2GZMA

Crystal structure of the glutamate racemase from bacillus anthracis
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
266
structure length
266
Chain Sequence
KLNRAIGVIDSGVGGLTVAKELIRQLPKERIIYLGDTARCPYGPRSREEVRQFTWEMTEHLLDLNIKMLVIACNTATAVVLEEMQKQLPIPVVGVIHPGSRTALKVTNTYHVGIIGTIGTVKSGAYEEALKSINNRVMVESLACPPFVELVESGNFESEMAYEVVRETLQPLKNTDIDTLILGCTHYPILGPVIKQVMGDKVQLISSGDETAREVSTILYHSKMLNEGEEQSDHLFLTTGKIGLFKEIASKWFGQPIENVKHIHLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamate racemase
publication title Structural and functional analysis of two glutamate racemase isozymes from Bacillus anthracis and implications for inhibitor design.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Isomerase
total genus 97
structure length 266
sequence length 266
chains with identical sequence B, C, D
ec nomenclature ec 5.1.1.3: Glutamate racemase.
pdb deposition date 2006-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01177 Asp_Glu_race Asp/Glu/Hydantoin racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gzmA02
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gzmA01
2JFXA 2JFYA 2GZMA 3UHFA 5IJWA 2DWUA 3ISTA 5EVCA 3UHOA 3HFRA 1ZUWA 2DX7A 2JFOA 2ZSKA 2EQ5A 3UHPA 2JFUA 5HRAA 2JFWA 2OHGA 3OJCA 2DGDA 5ELLA 5HQTA 5HJ7A 1IU9A 5ELMA 3ISVA 3OUTA 2VVTA 3S7ZA 2JFQA 2JFNA 4B1FA 1JFLA 2OHOA 2JFVA 5HRCA 2JFPA 3S81A 2JFZA 2OHVA 1B74A 1B73A 2W4IA
chains in the Genus database with same CATH superfamily
5J4HA 4YRNA 5AK4A 1E59A 2MU1A 2V6GA 5SYAA 1TJYA 5CNIA 3VDRA 1TQ6A 1ZIDA 3QNUA 1R6AA 4FKBA 4ZVVA 3SEQA 5LN1A 2ASVA 3A4NA 3QF7A 2BM8A 1SM4A 1XVIA 3U7HB 3KUUA 4L28A 4MUXA 5CEJA 4KQWA 3JQAA 2Q46A 1IOVA 2NO4A 2WEKA 2FOXA 3C24A 3GCDA 3C70A 5DE3A 1JAIA 4DSNA 3KNZA 3FX2A 1VIVA 5IF9A 5FO1A 1YAJA 1M73E 5DGHA 4KPUB 1U4SA 2F1IA 2OR3A 3FDXA 4IIUA 1RJGA 3T4UA 4ARAA 2JAOA 2ECOA 5JYEA 1LQTA 2XV1A 3WYNA 1Y8CA 1L7EA 1PTJA 2C5BA 3JPWA 2EKZA 4NCHA 1ZXLA 1AQJA 1DRKA 4Y1RA 4HNGA 4DWJA 1LW6E 2G4CA 1V6SA 2VRNA 4YFYA 3O8BA 1H23A 3G9XA 3VOTA 3C0KA 3ZDFA 5G0TA 3WAJA 1D4FA 4P4SA 3CBGA 3AJ8A 5DLQC 2J45A 2QN8A 5F1PA 4LV6A 3ETGA 5J2TB 4RJTA 3GNLA 1CG6A 3KKOA 3KJIA 4HAUA 4O63O 3JZIA 3N0VA 2QT9A 3CZ5A 1YXMA 4WGGA 4C4TA 1XRNA 4HEA6 3PGVA 1XTJA 5ARBA 4MR7B 1E1DA 1C8BA 1M67A 1ZS9A 2EVWX 1VCOA 3O5AA 4M99A 2HSDA 1B8NA 2A33A 3OZBA 4WTOA 4BO3A 4C6HA 2EL7A 5CIYA 1X19A 1MQSA 1VSUA 1QC5A 1ULTA 3AWIA 3M9XA 4LC1A 5ECGC 2DBZA 4HLNA 5AJYA 4A2CA 4YDQA 4CDRA 1BXZA 2JIZA 3UG6A 5E4JA 3T3HA 3VU8A 3JQGB 4LGMA 3V4ZA 2XJ9A 1E1MA 3GW8A 4K0RA 4BFSA 3MWKA 4CCSA 2FXIA 1YB4A 2ZDHA 2IBSA 1X9IA 3JYPA 2OXTA 2FN8A 1A5BB 3HZOA 4JNKA 3UOAB 4QQRA 5KYXB 3EDQA 4EB6B 4PSDA 1W47A 4KDRA 5DEOA 4ZCQA 5G40A 3SSOA 2ROQA 1M3SA 1YBFA 3TQSA 4R0NA 4KAFA 5T7BA 3T7KA 1AKNA 3OLVA 1VTKA 1OU4A 3MJVA 1XJ0A 4F4FA 3T38A 3ZDYB 4IH1A 3VTAA 1RRFA 4EUFA 1PIWA 4GLLA 4GOKA 1MC4A 4YNBA 3U4DA 1Z35A 5FP0A 1FDOA 2X2OA 4YHHB 4YACA 4D02A 4EGJA 1DC6A 3QBEA 3K16A 1TIKA 3KZMA 3H97A 1BOFA 2VP4A 1AQ6A 2YOFA 4LJ4A 2GOYA 1ZUWA 2Q0HA 1K7CA 2JGDB 2ZLBA 2ZGVA 2IIVA 1A4IA 2Q3LA 3ZE0B 2VUTA 5AW7A 2ANBA 3MMXA 4IXTA 2FSGA 3MLBA 2IK8A 2RGNC 2WHEA 3QM1A 2ZQZA 4NV3A 2R96A 1ND6A 1KQOA 3E8MA 2YY5A 4Z4QA 3T1YB 3OVMA 2BTEA 4ONEA 2O0LA 1TAUA 3MS2A 4OSOA 1JHOA 1YDFA 5FR2A 1LJLA 2QRVB 3SYTA 2G04A 2OO5C 1G5FA 4N8DA 1PBTA 3KLNA 1OH7A 5CCXA 2C9YA 2QAGA 3EXHC 4NPHA 4R9SA 4QUEA 3QE0A 4MV3A 4Y2HA 4DIOA 2G8NA 2WM9B 1N5JA 3OFND 3LXUX 2OV3A 4QULA 2CFIA 4K2HA 4WFQA 3MJRA 2Y1DA 3QKUA 1EXNA 3GA5A 4TLBA 4D98A 3CT4A 5KX5B 3NGXA 2B37A 2CLCX 4QYSA 1X87A 1YC5A 1DAMA 4X6YA 3WISA 1ANKA 3OECA 2NV2B 1OCEA 1YDMA 1L5QA 4FCWA 4EATA 3OJFA 2PO7A 1S8AA 3JYOA 3JQFA 2ZJZA 4OSEA 2NTYC 3V2GA 1KGDA 1EJ2A 2EAUA 3MOIA 3ZXYA 1DBPA 3I12A 2CZQA 4U3JB 2AMVA 5TPWA 4GGOA 4TYMA 2WKRA 4P86A 3LDGA 2VHTA 2WYUA 4TVKA 5HOEA 4JL6A 3WGUA 5DCYA 2AJLI 1JYFA 2ODTX 2NSDA 5HKOA 4P54A 5LP6A 1X74A 2O4UX 1OJ7A 3M70A 2VAPA 2L82A 1E7WA 2OHFA 4IS2A 1EWVA 3NONA 3RODA 2BMWA 5KVVA 3V7YA 3U39A 2QM3A 3JR3A 1P61B 4TROA 2O7RA 1UJMA 2WPNA 1MEJA 5LC1A 4Y2JA 3CINA 2Z6AA 2CC2A 2R1TB 4QE3A 2NZ2A 3SF8A 3ZYCA 3CXUA 3VPFA 2A30A 2HADA 4OY3A 4AYXA 2XLCA 3CVWA 3HFSA 1TFRA 1DVRA 3VPSA 1YOBA 3CUWA 4L9WA 1KDYA 4LTMA 2GESA 3KZCA 1QO9A 1CJMA 4BRZA 4J3JA 4IH4A 1K6EA 4HP8A 4E3ZA 3ZD9A 3RRYA 1URPA 1NHWA 4DMRA 1FZTA 4IV5A 4WESA 4J0FA 5CIWA 1YVPA 1YZTA 2F3PA 4X20A 7AT1A 4JVOA 3I5YA 1BXKA 5IH3A 2VI5A 3D6UA 1G4AE 3WICA 4L22A 3NNDA 3IV9A 4HAYA 4YRTA 2PKRA 3KQUA 5J4KA 5JPCA 3AY7A 4NECA 4FP9A 3B3QA 1T8WA 3G0BA 5C8YB 2WICA 1WSDA 2W4MA 4PN3A 3IHTA 4ZO8A 5AVSA 2O5EA 2ZVDA 1NF9A 4WCFB 4EGAA 5DRYA 1RXIA 3LPNA 1Z82A 3DCYA 3W8RA 3WHIA 3RVQA 1YAHA 4MUHA 4PS1A 4UJ5A 1Z74A 2MIIA 5IM4A 4BXOA 4CEJA 1KMMA 1OT3A 1Q20A 1WB4A 2QW1A 3C6KA 4PQGA 4ROSA 3A1VA 3CNHA 4XR4A 5B58T 3ZV7A 1ZXXA 4IDOA 2G06A 5IANA 4FQ7A 5D3KA 4TS1A 3KS9A 1KAEA 4HEQA 5AH0A 4IGFA 2WT4A 5GM2A 4UTNA 1EWTA 1RHUA 1XMJA 2I1WA 1AQYA 3AQ4A 3LIIA 4MQFB 3IRVA 3D6VA 1R8YA 2P4EA 3ONDA 4AWXA 1CNFA 1EDEA 1HTTA 1GR0A 1RFLA 3DPUA 3FF4A 4J3FA 4S2EA 3SY8A 4JASB 3LOQA 3LQRA 4NMXB 4GLFA 1PR6A 1XOIA 3G2KA 1B00A 3JRXA 1WMFA 4G84A 4Z1MA 3O4RA 4MGZR 3ZK8A 1UH5A 4IQGA 1K5DA 2CNBA 