4OYHA

Structure of bacillus subtilis mobb
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
163
structure length
148
Chain Sequence
FPIVQVVGFQNSGKTTFIERILEKASEQGLNLGCLKHHDRYQAAGADVTAVEGAGVLQLTARRLWDLTRLIELYQFLETDCLLIEGFKKAPYPKVVILSEKEDLEALKTVNTIAIIYRKKEHMTEHQGLPIFHADDPVAVDLVLSQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bacillus subtilis MobB
rcsb
source organism Bacillus subtilis subsp. spizizenii (strain atcc 23059 / nrrl b-14472 / w23)
molecule tags Biosynthetic protein
molecule keywords Molybdopterin-guanine dinucleotide biosynthesis protein B
total genus 35
structure length 148
sequence length 163
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03205 MobB Molybdopterin guanine dinucleotide synthesis protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4oyhA00
4BEBA 2Q9CA 5EE0A 1SVSA 3AKEA 3EA0A 3QEOA 1T5IA 1PUIA 4NU0A 5LPNA 3B60A 3QG5A 3BWDD 1JB1A 3KXIA 5FL7A 3TR0A 1HTWA 2Z5FA 2FFBA 5DH9A 2EQBA 1HH4A 1W4AA 4I1SA 5JS7A 3BC1A 1NIPA 2CXXA 2P2LA 4MGIR 3AVUA 3AVQA 3I32A 1S0UA 3K9NA 4IHQA 1VCIA 2FNAA 5KDLA 4FWTA 1J8YF 3Q7QA 4B3CA 2B6HA 3LH5A 2J59A 3REGA 3CPHA 5AWFC 1NLYA 2CHGA 2JJ1A 1N6LA 2V9PA 3BOSA 4ZCLA 4PC2A 4EFNA 1JBKA 3QBVA 1NLZA 3T1QA 1UEJA 3ZYCA 4D4LA 3TBKA 1E98A 1T0HB 2BMEA 3H84A 4OQNA 2OV2A 5CLQA 3L8YA 2IXGA 5JRJA 3LNCA 4DLUA 4UNNA 4B3FX 4KU4A 3AKYA 2GZDA 1ZU5A 1BMFD 1JR3A 3GJ7A 1YR6A 5JECA 4QM7A 3PEWA 4O0MA 2WJHA 4DLZA 1NVVR 2XNDA 4QJ4A 3VAAA 2FPKA 2JEOA 2JDID 1BIFA 3C4JA 2WSMA 4A8JA 4B2PA 3MD0A 2GESA 2DPXA 3Q85A 1W7AA 3QENA 2RAPA 3VMFA 1U0HC 1ZC3A 3TKLA 1XTIA 4PPGA 4CYMA 1RFLA 1R5OA 3L0PA 4KXFB 4WXPA 5AUPB 1KI6A 1XEWY 4GOXA 4PSVA 4B76A 1MH1A 1RYHA 2RGBA 3RS4A 1EX7A 2XTMA 3W3ZB 2IYXA 3QG1A 3IKJA 2DCUA 1NBMA 1SXJB 3GQBA 2G0NA 3NHBA 1C1YA 2CDNA 4HAZA 3LLUA 5EXSA 3CPJB 5E4FA 5BN5A 3DMNA 4R9UC 1X8JA 2QMOA 4F91B 3R20A 3EAQA 2R6CA 1D6JA 1DS6A 4FCVA 5GJBA 2QORA 3VNUA 5H8WA 1KJWA 2WAYA 1GUAA 4B2LA 3MJRA 4LV8B 4MYCA 1KHTA 2G3YA 4NCKA 1FMLA 1P60A 2G1KA 1FX0B 1COWD 3B5JA 2V7QA 4TL7A 4Z8XA 1NG1A 2HLDD 2R8RA 2D2EA 2Q6TA 4QM6A 4IVPA 4JL8A 2BC9A 4UKDA 4EPXA 5KSOA 1SKQA 2H1LA 1NVWQ 4HZUB 3P4XA 2QM7A 2ZRNA 1H8EA 2XTZA 3K0AB 3QY0A 4Q1CA 2ZJZA 2Z4SA 3RS7A 3DHWC 4EQ6B 3AVPA 4B73A 1JPNA 1KO5A 2C98A 5FPTA 1OT3A 4CT5A 2AK3A 4KBFA 4PR0A 1G8HA 3FVQA 1C4OA 2X19A 3CRRA 4BEJA 1XU4A 2R9VA 2IYYA 3A1WA 3DDCA 1GSIA 4JSYA 4QL3A 2ODNA 3W9YA 3K70C 2VF8A 1W36D 1N6NA 4A2WA 1CJKC 4D25A 4GP6A 2WWWA 4QC2A 3LRPA 4HB3A 3ZD6A 1XJ0A 1LB1B 2LKCA 1RE0A 2W83A 1AQYA 2QP3A 4OL0A 1W2HA 3ZIAD 4EJSA 2HXSA 2CLCX 2IS2A 2X2FA 1Y63A 4Q7MB 1VYTA 1F2TA 1XTJA 3GLHE 5FPHA 1SZPA 2V54A 3PFIA 3K9HA 4DB2A 2ZE8A 3CB4A 1H8HA 2GK7A 2FSHA 1ZAKA 3B7GA 3K9GA 2GHIA 2J0SA 4HLDA 3X1XA 4MUBA 4B32A 3H86A 1ZW6A 2V1XA 2FG5A 4TWZA 5EE1A 5JJLA 4FWIB 4Q9HA 1P75A 1CS4C 2GJ9A 4TLAA 1SKYB 3JVUA 4PZLA 3C14C 1Q1BA 1S2MA 1ZM9A 2ZJBA 1T3LA 5LDDC 1XF9A 2PCLA 2W00A 1N5IA 3FYHA 1Q20A 4B3BA 3FHTA 2ZVPX 4HAWA 5TB5A 2RGDA 1YZGA 1XTKA 3NC0C 5FOVA 3CKLA 3JZAA 2HJVA 2ZE5A 1YRAA 1NJFA 3GJ0A 3I8SA 5LBIA 2OBLA 2NPFA 2REXB 4JLDA 5EZ5A 4EAQA 1EWRA 5B2ZA 2C8VA 4URZR 4X8OA 2BJWA 3KKOA 1IXRC 4XJXA 3KB2A 1IXSB 3KUDA 1Z0KA 4Z54A 1W1WA 3TVTA 1GRRA 2VHTA 4TSFA 1B0UA 5UKDA 1XTQA 4C7OA 2GEUA 1J7KA 1ZM2A 2XJ4A 1E32A 4D0NA 4D4JA 1MO6A 1XRJA 3ASZA 5GJWC 1W49A 2NGRA 5KNBA 1XXHA 1VIYA 5FPYA 1OFUX 4BZXA 3NDBB 4IKEA 4LJ7A 2YKGA 2F9LA 1F48A 2GZAA 5E95A 1WP9A 4UQOA 2GF9A 4LWZA 4LCBA 3CO5A 5C1BA 1MKYA 2ZSAA 3CX7A 1G8GA 1JPJA 3DL0A 4NMMA 1Z28A 4DSTA 2WJGA 5JBQA 1P2VA 3W6NA 4C4PA 1P5ZB 3GLGB 1JR3D 1N5KA 3L82B 5BQ5A 2WKRA 1G291 1WXQA 1ZUIA 1UJ2A 1VG1A 1KDRA 4B35A 3DEFA 3ZQ6A 5HZKA 2MSEB 3U3KA 4Q21A 1SULA 4LJ9A 3EIQA 4Q1DA 2GA8A 4POAA 4NYIQ 5FI0B 4OQMA 3NDPA 4PO1A 5J4VA 1EFCA 2DY1A 3LBNA 5B64A 2UVQA 5BN4A 2CMKA 4KCGA 1E79D 4IDPA 1UPTA 4LJ5A 4LYAA 4OJKA 4A82A 2WKPA 3DZ8A 2N46A 3W34A 1GL9B 5FR1A 4B3GA 1Z0IA 1XEXA 1A2KC 3QSYA 3LDAA 1JALA 4BFSA 3B1ZA 2QT1A 4EPRA 2JJ8A 2KBFA 2GJAA 4Q4HB 2O8BA 2QU8A 1NMYA 3SN6A 1S9DA 2VP0A 4Q02A 1HYQA 1DO0A 3K09A 4RSGA 2BBWA 1S1CA 3IHLA 5CB8A 5IK2A 4RD6A 3AP3A 2O8CA 2ZRCA 3CNNA 2ZREA 1YU9A 2QENA 3I5YA 4Q4LA 1KZGB 3CF6R 1W4RA 1FMJA 3WNCA 2RH5A 2QBYA 3ND8A 5H70A 4DSUA 1XTSA 2GRJA 2P6RA 1TQ2A 1P7CA 1IY2A 2OAP1 3BD9A 5B58C 4EPVA 1XDBA 2ATVA 1YZQA 2QRNA 5FTJA 2R62A 3F8TA 1NBME 4BZQA 4DC9A 3SBEA 5CYPA 2YJTD 3Q3JB 5KPJA 1G5RA 1T3HA 2ONKA 4KYIB 4ZO4A 2VO1A 1KSHA 2VA8A 3DZDA 1MO5A 1N0VC 2V55B 3EW9A 2WJVA 4ARZA 1DAEA 2FMXA 2QNRA 3MWLA 2XSZD 3FMIA 4GZMA 3BH7A 4C0KA 2BCJQ 2G0TA 2Q9BA 2CLDX 2QG6A 1W2GA 1SHKA 4R2IA 1ZM7A 3NXSA 2IYVA 4PO9A 2HYIC 3MWKA 3PUZA 5F3WB 4XWKA 2F55A 3DM5A 2CL0X 1KIMA 1XD2A 4P33A 5KO2A 3U6BA 2P67A 2ZS8A 4QXAA 1Z6YA 1GAJA 3V4FA 2IK8A 3MGCA 3A6PC 1E9CA 2W2VA 4TL6A 1XCMA 3LWNA 4B47A 821PA 5A0FA 4TYWA 2Z6VA 1LW7A 2ZSDA 3VR5A 3QKRB 2WJYA 2NIPA 1E2HA 4AKEA 4PANA 4W5HA 1SGWA 1ZD8A 3HYRA 4YDSA 2JLWA 2PH1A 1OW3B 2WHXA 4HDCA 4BQSA 1OJLA 2J45A 4Q1EA 4OHZA 3LA6A 1AZSC 1Z6XA 5FUXA 3T1OA 4DJTA 2XNSA 1U9IC 2J7PD 1OB2A 4DCNA 1A1VA 4RFSB 4ZI2A 1E1QA 421PA 5B57C 4YLGA 3WNDA 2OCAA 3FDIA 4HB0A 1U9IA 4LBVA 2ORIA 1NKSA 1ZNWA 2XNDD 1S3SA 