1ZOIA

Crystal structure of a stereoselective esterase from pseudomonas putida ifo12996
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
275
structure length
275
Chain Sequence
SYVTTKDGVQIFYKDWGPRDAPVIHFHHGWPLSADDWDAQLLFFLAHGYRVVAHDRRGHGRSSQVWDGHDMDHYADDVAAVVAHLGIQGAVHVGHSTGGGEVVRYMARHPEDKVAKAVLIAAVPPLMVQTPGNPGGLPKSVFDGFQAQVASNRAQFYRDVPAGPFYGYNRPGVEASEGIIGNWWRQGMIGSAKAHYDGIVAFSQTDFTEDLKGIQQPVLVMHGDDDQIVPYENSGVLSAKLLPNGALKTYKGYPHGMPTTHADVINADLLAFIRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords esterase
publication title Stereoselective esterase from Pseudomonas putida IFO12996 reveals alpha/beta hydrolase folds for D-beta-acetylthioisobutyric acid synthesis
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Hydrolase
total genus 107
structure length 275
sequence length 275
chains with identical sequence B, C
ec nomenclature ec 3.1.-.-:
pdb deposition date 2005-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zoiA00
5LZ2A 1W1IA 2VSQA 4CCYA 2XUDA 3D2AA 4P92A 2WJ3A 1CIJA 1DQZA 5CT6A 1J2EA 1XZDA 1XQXA 4IH9A 2BFNA 2E3JA 4H7IA 1LPMA 3DNMA 3I2KA 1A8QA 4C89A 3BDIA 2GZSA 3E1GA 3A2NA 3OG9A 2JF0A 4X6XA 2XQGA 2DHCA 5AK3A 1LPPA 4AB1A 1XQVA 5HFNA 1Z68A 2HFKA 4HRYA 1FFAA 3N0TA 5H3HA 5AKGA 4KE8A 1C7JA 2VTVA 2RGUA 3I6YA 1KU0A 2H7XA 5ALIA 3KWJA 3V48A 3LIPA 4J0IA 4KACA 2VJCA 5T4EA 1CLEA 1MNQA 3H1AA 3C6ZA 4UHFA 1MX9A 3C8DA 2OCGA 2WFLA 3STTA 1CUZA 3QMVA 3I6ZA 1WHTA 4YK7A 2WTMA 1U8EA 5LKRA 2WFLB 2Y2VA 5J3JA 5LZ5A 2QTBA 5A71A 3LS2A 3DLTA 3JYHA 5LZ9A 2B4KA 3EQ9A 3E4DA 4WJLA 2AXEA 1O6GA 4H7HA 1QO9A 2C4HA 5A6VA 1FFBA 1VLQA 3WK8A 3WA6A 1Y37A 5JYCA 4W1SA 4BC1A 5F4ZA 1CUXA 2XQFA 1CUBA 5EHQA 2YXPX 1AUOA 2I03A 3C5VA 3IULA 5A7HA 2WUEA 4X90A 4F60A 1EVEA 3O4JA 2O7RA 5E2IA 4UBJA 2QKYA 3FBWA 3QPCA 1XZKA 2C5GA 4NZZA 5AKHA 2XMSA 3N2ZB 2QM0A 3EIOA 5CW2A 4KYVA 4LYEA 1EB9A 4GHWA 5IVIA 2IIVA 2XUQA 3W9UA 4FNMA 1NU6A 4Y2XA 3O4HA 2CBGA 1UOPA 1U4NA 4UBNA 2Y6UA 3STVA 4E14A 3AZPA 2WFMA 5ISMA 3STYA 4ZRDA 1THGA 3WYNA 3IA2A 5FV4A 3STUA 3ZV7A 4DMKA 4K5QA 1WB5A 3A2LA 2CMFA 4UUQA 3C8HA 1QIHA 5CT8A 4RE6A 2AJLI 1TK3A 3IUNA 1S8OA 4BZWA 4LXHA 2I3ZA 4N5IX 1XZAA 5ALVA 2QMQA 3DJYA 4QWWA 1PV1A 3MGAA 4H35A 3KXPA 1DQYA 2JGIA 4FKBA 3RM3A 3LLCA 2G5TA 5JZ9A 2DCMA 4X6YA 1CPYA 5IH7A 1MAAA 1MT3A 1D07A 2HRQA 3D4LA 1K63A 2Y1KA 4OB6A 2I3DA 4OB8A 2HU8A 3AJAA 5AM5A 5JATA 1UK6A 1XLUA 3VJLA 1F0PA 4AQDA 1XZFA 1E3QA 5K5EA 4A16A 4DM7A 4X94A 4Z49A 4JYMA 1H2YA 2Y2UA 4HS9A 1AURA 1OXMA 1BE0A 1CUCA 2RONA 5JADA 5LKAA 1XZJA 3PUHA 5AM3A 5AOBA 2UZ0A 5HFAA 1Q0ZA 2X5XA 4OU4A 5AICA 5JAPA 4X91A 4PNZA 3W05A 4G5XA 5DNVA 1P0IA 1R50A 1LPSA 3O0DA 4Q05A 1UK8A 4I19A 3WK7A 3WMRA 5EHXA 2VJDA 4X92A 1G42A 2DHEA 5JAOA 5DTIA 2XMGA 5C8XA 4U2CA 2ORYA 3O9VA 4U2BA 1BN6A 3V9AA 4J0JA 4UBKA 5AKJA 4EY5A 4WDRA 3DKRA 1JMYA 5E4TA 5SYMA 4UPDA 1ZJ5A 2QXTA 3TGLA 4DSZA 2HL6A 2IX9A 4TVKA 3PUIA 3H2JA 3VISA 5LZ4A 3JWEA 1L7RA 1R88A 2PL5A 1AC5A 3U0VA 3HRHA 1SCQA 3GA7A 5IVDA 3AZQA 2CZQA 1QIKA 4DMHA 1WOMA 1RYYA 4ARBA 4B81A 3SK0A 3KWFA 5AOAA 2PU5A 2XUOA 3G0IA 4MWTA 4G8CA 1ETHA 5AO9A 1HBJA 4UFNA 3W9BA 1A7UA 2OQIA 5DYYA 4OSEA 3ZLTA 3QITA 3AZOA 4U2GA 2D0DA 4K6GA 2I78A 2WIKA 4ZI5A 4DLNA 2V9ZA 5HF8A 1GT6A 5D3ZA 3C45A 3ANSA 1YSCA 3R41A 4DNOA 1CUJA 5FOQA 3F8SA 1YS1X 5K3CA 3STWA 2QS9A 4QNNA 4WY5A 1K6EA 3TJMA 1BEZA 1QIMA 4HXFB 2ZSIA 4BRSA 1O6FA 1QIFA 5DYTA 4EB0A 3PE6A 2OAGA 1ZJ4A 4Y9SA 3A70A 4G1FA 2WU3A 3G0CA 2VF2A 3DOHA 4N8SA 4Y7DA 1XLWA 1CUSA 5BWCA 2FJPA 4UHCA 5CMLA 3OOSA 1LPBB 1MAHA 4Q82A 2ZJFA 4J0CA 4U2EA 4BBZA 3ESDA 3W2TA 1XRRA 3AINA 3R3VA 3K2IA 5ALWA 1RWQA 1MN6A 4FFVA 4BCDA 1YR2A 4FDMA 1QIGA 3UMJA 3DYIA 3H04A 3I2JA 1TCAA 3ED1A 2HFJA 2QUBA 2WG0A 5EFZA 4Y2TA 2VJBA 4BB0A 5FLKA 1DU4A 2O2IA 1QGED 3HLKA 2QOEA 5AIBA 4ZV9A 3ESCA 3MVEA 2C0PA 2OXEA 1QIDA 1B41A 4ZXFA 4UBMA 3IIIA 3S2ZA 2ROQA 1X2BA 4HXGA 1DWOA 2VAXA 5FXMA 4B82A 2GYVA 2J4CA 2YYSA 3QMWA 3V1KA 2WU4A 1UWCA 5I9IA 3I1IA 4HVTA 5K3DA 2QRUA 1F8UA 4QDXA 5KREA 3I28A 3H17A 3NUZA 3DL4A 3PI6A 1W76A 1JMKC 4ITVA 1MO2A 1QIIA 1EHYA 2AJ8A 3E0XA 3BF7A 4OD0A 3QBJA 4RPCA 3SWWA 1CUWA 1JKMA 4QDZA 3I2GA 1FSSA 1QTIA 5CTAA 3S8YA 3C43A 3G0GA 5AI6A 4ZGBA 2OGZA 2XDWA 3FYUB 2CUTA 1FFCA 4Y2JA 1ZOIA 1H2ZA 2XE4A 