1YQQA 1X15A 2R4QA 1WPXA 5BV1A 1Z8FA 3RFXA 4DIMA 3FCUB 3CLKA 4BECA 4GRIA 5JSYA 1VYVA 3C8UA 1XNJA 1O95C 2RCYA 5JYBA 3O0TA 4HAIA 1G6HA 4CMGA 3RCBA 4YPFA 3ZZNA 1PRYA 5L7TA 2BKLA 2Q8PA 4LBVA 1CP3A 3J81k 2BPOA 2D5LA 2ZRLA 3MN1A 2CLHB 4DA8A 1XD9A 3HE3A 1QNFA 3W2TA 4PCLA 4DCTA 4JFRA 3SXUA 2OPHA 3H5LA 3NANA 1IIRA 1PVOA 4C7VA 2WIKA 4YONB 3NTUA 4GM4A 4MS3B 2IP2A 3MZ0A 4MCIA 5JC1A 3IUQA 1X1QA 5HYVA 1IBCA 2J4FA 2DC1A 2Z8YA 3SSNA 3AF2A 4QIHA 4IRXA 5I47A 4UMVA 1C30A 1CFZA 1EUCA 1QHGA 2COEA 2ZBPA 1J2YA 4X8OA 1O9HA 3M6AA 2BFNA 4EYGA 3OTHA 3R5TA 3THYB 4OOFA 4QYXA 1PR0A 4IJUA 3K94A 1PTJC 5KKCA 1ND5A 1AMUA 3SE7A 3TAXA 2BP7B 3PE6A 1WMEA 4A9AA 3F46A 4WXHA 4DWWA 4GOLD 5TEVA 5KSYA 1Q77A 5LLDA 4BY9E 2Z5LA 3JQCA 4EI9A 2WKQA 3R0IA 1A7JA 2XRYA 2AKEA 2EYQA 3S4YA 4Y98A 3AF4A 1VBKA 1XEXB 4E1BA 3DTYA 1C0EA 6PFKA 4BB5A 4UNQA 1B8PA 1MKYA 1RYNA 4BVAA 1SHLA 1EDOA 2W8ZA 4H7IA 5D3MB 5A2GA 2G1KA 5JEEA 4CL8A 4BE7B 2R87A 4ZKEA 4PRKA 3TCNA 3ZGZA 4I8IA 1WDTA 3B5JA 3B5IA 3CJRA 2JC3A 4D9NA 2BZGA 4DCJA 5BWNA 5C5EA 3AVVA 2X6TA 1SOAA 3FOAA 4Q1AA 1VMEA 1M7BA 2QM0A 2FFBA 2ZIFA 3OCUA 1XI2A 4UTZA 2RDMA 4S1WA 2KW5A 1E4OA 3KVRA 4O1IA 1NXVA 3M1IA 1ZOIA 1HLGA 1D09A 3RT1A 3F49S 3UQYS 4PCUA 3KUXA 2WYOA 4WLOA 2Y27A 3IIKA 2PDAA 5KJ6A 3OQ1A 5BUZA 3JQQA 4JI1B 8LDHA 1P4HA 4DWOA 1BVHA 1J5XA 5H9VA 3U13A 3DL7A 2EGHA 1P6UA 4R2LA 3U7FB 2Z8ZA 3OZDA 1JS1X 3DOOA 5AICA 2ZRAA 1E2EA 1MRZA 2W7TA 5E7IA 4H9GA 1D5WA 1XD8A 5DI3B 3KFLA 4W5RA 1IMJA 1TCAA 1O6FA 3M4JA 3P9ZA 4UVDA 2FW8A 3QX7A 2JGFA 3DE2X 1BGXT 1AXEA 1TEXA 1ZI9A 1XD2B 2KWIA 4BB0A 2OFXA 3OEWA 5DBHX 1ORHA 1CYDA 1UK8A 4KVGA 2IEIA 4OMFG 5EIOA 5I7UA 3NDBB 3WRYA 2EFGA 3PWKA 3ZQ4A 1Q2XA 2LDXA 5KQRA 1PKEA 4UFPA 1F3LA 1U7HA 3M6IA 2YXPX 1ZIOA 3GNQA 3WIDA 1HLPA 2EX0A 2PL9A 2XMZA 3BYZA 2P9CA 2IX9A 5D01A 4JB8A 4ZWNA 4RTNA 3ZE1B 1PJ8A 2VPIA 4PXSA 3K2BA 3F6SA 3TMKA 1J1UA 3KYDA 1E9DA 3NCTA 2Q4RA 3BWXA 1C9EA 4UUMA 1CQXA 1M2GA 1PGOA 3ESZA 3OMLA 5FNZA 4BP3A 2OG2A 2A35A 2BMVA 1BE0A 4P9NA 2X9LA 3RUCA 4BOYA 5CRIA 1W1WA 5ICGA 2WBLC 1F2UA 2NV0A 1ZD8A 2QAGC 3HCWA 2C96A 5L45A 4BYMA 3FI0A 2Z08A 3D7NA 1DRUA 4HGPA 4V0SA 5CG2A 4CKCA 3BF7A 2F9FA 3FNGA 1WOMA 1LVHA 4X63A 2FOLA 2XTNA 4JXJA 1RKXA 1L7AA 1PNVA 2WTUA 1PGJA 4H7EA 3ZQUA 2PLAA 5IUJC 2YBEA 5KHOC 1MB4A 1U3UA 3I9V6 3KU1A 4FGUA 4LAFA 4P4LA 2BFBA 3UAXA 1YWGO 4PSVA 3JQFC 721PA 3ZDQA 3TM5A 3I2JA 2AF3C 4X1OA 5KYUA 3O3NB 1M66A 2XIJA 5ALYA 4IXNA 4LZPA 3PDIB 2R6GA 1A7AA 1QKJA 1P31A 1BKSB 1YS2X 1KR5A 2EFEB 1PJ3A 2GBPA 4J94A 4RLFA 2Y3IA 3ZLTA 1R0WA 3CPSA 2ZYAA 3EB9A 3K8YA 1ZCFA 1E58A 5GGXA 4RF3A 5LP6C 1XTUA 2ZIXA 3FNEA 4G0QA 3PZBA 5B1DA 5KTKA 1F60A 4FWIB 3L2OB 5B12A 3T7RA 4WKBA 5HZKA 2JB9A 3V1UA 2OORA 5EERA 4MKRA 2QBYB 1M0SA 1GPUA 1HFJA 1IWPB 2IITA 4Z0TA 3UN1A 3WK7A 3EPLA 3ND7A 3NM6B 3MFQA 4B3HA 1PJ2A 1T2CA 1S01A 3E1SA 4R4JA 5JMTA 1WW3A 3LP8A 3R8XA 4JGGA 1DG9A 4RGBA 2WZCA 4OQEA 2XGJA 3IAS6 2W6QA 5DP2A 4PBTA 1W96A 3FPLA 2P1ZA 2IUEA 4E6PA 2ZREA 1NRJB 4Y6GB 3BAZA 5F1KA 1YKSA 3KQKA 4WW0A 1SHKA 3TOSA 5BSEA 1KAGA 2R8XA 4Y6PA 3WGLA 1IM2A 4FWBA 3QWIA 5TSDA 3R76A 1Q50A 3N3AC 1XTKA 3PTZA 3RADC 4Y6QA 5TNXA 1OILA 1PQWA 3QXGA 3DOIA 1V8PA 5C51B 1L9XA 4DPKA 1W5TA 2TYSB 3EDYA 2NUAB 3N76A 1R8QA 1YR2A 2CNWD 2V0CA 4G8JA 5HJ5A 1T3SA 1W5EA 5U4XA 3WSTA 4CMKA 4MINA 1EX6A 4TV8F 4D8TA 3QPWA 5EFZA 3HC7A 3FDIA 1R6VA 2XVYA 1Z5NA 2V0NA 1UBRS 4YJHB 2C7QA 3TLCA 3B1JA 3RC9A 3K3PA 4AN4A 3DCJA 2I3DA 4XB1A 3BZUA 3QNWA 1VBNA 4YT5A 4C3OB 4KPUA 1AH2A 4UUQA 2V9ZA 2QRNA 1KWGA 3VYRB 2OXRA 1Y7IA 4J43A 2BSAA 5FEUA 1NI4B 1XCBA 2GARA 2P0AA 1L4EA 3ED5A 1KE1A 2BSXA 2CHEA 4NF2A 4PNHA 4AZ0B 3PQ7A 2BHLA 2BGUA 4IMJB 5HCIA 4YCDA 2V74B 1WMDA 1OWMA 2C4WA 2ZPUA 1E2KA 1Y0BA 3KB8A 1XRQA 3M6VA 5CT5A 2O7SA 4ZEWA 3WDSA 1EQUA 2P2LA 2B4QA 4IGIA 5CK5A 1HT3A 1A1VA 4D43A 3H5VA 5CNKA 2CLOB 5JYDA 1JDVA 1OB5A 4BVHA 4P4GA 3ONEA 4XOUA 1M1UA 1XYVA 2F67A 5IAJA 1ZD3A 4LYGA 3IP8A 1R9JA 1LWNA 2CB0A 5DWQA 2RC6A 1Y98A 1VI2A 2IHJA 3TOZA 1EHCA 2BEUA 4CF6A 1CX9B 2L19A 3GZ4A 1SEPA 3GCGA 1IXYA 4GX1A 1HE4A 3LL7A 4WOJA 3I0ZA 2LCQA 2F48A 3DOEA 1KZ6A 1Z56C 1SUWA 5G1OA 4IHAA 4C3ZA 2QSUA 3A4LA 3EA4A 1UC8A 3B3AA 3JQGA 4L5BA 4QXAA 1O95D 1AG9A 5CFNA 5B7PA 4FEGA 3H6KA 3UAGA 3QXCA 3UJ6A 3WP0A 3TTXA 4BFWA 4XUGB 5I7FA 3S8EA 3CVUA 3A1EA 4EB6A 4I3HA 1O6BA 1WOYA 3PFWO 1NZFA 1X14A 2VCHA 5BMVB 4X65B 3MUOA 2Q3JA 2XCOA 4NC9A 3WIVA 4AQ7A 1B74A 3O8DA 2RAVA 4HFMA 5J1TB 1QZTA 3IH5A 1KEUA 2DBYA 3M34A 2JFXA 4IV8A 3KG2A 3JQAD 2CW5A 1Q1AA 2QN2A 4IEFB 5EXDA 1DTWB 5ULLA 4BQOA 4P34A 3M1YA 4YDSA 4Z5XA 1N6NA 2MTBA 2DFDA 3ZWAA 3S3TA 4DR5B 2JZNA 4AQYB 1FW8A 4L9SA 4KQ6A 2EF0A 3Q72A 2BFWA 4CCAA 3MRTA 1NJ2A 1XTIA 2BSQA 3VI3B 4DA7A 4RACA 4PFKA 1NZDA 1B2LA 3BGVA 4H77A 5H0IA 4UVIA 2AR7A 4MRNA 3DFIA 5B1SA 3RTDA 5A7HA 2C7RA 3A3NA 4IIXA 4OGWA 3A1SA 3GFOA 2W93A 4U8GA 3J80A 3TRIA 3BL6A 2YINC 4G5HA 1QXSA 2G4VA 1II0A 3MWJA 2WHPA 3AU8A 4XLLA 4CTMA 3NHZA 2I66A 1XDUA 5SICE 2IOFA 2XVMA 3QVVA 3OJ0A 2IEBA 4GQIA 2ICAA 1BU8A 2O2EA 4NL4H 5CLLA 1IY0A 2DT8A 4WNYA 1Y3DE 2FE4A 3DDNA 3MJ4A 4GC5A 4TV8A 2ZB2A 3DJFA 3GELA 1I24A 3I2HA 1UBEA 3K72B 4D5EA 4EPVA 1LLDA 1QLJA 4L72A 3JD1A 1SUDA 2YV2A 5AVOA 3HN7A 5CYOA 3QVTA 3KR1A 1E2FA 4TT3A 