2GZMA

Crystal structure of the glutamate racemase from bacillus anthracis
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
266
structure length
266
Chain Sequence
b'KLNRAIGVIDSGVGGLTVAKELIRQLPKERIIYLGDTARCPYGPRSREEVRQFTWEMTEHLLDLNIKMLVIACNTATAVVLEEMQKQLPIPVVGVIHPGSRTALKVTNTYHVGIIGTIGTVKSGAYEEALKSINNRVMVESLACPPFVELVESGNFESEMAYEVVRETLQPLKNTDIDTLILGCTHYPILGPVIKQVMGDKVQLISSGDETAREVSTILYHSKMLNEGEEQSDHLFLTTGKIGLFKEIASKWFGQPIENVKHIHLEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamate racemase
molecule tags Isomerase
source organism Bacillus anthracis
publication title Structural and functional analysis of two glutamate racemase isozymes from Bacillus anthracis and implications for inhibitor design.
pubmed doi rcsb
total genus 97
structure length 266
sequence length 266
chains with identical sequence B, C, D
ec nomenclature ec 5.1.1.3: Glutamate racemase.
pdb deposition date 2006-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01177 Asp_Glu_race Asp/Glu/Hydantoin racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gzmA02
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gzmA01
2OHGA 3ISTA 2OHVA 3OUTA 2JFWA 5HQTA 3S7ZA 2JFVA 2JFPA 3ISVA 2OHOA 2JFYA 2GZMA 2JFNA 1B74A 1B73A 2JFUA 2DX7A 2W4IA 4B1FA 3HFRA 2JFOA 5HRAA 3S81A 2VVTA 3OJCA 1IU9A 1ZUWA 3UHOA 2EQ5A 5ELMA 5HRCA 2DWUA 2JFZA 1JFLA 2DGDA 2JFQA 2JFXA 2ZSKA 5EVCA 5IJWA 5ELLA 3UHFA 3UHPA 5HJ7A
chains in the Genus database with same CATH superfamily
5IVHA 4MW2A 2XB9A 2J4CA 4QQ8A 4K88A 3OD1A 3UKOA 2ILTA 4RD0A 3P9CA 3S7ZA 4AJNA 1JR3A 2WSMA 4NIMA 4CMBA 4MPJA 1ECBA 3G0CA 5KNBD 4NNPA 4BBJA 1B43A 2P91A 1SXJE 1U31A 2C3OA 1DJOA 3FUVA 1FYVA 1R10A 2GK3A 3F7NA 3FPHA 3U3DA 2QM8A 3FVRA 2HF2A 1CJBA 4BVAA 2AEMA 1WNTA 1XWWA 3D7LA 4L8VA 5LQKA 4RSHA 1UBNA 4DMHA 1EXVA 1QZTA 2GI4A 4QOGA 2EHDA 4TL6A 4GI3A 4KPFC 5DM0A 4ZCPA 4TTPA 1CUFA 2QTWB 2ZAGA 3OLVA 4FEEA 4NE7A 2Q2OA 3ZY6A 3TGPA 1PDOA 4PBTA 3HBJA 1QRAA 1QH0A 2CXNA 1GQOA 4G0WA 1GQ2A 1C8BA 3PDIA 1OF1A 3TTYA 1Z56C 4ZU6X 2BJHA 2AWOA 2YWFA 1Q0UA 3KUXA 1OVGA 4IDNA 3UJ9A 3VH4A 4WLOA 1NW8A 4E31A 1NWCA 1TZBA 5L3ZA 4UUPA 4BMOB 4E12A 4J43A 1O54A 1LRKA 1SQ0A 3K8ZA 4JLAA 4RE6A 4S3MA 2YYSA 5ALRA 5TMDA 3OX2A 1BXRA 1KXJA 3PE6A 5IVPA 2OTCA 3TRDA 3D6TB 1JSLA 1IEXA 1ULTA 1U8TA 1Q1QA 2JHCA 2PH1A 3AJDA 2RHBA 3NP7A 5G1OA 2JI7A 3GJ6A 3B13B 1TM4E 4QVIA 1XCPA 9ABPA 3D02A 2C94A 5BVGA 4AJPA 1Y6QA 1JIJA 4HI0E 3PUXA 1E3TA 4M1QA 1QIFA 1L5KA 4QU5A 2IJGX 3K4QA 5SY6A 2I22A 2PXHA 4KFRA 5HJ5A 3HJFA 4R0MA 1ZO8A 2G80A 1J09A 4P86A 1T8UA 1BMDA 2MOKA 3OOHA 3EMKA 4UVHA 2JFOA 5AQ1A 4ZJYA 1TIPA 4Y6LA 4EYEA 1EM6A 4G3XA 4UTVA 3ORRA 1ZGBA 3LXRA 1MQAA 5HIJA 1YVEI 4B3SB 4OYRA 2DM6A 2VUHB 1RCTE 4UQLA 3U39A 3JAKB 3ROGA 3HV0A 3TIFA 5A5VA 2DUMA 1Z5OA 2JH9A 5F73A 3DEJA 5IBCA 1I0IA 1TYEB 5K0CA 3PX7A 3I8OA 4QYSA 3TR6A 4R9UC 3IP8A 1AT1A 1E6WA 4R8KA 1CNMA 1V0JA 1YJAA 4KKXB 3AF5A 1U6IA 4NDNE 3VAAA 1GXSB 1H05A 1MV5A 4J7UA 3UEOA 1RQGA 4JVLA 3BMQA 1E4EB 4DWJA 3B9PA 1I1QB 3D54D 1EE1A 3TSAA 1E2IA 1WKVA 1GOTA 1CVLA 3ANNA 4GM1A 3GJQA 1RBMA 1CRQA 2H9IA 1G20A 3JQFA 3EXFB 4IDPA 4US0R 2H4YA 4NZMA 1R37A 2R3SA 1C29B 4OQPA 4YUWA 2Q4BA 5HK9A 4LG1A 2Z09A 4ND4A 5TS3A 5EJ8A 5LQMA 3TNFA 1RP1A 2FEWB 1MAAA 1PLKA 4BCCA 2WHPB 2P11A 5KTOA 5GIPE 4FGUA 2D7DA 3WJ7A 2KM1A 1RXSA 2EX1A 5F1PA 1EHCA 1Z2NX 2ZBVA 3BGOS 3C3XA 3HY6A 5EERA 4ZOLB 1N5DA 5CDFA 2YMQA 3R74A 2OK7A 3UIEA 2BGLA 1Q1GA 4UASA 2HQ1A 3FWHA 4K7JA 1DKQA 5JCXA 4FEGA 2P90A 5TMBA 421PA 3TG2A 4ML3A 3HBNA 4NABA 1B6GA 4REQA 1IPEA 2V7PA 4X7BA 3UT0A 1BG6A 3VSBA 1R9MA 5IS2A 1HZJA 4Z8YA 2GPBA 2JFNA 3KE9A 1GQSA 3KZCA 1Q11A 4BKUA 5DGCA 2CMGA 3C3KA 3WWZA 2W0MA 1S3IA 1V9LA 3Q3HA 4JI1B 2HA4A 1V11B 3QVGB 4JJ6A 2C2HA 2P2YA 1ZG3A 4HLUC 5HS4A 5A4KA 1BROA 1RZRA 3GMSA 3ZBQA 2JEOA 2O20A 4K5QA 2P2SA 2WJWA 4QUKA 2JGIA 4IJ6A 2EJUA 3SS7X 2QTRA 2IV7A 1XN4A 3FGNA 3NCHA 3SJCA 4QVKA 1L5QA 4EHLA 2KW5A 1A98A 1T1EA 1QFMA 3DFZA 1I4LD 4PYMA 1K7YA 2AG8A 2XUKA 5J4LA 4CW7A 3DFIA 1VLHA 4OQXA 4KACA 2CUZA 5DEIA 3ZIAD 2B7BA 1SBTA 3FDZA 4IP0A 1R9GA 1Q1ZA 5DYNA 4ZDIA 2QRPA 5A04A 2RHCA 5JY1A 3SWWA 1J20A 1E3DA 1G8KA 3JD1A 4ZTBA 3DEFA 2ZIZA 2Q2NA 3DBLB 2NUPA 3KT0A 3P9PA 5CW1A 2O2DA 5C3UA 3ZQ4A 4QFMA 1DKMA 2BEKA 3GZNB 2VDOB 2A5YB 4Z4IA 1JFLA 1XMPA 2HTEA 4M8IA 2CXUA 2XQFA 3AR9A 2W2VA 3ELDA 2Z9CA 5FPKA 2RGBA 2QUHA 4OM7A 3NDRA 4KSCA 5FNVF 1D6MA 4AF8A 2M2IA 3NYWA 7REQA 5DTQA 2FWMX 1A5AB 2HBQA 1RRKA 3FUCA 4O2AB 1D5WA 3P5BA 3RF6A 1FFXB 2VJAA 2JIZA 2IXEA 4BNHA 4D57A 1JJAA 1G98A 1S4MA 1I3OA 4OBEA 5CBPB 3ERCA 3KVOA 5BW4A 1HNXB 3QKUA 4ZCQA 1MC5A 3C97A 4OBWA 1R2QA 2CJXA 3T7AA 1I24A 2FR0A 4D6PA 1G5FA 1ZEMA 1VL0A 1H5NA 1AA9A 5ABPA 1MABA 1OPRA 2ERCA 3SPXA 1R0ZA 4MWGA 1Z47A 1NT2A 2XXJA 1AMOA 4A15A 2HADA 1M2HA 3OTOB 3MWFA 3ENZA 4Y0AA 3NHJA 1TVKB 3F9IA 5G4LA 3B6KA 4LXGA 4Z4FA 4PCAA 1KP9A 3I01A 3RSLA 1XOIA 3TL2A 3K0CA 3W2EA 721PA 3DAHA 4NG4A 1T2NA 2ZSUA 1QH8B 5FNZA 4HDSB 2AWNA 5IANA 5LZ2A 4DIFA 1QIDA 2PWYA 1S5PA 4UM9B 1M7HA 1ZMBA 2X8JB 3WK5A 3RG8A 2QAGB 4V1CI 2GKOA 2GXQA 3W6UA 3F7MA 1QYIA 2C5GA 4IV8A 2IYEA 3K6RA 5TARA 4DMCA 1KMHA 4C7JA 3WC4A 4R69A 4BB5A 2PL3A 4HNVA 1JVBA 1J9GA 2OB2A 