3CR7A 2QI9C 3LVQE 1KTVA 1E3MA 2VIIA 4MGKR 1T4GA 1NN1A 2CL6X 3OHMA 3QKSB 4QBGB 3UMSA 1WMSA 5DI9A 4JJZA 3ADKA 4D0LB 2EWWA 4XWAA 3U5ZB 2IXFA 3H1TA 2B7CA 3FWYA 2IXEA 1Z6TA 3CRVA 3KQNA 4HDQB 1YHNA 1R0ZA 3KJGA 4OI1A 1TU4A 1ESNA 1NMZA 4RZUA 3AF2A 1IONA 2IYLD 4L16A 4I1UA 2C04A 2QZ4A 4LYFA 2F7SA 3ZZ0A 4MUAA 3A37A 4DT1B 2UZ3A 1F5NA 3PEVA 3FTQA 3SQWA 4W5JA 3QI2A 2ZPTX 2CCKA 4A2QA 2CJWA 3KJIA 5H1YA 4ZDJA 2NQ2C 5EXPA 4ZKDA 1TU3A 1P2TA 1ZU4A 1KI1A 2N42A 1M1YE 1E2KA 4Q18A 1XMIA 5EQTA 5J4LA 1P4SA 3O47A 4JBYA 4TQ9A 5GADl 3ZLJA 1H65A 1K5DA 1RVDA 5LD2B 1OYWA 1ZCBA 5KSPA 5CIQA 1E2LA 2HDNB 4M9XA 2OXCA 4KAXA 2A9KA 5AJXA 2BEJA 1TPZA 3EARA 4WXRA 4Q9JA 2PZFA 1AJEA 4JLOA 4GNKA 2AXPA 1AZTA 2D4HA 5EZ6B 3VNVA 2I3BA 1G9XA 2RHDA 2A30A 6Q21A 4RKEA 2OT3B 3NG1A 3LX8A 4H9GA 2OCYC 3P32A 3RRZA 3A4NA 3I72A 3LQQA 5C18A 3SZRA 1J90A 1W46A 2QAJA 4I81A 4PQRA 3R7WB 2HUPA 4MYUA 1G7SA 1KI8A 3N70A 1FNMA 3OE7D 1G4AE 1FZQA 3TQCA 2ATXA 4AKGA 4N3NA 3SI7A 4JS0A 3K53A 2XOKD 3KDSE 4KHZA 4NCNA 3G82C 3C15C 4FD2A 5SZHB 5FI1B 1GL6A 3P27A 3GEEA 1QHHA 4ESHA 1W0JA 2D7CA 3QPUA 2J87A 4F4JA 1NIJA 4YMWA 4RY2A 1YRBA 2BBSA 2NZ8A 3TLXA 3B78A 1SKYE 2D62A 2RMKA 2WWXA 3TGPA 3X1WA 1GNQA 4D4KA 3BS4A 4TMVA 2KI5A 3NBZC 3TW8B 4F92B 4C0SA 1SXJD 4Q01A 1CTQA 4D80A 1XMSA 1J8MF 1NY5A 3K0SA 1LS1A 2GAOA 2R6FA 3HWSA 2F3TA 3CIOA 3CZQA 2BKEA 3AP2A 2XTNA 4WVFA 3T61A 2G6BA 2REBA 1DAKA 4QKQA 1KJYA 3RRYA 3T12A 1KI7A 2J41A 2XITA 2SHKA 4BFVA 3KXLA 3RVBA 3W8RA 3GP8A 1D5CA 2H8KA 5DN6A 2VP4A 1JAHA 1G7CA 2PEZA 3N2EA 1ZD9A 1TEXA 2HT1A 1OKKA 1SVKA 1U81A 1NLFA 1F6BA 2I1VB 2YNMA 4GT1A 1YZKA 1R5NA 621PA 1KDPA 2YWEA 3EPLA 2YHSA 4Q4JA 4LYHA 5BXQC 1GP2A 5F2EA 2B92A 3IGFA 1P9NA 1RJ9A 3QJYA 4DSOA 4ERNA 2P5TB 4CEJB 2XXAB 2Q0HA 2W6JA 4RD0A 3B85A 3ADDA 4Q9IA 4XSGA 1QF9A 3QXCA 2IC5A 2YWGA 4G01B 4DEYA 1FQKA 3RLFA 2R2AA 3CH4B 3KX2A 4AWXA 1YKSA 4AURA 1ZBDA 2UKDA 3GLGE 5JJKA 3UK6A 4HEJA 1E1RD 5EE3A 2Q3FA 2FV8A 2EWVA 2ZRAA 4HB4A 4Q1AA 3KTAB 4TN1A 2NO7A 1MRNA 5JMTA 1ONBA 1IY1A 1M6NA 2QGNA 4IOJA 4ACBA 1CJTC 2JLZA 2WICA 4XTCS 1Z07A 5H68A 3BERA 4DKXA 4B71A 3TW4A 4S2EA 3VHLB 2IF0A 3AF4A 4PPQA 1EX6A 1KOFA 1AKYA 3DOFA 4XVQA 1OXTA 3K0FA 4ON9A 4C0AC 1WE2A 1P2UA 4MQBA 1U98A 1AGPA 2Y8EA 4HSEA 1IJFA 3B82A 1CR1A 1E4YA 3BGWA 3AVYA 3X1DA 4PHFA 3EIEA 2BDTA 3I1FA 4BRUA 1ZCAA 2K5UA 3K0FB 3GFPA 2DBYA 3ZVRA 1NL3A 1PVOA 3HPQA 5P21A 2VHJA 3IPXA 3SYNA 4P4UA 5AJYA 1KK3A 2ZJOA 2R6DA 4W7SA 3GLIE 3B6EA 3GMTA 3OIUA 3SJCA 5FR2A 521PA 2ZRHA 5FBRB 3ZD7A 1JQLB 5DHFA 4AYTA 2IA5A 3HJNA 3NBYC 4M1WA 4XIGS 5DO9A 4FW9A 1KGDA 2WOOA 4JZKA 2GCOA 1U0LA 2FZ4A 4KI0A 1IN5A 1R4AA 4N0DA 3O8DA 3GJ5A 3QXJA 4WZBE 2DFNA 3ND9A 2QA5A 1M7BA 1JECA 1XXHE 2VHCA 2GZHA 3U44B 2JIZD 4WA7A 1M8PA 1IJEA 3M1IA 1OXSC 4RCYA 2ZS9A 1LTQA 2ONJA 2ZUBA 1DEKA 3Q5DA 3KFXA 5CK5A 2QSZA 2ORWA 4I99A 4IFEA 3ZJYA 2P6UA 3GJXC 1E0AA 3UMRA 4CEHA 1D8TA 1CIPA 3DOEA 1D9ZA 2RGGA 3QQ5A 4XVUA 3CRW1 2YVUA 2F1RA 3R9IA 2Q3HA 1Q21A 1XCGB 1QZXA 4UNQA 2FFAA 3Q9LA 4LV5B 3VR1A 4WZAE 4NYMQ 4WZ6A 4HLUA 1U8ZA 4NYJQ 1KDTA 4RD4A 4ASUD 3RHFA 1WDTA 2YWFA 3QKRA 4GBMA 4ACAA 3RWMB 4Q4AB 4YXWD 4HATA 1S8FA 1MO4A 1N5JA 3EZ2A 3F5FA 4A0HA 3CW2A 4A0FA 3DO6A 3OF5A 1OPXA 2DFLA 3A4MA 5DSZA 1XJQA 2VP6A 4X8LA 3TUIC 1E9DA 5JI3E 3LBHA 4AKHA 3RDPA 4DUGD 3AKCA 2CBZA 1Z63A 1KSGA 2KSQA 1XFAA 2HF8A 1Z6AA 2WV9A 2O8EA 2XAUA 1OH7A 2JJ1D 4FINA 1E9FA 2IS1A 4YMSA 3QKTA 1GFIA 2KBEA 3NBFA 2IS6A 3R8FA 2FGJA 2VSFA 1SQ5A 5J40A 5BW8A 1GNRA 4IDHA 1N2CE 4Q48A 4TT3A 3OAAA 4TMTA 1P3JA 3Q72A 3QPWA 3IILA 4QNRA 3W8NA 2ODWA 1BYUA 1OXXK 2UZIR 4EDHA 1KO8A 4BFUA 1BMFA 2F1JA 1E94E 1VKJA 4YONB 1IXZA 4PZYA 2XB4A 2R6GA 4AD8A 4EPTA 3C5HA 5HR5A 2V1UA 3THYB 1E1QD 1JJVA 1NVXQ 4NCJA 4QHSA 2DFKB 1XEWX 1F2UB 5IRCD 1AN0A 4JMPA 3DMDA 1ESMA 1W36C 1CF4A 221PA 4LHVA 5JCZA 1G4UR 1V5WA 5LB4A 1U8YA 3GEIA 1E2EA 4ZCIA 1E2IA 5LD2C 1CJMA 4U00A 5K8TA 4LRWA 2R44A 3SU8A 1OH8A 1A4RA 1GILA 2TMKA 3VR4A 4UXIA 1VCOA 1AA9A 5JCPA 2GBLA 3QBTA 2IHYA 3CNOA 2O52A 3VR3A 4MRVA 4JLPA 1MOZA 4DHEA 2PLFA 4DUGA 1A5TA 2Q9AA 4GRAA 5KYKA 1AKEA 1N5LA 5FUWA 3GFTA 2G9NA 4TYPA 3NBXX 3GLIB 4L15A 3MFYA 1E9BA 1L4UA 3TUZC 2FF7A 3U4QB 1AS2A 1PZNA 1LS6A 1PUJA 1LV7A 3UMFA 2I1QA 3GCGA 2ZJ5A 1E2FA 1G3RA 3RS3A 4MA4A 1BYIA 3SE0A 3K8YA 4IEIA 4HDOB 3RSOA 1UBFA 2JCSA 3PUWA 4ZIRA 1N6OA 4BFYA 8OHMA 1QHHB 1G8PA 2WMOB 1T0JB 1M7HA 3PR1A 2BMDA 5JS8A 1WQ1R 1BS1A 1IOZA 3FKQA 3CONA 1IAQA 4GOKA 4UNRA 5AK0A 3QEJA 1G5PA 2D74A 2J7KA 1TUEA 4JL5A 3FKSD 2BOVA 2G1JA 1RPZA 5FOXA 1TAGA 1E2PA 4RFSA 4HAYA 2GEVA 3SJZA 3T15A 2C96A 2GCOB 3E2IA 4NL4H 1R10A 2QAGA 4HLCA 2BJVA 2IYRA 3K70D 1YR9A 4PC7A 4PC3A 5E7MA 3FMOB 1CXZA 2QBYB 1UFQA 4PAQA 2ZE7A 4ABYA 5FH9A 2YINC 5LB2A 3H4MA 1EWQA 1TL7C 1T3SA 5KNCA 3SDZA 3EWSA 4TL9A 4C9BA 4JVNA 2B8TA 1I2DA 1RIFA 4YDHB 4IDOA 4FXPA 2AN9A 1L4YA 4B6FA 1XBTA 1YZUA 4KJZA 5JHHB 5AUNB 5AR1A 1KO7A 1OV4A 2YC4C 3THWB 2XZLA 1HUQA 4EFLA 3PENA 1KO1A 2NZJA 1G6OA 4OQXA 1UKZA 2A5FA 5J47A 2ZSFA 3THXA 2PX3A 2DYKA 2PZEA 1XTRA 1I4LD 3PVSA 1G21E 1XMVA 5F9HA 1TF7A 2YC2C 1N6PA 1T5LA 4CIDA 3MUFA 3PITA 5G41A 2V6IA 2HCBA 5BN3A 5TDHA 2AWNA 2VP2A 4ZKEA 1FTNA 1W48A 2GILA 4LI0A 3B1YA 2O8FB 1EFRA 4LV6A 