2OZPA 2J3JA 3PEEA 4B3CA 1Y6QA 3JXEA 4H0CA 2JIZD 4YASA 5EI5A 3P0FA 2GYVA 1SOWA 5KX5A 2CE7A 1BX1A 2E4WA 1O9BA 2I4NA 2XZPA 1CUUA 2G1JA 2XODA 1YB1A 2O8VA 5KDLA 1KWKA 2PUGA 3TQHA 2X5NA 1E2JA 3VJMA 3RVLA 4NU0A 1VJ5A 3L0ZA 3EBOA 3OQJA 2IPLA 4BV3A 5T4EA 3LYHA 3OZUA 1NW7A 4EKNB 4U3JA 2XGSA 4B6GA 2ID8A 2GD1O 4MHSA 5CBKA 2Q1XA 1DRVA 2VSFA 4WKCA 5A5VA 1YFJA 2FDXA 5A5EA 4Z8YA 2GCOB 1HEUA 4MHOA 3BQMB 4KI7A 2ZI5A 3D2CA 1D6SA 3PJEA 5G4KA 3TW4A 1H93A 3L79A 3IUJA 3L07A 1Y5MA 4CQJA 5LZ9A 5FHQA 2G71A 1XZIA 4LVUA 1APBA 5ERXA 1SQ6A 4B5KA 1DKOA 4AY3A 1VC2A 3RG8A 4MWSA 5AUQA 3ULKA 1TAHA 3P9YA 4RVHA 3DEIA 4D4KA 1AHHA 4EA8A 2R1TA 2QRLA 5T67A 3F3SA 1TYZA 3HXOA 3KQYA 4L07A 4KE9A 2R7LA 4UHJA 5EXPA 3UKOA 4AECA 4PZPA 1CRPA 4BVJA 1JXOA 1NKTA 3JS5A 3KQTA 4ZOAA 5IJZA 4LVNA 2ZYVX 2CL0X 5CH5A 4HVCA 5K01A 1U3DA 4KQ9A 4TYQA 2WWRA 4GE0A 4B3DA 1CEEA 3UJHA 3AR2A 1CLUA 4J16A 4PX2A 3VYWA 4EYKA 5CVJA 4XM0A 2VPWA 3DLCA 1CNMA 4FFNA 1FIUA 4DV2B 1HKHA 5U9CA 1NSTA 1E3QA 3Q7SA 4UREA 3QY0A 3BRQA 5I3ZA 3AEQA 4OQZA 4PYIA 1KJZA 2ETXA 3O8QB 4EYSA 4Z9FA 4PYQA 5ILOA 1IUPA 3EGCA 3KSUA 1KO4A 4ZQBA 2V3CC 2FK8A 3EVBA 5I4IA 5F12A 5L3VA 2IYZA 4YFVA 4MDFA 3CZMA 1UKCA 4TKVB 4W1RA 4AULA 5AVYA 1OXBB 4C43A 3I62A 2QJRA 2MOKA 2GKSA 1PV4A 2OOKA 2J6BA 4I8DA 3Q15C 1MAHA 2QPTA 4OGKA 4P92A 4KQJA 5DHTA 5TEWA 1FJXA 2REXB 4PEVA 3G5TA 5A3JA 2QX6A 4OAQA 2AG0A 1TLLA 2B7LA 2NQTA 4Y6SA 3TW0A 2GTHA 1XTBA 2H0AA 3OX2A 1M2FA 3DUWA 3KLOA 5FWYB 3HB4X 1GUYA 4H18A 4INOA 5JXIA 2ZUSA 2C4KA 3Q9UA 1S3GA 3QIAA 4V3CA 4JLVA 3PRHA 1T36A 3HKBA 2R6AA 3HO8A 1JLLB 3LKVA 3M5WA 4EEXA 1ZR4A 4MQFA 4JB3A 2OORC 1WXDA 3IPXA 3VC3A 2BFPA 4XVQA 4GPBA 4PYRA 2C0PA 1A77A 2GWRA 2IOFK 1KMNA 3AUSA 4FFVA 5HF6A 1JEYA 1GSIA 3QKSB 4L0QA 1I14A 1UFRA 1CYEA 1YNSA 1EX9A 2G09A 2GYUA 3SNKA 3URKA 3V55A 4EQ6B 2WWHA 3BK1A 2P6PA 1NGSA 3V34A 2OFPA 2BJVA 3BXOA 3MAAC 3T5GA 3U5ZB 2LXNA 1V25A 3EVTA 2WQZA 4HVAA 3VISA 1K97A 3W5DA 1V5FA 1YB5A 2AXEA 1R1DA 1FS5A 1DHRA 2K6GA 4EY7A 3OI7A 3U3OA 1YS7A 1HT0A 2EFDB 3H0CA 4U1RA 1K7YA 3G5MA 3H9BA 3N6VA 4L75A 3FGZA 2UZ1B 5JZBA 1M5RA 5FTNA 9ATCA 3EDMA 2HK7A 4W6QA 4L8WB 1TVKB 2QUHA 3RTCA 3ZUPA 4MS3A 3ROZA 3EOZA 5SYNA 2SICE 4JU9A 2QD1A 4EG1A 3TEJA 3I6YA 1GGNA 3IMEA 3KHUA 5LDHA 4AY6A 3OQBA 3TH5A 1KJWA 1W48A 3ZPXA 2NSJA 5BN4B 1TZCA 3O9ZA 4WKNA 2BP7A 1V48A 1U0RA 4JSYA 3LY9A 4TQ9A 5K5EA 1UPAA 5L4NA 3IFSA 4Y6LA 5JHGB 3B1XA 1L7QA 1YZYA 3NMUF 3HJUA 3HYNA 4LJKA 2ZI3A 1E6MA 4JVNA 4YV2A 1TT5B 1F5SA 2DHQA 3A6ZA 4F4IA 3SJBA 3ZLJA 2ZB7A 1A4UA 1D8AA 1NBAA 3GBSA 3O1HB 1LRLA 2J08A 2LCIA 1PFGA 2XCQA 2UAGA 3MC1A 2ZIWB 3HZRA 4JBYA 1XNQB 4KG7A 3EIXA 3LVRE 1S0UA 4Z1MD 4MITA 2VJPA 2F1JA 4D25A 2GAJA 4FDVA 4OJTA 3GROA 1QZZA 2GZHA 5MN6A 1K8ZB 4BLOA 2AEJA 3IEKA 4PCVA 3S1AB 3N58A 2C83A 4HO1X 4K6MA 4DLVA 4GZ3A 4LMRA 2PSFA 3U0VA 1TUEA 1UBFA 3DR5A 4H16A 2R8BA 3C14C 2A1UB 4RZSA 1EXWA 4IUCS 3GUCA 1QB7A 4KGDA 2BISA 2JBHA 3CZ4A 3R24A 5B53A 1T4CB 3VI4B 2OBLA 4YP7A 3JYHA 2I34A 3PHBE 4FOSA 3RVSA 4M6WB 1A72A 4PHCA 3TQRA 5KVCA 2O59A 3OE4A 1U7ZA 4NG4A 4ENPA 4TL8A 3FY4A 3F2VA 2WJHA 1UODA 3UHOA 4ZYYA 4I55F 3V7WA 5ALDA 1T1RA 5DI3A 2FFHA 4FHEA 3P8ZA 4LK2A 2O2IA 5JNSA 1HDCA 2NU8A 4QRHA 2P2CA 1P77A 1XD2A 2FTKE 1JIIA 3C8HA 3PRYA 5K03A 1QNLA 5MN4A 2OKCA 1IK4A 2OGTA 5REQA 4B9EA 4D9GA 1YQ9A 4LFCB 3ANXA 2VDQB 5DK6A 1HE1C 1OXVA 4PU0A 3ZLVA 3E7FA 1Y1TA 4J7UA 2HM7A 4YRDA 4KPYA 4PANA 3W2GA 1BCRA 2WT9A 5KSPA 1RCUA 1ZQ1A 1YBAA 4Z7JA 2PV0A 2H4WA 1EJ0A 1W2GA 2PPLA 4YRZA 2AFHB 1DO2A 1IULA 2WWTA 1NVVR 4IQFA 3H9JA 4ZYTA 4K86A 1IXKA 5B4TA 1MZPA 3ZX5A 3BKWA 1GUFA 3QW2A 3JQRA 3RC1A 2F90A 2A5GA 1OPXA 1O96B 1YCHA 4JJ4A 4K28A 2Q4DA 2BW0A 4O4IB 4MJLA 5C1IA 5KDDA 1KKLA 4QGFA 4F5ZA 4DV4B 5D5HA 4DR1B 1G20B 5EZYF 3NTXA 3B85A 2JH8A 5IASA 4MYDA 1STOA 4EKYA 1W88A 3NXSA 3HU2A 821PA 3KETA 2XVXA 2R47A 2YJZA 4KFRA 1YF3A 3I6BA 1SC3A 1Q84A 1F9EA 3L04A 1E7SA 4OIMA 1XZMA 2D2FA 4O4LF 4QPZA 4BFVA 4QPNA 1HSOA 4R1OA 3RSFA 2RGDA 2DSNA 5KYTA 2RAUA 2QNBA 1Y82A 1EVLA 4NS1A 3UT6A 4FFRA 4JUCA 4TTTS 1EESA 1O94A 3HKDA 2B4YA 2H54A 3IT2A 5TJ9A 2WKSA 3PDIA 1BX0A 1I5EA 1ULAA 5DBEX 4DLSA 2B5VA 4Y18A 3E4DA 4D4GA 1TMYA 1N6PA 3RK0A 3ZX4A 1AHIA 1II8B 1R10A 1WKVA 2V7PA 4TMZA 1K9VF 4IDQA 5EIFA 3TR6A 1EB8A 3WRXC 4QXOA 1D7OA 3EVGA 4LRXA 4DLNA 4PW0A 1U8CB 1XDDA 1HQYE 1ORWA 2QBYA 1XVLA 4NQZA 1DO8A 1D1TA 1SK9A 4BJ5A 1RCFA 2IYFA 2XGGA 4HWOA 4J9VA 5C53B 1GPBA 4LISA 1G8PA 5BWBA 2RJOA 2QEQA 5GAJA 1JZQA 5ALMA 2CJWA 4K81B 5C5DA 1Z83A 3VH4A 2WKWA 2WU3A 3WI7A 4P3OA 1TGYA 4B3JA 4JCOA 2VK2A 2HA2A 5IG2A 1WKBA 4TQGA 4WK4B 1IJEA 2NTJA 2P30A 3TQFA 2QJFA 3E7PA 3GVIA 1J7KA 1PLLA 1Z22A 3FWNA 3OCWA 3R8CA 1KZ4A 5GONF 2FPOA 4RMHA 4MUGA 1PEAA 3FOBA 5AJWA 3ET4A 4AG6A 1YRHA 2I87A 3H5RA 2YWRA 1AK9A 1NNLA 2PVPA 4LXYA 4M7RA 1FX0B 4TQAA 5B3JC 1T8PA 1A82A 1NVXQ 2AFVA 2XYGA 3ITNA 3M3DA 2II6A 2KMLA 3Q40A 2GD6A 1ZG3A 4HRAA 1Z6ZA 2NUAA 1W4CA 3FKJA 1E5QA 3MWEA 3IT1A 3Q1LA 1QQ7A 4QHYA 1NMXA 3PWTA 3GLGB 4M1MA 3LF1A 1LFDB 1NT2A 1TK9A 2AG5A 1UJ4A 2VBGA 4YT8A 3P96A 2O1SA 3A9CA 2R65A 3QVGB 5EWJB 2YMPA 2GFQA 4WCFC 3FBGA 4FTWA 1WZNA 4M4SA 1YBVA 4OHUA 5AJXA 3MAGA 3WBKA 3QV2A 4ZFNA 3LK6A 4G0NA 3N6RA 3FWPA 4S35A 2JJQA 2IDZA 3CNNA 4TTRA 3ANSA 4LKRA 