4XX1A 2PKYX 1SCKA 4JH0A 4J3JA 4FFWA 2ACKA 4HAIA 5HZGA 5ALHA 5E4JA 4X00A 5KWIA 3BJMA 1YAHA 3G9UA 1JT2A 1LGYA 5D7BA 3UUFA 1E5TA 1UOOA 1A8UA 4EZIA 4MQLA 4XJVA 2ES4A 4QDTA 2CB9A 1GKKA 1K8QA 2JGLA 5CURA 4X7BA 3BF8A 3ILSA 5JD6A 4XVCA 3OURA 2QVBA 3AIMA 1CQZA 5AP9A 1N5MA 1MNAA 4BE4A 1F6WA 5ALOA 5CH3A 1BN7A 3MUNA 4MXDA 2HA4A 4G4GA 4W1PA 3BJRA 4CG1A 2Z8ZA 5DJ5A 1UKCA 4FTWA 4ZREA 2XUKA 2OCLA 5DWDA 3G7NA 4MEBA 4PSDA 3WK9A 2LIPA 5ALRA 1LNSA 4CCYB 1J07A 3FNBA 4QWMA 3KD2A 4ARAA 5JZSA 2RIPA 1T4MA 1HKHA 1L7QA 4PO3X 4C6HA 5HF6A 2HA2A 2WKWA 4N8EA 5A7GA 1ACLA 2OGTA 1DT3A 3WK5A 1E8NA 2J3DA 3MUOA 5EIHA 5CBKA 3T4UA 4W1RA 4X6UA 5DYWA 2EDAA 3VJMA 2WLSA 4G8BA 4G9EA 4BDTA 1BEEA 5IKXA 3R40A 1XLVA 1ODSA 3CCCA 4FOLA 4BAUA 2XMZA 3ZPXA 3DOIA 4AO8A 3SX4A 4X97A 4BZZA 2DR0A 4OU5A 5C7YA 4RE5A 2GBGA 5AKIA 4AO7A 4C4XA 3IB3A 2X76A 1HPLA 1VE7A 2Z3WA 1TCBA 1E66A 2XLCA 2Z8XA 4B9AA 4UBOA 3FVRA 1UXOA 1EI9A 1Q84A 3ZWQA 4BE9A 4KE7A 4MYSA 4DNPA 5AK4A 3I6MA 3AIKA 1QJ4A 2PPLA 1XZBA 1YB7A 1Y7HA 3AUKA 5C81A 5ALJA 1SCIA 1USWA 2R11A 3FCXA 3QH4A 2G4LA 4QDUA 3F67A 1GGVA 4EUSA 2OG1A 4H77A 2FX5A 5AKKA 3CN7A 3DCNA 1RP1A 4NMWA 4LKOA 1U2EA 3B12A 4UHHA 3PF8A 1XZGA 4AXBA 3IBTA 4X95A 3PF9A 3G0DA 3GFFA 3R3WA 4JYPA 2XB6A 2CEKA 1QONA 3VXKA 4B9EA 3W04A 3L1IA 4J0DA 3JW8A 2WILA 5K3FA 1MTZA 3OM8A 3RKSA 2O7VA 4YPVA 1C4XA 4KAFA 4C4YA 3H19A 1BCRA 1E8DA 4XWGA 3WJ1A 4FHZA 5EIEA 1CUDA 2W22A 2GBCA 1QZ3A 1WB4A 2VT7A 4BTLA 2AJDA 2HA0A 2XMRA 1UK9A 3BE8A 3IUJA 1QOZA 1DINA 3C70A 2K2QB 1XZLA 5FP0A 4PQEA 3E3AA 1GXSA 3VVLA 1XFDA 3V1LA 1IMJA 5AI4A 2RAUA 5IVKA 4YX9A 3WZMA 5SYNA 2BUBA 3WKAA 3VVMA 3PDCA 2VAVA 1MX1A 2O2HA 2WQZA 4J03A 3R3YA 1L7AA 1P0QA 2EEPA 1YASA 3RARA 2CJPA 4B0OA 4WFIA 2GYWA 4BP8A 3DDUA 4LXIA 1EK2A 5ALYA 3O4IA 2JGJA 1A8SA 1T2NA 1XQYA 4UFOA 3VKFA 1UKBA 1AX9A 1JU3A 1VA4A 3DL7A 3FYTA 1UFOA 4H7KA 1R4ZA 1CUFA 1H23A 3QM1A 5AHXA 5AK6A 1YA4A 4GDMA 3GROA 2GZRA 1JJBA 3QMMA 3QVMA 4DNFA 1DT5A 1J06A 3WKEA 1CUIA 4OUKX 5LYYA 4UBLA 2B9VA 4Y2SA 1XQWA 3NWOA 1NX9A 2WM2A 4HTAA 3QPDA 5LZ8A 1ORVA 2HHAA 3U1TA 1EA5A 2PSDA 3V1NA 4U2DA 3WKBA 4IH1A 4FNGA 2OCIA 4AO6A 2QZPA 3HSSA 2WJ4A 1LPNA 2ZJ7A 4K6HA 1VKHA 3NOXA 3HYSA 2OLEA 3K6KA 1ZIXA 2CKMA 3A2MA 4QLAA 1PFQA 3EQ8A 2WJ6A 2XMDA 1EDBA 1EK1A 3WL5A 3CXUA 4J0GA 1IZ8A 2EDCA 3FWHA 1XROA 3IUMA 2WIGA 4X3CA 4Q1VA 2C5FA 1SC9A 2JEYA 4H0CA 2O2GA 1QLWA 1OCEA 3FLAA 1YS2X 4A23A 3ZI7A 2QXUA 5T4BA 5ALDA 5A7FA 1VA5A 5AI9A 2XMQA 1N5RA 4KRXA 3D7RA 4AZ0A 5YASA 2RI6A 4OYYA 4N5HX 5AK5A 2Z3ZA 2PUJA 3H2KA 1X2EA 5AM2A 5ALPA 3WK4A 3FVTA 5JASA 1XRMA 1ZGCA 2H7CA 5KWJA 1VJ5A 2PU7A 3GELA 5EHZA 3HZOA 5JIBA 4C4ZA 4LIPD 3D2BA 5IVHA 1LZKA 3BIXA 3WL7A 5ALLA 2QR5A 4I3FA 5AKXA 3WQHA 1W6RA 5JALA 4B83A 4QA9A 3WZLA 2JGKA 3F9CA 2XUPA 4L9AA 3SC2A 1CUVA 4GLBA 3T52A 4UHBA 1AKNA 1TQHA 2ZYIA 2VEOA 5K3BA 4EBBA 3D0KA 4BYMA 2HA5A 1ZD2P 3GZJA 3BDVA 2OQVA 2WFZA 4PSUA 3A6ZA 4MWSA 2Y6VA 4EY6A 4Q3KA 2BGRA 4CG2A 1TCCA 2C7BA 2C0QA 4L72A 4Y2QA 1UT6A 1JJFA 4L3WA 1BCSA 2BKLA 5LLSA 5JD4A 1R9NA 2XI4A 4B80A 4G8DA 4Y2UA 1XZIA 2WUFA 2ONCA 2WG2A 3OPMA 1GZ7A 1UZAA 1QFSA 2WG1A 3VDXA 1WB6A 1JU4A 4C88A 2DSNA 3AFIA 2PUHA 1YAJA 3YASA 5LP1A 3H18A 4CIBA 4PSCA 5DTJA 4BVKA 3ANTA 1R1DA 4JUIA 4MYDA 5FPQA 3DD5A 2HADA 4FBMA 1W4LA 5AKYA 4LHEA 2GBFA 4E11A 4DMCA 1FFDA 2WIJA 1XRQA 3GUUA 1DX4A 1XZCA 2OGSA 2PVSA 1LBTA 3WA7A 4P9NA 4BATA 3G0BA 3HI4A 2HU7A 5FKJA 1QIEA 4LXGA 5AI5A 2BUCA 4GW3A 3D3NA 5AOCA 1LLFA 4AX4A 5DNWA 3C6YA 3I2IA 5ALEA 2XLBA 3IDAA 3WKCA 5AM0A 4QDOA 1ZICA 5JZBA 3C87A 2DQYA 4Y2YA 4AMZA 5EI5A 1XZEA 4QE3A 3WWCA 5HK9A 1N8SA 1THTA 3WYDA 1BU8A 3TRDA 3M81A 4IH4A 1MPXA 4Q3OA 1B6GA 4YASA 3R3ZA 3G8YA 1DWQA 3F96A 1HDEA 2WHPA 1AQLA 2GYUA 2ZYRA 3FYUC 4DIUA 1ZD5A 2YH2A 4JEIA 4EA6A 3FLBA 2WHPB 5A62A 1CUGA 3KOOA 1WM1A 1FFEA 5HF9A 1R9MA 2ZSHA 1ZD4A 4PV7A 5AH0A 4F0JA 1EB8A 4KEAA 3D5EA 4A5SA 2ACEA 3WL8A 2ZVDA 5FDFA 4FMPA 6YASA 4N8DA 1IUNA 4FBLA 3HABA 1W75A 3V1MA 5K3EA 5AKZA 1LZLA 4MJ3A 1LPOA 2RHTA 4DTCA 2V96A 3DQZA 3LIIA 3H2GA 1ZD3A 3DEAA 5ALSA 4K6KA 5ALFA 2VJAA 4FWBA 2J4FA 2FJ0A 5D6OA 5HF5A 4AMYA 2OCKA 1SOMA 2HA7A 2XQJA 1TRHA 3FAKA 1C7IA 2JBWA 2HU5A 1CUUA 1GPLA 5BWBA 2HA3A 2JIDA 4H7EA 1YA8A 2VA9A 5C8VA 5AJHA 1J1IA 2XQIA 3DKKA 5EIAA 3NGMA 2FUKA 4MQMA 3M3DA 