2GVDC 2GCNA 3L8ZA 4Z51A 3V00A 2LCFA 5TMPA 5FBVB 1OKKD 5KDDA 3LW7A 1A7JA 3T5DA 3A4LA 1XJCA 3F0TA 1WF3A 2I4IA 1RJ9B 1R8QA 2GXQA 4E22A 2P6NA 1E2NA 3B2EA 3FGNA 1Z2AA 3AM1A 2Z43A 4US1R 4ZPXA 3CNLA 1XX6A 1GRNA 3IO3A 1FP6A 1Z08A 1XZPA 2FZLA 2VTKA 4B34A 1KAOA 2CEAA 3CWZA 2PT5A 4HAXA 3LBIA 2OO7A 3RC8A 4V0KA 3B1XA 1X6VA 1QHIA 1ODFA 2A5DA 1L2TA 1Y3AA 4C7OB 4IRUB 3C16C 4PSKA 1G20E 3M4YA 3T06B 2CVFA 4DCTA 5EP3A 4B6EA 1G7TA 3KQKA 1Q57A 1D2NA 5L8VA 3U3RA 3QF4A 5CM8B 3CZPA 1NJGA 2AXNA 3EPJA 1Z22A 2HXYA 2B21A 2VPPA 4YQFA 3AUYA 3HU1A 1XB2A 2ZROA 2W0MA 2YZ2A 4FCTA 5CDFE 2HCJB 1N0WA 3N2IA 4IOKA 3KKMA 1NY6A 3I61A 1ETUA 1ZP6A 1KKLA 2ASEA 2JATA 2O0HA 3TQFA 2BMFA 1XEFA 2X2EA 2VHUA 4KFTA 2A5YB 3NHAA 1IHUA 4BFWA 3PXGA 2ODBA 5TXGA 3I62A 2IHBA 3CPEA 5DI3A 2QPAA 3ZH9B 1ZM3A 2F9MA 4BZPA 4LPSA 1X1SA 4KFSA 1MRSA 4BPBA 4Y0AA 5HTKA 4DXAA 4TQUS 1EFRD 1S1MA 4GFDA 2ECKA 4LX0A 2JASA 4P0TA 4PHHA 4TTRA 3EXAA 4DEXA 3QF7A 1AGRA 4JLNA 3C41J 1XXHB 5HCIA 3U7EB 4DDTA 3KJEA 4G5QA 2FSFA 3R7WA 4B43A 3HP1A 1NVVQ 1P2SA 4TMZA 3P26A 2PLRA 2PX0A 4NHOA 3FE2A 4CT4B 2GCPA 3T1TA 2V8OA 4QHYA 3O8BA 4N0EA 2OCPA 4NKRA 4CEJA 2XXAA 4FMDB 5FBQB 3WHLA 5AJZA 5FL7D 4OI0A 4URXR 3U7GA 3D3QA 4BLOA 4GSYA 1US8A 3OEHA 2GWHA 1IM2A 1RKBA 3P20A 2FU5C 2L0XA 4M9QA 4P4TA 4IDQA 1KY3A 2HF9A 3HR8A 4JL6A 5D3MA 4D82A 2QT0A 2QL6A 4DLSA 1NVUQ 2HV8A 3R8CA 4NTZA 4C2UA 5BYJA 1GTVA 2BV3A 4C2TA 1E0SA 4TYYA 3MG9A 4L9SA 4YMVA 1U0JA 2F3RA 5KDOA 2AFIE 1RRCA 1TQ4A 1T9HA 3LAWA 2LWIA 2JLSA 4C0BA 4RFVA 5A4JA 2A2ZA 5JEEA 1E2GA 5CIWA 4V0ME 1KKMA 4GMDA 3ICQB 3SFZA 1G1MA 4QOSA 3QVUA 3WBKA 1YE8A 3OESA 3ZDQA 1FNNA 1G64A 2RGCA 3SHFA 3PCRB 1TX4B 3EG5A 3VKWA 2JA1A 4JVMA 1W0JD 1S4QA 1NN0A 4M4SA 5K8IA 1K6MA 3O8CA 3L0SA 4CEHB 3PUVA 3ZVMA 2BHRA 3TAHA 2EFGA 2E87A 4PTLA 3VR2A 3K70B 1DAIA 1J99A 2EFDB 4OI2A 1MR3F 2IUUA 5ANRB 1SXJA 4IJMA 2JLXA 1EK0A 3R9XA 2KJQA 1Q1QA 4LSGA 4TTPA 4B74A 5IHPA 2RGNC 2EFHB 4LJYA 2ZRJA 3TAUA 3X1YA 5KNDA 2QPOA 4II7A 1D2MA 4PXAA 3SR0A 1NN3A 4B33A 4KLZA 3QXSA 2H18A 2REOA 4KVGA 3Q7PA 5KTYA 1WBDA 4MGYR 4C0HA 3WHKA 5JSZA 3AUXA 4NE2A 5AJVB 2B8WA 3A8TA 1TADA 2VP5A 5JWOA 3V9PA 2RGXA 3RRMA 2V3CC 2FPMA 4BFZA 4RD2A 2ZE6A 4JYBA 2WJIA 4RKFA 1PJRA 4QFMA 3T35A 3RSLA 1I4DD 4CEIA 5KU1A 1HY3A 3DVLA 1VTKA 4Q9LA 2DFTA 1VG0B 2EYUA 2CCGA 1Z5ZA 2GAAA 5G40A 3WY9A 4A92A 4WIAA 4E09A 3S1AB 3W90A 5DYGA 2IYUA 2JIZA 5DGXA 2Q3MA 4KITB 1MT0A 2OCBA 1NI3A 1VYUA 3U60B 2YV5A 1SXJC 2E9SA 2FEOA 4M8NE 2NO1A 3QVVA 1E9AA 3GPLA 3RANA 3AV0B 4DT1A 1R0YA 4RZXA 4XD7A 2RGNA 2ZI5A 3LD9A 1UKVY 3MSXA 1Q1ZA 3EC1A 4PQFA 2R6AA 4PX9A 1P73A 2ZAOA 3D31A 1F2TB 2QUZA 4QGHA 4F38A 5C4MA 1CKEA 2P5SA 1J2JA 4CGZA 1R8SA 1D2EA 3BJIC 1E96A 3DKPA 2GJ8A 3A1SA 5CITA 3M6AA 3KKPA 4FIDA 2ZJ8A 5EXXA 1ZIPA 2WOJA 1EESA 3Q8XB 4LYJA 3IUYA 3JVVA 4V0OA 5FBWB 3LQRA 2PMDA 1EFUA 2VLIA 2QP9X 1OIWA 2H92A 4R2HA 2A7QA 1Q0UA 1II8B 3ICEA 3RWOA 4AC9A 4P3YA 2VP9A 2WWFA 5GJVC 1WA5A 4E07A 1ZMXA 3ADCA 3G5UA 4GI7A 1CP2A 3TK1A 3UATA 1CULC 1MV5A 2IX3A 3NH9A 2NPIA 2DHRA 4DCSA 2J9RA 1IBRA 3B1WA 1LVGA 4JLKA 4MKGA 1Z47A 1JXMA 1IN8A 3VR6A 1OLOA 2CNWA 3UWOA 3BFXA 2BEKA 3QOFA 5DIFA 1D9XA 2QMHA 1QRAA 3BRWD 1FUUA 5FPSA 1W4CA 3KQHA 4M1MA 2O8DA 4BUJA 4CZ2A 1P9WA 3OIVA 4D4MA 4NYIR 1II8A 5AUOB 1X8KA 1US8B 2C9OA 2RGEA 4OHYA 4LBZA 5FL3A 1CRQA 3ONWA 1O3YA 1QHXA 4EPWA 2GTPA 3K0CC 4L9WA 2ZIAA 1JNYA 4C30A 3AP1A 1HE8B 5HE8A 4ESVA 2CK3A 1G7RA 1KMHB 1TF5A 1YQTA 3L0OA 2WIBA 4XD7D 1DE0A 4YC7A 2MMCA 4M1OA 1KI3A 3WYAA 3QKSA 2VF7A 5JEDA 3SQXA 1VCNA 2IWRA 1ZUHA 4HZIA 1XPUA 2ZRPA 4QRHA 2DWQA 3WMGA 1HV8A 1R7RA 1X1RA 3CRQA 3C7KA 5FTKA 4R98A 1JAIA 4PO8A 2P65A 2ZJYA 2ZRIA 2ZRDA 3TR5A 4YMTA 1VECA 4BFXA 3IQWA 1OXUA 2OZEA 1E9EA 4OK3A 1YZLA 2O0JA 2PEYA 3BK7A 4TMXA 3KQLA 1Q1EA 1GWNA 1OH5A 2X77A 4BGDA 2ZU0C 1RYFA 2J5XA 5F98A 4MKIA 4OBEA 3NWJA 3L2OB 4Q03A 1LNZA 3LXRA 1W5SA 1UEIA 2ZRKA 3ZZUA 2ZI7A 4LJ6A 3SYKA 2NO0A 1XCPA 1VYVA 2JLYA 3A58B 4K8OA 5DYIA 2BIFA 3BFVA 4DDUA 2CCJA 3IIKA 4U7DA 1MABB 3ADBA 2RHMA 5AUQA 2AX4A 1DAHA 2QMUA 2IYZA 3RC3A 4DIEA 2ZR0A 4NBSA 4TT3D 2OILA 4OQFA 1OXVA 2H17A 1XEXB 1RC8A 1OFTA 2GXSA 3IEVA 2FJUA 4JBWA 4Z1MA 3B13B 4S35A 1E0KA 1RW4A 2IYQA 1DPFA 1Z06A 3B1VA 4HLQB 2QAGB 4LBWA 4BWYA 3HDTA 5AJWA 5JLJA 4EPYA 1Q44A 4G0NA 3IQXA 1F60A 1GNPA 2C95A 2CJWB 2QE7D 3UG7A 4YXWA 4DCUA 2NMVA 1W5TA 3VKGA 1FUKA 2QPTA 4IW3B 2FE4A 4E5UA 1NG9A 1FPMA 4KSBA 1OIXA 2ZU6A 3TIFA 1SXJE 5FTNA 2GKSA 4C0JA 4XTRA 2ZUCA 4TSFD 1X3SA 5FTMA 2AKAB 3SJAA 4DZZA 4LHWA 4H1UA 1E9SA 1SVLA 3UXMA 3TH5A 1E9RA 4LOAA 2R65A 2ZS7A 5HCNA 4URVR 4V03A 3RRNA 1R0XA 1U2RA 3W5JA 3TMKA 1T8TA 4ZDKA 3LXXA 1G3QA 2WWHA 3K0EA 4KFRA 5SZKB 3E70C 3U61B 2IUSA 1Z0JA 2ZRFA 1KZ7B 3EX7C 2ZYWX 2RGAA 3U4QA 4Q7LA 4AY2A 2O8DB 3ECCA 4AI6A 1EFHA 3I73A 1E1RA 3I92A 3LV8A 1TMKA 2GK6A 4O2LA 1G16A 3HPRA 2EYQA 4GPTA 5HZHA 4D81A 3VU9B 1G19A 2G88A 3A36A 3WYFA 1YZTA 4OHWA 4A6XA 1EXMA 2IT1A 4A6PA 1PLJA 3TNFA 3ZQJA 4L5BA 1U90A 3K0AA 1N6RA 3EZ6A 3SHWA 3QNUA 3IBGA 3AF3A 4IOMA 4HZUA 5EE5B 3CWQA 4HAVA 3FHCB 4NONA 2CNWD 3THXB 2WSSD 5J4HA 2D06A 4DLRA 1YR8A 1NNEA 2IS4A 1OYYA 4EUNA 3BFKA 3EA5A 4J0QA 3X2SA 1G8YA 4RZ3A 4ASUA 4LJAA 2QMEA 3OIWA 3N5CA 1NF3A 1Z83A 