1LTQA 1T5DX 4F93B 5BN5A 3DMFA 2VBCA 3PX2A 2CXSA 5JAUA 3ZWXA 2BL4A 2H4JA 3GXBA 5B30A 1KVTA 1XZAA 5JBNA 2IPOA 3MCVA 3LAWA 4ZO9A 1CFJA 5D86A 5TQJA 3KDPA 5F33A 4CV0A 1GTVA 1OGIA 1ULZA 4A6PA 4TN5A 2G83A 3HTXA 2XBLA 4YJ2F 2HU5A 3MK31 4ND7A 4EHBA 3PHCA 5EZYA 1K4MA 3AY6A 2HLPA 3MTBA 1L6RA 5CNMA 3HVRA 1NY6A 2V3WA 3RJMA 2JLZA 4WX2B 3VDXA 4I4TF 1N2CB 1VPTA 2F59A 1Z6TA 2ET6A 5A3RA 3PQ2A 3OOHA 1ZOSA 3NHRA 1JEAA 2Z5FA 4HYTA 5A0TA 5JS1A 1VLZA 4FW8A 3AVOA 3WYAA 3U3MA 1ZI8A 1BJRE 3AB7A 2FDRA 3HCFA 4YMVA 5BNWA 1YS4A 2C98A 2PS0A 4GXTA 3Q5EA 2QN6A 1FUKA 2GPJA 4EF4A 4DB4A 2I1QA 3IAHA 4ALKA 3ABOB 3HY6A 4DOMA 5L9AA 1L6IA 1H1DA 1PDVA 2G0NA 2O23A 3FIJA 4GSLA 4QUJA 4Z0NA 4G5FA 5C31A 1KFJB 1OC2A 2QSJA 1JJAA 5E6RA 3E7XA 2OXEA 2A59A 2YCBA 4KXLA 1KDRA 1EFPA 2IW1A 3BD7A 2JGJA 2NVUB 3HXLA 2J9YB 5T6BA 3RC2A 2H85A 1QWSA 3ESCA 1AMNA 3T9AA 1JQAA 1UXHA 1GZ6A 1SUAA 5JADA 4PC2A 1W73A 4MO2A 1JH9A 1EEXB 1L5YA 1QP7A 4Z9YA 4R9VA 4IHJB 4EZIA 4IDDA 4I4CA 4FN4A 1L5SA 3ZCUA 4JLOA 2WRZA 4LJ5A 3RUPA 2ZQ5A 4PZZA 2W2NA 3CZPA 3M1LA 1YS1X 4HPJB 5TDHA 1B8UA 4RVFA 4JNCA 3COWA 3B6EA 1IC6A 3JV7A 3EODA 3PQ8A 2F1HA 2XTZA 4EUNA 2O54A 1I80A 1DJMA 1O03A 1GILA 3GCZA 1FJ2A 4YJFB 3VH1A 1XZFA 1JSCA 4ZAWA 1FMFA 4CMHA 3D6NB 2V55B 2X6RA 4L9RA 2YYYA 4FYKA 4JI2B 3GDGA 1KEVA 4QVIA 4KFUA 4LJLA 4KR2A 5C37A 2CN1A 5EHIA 2WJYA 3R9KA 1YR6A 2JHPA 3V7UA 3WWCA 3FDZA 2VP3A 5BVHA 3O7WA 1F6WA 2FETA 2BMAA 1JAHA 4PLHA 1RQ7A 1TKCA 3H7AA 3AHCA 1CDDA 1NQXA 2ZSAA 4FFSA 4M83A 4QA9A 1I6KA 2EKQA 2H8KA 3KUDA 3MHPA 5C9ZA 2P67A 4W5HA 2ZUEA 4LJSA 3DHYA 3V8RA 2PUVA 3T52A 3GC6A 3NT5A 4IINA 4BO2A 2AMYA 4J8PA 1ZSVA 4PC1A 1UEJA 1M33A 1V16B 4IIVA 2ZUFA 1E9RA 5K8LA 3EZXA 2ZT8A 4PAWA 1WR8A 3UCXA 4V0ME 5BMOA 2CCKA 2AR9A 3VFDA 5F9MA 4A0FA 1N5KA 1H3NA 2CCGA 4JP8A 5CVVA 3SHTA 4DQ0A 3PQCA 4EG3A 3QVKA 5BR4A 5CFLA 1WF6A 2NPOA 2P2GA 4BCBA 2FVYA 4R9RA 4ZTZB 4MRSA 1T5LA 2IRWA 2HO4A 2ZU0C 4I4TA 2HSGA 5EUCA 1Z4IA 2ARKA 4NZNA 3CRW1 2Q0SA 1N9ZA 2R84A 3MMPA 3IOYA 3UOGA 4ZZ2A 3ETNA 4F4CA 3AR3A 1HE3A 3E61A 2DWQA 2QTZA 1IBKB 4QOJA 2J7PA 1SO8A 4RQBA 4N0PA 1Z0KA 3EAFA 5E9AA 5FPPA 1JHRA 2WT8A 3TL6A 1M2HA 1N75A 1YL5A 1A5ZA 1TD1A 3BCHA 5A4FS 1QZ3A 5BQXA 1MW8X 3ZHTA 5L4LA 1V2GA 1FFXB 4KWEA 2NQ2C 2HWXA 5KTTA 4WGFA 1KKUA 1SPBS 2D1YA 1NMQA 2REQA 4AZ3A 4QUAA 3OPVA 1Z8HA 1HYEA 3F9IA 1XJQA 2F43B 4RFSB 5TX7A 2LVBA 2ZBRA 3PWSA 1EFTA 3B1YA 2A5LA 1GL3A 2XKJE 3KLMX 5I9TA 4XQGA 3CLSC 3O8QA 3IPLA 3KUCA 2OGUA 3DLIA 3JU3A 3ZDCA 1ADYA 2NT3A 3UGKA 1D6NA 2IKQA 3E9QA 1JDJA 1G3UA 2X6QA 1U7UA 2RMKA 4KRYA 4LK3A 4C7MA 1QPGA 1VE9A 4PIPA 5D7BA 1QYRA 5DBOA 2UZ4A 1O94C 1SCBA 1MAWA 3UUGA 4HLCA 3NPAA 4HJRA 1M1YB 3GP5A 5CXSA 4C2AA 1NKVA 2ENWA 3IELA 1NUPA 4NOJA 3KHTA 4UXJA 2V59A 1G1MA 1F7UA 4QM6A 1AE1A 2QTMA 4WV3A 3M33A 4ZREA 5E38A 5DWDA 3V4OA 4AAYA 3IKLA 5FWYA 1XEAA 1K06A 1VYUA 2QTWB 3BE8A 3VSCA 3FYCA 3HACA 1BXRB 4K40A 4B47A 2B4AA 1BWPA 1IJFA 5K3FB 2AX3A 2Y6UA 4JLJA 5A4AA 3RSSA 4DLZA 5LD2B 2GX6A 2H1VA 1Z13A 3I09A 1ZN8A 2AXPA 3E35A 1FFCA 3DZKA 3O4IA 4DLBA 1QWOA 3BIWA 4WXPA 1LS6A 3TCXB 4B75A 4C20A 4EKGA 3CONA 1ZA2A 3VR5A 5FFFA 4XSGA 4GP6A 4NIMA 5FKJA 3WGIA 3K0HA 1DAIA 1IXRC 3CUYA 1AKRA 1QCZA 3I05A 3K09A 2BBOA 2PUTA 1N2ZA 4EQ6A 4RZHA 2XWSA 1SVMA 4KQKA 2GHIA 2VTBA 2LBPA 1OFIA 3WK8A 3KEMA 2PZLA 3GVPA 4MP3A 3CVXA 4KITB 2HV9A 4IZ6A 3T3EA 4ZZ0A 1GT91 1E1LA 1V7ZA 3PPWA 4PN7A 1U7OA 4KGVA 4WLNA 1PKXA 3D4LA 3E84A 5DSTA 3GGPA 4BNGA 2G7ZA 4H27A 4HXFB 3REOA 4D0LB 2GEFA 4JP2A 9GPBA 4ZANA 3E9RA 2FZLA 2W6MA 3Q10A 4KC0A 3GEEA 4C6RA 3AESA 4GUDA 4GQBA 1EUDB 4LOAA 3BJMA 2OHHA 3WGOA 5GIPE 1E1KA 3L4JA 2XCRB 1OI4A 1Y6RA 5K8JB 2Z3VA 4H3KB 4WOPA 5IC6A 2I6FA 2VK4A 2JGNA 2GF0A 2Q5FA 2PXHA 4KN5A 4K9KA 1XZKA 4RVDA 1FRNA 3TRFA 3W2EA 4C04A 3SEZA 1BXGB 2PSHA 3LS2A 5JC8A 3ISJA 1T4GA 4AS2A 4FXOA 5JE8A 1JQ3A 2CHVA 2UYHA 8ABPA 2JL1A 1XLTC 3R0QA 1P7VA 5ALEA 4N5HX 2C31A 3DKRA 1J2EA 2GCGA 1YRLA 2R8RA 4FCTA 4DIEA 3EIOA 4MW5A 4BFTA 3X0DA 1N5MA 3NT4A 2G72A 1Z36A 2WC1A 1XWWA 3W8NA 3ZU2A 1JT2A 1VBFA 5HKKA 4EHIA 4N39A 1KDZA 5E6UA 2EDAA 1G5HA 3O4GA 1OI3A 5AJVB 4ALIA 2PHZA 4ZD6A 5K8UA 3H16A 3N8DA 4B84A 3VPDA 3P45A 2VHJA 3ONNA 3QV1A 1REQB 2OAQ1 4EO9A 4MUJA 4RV5A 3S1AA 1AK1A 4YH1A 1Q7BA 3KU4A 2BDTA 5KEIA 1MCZA 3GJYA 5UKDA 2C2BA 5BR7A 2BGGA 1JW9B 3OZTA 3K20A 4MW6A 2YMMA 2WR8A 4R1PA 3OD1A 1FDSA 1CE8B 1Y7PA 4FZRA 1CZHA 1G3RA 2NXEA 1K86A 4EX7A 4M6WA 4G67A 4G8DA 2BY4A 2ZWPA 1B42A 2QE7D 3OJWA 1MA0A 1PT6A 2YVQA 3KXLA 1EQAA 2D0OB 1AURA 5EHGA 5CG1A 2J0VA 2H2DA 1T4BA 2RG1A 4A82A 1IZ0A 4OKIA 1XKLA 3FOZA 2PCJA 1W75A 1E9BA 2NO6A 3JSXA 4K2AA 1Q0QA 5FWXA 3D3KA 2E21A 5K0LA 1FMTA 2VTKA 2X4GA 3AI7A 2JA1A 3ETDA 3Q2IA 5BSMA 2FW6A 4DV0B 3OU7A 4JJAA 3R5XA 1IM5A 5E8JA 3FPBA 5BW5A 3OZIA 1KYYA 3AKEA 1FVOA 5IJWA 3E6AA 2BJWA 2V03A 3KQWA 1V47A 5KSOA 3OQVA 1A9XB 3ZD7A 2J3IA 4LQ4A 4IDFA 4OB7A 2XXAA 3RSGA 1GHTA 3KVVA 1W0KA 2JCSA 4LRWA 4NARA 1OW3B 4TV9B 2FWRA 2HCBA 3W1EA 4CM3A 2FH5B 3JYQA 3ZVNA 2AFHA 4GBMA 4L50A 4BZPA 1E3JA 1ENOA 2OMEA 4Q1CA 2A1IA 2G25A 4ITVA 3NBMA 4W9RA 5E2BA 4F4DA 4N3CA 3QU9A 1JU9A 2MJLA 5LP6F 3HDVA 4JT2A 2TMKA 1O96A 4M1SA 1UJBA 1THZA 2YJ4A 5CT4A 4OG2A 1ABEA 2QRQA 1R0YA 1GYRA 4WJZA 1SIWA 3B2NA 2C5HA 5ILGA 3U49A 