4E46A 1QFMA 3B3QA 2Q0XA 1G4HA 4Q34A 1Y7IA 3C6XA 5JANA 5JAHA 3FSGD 2BGNA 3DYVA 4LYDA 4UHEA 3F97A 3FLEA 2BUAA 3ZLVA 5DNUA 3M83A 3AILA 5A2GA 3BXPA 2BCEA 1GPKA 1XZMA 2XUIA 5FRDA 1QO7A 5CT5A 1YCDA 4TGLA 4G9GA 2ZJ6A 5I7UA 1DWPA 2VATA 3OTQA 2V98A 1JFRA 4INZA 1AMNA 3ESAA 2V97A 4KAAA 5T4FA 2HRRA 4CCWA 1WPXA 3QYJA 4W1QA 3R3XA 4WDQA 2PM8A 4B84A 1MX5A 3KDAA 5EGNA 4J0HA 4WFKA 2QJWA 2HDWA 4UFPA 1U65A 1QE3A 5ALMA 5AM1A 1Q0RA 3WWEA 1PJAA 3R0VA 2JEZA 4KR0A 4DMFA 5ALXA 4O08A 4RGYA 4H7FA 4BTVA 5HK8A 2ZYHA 2WUGA 3W06A 2DQZA 5ALUA 1W52X 5ALTA 3WK6A 3STXA 3C6BA 2QJRA 5FUMA 4P93A 3D59A 3IUQA 4BP9A 1E89A 1G5FA 5K3FB 2XMCA 3AIOA 4BDSA 1CR6A 3CCBA 5LIPA 1ZGBA 3ZLUA 2HA6A 1CQWA 5FPPA 4M0EA 4B0PA 1WPRA 4S0XA 5K3AA 2ZYSA 3WJ2A 1KU6A 4GEGA 1HL7A 4BVLA 3PFBA 5AM4A 4JNCA 1ODCA 4ZWNA 3C5WP 1EDDA 5HQ3A 1JJIA 1NU8A 1N1MA 3HC7A 4W9RA 2PSFA 5ALGA 4NS4A 4H7DA 4ROTA 4KE9A 4EY4A 1UK7A 1EH5A 3L1HA 4GBGA 5AIAA 4UBIA 5HQ3B 2IITA 4Y2RA 3BL8A 4AN0A 4EHBA 5AKLA 4QLOA 3CN9A 3ICVA 1CV2A 4BRZA 1CFJA 2PSJA 3WL6A 4J7AA 1XKLA 5C8ZA 2B61A 4G4IA 1UKAA 4IQ4A 1LPAB 4L0CA 4M0MA 1QTRA 5CT4A 4WY8A 1AGYA 1XZHA 4XIIA 2H1IA 4Y2VA 3BWXA 4GXNA 4DSAA 5I8PA 1R3DA 4B85A 1ZI6A 1I6WA 1TKRA 1BROA 2C58A 1VXOA 2OAEA 1XRNA 2P8SA 3DS8A 1XRPA 1WHSA 4KE6A 5CRIA 4EY7A 3H1BA 4FLFA 4OB7A 3B5EA 2WTNA 4IO0A 1Q83A 2XUGA 2QUAA 1P0MA 2Z5GA 3I2FA 4UHDA 4X71A 5BV7A 2DFPA 1VOTA 3BIWA 2G63A 5AKEA 3LP5A 4QEKA 2HIHA 4BCCA 2JGFA 4DNQA 1P0PA 3Q8WA 3PICA 4Y2PA 1H2WA 1ACJA 2X8BA 4B7ZA 1VZ3A 1H22A 4M0FA 1CUYA 3WWPA 2NW6A 1GQSA 1TAHA 1SFRA 4PW0A 1H2XA 4RNCA 1VXRA 4OPMA 1IUOA 4GECA 2XT0A 3IVMA 5HKBA 2XUJA 3WI7A 1XRLA 3WWOA 3X3HA 4GWLA 2JGMA 4G4JA 4DYHA 1F0NA 1EXWA 4FLMA 5ALZA 3I2HA 3H0CA 4KAJA 3G02A 2PX6A 3D2CA 1UOQA 4V2IA 1CUHA 2GBIA 4QZVA 3QZUA 3F98A 3G9ZA 2XMBA 4BCBA 1YB6A 4CG3A 2PBLA 3LCRA 1EINA 1XKTA 4Q3LA 2VT6A 4CFSA 4ETWA 5JARA 4OCZA 2WHQA 5CXUA 2B20A 3GBSA 4F5ZA 1CUAA 2HM7A 1VE6A 1TIBA 5KBYA 3H2IA 5JAUA 2YASA 4BC0A 3KSRA 1CRLA 4AZ3A 1ODTC 4HZGA 4MEAA 3WIBA 3EF3A 3H2HA 3IURA 4D9JA 1WCYA 2WIFA 1ZI8A 3G9XA 2ECFA 2PSEA 4CIAA 4HRXA 3OC0A 3ESBA 4H18A 5CT9A 1FJ2A 1M33A 1X70A 3VJKA 3UUEA 2WHRA 3O95A 4ZV7A 3ICWA 1BS9A 3L1JA 1MJ5A 4FLEA 3M82A 1OILA 1HQDA 4EY8A 4F21A 4K2AA 3WIOA 4C01A 1DTEA 1K5PA 4J0KA 2W6CX 4BAZA 2BAGA 2XUAA 2XUFA 3WLAA 2H7YA 2OPHA 4TPKA 1IUPA 2WUDA 5D3KA 3HACA 1BRTA 1A88A 2RHWA 5E4YA 5ESRA 4C87A 3FCYA 1DX6A 4OYLA 4P08A 4IHAA 1CVLA 3P2MA 4DGQA 3FYUA 3PFCA 4KJXA 4PF1A 2QT9A 3K9BA 4X93A 1JI3A 5ALQA 4I4CA 1AZWA 5JD5A 2WIDA 5CXXA 3FSGA 4WCVA 5CH8A 3Q0TA 2AJBA 2R8BA 1ISPA 4B6GA 2H9YA 1LBSA 3HEAA 4E15A 3G9TA 2XQKA 5ALNA 3I1YA 3RK4A 3O9MA 4H7JA 4X85A 5HCUA 1G66A 1GQRA 2G5PA 1K4YA 3EQ7A 2VQ6A 2DHDA 1HLGA 4BAGA 3TEJA 3QPAA 1ORWA 1ZI9A 4BVJA 5AI8A 7YASA 3EBLA 1CEXA 2BJHA 5LZ7A 2D5LA 2J3QA 3FOBA 2AJCA 3HJUA 4W63A 2PSHA 1IVYA 1MU0A 1IZ7A 4U2FA 4CI9A 1EX9A 4WFJA 1EVQA 3HXKA 5AI0A 5DLPA 5EHNA 3WWDA 5BOVA 2JGEA 5CH5A 4KRYA 5T4HA 4AN1A 2WSLA 2XUHA 1EDEA 1VZ2A 5ALKA 1QIJA 3WKDA 1KEZA 5HKAA 4GI1A 3RLIA 3O4GA 1E8MA 4HXEB 1ZIYA 1CUEA 1GPNA 1GKLA 3R3UA 4NVRA
chains in the Genus database with same CATH superfamily
1UXIA 1IQRA 4LCBA 3EY4A 1DUVG 3BSSA 5GVSA 4BWYA 3G8BA 4TVOA 5LP6A 4CCYA 3PHLA 3IC5A 5K8TA 4G0QA 1CIJA 1DEHA 3E9RA 3VU1A 5CLFA 1XZDA 4UQLA 3DV9A 3CR8A 2YV5A 1WB9A 3IX7A 5FI3A 5EP1A 3WYAA 3BD6A 1VJTA 2D0IA 3BKXA 1E2JA 3T95A 3H11A 1TPYA 3TINA 3NETA 2DY0A 1KQPA 3DMPA 1C0EA 1FRVA 4PZYA 3U80A 4K9QA 3AHCA 2FXIA 3BDIA 4KH1A 1Z2OX 1M73E 3M1LA 1IEVA 2Q8NA 3F4LA 2WF5A 1F17A 2F90A 3ZOKA 4D4JA 5KNDA 4ETIA 5LD2B 4OHOA 3QP9A 5IT0A 2IYTA 2YRFA 3AHIA 5G1OA 4AB1A 1XQVA 2PVCA 4D43A 5HFNA 2RI1A 1X3LA 1OA0A 3H11B 2GFHA 5B3LA 1YNOA 1QBGA 1VECA 5F9FA 4GPIB 1ZA1A 5AKGA 1OGIA 5KMGA 4DUZB 2CNNA 2AVNA 3BA6A 2C07A 4CVNA 1WY5A 4LJ9A 2X6RA 2BKEA 4B4WA 2PT6A 2XRYA 1NX6A 2KPOA 3A4YA 3K5IA 1PGQA 1KU0A 1U9YA 1TFUA 2BI8A 5ER9A 5BYJA 1KZ4A 2L2QA 2H7VA 4MV7A 4A0QA 4D0RA 2YVKA 2HQOA 4KACA 4NMXB 4QOSA 4F71A 1UDBA 1V6AA 1MNQA 1BU5A 3H1AA 4UHFA 3RRFA 4E5YA 5A6SA 5F98A 3DDCA 1IRIA 1MX9A 1PDWA 3KKKA 3U3KA 3WIVA 1WIWA 4QU5A 4ESOA 4Z4FA 3D6MA 1E2QA 1U1GA 3BSFA 1PJ8A 3LWDA 1I14A 1YKSA 4R3WA 3F9RA 4BWVA 1U2QA 5LBTA 1H6CA 4PHCA 3KYCB 3OZCA 5DT2A 4R84A 4AY6A 4JA2A 