4QBFA 5FFMA 2AD1A 1DAGA 2EU8A 1CJUC 1YR7A 2CHQA 4TYQA 1PLKA 2G77B 2CE7A 2QE7A 3THOA 2BBOA 1XD2B 2FGKA 5CK4A 2LKDA 2PJRA 2VHQA 4QJ5A 4A9AA 1TQ6A 2ZTSA 3PEYA 4LBYA 4IDNA 4V02A 1UBGA 4B2IA 2ZUDA 4TZ0A 2BKUA 3SYLA 4BLSA 2XB2A 2FWRA 3CUEF 4CVNA 3BB4A 3SNHA 2WAXA 1MO3A 1TQDA 4MRNA 3WBJA 1KI6B 4URUR 2PZGA 2IBMA 3EZ7A 4Q9KA 1QBKC 3WRXC 3AVVA 5SZJA 3NVAA 2XGJA 1FL9A 1N6HA 2C9CA 5EP4A 2WWGA 4ZIRB 1B23P 4M53A 3ZGXA 1KMHA 4ZDIA 4KSCA 1HE1C 2AR7A 3EASA 4D2IA 3K1JA 4CEIB 2JJ2D 2WPDD 1IN6A 2VEDA 2CE2X 4TLDA 5EE9A 4AG6A 1XNJA 4A15A 1AS0A 1CBUA 2A78A 5IT5A 1R6BX 1E2MA 3FMPB 3U2QA 3MAAC 2OFOA 4DDWA 4F93B 1NN5A 4C0QC 3GJ3A 4Q66C 1DTSA 4QGFA 2ZM5A 3NTUA 4URWR 1E79A 1FW6A 2OHFA 3CRMA 4Q4HA 4AK9A 1N6KA 1KK0A 3JZMA 3FKSA 1BO6A 5JWRA 3UPUA 3BXZA 1E99A 2GBLC 1OIVA 2DR3A 2VQSA 2ZRGA 3PUXA 4MRRA 3IO5A 2ZI9A 4NYMR 1DVRA 3AGQA 5BWMA 4F4CA 2H7VA 3R9WA 4NP6A 2BCGY 2W2XA 3ASYA 4X8HA 4W9MC 4IXMA 3RNLA 2QEQA 1W0KD 1YZNA 4JLBA 3VU9A 1SVIA 721PA 1ZD1A 2EVWX 2OFWA 3MJHA 2QTFA 5CYOA 4QGAA 3NEJA 4TMWA 2GVZC 3VX3A 1ZINA 1N3BA 4OKSA 3ZZTA 5CLLA 5C2JB 3GLGA 1E2QA 3OAAD 1Z2CA 3QPVA 4RD1A 1G18A 4NCIA 1IY0A 3UANA 1Z8FA 2BWJA 1T8UA 4OI4A 4LHYA 4BLRA 4G5SA 2ZI4A 1NSTA 3EZFA 5FUYA 5HE9A 3G0HA 4HYYA 5CB6A 1Q12A 1JQJC 2DWOA 2WWIA 2C2HA 1CR2A 1JEEA 2ANBA 1COWA 2HJGA 4NDZA 4P31A 4UXHA 5DLQC 2ORVA 2C9YA 1JI0A 4Z1MD 2D3WA 1E69A 3MRSA 4BASA 2FH5B 2QTVB 1QDEA 3RS5A 3NH6A 3ZVLA 3KUCA 4RVCA 1G3IA 1Z6GA 2AKYA 2J3EA 2V4ZA 2PBRA 4PAOA 4UNSA 5D3MB 3BB3A 3A1TA 2ZJAA 4BRWA 1WCV1 2PMKA 4KVAA 2ZANA 4GDFA 4Q00A 2YWHA 1C9KA 5JI2E 4O3MA 1NRJB 1S9HA 4PQYA 2F1IA 3PUYA 1XD8A 4FMCB 4B3DA 5SZIA 2C77A 2ZQ5A 1GM5A 1LF0A 2GDJA 2XZPA 4HB2A 4FCWA 4P4SA 4KO8A 2A5JA 3FOZA 4IVQA 4TTQA 1Z3IX 1CJVC 3AVOA 3QUSA 5FOWA 2QN6A 3NKVA 3O8RA 4V0NA 3FB4A 4FMDF 4WOPA 5JFGA 1UF9A 4TLBA 3K9LA 1OF1A 4JVLA 2ZI3A 5IDVA 2IYWA 3HYTA 4GP7A 3T1VA 2A5GA 2FEMA 3L43A 5FPKA 1G41A 4UXJA 1AK2A 4UNPA 3CF2A 3W6PA 2VSXA 3KXKA 1H8ED 4AIIA 3I4LA 1R0WA 1N25A 4US0R 4MYTA 1CRPA 4BLQA 4Z8YA 4LK2A 3KJHA 1W4BA 4TZ6A 5KPDA 1RZ3A 2IF2A 3RS0A 4EJSB 1A2BA 2Q21A 2GXUA 1GKUB 2OBNA 4LC1A 3WP1B 4QGGA 4HUQA 1OHHD 4LJ8A 2JGNA 4M21A 3TSWA 5FOTA 5JJIA 2J0UA 4B75A 2HT6A 3IHWA 3SOPA 3QF4B 4JYCA 3OEED 4IFBA 1GITA 1KI4A 2BM0A 2J0VA 2C78A 1QHGA 2GJSA 4M0LA 2BM1A 4QJ3A 1NSFA 5TARA 5CJ2A 3GFOA 4M1TA 4DDVA 3BE4A 4G5RA 4MITA 3SFVA 3GJ6A 5F9FA 2KE5A 2WVJA 2FOLA 2OEPA 5JZVA 3SJBA 4M22A 4MH0R 4TMKA 2F43A 4K81B 3PV0A 2GNOA 2YOGA 4F4IA 5G3ZA 1UDWA 3MMPA 1OFIA 3F3YA 3GEHA 3DKVA 1ZM4A 1TEVA 2YOHA 3PG5A 1OSNA 3KKNA 5K8UA 4WAUA 3E5HA 3VQTA 1FX0A 1QG2A 4M1SA 2IWHA 1K8RA 1ZRHA 2JJ2A 2WPDA 3RAPR 3QXHA 3WXMA 2HLDA 2VBCA 3UG6A 2JLUA 1ZUNB 5G3YA 2YOFA 4MGZR 3B8HA 5A5GA 1U8AA 3OE7A 1UAAA 4TLEA 3I8XA 1VHLA 3V4RA 2NO9A 2W58A 1AM4D 4WW0A 4MDEA 3AVWA 3CX8A 3ZVNA 3VKHA 3LO5A 4G3XA 2XOKA 2YYZA 4MKHA 3IBYA 4MDFA 3KQUA 2DB3A 3SEAA 1TUIA 4XSHA 1EFTA 5DE3A 4ZI3A 4M9ZA 3MWYW 4URYR 3TSZA 5GVRA 2GXAA 3CX6A 2RCNA 4O2RA 3UWKA 1VG8A 1KO4A 3P1JA 1KDOA 2B7BA 3GLFE 5DI3B 2WTUA 3L0IB 3OEEA 4FI3C 1YJ5A 3K0CA 1GL7A 2ZRBA 4A8JC 5J4YA 1QG4A 5L3SA 3U3MA 2F1HA 3BORA 1QVAA 3GJ4A 3SBDA 2DWPA 3GLFA 4PFSA 3LX5A 3AQ4A 4HLUC 3LFUA 2W0SA 5L3VA 2W2TA 1KJZA 2X1VA 3ETLA 4UJ5A 3D7MA 2W6ID 1SVWA 5JSZB 2ZITA 5GJCA 1WRBA 3I5XA 3U3JA 2KB0A 1W44A 2AK2A 3AKDA 1VG9B 4LC0A 2GEDA 3DPUA 4EIWA 1G3UA 4Q4AA 5ELXA 4KLNA 4ZV4A 1VCMA 1HQCA 3RABA 4W5WA 4M1KA 1II0A 4NPHA 4OYHA 4ZDWA 1AQUA 1UM8A 4I1VA 1S96A 2E1RA 1ZNYA 4BFTA 2EFCB 3LLMA 2WWYA 4RD3A 5EUQB 4DLVA 1VDZA 5HKKD 2BVNA 3GLHB 4DB4A 1X86B 1Q3TA 121PA 2WJJA 3PQCA 2ZXUA 1KAGA 1VPLA 5EP2A 1AS3A 2J1LA 5B30A 2O5VA 3GLHA 4G5OA 3KFVA 2ZR7A 4TQAA 4EJSC 2OESA 3BB1A 4O25A 4BLPA 3UKDA 2F43B 3W3AA 4IVRA 5J4KA 1HURA 2GJKA 1CU1A 4IXNA 4XH9B 3BIFA 4ILEA 4TL8A 1OB5A 1GVNB 3TVDA 2ZI6A 3IPYA 4QG7A 1DAFA 4M2LA 3BH0A 1DELA 2C99A 2H57A 4LGMA 1CR4A 1M34E 1WB9A 3CLVA 4CW7A 3UIEA 1TTTA 1JEDA 1K5GA 4RCZA 1BKDR 1Z29A 3QE0A 1ZYUA 1HEIA 3CF0A 2MSCB 3NIBA 4JLVA 5FBLB 4IOLA 4OHVA 5FOUA 4I1OA 2PL3A 3AF0A 3WMEA 1UDXA 4E03A 5FTLA 2ZRMA 5FOSA 3CBQA 1VHTA 5KUTA 2F6RA 2Z4RA 4LUCA 2AWOA 5BYKA 3CH5A 1NP6A 3FMFA 2H5EA 3HU2A 5KSZA 3U6KA 2OAQ1 4RZ2A 1KNXA 4OJQA 2QROA 2AD5A 2Z0MA 4G1UC 3U3OA 4WBSA 4A2PA 4DLTA 5G53C 5KHOC 1VIAA 1BOFA 4X8MA 2J46A 2G83A 4LZZA 1G6HA 2AHOA 2GETA 3EPHA 3WRYC 1FFHA 1XZQA 4I4LA 4LHXA 4PHTA 4QNMA 2NG1A 2ZYVX 5KOYA 4HUTA 2XEXA 2JAQA 2JLVA 4A36A 1E2JA 4B3XA 2C5LA 4CF7A 3A1UA 3CM0A 1Q22A 2FSGA 4PC1A 1WBBA 4H1VA 2EW1A 4JT4A 1KSFX 1XWIA 2CL7X 4V0MA 1T91A 4JIMA 5L3QA 4DLWA 1DADA 1DOAA 1JXOA 2V6JA 2WM9B 1OFHA 5IF9A 1O87A 1M2OB 1NKTA 2FX3A 2RB4A 1XPRA 1P9RA 2OM2A 2O8BB 1BH2A 1UBCA 1H8HD 3KZ1E 4DSNA 4ZCMA 4JBXA 1G3MA 1ZJ6A 4OK6A 4LPKA 1HT1E 4C0LA 4A0RA 3H2YA 4MKFA 1JJ7A 2J0QA 2PJZA 3Q5EA 1SVOA 1UBEA 4FN5A 2C03A 2A3RA 1DBSA 3VFDA 1CLUA 1L8QA 4MRPA 2N1BA 2QRZA 2OLJA 3X1ZA 3IIMA 5D3QA 1ANKA 3W6OA 3HR7A 4AKIA 4US2R 4KV9A 4RJLA 3TSOA 1TF2A 5TV2A 4XWOA 2OBMA 1FQJA 2IEYA 2AL7A 1JR3E 5HPYB 2ODEA 4TLCA 1X8LA 3E1SA 1JR6A 4DLYA 1U94A 4LHZA 2ANCA 2J0UB 2WIAA 3KL4A 3DM9B 4NH0A 1UADA 4KBGA 3PJRA 3PIRA 1GKIA 1GIAA 3MWJA 1R2QA 4HUQB 4Y0VA 4DRZA 5DHAA 5KSYA 