5ECWA 3DC7A 4CV0A 2P27A 3G2OA 1M2KA 1DQYA 4EVIA 4OTZA 5ALPA 5K0TA 4WTOA 3HDYA 1ORWA 4J9VA 3P7MA 1FS6A 3LVBA 3TH5A 4V0QA 3TX2A 3GQBA 2M98A 3N9IA 4RAQA 3ADDA 5REQA 2AMVA 4ZIRB 1WXXA 2JIDA 3GXOA 2QN1A 4I5GA 4WNYA 1YZYA 1Y8RA 2FZEA 3GLFB 2BD0A 2HJSA 5JSHA 1KSFX 1XELA 4R9RA 1W36D 1D2HA 1XK6A 5T4HA 3TR5A 1RCFA 2P4QA 1D0IA 3ITKA 5DGIA 2QTNA 2O1XA 3ETGA 3F6RA 3FKQA 1V8OA 2IYPA 4YRCA 5FHQA 1V3VA 4X1OA 3QRWA 4HT3B 2IHZA 1G4AE 3N3AC 1RZUA 3MOIA 4DUYB 3W6ZA 3FDIA 2FEPA 3JWEA 2FQQA 2XNHA 1W8IA 4II3A 2YJ5A 2BJWA 3L8FA 1JTFA 2WVJA 4YAGA 2WJHA 4U5QA 3D6UA 3EZYA 3BERA 3WMXA 2XMQA 1NVAA 1UFOA 4R81A 4TMXA 4ER6A 4DA4A 3W8RA 4MA4A 2WJGA 5FTNA 3TMAA 1QHSA 2PYDA 3CKMA 4NICA 1S2DA 4LZOA 5HUHA 4CKCA 2FW7A 3ABRB 1Z83A 4KRFA 2B6HA 3AU9A 5D01A 1F9EA 1JNXX 3BREA 2ORVA 5HMLA 1FYWA 1FZTA 4E46A 5AR1A 2PE5A 4NEGA 3D3JA 5COQA 3VHXB 1G6KA 5LQRA 1U0EA 3F47A 3M4JA 1KHTA 2OGZA 3AIIA 4FNMA 1X1BA 5CYFA 4BTVA 2C92A 3OEED 5FH9A 5BW5A 4EW6A 3UMYA 4U02A 3KAJA 3N0TA 4IG9A 4MJXA 5IN4A 4PFQA 4TYQA 5KMGA 1QHYA 1VHJA 2G07A 5JYEA 2DR2A 3QEOA 4F7WA 3SSOA 4K9DA 4BO1A 4F3KA 2XVAA 4F45A 5K8LA 3ZW7A 2XQVA 4HZIA 1LJ8A 1O5IA 4AYXA 5BNIA 1OOEA 4QSHA 3W77A 4BB0A 1LA2A 3WTBA 1FRNA 1XALA 3R9WA 4JI8B 3OLCX 3QUBA 4ETMA 2ODQA 1C4KA 2YWEA 1ZU4A 2PGDA 3L8ZA 1N9GA 3TKLA 5LQCA 3NG1A 3KYCB 3JSAA 2ET6A 1QO0A 3CF6R 4BECA 2J0QA 3QX7A 4N03A 1B26A 1VB3A 1JHPA 3O83A 2W2LA 1WAMA 3CMCO 4GSYA 4HB0A 2HRQA 1OFGA 2V98A 3CUTA 4MMZB 2WF8A 1DUVG 1G5RA 1D07A 1GU7A 2GTIA 4CDNA 3ILXA 3NQ41 4KIGA 2GYWA 3TSWA 2C42A 5IABA 1R0WA 3L5OA 2YS6A 4FYJA 1NM5C 1WULS 4UBJA 1GZDA 5HKKD 1SHZA 5E9AA 4YRPA 1CUEA 2P75A 2F59A 1VMEA 5E6RA 4LF7B 1L5HA 2ILVA 4TTRA 2FSGA 4WRRA 4RK6A 1KK1A 4QAQA 4YQYA 3SS9X 5I7HA 3EGEA 5G0TA 1K92A 2HXSA 4X20A 2CVOA 3R77A 4OAPA 1L7PA 3TZ6A 3T5MA 1BXGB 2RGNC 3JD3A 4PZDA 2QM7A 3UFXA 3WGQA 2IDJA 3RB8A 4PC3A 1XIVA 2ASEA 4IVPA 4M7PA 3ESBA 4ZPXA 1SUWA 4DM4A 5JZMA 3MWLA 4BO7A 4IYRA 3B3GA 5EJMA 2Q9CA 1SVMA 2NV2B 5I4BA 2GBFA 2YWHA 1E58A 2RI1A 5B36A 4ZI7B 4A23A 1L5WA 4IHJF 1A4IA 3O4HA 4MQBA 4JWKA 2GLTA 1LDNA 3L05A 4R2MA 3BCHA 3STUA 2DLCX 3L84A 4FKMA 3VPAA 4MYHA 4DAOA 5L4NA 5DP2A 4NJMB 5DXFA 5BSRA 5K0ZA 3OZIA 4JCCA 3QYJA 5AM1A 3LBHA 1ZW6A 1POXA 1T8PA 4A8PA 2GRUA 1V1JA 4KB5A 4LJ5A 4WWHA 1T5SA 1P9RA 5EIWA 2PUTA 4CM7A 1Z15A 1Z8DA 1EX1A 3MTAA 4K40A 2YYYA 4KSBA 4E4TA 4M49A 1Q0TA 1NF9A 2WV7A 2D4AA 3NWOA 5KX5A 1K5GA 4ZOLF 2ZW9A 3OJOA 4ZQGA 4GE3A 2E4WA 3O3CA 4JP2A 5AHWA 5E9WA 4AC9A 2QHXA 2DPHA 1I4EB 4WPGA 1RQ7A 2B21A 3L7BA 1CUBA 2ISCA 1NN0A 4BV3A 3IQWA 1IY1A 4FW8A 1J2EA 3WLEA 4IFIA 2FF7A 4EY8A 4YALA 3L7YA 2RKWA 3QM1A 3T0FA 3YASA 3EQ7A 3DOIA 5FBRB 2XUFA 4WEQA 1MHTA 1YRWA 2GEVA 1DEXA 1KGSA 3BXGA 2DWQA 3MNFA 2PUFA 4O2AF 3G9ZA 4GX5A 4QFCA 2CEKA 4DQ0A 3LLCA 2GKSA 4CMKA 4YIKA 3UMMA 3RIYA 4GKAA 4IWXA 3TYXA 2CLSA 3F3KA 3L43A 2VQDA 5JD4A 4OGGA 3HXTA 3QKIA 4KUHA 2MYPA 2L2QA 1Y6GA 4MCHA 4PHCA 3DWFA 1ILWA 1WSWA 2NM0A 4RF2A 3MMZA 3OZFA 1JFVA 2Z98A 2R1VB 2FFRA 1KA9H 4PCUA 2QN7A 1CHDA 4UHBA 4UULA 4N7BA 1A50B 1IIRA 1WSAA 3WIEA 1L3IA 1WCIA 5LP6C 2GHTA 4RK0A 4EO7A 4XIFA 4I1PA 1G3RA 4ND5A 3SHTA 4LXUA 1S6YA 4MB0A 3ZYZA 4MW0A 4HZUA 1R4AA 2MWMA 2QIPA 4L28A 4PSUA 3PC4A 2OHJA 4UQPA 3U80A 4KXLA 2P4SA 1RVV1 1K7SN 1NM5A 1X0VA 3E15A 4F2DA 3DWEX 1I4DD 1PK9A 2FGKA 3SR3A 2WA2A 5J63A 3WNZA 4GIBA 4M0DA 1Y1KE 3B9RA 3SLKA 4ZAWA 4A10A 2JFBA 5HVNA 4MV0A 3GP3A 2GBLA 5M2QA 4LNAA 4G5QA 4JUDX 3ZJYA 2VLBA 3H2IA 2I9KA 1L7BA 2JIBA 4JLKA 1MB3A 1SRRA 1QV7A 4JZYA 4P3KA 3KKOA 4RVFA 4GKKB 1AQLA 5KWSA 3EVCA 3B12A 1CY0A 3L7OA 1HEYA 1JR6A 2OO7A 2X4DA 2QLNA 3ZBPA 1M2VB 2HBYA 5FL7D 3I52A 3PUIA 2HBRA 1D1SA 3CRW1 2I80A 2PKWA 3PHLA 4P9NA 1TD9A 2WG0A 5HGJA 3AOGA 5AVVA 2IQ5A 3DP9A 3H3FA 4S35A 1YNOA 5CFRA 2WIKA 4XE5A 4XCXA 1H2FA 4Q7MB 4QTTB 4GLJA 4Z0PA 1A71A 1K3UB 2WSSD 4WESA 2O2CA 5K3FB 1N3IA 5KWJA 5ERXA 1THZA 2ECFA 4LRXA 2VJDA 3TSZA 4A2QA 4D4IA 1P8AA 3LTEA 1AZLA 4D7AA 5IXSA 2CLOB 2IU6A 3DLAA 5H70A 2OBYA 5FLKA 3V6MA 1JBEA 1UK8A 2CLKB 3V2HA 3FTEA 2AF3C 3OJXA 3ZNQA 2P41A 4NU0A 1E5LA 5ADHA 3N70A 4HDNA 1FW8A 2HJHA 3M9WA 5K2OA 3UHJA 3BMOB 3GN2A 3VO1A 3OE7D 4OOFA 1N0IA 3O4FA 4L8LA 1J7JA 3L4BC 4IH1A 3C1AA 5HJEA 1LEHA 1NSYA 2ZTMA 2YJ6A 3GGOA 4GE0A 2O2ZA 3LAWA 1NASA 1HFJA 1KU6A 3Q0TA 2R8BA 3DL0A 1E5QA 4N8DA 3N87A 3EA4A 4AJ9A 5HRUA 3GVCA 1KIFA 2ZREA 4TXJA 1QH8A 1TCUA 5DHRA 2ECKA 2PX4A 3OIWA 5CTAA 4CL3A 3VDNB 1FQKA 2OFFA 2YDYA 4TS9A 2O2JA 4C87A 4CF4A 4YAUA 5JJIA 2PWPA 3ZW9A 5JCZA 2YY7A 5JSUA 3IEUA 4XVUA 1W0JA 1YZNA 5BSVA 1TA4A 4FCVA 2COEA 1Z0KA 1MX1A 1ZN8A 1YQQA 2J1LA 2IUFA 2QRJA 1SUDA 5ELMA 3IUSA 5HGXA 5LKRA 1YS9A 1FX0A 4J76A 1ZJ5A 4RIEA 2D00A 2GZSA 2GCEA 2I29A 4IH9A 2VDUE 1KEUA 1KRWA 3RVLA 1DEAA 1QB8A 4LHYA 1ACLA 1MVNA 1YZGA 5EE5B 1GKKA 1E79D 4ON9A 5CYOA 1VHWA 3VUEA 5K6RA 1Z34A 3WAKA 4DLNA 8LDHA 2J32A 1R5NA 3PB3A 4F85A 3BGWA 3E2IA 4ZANA 2JD2A 5LLTA 1P18A 3T3OA 1VYHA 1N57A 4LECA 3EG5A 4QG7A 3IRUA 4QWWA 2QIOA 4XWTA 4DJTA 4WLEA 1TAGA 2RH5A 4B8ZA 1SVOA 4OJNA 4XVHA 3EZFA 3Q1LA 4JB2A 2GFQA 3EK2A 5CT5A 3DUFB 4DDKA 1V1RA 4RPLA 3H16A 1PJBA 1T8RA 4RXTA 3VUFA 2XEXA 1DARA 4LV6A 4M4SA 4FYWA 2JHAA 5C9ZA 2K2WA 1BHSA 4GVPA 2WYOA 3DPSA 2ETVA 3X2EA 4FYPA 4LJYA 1JP7A 1E8MA 