VJKA 4DKJA 5A7FA 1DIGA 2Y2UA 1VSQA 3FM9A 4ZCQA 1ICEA 4DJ5X 2P68A 4Y30A 2QMUA 5EEGA 2BR4A 3HR7A 4LCBA 5M5BA 1J8YF 3FPFA 3HDQA 4MRPA 3U1TA 2YZNA 5IJ9A 4HCJA 3KEOA 1P1BA 1U9IA 3FFTA 1GY8A 2D74A 3KAJA 2ETVA 4EPTA 4EUSA 3K70B 4NBTA 4DDHA 2HNAA 4WLFA 3KYCA 1WZUA 1HE5A 1NUAA 3C5VA 3G8BA 2GEJA 3TX2A 2X8WA 3UAZA 4AIRA 1VIDA 1SVNA 4YAKA 2VPQA 2HJSA 5L4NA 3TNYA 1I0ZA 4W1QA 4P4SA 2OYCA 2Q3CA 1G5QA 2I7TA 2H2GA 4GD3Q 4DJTA 5JD6A 1CD5A 1Z56C 5CA1F 3SF8A 4Q9AA 4W9NC 2WU3A 3EC7A 2JZOA 4FEYA 2C7QA 1G3QA 2MMGA 2A1IA 1YQXA 3EVFA 2N75A 2EG5A 1FU7A 2RHLA 3MWEA 4TGLA 1MGPA 5KYYA 3WK6A 1CRPA 1V1MB 1D4FA 4DYVA 1UBOS 4MO2A 3ZLJA 1NZDA 4FINA 4G1BA 1O95C 3QV2A 5GJBA 2I4RA 4TMYA 3QEAZ 1U3UA 3IMEA 2R1VB 2OGSA 3D8TA 3DXYA 1WA5A 3I8XA 1AN0A 3JRNA 3K5WA 4U2FA 3S99A 3U4AA 1MORA 1EFAA 3KHUA 2UAGA 3IMFA 3CJQA 3K20A 3M4ZA 4I1UA 4K87A 1T9HA 3MFYA 4B6PA 4BVJA 2NSYA 2ZSFA 3JATB 4JKIA 4JXXA 1Z07A 1ZAYA 4K2AA 4LK3A 4GOXA 1SPBS 3M4JA 3G5AA 2XNJA 3NHMA 1X1AA 4GBJA 4GNRA 4PC7A 1B3BA 4LJSA 3VISA 4RMJA 1J42A 5E9AA 3C4JA 3F7TA 1QO0A 4A0SA 4D4IA 2PWPA 1BHSA 1N78A 2DE0X 3K2EA 3SJAA 3EZ9A 3T1YB 1ISRA 1DZIA 5BV2P 3E7FA 2UU9B 4UBJA 3MCZA 1Q20A 4PAGA 1W88B 2ZSKA 3FOWA 1M2HA 1UBTS 3PDHA 4NK4A 2YJ3A 4G0QA 4QOHA 2NUPB 4ACAA 2UXCB 1M2WA 1QLJA 1T4CB 4OHOA 4EZIA 3U19A 2CFRA 1J39A 1PF7E 3OU6A 4ND8B 4XFDA 1YVEI 4WCFC 3TD2A 4R9RA 1L4MA 4Q66C 6REQA 1MRSA 3BL8A 5EIWA 1CZOA 1I6LA 3ZQ6A 5HR5A 2FA9A 5IH3A 2HA5A 5AW6A 2QU7A 2B7BA 5A4FS 2BL4A 3D5TA 1V11B 3PHCA 3HJGA 4CKCB 5EKUA 4DUZB 3PLAE 5EZYB 2IBMA 4EH1A 3HV0A 1ORTA 1FJHA 2FR8A 2AFIE 2LXNA 4Q47A 3QU4A 2ONCA 2XGJA 1CNEA 1XYGA 3H9CA 1Z6GA 1ZKMA 4KMSA 1M7HA 1BVRA 3AC0A 5CVVA 3Q9NA 2HK9A 3FGZA 2IV7A 4C7KA 4AKHA 2NO1A 4NYIQ 3PR3A 4QG7A 1SQ5A 3PNQA 4I14A 3U1BA 1NXOA 2L69A 4I4CA 3NALA 1N2CB 4MA0A 1Q83A 2XAAA 3GPDG 3EODA 1WUYA 3VNUA 1JDPA 4OHUA 3E27A 1IK4A 2Z2XA 5I9SA 5HQJA 5LB4A 1TT7A 1VIAA 3V42A 1HK7A 3SBDA 1E6LA 3EF3A 3PGKA 1L5HA 1K75A 4NHOA 1JX6A 4KO2S 5B58C 1AQYA 4K9KA 1Q92A 5SYAA 4B3FX 2R8OA 4H7EA 3QYFA 1XDDA 3D8HA 4CQLA 5LP6B 2Y27A 1U31A 1BWPA 3OT1B 2V3CC 3ESYA 2VJDA 4ZAFA 2X13A 1YDMA 3C70A 4CU2A 3OF5A 1QKJA 1J4AA 3AUUA 4LRWA 3CZ9A 2RD2A 2IY7A 1LXCA 3OF3A 3O95A 5LBIA 4W7SA 3MCUA 1OBCA 3F4KA 4DA6A 4YO8A 1JWBB 4JJAA 5A7HA 1X77A 4YONB 2PXCA 4OO3A 3C0KA 3ZU6A 4DXDA 1YR7A 1KQOA 2XUJA 3HDYA 1KORA 1SUWA 2X2FA 3IEIA 4JBXA 4LBVA 2WOOA 4TRRA 2XSZA 1NG9A 4G26A 3W34A 3HP4A 3J81k 2JJ2A 4RORA 1PEDA 3CUUA 4X8MA 3QRWA 3RCBA 4ALLA 5C53B 1B41A 1VJRA 5B30A 5D3ZA 2OV6A 3CBQA 1PR9A 1PQWA 1E1CB 4URYR 3EVNA 3I6ZA 2QPOA 3U4CA 4F11A 1TEXA 5IT5A 3CURA 2ODBA 3F74A 1DINA 4HQ0A 4C29A 4R1TA 2FW1A 2QQ5A 4REQB 1QHXA 1FIUA 2Q1TA 5ANRB 1J07A 2BDUA 4QWMA 1BE8A 3LYLA 2HPAA 1FPMA 3HVUA 5GWXA 1GFWA 3PV0A 4OHCA 2IU0A 1SCKA 1I3KA 1SXJB 3WLEA 1WJGA 2J3LA 4HQ6A 1FCJA 1W5SA 2EJCA 2ZVDA 1N5DA 3UUGA 4KGDA 2JIQA 3CEMA 4M1QA 1HEIA 5CR9A 3D7MA 3F6YA 1NTOA