4GZLA 1V43A 4R7ZA 4F7WA 1Z0DA 4PPNA 4PAMA 5K8LA 2JLQA 4D0GA 2FFHA 4R71A 2OXRA 1XMJA 1Z0AA 1M74A 1LY1A 1GKYA 3VX4A 4HAUA 3QIAA 3PEUA 4ARZB 4JLAA 5JRZA 4D26A 1KK1A 4Q1BA 2BMJA 3EWAA 4L8GA 3GD7A 2BBTA 3EPKA 4Q7KA 1S3GA 2GF0A 3BH6A 3SS8A 5E3HA 2V7QD 3LY5A 1F3OA 2IEZA 1XPOA 2VH5R 1GRQA 4DIDA 2P0EA 4OHXA 1XD9A 3KB1A 2O8FA 1KMQA 1UKEA 2VRWA 3NEYA 1IN7A 2QTHA 2PT7A 4XOIA 5C4GB 1FP7A 2ZSEA 1SHZA 4Q5IA 2O0KA 2OUKA 3GLIA 2X8AA 5CDFA 2WMNB 1KNQA 4AG5A 3AGPA 2O8CB 1YVDA 2OSBA 3RYTC 1NMXA 5GVSA 4P4SB 1E4VA 1L7VC 1MABA 1OE0A 4JJKA 1EG7A 4LDJA 4EKDA 2ZJ2A 4CRWB 1I4TD 2AFHE 4P32A 2O8EB 3K09C 3ZS8A 4Q7JB 1W47A 5JHGB 3AVTA 3EC2A 2NTYC 3LW8A 2QQEA 2FA9A 1R5BA 1ZVQA 2OG2A 4G5GA 4QBHA 3IEUA 4HI0E 4AYXA 3THWA 2JLRA 5C46F 1W36B 4N1AA 1ELOA 1A82A 3FFBA 4OK5A 4EFMA 3U7FB 3TUJC 3VHXA 1E6CA 2ERYA 5L3QB 3KKQA 1GDDA 1IQPA 1F2UA 2Z83A 4KODA 1QHNA 5CJPA 4MYHA 1Q3HA 4DLXA 2W6JD 2FSIA 3MCAA 4Q47A 4M1YA 1SVMA 1HQYE 2VSOA 3TE6A 4C3ZA 3FPAA 2CLSA 4JVSB 3OZXA 3WP0A 4BLTA 2ZRLA 4L4UA 1DAMA 3IDQA 2IL1A 4KFUA 4Q1FA 3WYGA 1P6XA 5CM9C 2MSDB 3FFAA 1VMAA 3C8UA 3W5IA 1LFDB 2HEIA 1CEEA 3WMFA 2CK3D 1ZIOA 1N0UA 1T6NA 1EGAA 4Q4JB 4AYWA 3NC1C 1GOTA 4YMUA 1DG1G 1QVRA 2FDCA 3GJ8A 2WKQA 3VTKA 2D2FA 2EFEB 3I3SR 4IEEA 1RRPA 3U44A 1AIPA 4FMCF 1XP8A 3T34A 3EIHA 4U5XA 4ITRC 4UJ3A 4DWJA 1KK2A 1NBMD 1PLLA 2NO6A 3AEZA 3OEHD 4PHGA 1RRGA 1HA3A 3B9QA 4OQLA 1RRFA 2ERXA 4BECA 3LVRE 1FTSA 2XJ9A 3M0EA 1OH6A 2XSZA 1U99A 4EQ6A 2IYSA 2JDIA 4JSTA 2ZYUX 4GOJA 3AVXA 2MMGA 4PC6A 4U02A 4NZYA 1TNDA 5EJEA 1HT2E 3ZS9A 1KSJA 1ZNXA 1Z0FA 3RS2A 3SC3A 1FOEB 1QHYA 1DARA 4LY6A 5EUMA 5M04A 4JLMA 2VL7A 3MLEA 1E0JA 5E7JA 2OLKA 3OFND 3J81k 2ZETA 4PSAA 1QHSA 5L3SB 2ZR9A 3AH8A 5E7IA 4DBLC 1PV4A 5L3RA 4MRSA 5EP1A 4KYUA 3IIJA 3FHOA 2QSYA 1KI9A 4LJ4A 1P62B 3B9PA 5DNYB 4K46A 3REFA 2ZEJA 4D6PA 2W6IA 1N6IA 1ZNZA 4CDGA 4TYNA 4M9SA 3AF1A 3H0KA 2OE2A 1CR0A 2IW3A 2QQ0A 2CHVA 2J7PA 3WNBA 1IN4A 1KI2A 4Q19A 2FN4A 2QGZA 4JT2A 5JWHA 2OFXA 4B48A 1P61B 2IYTA 2NOAA 2QY9A 4A4DA 4DVGA 1G8FA 2XX3A 1ZC4A 2QAGC 2P3SA 2ZSBA 4PZZA 3C5CA 3QXXA 3P4YA 3THYA 4XVRA 3OIYA 2PCJA 3S1AA 5TY0A 2D7DA 4BE7B 1OHHA 1J70A 2QM8A 2CVHA 1II9A 2FFQA 3HU3A 5DN6D 5HKKA 3CR8A 4A8JB 1M7GA 2WZQA 3A1VA 1KY2A 1W0KA 2IUTA 4QHTA 3EZ9A 5J5CA 3AB3A 2ZVQX 4B44A 3TJZA 5FUVA 1P72A 3U7HB 4GMXA 1UKYA 2HYDA 2RKOA 3D6TB 3TRFA 3GLFB 5DISB 1E2DA 4NCHA 2QP4A 2VYFA 4FMBB 4NYJR 4JKYA 1DO2A 5IK2D 2KWIA 1KYIA 3BAFA 4JKIA 4V0LA 4A1FA 2H16A 2ZAMA 5TVKA 3OFNA 4JLJA 1DG3A 2ZYTX 1GZSA 2XZOA 4GL2A 4PPFA 3ZIAA 3BBPA 1I2MA 2WSSA 4DCVA 1GG2A 3KTAA 3QKUA 1LF5A 1G17A 1G5TA 2WBLC 4A0GA 4QBIA 5EXTA 3T5GA 2FPLA 3D8BA
chains in the Genus database with same CATH superfamily
1KC3A 2NQTA 4FI3F 2PL9A 2B78A 1SVSA 3IP1A 4LYEA 4Y0NA 2B5OA 1EI9A 3AKEA 1L3CA 3OC0A 1GZUA 1S2OA 1HMPA 1PUIA 2KHZA 5IYZF 1H5UA 2IKQA 3B60A 4YCMA 5A2GA 2NXWA 3KXIA 4FEAA 4KGXA 2MYUA 1GZ7A 2XB6A 1B2RA 5I9SA 2FFBA 3WK9A 1HH4A 1W4AA 2PO7A 4U9HS 2OMKA 1VC2A 4PPYA 4WESB 5FNVB 2IOYA 3I01A 3Q2OA 4DMRA 1GCGA 3N0RA 1OWMA 2P2LA 4L5CA 4MGIR 4B9EA 2IIQA 2YS7A 4Y1FA 1TYZA 1S0UA 4PGMA 4IHQA 1VCIA 2FNAA 5EJFA 3ZOKA 1YFJA 1NXTA 4J90A 5KDLA 4FWTA 3DNMA 1J8YF 2G82A 2VAWA 4B3CA 5L6MB 3ZJUA 2J59A 4OCZA 4WNAB 1VPVA 1QPBA 4CUJA 4BQQA 1OLUB 1NLYA 4RJKA 4WZAB 4JUAA 4BN4A 4B17A 4EFNA 3OCXA 4DTCA 1XDWA 3OZFA 1KVUA 1WY7A 2HK9A 4QDZA 4II2A 4MVJG 3T1QA 3WWOA 4A5OA 1R18A 1VLHA 2BMEA 3E7WA 3OOSA 4WMLA 5I4CA 3H84A 3VBEA 1WVIA 1DV1A 1W5BA 2OV2A 4OQNA 4NJMA 5LUBA 4CKWB 1IHXA 2GK4A 3G1WA 2ZAGA 1L5OA 1K86A 2IXGA 2PMWB 3DAPA 4H6PA 4LE1A 4OPMA 2VDUE 2VWGA 2GZDA 4BNDB 1YCHA 2CLHB 2YXNA 4KE7A 4YUXA 1Q0TA 2Z6UA 3UHAA 5B53A 1A5SB 1X0VA 1XEAA 4NQRA 1YR6A 2Z1MA 5GTDA 1WB4A 2PKYX 4O0MA 4JR2A 3ZLVA 1USIA 1ZA1A 2EJVA 4E5PA 5A9RA 1NBEA 2XCQA 4R2MA 4R1OA 4QJ4A 2EZ4A 3CVXA 4KWCA 4CXMA 1H1LB 3C4JA 2WSMA 4R1UA 3TD9A 3MD0A 2Z09A 4FYKA 4QELA 5FADA 5B3LA 1W7AA 3H17A 2RAPA 5TR9A 2D1FA 3MD9A 3TQHA 1M83A 3A9CA 3I4FA 4PPGA 4XDZA 4JBHA 5EKDA 1X2BA 1Q1GA 3K31A 4AF8A 1SBZA 4UAUA 5CXSA 2QPLA 1XCJA 1YDWA 2H2GA 1VKHA 4B76A 2OC4A 3AV3A 3R5XA 3N0XA 5KYUA 4AU1A 1DQRA 4MHTA 4GW3A 1MH1A 3RS4A 3A3KA 4RJIA 2MYPA 3IKJA 2MOKA 4E1BA 3A9VA 4HAZA 2OV4A 3EXG2 5C7OO 3HJBA 3CPJB 3ZLTA 1JG4A 1WV0A 3FSRA 4QTUB 4R9UC 2QSUA 4F91B 3IAM6 2Z1NA 3WB1A 4HS4A 5C8ZA 2NZWA 1XDZA 3VGJA 2I62A 2I80A 1J00A 1D6JA 1X1TA 2HGSA 1FDRA 3FCYA 3HUTA 4JCOA 3UMVA 2NU9A 3BQ9A 3OY7A 1I3LA 3ZV6A 3C7TA 3IEPA 4FN4A 1GUAA 3MJRA 1KHTA 2PBLA 4YP6A 2C2XA 1SEPA 1KYXA 2KX7A 1WNFA 5CPBA 1PEKE 4JNKA 3SJUA 1NNUA 4YRZA 3O1IC 4X1OA 2QN7A 4Z8XA 2XMDA 5ADWA 3H8JA 4UE2A 2Q6TA 2IOHA 1Q7TA 3KDAA 4EPXA 5KSOA 1G9SA 4NCBA 3TRJA 4ZEMA 4OFWA 3ZZMA 2NN3C 1BVHA 1D0VA 2NWQA 3QY0A 4Q1CA 3OZBA 1N57A 4EQ6B 3RS7A 2CV2A 2Z56A 1PYOA 3DDNA 1KO5A 2OC9A 4F0JA 2ETVA 2Y1CA 1PUXA 2WM2A 4MPRA 1MA3A 1SXQA 1Y7HA 4G5FA 3EGOA 5LDHA 1C8VB 4OP1A 3EPLA 3FVQA 4BEJA 4RDXA 2R9VA 2BELA 4QL3A 1GYQA 2ODNA 4E46A 2VF8A 3K70C 1TAHA 3IAXA 2OFFA 5HM6A 1L7PA 2DPYA 3IJ5A 1V71A 2IH4A 1GKLA 2WWWA 4HN9A 3T7EA 2C61A 4FYJA 2P1RA 4MS3B 5C7IO 5EJGA 4QC2A 1Y33E 1WZEA 5KJEA 4AMBA 2ZUEA 4DCJA 1ZW1A 3DWIA 1FXUA 2G9VA 3SYMA 2BFBB 2SCUA 1EVZA 