2H2FA 3G02A 2P5TB 3OIVA 1GGEA 1M6WA 2ACKA 1W49A 4XQCA 3BB3A 5G3ZA 4CL0A 4XE5A 1X1AA 3QU4A 4GOJA 1KSGA 4B76A 1TCBA 1OIWA 4IXWA 2HF9A 5ER6A 1E1YA 2PRJA 1NR5A 2PFKA 2WD8A 3ZTYA 3P9KA 4GVLA 5JCZA 5JAQA 1N2XA 3OCXA 1K68A 3RYHA 4B7AA 1E2UA 4OAPA 4JUDX 1XL1A 4RY9A 3GXOA 4PPQA 2YIJA 4KTTE 4JLKA 1I1NA 2PUAA 1DAGA 1KAOA 1SR8A 5L7YA 3I37X 1B4DA 3EE6A 3NASA 4YRQA 1OROA 1R7RA 1OH5A 1UAYA 4CQLA 4H6PA 4FSHA 4R3NA 1ZK1A 5IVDA 4DABA 1ZITA 2H1CA 1NNUA 1LUAA 3I42A 4FFOA 4JYPA 3WLEA 4DILA 1U1GA 1KE2A 4TYNA 2P3QA 2RHOA 5ECDA 3O1JC 4KJZA 4WY5A 2WMOB 1KYXA 1E63A 5JIBA 2X23A 3KE9A 3OLWA 2EU8A 5BSRA 1VLLA 2VWHA 1P7WA 3MM4A 4J03A 3ZHVA 1NUSA 3JAKB 1D2MA 5HCUA 1SN7A 1ZGGA 2M32A 3CH5A 1KZ7B 1UOPA 1NNI1 1ZBDA 3PUKA 4B8WA 2LIPA 2YN0A 2W4QA 1JR3E 1ODLA 2XMBA 4KPEC 1H5NA 3S44A 4A10A 4ZN6A 4XGKA 4QUHA 3T3OA 2RAFA 2JAHA 5IKOA 1EVEA 1CUFA 3AR6A 2Q0QA 3CLUC 4ND3A 2HMUA 4H4EA 4OHMA 1NDHA 1PJBA 1AKUA 1AGXA 1JMKC 3FDJA 3FYUA 4NHEA 2VAVA 4NMHA 1HT2E 3B2EA 3GJTA 4L8GA 1B41A 2Z9BA 5AM1A 1O8BA 3OQNA 4YRBA 3CNBA 3G0IA 1FX0A 4PSCA 2C3OA 4NG5A 1X0XA 4V03A 2DHRA 1HPLA 2WF7A 4JYAB 1XHLA 4MLDA 1PEDA 3O1LA 4IOLA 3FJ1A 4FB4A 3RSQA 3EXFB 1L8XA 5K0NA 5KTOA 1MDBA 3ESBA 3PR3A 3REQA 1RE1A 3U48A 1VL2A 3CLSD 4PIMA 4BWFB 2J9XB 1O58A 1RWOA 2Y92A 3C6XA 3NKFA 2BZSA 2PIDA 3QU7A 3QVGA 4UUOA 3OLZA 4CIAA 3BGSA 2CKDA 3KQOA 1PWHA 1V35A 4XIIA 1ECJA 3OX4A 3EQ9A 4RY2A 3V8BA 4B87A 1TVCA 1QRTA 4H15A 3RV3A 3QEAZ 5J4YA 1ACMA 1J8YF 1T91A 1O94D 3KC2A 2VNJA 1EX1A 5F64A 3CPHA 4UD6A 1RJ9B 2C94A 4UBMA 4X6UA 1YQTA 3BORA 3IAUA 3VVMA 2HA5A 4C29A 1L5OA 4URYR 1BAPA 2CL7X 4M98A 5F5XA 3RIGA 4MV4A 1AUPA 4RF2A 4ID3A 4I4LA 1R0BA 2COUA 1P1KA 4DA0A 3B20A 2C29D 1I7SB 2GZ2A 1NVAA 1N8NA 3R6DA 3GJ8A 1L4LA 5INTA 1L8QA 1MNQA 2B9EA 3ILYA 3CH7A 3K09C 4N54A 5DT2A 4ZT3A 3U9TA 3LPAA 4DUPA 4EPRA 5KMGB 1NL3A 4K03A 4CT4B 4DF3A 1RZRA 3TO5A 4YVFA 3AGQA 1A9TA 2J7KA 1K92A 2JFPA 2V6MA 4G5OA 1TUIA 1NLMA 4GPAA 5DM0A 4ZAYA 4YCBA 3V8EA 4AROA 4K0KB 2UYYA 3V1MA 1NQ5A 2H48A 5LDGA 3TKAA 1OR8A 4XPIA 2ZBEA 1Z2OX 4BJ3A 3IO3A 2YN4A 4NFYA 4NZPA 1RJDA 2I1LA 4OYYA 3SQNA 2QUBA 3E48A 1WP9A 4ZOEA 1R37A 1FQJA 1K8YB 1KQGA 5HF8A 4ZTUB 1PL7A 3DFKA 4I1IA 3ZHCA 3IOEA 2DFLA 4CMJA 1YZNA 2YDXA 1NV8A 3L6CA 3QLVA 3UMMA 4CBVA 1RQRA 1Z2EA 1X9HA 1YUBA 3NKVA 1CJKC 5IZ4A 1C4KA 1IDOA 1NOKA 2JAPA 4HR7A 1FDIA 1PDOA 3RUEA 4EHDA 4F04A 4ZGGA 2NSLA 5K8VA 1FU7A 4FINA 2VOEA 4B4DA 3UJCA 3HCRA 5IJ0B 2XE8A 3PDUA 3G23A 1VKNA 2QYSA 3L77A 2FPKA 2IYYA 2BONA 3R4CA 3W5UA 3WV5A 2NP6A 4PYNA 1EVZA 4ENTA 4IHJA 5TT1A 5JVDB 2XHZA 1DQRA 1CQIB 2C3UA 1NXWA 4NCNA 1JBEA 3HPQA 3U4AA 1V3VA 4XGIA 1Y3AA 1NBWB 2TMGA 5CDFE 1ZAKA 5IBCA 2KPOA 4E7OA 1GRRA 1NI3A 2OQIA 4L9AA 4ZRDA 3SJZA 1LD3A 2JHAA 3D7LA 1JEEA 1J06A 3DHEA 4AMZA 1B76A 3OFJA 2JBAB 1TA0A 2CNNA 2HXYA 3MW8A 2XVZA 3P9NA 5CDGA 2R8EA 3OLCX 1L5HB 3DEAA 3EMDA 1CUVA 3RKSA 2CSXA 2VA9A 1FK8A 3WYBA 1T25A 4R9NA 1P0PA 3G89A 4W5TA 1VKHA 4TWAA 2HR1A 1WW8A 2BEVA 2X8BA 4J0GA 1AZSC 1OTHA 4WBXC 1OI7A 1X6VA 2QQGA 1YZVA 1PZHA 2TRSB 2A0YA 4XDYA 5IULC 2OFWA 1MXHA 4WOCA 3TUJC 5G0SA 4IIFA 4PXAA 4EKEA 1J9GA 1JSZA 2I6SA 2PLNA 3EH1A 4O2AF 1N6OA 4J90A 2H2AA 5EE0A 2CT8A 3EYAA 5ALHA 4G0UA 3GFRA 4PR3A 1KGSA 4ICIA 2HJHA 4YHBA 3O4HA 2P2SA 5LMCA 1V16A 5DSZA 2HJWA 1ZONA 2ZUCA 3MQ4A 4HS9A 7ABPA 3CURA 2XDAA 1WDLA 2GASA 4MJ7A 4NWIA 4F4JA 3HMQA 1EU1A 4B0PA 5IAEA 2R2GA 3S28A 2Y4NA 3FUXA 3LXRA 1RQPA 5T41A 1L4GA 1Y3FE 5IVHA 1OBOA 4NAUA 4JJIA 6GPBA 3KO8A 3U7GA 2X0FA 4XDGA 1BA3A 1HFWA 1TM5E 3GJ0A 2P6NA 3L43A 2WYHA 3AJDA 1KBZA 4O2BF 2NVBA 4H6XA 3HWSA 1IOWA 5B6JA 5FBKA 2ZB3A 5T4BA 1G6KA 3CEAA 4OHKA 5IVKA 1VE6A 1NJ8A 1SG9A 4PZDA 1YZQA 4IKPA 3WHPA 3K30A 2WLTA 2AEFA 4JUBA 9ABPA 1XQVA 2CXTA 2Q1YA 1CQWA 3HB7A 3O83A 4D8YA 1NSYA 1XPOA 1FFXA 2HYIC 3GJ5A 1NSFA 3IBFA 5CCBA 4LWPA 2Q45A 2J5KA 2CFOA 3VR5H 1UOQA 2VRCA 2QP3A 3ZD6A 4RFSA 2GO7A 4X97A 1LRJA 2XUDA 1ORVA 4Y2RA 3LUDA 1FP7A 3PFGA 4TTJA 1JFVA 2ZYTX 4BJHB 1L4KA 3O47A 5FBLB 1YIOA 4F5DA 2O5VA 1H8EA 1QJCA 4OL0A 5DGDA 2LWIA 2OL4A 4D4LA 4Q7EA 5AUOB 3UWPA 4AU1A 5EE3A 4B8YA 4ZO4A 3D2AA 2Q5JA 4WLFA 2DRIA 2OLJA 3E1KA 3JVDA 5I7EA 2BWJA 1J5PA 4FMBB 4NTZA 1QFMA 3NTQA 3ZBQA 1F8YA 2VJOA 1P44A 4RPIA 3MT0A 1HV8A 4J9UE 3KWMA 3QOFA 1TGVA 4TXLA 1D9XA 4XM1A 5J40A 4NCAA 1HOTA 2C42A 2HWYA 3CBQA 3QPCA 4V1CI 4BNYA 3W5CA 1G17A 1K3TA 3P2OA 2ILTA 4Q9NA 4KXUA 3L01A 1L5WA 5F1OA 4O5AA 1TQ4A 1BXRA 1SZPA 5KQPA 1ZGBA 3DOFA 2G67A 4PO9A 5EWMB 3OIUA 2NO0A 1FFEA 1MB3A 3GFQA 3C7AA 1OWPA 2J4CA 3LHFA 2JDIA 3AFNA 1I94B 1P80A 2VSYA 3FCAA 4FMDB 1RRMA 5LU8A 1XA3A 2Y0DA 2HHAA 1CVLA 1ZWKA 3ICPA 3A6KA 4IICA 4LIPD 3VTZA 2WWYA 3AVXA 1DI0A 2XNJA 2R60A 2QTVB 1W2HA 3WLTA 2DUMA 3OTQA 3P0IA 3P94A 1SBCA 2J7PD 3C4JA 5L40A 3V33A 2XXJA 3D54D 1I13A 1A5AB 1WVIA 3PC4A 3SVZA 1UWLA 1U63A 3E22A 4D82A 1F48A 3CLUD 3HO6A 3HEBA 3W5JA 3LQ1A 1I3OA 1CZOA 2V54A 2ZDQA 2LP4Y 4TMXA 2MYNA 4EW2A 2NTNA 1MR3F 1RXEA 1NQWA 1P45A 2CJFA 3BGOS 3UY4A 5HQ3B 3ZI7A 1PFVA 4A23A 1Q7TA 3PX7A 1UFQA 1MX1A 2Y1FA 4L8VA 3S1LA 5FOXA 2B4KA 2EATA 1LPSA 4H3SA 2HA7A 5IEBA 5CVUA 1J8MF 3T5TA 5C1OA 1EUDA 2Q5HA 2JLCA 3ELYA 5AP9A 4O2BA 2IHTA 3LO5A 2QR5A 2FRVA 3M0EA 4QDZA 4EMTA 1V4NA 4BB6A 1GSAA 3MYYA 4PLTA 3RRMA 4WFIA 