4I8XA 5WRFA 3H8VA 2M32A 1Z4OA 1ZH0A 3F6SA 5TX7A 3ZJ5A 1Z4NA 2B0JA 4TXMA 3M6VA 5UKDA 6PFKA 5GVSA 3ASYA 5TJ9A 5TPWB 1WA5A 1XV5A 2WAYA 4B6SA 4Z4HA 2JARA 4GZMA 4RKQA 5C81A 3ADPA 3CRQA 1N5KA 1EI9A 2PU5A 3F6CA 1QNFA 2O1WA 4UPDA 4AFNA 3OPYA 1TO2E 4UARA 3EXEA 2INGX 4PR0A 3HL0A 1BN6A 3A1VA 5AVUA 3DT8A 2OPHA 2JAWA 1P3Y1 3R0XA 4ARAA 5BN4A 1M8FA 3F97A 2ZE6A 2H4JA 4QDTA 3ZDYB 1OCEA 2BPOA 3PK0A 4D4HA 4CLRA 1L8LA 3TNDA 3KVVA 5TEWA 5A2QA 1EHYA 3DBHA 3PZRA 3FETA 3ZK9A 2A9JA 3G82C 3IDSA 3V7YA 2IBSA 3T3PB 4PLGA 3UBMA 3QPBA 2RGDA 2ZYIA 3KYCA 1TLTA 1YT5A 2DFPA 2PH7A 3ORYA 5KHAA 3E9MA 3QLUC 4FOPA 5LOVB 2VQ3A 2OVFA 5IASA 4N3GA 4F93B 3OJFA 3RU7A 3EVFA 4I5DA 1WPQA 2Z4RA 3L9WA 1YIOA 1YRLA 2F90A 2FFBA 4JNCA 3DMPA 2VOEA 3MJTA 5F2NA 1RRCA 4MEJA 4E08A 3W6PA 1JEOA 3SEZA 2EX4A 4UBOA 3CEJA 3DO8A 2Y4NA 1T24A 3FVTA 1TTQB 4NJOA 2I3ZA 1YS4A 1E0SA 3A04A 1R27A 3GEBA 1K0UA 2GESA 3RTCA 2YKGA 4LOLA 1Y5RA 3C4JA 1VSUA 3DV9A 3QFSA 4JGBA 3O93A 1ETUA 2AZMA 4B4DA 1JHRA 3DMTC 2BFCA 2RGYA 3K16A 1E99A 2CJWA 3NBZC 3NHLA 4HWGA 4X20B 3IP9A 4H3VA 3QU2A 1T5IA 4JOQA 2P40A 3E1KA 4Q3KA 2HRCA 3DE4X 2V7QA 3H83A 3Q7IA 5BMVA 1ZXBA 5HBGA 5G0WA 4YV7A 1P5RA 3W8DA 1EFPA 1WS6A 2WHXA 1EFRA 1U28A 5JVDB 5BWOA 1M8JA 2VF5X 4PW0A 4Z9AA 3TF5A 4P3NA 3OQIB 5B6PA 4GOND 3V4OA 3GFPA 3JQBC 4F4HA 1ENYA 1E3WB 4IVNA 2R11A 2HJRA 4PXYA 1WPRA 4XSHA 1D0VA 1N5IA 5FD8A 2CB9A 3VVBA 1LS6A 3LUAA 4XFDA 2NUTA 4JKYA 4I6EA 3QVTA 4IVRA 5ITSA 4IV0A 4OB6A 3QX8A 1UXHA 1GA6A 3LW8A 5DF1A 3SS8A 3W3AH 5KKNB 3C4VA 4MO9A 1HORA 1WVIA 3MIIA 1P6QA 2PBLA 5DNYB 16PKA 3ICCA 4HVAA 2AMLA 1UMBB 3TLXA 4AWAA 1CS0A 2GN0A 1J2JA 4H7FA 4BLQA 1WCYA 1X87A 1IVSA 5AM5A 1AKMA 2VTEA 2REOA 3VPBA 1PFUA 5CYPA 3GJ0A 2Q9BA 3MD9A 3RT7A 4B48A 1ORIA 2EQBA 2QN9A 3NHWA 2CYBA 3NO4A 2M1ZA 4TTIA 3M6MD 2OOKA 2Y0PA 3X0DA 3HB0A 4F5EA 1NF8A 2G9RA 2HLDD 2AFIE 2FPMA 1IG0A 1Q7TA 4I55A 1EBBA 4JFRA 2UKDA 1YTUA 4OHVA 2WSSA 4LPKA 3WA6A 2C31A 5L3SB 2CT8A 2Q1XA 3QV1A 1WF3A 5C46F 3RSFA 5AKEA 1L5OA 3FPEA 2E1RA 4HBZA 3T5AA 2AQIA 2QDXA 2R6CA 2WR8A 5EIAA 1K68A 5I7WA 3NNSA 5JROA 3D1LA 4B46A 3O1LA 1JU3A 3PNMA 4OK6A 3RSQA 3SQDA 3UKJA 1ZJ4A 3EXHA 2NXJA 2QOEA 2WPDA 4UDNA 4WLNA 3S2FA 1E1LA 3VYSB 1RBQA 2V6FA 3WKBA 4K87A 3GAZA 5IN5A 4NBLA 5ELXA 1KFKB 2ZTHA 1K98A 3IAXA 3KL4A 2ID9A 5GY7A 2AKYA 4LXTA 1X1QA 1A8PA 1ZM3A 4L0DA 5A0TA 2IPXA 2P35A 4TTAA 1VI5A 4YR7A 3A4MA 3HJHA 4WOKA 5JJCA 1SK8A 3K5IA 2ZM5A 1ELOA 4C1NA 4YUZA 2VZ9A 3NFRA 3IV6A 3QKWA 3UTCA 4MDFA 3D4OA 1E96A 3AESA 3JD4A 4D9HA 5IDQA 4Y1GA 2YN4A 3E70C 4OFZA 3ZLTA 2ZI3A 4WW0A 4S1WA 5D85A 3LBFA 4Y2HA 3VPFA 3I4FA 5D84A 1XZDA 4XWYA 4E3WA 3P9NA 4D4JA 5AKXA 2CE7A 3PSHA 1YS7A 3E3AA 3P45A 1Z73A 3BE4A 1JZQA 1X19A 5KI6A 4L8WB 1ZIYA 4PN7A 3T7RA 1QG2A 5K3CA 5LQAA 4R5HA 3HPRA 2PX6A 1VPTA 4YCNA 4RL6A 1M6NA 1KJ8A 2YIJA 4OXQA 5DBFA 4L6CA 4EATA 3AMVA 2FDCA 1GZHB 5AHOA 2JGRA 4CWAA 1W0KA 2CVHA 4MVJH 4RVCA 2ZWMA 3U7IA 1P17A 4A8JC 2FK7A 4JYZA 4NXNB 1RNLA 2YFKA 4EY6A 2ZIXB 4HJRA 3FWZA 2P67A 3RJMA 4D42A 1GQYA 4M9QA 2GPTA 5L7YA 1VIVA 4UM9D 5HIKA 2R8XA 5TGTA 1SXJD 1UBLS 2AH5A 2HJ9A 3H9GA 4FDVA 2UU9B 2NU9B 3O2SB 3Q2KA 3PE4A 1JR4A 4I1VA 4B44A 3OJ0A 1HL3A 3DFFA 4UTXA 3LH5A 4BB6A 1SWWA 1M1YA 2FQYA 4QDUA 1K4YA 4KLRA 2V5UA 2WDZA 4R1SA 3B82A 1U3WA 1SBCA 3ZJUA 1NXPA 3LX4A 4U2FA 3TTWA 3CW2A 4RCYA 1ZMRA 1AM4D 1ZH8A 2WZDA 1GVHA 3KQHA 1ZM9A 2I3BA 4F9FA 2DCUA 1MGOA 5B7QA 3P26A 3V4VB 4US1R 2QSZA 4P4SA 4U2BA 5ICFA 1LW7A 2J07A 4JBWA 3MAAC 3IIIA 4RGYA 4XA8A 1EGAA 2Z56A 3REQB 1BQ4A 3U9SA 2FPLA 3WMEA 5AFSA 4X1YA 2BFOA 2W6ID 2P2NA 4M54A 5G0SA 1GTL1 4L6IA 2FMXA 5GJVC 5TLSA 2F9FA 1QYVA 3ZV3A 3NTOA 4UE3S 4LXIA 3T0GA 4CVNA 5EGNA 4DCTA 4WCVA 2C7PA 4CNQA 2FSHA 2CC2A 2OLKA 1A88A 3H86A 5DW3A 4QUEA 2WIJA 5EC8A 4RPJA 2QR2A 4I1IA 4KQ6A 4OH7A 3QWFA 1UMKA 1UPFA 1YBFA 3TM4A 1CIPA 5TF0A 3VR4H 1ECJA 2YNMA 4L6AA 3T9FA 4YJ3B 3AGQA 1GGVA 3FLBA 1I30A 4B3GA 1EBFA 1FJ2A 2YQZA 1ZFNA 3URMA 4J2HA 3VDRA 4DJFC 4WHMA 5LMNB 1UINA 3WLHA 2IA5A 5ALJA 4NC9A 3PX2A 1RWMA 2LIVA 3HKCB 2Z3ZA 3BS4A 5BN1A 5AW4A 5KB3A 1NXOA 1ZRMA 3NALA 5FBLB 4W7HA 3KK0A 2XGJA 1ZVKA 3A1NA 3HRKA 2VHWA 4HRVA 1KQGA 2JI4A 3LIPA 3RT9A 1ZKDA 2H2IA 4GPZA 4MQFB 1IC6A 5AWFC 2D7JA 5HK8A 5K20A 5K6TA 2ZJ7A 2CHGA 2AXNA 3N2ZB 2AN5A 1PJQA 4CGZA 4N39A 1SU7A 1T0UA 4D02A 2OWDA 1O1YA 2MYUA 3PUVA 2FPGA 3N6XA 4RF5A 4UEJA 1RWPA 3AHEA 3S1AB 1OWLA 2GD0A 1G5QA 1U3CA 4AMYA 1HLGA 1PFKA 1JAXA 4JKOA 4BNWA 2JGJA 4TV9A 3G1UA 4XDYA 3BZWA 2WMYA 1HQDA 3PKZA 1U7PA 2V7XA 1E32A 1RZ3A 2ZI4A 1EWVA 1RI5A 2B1RA 3HHEA 3KLOA 1JEAA 4B17A 5K8UA 2GO1A 1A7UA 4HATA 1U65A 3JATB 5KWEA 2PMKA 1KORA 4CODB 4N76A 1SCIA 4JHLA 1IL0A 2PU7A 2CMDA 4HQLA 2B1QA 4OJQA 5C52B 1Z6PA 2LNDA 3RS4A 3AUJB 4DLYA 4AWXA 2O8DA 4MGYR 4LGMA 2KB0A 3HO8A 4AIIA 2V5AA 3I92A 3DW3X 3KCQA 2N9UA 3ZWDA 1Q7EA 1GTVA 3F2VA 3OEWA 4PM4A 3TQTA 3H1FA 4MIEA 3JYLA 1K6IA 3DTYA 1OBOA 1MH9A 4TWIA 3VH1A 1B6SA 5J47A 2Q28A 2HZ7A 3ELBA 1MAVA 1G8AA 1DAOA 1W88B 1RAHA 2H31A 5D7BA 3D6NB 2GJ9A 5D5PA 2ODAA 4EHJA 1J70A 2AL7A 2YCLA 4R1UA 2OXEA 4WZBA 4N7JA 5DPMA 3NKVA 1E4EA 1CD5A 1W2WB 4BC0A 2ONCA 2FN9A 5JAUA 4BQRA 4YMHA 3KWMA 2GRJA 1U3TA 3AFOA 1UZNA 2ZRHA 2G9ZA 1HT2E 4EG8A 1W4CA 5HWSA 1QBKC 1JQ3A 2OEPA 5CA0F 2ZR7A 3GX1A 