3OFJA 3OJCA 2W83A 3P2YA 1RE0A 4HYQA 3ZIAD 1PAUA 4IDFA 2CLCX 2IQIA 3L0DA 1DTWB 4TV9B 5JSUA 1YMUA 2X2FA 3DEAA 4BO8A 4GL4A 1VYTA 3MT0A 3H1FA 1C41A 2UUCB 1SZPA 2V54A 3IOYA 3JARB 3PFIA 2ZK7A 1VDMA 5JXHA 4XB2A 1X15A 3ITDA 3FBGA 4X7RA 1MFPA 2RJ3A 1ZRMA 3B7GA 3K9GA 4R1QA 4Q93A 1MGOA 3KVYA 4EJ2A 2WD9A 4Q9HA 2WNSA 1Y5MA 3ZGOA 4TLAA 1SKYB 3IOEA 1MCZA 5B1IA 4F2DA 2RE8A 3T7IA 2A1IA 3C14C 1UMDB 3D2BA 2I1WA 4GKJB 1Y1LA 2OHXA 5LDDC 4QQFA 1YZHA 2PCLA 3C6KA 1RR6A 1DC8A 4WTOA 1CX9B 3BD7A 3FYHA 1SU6A 3BUSA 5TB5A 2P4QA 3HRKA 4J6FA 2RGDA 3AW9A 5EXEA 5L9AA 3K05A 4INPA 3CLTD 4EY7A 2GQ0A 3VMMA 4PLFA 2D0OB 2XNKA 2ZDHA 3H6KA 1NMSA 3GJ0A 5LBIA 4MWEA 1T8SA 2OBLA 4JLDA 3UH1A 1BQ3A 1CZOA 1E1CB 4WKNA 2O5CA 3MK31 1XROA 2W4IA 3NFYA 4X8OA 1ZH2A 2BFOA 3TIXB 1I36A 1YAHA 3LQ4A 4XJXA 2Z6QA 2FB9A 1CY2A 1KJQA 1W1WA 4ZO6A 4RTNA 9LDBA 1ZHHA 1MC8A 1L1EA 1T13A 3IR7A 2XOEA 1XTQA 5EC8A 4B80A 1MVLA 4C7OA 2VRBA 2YBDA 1Y5LA 5F7JA 3BX1A 4ND6A 1WLSA 2PKEA 2R25B 3OLCX 1Z5NA 4IH1A 2WYIA 4BQFA 5F1KA 1MO6A 5BMVA 5IM5A 3IAHA 1SUFA 4KIJA 3R7WB 1C30B 1OT5A 1W19A 3C74A 5EPOA 3MQFA 4E15A 4E4RA 1WSBA 2B83A 4BZXA 1OXMA 1QO9A 1GLGA 3UMMA 3Q8KA 2V5AA 1E5DA 5JD5A 3JZFA 4WY5A 3UJNA 1FS6A 2WAAA 2OSVA 1A9OA 1I5RA 1GZVA 5E95A 2W2NA 5BWCA 4D42A 4UQOA 3ESYA 7AT1A 4Z4GA 4MKZA 3N2KA 2OTCA 2IZZA 4TV9F 3NT2A 1YSCA 4J0CA 4DSTA 5C1BA 3RQIA 3JQRA 1ISSA 2WJGA 3HB9A 3WADA 4B7AA 2H0QA 4C4PA 3L8HA 2HO5A 4RA9A 3LPDA 3HVRA 5LIPA 4RVOA 5MN5A 2NTJA 3Q3VA 1XWFA 1ZUIA 1C9MA 1UJ2A 3TYXA 2CWWA 4B35A 3HSSA 4RY0A 4YFVA 4R0MA 2ZJ0A 1SULA 3N3BC 1IVNA 1Z4OA 3JCZA 4EL0A 5ELMA 2X8LA 4B6JA 4B0OA 3MQ2A 4FOOA 4OGFA 2BF4A 2DY1A 1K97A 5B64A 1ZLXA 3ZGLA 4OJKA 3ICCA 2ZT8A 1C0IA 1LSOA 3GB9A 1H2EA 5CVDA 3AC0A 2ZSIA 2DUMA 3GDGA 4NMWA 1GL9B 1HSOA 3MINA 5K03A 4GPEA 5A06A 2P2DA 3KUKA 4KVFA 4RTLA 4BKOA 4DV6B 2GJAA 2Q5QA 2OCDA 1XYGA 1NMYA 3W5CA 5KCMA 4KWTA 4F6LA 4CF6A 1IOWA 5K99A 3F67A 4Q02A 2XF2A 1HYQA 4LDZA 1RRKA 3K09A 4M0CA 3OP4A 4YA6A 4FNOA 1S1CA 5HFJA 3ABQB 4BV8A 1P7WA 4QTZA 5IK2A 1MTZA 2FUEA 4KVZA 4RD6A 2ZRCA 1P3DA 5EYPA 5CBKA 5JIBA 1RIIA 2HX1A 1YU9A 2QENA 3BL5A 2WHPA 1HOTA 4Q4LA 4TXJA 5FPHA 4EELA 3ZIUA 3NKLA 2V7TA 4QUIA 4R6WA 1W4RA 4YCCA 3WNCA 5K0BA 2QBYA 3ND8A 2MJLA 3ILSA 3UOAB 3CQ9A 2GGSA 5K4GA 3MPUA 1P7CA 3PHJA 1IY2A 3TTTA 4DYHA 5B58C 2B1GA 5KHAA 4LTMA 4C4OA 1R8XA 1IL0A 1XDBA 3NHWA 1YZQA 2QRNA 4MI1A 2R62A 3DTNA 4XDYA 4GPD1 1JWBB 3IT3A 5AOBA 1AB5A 4IHJB 3DMTC 3PKZA 2OBBA 3V1TC 1O94C 4AT1A 1RM3A 3LIIA 2YJTD 1S7CA 3Q3JB 3ZY4A 3M34A 3SZMA 1G5RA 5DGIA 4KYIB 5IT4A 1WETA 5FWAA 5BURA 1U11A 3DZDA 1N0VC 2YRXA 4N5NA 4TV9A 3U0BA 2WJVA 4WXMA 1RYBA 4IO0A 2QNRA 2ZW9A 3WNQA 2O8NA 4HMPA 2W8BB 3BH7A 1HO3A 4MROA 1GSOA 3CCBA 2CLDX 4DR2B 1W2GA 1PJCA 3GDWA 2GB4A 3D02A 3KQYA 4R2IA 4HDAA 5EGSA 1D4FA 3IDFA 3NXSA 5I4IA 1ZSNA 2WAOA 1L5HB 2R8ZA 4P4LA 2COUA 3GAFA 2BPOA 4LJKA 4XJTA 3WIDA 4XWKA 5F3WB 3EXEA 4YECA 3ILXA 10MHA 1TTPB 2PTHA 2ZBVA 3TRIA 3MNFA 1CQPA 1R5JA 3QUBA 3MGCA 1X92A 2IUYA 1XZMA 1GPMA 2FETA 2QD5A 4TL6A 821PA 3A6PC 4B47A 2I1LA 5A0FA 3NOVA 1YAJA 1CT9A 5DGCA 3QKRB 2WJYA 1E2HA 4AKEA 3H97A 4CLRA 2BH2A 4WVLA 4YAUA 1SGWA 1ZGJA 3HP7A 3HYRA 4ZVLA 2YIJA 3OD5A 1VBFA 4YJFA 1F2DA 2Y0PA 3A2KA 1OJLA 1RHQA 2J45A 3H87A 4Q1EA 4OHZA 2HSGA 1XA0A 3VR6H 4B6OA 4FNGA 4ED9A 1VE7A 4D3YA 4XGIA 3T1OA 3DS8A 4RXUA 4BPRA 1S2DA 3E48A 1J1IA 4PLYA 1VBMA 1K4MA 3V4LA 4RFSB 3G2OA 1NU6A 3N3AC 4OIMA 2I7TA 2QJFA 3WNDA 3FDIA 4LBVA 1BNCA 1FNCA 1U9IA 2ORIA 4MV6A 4N7JA 3WLJA 1ZNWA 2QQGA 3BWYA 1JKJA 1WZNA 5LDGA 1L6IA 5CLFA 3EY4A 4FW8A 1LI5A 2FY8A 2VIIA 1HDYA 4N3AA 4QDTA 1T4GA 2O5RA 3PNKA 3QKSB 5LA6B 3DE2X 4TN5A 4F6RB 1WMSA 4NPAA 3RGWS 2G76A 4XWAA 1KMMA 1RKQA 5J1TB 2IXFA 4HEA6 1AXRA 4IIVA 5DNWA 1MN6A 2UUPA 3M6XA 3NC4A 4HFMA 2B7CA 4UEQA 3UWPA 2ZDGA 3K8OE 1A8IA 5HCUA 3TD6A 2DZDA 3KQNA 1KORA 3PPYA 1YHNA 2WYHA 4W1SA 3VVCA 4E6PA 1JFVA 4YEDA 1TU4A 4ISCA 5KJ1A 4XR4A 4IIJA 3MOGA 4BNLA 1N1MA 4Q3AA 1H3FA 2IYLD 4I3FA 1FDSA 2QZ4A 3KWLA 4FONA 3OLWA 2F7SA 3A37A 4FKMA 3DMRA 1BEEA 5C4IA 4BYGA 3PEVA 5DFAA 1J22A 4JUCA 4TKVB 4RGQA 1NUHA 2WFLA 1GG5A 3R3JA 4A2QA 3KJIA 3PD7A 3LPAA 2XV1A 3NYRA 4K9MA 1GPUA 2OD9A 2OLEA 1TU3A 2JEYA 3UK0A 4DIFA 2Q2QA 2B94A 1E2KA 1XMIA 3JW8A 3SKXA 5J4LA 5J5AA 3QOYA 4F12A 4JBYA 5GADl 3ZLJA 1ORTA 1UJMA 3BWEA 4KEAA 3FOEC 1ZK0A 1FC0A 2NUBA 5TJ9A 4BO5A 2CEKA 2HDNB 4M9XA 2BEJA 3EARA 4WXRA 4Q9JA 3MRTA 4U2DA 2PZFA 2OZKA 1BXKA 2AXPA 5HX7A 4LNHA 3R5SA 1N2CB 3NWBA 4DNFA 4RTSA 1G9XA 2RHDA 3AONB 3OPYB 4N6GA 2W43A 4DQUA 1SBQA 2RHWA 4RLFA 2MTBA 3OQIB 5JT1A 4S04A 3AZOA 4XAQA 3OCZA 2OT3B 4LI3X 4PWYA 5CW1A 2QRKA 3O8QA 2YWBA 2YS6A 1Q77A 2EL7A 3NANA 3R9XB 5ARBA 1KPHA 1H6AA 2J0EA 3EDYA 4HGOA 4MYUA 3F4KA 1TFRA 2CSUA 4MR7B 5KKAA 4KXYA 1FZQA 2H51A 3A6KA 3TQCA 1ZD4A 2ZDQA 3PT9A 5B58T 1GPJA 3ORSA 4JS0A 4X6YA 4D9GA 5JAPA 2HFJA 2LNDA 4K6KA 5F4BA 4UTPA 1KY5A 1VA5A 3SLRA 3A7DA 3OX1A 3BICA 4R54A 2QLTA 5FNVA 3TQSA 5JQGB 4FD2A 2AVDA 1NWCA 3ECSA 1GL6A 1FSZA 4M98A 3G85A 3HY6A 3P27A 5J2UA 1QHHA 3ZV4A 1W0JA 2D7CA 4RDCA 3U62A 1E2BA 2IEGA 3NYIA 3IRUA 2B4TO 1R64A 5FHQA 4F4JA 5F2NA 1SQGA 1XR3A 2VBIA 1ZO8A 2XW6A 1EBBA 3ENVA 3SWWA 3OTIA 4GIBA 2PBZA 4YIHA 1SCBA 