5K05A 3AOEA 1IPEA 3DEHA 1GQFA 2H18A 2WUFA 3NYQA 5IYZF 2X5XA 4DANA 4DLLA 1HZZA 1PWYE 1XB2A 5DO9A 1HNWB 1NRXA 1C81A 1BXGA 3ZGOA 4GLOA 2Q1WA 1MHPA 2JI8A 2QHXA 3R6TA 3ID6C 4OF4A 2PR2A 4ZDJA 1NF3A 2GXQA 4PNZA 5IK2A 3JTMA 1SXJE 3D64A 4W1QA 4WZBB 1ZGJA 4R8VA 1WO8A 5CW2A 2BKXA 2QTAA 3P2IA 3QHQA 2XE6A 5AHXA 2VDUE 3ROKA 3ZHBA 3D3EA 1E6WA 2CLLB 3I9FA 4LFAB 3LDFA 4D0SA 3VR5D 3VVLA 1NPTO 2FZ5A 2VP0A 3KLBA 3O6VA 4FYPA 3GHHA 1X80B 2PUDA 5HILA 1UKAA 1UDXA 3VU3A 1DC8A 1REQA 1SZCA 2P90A 3U1VA 2RARA 1JILA 1KFBB 4JENA 1M6YA 4N8EA 2HSEA 1QVAA 1R0KA 2B6HA 2JKZA 4H3HB 4X85A 2A94A 1CJCA 4LCEA 1ONSA 1SZJG 5HE8A 3RIHA 3KTAB 2G77B 2JFWA 1NVVQ 2ZCUA 2R6DA 1T5BA 3ETJA 1CE8A 4FZVA 1BGWA 2EJTA 5KWEA 1RMQA 2I8AA 3OD5A 4ZMBA 2B7CA 4EA9A 5ES4B 1DKQA 1DKRA 2R7KA 3AVPA 3E8XA 1M76A 2PA0A 5FA6A 2VJBA 3H1TA 4YI3A 4CRWB 4IFEA 2ZM6B 2D6FA 4HFRA 4EMUA 1DAHA 1PZMA 3FUTA 1P1JA 1ZMBA 3I1JA 3QLVC 1CP2A 5CU7A 3SX2A 3ZY2A 4JDUA 4ZJPA 5E7JA 2A3RA 4E5MA 1FVHA 4ZVUA 4DIUA 2FR1A 3LIPA 5DXJA 5EJ6A 2A0UA 1FRZA 4DNQA 4LHYA 4BGIA 5FUQA 1F7VA 4Q3DA 1CHNA 4Z86A 2H7YA 3AHGA 1X7GA 2WG0A 1XQWA 2JD0A 4LZAA 3QEMB 4MWEA 3S68A 2F4VB 4ZO7A 3NJ8A 1UPCA 1RRVA 1BDJA 1E2NA 4UTOA 2PSEA 1LU9A 3HCEA 3ZLBA 4F2DA 4P5DA 1DDIA 2Q9UA 3LYLA 1Y4UA 4ZC1A 4F8EA 1A9XA 2VCEA 2BE7A 2FG6C 2YIMA 3BIJA 3H4IA 4GOND 4YO7A 1TUGA 2VN8A 4TV9A 1IN7A 2CXUA 2UKDA 3CG4A 3GMTA 3MVEA 4LW8A 2IU0A 4C78A 3MBIA 5CA0F 1VJCA 1FLAA 2V4UA 2AFIE 4GNKA 4MAAA 1T8YA 4PBRA 4D9JA 1LZKA 2V3VA 1LPOA 2XB9A 1LJ8A 3O8OA 4M88A 3FOEC 1XRRA 2HNKA 4AMUA 3S6JA 1PK9A 5IM5A 3IURA 5HKKD 1U2TA 1IK6A 4HATA 4IJVA 5CAEB 3RWBA 4MUFA 1TZ2A 3JD0A 3X3HA 5KWSA 4ATNA 1V3QE 1RI4A 1TU4A 4A0SA 4F2PA 3QNMA 1J1ZA 2Y77A 1JR3A 4ZYVA 1Z2AA 2PWPA 4B81A 1VHTA 1UUFA 2X13A 3CRNA 2DM6A 1P2SA 3WK9A 3BIOA 4OB8A 1F9AA 3M5DA 5CB0A 4LZNA 2O05A 3KTOA 4OQMA 13PKA 1IHPA 1UM8A 4FHDA 2QR3A 2DQZA 1P7CA 1NP7A 2GEDA 5DYWA 1IVNA 4OHRA 3WFZA 4F2GA 5JMOA 1Y9ZA 1Z8DA 3MJSA 3CH6A 4S1NA 3WXBA 3AM5A 3EW9A 3UMVA 4RPCA 2YMLA 1PEKE 1RLTA 4QDXA 2CYCA 3QLUA 1NDUA 3WWDA 4B31A 4JT8A 3N3BC 4O2RA 4U7DA 2QDXA 1HMYA 2P41A 3MIIA 3EWSA 3VZPA 3NHAA 1N6RA 2VHVA 3MT9A 5JS7A 4QGBA 3HWRA 1JLHA 3QMWA 4AJ9A 3RARA 3ADOA 1IY1A 3SBDA 5EJ8A 1T8RA 2FUKA 4RTRA 4N65A 3WMRA 1P3Y1 3CF4G 1Q1ZA 3JAKA 3TD2A 5HJEA 4OLBA 2QS9A 3NIBA 2Q62A 5JT1A 4CKXA 3VDMA 4Q4HA 4R3UC 4ZVNA 4C22A 2XMPA 3VPXA 1E7MA 4URUR 1DKLA 3BWVA 1W0KD 1N6HA 3CQ9A 3BSWA 2JLWA 4CCYA 1JHZA 2FXVA 2D7CA 3PGJA 5GIOE 1JV2B 4LSMA 5LYJF 4HX5A 2WKPA 1NULA 3H5OA 1ZNQO 3IS3A 3ZS9A 4EMSA 4LWOA 1VI6A 1ZH2A 1YTUA 1GNRA 3PBKA 4C4RA 2VPPA 4KEAA 3OF3A 1M75A 4L02A 3WQHA 2C5GA 1M1NB 3E9YA 3EVAA 3SM3A 3RIMA 3V8VA 4GECA 3VU1A 2QLJA 3BQNB 3ZLUA 1WB6A 4YV1A 3DAPA 3BRWA 3K9QO 1P1RA 1MFZA 1XXHB 2ECFA 4YY3B 3ESXA 4LI3X 3SJCA 6NULA 1CY6A 1MB2A 1WJGA 4IDPA 2GPWA 4ILKA 4MR8A 3RM3A 3ZHYA 3T5DA 4YMHA 4JBXA 2H7CA 4ALNA 5JSQA 4JODA 1FC0A 2F64A 5CLJA 3K9GA 4K1LA 4QGSA 3OEEA 4BFCA 3AP1A 1QKIA 3INRA 4QSMA 3KR9A 4JP5A 5CA0A 3H6GA 4EO7A 1SBHA 3I76A 3N53A 3WE7A 4A03A 5D5PA 4AJHA 1UZMA 1DUSA 1G19A 4DQXA 4BNVA 4IHKA 5LFAA 3UYLA 1HDZA 3MBKA 1RJ9A 1O5TA 2OCAA 4MWDA 5JI2E 3KDSE 2GEJA 1RWKA 1RC8A 2VEDA 4WIAA 5DSXA 1BQEA 1K5PA 4IJKA 3NV9A 3VJRA 5C35A 1RWBA 2C1XA 3DEKA 4QOHA 5E1DA 1MX9A 4XM2A 3O4JA 5LD2C 1XA4A 1CJVC 3H1BA 1K5HA 3A6DA 3GIDA 4F9FA 3KQPA 1J97A 4UNRA 1A4RA 3L84A 2ZR9A 3QIVA 4FGSA 4A92A 1Q7CA 1RJWA 2AMLA 5GY7A 2QT0A 5JANA 1UKEA 4JQYA 3AG5A 4B7XA 4P0PB 2DFNA 1ZOLA 2PY6A 4KMOA 5J2UB 4TSKA 4UHFA 5F2EA 2N75A 2PMWB 3C3JA 4OHOA 2KLHA 4UQOA 1JEDA 3ICQB 4F8YA 5CDFA 5K0FA 1LKZA 4UFNA 3U16A 1QQAA 1OYOA 3D8RA 5ESRA 4BRUA 4N5NA 1Z08A 3N7UA 4NV0A 5FADA 4C4ZA 4BP9A 3WADA 1I2MA 3SYNA 2RHLA 1BD3A 1CS0B 3U61B 2X14A 5AVUA 3P0EA 3VKWA 1O97C 1T5SA 1PFQA 4JIGA 5GZ3A 1AN9A 1RWQA 2Z8YM 1YS9A 1XN4A 3WA7A 1KO7A 3LA8A 3PKZA 4BLSA 4FYVA 2XYPA 5LA6F 4KQIA 3TTYA 1EXDA 1QRRA 2IBMA 4I5DA 4NJOA 1BS2A 1U8EA 4US0R 5EHNA 3RLIA 5FOUA 4C0QC 3KJHA 4JQSA 1A69A 2BN4A 1UBHS 2PZAA 3PJGA 4NZMA 2PQ2A 5FOQA 4D4IA 1T3GA 4I19A 4Q4JA 1HZZC 2Q28A 2YFHA 1N6KA 5G41A 5JVDA 1ZM7A 1I5RA 3ZVKA 4GI2A 4LE2A 4U0JA 4RTOA 2NUBA 5JATA 3R3YA 2WI8A 1IN6A 5LYJA 3LBAA 3ZJVA 5LUBA 1DAFA 4TS4A 1JEQB 4LMAA 4P7KA 2PD4A 3OLXA 3C3PA 4LXUA 5BYKA 4QDJA 3HJRA 1W0CA 2D0IA 3HCAA 5C3MA 2B4TO 1EVQA 1N5IA 2IH5A 3UJ7A 4Z4EA 1TNDA 1UMBB 3P97A 2OECA 4BO7A 2JBAA 1GXSB 1UP6A 2ZSJA 3F5FA 2HA6A 2DG2A 3VXKA 2DU8A 2JAXA 3CN7A 2HDOA 5F21A 2NNLD 5FO0A 1LSSA 2FG7C 1V43A 4OJMX 4DCNA 4YCMA 1ECGA 2C77A 2X8WA 1RZRD 1NYRA 1CKEA 1K6MA 1QFZA 3HB9A 3K6KA 5K4HA 3N75A 4MO9A 2AG8A 2P79A 2R8YA 4YPVA 2VFAA 4OMDA 1C8VB 4Z8XA 3VHRA 3DEJA 2VS1A 1N1DA 5EMMA 4ZHQB 1Z17A 1NP6A 1I3KA 3T3GA 2FPGA 1IATA 1PJQA 4FNGA 3B53X 3MXTA 3W4IA 4YX9A 4YGYA 3V8PA 1JA0A 3FPJA 1VB5A 5T6MA 4BATA 3N2GB 3ER6A 5ADVA 1JA1A 2Q07A 3Q0TA 4OKNA 4M8IA 3KSMA 5KCMA 4FB5A 5DBIA 4OHCA 2QTBA 3PXUA 5HGXA 5AHRA 1V39A 1NBHA 3LZCA 3G6WA 3EVCA 4RHTA 4CTNA 1TM1E 3NXKA 3OIGA 3LKZA 3SJAA 5A62A 2WB2A 2VDWB 4M0LA 4TKMA 1YMUA 1MVNA 1UMCB 3PHIA 3HV2A 4Q9JA 1EDZA 1RE0A 3K0CA 2NXWA 1XPJA 3T8YA 1DAKA 2GBGA 2P4HX 2X3UA 5AI9A 2QQFA 4GE3A 1KYIA 1J42A 3AKZA 1QGED 2F9MA 3KIPA 5CTJA 3ESRA 1ZUNB 4BO6A 5ELXA 1LDBA 