1EGHA 3NBUA 3BYZA 5CFPA 2UZ1B 3T0IA 2E4AA 5ICMA 1GYPA 2GNPA 3LHKA 2HCJB 1I0LA 4YRSA 2HMUA 2I76A 4YMLA 3E9MA 3NRCA 2R8XA 3T9DA 1DX9A 3FGPA 3NBKA 5BWBA 1EGVB 5LKRA 5CDYA 2VXYA 2ID9A 4C0KA 4OLFA 4RV5A 1NMYA 4K88A 4JHXA 2VPIA 4ZO7A 3AWIA 2UYOA 4BEVA 1ECFA 4RHTA 2QTBA 3GN2A 3GH1A 4YRCA 2COKA 4CHTA 1OI2A 2NZ2A 5IK2D 3O26A 4TWBA 6Q21A 1QHFA 1EX1A 3FJOA 1Z6XA 3TW4A 2Q3FA 4P7FA 4RGQA 3RUAA 4IS2A 1OJ7A 3GGJA 4NDNE 1H6AA 1SIWA 4LOIA 4ER5A 5FH9A 2CMHA 2DFNA 1C30A 4QG7A 1DAGA 2A5JA 1FMLA 2AHRA 3GPCA 2N47A 2QM8A 3NHLA 2HLDD 4F7WA 3SC6A 3CKKA 5JSYA 3S29A 1QNFA 1VL1A 3LBAA 4EA8A 2X0IA 5LFAA 2P9CA 3BMNB 1FFBA 1VLQA 3RRMA 1VL5A 1WMDA 3ZHZA 1E6CA 1PW7A 3ZXYA 1YF3A 4BC1A 3FM9A 2AC2A 3RTEA 4DABA 5EHQA 2MSLA 2XYPA 1GPBA 3DPSA 3AEKB 1C30B 4CUKA 4Z7JA 5KYWA 3A0RB 4DCOA 5JD3A 4HNSA 4MGZR 5JXGA 2FWIA 1BS1A 1V2GA 3C5VA 4HPWA 3T1YB 1WZIA 1NUPA 2W6ID 1QAQA 1EVEA 3HKBB 3II6X 3O4JA 4OOEA 3B6KA 5D5HA 1RHUA 1GN8A 4FBGA 3E2MA 1SXJE 2HPHA 2Z1DA 4G4SO 2WD9A 3V7YA 4B75A 4D4GA 3KPUA 1GKIA 4E07A 2F8LA 1R8SA 2A78A 2NZWA 2QIOA 13PKA 1EUDA 3AFHA 521PA 3R9IA 2VYNA 5IJ0A 3QFTA 1V1RA 1GNSA 1WOYA 1ZG3A 2AF4C 4HATA 2JBHA 4ZK6A 3C41J 4I50F 1HXHA 1HOXA 3LVQE 1OAOA 1P7CA 2YOFA 4RMJA 1V5WA 3U17A 1QDLB 4KYVA 4C4OA 1KWKA 4UM8B 3AWDA 4WWHA 3UMBA 2WMOB 3R44A 1BHQ1 3FRJA 3LWZA 1GRVA 1T2FA 1UC5B 1VMIA 1EUDB 3I39X 2WWFA 2B4TO 4V0RA 3BXOA 2N1MA 3ZHUA 1DC6A 5IJ0B 1FRZA 4QUGA 2ID7A 3ZD9A 2OMEA 3SYNA 2NSDA 5HW0A 1A9OA 3ZV3A 1NQXA 4LPSA 3ZDDA 2PSSA 4S3MA 1U4NA 2J33A 3OWOA 2JLQA 1Y8QB 2Y6UA 5LLTA 3I4FA 3LMKA 3C6MA 1QMPA 2QORA 1NW8A 4YCDA 4GPZA 2DFLA 1WWKA 5HIAA 4JC4A 2DERA 4RX1A 5IANA 5ISMA 1WUKS 3TQIA 2F8TA 1CLUA 2I4NA 4ZRDA 1X9IA 1THGA 3TL3A 5ADWA 1W36B 3MMXA 1Z4PX 3IA2A 5BWMA 3KJEA 2RK3A 5A4JA 5MF6A 1JFFB 2J45A 3UM9A 3EGIA 5C4MA 2VCYA 2HI0A 3ZV7A 3CW8X 2EBUA 4K5QA 3T0GA 1WB5A 1IN6A 3A2LA 3IR6A 4DQUA 1J9GA 1JE1A 1SVUA 5EL0A 2CMFA 2AKYA 5IUNC 1IY8A 2FP4B 2X7HA 3C8HA 5CT8A 4RE6A 5BV1A 1BOFA 5GJBA 3NIFB 2XJ4A 3D5QA 4BZWA 2QDKA 2X2EA 3ZD7A 2OO3A 3UW3A 3RT1A 2M2IA 3IAS1 1WQ4A 4BVGA 5CFRA 2VJYA 1XZAA 4MDFA 1P1IA 2OCBA 2WYIA 5I7OA 3F8WA 1NW6A 3DJYA 2QP9X 1JAXA 2VUTA 5IMSA 1P4RA 5EJFA 1NUSA 1AKYA 1KK0A 2C2KA 2IZ5A 2NVBA 3CONA 3LUDA 1NKVA 3NATA 2YQZA 3KXPA 4M9ZA 5LU9A 1V9SA 2G80A 3OCUA 4AJEA 3BULA 2Z4SA 1RQGA 4QT4A 3WGIA 1KO8A 5BW4A 2X8AA 1WVIA 4LJSA 2PCJA 2FAXA 4KBYA 5BO5A 2P5TB 5JXWA 1ZS9A 2DR2A 3F4BA 1CPYA 1A9SA 1V71A 1P2SA 4YIHA 2FN8A 1ZOLA 3CF2A 5EE9A 3D8HA 1WZ2A 4HMOA 4AJ1A 4REQB 2HRQA 1K63A 5KQMA 4OBBA 1T5OA 4W6QA 4MV9A 3QJ5A 2R86A 1WG8A 4OB6A 4PLCA 5FLYA 1JDNA 1E9VA 1SH7A 1C0PA 1P0FA 3X44A 2ZWVA 3U1VA 5A9TA 4CMIA 5CPBA 5LA6B 5CFNA 4PG4A 1WW8A 3I3OA 2WJYA 3DE1X 5JATA 3EXG2 4C0WA 1M0WA 1FRQA 3M4JA 2F3UA 3ELDA 5LWHA 4OI0A 3TUZC 4LGMA 1UKVY 1XZFA 5K5EA 4AD8A 1E7MA 1FB5A 3ZUGA 4FGSA 3OZUA 2M9MA 1GAEO 2GGSA 2JFYA 2OCYC 3M9LA 4QUDA 3OOWA 3CEAA 4LZOA 4HUTA 1XTKA 1MAUA 3ONEA 3ANYB 2YY7A 1H2YA 4HS9A 3U13A 1TJYA 3F6RA 1AURA 2B78A 3ELUA 3OQHA 4I14A 1Z3CA 3OTWA 3GGGA 5DP2A 1Z37A 5AVOA 2O1XA 1NI4A 3QW4B 1CUCA 1KVRA 4I4TF 4LOHA 5D1NA 4ZT6A 1HYGA 2V7QA 1A7AA 4QOJA 3MAJA 1JR3D 4O4JF 4RPHA 4AS3A 1YTLA 3JQ6A 4E15A 4UEOA 1UEIA 1DDGA 2ZBQA 5LKAA 2PS9A 2XTAA 2ZANA 4H6XA 3GD5A 1RYEA 5AM3A 2VO1A 1SURA 4GBED 5K20A 3D4NA 2AZDA 1SVLA 1PT6A 1T15A 2H0QA 3QA9A 4HGRA 4U7JA 2X0FA 1Q0ZA 3BILA 2X5XA 3TXXA 1WV0A 5IC4A 1B0ZA 5JAPA 2WVJA 3AU8A 2ZI7A 2EGHA 3IV9A 5FQOA 2WDZA 3IJRA 4X91A 1NI4B 4B2YA 2F43B 2Q7DA 1GTMA 1F2TB 5JCOA 2R1TB 4R3UC 5AW9A 2ABWA 3OTOB 1E2FA 1ECLA 4HQ0A 4ZANA 3W05A 1I4WA 5DNVA 2HK7A 4GXTA 4TVSA 3W5CA 1OA1A 4OXYA 1DJOA 3MT0A 4QFCA 4WRRA 3ROPA 2FQ1A 3PVSA 1P7VA 1BXRB 4WUTA 2LTAA 3DOCA 2QG6A 3TRHA 1HF3A 3ZDZB 1I0IA 4EQ6A 4F5EA 1I36A 4EHKA 1USVA 5BMVA 2OHGA 1J8VA 3JQAA 3ND5A 4FX2A 4UCFA 3FMFA 3NONA 3WK7A 2DFVA 2DFKB 3WMRA 2M1XA 2IU0A 1DJNA 1G5TA 1SBIA 4RVCA 1ML4A 3BWBA 4MLPA 1TZ2A 2XH8A 4RHFA 2H2AA 3D6AA 3T7RA 3KJFA 3AVWA 4E22A 2DHEA 1L7BA 3DWEX 1SRQA 2OBYA 4QJ3A 3G13A 1PX2A 2QIPA 3KS9A 3QFRA 1L5HA 4FQ8A 2ORYA 4E5PA 3PC7A 3O9VA 1XPUA 1ID8A 4E03A 3UWMA 2G09A 2Y0DA 3U4IA 4P36A 1RBMA 5C7OO 3LKDA 4YJFA 5BXYA 2AUMA 3KCNA 4MW2A 2PZJA 3PRYA 3LUHA 5A06A 4PFKA 1JEDA 5D8DA 3VBCA 4JP2A 5I7EA 4N7BA 3DKRA 1W49A 4E13A 5KQPA 