1GNQA 1D4AA 2D1RA 4D4KA 5AM4A 1KPGA 3KR9A 1BD3A 5HS4A 4C0SA 1XCLA 3ANLA 1VP3A 4IFTA 4PXSA 1CTQA 3D6MA 1MXFA 2GZ1A 1NY5A 3OCYA 4FK8A 3K0SA 3UAVA 2WLTA 1GCAA 1XDUA 3DLHA 1V8BA 2WWVD 5CVCA 3VV3A 1SUIA 5K9ZA 3ZWAA 1WMEA 3IAFA 3F5DA 3G2PA 3L7IA 3RODA 1RWQA 1RXVA 1NQUA 1USGA 2E4UA 2J3IA 4TROA 4LMRA 3T61A 2Y27A 1KJYA 1FK8A 1ZKDA 3RRYA 4DPKA 1WWKA 1EIWA 2SHKA 3W8RA 1RWKA 2SKDA 1TK9A 2A86A 1COZA 1JAHA 4C01A 1R1DA 1SC1A 2EDAA 2VDJA 3TLGB 5I01A 3ACBA 2HT1A 4I36A 3B9RA 4WERA 2R00A 4EMSA 1OKKA 1CQJA 1X1QA 1U81A 621PA 1YB1A 1R5NA 2YHSA 4Q4JA 5BXQC 2VH1A 5GOZA 4ANFA 5KTSA 2BN4A 1QS0B 1P9NA 2M9MA 1HORA 2A7XA 4G2TA 4KRYA 2IH2A 4RD0A 4D3DA 4P92A 3VM6A 1L8AA 4CG2A 4FS3A 4CR8A 3ADDA 1Z2OX 2YVAA 4NSNA 3CG0A 1Z88A 3QXCA 3E7DA 4DEYA 2WVGA 3JQDA 4GWLA 3AWIA 2W2OA 3C85A 2KYRA 4R81A 4QXMA 1FQKA 2ZUWA 3EISA 1ECBA 2QZPA 4D4HA 4IV5A 5AW8A 3GLGE 3ICOA 5C81A 5JVDF 3BD6A 3EVDA 4HEJA 1E1RD 3VR6D 2Q3FA 2OCGA 4Q1AA 3O1LA 3KTAB 1ZR4A 1NVMB 4D96A 1QOZA 1IY1A 2QTBA 2K7FA 4ACBA 2CB0A 1U9CA 4YAIA 4BEWA 1TQ8A 4EA7A 2JLZA 3B7PA 4AY4A 3MSCA 1Z07A 1UBRS 2HRRA 3U13A 4DKXA 2HRZA 1WSDA 2IITA 4S2EA 2BCEA 3AF4A 2JK0A 5EWJA 3UN1A 4JYMA 3HO1A 2H0AA 3I2FA 3IHTA 3K0FA 3DUWA 3DYVA 4MQBA 1UJBA 4HSEA 1IJFA 2DFVA 4ZHSA 4DXDA 3QU5A 1H9BA 1L8LA 5EXDA 5IAKA 2PPVA 3U7QB 4ILKA 1XRPA 2JH3A 5DOVA 3SEQA 1I6LA 3KT3A 1XZAA 5GINE 2Z95A 1V41E 4YR9A 1XNQB 3I1FA 3ITKA 3SMVA 1ZCAA 2K5UA 1ESCA 4OU5A 3DGFC 3WGGA 1M8KA 3HA3A 4A73A 4DE5A 4PYJA 5AVTA 2VHJA 3AR5A 3LYHA 4HWTA 3NO4A 3P2IA 3NXKA 5BQXA 3FLEA 1L7EA 2NT4A 5J2TA 1Z34A 1KK3A 3PD0A 4N4AA 1Z35A 2A1UA 4IJ6A 4YPOA 1E60A 3GMTA 3JQQA 3OIUA 3RU9A 3SJCA 1QUEA 4HGPA 3QVGB 1IRIA 5FBRB 1JQLB 1X74A 4RVNA 1UMBB 3EBPA 4G0XA 5DHFA 4AYTA 4CJXA 3MFQA 5HGJA 1U8CB 3EYWA 4M1WA 2NVUA 3OETA 4JZKA 1KGDA 2PX5A 2WOOA 3RBXA 1U0LA 4JC4A 4JB2A 1P2FA 1FE8A 4M9UA 1U7WA 2PH5A 3JWHA 3RAGA 4ENTA 5BR1A 3N8NA 5LYJB 1IQUA 4WZBE 2WUDA 5FRDA 1SBYA 4WKPA 1OYOA 5EFZA 4B6SA 3AESB 1M7BA 1JECA 4N5DA 5DSXA 3HBFA 1HK7A 2JIZD 1E7YA 3B70A 1YHYA 3DFMA 3HCEA 3A27A 1QE3A 3M1IA 4RCYA 4OLJA 1RWNA 1W88B 4WXYB 1AMNA 3GDFA 2W42A 1VPTA 4IDGA 5LNK1 4YY3B 1YQEA 1KH1A 4WNYA 1RYZA 3CFYA 4QU0A 3ZDZB 2XE8A 3ZDDA 3HXLA 4AS3A 3DOEA 4Z9XA 1ATIA 4PSCA 2GWRA 3CRW1 2YVUA 4FOLA 4RKRA 2Q3HA 3R9IA 1XCGB 4WZAE 4D0SA 4F06A 4HLUA 4NYJQ 4R8KA 5FB3A 3RSCA 3RHFA 3W4IA 3OT1B 2XUKA 2CJPA 1OLSA 2HSJA 3BSSA 1ULTA 3RWMB 1A7UA 2OV1A 1AUQA 3ZD9A 1EDOA 4Q4AB 3C87A 3W5HA 4YXWD 4CN8A 2CV1A 4Y9SA 3VPCA 4LDRA 1BW9B 3QUTA 3GMDA 4HG2A 4RM3A 5HNKA 4CU2A 4Y6QA 5K6AC 1LWNA 1FVFA 1XJQA 2Q4BA 2VP6A 3FPLA 5ERGB 3WIBA 1SXHA 4X8LA 3WIUA 1WTAA 4BO0A 3EG9A 4G09A 1E62A 3G9ZA 3R3HA 5JAQA 3HCDA 1M6VA 4XUGB 4HWKA 2BR3A 3AKCA 2FLWA 3AY0A 5B1SA 5JVDA 1JH9A 3BEDA 3JYLA 2HF8A 4IJWA 4X41A 1EE2A 4HWPA 5JCXA 1V6CA 1TT5A 2B36A 4FINA 3H83A 2IS1A 4WUTA 4KN8A 2KBEA 4MO9A 1JR2A 1QK4A 2D1SA 3IL2A 2G04A 3FWHA 2VSFA 3E8XA 1B2LA 4Q48A 3DMTA 5DLYA 1OI4A 4MCAA 3QPWA 2B61A 3D7LA 3EUFA 4QNRA 2ODWA 1KAQA 1ZCJA 2WR8A 3ONNA 1BYUA 4PVCA 5BT9A 4YJ3B 3E35A 1RE1A 5AH0A 8GPBA 1OYVA 5B2EA 1KETA 4EF5A 3ESXA 3ET5A 2R96A 1DBWA 3O74A 3IUBA 3ENZA 4FLFA 4AD8A 2WI8A 5F33A 3OJOA 3QWHA 3THYB 1E4EA 4PM4A 2ZB7A 4G1EB 4QHSA 5GWXA 1GAEO 1HT3A 3P9KA 2A57A 5T4FA 4ZTUB 3GEGA 2QYTA 1MMFB 5LSAA 2H08A 2DGDA 1GNVA 5KTPA 5IRCD 3ANXA 3GAMA 2JFPA 1BVRA 1ECCA 1WPGA 2YHIB 3O84A 3U40A 1W36C 3ABIA 1OAOA 3IESA 1I13A 1CF4A 3M8KA 5JCZA 3V6MA 4C43A 1V1MA 4QPDA 3ZUGA 4QFBA 1QNLA 4P7GA 2FCRA 6ABPA 1XU7A 4CI9A 3ZCRA 4LF4B 5JZMA 5LD2C 3T5BA 1CJMA 5E0KB 4I50B 1J0AA 2R44A 1X42A 4GZ3A 3SU8A 7MHTA 1GILA 1VKRA 5KIAA 1VCOA 1FJGB 5JCPA 4LTNA 1YXMA 4B82A 3QBTA 4IUBS 5KJCA 3DVAB 5JPDA 2IHYA 4QPJC 3CNOA 2O52A 3VR3A 2R84A 1XP5A 4MRVA 3LUBA 3CZMA 2UZ4A 4JLPA 1SC6A 1YRWA 1VIDA 4H7KA 4DHEA 2I2BA 4GRAA 1FDVA 4JR0A 4P7BA 2IRWA 1BJRE 3WR5A 3Q8WA 5T57A 4I9GA 1W76A 4DDHA 5KS2A 2OGTA 2YN0A 4PYMA 4ZZ3A 4UAGA 5GY7A 4TKZA 4LCEA 4H35A 3GLKA 4D9NA 3EXHB 1LH0A 3Q9SA 4OV6B 4YQZA 3LU1A 3N9IA 1N2GA 1DBPA 4OUKX 3K73O 1VPEA 1RQNA 4KDRA 4E08A 1IWBB 3RS3A 4B79A 4MA4A 4DMKA 4REQB 3H1AA 4IEIA 3SE0A 4HDOB 4MAAA 3RVNA 4E32A 5M3BA 3UHPA 1K0UA 1N5MA 4RAOA 2YV1A 3KHKA 4BFYA 4WHMA 2WMOB 4C4RA 1T0JB 4MUKA 4QUDA 5DHRA 1MB4A 1P4HA 3X1JA 2CLKB 1XRRA 1K6XA 1DKPA 3CONA 1BQ4A 2NNLD 3M3HA 3QEJA 3S6JA 3D3NA 1TUEA 1R6DA 1GU7A 2AQHA 1S01A 1TAGA 2WZCA 4QYTA 1OFVA 5CVUA 3SJZA 1TZBA 2C96A 4IIEA 2QAGA 1UJ5A 3NT4A 2C8LA 4E12A 4PC7A 1CXZA 1JGTA 2DJIA 1UFQA 4M8LA 2ZE7A 4OLHA 1KFCB 2GN6A 3H2HA 1QYVA 4ABYA 1PS0A 2X4DA 3VDQA 3H4MA 2EAUA 3PU6A 4EHAA 1EWQA 5FFNA 1U28C 2QSJA 1DXQA 3I42A 3V1YA 1V5FA 2JIDA 1AUVA 1H2YA 1NBAA 4EB0A 6AT1A 5CXQA 3DKIA 4JOSA 5MN4A 2EOAA 4AX8A 1G0NA 1KFEB 5E6SA 5FA5A 1XBTA 2H7YA 2WYVA 1T0PA 2TRSB 4QDKA 5JH7B 4HEHA 3K1YA 3LUFA 5DM60 4YJHA 1SIOA 3MMSA 4R8SA 4YASA 1ZXBA 3GARA 1EGMB 2P2ZA 3PDHA 4EFLA 1TKAA 2XZLA 2I2AA 2Q4EA 2C88A 2NZJA 1D0IA 3R3YA 2BMAA 1L5HA 1JDNA 2A5LA 2VDRB 5H4HA 3S2GA 1UFRA 2DYKA 1Z2NX 2PLNA 8MHTA 1XTRA 4UCWA 3S0JA 2GM4A 4DR7B 1G21E 3S29A 4HAIA 1BXZA 5IEBA 2I6GA 3WQHA 5BW5A 4CMHA 1UP7A 1Z4NA 2YC2C 2B5WA 2W6CX 1N6PA 2C9MA 3DOOA 3DZKA 2B1RA 5A9TA 2ECOA 3A3PA 3OZWA 