2YS7A 3D4IA 3QE2A 4H7JA 5MN5A 3R23A 1HE1C 5ALQA 4IXDA 5AW8A 2VP9A 3EC7A 4QU9A 4EPRA 2C9BA 1LBEA 5AXBA 5JLJA 5LQSA 2VWHA 3MBIA 2WNHA 4I9NA 3CXRA 3DDCA 3IMGA 3FPBA 1XHFA 4TWZA 2Y77A 5LU8A 4TMVA 1GNTA 1KAEA 3FYSA 2H08A 1JH9A 4UEWA 3TW4A 2IELA 2WWIA 4UUOA 1GCAA 2IIBA 4LY3A 3CB2A 4G0QA 1XXHE 2NYAA 2LV8A 4ZGGA 5IF9A 3U1BA 3SQNA 5K05A 4RMIA 2GEUA 2V3VA 1KI9A 1U63A 4ZDWA 3CWCA 1YE3A 2NTVA 3MRSA 3ZU3A 2VPIA 3QF7A 1T13A 1XTRA 1TQ4A 2XCOA 2C2GA 4INJA 4WKOA 3GLQA 1NG1A 4YRBA 2PWAA 1DRWA 4CT0A 2ODBA 3UAGA 4YRGA 5FTLA 3U4MA 3WIBA 2P9EA 2XA2A 2XY4A 3IOBA 3NC1C 5CDTA 1QFYA 4RH0A 4W8OA 1ONBA 2WW8A 3IQEA 4XEUA 3UVEA 1UBGA 4OAOA 5EJGA 4HKTA 3RS2A 4J0FA 1UKCA 1QTQA 3B36A 1PS8A 3LXUX 1Z22A 1Q7GA 2ZSJA 3A36A 3LWNA 1R88A 4M0CA 5EJ2A 4JEMA 2FPPA 2I03A 3FJ1A 3EY9A 1FUIA 3U7QB 3O8OB 1P31A 2SHKA 4CIXA 1EE2A 4HAVA 2HSEA 1FC0A 2NUPB 1GCGA 4FN5A 4KYIB 2DUJA 5L9AA 3R24A 1N1EA 4CIWA 2IHYA 3LCMA 5EAIA 2ZRIA 3PNQA 4IFTA 4ALLA 1UBMS 4MW1A 2PMBA 1GTZA 4GWGA 3IJRA 2VJYA 2QE6A 1WZNA 1YCHA 1G42A 4UREA 3W4IA 1N3BA 1USGA 4ARSA 3F2IA 4O2AA 1DAEA 2FFJA 4YJ2F 3CG4A 3OC0A 5DGHA 4FK8A 4FN4A 1H3FA 2VHUA 3FLMA 1BEUB 5B5SA 1YI1A 4V0MA 3S44A 1GL6A 2CWDA 3HDVA 1DJLA 1MO5A 1FBNA 3HKDA 6NULA 1KQFA 5CM9C 1PR1A 2W9XA 3JALB 3LY7A 1XTBA 5H82A 3ZTYA 5L51A 1N2BA 3A4LA 1JAHA 1MO4A 4G0MA 5BW8A 5CB6A 3LKVA 5IZCA 5C53B 2X9QA 2J9YB 2Z5GA 4C4ZA 3M4YA 4ILEA 1ACMA 5C32A 1ZCAA 4NMMA 3RYFA 2WUGA 1N3LA 3K0CC 2P6NA 4GMHA 3IIEA 2WLSA 3SC2A 3HZRA 4CLHA 2FAXA 4TTQA 1KJZA 4UHCA 1QPZA 3HFSA 1JT2A 5J2TF 5EJ5A 2V7GA 1UPCA 3IV7A 4REMA 4RTMA 1NVXQ 4MV8A 1S3GA 1EVLA 4M0UA 4PHTA 2VEDA 3IVCA 1J2RA 5HE9A 1C9MA 5EXXA 4GKJB 2WIDA 4XCVA 4AO6A 5AIAA 2FZCA 1SHUX 3FWNA 4KGDA 3CCFA 4DCGA 4ZYZA 4L9RA 1A9XA 1AO0A 4RULA 4IKEA 2IDKA 2PQ6A 4HG2A 5DHUA 5T4EA 2D5AA 2ZAYA 2ZTUA 3S40A 4ER7A 5JEDA 1FFEA 3KD3A 3A9WA 4XM2A 2FKNA 5IJ0B 3BIFA 1BQEA 3F6BX 4JT8A 4OMUA 1CE8B 1MH1A 1EUCA 1SD5A 1WX1A 2WWTA 3L6DA 3PPYA 4TKVB 2VDMB 5AJZA 2GCOA 4BP8A 4MPDA 1GILA 2OHGA 3CSSA 2JJ1D 1GCIA 4HGOA 2C4KA 4GQBA 1B0ZA 1LVGA 2XGMA 3NH6A 4TLBA 2P79A 4ZQIA 5HNKA 1HDXA 2ZQZA 1MC8A 2QYSA 3KJZA 1ORHA 3VR4D 1X1TA 1GV0A 1QCZA 1K97A 1HO3A 2JJMA 2Q6KA 2ZEJA 1GPNA 3FRIA 3HDGA 1CW2B 4HFRA 4INOA 2IEYA 4U9HS 1JKJA 5EPOA 4WECA 3HWWA 1VJ5A 3EBLA 3VMMA 1HDZA 1REQB 2OZVA 5SYMA 4A0SA 3DFMA 1CERA 4KPEC 1PFWA 1YGPA 5DM2A 1E2QA 3T5DA 5IHXA 5SYAA 3WLKX 1DUIA 4ZAFA 4OYHA 2QLFA 3NJ4A 3T41A 3G9XA 2PLNA 2H54A 5IDVA 4S0ZA 1TT5B 4NPHA 3D3WA 5ELLA 2G0AA 3B9QA 5DM70 4PLWA 4ZVSA 1T36B 1D1TA 2CMFA 3I45A 4E5YA 5KTKA 3SXJA 3QZUA 1H0KA 4JC0A 3RSHA 2I7CA 1K0FA 3C3BA 4RKWA 4A0QA 5YASA 1VJGA 3NUZA 1FNCA 1AHNA 4UZSA 2FUG1 1T9HA 5LQNA 1JHUA 1CG6A 4YJHB 2IS6A 2FHSA 1O8BA 2ZYTX 3ND7A 1V43A 3PF8A 4MS4B 4DDVA 4ZOQI 1JLKA 5HIAA 1PGOA 3DZGA 1YJXA 3ZXUB 2XVZA 4S05A 2ZI6A 4HDKB 4HWPA 3BL8A 3C3PA 4V3BA 5I3ZA 1X1CA 3A14A 4I1UA 1B4DA 1ECFA 2ZRAA 3GLKA 4B32A 2F62A 4OHUA 4BE4A 3RNLA 2O05A 4S24A 3PRYA 1E20A 1RMQA 2HA7A 2QE7D 2ZYUX 2Z83A 3R7WB 4DTCA 2H1RA 4EJSA 4DR4B 4QXQA 1SFRA 1U3FA 1N2JA 2JLBA 2C2XA 2PBZA 3KUUA 4AN4A 5L40A 5C5DA 2B5OA 4RJLA 3DLIA 2YIDA 3QEKA 5J5VA 3KU1A 5AOAA 3K9NA 2FPIA 2NVWA 2EIXA 1K5PA 4NHEA 3I1FA 4Y9RA 4M9CA 2D4HA 1QBGA 3KE8A 2DFTA 2XAAA 5DNUA 1L1QA 4DMUB 1JUDA 1R9NA 2XT0A 4TV8F 4PC7A 1MPTA 5DOZA 1IBLB 3KD2A 4HUTA 5ALDA 2H4FA 1QGED 4FXOA 1IZ0A 1T8TA 3EEYA 5DN6D 2QTGA 1APBA 13PKA 2CXQA 2GH1A 3NOVA 2ONKA 2P9QA 3E3OA 4RHTA 2LCQA 4WERA 2W6CX 5ANRB 2YWBA 5FUXA 4EGSA 1T6NA 4IGEA 2Y99A 3WLSA 4NV0A 3BVPA 1A9OA 5BO5A 3MFQA 1KYXA 1O9GA 2BMAA 1Q7RA 5JWHA 8MHTA 2KE5A 1EJBA 5BSEA 3NB0A 3GDOA 4DIDA 3GARA 3BTSA 1E0DA 4AW9A 4AP9A 4YAKA 3L2OB 3H1AA 2DUUA 2CNBA 2VPZA 1JG7A 1GUFA 4N7MA 3VBEA 1OXKB 2QUAA 3GMDA 3ROKA 2OBNA 2FZGA 3K9CA 1XRJA 1PQ4A 4FDTA 2C5HA 3HA3A 2VNJA 4H18A 2JCVA 3BICA 3GZJA 4GBED 2OYCA 4MWCA 3HJUA 4EP1A 1O95D 4KFUA 2UXDB 4D45A 2G09A 2MDTA 4OXYA 5DZSA 5E7MA 1CFJA 3P9KA 3QPCA 3FCCA 3L07A 5JMOA 2BFEA 5B4VA 2XB4A 3B89A 1OA0A 2QMUA 5DLQC 4XYLA 4EDHA 2BGNA 1AMNA 2H63A 1OBFO 3IO5A 2XWJI 4G2NA 4IKOA 4LRUA 4ZRMA 4ZTZB 4NU8X 5LMCA 1W36B 5AYVA 2P4EA 2WHYA 4KLZA 2QR5A 1YB4A 5KDOA 5KSOA 4YT8A 1IK4A 1TF2A 1M5UA 1VLLA 2B3TA 1E2FA 2QRHA 3K9BA 3UATA 2DEUA 3GP8A 4WZAE 1W96A 1W88A 3VR3A 5LIRA 2YV3A 1JR2A 3DFKA 5HTOA 1YVRA 2Y1DA 4WZBB 1WEHA 3U56A 3CR3C 2NZVG 2GAJA 1DHRA 3N28A 4O25A 3PU6A 1FFWA 3JRWA 4CGYA 4YRAA 3UICA 3RAFC 3RSOA 1V8ZA 1VHLA 4PAWA 4DS3A 1EB8A 1PBNA 5C31A 3A70A 3SM9A 4RZIA 5BV0A 5I7UA 1L6IA 1XG5A 1T1JA 4RX1A 4A5OA 3CZRA 1NVBA 3JQRA 1WCWA 3ETDA 1JDZA 2B99A 3RE1A 4EY4A 4CEIB 3W8FA 1S4QA 2GN6A 2X0JA 4GNKA 5IRCD 5A7GA 5M3BA 4YBZA 1VYVA 1T6XA 1Z45A 2BR5A 5FBHA 3I23A 2RH8A 2MSDB 5BRNA 3UCXA 4GFDA 1LBIA 3X1MA 4BLPA 3F71A 3FYUA 3I76A 5FQOA 3LQKA 1DS6A 1YJBA 3TW8A 1X77A 3DLCA 3UUWA 2PUAA 4RIFA 4Q4HB 5G1PA 3QUCA 4E2YA 4AJ4A 5ED4A 3TZBA 3S6JA 5HZHA 1WO8A 1G55A 1YOBA 3G89A 1GD1O 1Z4JA 1J5PA 4P2GA 4W9NA 1WB6A 5DXJA 5IBRA 4O4IA 5F1KA 2WF7A 3ABZA 4KJZA 4Z4GA 1ORRA 1FPQA 2OSVA 3T1NA 2C0QA 2XMDA 2WTXA 4DA7A 2IOFK 4L8GA 2QAGC 2GETA 1H3NA 5D1NA 1SU6A 2Q4EA 4X8MA 2A84A 1T29A 3A2NA 5JALA 3C7KA 3EVDA 1DAGA 3DZHA 4ND7A 1KNQA 1I1HA 1IG3A 1ZIPA 3HYTA 1J8QA 3BSWA 3QBTA 4UPVA 