2A5DA 3OJOA 4O0LA 5E4TA 4ND8A 2JLWA 2BKAA 1IHUA 3ESYA 5BN3B 1L5HB 2F3RA 3MNFA 4LK2A 5JOQA 1H2RS 3IIJA 4LJYA 3AGQA 3KQLA 4JMPA 2YZKA 4ZK2A 1L5MA 3ZR4B 3R7LA 4C0QC 1L5RA 2KQUA 1KDYA 5BOSA 1ZCZA 3QX9A 4YJFB 4OHVA 1OU4A 1D2CA 3SLKA 1NUQA 3O38A 5TMBA 2B7LA 3TPFA 3VISA 4AULA 5IBCA 4NWIA 4C20A 5EA2A 2R6AA 1YB5A 5LZ4A 1W4ZA 4D82A 4MDEA 4NV0A 1H2BA 3CEPB 2BD0A 4G0OA 1R88A 2R1VA 4L8FA 3U0VA 1PZNA 4GGMX 3GA7A 4MYCA 3LSTA 1P7PA 3B9RA 1ZHOA 5GONA 3HCOA 4QODA 4ZICA 1QIKA 1VHDA 1YDWA 3A36A 3PWZA 2CW5A 4PWZA 2ALJA 4ZYUA 3MEQA 5TF0A 1A2OA 3WRVA 4ARBA 3NIGB 1NLYA 1X1DA 1M7HA 3HLTA 1BD4A 2XUOA 2A5LA 4EW1A 3B8HA 2K4MA 1RBYA 4G8CA 4RK0A 4B4DA 2JAWA 2QLNA 1QU2A 1A8PA 1QHNA 2OQIA 3NH6A 4L7QA 5B36A 4EVSA 5E9QA 1VSUA 1E7RA 4RO0A 1HUQA 2WY2D 3U19A 4OX9B 1KJJA 1C3JA 2D0DA 4IJ6A 5IM4F 5NLLA 2Q3JA 4K6GA 3HVKA 2G1PA 2YWRA 1UIMA 1XTBA 4LMAA 4ZI5A 1XYVA 3DZFA 2ZVQX 5C18A 4C3OB 1POWA 2YTZA 3A6HA 3K1AB 2XNSA 3ABRB 3CO0S 3AEQA 1DAKA 3LC2O 4FGWA 4LDZA 3CEHA 3EGVA 3KV3O 3VI3B 4F9FA 5D3ZA 3C45A 3FZGA 5KNDH 3UMMA 4PIMA 5M5BA 1JRLA 2YHBA 4MRRA 4WTOA 3EVDA 1QHYA 4IR7A 3OESA 3TZBA 3VKHA 3O6VA 1EA7A 1RP7A 2AOUA 2WKSA 3DHVA 1OX4B 4J75A 1LLDA 4UARA 2D3WA 1JHDA 1T0IA 2PGLA 3VAZA 4N03A 1ODIA 4YV0A 4IZHA 2D3TA 1EAMA 4RS4A 1YS1X 3CEMA 4MSUA 2G83A 1YL6A 3AEQB 4IWNA 4QNNA 1PFYA 1K89A 5CEJA 1CNMA 1BEZA 2I1WA 3ND8A 1U9IC 3L40A 4HNGA 3TOVA 2WABA 3AVOA 4BRSA 3SQXA 3BSYA 4M36A 1N7HA 3NOOA 4Z4CA 4D44A 3WB9A 1TC1A 3ODGA 1VBKA 3NORA 1QGDA 3A70A 1XA4A 2WU3A 4JGBA 5MFPA 2FCRA 1W0JD 3LGSA 3DOHA 3S2EA 1CDEA 5EPEA 3W3AA 1IDN1 3WWYA 1CUSA 1Z45A 2FJPA 3MJDA 1UPTA 4PC2A 3PTZA 4PHHA 1HM5A 4G84A 5FTMA 1KS2A 1E96A 1JI0A 1LPBB 3FRHA 3GNSA 4G1BA 4YJ3F 3FMOB 1V4BA 3E7WA 4IEFB 4Q82A 3EVCA 2TMDA 2PZKA 3FF1A 4J0CA 5H7XA 1W5SA 4YR7A 3ESDA 2XVYA 1M75A 2EFDB 3CUKA 2YYZA 3W2TA 4LMBA 1KDRA 1N2ZA 5KOYA 1U04A 4GH5A 1DJMA 5F2NA 1MN6A 2V65A 3I73A 1AQ6A 4FFVA 2F3SA 4IY1A 4PPQA 4GVXA 2J09A 3P71T 2JHAA 4FDMA 5JCXA 1BO6A 1FPMA 1PGPA 1PL0A 3AUUA 3PJDA 5ICGA 1OC4A 4FK8A 3DYIA 1WABA 1DKLA 1IJKA 1UDCA 3CZCA 4URYR 3OZRA 4MW5A 3ZJTA 4P31A 2OLJA 3L4BA 4BMPB 1EESA 2HFJA 4EI8A 2AR7A 2RKOA 2PCLA 2F59A 2VHJA 4NNOA 1RIFA 2TMGA 3QV2A 5ICCA 3IQGX 3ORRA 3UB2A 3WB0A 4DCVA 3U4QA 3DO5A 5DZSA 1R6AA 2CLSA 2VJBA 3A11A 2J1LA 1U0FA 2IYLD 4BB0A 5A9SB 1XMSA 4OQDA 3L0YA 1DI0A 1K7FB 1JQ5A 221PA 1Z82A 1QGED 3N2EA 4GOXA 2HQ1A 3RYIB 1IVSA 3VH1A 1S7GA 3EUAA 3OD5A 4WOKA 2BGMA 3ESCA 1FFWA 1GSHA 2XKKA 2FUG6 1UKYA 4Z53A 1F38A 3C1AA 1SC6A 3CW2A 1VJ1A 3E23A 2EX0A 2VNKA 3S2ZA 2UAGA 3A3KA 4ZCPA 2GN2A 2C8LA 3ZVRA 2FRDA 2DT8A 4JXKA 4Q37A 2FW6A 1X2BA 2BTQA 2GHRA 1ISHA 3AY7A 3GW8A 4NC9A 5CFLA 4YP0A 5FXMA 4BFVA 4AY4A 5EMJA 4CI0B 1IHOA 1FW8A 4ER7A 2J4CA 2EZ8A 3QMWA 2A3NA 1H65A 2VHVA 1W4AA 2ZYDA 1C9EA 1UWCA 3ON5A 2I6XA 2JK0A 3RSFA 4F97A 4MRPA 2PZEA 3KFVA 4ZAWA 3MUFA 2FUNB 3FCOA 5EYPA 1N8NA 2D2IA 3I1IA 4N3AA 3SDZA 1RKBA 3FOZA 4G1UC 1H0HA 4NESA 3V4RA 4QDXA 2BTQB 5KREA 4I5FA 4L08A 3DL4A 1NVVQ 2RBEA 2VPQA 4JJKA 2BYTA 1NURA 1FMTA 1JZSA 1IJBA 1ZM7A 2ZAMA 2P9ZA 3JTEA 1RLMA 1ZONA 1MO2A 1QIIA 3LL4A 4UEQA 3X1XA 4A8PA 4ZDKA 4KIUA 1Z5UA 3MT8A 3ZJUA 3BF7A 4OD0A 3QBJA 4FHDA 4NQRA 3TIVA 1CZRA 5DASA 2IZ0A 1T29A 1G9XA 4U5XA 4I4IA 5HMLA 3P94A 3E7FA 1PFGA 1QTIA 1L5NA 1WDTA 3S8YA 4PFJA 3KAPA 1OAKA 3Q98A 2WSIA 5AI6A 4L4SA 1HDYA 3CNNA 1ONNA 3F7MA 4D4KA 3R7FA 3WQRA 3TD9A 5A03A 2IV7A 2OL4A 2YWJA 3CV3A 2GEUA 2V6GA 5KTYA 2RGWA 5EXSA 4IYJA 5HCNA 4Z7OB 2ZT8A 3O75A 1CF2O 1MXHA 1U0GA 3JX9A 3EXIB 1JN0A 2XE4A 3NR2A 3LXRA 2IYYA 4MUAA 4DVJA 4AS2A 5JH7A 1PJ4A 1XTUA 3LJKA 1L7VC 4P5EA 3G5MA 4ZVQA 2B1QA 3FUCA 2PY6A 4WXEA 1CZKA 1T0PA 5TJHA 4B6RA 4LBWA 3SVLA 3K0CC 1SD5A 3BD8A 4IMPA 2WZQA 4OBEA 3HN6A 4J3JA 3MRXA 2DT5A 4M54A 1KVSA 4N18A 1EBFA 3GQVA 4CCSA 1MQSA 4BNUA 5K8JB 3NXSA 4K6FA 3SOZA 1M76A 4U2KA 1E1YA 4HAIA 5AJXA 3PDWA 4XGNA 4JC8A 3PD0A 3GEPA 5JH7B 4DL9A 1HFWA 2ZJOA 4LZJA 5GVRA 3TM5A 5BSUA 4DREA 4E4RA 4JI8B 2FJUA 1GRRA 4MVJG 1YAHA 5KWSA 1U94A 4KNVA 5E1OA 3FSEA 1DAEA 4R8LA 3VZDA 5KYXB 4G56A 5C5EA 2CL7X 4YMSA 3GT3A 1R0WA 1JT2A 3U7FB 5EXEA 3VI4B 1X7GA 2WTXA 1NXWA 3WICA 4OFBA 1N0HA 4TV9A 4XWTA 5KYVA 5DM70 4HGOA 1AF4A 4CM4A 5GWXA 1ABBA 5JWHA 1UC8A 2ZPAA 4XJVA 1Z22A 2RI0A 2VWQA 4OBXA 3E35A 4YHBA 