4I3HA 1KPIA 3PITA 3VDNB 5G41A 2CFOA 1T4CB 4D4IA 5HOQA 3CBGA 3D8HA 3UFXB 2IP4A 5TDHA 4KNYA 2I4LA 1FTNA 1W48A 3AEUB 4E1VA 3B1YA 2B4YA 1R6XA 5J23A 2O8FB 2Q6KA 1FQWA 1KH3A 1YH3A 1CUCA 3FYUB 2HCRA 1T2AA 3D4IA 5KDDA 3DO8A 5K09A 2VWHA 3A4LA 3F0TA 1WF3A 1WDMA 3GELA 3G6KA 2P6NA 1RAHA 1H9CA 1Z2AA 1D6SA 5DM1A 5TLSA 2AEJA 2QVYX 3MOSA 2FEAA 1O9BA 3U4IA 2XD4A 4MVJH 3QMPA 1PR4A 1XX6A 3DQPA 1O96A 4Q3NA 3AHHA 1ZMTA 3IO3A 4BB6A 2HAEA 2JGDA 3KHSA 4I9NA 4MVJM 4U0KA 1KEPA 2QL5A 3M2PA 3EUWA 3JYQA 2JF0A 3N2YA 1CLEA 2B3DA 4PGAA 3RC8A 2PSHA 3F3MA 4HDSA 1KZ6A 5SY9A 5JALA 1M2EA 3H5RA 3M49A 1QHIA 1ODFA 4EDFA 5BSFA 3EQ2A 2Z3WA 3ZE1B 3K71B 2XA2A 3C16C 4PSKA 1G20E 3M4YA 4O6VA 4B6EA 4K9KA 1G7TA 1U3GA 1XZLA 1K08A 3U1VA 5BRAA 1IZ9A 3RBZA 1YC5A 3HKCA 4HJXA 1NJGA 2AXNA 4CM9D 4DW8A 3NIFB 2QM3A 5BRNA 2ATEA 4YDQA 3PTAA 3MTIA 5F78A 3IXMA 4K9SA 4KXVA 4MV3A 1CR6A 3VNBA 3WI7A 1PIWA 3AU8A 3CLHA 4FCTA 1SEVA 3ZNQA 4NV1A 3U1BA 4O2AB 5BOVA 4JC8A 2Z9CA 4DNXA 4FB4A 3M5CA 3IUMA 1JJFA 2ASEA 2BMFA 2P78A 3CF4A 3LC7O 5AW2A 2YIMA 4LOHA 1NLMA 3NETA 1IHUA 4RK6A 1NXOA 5CTAA 4TTVA 1QRTA 3EHEA 1VJCA 5TJHA 5DI3A 3ZH9B 2VK4A 2Q07A 2P4UA 4UEKA 3ZQKA 1MRSA 4Y0AA 1N3LA 3FIUA 2ZYHA 3JXEA 1EFRD 3F6EX 4PHHA 4TRRA 4V0SA 1KERA 1KR2A 4R71A 1DGQA 3N05A 4FYWA 3L0ZA 4JLNA 1I6WA 3HABA 2WF9A 1QH8A 3L6BA 3QVTA 1KMCA 1BEUB 1JAZA 3AESA 2FSFA 3R7WA 2CLOB 3HP1A 1PSZA 3Q4GA 1JHVA 5C4MA 4WD3A 3MTDA 5B1DA 2FI1A 3M7IA 5LM3A 4F85A 3D7NA 4CT4B 4MQEA 1XAGA 3O8BA 4TS1A 1LFAA 5DHTA 1UBLS 5ALOA 4HNVA 1CIVA 5ALSA 4COOA 3K72B 4GKKB 3B36A 1WEHA 4L75A 4NKRA 2XXAA 4YJ3A 1UZUA 4JJ6A 4KR0A 1NUSA 1WCIA 1Y8AA 2P9HA 4TTTS 5TT0A 2WINI 3WHLA 2XCSB 5FL7D 1N9ZA 1J8FA 2C2BA 2RSLA 3L01A 4YVFA 3ZNOA 1FSPA 2Q7OE 3FRHA 1E1CA 1VZ3A 3U7GA 1M6YA 1T5SA 3INYA 4CTNA 5AKJA 1RKBA 2Y4NA 1ZOIA 3MJSA 2W37A 3WGOA 3FM9A 1RQGA 4N5MA 1QR2A 4M9QA 3H5TA 3KR1A 5KQRA 1XTTA 3BTVA 2X0FA 3ADPA 3HVHA 4X7BA 4XVCA 2QT0A 2QL6A 4JU8A 1MRZA 3R8CA 3TS1A 1NYRA 4Y2YA 4NTZA 4UBKA 4C2UA 2CNDA 5BYJA 4ZCTA 4C2TA 1E0SA 2DETA 3MINB 1ZI9A 2DJ5A 1B8PA 2JKYA 4OQEA 2AFIE 3IB6A 4XWGA 3RK1A 1QQBA 1WQ4A 2JLSA 3FSJX 4I5GA 3C70A 3D5EA 3FSEA 3N7UA 3VZSA 3OZDA 2E85A 4GOND 5A4JA 3QEBZ 4ZOCA 2O0LA 4V0ME 3KZOA 1KKMA 4IIHA 2E48A 2H9AA 1Y89A 4MVJP 4JUIA 4ZHQA 4F9FA 3SFZA 4J07A 1G1MA 2GBCA 3GRPA 3PQ4A 1QZTA 2X4GA 4RPLA 1EUYA 3L79A 3QEKA 3ZDQA 3ODPA 4EO7A 4HJRA 2O3QA 4V39A 2FJPA 5B37A 1ISJA 3JYPA 4RA9B 3DXZA 2Q1SA 1UWLA 1W0JD 1RKXA 3TOSA 5K8IA 3UTCA 1SHLA 4DMUB 3PUVA 3KEFA 2Z5VA 4CQMA 3UF0A 1TDJA 3NWPA 2QR3A 3QMVA 3H75A 2AJ8A 1NT4A 3S2IA 2CFRA 2PUAA 4R2WA 4OI2A 3D43A 1V7QA 3DFFA 2HPAA 4IHJF 4F11A 3MUOA 3FB1A 1NLUA 3MJCA 1D6NA 1D2HA 2WV7A 1IXKA 1K7XB 3B2NA 3V8VA 4BQOA 3BGSA 1KIAA 4MKRA 2EFHB 3HCNA 1LK7A 3X1YA 4YRCA 1G8SA 3M1YA 1NN3A 3G49A 3MJDA 3NUZA 4J7CA 4FHEA 3Q87B 3QXSA 3BEOA 4KVGA 4BEVA 1P18A 3G9TA 3QHPA 1LDGA 4KUGA 4MGYR 1MBZA 1H93A 1G98A 2VT6A 3OPQA 4NX2A 5AJVB 4Z99A 3OHSX 4C78A 3KWFA 3AFMA 3L5KA 3WWZA 5LZ7A 4H3SA 1VZ2A 1X87A 2FR8C 5I9IA 2O2JA 2WFZA 1SZJG 3JSAA 4QDXA 5KMGB 2HA3A 4JYBA 4HGZA 1IHYA 4ZTBA 3T35A 2GPYA 4IQFA 1JJIA 1VTKA 2IPAB 4A92A 1VG0B 2GAAA 4ZRMA 4E4TA 2FW7A 2R6HA 1QGOA 3GNSA 3EDQA 3BJRA 3SR4A 3WY9A 2NXEA 4E09A 3WAJA 2PR2A 3MMZA 3JQAD 1VJRA 2P27A 3IH5A 3KYCA 2JIZA 4HDRA 4MJ7A 3OTHA 4TV8A 3W90A 1GYRA 1VYUA 2FRDC 1T15A 4ZOLF 1SXJC 3C6YA 3WIOA 1OJ7A 2Q5FA 1QRSA 3GPLA 5DW0A 4UHCA 1D0SA 4LXYA 5EIFA 3RAFC 4DT1A 4OB8A 4DMCA 4BMZA 4RZXA 1OOEA 4YRDA 4K9QA 1NJ5A 4DRXB 5CH5A 2FCAA 1UKVY 3W8DA 1RD4A 2PRSA 3VRHA 1QIEA 2R6AA 3ZXSA 4M3NA 2OQRA 1CKEA 1XRQA 2P5SA 1J2JA 2Q3LA 3FBWA 2C5HA 1D2EA 3BJIC 5FYDA 1KJIA 2NNWB 5ARDA 5KOJA 4OXRA 3L07A 1JIKA 2H2DA 5KWEA 5HM8A 1F38A 3ZU5A 3Q8XB 4LYJA 1VP9A 3IUYA 3T4EA 1GEGA 2O50A 3JPWA 3CO0S 1V7PC 2A1TS 5FBWB 4DCGA 3N75A 2C2YA 1ZGAA 2YXLA 3BSWA 3FR7A 2H92A 3R5TA 4MS3A 1TJ4A 2PA0A 2A7QA 3GEBA 3PUJA 1Q0UA 3D7KA 3INGA 4OYYA 3E6AA 3RV4A 3VH3A 3CC8A 1FFDA 3F8WA 4UCFA 4XRRA 4BVJA 1YA6A 2ECFA 3DDSA 3BJZA 2E5FA 3G5UA 5CIYA 3K3PA 3TK1A 2XUPA 3B1JA 3HWX1 2DHQA 4FCCA 4IP0A 3BXXA 2I87A 1KA9H 2AYYA 2EJBA 2NPIA 1JSXA 4LISA 4LXQA 3QWBA 3L4BA 5TMEA 1P5FA 3B1WA 4V0QA 3QYAA 1Y3FE 2PGDA 3KC2A 8AT1A 1ZXXA 4GXNA 5KNCD 2QMZA 2NX2A 4MVJE 1X7XB 3DKRA 3R75A 1IZ8A 4IH9A 4TKMA 1PG0A 4E11A 1G5IA 3IURA 2JGLA 1AHIA 3EH2A 1L4LA 3KQHA 3ZXXA 1FMCA 3OQOA 1ZR2A 3MILA 1PJBA 5KAMA 4YJGA 2CD7A 4P38A 1P9WA 3OO0A 4D4MA 2Y77A 1II8A 3EJWA 3GRUA 4PFQA 5AUOB 2AX3A 1P1HA 1QQ5A 2Y3IA 4B3JA 4DR6B 3JR3A 4S1PA 3ONWA 2JFNA 4EPWA 2IEIA 1YULA 4OM7A 1JNYA 4PG7A 1R6TA 4KJXA 1FJHA 1RP7A 1R0RE 1WL8A 4TOIA 3WGZA 2PUGA 4Q1VA 4EYKA 2JJQA 4AJ4A 5KKNB 4AMYA 1H1DA 3PGA1 2MMCA 3GJTA 4CIVA 5EVCA 2GI4A 2VHVA 1WOMA 1Q16A 1RHRA 2FWJA 2DLCX 2IHNA 2P8JA 3JX9A 4MJ3A 4UZEA 3WYNA 1R7RA 3ZHRA 2ZBQA 5KX5F 3DNFA 4R98A 4C14A 2EGUA 4DCMA 2ZRIA 3IS3A 4ITUA 1P1JA 1VECA 3OT4A 3SR3A 1RI5A 2B1IA 2JAUA 4IS3A 4BFXA 1OXUA 3CGWA 3E9QA 4C4SA 5IARA 5AVJA 3RTAA 2OHIA 2I67A 3ZQ4A 3BK7A 5AKYA 1PL8A 4XX0B 1E89A 1JHQA 2ISQA 4NZOA 3O03A 2X77A 1VMDA 4H1WA 4TKUA 2GTIA 2ZVDA 4BN5A 1BTOA 5JCJA 4GZ6A 1T9GS 3O92A 2UZ1A 4MKIA 3NWJA 4OBEA 2Q7XA 2XQGA 4D5EA 2HNKA 3GUUA 3LXRA 1FFYA 1WKCA