1TZKA 4YEDA 1FNSA 1UOOA 2PZFA 3NVDA 1USIA 4KGXA 4UVIA 2HDOA 3OIDA 1NJSA 1XTSA 4MVJM 1Z7YA 4ZAZA 3U62A 4EY7A 1P7VA 3M49A 1NKVA 3K0HA 3LT2A 4BN5A 2DC1A 1UWVA 1I10A 3DDOA 4TYPA 2BEVB 3LPLA 4NCAA 3GJSA 3RKUA 1UZAA 2JJ1A 4EVRA 1KI8A 3NLLA 2WNSA 3L4KA 3HJCA 2RHJA 1MA0A 5AUOB 3N8HA 3TBFA 2Q5JA 3QKSA 4RKRA 1J21A 4XX1A 3VOTA 3WGYA 3COPA 3C4QA 4XPZA 4JBXA 5GPBA 1O7JA 1RM4A 2OFWA 3KJNA 1JLLB 3R7NA 1Z8HA 3P9SA 3R3ZA 1M0EA 1M72A 1OAAA 3JQBA 5AJTA 3CVJA 4P53A 1CEQA 1GPJA 3CVXA 3TD2A 3OTGA 3I6QA 4K81B 3BIXA 4ZREA 3L7MA 3RYCB 3GLGE 4KODA 3GMTA 1DPGA 1NDUA 5B1DA 1U2GC 2WE8A 4HVLA 1LTQA 2KS6A 1K6MA 4WZAA 3ZDBA 1X8KA 4HAIA 4EGQA 4DYDA 4KE7A 3IGFA 1O08A 5TV2A 4M0PA 1H5UA 3AXTA 3AC0A 1QO9A 4CV2A 3LUGA 4X6UA 3W5UA 3F9CA 2QTTA 4XYEA 3UGKA 4C5AA 1A97A 1SQ5A 1D9XA 3WQSB 2H4ZA 4QRDA 3WNCA 1K7XB 1U1EA 1WZUA 4BNZA 3VKVA 4RENA 1L7NA 2JFHA 4M21A 4IOMA 4X85A 3P2OA 4JBGA 1PV1A 3FBTA 4ED9A 4KXMA 2V4MA 3KZ1E 4KWHA 1RAGA 2A30A 1XMQB 3CEAA 3E5RA 3L8MA 1DEHA 4OVKA 1KWGA 1TYZA 3IUYA 2I6QA 3P2KA 4R8LA 4W9RA 1GFSA 1ARZA 2F6RA 3G02A 5AOBA 1QZZA 4JR1A 3VC2A 2PS3A 5AVKA 3U61B 4I50B 4IIDA 1SJ9A 1PVVA 3B52X 2O8BB 4EDFA 3PEVA 1PSDA 2H48A 2ZRCA 3G85A 5K6AA 3CWQA 3V4PB 1YBMA 3H5VA 3RK4A 3T54A 3TCXB 2ZR8A 3GRUA 1YDGA 2CMKA 4PO3X 2SECE 3FMVA 4IPTA 3M7IA 5KCMA 2J0VA 2IYLD 2FP4A 2NWQA 2EERA 3KKQA 4PAGA 5HA5A 4F21A 4HB4A 3MELA 1XQXA 2P6MA 3RYIA 1ZESA 4HLUA 3U49A 5JNWA 1CJUC 1IYZA 4JGGA 1H93A 4RPCA 1Q83A 1ESEA 1YE8A 1L4HA 3F98A 4G8DA 4IRUB 3FMFA 2B25A 2B36A 1G9TA 4GT1A 4C7OA 5KPJA 3MD0A 3NH9A 4D81A 1E6CA 4MHOA 3OESA 4YIHA 3QNWA 1Q6YA 2XOEA 1ML3A 4MEAA 5KYVA 4QBTA 1GNSA 3D31A 4NXMB 2H11A 1P29A 4HQOA 5EIBC 1QK4A 1TGYA 2JANA 3IPXA 3W3AA 4JLUA 3HU3A 3VXKA 1ULAA 1RD4A 2VYCA 2WZBA 4EMUA 3GIWA 4CTNA 2XADA 3EYAA 3SVTA 1P44A 2TSYB 1S9HA 2K5UA 1XJQA 4AU1A 2GN8A 4FHDA 1X39A 4U7PB 4BVGA 4JJGA 3OZAA 3GPLA 1SEPA 2Q50A 1U6KA 2I6TA 3ZVLA 5HFAA 3ZE0B 4CR6A 2WIAA 3I0MA 1O2DA 4A0FA 4F3CA 5IT0A 2PX2A 4P4TA 4ZKDA 1OROA 5AO9A 3FG9A 4M7RA 4QEDA 2Y92A 3ZXXA 5LBUA 3LK7A 3ZDXB 3N8DA 3C14C 3BJMA 3NTXA 3RRBA 1T8YA 4WY8A 1VSVA 2OHXA 3CNEA 2LZ0A 1V39A 5L45A 2ZROA 4BVFA 1IDN1 4D8VA 4X65B 1I9GA 1Z6YA 2H52A 2QSYA 3MBOA 3S2UA 3MUNA 1H66A 4UBMA 5BXQC 3TTSA 3IT1A 1ZI8A 3Q3GE 1GNLA 5K3OA 1HT3A 2VKQA 3HJTA 1NW5A 1T6ZA 1WMAA 2G4LA 3BSSA 1KVTA 3DBHB 3MAGA 1Y89A 3SM3A 1DZ3A 4HYQA 1Q3KA 3L3BA 4NPCA 1NHGA 1XJWA 3A6HA 1RQ2A 2DVMA 4LSGA 2EFEB 5BMVF 1IHPA 1LJLA 4ZTUB 2O3RA 3DZJA 4RABA 4N7RA 3SLRA 2PX8A 3TI7A 4XVCA 1IIBA 3DH0A 3ZWOA 2GZHA 3FI0A 3ML1A 2YFHA 4FCTA 4JDUA 2NO5A 1WSDA 3HWX1 2ZG6A 4FI3F 1MG5A 4L75A 1IN7A 1WV0A 4RV5A 1MHPA 4O4HF 5B3AA 5KVSA 2DBVO 3C3DA 3GN1A 2HZBA 1HNNA 5BSHA 4JI6B 1H2XA 2GAOA 3TSCA 1V4NA 3P19A 1RWBA 4OUKX 5IXYA 1ADFA 3LK6A 5AUPB 4W6ZA 2VDWB 1O8CA 2AYZA 2P62A 3PDIB 4GD3Q 2VJOA 4MV6A 4PLCA 4RXMA 4IQ4A 4NOKA 2HQSA 1B76A 3WFZA 4N3BA 4QPCA 4QBGB 3WY9A 4KMMA 3IHTA 1T5OA 4TQGA 4Z9XA 5CURA 3THYB 1Y4SA 3H7IA 1O96A 5KBYA 2RAVA 5IM5A 5FOWA 1T35A 2IFTA 3HZOA 2BKUA 2CDAA 1LF5A 4FT4A 1JG4A 2Q21A 4KOAA 5AM2A 1L5FA 2XR1A 4ZC8A 1W581 1YWGO 1WW8A 2JIPA 4PQYA 2GZ3A 1TX4B 3C16C 4N0MA 4RQAA 4ZT6A 3FLEA 4D25A 4LBWA 3RW9A 1NE7A 2NV6A 2IXAA 2XJ9A 3RSZA 2FGJA 3OPYI 1FJXA 2NU6B 1AQ6A 1SA0B 4J0KA 1E2EA 2WPDD 3IUQA 1C9JA 1T0IA 4L4SA 3VJLA 2IZ1A 4L08A 1N77A 4U63A 3DA8A 5JYDA 4QM6A 3AEYA 5AK0A 3H9JA 4B8WA 1XZJA 1TD1A 1ZYUA 2XYPA 2NVBA 1KBOA 4HNRA 4RZHA 1N0WA 1VCIA 3EGDA 4MQ6A 1F6BA 5CVDA 5IC5A 4EA9A 4DKXA 2AKEA 1R0SA 2FH5B 4H7HA 4M53A 2ZT6A 3IL2A 2A78A 4LF8B 1N6IA 2J45A 3QELA 5KOHB 4DSNA 3KLMX 1NNSA 1NRXA 2W2KB 2YRWA 3EIUA 3HO6A 4OMDA 3V34A 1DTWB 2D59A 1Y5MA 1YL6A 3ZLJA 3L0BA 4A0RA 3S3TA 3T99A 4DPLA 1GGFA 4BE9A 3ESYA 3LPDA 1CEYA 1ADBA 2YV2A 5H02A 4DLLA 1E1QD 2W58A 2PUJA 1LY1A 1MR3F 1TMGE 2X40A 2NNLD 1SUEA 3IOEA 3ZU5A 3EXHC 1YDWA 2Q5CA 4RELA 2ZJ5A 3SQLA 2UYCA 1SZDA 4ZVNA 5TJHA 5LYJB 2NMVA 1M73E 3H1PA 3TOCA 1JJIA 1L8QA 4FIDA 5FR2A 1CQIB 3GVXA 2QL6A 4RZXA 1NA5A 1FCJA 2VXBA 2CHUA 1YNSA 3G59A 3SZOA 5C51B 3H1BA 2XE6A 2A9QA 1IHXA 2QORA 4PE5B 3UB3A 3X1WA 2WWXA 2JCGA 1XA4A 3PCTA 1ECCA 4D43A 1U2EA 2B4RO 3DDHA 2B5VA 5F1OA 3J81A 1DWQA 2H59A 1L5RA 4B7AA 1SC4A 2FDXA 4UD2A 2A9RA 3M5DA 3AL3A 4KUEA 3LT4A 2I6GA 1Y1LA 4MVXA 4PRZA 3SU8A 2W2XA 1P1JA 2R6AA 5FOQA 1Q16A 2O57A 2EG9A 1DRKA 1UXJA 5DN9A 3NRJA 4XDHA 3SBXA 4CKZA 3REOA 3Q11A 4DABA 2GEBA 2Q99A 1QH1A 1I6KA 2WU4A 3OFVA 5LLSA 4A6EA 1Z8NA 3FMGA 4RWEA 2O0JA 2IYWA 1WDMA 3WADA 2UYQA 3A4TA 5BV7A 1IONA 3PGA1 1NZDA 2WKSA 4KFSA 5DOVA 5EIBD 4BQFA 1AJEA 4DCPA 1RWXA 4KYUA 3Q0EA 1WETA 3EVNA 1Y3IA 4KO8A 1GV1A 4KVAA 5CR9A 3ZUPA 2ZB2A 3PIRA 4NH0A 1PT9A 1C0LA 4UNQA 2XRYA 2VI5A 5LZ9A 1C8KA 1XVLA 1IHUA 2JC3A 3KJEA 3OIVA 5F9MA 3OQVA 4MR9B 4AULA 1I80A 1MNQA 3JAWA 4KK4A 3SGLA 5IH7A 1NMYA 3EXAA 1QQAA 3N6VA 3TZKA 4LX0A 2QSUA 3X1YA 5E6UB 1G8PA 1PL7A 1SCJA 2HSDA 2ZIAA 3GMIA 1N5RA 1TFUA 1IDOA 4LSMA 3UJPA 1LRLA 2XQGA 3KVYA 1I9CA 1QSGA 1E7WA 1FNDA 1SRQA 2XCUA 4I2VA 1EFTA 1GPYA 1KYTA 3PT9A 1M54A 2H2GA 2GK6A 2L19A 3TRKA 2P2ZA 1RJDA 3AU8A 4GC5A 4I9UA 3KYJB 1K06A 4JH0A 1ZGCA 4MDHA 3RANA 1BDIA 2GCIA 2YXNA 2Q7OE 1YFKA 4JC5A 1Z25A 4DWOA 2XWQA 3D2CA 3GZNA 3LPCA 3G1WA 1E2GA 5KYUB 1D4AA 4EEZA 3PJRA 