4JI6B 4QDTA 2CB9A 2WZBA 2Z9DA 1GKKA 3DFMA 2A3RA 4XVHA 4KIGA 5CURA 2AR9A 2XCQA 3BWMA 1N2BA 3D8SA 3ILSA 1AKUA 4DA7A 4D9HA 3ZX5A 1C2TA 1CJSA 1GZ6A 2G1UA 1CP2A 1HDGO 4B6OA 2QVBA 3DW3X 4G1CA 1E5VA 4L9SA 4QFMA 3IQEA 4EI9A 2BEVA 4G2TA 2G7ZA 1PJLA 4LOLA 3JYNA 4RZIA 5TY0A 2E82A 1SIUA 1Z8NA 3O1IC 1PG2A 1CQZA 3AGPA 4K6CA 2M6SA 3FHJA 1I6MA 3BL6A 3ZK9A 4DB2A 4II3A 4YRFA 3N86A 4LVCA 3KU1A 3L9XA 1PT7A 3T35A 1TA4A 1UBCA 1V11B 2GEFA 5ALOA 3AP2A 2YVLA 4EPXA 4RACA 1AMUA 4G67A 5FWDA 2ZYGA 3BVPA 3C3WA 1BN7A 1I7NA 1NXSA 2MJLA 3GFPA 3KCQA 4JD5A 3R7BA 4EMTA 3MUNA 1BHJA 4IF6A 4YBZA 4ZRNA 4MXDA 2A9PA 6ABPA 4W1PA 2O3SA 1ADCA 2ZVJA 3M5PA 1ZWLA 1Z0FA 1AHHA 4D8YA 3HR4A 4OHXA 4R8RA 2V0GA 5H82A 3ZZMA 3OPYA 2FOLA 2X42A 2XUKA 3CF4A 3UV7A 2XKAA 4XI9A 4QM7A 4TMTA 4EUKA 5HIJA 3A7EA 5JZSA 5JDCC 4J1QA 4XQEA 4BNTA 3R5TA 3AUFA 2ACWA 1YCFA 4Y0VA 2WJHA 1IK6A 2E4YA 2EC5A 2GEVA 4OK3A 1PQYA 3IGFA 4WZBB 1LNSA 1K06A 1RCTE 1E6EA 3WS7A 1ULBA 2NTYC 3GBVA 4ESHA 4QWMA 4P3NA 4JLKA 3SC4A 2WQ7A 1TM7E 1KFCB 2P79A 4AMGA 2Y1CA 5KOHA 1IN7A 5E9AA 4LW8A 2P9EA 1G16A 1ZD1A 5B30A 1D4AA 2BCJQ 2RIPA 3G5UA 3O3MB 3PYXA 1QYWA 1MG5A 1PU2A 2EP7A 4ASUA 2P7IA 2ZE6A 2QTGA 4PO3X 1HSZA 4ZU3A 5IMBA 1I7PA 3QBEA 3WLNA 1YRLA 3C1UA 3LPAA 4GM0A 5HF6A 2HA2A 4N8EA 5A7GA 4HNQA 3PT5A 2PGDA 3GMIA 1QYIA 1DT3A 5M04A 1E4EA 1X7ZA 4WK6A 3NT2A 4QBIA 4U4AA 3T3GA 1VIAA 2QQEA 5IHXA 1P0CA 3R9KA 1P33A 4PPNA 3GPIA 4OJMX 3TF5A 1GZVA 3PVZA 3ZI0A 4QL3A 1F14A 1K4KA 2IHVA 3EQ6A 5CBKA 1RFLA 3T4UA 2CHUA 4X6UA 3ZKWA 5KTKA 5DYWA 1FSGA 1TX4B 4K28A 3S2SA 5B53A 5A4DA 2A9OA 4GX1A 4GMXA 1GG8A 2HB6A 1X7ZB 1FSZA 4B2IA 3T3HA 2IZ6A 1C7EA 2ZJAA 1BEUB 1J99A 1W19A 2J3KA 3GNLA 4BVFA 1GGJA 2GJSA 2H4FA 4UM7A 5LA6F 1L3BA 1BEEA 4AJPA 2FWNA 3GUHA 4BDTA 2I7CA 1S2DA 5L4NA 4P22A 3ADKA 3W7AA 3IODA 3ZKWB 1TECE 4AJOA 3HXOA 2HW8A 4WOJA 2WJVA 4CL2A 5THQA 2QMOA 2R48A 3L0SA 3QTLA 3HA7A 1WMSA 4L4YA 2JIRA 2YCLA 4HSEA 4P32A 4Y6RA 5BWNA 2B36A 1GNLA 4EB6B 3O4VA 3SX4A 2R2AA 1GDHA 3WVNA 4FGUA 4BXOA 1E1CA 1SVOA 4UE6A 2DR0A 5AYVA 1W0CA 1I0ZA 2A9RA 4BZZA 3KQHA 2JFWA 2XDQA 1JLSA 1R8QA 4X41A 4AO7A 5BV2P 3UPUA 2VP3A 4E09A 3JSXA 3OSZA 3SVTA 5JBQA 3A3PA 1KI3A 1KBQA 2X76A 1HPLA 1U3VA 3MJ4A 1E2MA 1E2HA 3A27A 1JPVA 2G70A 2ZYAA 1JLLB 3ICOA 2FN3A 3RVJA 1FBNA 4QREA 1NVAA 3CG4A 2Q41A 4WZBE 5F78A 4KQ9A 3GI1A 3ROXA 2VDWA 3SS7X 3SU8A 1OW3B 1GVNB 5T57A 4QRIA 1Q84A 1H5NA 3JQQA 3ETHA 1RTKA 3TI7A 4BE9A 4XVUA 5BP7A 5IZ4A 4MA0A 5ER6A 3VHXB 3AHEA 4OHUA 4DNPA 4CEHA 1VE9A 1SN7A 3DB1A 1LA2A 4KO4S 4CN8A 3ZQUA 5HPYB 4JBIA 3B3FA 3D6FA 2PZLA 2H4ZA 4A5OA 8MHTA 1VYHA 1QJ4A 3UANA 3TTSA 5JBIA 4I36A 3AF3A 4W5HA 2QGZA 3RIGA 1Z8FA 4JA0A 2ZWIA 2REQA 1F2DA 3AUKA 3UHAA 1TUGA 2BGIA 2ANBA 2I55A 5C81A 2DPYA 5IYZA 4CEHB 4JQZA 4LN1A 4JY7A 2PWYA 3P4UA 4QYTA 5GOZA 3BHIA 3KT3A 4LMPA 4WK0B 3DZKA 3KJGA 4L7VA 4FW8A 3AJ8A 2FR0A 3DMRA 3F4KA 4X1YB 4OJYA 2VBCA 1EFRA 5I4KA 2IS1A 3F67A 1Y8CA 2E5FA 3GVHA 4GMDA 3T7AA 3QW2A 4PZ9A 1OFUX 3TUIC 1RXWA 2OG1A 2JHGA 4H77A 2IW3A 1S1CA 4MDYA 5AKKA 2REQB 1RP1A 2W6NA 3U4DA 4I2NA 4LKOA 1GTRA 4LYHA 4LNAA 1QHHA 2ZTHA 4UHHA 4I5GA 3DE2X 2VPTA 4RD6A 3NNNA 5EP2A 3UJ8A 2CNLA 1GCIA 3JQCA 4B7CA 8GPBA 4TZ0A 1DMRA 4MW6A 4P4LA 6AT1A 3AL2A 3IBTA 4JT9A 4JI0B 3M4XA 2OB2A 3C7KA 3CZPA 3KOUA 5EIFA 1JXAA 3V42A 2Q8QA 2CFTA 4QGGA 2D1YA 3ECCA 1W5FA 3FPGA 1MT0A 2CEKA 4GRDA 3K0BA 4ZCQA 2MINA 3K1JA 1RYNA 4RQUA 4RWEA 1QHHB 3IH5A 3ND7A 4WZZA 3Q3VA 3RJMA 1HE3A 3W04A 1FW6A 2XIQA 2ZPTX 4RF5A 4MUEA 3L1IA 3R7NA 1FX0A 1TADA 2DWQA 2L19A 2QL5A 3JW8A 4OFZA 3AF2A 3PRJA 4W8GA 3ZWKA 4A6EA 1ZH2A 4Y0NA 3ICCA 3AC0A 5JSZA 5BRNA 5D51S 5HOEA 4QEZA 1D1SA 4HGYA 3RKSA 2RDMA 5C52B 2O7VA 4Y98A 2D1RA 4YPVA 1C4XA 3ZJYA 2HIMA 3TZKA 4H3VA 5FULA 2JLZA 5CEFA 1CS0B 2AVDA 3QQPA 4HF7A 1U2TA 4L74A 1GQYA 2DHQA 1M7BA 4DF3A 3L05A 2JW5A 1X6VA 2Z58A 5CDGA 3A6KA 4G5QA 1TUEA 4FHZA 1V43A 2FWRA 2Q5EA 3VZSA 4EHDA 1JAHA 4G5SA 1A9QA 1PJBA 1O5TA 2AFIA 4CKEB 2I3AA 2ZB7A 4ASUD 4H4EA 2BMWA 2PD6A 3GY0A 4FU0A 1WB4A 3K9LA 2VT7A 4GLFA 3UB3A 5A3JA 5JAIA 3LGXA 2YYYA 1IBRA 1NBHA 1UK9A 4AF8A 1ZR2A 1KBOA 2I65A 4FN4A 1ZZGA 3NTQA 1Z7BA 4DWVA 4B4VA 2K2QB 1V16B 4YMWA 3K70B 3P0IA 4MI3A 4BV3A 1AHPA 1C3OA 4ARCA 2ZTVA 4HB3A 2FEAA 1FSPA 2HWWA 2B82A 2O05A 3KWMA 4A9AA 1CZHA 1JEAA 