3S2UA 4AO7A 5KPJA 2C9CA 2V8OA 3QUQA 3SC2A 5KZMB 1A3CA 4P58A 4PAGA 4CEIB 1BFUA 2R85A 2AZMA 4MEAA 3ZQKA 5JALA 1EP1B 2N47A 1ZJJA 3D9QX 2FR0A 2ZWVA 4HNTA 1KK0A 5IAOA 1UADA 1RAAA 5LA6A 2P2NA 3MJEA 3U7IA 2M6SA 3P2YA 4V02A 3F78A 4CR6A 2VRBA 3DTTA 1KP2A 1NBME 2NYVA 4KKVA 1KNQA 1Z3CA 3G2QA 4JY7A 4MI1A 4YUYA 2QWXA 5KOIA 3EG5A 2EXXA 4RHEA 1MNAA 2NU6B 3RDPA 4B2IA 1BEEA 4QXRA 1AXRA 1ZD1A 2P69A 3K1JA 3KPYA 5C1DA 2C2MA 3OUUA 4EFNA 1XTZA 3SQMA 2VJYA 3L49A 2OV4A 1A9RA 4HEHA 4WK0B 2OCGA 3CKYA 1J7JA 5KC8A 2Y9MB 3TE7A 2ZB4A 3ZQ6A 1BA2A 3QLUC 2I3GA 4H1UA 5DTEA 3EEFA 3AT1A 3IXQA 3I1FA 3EEBA 3E8SA 1TLTA 1AOXA 2O14A 4RORA 4WVFA 5F76A 1RYDA 4MQEB 3RSLA 1E9FA 1T0BA 2YWXA 1QLHA 1XZEA 4N9QA 4COKA 3HQ4O 3R9XB 2FKNA 2G0TA 2FV8A 5D7NA 3TG2A 2JK0A 1P4JA 2DTDA 4N03A 4HQKA 1YB7A 3SM9A 4A1FA 2ZRGA 4M0KA 2C2XA 4ZJZA 2VIIA 3JQ6A 3DLTA 1K3UB 4U9HS 1UC9A 3E3MA 2C5LA 2YYSA 4R05A 4CT0A 3EVNA 4MPPA 3I04A 1BEUB 4MWGA 3R9IA 2RHRA 2HQRA 1ZUD1 2YC4C 4UE3S 1OASA 4MROA 4URZR 2C8LA 2G5PA 3ABZA 4UNPA 1DMRA 1FUYB 5HTOA 2QTVA 4S05A 3QYAA 1NXXA 3GIWA 5BSTA 4BO4A 3IJRA 3HY4A 3JD2A 1F1JA 1QM5A 2NXNA 3ZWPA 4P83A 3X44A 1TYCA 1BW9B 2B82A 2ZAGA 1RXSA 4AK9A 5KJ1A 3ECSA 4NRDA 1ORRA 4REMA 3D0OA 3I9OA 3GAAA 4Y1GA 4JI6B 3GMDA 3HCCA 1J56A 3L7LA 3QK7A 3VR0A 3GOHA 4M8LA 1GTJ1 1YRBA 2IWRA 2OFOA 2VRCD 3C2QA 3SX0A 2BCJQ 1NXTA 5HQ3A 3CB2A 2D00A 1Z39A 3GF4A 3DD1A 3PP8A 4GNRA 5BT9A 5AW0A 1WCXA 1ZHOA 3PNOA 2X2EA 1O6CA 2CHQA 2JFFA 3DBLA 4CMIB 1H8ED 3WGZA 1XTQA 1P5HA 4C21A 1R18A 5L6MB 2RHCA 1V1MA 4Q21A 2P2DA 3CW9A 2DPMA 4IIBA 2ZJBA 4HNAA 2XUKA 3H18A 4MOWA 3LJKA 3LMKA 3H05A 2ZI7A 2VKTA 3G2HA 3HY3A 4HH3C 4NZ9A 1T29A 4R3WA 5C0OE 4NCXA 2W2KB 2WA1A 1MABA 4HZUA 4QDKA 4UE2A 5EN4A 3RBVA 1S3SA 2ZYHA 2PZ8A 1OTYA 1X3SA 3R3HA 5ICSA 2VJLA 3N2YA 4C5CA 4DMMA 1VQ1A 1TTHA 1HWYA 5I9MA 2QGNA 5DB4A 2XOKA 2QIPA 4O1HA 3ZHZA 4OFWA 4WZBA 3OM8A 1S2DA 5J5CA 2C99A 2OGWA 2IBTA 1Q92A 2QAIA 4QYIB 1GGMA 3D4PA 2E4VA 3H42B 4Q3KA 2JDID 4JYBA 4G5QA 2GJAA 3FCEA 2VP9A 3H9CA 3F3MA 3KYJB 1T6BY 1G3QA 1PWEA 3GGCA 1EG7A 1XK6A 1X80A 3OA0A 2O3TA 4Q39A 4RJIA 1JHAA 3PPVA 3DLBA 4KIWA 4LDZA 4DDVA 1Q91A 1KETA 3MINA 4TVBA 1MB0A 3LY5A 1HLFA 3K5WA 2CFRA 1PNRA 5FNVB 2CWWA 4X8HA 1JVNA 4IG9A 3KTAA 4M0MA 4OKSA 5B1HA 1D07A 3P9CA 1WBDA 4QLBA 2XD4A 2AFRA 3DL4A 4RK6A 4RTJA 4DV7B 3N8GA 3RBAA 2WFLA 3V97A 2JIQA 3HFGA 4H59A 4DNOA 2B30A 2Q3MA 3RHSA 1O97D 2OBYA 1AK2A 2QE6A 4GX2A 4PYJA 5G0VA 4YR9A 1AS2A 5CDUA 1R9NA 3QRWA 1E98A 1X7YB 3HV0A 1CUSA 3I6ZA 4S1TA 3QE3A 4KTVE 3N6XA 4X1IA 1SUIA 3NBFA 3BRSA 1L5VA 2FMKA 3A1TA 3BA1A 3PTLA 3Q7PA 4YPOA 2VPXA 3A1NA 2VHZA 3CF6R 2VP5A 3QEMA 2QMHA 1WXQA 3FNFA 4C06A 4CQMB 3FTEA 1SZDA 5KBYA 4BMDA 3KAQA 3ZY4A 3I4FA 3ISVA 4KLAA 4QRDA 4UW9A 3I92A 4BQRA 1RP1A 4QNNA 1X94A 1A5TA 2FFAA 4I8XA 4XQ9A 4RA9A 1ZK3A 1J0DA 3D4IA 4YRRA 3WYEA 5IK2D 4Y9UA 4HV4A 1JHPA 2E4UA 4TZKA 1P1HA 3P2KA 3T99A 4DUGA 2DEUA 3SEAA 4EPYA 5FTLA 3P0JA 3ECCA 4ZVOA 5T8KA 5DNUA 2ZITA 4D57A 4A27A 2XB2A 1ZHFA 2ZKIA 1DQNA 4DL9A 2CV0A 3IE0A 5FPHA 1TCVA 3FWYA 3ZIAA 4ZGWA 2H17A 3TLMA 4Y2GA 4FONA 3FPHA 3VDQA 2VWPA 5IDQA 5EIXA 2B36A 3N05A 1H85A 3NDPA 4UJ3A 4H08A 1WM1A 4HCJA 2EJWA 3P9PA 1USIA 1SOMA 1ZRSA 4B2PA 3VUFA 1R9GA 2OWDA 3UENA 2DY0A 3GUHA 4P3YA 4XIGS 3A27A 1QH0A 3QUSA 3K31A 5EQFA 3ZNNA 3E5MA 4LA4A 3HBFA 4QASA 5SYMA 4OK3A 3FNBA 4DSUA 2PE5A 1WCV1 4US1R 2PEYA 4JLBA 2IEGA 5A6VA 3EEQA 3A31A 3FNQA 2GEBA 3IPCA 4LQCA 4C4YA 1I3LA 2ZRPA 1KH1A 1ULUA 3K5HA 1Q7RA 2P0EA 2PZEA 3TBFA 1PW7A 3BAFA 1HQKA 2FW0A 3C6ZA 5A7GA 3LTEA 1UPBA 3QF4A 5IXJA 2O7NA 3DWEX 3H1EA 1MGPA 4BFYA 5K3BA 2K2QB 3K0CC 4Y2XA 5I7HA 1M2OA 4D56A 3QU2A 2HMAA 1IMOA 3TDKA 3FYHA 1F1BA 5TF4A 4B3XA 4EA6A 3W4KA 1DIOB 5ENZA 3UW1A 2YX1A 4DJDC 3U5TA 1ZH4A 3CEMA 1Z2DA 4F7WA 5JO9A 3T3DA 1YQGA 3NUQA 3UCEA 4E31A 1IUOA 5CT8A 2CDRA 2ZBGA 4WNCA 3U81A 2FUNB 1X42A 2JKYA 1Q6YA 4OI0A 2GCNA 2FPWA 1T5IA 1X2BA 2QN3A 3AEXA 1N2OA 3SKXA 4KXMA 5B64A 3HU5A 4EW1A 1AC5A 1VRVA 2HWUA 2RH5A 2CV2A 4HGZA 5AXAA 4XD7A 4LNHA 4ENSA 1L5ZA 3GJ7A 1L3IA 1P7PA 4KN6A 1HH4A 2FEOA 4I4NA 1EM8A 4X6XA 4YBRA 5DKFA 5HBGA 4C4SA 3UMGA 1V8BA 1JR3D 1X8XA 2OTCA 3CX3A 1T9DA 4L8YA 1JDPA 2QZ4A 1L7NA 2FI1A 1Y9DA 2W0MA 1GKLA 2H11A 2WILA 3DAGA 4GPEA 4UHEA 4E70A 1ZP6A 2IYLD 2NVOA 1S8NA 1XZLA 1RHMA 2XXBA 2ZP1A 4CG2A 5EGNA 2F7SA 5TMPA 1E7RA 2I2WA 3HKCB 5KNCA 4I08A 3LWBA 1TA4A 5C3UA 4KOEC 3E58A 4LI0A 5KOYA 4RLHA 3IODA 1HL3A 1WS6A 2CJYA 2H4YA 3TJRA 1KMHA 4ENRA 1WF3A 2OILA 4BNDA 4A0QA 2AWNA 1DTEA 3PB3A 3UXMA 4RTKA 4JC5A 3UJBA 3KQHA 1E4EA 3U4CA 5DOZA 5I5GA 5ALUA 3WZ2A 3MS7A 4DRXA 3PA6A 1DELA 2QNRA 1K7SN 1CRZA 4FFLA 1YE5A 4ZIRB 3D7MA 3FFXA 4FGWA 4ER5A 4RCVA 2VSQA 2PWYA 3UMFA 1ESEA 1FTSA 3GGOA 3GO4A 3LDUA 2VQEB 2R6CA 2GNOA 5J2UA 2XZLA 2NP7A 2QNIA 3AZQA 5CITA 4UQLA 2YW9A 4QYMA 4W7IA 1YE3A 3O95A 4D41A 3FJOA 4IRMA 7REQB 4FOTA 3ER8A 3WGJA 4OD0A 3AR5A 3ZCTA 1E1RA 2O3RA 1FP6A 3UFBA 4Q1BA 1CS0A 1NLZA 3WHLA 1PJCA 4H3VA 4DARA 2EJCA 5BQPA 1H69A 3TQTA 3ZH9B 3THSA 3HR8A 4HZIA 3DKPA 4E5DA 2E37A 1HG1A 3H2IA 3DB2A 3EYWA 2AK3A 4LV8B 5H8WA 3IUSA 2VNIA 2Y1EA 3NGLA 4ZZ3A 1QO7A 1ITZA 2ZPTX 3DT9A 3EGOA 1GNQA 5C7IO 1EINA 2WUDA 2JS7A 2ID7A 1CUZA 1IN5A 4LRQA 4IF6A 4CKWA 2JANA 3ONWA 3ZDXB 