1TW3A 1K2WA 2GXSA 1IEVA 2IDZA 4C7BA 1XQ6A 3PUJA 5J40A 3U44B 4YCJA 2Y9MB 4L5IA 4KO4S 4J0IA 4YP7A 1TQHA 1SWVA 2X1LA 4GYYA 4X71A 3VKUA 4KR2A 2HLPA 5CG1A 2X77A 2JGLA 3E3LA 1N7IA 5J23A 3HCFA 3S0JA 1DTSA 1M3SA 1YFZA 4HUQA 4PSKA 2MMGA 4D8WA 1E5DA 1KH3A 3QUSA 3UAVA 2ZSAA 1T9BA 4Q7LA 2Z58A 2HA6A 3GZTB 3KYDB 4N49A 4Y2JA 2HGSA 1V9CA 4EG4A 1KPIA 3KKKA 4J03A 4LPSA 2J7PA 3L0YA 1EAYA 4WOPA 1P75A 3X1XA 1J49A 5HRCA 1QQ6A 1YQEA 4GW3A 3TRFA 3ZJTA 4PZUA 2VRCA 1RADA 4Q9NA 1A04A 3AJAA 3RV3A 1OC2A 2C3MA 1VL6A 4DIBA 2I8CA 2B8WA 3R09A 4A6XA 3SFZA 1TADA 1VG8A 2QT0A 3OZGA 1AA6A 2O7SA 2CXXA 3L0PA 4MGKR 1M66A 3BWEA 1NYQA 2BAGA 3AF4A 3ZGZA 5AJUA 1L4FA 2X15A 2BE7A 3VR5A 3HKBA 5G40A 3JQQA 5C8VA 4YJ3A 4HNGA 3AX6A 4LA4A 1DSSG 2X4IA 1MO6A 3C5CA 3TZEA 2ZULA 3OOEA 1EE9A 1N2CE 3GIDA 4IL5A 5CFPA 1WBBA 2ZAMA 4PYRA 4DRXA 4AN0A 1AKNA 1R8SA 2P9HA 4NV1A 4TTVA 3FSGA 3GUCA 3DYIA 2P4HX 5DGDA 1YI0A 2BISA 3GQBB 3RBXA 1KHHA 3TOVA 3E4CA 1GDHA 2I67A 3JAKA 3RYIB 4BKQA 3AONB 3K2QA 3KSUA 2C97A 4A6DA 3PICA 4F3TA 3WHIA 1US8B 2NO6A 4M3NA 2DCMA 2VHVA 1U0NA 3TE6A 5LKAA 1JHMA 2OFPA 2Q3DA 2WMNB 4BV9A 3BMQB 4QYIB 3TNJA 2KBFA 2GK7A 2H7CA 4I19A 1ZINA 1PFVA 1I2CA 3TSYA 5A2GA 5IZCC 3DEIA 1P74A 2RC6A 3S1AA 3EY4A 3DYVA 3L1IA 2AFHB 2ZVQX 4IUDS 4EWLA 3KHKA 3OZ7A 4DCSA 4K3VA 2Z4TA 3KSMA 1J7KA 2TMYA 3SYLA 2NSDA 4BMYA 2QQ0A 5AW6A 2MSEB 4BX0A 3MB5A 4EF4A 4QDZA 3S28A 2HK8A 2O2EA 1JYEA 3AY0A 5KOJA 1OT3A 1RTTA 1XEXB 2XWBF 4Y7DA 3ZU2A 4MIKA 3PR3A 4WK0B 1TKRA 3BIWA 2RHDA 2DTDA 3R7AA 2FWAA 1W4BA 1ZAKA 3FZQA 2WP8J 4FQ8A 5CIYA 3WV4A 2IF0A 1KJ9A 1NU6A 2B4AA 4IRMA 4MRSA 2OLJA 4Y8VA 1LDGA 3UXYA 5KNCD 3ZHQA 1GNPA 4Q3OA 1E98A 4ZWNA 1BE8A 2R85A 3D64A 4P7BA 5MGNA 3RTEA 3Q12A 1XTJA 2ERXA 3CTMA 2NZUG 3GEGA 4Q3NA 5CFMA 4B3RB 2CL0X 1F3OA 2QP4A 3H9QA 4HX5A 4JYBA 1S02A 4LF6B 1VJTA 3D2AA 3VHRA 2J9FA 1C1XA 3V1KA 2B92A 1N7GA 2FSSA 3I0NA 5JDCA 4AJOA 1DIRA 4B75A 4Q3BA 4LY0A 1P39A 2N1BA 1ZZGA 1FFBA 1FXUA 3LPMA 4F9EA 3OP1A 3GFBA 3OEHA 5EEGA 3GJ3A 3VTKA 4A7PA 3SEFA 1V7QA 3OTQA 5CK4A 1HWYA 1RYBA 5ETJA 1Q7BA 3UA3A 4C14A 4OFXA 1F1JA 4QECA 1A5ZA 2ZZMA 2VUTA 3G0HA 4E2XA 3BEOA 4Y6RA 1BH6A 1K08A 4BTLA 4G89A 3RUFA 1WZCA 3CMMA 3D1JA 2LW7A 2MINB 1BSVA 2A35A 2BH9A 4OXIA 5I51A 1M0WA 1MORA 3D2BA 1PLLA 2MSKA 1DIHA 3T5TA 3VTZA 1NRIA 1YK1A 1GAJA 2Q0QA 4GPIB 1A96A 2GZ1A 4K6MA 3VSAA 3W1WA 4XQ9A 4RMJA 3FFTA 3W5HA 1YBHA 2ZI9A 4JVNA 4JC4A 4TRNA 5EN4A 3S55A 4Z2AA 1H4QA 1TVEA 4YHBA 5AKLA 1Y8ZA 5AJVB 4LYJA 2ZCUA 2W00A 5JMPA 5LZ4A 1UQUA 4PIMA 1VDZA 5FO0A 3BRWD 3IUPA 4RVDA 3GDWA 1L0BA 1SXJB 2CLFB 4G4GA 1SBQA 3E9CA 4Q15A 3S2ZA 1ID1A 3RVNA 1NDHA 3C8ZA 1J8DA 2VWQA 2YR0A 1SKQA 2ZS8A 3VR6A 4HDQB 4KQ1A 4Z54A 4Q4JB 3K73O 4PICA 2IYOA 3TQOA 4UUAA 2VT6A 3M83A 2UDPA 5L8VA 1DOAA 1URPA 2HCRA 1BE1A 3IAS6 3VR5D 1U5AA 1UBEA 2E55A 1L3BA 3KZOA 1W6RA 3G2KA 4FGJA 1X7ZB 2F3TA 3OVMA 4LJ7A 3WS7A 4XWOA 2DPLA 1AY0A 5IWCA 4A2PA 4EBFA 4WT7A 3D3KA 3M34A 1NR1A 3LVFO 3SQXA 1U0GA 2PZMA 5DBGA 1L1EA 3KTFA 3O8OA 2LDXA 3CPHA 1WZ2A 1EUQA 1XKTA 1BHQ1 1OXTA 3GFTA 3WIVA 3AJ8A 3LUCA 1P4JA 1EVJA 5AVTA 2VPYA 3BQNB 3ZCUA 3JASA 3O4GA 5T4FA 4MO2A 3KQMA 2JK0A 4D2IA 3PNOA 2HSJA 1XMOB 4QTYA 3IEXA 2AQHA 3MUOA 1KZYC 3P0JA 4KPUA 4CCAA 2CL6X 4P36A 2CLLB 2Q6IA 6YASA 2GA9A 4P0TA 1UBCA 4BFUA 5AVQA 1Z4IA 1YAJA 2PRJA 2QXYA 5EQFA 1V8PA 1GUDA 5E6SB 4LQLA 1GL9B 4UDYX 1AXEA 3ZHXA 2LCFA 3NDIA 3NEYA 1NVMB 3ZDEA 4ZCTA 2QTZA 4N5MA 4WXRA 3QSGA 3P2MA 5AT1A 1XWFA 4LJKA 4OB8A 3OPQA 4C43A 3NHKA 1OWPA 1Q5PA 4KU4A 1JSZA 2W4QA 1W75A 2EW2A 3GUZA 4F38A 3WQBA 2IUSA 1E94E 2PV0A 1U3VA 1YDHA 2C96A 4QREA 4R9VA 3WA7A 3TPFA 1Y8CA 2M6LA 2IGTA 4BFYA 5JBQA 1J97A 2WTUA 1V16A 1OJ7A 2IW1A 2IEAA 3SC2B 4ZJZA 1G5HA 1DIBA 3CZAA 3LZDA 3L7JA 4G1EB 2V6JA 1HZZA 2M6SA 4HNAB 3VZBA 1W25A 1BNCA 2IYXA 3ZZUA 4BVBA 3OQJA 3PNPA 2H6EA 3C41J 4K8RB 4KX5A 4L0QA 4HBGA 4RA9A 5C8DA 1T9DA 3E8MA 4TRMA 3V1UA 4V38A 4NOMA 1PLJA 5AVYA 3U5TA 2BUCA 3ZWQA 3G0IA 3K0AA 4UHJA 3O2NA 1PGPA 1GKIA 2D1FA 1RFLA 1RABA 4HPJB 4LSWA 4R1LA 4EK9A 3TBKA 4G56A 4E1VA 3BQMB 4Q82A 4TZKA 1FY2A 1GAQA 3IOCA 3FD8A 2PAAA 4WK6A 5HKKA 2ETXA 5EVJA 1UDRA 2HGZA 2XMCA 1GPUA 3OC6A 3BZUA 3R4CA 2DG2A 5AI5A 4FGZA 2FXIA 2Q3JA 3A6FA 4P8RA 3M1LA 1ODSA 3ZNPA 3AF1A 5IYZA 2H17A 5JYBA 2W90A 3QHPA 2BELA 4PR3A 1Z3CA 2OZLB 4ZT7A 5IKMA 4BXOA 2V7EA 4DEVA 2VDJA 3JYPA 4ZV7A 4AZ0B 4JKIA 5IAAA 3CNOA 2E49A 2PS0A 2WHEA 5JH7F 2WLTA 1G7CA 1HKUA 4UEKA 1XI2A 4WKPA 1FFYA 1WJGA 4AJHA 4LC0A 4ME6A 1ZL2A 1PWEA 1REQA 3OMWA 4FZ5A 1KEPA 3KWLA 1ZBQA 3F5MA 1GR0A 4ZV9A 3AWDA 3QWAA 1ONNA 4ZC1A 2MSWA 1T3LA 1VGRA 2YJ3A 2ZS9A 1JTEA 3N5CA 3RJ5A 1TW2A 5K0JA 4AUKA 2J0UB 1U2ZA 3QXXA 5A9SB 4BKPA 3EZNA 1WMEA 5E7IA 4IZOA 1LCIA 3BE5A 1DAPA 1FFDA 1QJCA 4ZVLA 4JN6B 2QW0X 4ESHA 3OPNA 3TZLA 3B1YA 4MV9A 4A03A 2DJIA 3GYGA 5CIQA 3S29A 2NSYA 1N25A 4U7DA 1LSSA 4Q01A 3WL8A 1PWZA 2BFBA 3OF3A 1KJQA 3ABSB 3RJTA 1L5HB 2BBWA 4WFKA 5EOVA 5LQDA 1C7EA 4XWGA 4N3CA 2PEZA 3B78A 5F3DA 3WRXA 3NJ8A 4YJHA 4DRYA 3SZMA 4MS4A 5T8KA 1LLUA 2OOSA 4JP1A 3WOHA 3GDFA 4AMGA 4EEKA 1U94A 1QYWA 4G4SO 4ZZIA 1CY7A 4QOEA 3U3XA 2WILA 2Z9DA 3Q1KA 3UFXB 3UUEA 4BMVA 2BHNA 2Q2WA 1K8RA 1VLVA 2YVAA 3CUWA 3PJEA 4AN1A 2NUAA 1JJVA 4G1VA 1H3EA 3KU4A 4GR9A 1T2DA 3GLUA 