1N9ZA 1EKXA 2E48A 1JU9A 4KN8A 4LI0A 3VSAA 4B6QA 4KAXA 1RACA 5EJ9A 5HDBB 2IWHA 1SZCA 4P8RA 1DHRA 2RAUA 3KOYA 2ZTUA 1P61B 2FEMA 1B7GO 3PNLA 2YOHA 4Q1CA 3QEJA 5CUQA 3VR2D 5J5CA 3WZMA 2IQ5A 4JLDA 2IE8A 3GLFE 3T3IA 2R2GA 1VFNA 4WQMA 5BPHA 1C3OB 2QX7A 3W5DA 1GVHA 4TMFA 1E1QA 2WWXA 3R3YA 2NAPA 4YB8A 2I80A 3LYHA 1ECPA 4QPPA 2FEKA 3T1HB 1IXRC 1V5IA 2OBNA 4G0XA 4H1VA 2HXGA 4HDSA 1CQJA 3ANXA 3HY3A 3FTFA 4BGIA 4WLVA 1FFSA 2YXDA 2CJPA 1RWMA 4HBZA 3OWXA 4FM9A 1OTXA 1H4TA 2R5FA 4PHFA 1N9GA 3HPRA 4WFIA 1YTUA 3QNWA 4ZYXA 2FPSA 1O97D 3BFJA 3DNPA 3NTRA 4LXIA 4A03A 4BO7A 5ICSA 1W0KA 5DCLA 3TJZA 2YZGA 4IHJA 4LK3A 1T9CA 1KK1A 2H1LA 3DZJA 3R0ZA 4WACA 5F76A 5HWSA 2A0XA 4RZXA 3UGTA 1CRPA 2UXBB 4RVUA 4GSLA 2IBMA 2JGJA 3CR3C 4IMRA 1TJPB 4IQFA 4JQYA 4YTEA 5DISB 2AN9A 3O74A 5F3RA 5JYEA 4ZJPA 2IUFA 3UHJA 4Q1AA 4RVNA 4YWHA 4NFYA 3TO5A 1YVRA 5KSYA 3VKFA 4ZAFA 1XB2A 4C5BA 3JQGA 4EPTA 3P9XA 3GRAA 2HBRA 3TH5A 1AX9A 2WOJA 1Z08A 1JU3A 1VA4A 1AB6A 2YINC 4HVCA 2BMFA 2C7GA 3V8NA 1AGXA 4V0LA 1KYZA 1QVAA 2AHOA 1JHYA 1RLTA 4FE7A 4ZJYA 3RIEA 1LX6A 2HMVA 1UFOA 2G72A 3QHQA 4N47A 2ODAA 3E70C 2UVPB 4Q03A 1GR0A 4UZSA 4QTUB 1QR2A 3QM1A 3QUCA 5AHXA 1L3IA 4BNVA 5KTSA 1YA4A 2CN1A 1GFIA 4RC9A 2I2BA 2D1FA 3B1YA 3SNKA 1QV6A 2Q1WA 1A97A 5A4IS 1NNI1 4Q3BA 2GZRA 1SCUB 1AQJA 1A9TA 4DXAA 1L6RA 1YL5A 1FX1A 2R6DA 1VMAA 1JJBA 2P4SA 3QMMA 3U3DA 4CDMA 1UBRS 4ZZ2A 4IIYA 2ZUFA 1DT5A 1VBNA 2YWEA 4IUCS 2D00A 3IJPA 5CNMA 3VC3A 4BFTA 3L7BA 4D46A 4LCEA 4OF4A 1WL8A 4Y2SA 3TFOA 2E18A 1X1AA 3NWOA 4F9EA 5A3RA 3KK0A 4QC2A 4HTAA 1C7QA 4MVXA 1MVOA 3TD2A 1XF9A 1EUZA 1RHRA 1YMUA 2H5JA 1PR2A 4N5DA 3W8DA 2HHAA 3TIGA 4IIXA 2ZTMA 2GVZC 4YQYA 5KI6A 4ARVA 4HQFA 4YLEA 1T43A 5I3CA 2GJAA 4LDRA 1K88A 5CHEA 3V1NA 1V3VA 3BJIC 3UT5B 1P77A 3FKJA 4FNGA 2ZBPA 1C7FA 4MUNA 1JUDA 2OCIA 3ISVA 5F5LA 4AM8A 1M34E 3GLGB 1GV0A 2JRLA 2QZPA 3G8DA 4HWRA 2FZLA 5GP1A 4D9IA 1H9AA 1N8TA 4Q4LA 1WV1A 2O3JA 1LPNA 1X74A 3GCWA 3H9QA 1MQAA 4K6HA 2GAFA 4ZVLA 1R16A 4KYUA 4Q9AA 1X1TA 4YJDA 4B31A 4BZPA 4H1TA 4K9MA 2XYVA 1X7YA 5KVQA 2I6FA 3THXA 3NDBB 1FVOA 3SD7A 5H02A 3WGNA 1ZIXA 4D9NA 4W5WA 3OU2A 1K08A 4Q4AB 1O5IA 2R79A 1QBKC 1N3LA 9GPBA 2QRQA 2F55A 2FLWA 1KDVA 2ZSUA 1CR4A 3I6QA 3OPQA 2WJ6A 2FPKA 4FWIB 1RKQA 1EDBA 3EXHB 4AKSA 3OBBA 2VS1A 4IZIA 1U6IA 1OXVA 4XYEA 3W1WA 2C7RA 2YHAA 1IZ8A 1NHGA 1X7YB 1GQQA 1NRWA 1G3RA 1XROA 1I4TD 2BEKA 2G4CA 2P6PA 3IUMA 4V0NA 4QPZA 3RT9A 3W2EA 4UXHA 4ZIRB 1ZNYA 1KETA 5BNWA 1H8EA 5ES4B 4ESVA 5C35A 4HNVA 3R20A 4JT8A 4PNHA 3GLRA 4U6NA 5H3LA 5TGZA 1SIOA 1DNPA 1P5JA 2C5FA 4OHRA 3RAPR 3ZGLA 3JU3A 1U7TA 4EW2A 2XCRB 3EIUA 4GE3A 1E1RD 1X3SA 4U7GA 4JS0A 5DHPA 3SZMA 5CFQA 1X38A 1V41E 2P1ZA 4QO8A 3WBKA 4L9WA 3C3YA 3WOVA 1UJ4A 3FLAA 3RROA 2EYQA 1QQBA 4PIPA 3LBFA 2WTAA 5JH7F 2PZBA 3EPPA 3H5LA 1YKGA 4H31A 5L7TA 4MR8B 1MEOA 3H9EO 4PG7A 4ZDWA 3CY6A 2GRUA 2F1IA 3IHWA 4E88A 3OLYA 1TW2A 2ZJ1A 2XF8A 2OHXA 3SQNA 1VM6A 1HNNA 1OFIA 4UTVA 2ZRDA 3JD3A 4EF4A 3RRJA 3C3MA 4Q15A 2C2XA 3ECAA 3U0BA 3UEOA 2LDBA 2PHZA 3OLQA 1MF7A 4MVWA 3RSCA 4ENVA 4N5HX 4OI4A 2UVQA 1N78A 2DBRA 2TMKA 2ZAGA 3CLHA 4M1EA 3UC9A 4CFZA 5HHTA 1EP1B 1G8PA 4R1PA 5K45A 5GZ6A 3UAWA 4EYGA 4PXAA 1V7PC 3NHJA 5BSTA 4PGGA 1PFUA 2XCTB 1NR7A 5J2TA 1EG7A 3PUZA 4C6TB 3PXXA 5DE3A 3WISA 3WK4A 5K99A 1RWBA 2OFPA 4YXFA 1IM5A 3EDOA 4UTNA 4QOHA 1R6VA 3OQNA 1MGPA 3HDHA 3UKOA 1E1QD 1KJQA 1Z5OA 1KA9H 2RC5A 3FH0A 4MH0R 2P0AA 3SX0A 5LB2A 2H7CA 3VPDA 4YACA 2Y0EA 5KWJA 5JE8A 3GLGE 1ETUA 1XWWA 2PU7A 2TYSB 3HZOA 1DQPA 4MJXA 2MU1A 4ON9A 1LNQA 3VR5D 4MS4B 5JNSA 3WTBA 2BEUA 4EF5A 5J2TB 2ZYUX 4FZVA 2ZI4A 1L4FA 3HBMA 3HUUA 1SVKA 3IMFA 3OJLA 4RMIA 1MR3F 3T9CA 4MLDA 2OESA 4MI9A 5F2EA 1UFVA 2VHZA 4IG9A 2FDCA 3N07A 2X0KA 4UNPA 4JLNA 4Q7LA 3ZDEA 3LT5A 1ULHA 2ATXA 5LN1A 4WNIA 4WNAA 2A4MA 3ISJA 3FOWA 2F8SA 4WEOA 5EMNA 4U7WA 1NNLA 4TT3A 2XUPA 2Z6UA 3PEUA 3GJSA 1VPWA 4EFNA 4R1OA 2YMQA 5BORA 3K0CA 1DOHA 3LO5A 3N8IA 4GLBA 2GJ9A 5AW5A 4C30A 3WGJA 4BGUA 4X7PA 1QP7A 4HC4A 1AKNA 4RSMA 4QQKA 4P5DA 1TLLA 2CV2A 3K1YA 2OZLA 1U7UA 3GT0A 3OA0A 4WN9A 1A5SB 4UNRA 3UJDA 2QTWB 3NWBA 4N4AA 3SJ7A 2E1PA 4WNAB 3SXUB 1N57A 3L77A 2R8PA 4OXNA 3BDVA 4D6YA 1RAIA 1YOVA 1DRUA 4UDXX 1M6VB 2PUVA 4PSUA 2OMKA 5CYFA 5B58C 4MWSA 4EY6A 3OQIA 1EJ0A 4Q3KA 