4C1BA 5TIIA 1SPXA 5BRJA 1ZRHA 4K88A 2X1LA 4OU5A 1TADA 2W8BB 3E23A 4MWTA 3LCCA 1YFLA 2TSYB 1DBSA 2PKCA 2VQ6A 2IZ0A 4MULA 2PL3A 2O8FA 3QKRA 3HA3A 1NVKA 4KQCA 3WLAA 1K4YA 2XEXA 4RXMA 3ABSB 4EG8A 1T24A 5D1NA 3WQQA 1L5KA 2O2CA 4ER3A 3CVVA 5ISMA 4RVCA 1I33A 1LBHA 2HJ9A 4KDEA 1P73A 3ETCA 4OUDB 3M3PA 2G4LA 2J33A 3NNSA 4X7BA 3SR3A 1C9MA 1QCYA 1OTXA 1UMBA 3GLSA 3AUTA 4U2DA 2V6BA 3UCFA 4HDNB 1GXSA 3WGMA 3G17A 4CM5A 3D3WB 1IE3A 3V8QA 1EHYA 1Q7GA 4M0EA 2BHTA 1YA6A 3PXAA 3AM4A 4F46A 2DH5A 1KSFX 2HQBA 4HB0A 3IILA 1QV9A 1R15A 3CSDA 1II9A 2BUCA 2O0JA 1EBFA 2RKOA 3ZE6A 4KIUA 3ZVRA 1TDJA 3WLFA 5IWCA 1K7FB 1WCYA 1GDHA 2PU5A 2Z2IA 3BXHA 3OSZA 3C39A 4PYLA 4MARA 5AM4A 4ZHQA 2HK9A 3MOSA 4P22A 1RWVA 1QE0A 1HZJA 2HXSA 3CGWA 3N8HA 3E9EA 1YOVB 4GOXA 5DMXA 4CCWA 3EZ9A 3GT4A 4IDCA 4DQVA 1QRSA 3SCZA 1PTKA 3IBGA 5GJCA 3RO7A 1ISSA 3FOWA 5FFNA 1MH1A 4QG7A 4FIZA 1WHSB 4DDTA 3FR8A 4LF5B 4M7PA 2C3YA 1F2VA 1N7HA 1CY7A 4EHAA 1P2VA 3F9CA 4MRMB 5CPFA 1S4QA 2XCUA 4CR7A 5IKXA 1HG0A 4D5GA 3B70A 1XMVA 3RTEA 1CB0A 1V8FA 2WUGA 4KO2S 4WSOA 1WVMA 2VA8A 3D8HA 5CLQA 2FF5A 3DHVA 3P4UA 1HF3A 4EH1A 4I1VA 1NV9A 4RQUA 3T7AA 3PGMA 1U0FA 1IJBA 1GRNA 1H9AA 1U0NA 2B9VA 3RIEA 3T7JA 3AKDA 6ABPA 2BFFB 1QGOA 2WOOA 5IFKA 1WTCA 2V7TA 4YRIA 3ZWNA 4YXFA 1SGWA 3D3QA 3RTBA 3N39C 4AMVA 3IL2A 2D3WA 1BKYA 2QRZA 4ZCLA 1C8KA 4C76A 1YQUA 4CHGA 5T8KC 1Q1GA 3LWNA 4DUYB 1ENZA 1QP8A 3GFFA 1CR6A 1Y1LA 1KI9A 3L8ZA 4DIDA 1GDTA 5HOQA 1E94E 1PL8A 1W34A 2WVHA 4HB4A 2D0DA 4DKJA 4B6RA 2OCKA 3HJNA 3OETA 2DQKA 2I99A 2H9AA 4UBIA 3FGNA 4WXRA 4HVLA 1OBHA 3K9LA 1L4FA 3AUUA 3Q6MA 1CDOA 2X5KO 2NU6A 3DFFA 3BGWA 3EK2A 4GPZA 3B1KA 1L5MA 4PFQA 4RLQA 4O4JB 2VNHA 3CWQA 3EXEA 4PIVA 4WQMA 1W93A 4IO1A 5AVVA 1N0WA 1WEKA 2WSBA 4Y2QA 2GPNA 1XMIA 1EEHA 1KHHA 3NHJA 3NYWA 4Q15A 5B37A 3VR6A 3A2MA 4HKTA 4RC9A 4FDTA 3NT2A 2WJVA 5TR9A 3WSVA 3H2HA 2IEZA 4IYJA 3T1TA 3FVRA 1UFOA 3GJZA 3K9WA 1RZ3A 2H2GA 2QV7A 4MQEA 3AI3A 2C8VA 2CNKA 2DETA 4B34A 4IYRA 1ZMRA 2AWOA 1Z38A 2XUHA 4BQPA 2C7PA 3BS4A 1EBBA 2GN4A 3HBJA 3I6IA 3KUKA 3MYRA 1JDSA 2VWQA 3DLPX 3ROPA 4F2HA 4H4DA 3VAAA 3SHOA 4N0QA 3AO0B 3EASA 2IPMA 5TC4A 3V80A 4DUZB 4S0XA 1PWXA 2YC2C 3K0FA 2ZXFA 4RGQA 3TRDA 2ZR8A 1IQ0A 4ZCSA 1UM9B 3CNOA 3SU8A 3I45A 4UMEA 5JECA 4EWLA 3H2BA 4DDMA 2PN1A 1JJBA 3D5QA 4YMTA 3OCZA 1GZ7A 3OE5A 4G63A 1GFIA 1W36B 3RJZA 2WINI 3KT8A 1TI7A 1Z06A 4P3PA 4B4WA 8ADHA 1EFRA 2C2OA 3QPVA 3IAM6 4UD2A 3UOWA 3OEYA 1GA6A 4X84A 4PGAA 3RS7A 3Q5GA 2HIGA 3RTGA 4HDQB 1VA5A 2IY9A 3N9IA 3WNCA 1V7PC 4FMCB 4URHA 4M76B 4U2KA 5THQA 3IAFA 3JARA 2QR2A 1F2TA 2C5SA 1N92A 1MC5A 4RZQA 1E1CB 2Q2WA 3HFRA 2YQ5A 3LH5A 4HDKB 5FTWA 3T5MA 1EZ1A 1YI0A 3BBLA 3EGVA 3JZMA 3W8DA 1T1EA 2SCUA 1TZBA 4RD2A 4CMIA 5AUNB 1Z4LA 5TQ0B 3IRUA 5LXTB 2RSLA 4CTJA 3F6YA 4P93A 3MXOA 4TSFD 1V5EA 3HNRA 3V3KA 3ZKAA 4U5XA 1J0XO 2X4LA 4TS3A 3MMSA 5ECWA 4YV7A 4ILEA 4KLRA 5EPOA 2N1MA 2Y93A 5K0ZA 4RK0A 1JTEA 2XCSB 4U7GA 3INYA 3B1ZA 2P91A 1U3WA 2Y2VA 4M1ZA 1CZUA 4BJ6A 3G1UA 4X00A 1ZU4A 2Z43A 1AQNA 3PR1A 4NFLA 3PNLA 5FLEX 3GLIE 2QX4A 1KAQA 3MTAA 4FILA 5FRDA 3ZZ1A 1WL8A 2GN0A 2H5LA 3IEMA 1B23P 3VHLB 2RJNA 2HPZA 1NU6A 2GAOA 5EMKA 3SPXA 1MJGM 4A8HA 2NV6A 2GVNA 4C4AA 4NYMR 4JWKA 2MYPA 2I7DA 4NCBA 1JG4A 1NVMB 1ADCA 4UAVA 5FA8A 3ZHOA 1VLJA 3W06A 3KHKA 3R2JA 1G0OA 1FF9A 3B1FA 3HYRA 3UAVA 1PLKA 3RYCA 1VRCA 2OZLA 2Z56A 1G291 2IPAB 3BHNA 4G4SP 4LYEA 4YP9A 3VA7A 1QIGA 3DAOA 3A8TA 4DJFC 1Y1PA 2RGAA 2XCLA 1QHHB 2YVUA 1HE8B 3RK1A 4LYJA 1R88A 2TMYA 3II6X 4BO0A 4OQXA 4XLZA 5SZIA 5C7LO 5EZQA 4A8PA 3DV0B 4WN9A 4BE9A 3FSRA 5KTYA 3A26A 4CDMA 4DBVO 4XGQA 1VZ3A 2X76A 2IYAA 3BMCA 4GYKA 1D4OA 3ASVA 3KPJA 4G5SA 1G8YA 4TMKA 4LGCA 1HX7A 3EAGA 1ICEA 5EXXA 1K2WA 3HEMA 1X7YA 2QLBA 4XARA 1QHXA 2UVDA 4O02B 4LG1A 4PM4A 4Q18A 1JLMA 1ZGZA 2IEYA 4XQEA 3ZNOA 1EB9A 2Q4TA 3C4QA 3IXLA 4RA6B 4U7PB 3RFTA 3SKVA 3UFXA 1ZYUA 3UB3A 3TRHA 3ZGNA 2A9RA 3Q8MA 1SCIA 4QOEA 2C4HA 4CQMA 1KAHA 3TN7A 1MFPA 4BN5A 1BHQ1 2NM0A 3OZGA 2YRFA 3QQ5A 1A98A 4PZCA 4KFCA 2G9VA 2TECE 3DPIA 1AB5A 2GLTA 1X39A 2X1HA 2JPDA 3THOA 1QUFA 3G7UA 5T5QA 1CULC 2W6JA 3DS8A 4LCBA 3RYIB 2XGOA 2P8JA 4UM5A 1AUVA 4KR6A 4MTCA 1WZEA 2X7HA 4BNUA 3QVJA 1PG2A 4D6XA 4G85A 2BHNA 4UVEA 4BNKA 2W6IA 3KZVA 2B4RO 2H4HA 4KO1S 4DMCA 1TKRA 1QTQA 3HM9A 4MYCA 1F38A 2VK1A 2ZZKA 2GNPA 2EP5A 4HWPA 2ES4A 3S2EA 4YCAA 4NQRA 1ADFA 5G1PA 3SWWA 2ZTHA 4GOOD 1OBVA 1XNHA 5BPFA 2W37A 3G13A 4EB0A 3NV7A 3R7SA 4N7RA 4AIIA 4CUJA 1BOOA 4F3KA 1NIJA 1M5TA 2WK1A 1U4OA 1VJGA 1DBQA 1Q0ZA 4OP3A 4WY2A 5EFOA 3GH1A 1MRSA 1U5AA 1V8DA 5E8RA 1Z88A 4JVSB 1TUBB 2B8EA 5CA1F 1UEIA 4GYJA 1CY0A 2C92A 2ZRDA 3HXPA 4O0LA 4B3TB 1EG2A 1JKIA 3KHSA 5E9QA 1VE5A 1E9AA 2RGCA 4J2HA 5B1IA 3F6EX 2D06A 5JD5A 1Z7YA 1COZA 3Q7QA 2IODA 4UHKA 4AJEA 3KKPA 2ENUA 1QH9A 1W46A 3D43A 3GEPA 3RVPA 4J0EA 5EJ9A 5KOJA 1OHHA 1QO0D 3ZNQA 3JQ8A 3RKUA 3H83A 1RQXA 3K35A 5KS2A 1E89A 3ZW9A 4N3BA 2C82A 4YRJA 1TZJA 2FX3A 4QHSA 4RFVA 3SZRA 1YR8A 2P9BA 3AJ9A 3MNFA 4MUIA 1JRLA 1E79D 4OXKA 4BUJA 1YI1A 4ZDIA 2HT6A 2GN9A 4RIIA 2JHGA 5A5FA 5KNCH 5DM70 4LF4B 3UKDA 3ZU5A 2JHCA 5D6OA 3AUAA 5TMDA 4RMIA 2NO7A 3NDJA 3QMPA 3EUWA 4V0OA 3R3WA 3WK4A 3PC7A 3IB3A 4PWZA 3VZDA 1ZJYA 4G0ZA 3EVEA 3R0JA