2AD5A 4KRYA 2BGTA 5COBA 2R4QA 3ZK8A 2JS7A 2EWWA 4PQEA 3H2KA 3ROTA 3O4VA 1TU0A 1DV2A 3KALA 1O0BA 4MUIA 4TUYA 1T8SA 3R7WA 4ZI7A 4ERXA 3EBOA 3IPCA 1J1IA 4Q18A 1MFZA 5KUTA 3KT8A 4OJYA 4RK1A 3MWYW 3IB6A 3LQRA 4KTTE 1P80A 1ZN2A 1XZCA 4NK5A 3SIPA 1BMFD 1DI0A 1T5HX 4LXHA 5A7HA 5JEEA 1XEAA 2WSIA 5FTMA 2X19A 3ADCA 3H5LA 1QS0B 2B82A 2JI9A 3KWJA 3NJRA 2GN2A 5GOZA 3O82A 2W11A 1Y8QA 1R8QA 3O2QB 1W5SA 1NY6A 4PPGA 5AI8A 2XHZA 4B3XA 3F0TA 4PAOA 4KFTA 5TNXA 1P1RA 2HK9A 1SZJG 3LWZA 2PCJA 4I1SA 1QGUB 2R62A 2HYDA 4XDGA 3HXPA 4XB6B 4RL4A 3VR4A 4PC2A 5KJ6A 2VP3A 3RLFA 2DPXA 3KTOA 5DH9A 2R6ZA 1KL7A 2HHLA 2NAPA 4XUEA 4TQAA 4K8OA 4E2FA 3LOPA 1L5ZA 2O07A 3AR2A 3WYAA 2PT6A 5AXAA 2PG3A 2CHVA 4XM1A 521PA 2VJQA 3QE0A 1GQRA 4C7XA 4X92A 5FOUA 3ZCQA 4R05A 3UJ3X 5HKAA 4L22A 2AZ4A 3KLBA 4EJFA 4Q4DA 1G21B 1C80A 4XGNA 4WFIA 3ZOZA 4B80A 5TIIA 4RHEA 4JQOA 5C37A 4TGLA 4C6HA 2NXEA 2QYOA 3DEHA 3W34A 5EP2A 2C9DA 1NBME 1QIHA 1T15A 2GBIA 1QGDA 1ZNYA 3GELA 1XKLA 4RIIA 5B6IA 3HE3A 5ES4B 5KOJB 1ICIA 1F1BA 3RVKA 3D3NA 3MG9A 1UJ5A 2Z1NA 3JQDA 4CUZA 3Q5EA 2WD7B 2FRVA 3T95A 4WOJA 2GPAA 5TQVA 4D4GA 2BMDA 1V6AA 4DIUA 3OHSX 3R9XA 1QLWA 3EG9B 1D4ZA 2GNPA 4KCGA 5ILQA 3DDSA 4RPIA 2JHPA 3AP1A 3VVCA 1L4NA 1U5CA 1ZISA 2QMZA 2RH9B 5AM4A 1N1MA 3SDZA 4QYMA 4RLHA 3C6ZA 2WIBA 4B3IA 2ZDHA 3MS4A 3INRA 2R44A 1J90A 1JMVA 3CUKA 1EDBA 2EATA 3DE1X 1Y3CE 4II7A 2DFDA 4QE3A 4HAZA 2X9NA 3Q0IA 4CLRB 4V0OA 1VJ1A 3IBCA 3M5WA 3OSZA 4MQ4A 4PYNA 1AMUA 4QJBA 2KX7A 1EK5A 2CFRA 3K9QO 3ZHZA 4C0SA 3HJBA 2VIIA 4RZ3A 3FPKA 3QEMB 1VKOA 3A2LA 3AI7A 5B7GA 1EQUA 3NONA 2FPWA 1KVRA 2WZCA 4WOBA 1RWWA 5DX0A 5DX1A 4CEJA 4JHXA 1F0KA 2GM9A 2BF4A 4NYMQ 4MNTA 3I2KA 1AN0A 2ZI5A 1HTTA 3TJZA 2IS1A 2EG5A 3QVJA 1D09A 3T52A 2AFIA 2HLNA 4NX2A 3D0RA 4WLVA 1XMIA 4M9SA 3AKYA 1BMQA 4AF6A 5KJFA 3C39A 3IT3A 4I14A 3EMBA 4EI7A 2QUJA 3H8WA 3ECCA 5D1HA 4TV8A 1NR7A 3ZHVA 2PL1A 4DLPA 4G24A 2R751 3P0IA 4D9CA 2RHGB 1UXKA 4E22A 1YVUA 3JQ9A 4MRVA 1VCOA 2VPPA 2J6BA 4DV3B 4QEZA 1BN7A 3U6KA 4CF7A 3Q98A 5INTA 5K4GA 3ADOA 1JE1A 4O4IB 1FX1A 5SY9A 1LPSA 4MW9A 4E6PA 1B2RA 3G2LA 3LXXA 3TGWA 1AF4A 4EJ6A 4YJGA 1E9VA 3B2NA 3OFSA 3QLUA 1PZEA 4D8YA 1HTBA 3LDUA 3M2TA 5KYNA 4HNSA 4YT5A 5SICE 1A9PA 3QIAA 1XQ9A 2WFLA 1A82A 1PNVA 4R54A 2H07A 2PEYA 2ZJ6A 1FXSA 1L7EA 3OTIA 4BEWA 2PRIA 5KNCA 3HGMA 4I36A 1D1QA 4TYWA 4XLTA 1FYXA 1N0UA 3AW9A 4X64B 1Q22A 2PNFA 1WRBA 2N46A 3DE6X 4HDRB 2H7VA 4X1IA 4PN3A 1AHPA 1UKVY 4YFVA 3DJYA 1EXWA 3MK31 2GMWA 1UKBA 1E0JA 5HDQA 3SHQA 1J0DA 3ENKA 2DETA 3QI2A 1W94A 2NO1A 1OAOA 2FFAA 1GYQA 1UBSB 3JYNA 3T1HB 1XZGA 1TVCA 1U6JA 1Z12A 3G5TA 1Q6ZA 1JGTA 2PZ8A 2QD3A 4PIPA 4W5NA 5ECDA 2FE4A 5IVDA 3K0KA 4J7CA 3EUEA 4GKBA 4PLZA 3C8HA 3S2IA 2N75A 4OSOA 2CSUA 4MYCA 4BATA 1RYEA 4OQDA 2IT1A 1NP7A 2J4DA 4AMZA 2W42A 1L5GB 4I99A 1PN3A 2EJBA 4JB0A 3HNRA 2X76A 1NW4A 4DDWA 1BDJA 4TVOA 3DTVD 3ORFA 4UHDA 2P2LA 4E15A 1BYIA 3BBPA 5E1OA 3V8QA 4ISCA 3D5QA 3ETHA 4BP1A 1UKZA 2N1MA 3IQZA 3ONDA 1GPBA 5F5LA 4BLSA 2ZUEA 3C8UA 3LFUA 3KYBA 5E3JA 3OCWA 4UCXA 2G06A 3LLUA 4FSXA 4EB6B 3ZDFA 1I3LA 1MABB 4KXNA 4YMLA 3LYHA 1D3AA 1V8FA 1RI3A 2H9AA 4X94A 4EFLA 2R5WA 5GM1A 4AKIA 4EY3A 5TB5A 2XTNA 2OCPA 4P7GA 1SZPA 1NBEA 4BJ3A 2B9VA 1PKXA 1R0LA 1ZWLA 1HSZA 1V16B 1Y3DE 4HDCA 4TVKA 2V74B 5CITA 3OQMA 3UHAA 1V1RB 3LGXA 2PNJA 3ZE7A 1YAHA 2OCGA 5JUWA 3ADBA 4MITA 4TRJA 4FCCA 1JT9A 3PQEA 3FVQA 3L1HA 5E4YA 3EVZA 2YZ7A 5BQPA 1RI4A 3B85A 5JTTA 3C7TA 3G3EA 3D59A 3QOFA 4GL4A 4JODA 2AV6A 4KVZA 4YXWA 5JSFA 5FXMA 2WBLC 3AESB 3RC7A 2QAGA 3AR6A 1YR1A 3L7NA 2EGHA 2AFVA 3NWEA 5IMBA 3WWPA 1OZGA 5C4MA 1E3LA 5JSZA 2RE8A 2O8BA 1MB2A 2ZJ8A 2WFAA 1OXUA 1EEHA 1N2ZA 1H22A 2GJKA 1SG0A 1OW3B 3L7KA 1PT6A 1IUPA 2V3WA 2WE7A 1HI9A 3OZVA 1J1ZA 3Q3EA 4KX3A 1AS2A 1D4OA 1C0KA 4C4XA 3W8EA 3B8EA 1I3NA 4RTSA 3U16A 2W2MA 4FYKA 3LY9A 3CLTD 2Y1FA 3RVJA 4KKVA 2OZLA 4BNJA 3FPGA 3SSNA 2Q5IA 3I5YA 1AX9A 1H2BA 2C5BA 1VB5A 4HAUA 1P1HA 1UBHS 3PXXA 1VG1A 4XGQA 3HYCA 2BN4A 3C85A 1HYQA 1GCUA 3VU9B 2QGNA 5CFLA 4MI1A 4RPKA 3DTNA 4R1NA 1PQPA 2LKDA 4TV9F 3CFYA 3N2EA 1J23A 3V97A 1PNOA 1L4YA 1AB5A 1LPPA 1KARA 3PFWO 4D4LA 3P9RA 3D5EA 5C1BA 3AUAA 1P7ZA 4X62B 1Z6TA 2X14A 3A6ZA 4J4BA 4Y3UA 3Q9UA 3TIVA 2Y3IA 2HJGA 4I4TA 3W4KA 2QVLA 3HQ4O 4MUKA 1GT6A 1RAFA 2J0UA 2VDRB 2WD9A 2XAUA 2ZUSA 3H87A 3PHJA 2IUUA 3UH1A 3PXGA 2ZE7A 4XEHA 3NGLA 5CDGA 2DY1A 2GZAA 1XDZA 1KZ7B 2QF7A 5JTUA 1WXDA 1XTVA 3HRIA 3GZ4A 1PDVA 1RWNA 2II6A 2C61A 3QVXA 1K9VF 1JHYA 1RXIA 1RPJA 1GZ4A 2H1OA 1ZHOA 5ALXA 2IDMA 3FOCA 1VHQA 1ENZA 1KETA 2CJWB 3Q8XB 3A3PA 3CU5A 4H4EA 4FMCF 3WB2A 3EGXB 1P1CA 2R4TA 2JGAA 2F3PA 3Q88A 2BKXA 3KB8A 2CE2X 3VAZA 3ORQA 3VU1A 3H0CA 3HRHA 2ZRLA 1AQIA 3I2GA 3M4NA 5JS7A 1H0SA 2NUAB 1FOEB 1JIKA 4GSLA 1X80A 4HRXA 2OD9A 3CE6A 2E6KA 2C4VA 3LMKA 2CN1A 1U0LA 3HLKA 4RMGA 2J5XA 3O4IA 3QUAA 2PAFA 4DTIA 1BCRA 2IBMA 3NGMA 2QV0A 4LVCA 1J8FA 3O4RA 1EFRD 1M1ZA 3O26A 3PHBE 1EVZA 1E6MA 1ODCA 3CBGA 2BC9A 1NVEA 3WL4A 3FMIA 3IQDB 4NPAA 2NUTB 2P9GA 2O2SA 5JNSA 5BVHA 3RJ9A 1YL5A 2EKBA 4JT4A 2IV2X 3ICEA 4HMQA 2MU1A 1I7LA 3ZDDA 5JCOA 5DHSA 4LDZA 2A88A 3WKDA 4FU0A 4WXPA 3EVAA 1ZICA 1LRJA 2ZBUA 2GS9A 3CCCA 4QELA 3ZZTA 3RFTA 4F97A 1E4VA 3PG5A 2W7TA 4MV1A 5FUBA 1U99A 3QK7A 4HEA1 2GTPA 4QIHA 1YMQA 1HLFA 1SKYE 1WMFA 3C6QA 4U8GA 1ZHFA 2I2AA 2QZ9A 3ANXA 4G5XA 4E5DA 2UZ4A 3Q8KA 1CT9A 4N0DA 3T0IA 1RHRA 3H65A 4DLBA 1YQGA 3QLEA 3AY3A 3OX3A 2Y1KA 1T3ZA 4J1NA 2RH4A 5FIUA 5C34B 2X5OA 3E7XA 4C2AA 4G63A 5DN6A 5EJ9A 2QRGA 2ATEA 1OLXA 5KC8A 3AR3A 4KN6A 3OCYA 2RCYA 1J25A 1FFHA 4M0KA 4YRDA 5C5CA 1GAXA 1P4RA 1Z68A 2ZB3A 3E3NA 5JD5A 4B84A 5A7FA 1TLFA 4GQAA 3FNHA 3IYLW 3BA6A 4YY3B 2I55A 3I58A 4QUAA 1F2TB 1N1GA 3THXB 4BCBA 2P9ZA 4WSOA 3LUFA 1U81A 3RUEA 3UK0A 5A4JA 4CM6A 1KEEA 3HJGA 4RVUA 1SKUA 3V4SA 4LZNA 2O8DB 2VHQA 1H85A 3WE7A 1H6BA 2EFHB 1XE3A 1S3FA 1JU9A 3COJA 1EIZA 1K6JA 3AR8A 3FDXA 3DWIA 2GFIA 1L8XA 1L9KA 1Z2OX 1GKUB 4IEEA 1M10A 1QFJA 5H3CA 2FG5A 2H4HA 2ZVPX 5FFFA 4FR2A 3SYNA 1E59A 3ETCA 5DBIA 3IP1A 2C2BA 3R9IA 5KOHA 3HCCA 3I62A 5EYPA 2Q4OA 5TEVA 5H9VA 1DC7A 2J87A 3I04A 5IF3A 1X1SA 3C3JA 4HHEA 121PA 1SR8A 2YX1A 5A0VA 4MWTA 4DCCA 1T4MA 4DWVA 1FFGA 4CIYA 2IU4A 1RAIA 4ZXFA 3SHVA 3IIKA 1CCWA 1CJTC 5TS2A 3WZLA 4I4TF 3P52A 4GLFA 3IAUA 2UUAB 1BX0A 1U7XA 1A2OA 1R6AA 2QJWA 1NYRA 4G4IA 5DWQA 5EY5B 1UJ4A 1T2VA 5IDXA 2ZBGA 1CTQA 3NFYA 4JDPA 1EB9A 4FSDA 5T57A 5I8PA 1G59A 5E9JA 4PTYA 4EPYA 4JP5A 4DC1A 1TUIA 4EKEA 5FBVB 4RKEA 3HO1A 1LXCA 1KR2A 1TCVA 4A8HA 1A9TA 1NX9A 4OUDB 1ZL0A 3KFVA 4U7HA 1V71A 3DEYX 4BU1A 2PHZA 5DE3A 1CXZA 2JGDB 3ASUA 2RGCA 1ISSA 2J4FA 1G2PA 1WW3A 2ID4A 3PKIA 4FNAA 2PS9A 4EL0A 5LQUA 5A6VA 3NVMB 1LWOA 5JJLA 1W5TA 1UADA 1AQYA 3IMKA 4JI0B 3H7AA 3QP9A 4FQ7A 2IHUA 2GDJA 3NHFA 4TV8B 3PD1A 2XNSA 4IM7A 4J1TA 4JS0A 1YB6A 2NU9A 2OYSA 2PZBA 2R1VA 1V45E 2DUWA 2Z30A 3EJ6A 1LZKA 2LPMA 1JKXA 2X9LA 4DV6B 5F9HA 3WRWA 4E3ZA 5EWMA 4KLNA 3VM6A 2YN0A 2CDRA 2I4RA 1DAIA 4FNGA 4GHWA 4WQMA 5FORA 1QDLB 4C78A 3BZBA 4L9AA 3LL7A 3PLRA 1P91A 3ROPA 4NTZA 1NF2A 4XPIA 2R1ZA 3VOBA 3LNTA 3Q9NA 4BNMA 1F0YA 2P2CA 1TU4A 3R3JA 3WOVA 6GPBA 3GL9A 4C4RA 1TJYA 3V1TC 2BFWA 3HFJA 3OWXA 1P3DA 2HPHA 1IVNA 1EK2A 3WGMA 2B8NA 1W6UA 3FFWA 2PZJA 3C8MA 4G26A 4KQ2A 3I9FA 2F1HA 4D97A 3KT3A 4CKYA 1GU0A 4P4SB 3FOWA 2HA2A 1FVOA 3IPLA 1NPDA 4J3FA 5BR4A 5LJIA 4E6EA 3JQCA 3N76A 3L0SA 2VHCA 2KI5A 1Z88A 2FW1A 3NVKI 3A9SA 4MTLA 4QQNA 2TMDA 2XSZA 3N86A 3PFIA 4MLPA 4CQMA 4ZVPA 4IIGA 4NENB 4DG8A 4F2PA 3ZD7A 2TRSB 1GWNA 1A5BB 1G8GA 2WTAA 3AVOA 5B3LA 3I9LA 5CX4A 4Y9TA 1XYVA 3CF2A 3HCBA 4JL8A 5AKIA 1OAOC 5BURA 1XEWY 2PGAA 1J00A 1Y4DE 1ZLYA 2JLQA 3B8HA 3KHTA 3GFQA 2H4XA 3BSYA 3CISA 5EMMA 3U3ZA 1KFJB 5LUBA 2IV3A 1N33B 1L4BA 2W4MA 3VMFA 4NWIA 3TVYA 3WTCA 4ZK2A 1W9HA 3JQPA 1E2NA 1LBHA 3NTVA 4R6XA 1PEDA 5BQ3A 5MDHA 1B42A 3MTDA 4YP0A 3THSA 3BE6A 1A2BA 3WWDA 3SAJA 4WESB 2Q41A 2I7DA 4DRZA 2V45A 2AUNA 1K6EA 3JQGB 3PCRB 2HT6A 4OY3A 3NZEA 4UUQA 1WLYA 3UM9A 3IP7A 4Y2VA 4RK4A 3SK0A 3HKDB 4DDTA 3ZD9A 3GLRA 4X1KB 3LX8A 5L6MB 3ZWMA 3R3XA 1V26A 4M1SA 3HFRA 4DQLA 2FJ0A 2HCFA 3RU9A 2Q7XA 4RK5A 2P68A 1J8YF 3BD9A 5H8WA 1QIJA 3IXQA 2Z8YA 2O8CB 1TL7C 4TMWA 2DF8A 2VZLA 3EH1A 3B3AA 1BWSA 4C0WA 1W46A 3F7OA 3NOOA 4WDRA 1ECGA 1I33A 4NFLA 1ZSYA 5FOTA 1NY5A 2V65A 2YCBA 3EUAA 4GMFA 4Q1BA 3WG9A 3O2JA 3BDAA 4JQSA 3NT2A 4LXXA 2ODWA 5SZHB 3SJBA 1II8A 3I42A 4OHBA 3WLLA 3DL7A 3PQ3A 3GAMA 3DQPA 1FE8A 1WP9A 1YC2A 3KC2A 3P0EA 1E3JA 1NFFA 2YHIB 5EHXA 4B3TB 3A3OA 4X63A 4IFEA 3NXKA 1F5SA 2C5EA 3NASA 4B9AA 2HEIA 821PA 3ESAA 1C1DA 3AI3A 3U26A 4UXIA 5F64A 1FQJA 5KQGA 2JI8A 4GP6A 2H7XA 4Y2PA 4K3UA 4LVNA 1E7RA 3WK9A 3PC8A 4X6XA 3B6ZA 4PZEA 2QW1A 3K1AB 2R6FA 5D51S 1P0MA 4RSMA 1E1CA 3AYXB 4JJEA 3KLPX 2RGAA 2QL7A 4IV5A 4UMEA 2MR6A 5JZ9A 4L5CA 3ID6C 5AVJA 3ZGOA 2NZWA 2IKSA 4QSMA 5LM3A 3R0IA 3HNOA 1RRGA 3G5LA 4PYKA 3MHPA 2DXIA 1IHYA 4JMPA 2AIRA 2BBSA 4MUXA 3R20A 1RLJA 2H1LA 4MIOA 4OG2A 3IR6A 3OCXA 2NT3A 4QYIA 1BWRA 5TQJA 5KMGB 3MTBA 2I91A 3RJZA 1SKAA 1M2NA 1SXHA 1AIPA 2OA0A 2WICA 5KYGA 3NBFA 2QVBA 2C20A 3WDKA 3L8EA 4W5WA 5IDYA 1JEJA 3F5QA 2Q9AA 4GMDA 1NVFA 4J6EA 1AQUA 3PIIA 4DXAA 2ARKA 1Q0PA 1SC9A 4Q9IA 2SKCA 2GCPA 5HG0A 3VR1A 3GLSA 4NEQA 1VG0B 3GR6A 4Y30A 2PUDA 4MAAA 1D2NA 2PLAA 4G0YA 3SX4A 3REFA 4AZWA 5ALSA 3TNLA 1EM8A 5E4TA 1MOQA 3EA0A 3I9JA 1R4MB 4GS5A 2PX3A 1WDLA 4DGQA 3HCAA 1F5NA 2BGUA 4Q9AA 4UFNA 4CYMA 5ITZB 3ZBTA 1E6EA 2RGRA 3HC7A 3QFHA 2H92A 2FKAA 1RZRD 4PU0A 2ZB4A 5ALGA 3GVIA 3ZQJA 3VQTA 4HDKA 3E61A 1U3UA 1W4AA 5D5QA 3VU3A 3STYA 2DBZA 1EVIA 3CWZA 1G6OA 5BN4B 4ZO6A 3V4FA 2C0CA 4PXAA 5DSZA 2WQ6A 3HSSA 1MV8A 4URXR 3LFTA 2VUSA 4DV4B 5ILGA 4F2HA 5A06A 1ORVA 1WUHS 2VTVA 4ZJUA 1XHLA 4YO8A 3H8JA 4PX3A 5FUVA 3ZWNA 1DOHA 3IA7A 4S1VA 2HPAA 2NYVA 3BTOA 2PWZA 3R6GA 5JBNA 3C5HA 2FWRA 4N5DA 5BP7A 1IM8A 3I28A 1XDBA 3K2IA 1OFVA 3JU3A 3ENQA 2NW6A 2VRBA 3KSRA 3C1TA 4TMKA 2PO7A 1QGAA 1YCFA 2YVQA 2WABA 1Z7GA 4IG4A 3R7DA 2WINI 4WXEA 3ZGVA 1GPMA 3UANA 5A4DA 1EWRA 4M8NE 5LPNA 1ZVMA 2QQEA 2I1LA 1ANKA 1U8EA 2C5AA 2W22A 3B2QA 1UBKS 4W6QA 1K86A 2BZGA 3PHGA 1X14A 2GCGA 2HCJB 4OU4A 3LYLA 5DI3B 3QFFA 4PNHA 2NXCA 3OMLA 1XJ5A 2Y1GA 1UJNA 5BMOA 1COZA 2ZBFA 3WYEA 4BCDA 1IQUA 3EIQA 3JTMA 5AW0A 1YBVA 5JPDA 4LYFA 4PRYA 5FO1A 1UPUA 5JWRA 1C8LA 4H7IA 3WZ2A 5C4IA 2CLMB 2B98A 1E6LA 1NUQA 2A3RA 3OT4A 1Q1AA 2R8OA 5LDDC 3KOUA 4BDTA 5EJFA 2BGGA 1AU9A 5EHZA 1V5IA 3D8TA 3ZHRA 5HM6A 2I3DA 4BVHA 4HCJA 4EOGA 4KR3A 5EXDA