1R0YA 2NP7A 4R0VA 2AK2A 3P2EA 2EJCA 3CH5A 4IYRA 1FXSA 4BEBA 3IQFA 3KKMA 2NUPB 4RPGA 4B34A 1FNMA 4GIBA 4WE3A 4KR7A 4JVOA 1XCOA 4HNAA 3EEIA 4JR2A 3DBHA 3C97A 1GNRA 1WZNA 4B3BA 5JNUA 1ULTA 1PE0A 4CIXA 1Q0TA 4Q47A 1BMTA 5AW2A 1QSGA 1BCSA 3H5WA 3PQEA 5LLSA 1JVBA 2XI4A 3IMCA 1OZGA 2H4XA 5FTKA 4KFSA 2BLNA 2QLJA 4UOEA 1NZJA 4JN6B 4DLLA 1JA0A 4BVHA 3PA6A 3FDIA 4OI2A 5HZHA 1H9CA 4OHPA 3WLIA 1RPNA 2PBRA 4RM3A 5EJ4A 5AWFC 3OPMA 1IOVA 4ENPA 2OBLA 4OXQA 3SBXA 3EODA 3BSWA 4HNAB 4K40A 1GGFA 3DR3A 1GZ7A 1PKEA 1UZAA 4BTEA 1X77A 1QE5A 4OUDA 1N9KA 4Q19A 5EJAA 3MJEA 4XLLA 3RF6A 2NO1A 4YP6A 1TTHA 2JJ1A 2V6FA 5DLQC 2DSNA 5D87A 1HSOA 1E79A 1PN3A 3AFIA 3VZBA 4BMZA 3HY6A 1UUFA 1F2VA 2H11A 2PUHA 1SRRA 2YZMA 3OQPA 1SULA 4E94A 5JU6A 3YASA 1PD0A 4E21A 1KAOA 1DOAA 1ZD9A 1V8FA 1SXHA 4PG8A 4G5HA 4Y8VA 5AW0A 1HA3A 4LEIA 1AK1A 4GICA 4ZC8A 2DBYA 1VKJA 4FQ5A 5F1KA 5EJ8A 3ZEIA 5DTJA 2EF0A 2PL3A 4JU9A 4HH1A 1ZN7A 3EZ9A 4F6CA 2B7BA 1EHCA 2PRKA 3GEIA 2JJ2A 3LX4A 1HDOA 1J4AA 1JJVA 3M9XA 5DYIA 3ZU2A 4ZI7B 1JDBC 3TX6A 4RK1A 3LUPA 4EENA 5BSWA 2L69A 3WHLA 4QQRA 5FOVA 2HADA 5IAAA 2NUTA 1IULA 4C2TA 1BWSA 3LI2A 3J7TA 4LHEA 2EG9A 2PR7A 3DZGA 2X5OA 4PVDA 5JDCA 4DMCA 1RE1A 2WU8A 4O4HA 2WIJA 3NC4A 2OO5C 1KJZA 1KHHA 3TBFA 1L4LA 1DX4A 4QXQA 3G2HA 2R0QC 1XZCA 4IX1A 4URWR 1BYUA 1SXIA 3L7OA 4V03A 1PT9A 2QPLA 2X14A 3PDIB 1LBTA 1T2DA 4TTPA 1N2SA 3KHKA 4D3YA 3DZCA 1E9CA 2ECQA 1LF5A 4Z8XA 1NJGA 4KG7A 1Z28A 1OY1A 2QQFA 4LNHA 2DTXA 3WYGA 1J7JA 4AUNA 4O3MA 5KNBA 2VZEA 1D7AA 1ZFNA 4GOKA 4MP6A 3AKZA 3FSRA 4FR5A 3T5AA 1T6ZA 3WMWA 1J39A 4HVLA 3WL3A 4UPEA 4EPYA 1IB0A 2H5LA 2VHYA 3P9PA 3QEOA 4YMGA 1KZ6A 2QYHA 2QYOA 4HNRA 4IOMA 5AI5A 1LSSA 2O4UX 3KFXA 3VX4A 2I8CA 4N3NA 1LLFA 3V7FA 3DXZA 5F64A 4G0ZA 4G24A 1ZCBA 3DMGA 3ICQB 1GFZA 3C6YA 4R1LA 1KI6B 3I9NA 3QKRA 5BSKA 1MB2A 4W9MC 2GDJA 4P4GA 5DSXA 2Q07A 1Y4ZA 3IDAA 4JBYA 1XYGA 4AICA 4HWPA 5CA0B 4Q9IA 5DKFA 2AL7A 3AY3A 2HX1A 1BW9A 4J07A 5E2BA 4ZO8A 4DKXA 4Q0MA 1GCOA 4KXWA 3PCRB 1FP6A 4KMOA 1VLMA 1T34A 4LJ8A 3W5SA 3WWCA 4KR9A 2BCGY 5B2EA 4EZBA 1N8SA 1RKXA 3TQHA 4KN9S 2OYSA 2BTOA 1UQRA 4LHYA 3TCNA 4HH0A 1R37A 3ZW9A 3E53A 3CGGA 3M6VA 4NCIA 2P8JA 2O8NA 2KS6A 5FI0B 1WX1A 2VDRB 2EOAA 3DXFA 1MPXA 3V4SA 3KUDA 3R3ZA 4MW4A 2QTMA 2GAJA 3PKZA 4KOAA 2O0LA 4FNAA 4QJ5A 1PHPA 2C3PA 1DWQA 3HA5A 3ZKAA 1AQLA 1NW7A 2GYUA 1NVBA 3GG9A 2AI3A 3AVYA 3OEHA 2ZYRA 4TWZA 4Q4HB 3TLXA 4DIUA 4MIKA 4OYHA 3FGZA 2AFRA 2IU4A 3PU6A 4J8PA 1T2EA 1X19A 2Q4DA 3KZXA 1C50A 1QTQA 4FD3A 2OV8A 2JASA 2IUUA 4EA6A 4DWOA 3BIFA 3EZ2A 2FFJA 5JCJD 1P31A 5JNVA 2IHYA 1C41A 3DR5A 5JMPA 5T3YA 3BFVA 5A1JA 4FB5A 1XPJA 2HF8A 2XB4A 5THXA 2R7AA 4DVGA 1WCWA 1JQLB 4OX9Y 1RCUA 2A7XA 5L3VA 1ZY2A 1FUYB 4K6MA 4NEQA 2BJVA 2WMYA 4PYNA 5HF9A 1TEVA 3CLVA 1R9MA 3T5MA 3IXQA 2ZSHA 1RI4A 1F0YA 4PV7A 5AH0A 4O63O 3N05A 3VGJA 2XHZA 1U3GA 4A5SA 2FMTA 3IIMA 1KDZA 4N3BA 2CCGA 3M89A 2FH5B 3ZN2A 1CDOA 2Q4OA 2BM9A 4RLHA 4AY2A 1LF0A 6NULA 1QKKA 2QTHA 5ITVA 2WU0A 4B73A 3LUFA 4K9PA 1W75A 1F9EA 5K0EA 3F1LA 1VTKA 3EFBA 4K1LA 4YRGA 3TVYA 1DXQA 1JFLA 2YVUA 4M37A 5K3EA 2CNWD 3UENA 3LDAA 3G2OA 3VNAA 4DUGD 1OYVA 3QOFA 2V7XA 3RAEC 3EOZA 1RZ3A 1Y1TA 2FA9A 3QEMA 2Y05A 3M6UA 4XWKA 5ELXA 1YO6A 1K6XA 1XTIA 3H2GA 1L4GA 4DV1B 3R9XB 1NASA 3RS9A 4NYIR 3DEJA 3RODA 1RWKA 3NNDA 1SEPA 1GLGA 3CKYA 3W2FA 2VJAA 2IA5A 1E9DA 4FWBA 4PLGA 3EBPA 2C5LA 3LCUA 2FJ0A 3LDUA 3T1OA 1U2DC 2NTEA 3K94A 1NVUQ 4PFSA 4QSHA 3W79A 2WB4A 1M7GA 2OCKA 1SOMA 1WBDA 1O8CA 1OIXA 1E2BA 2CJXA 4YJGA 1T3TA 2C5SA 1P7WA 2G9RA 2X15A 1SWVA 3OIUA 4JJ8A 3NBZC 4WY2A 3SEQA 2GD6A 2GUGA 3KQSA 4BFSA 5BT8A 3CUYA 2BBOA 1D1TA 4TWRA 4YDHB 5AJVB 1QK5A 1GN9A 4RKRA 1A1VA 1IIRA 1RMYA 1JKXA 3VO9A 4A82A 4QGBA 3MB5A 2VA9A 4X20A 2J5BA 3C7TA 1OOEA 3MK31 2BBTA 1ZK4A 1NJ8A 2XQIA 3DKKA 4D8WA 4IIHA 3NGMA 3OF3A 3LQ1A 1QQTA 2QUJA 4HSGA 5TPZA 3SIXA 3VPSA 2I29A 3IVCA 3QKUA 4EW3A 3DWIA 2VP9A 1F3LA 2XHEA 4HDOB 1BKSB 3FPBA 4PS1A 1G4HA 4YY3B 2E21A 3AR7A 2A4KA 2GHIA 5M2QA 1JFVA 2BGNA 1QG2A 4DLVA 3N8DA 4UHEA 3RBZA 1Y9EA 1TF2A 2GMWA 2WWRA 4OQEA 5G0TA 2QNBA 1U11A 1GA6A 4CMJA 2JZOA 1ZN9A 1JKJB 3AILA 2VH5R 1LI4A 2BCEA 2QMHA 3DTVD 1IQUA 4MK4A 3KZKA 1U4OA 4JITA 5FT9A 3TLKA 1TC2A 2A92A 2JI7A 3C8MA 5JMOA 1FYXA 1WVGA 5FRDA 4FMCB 1ZRNA 2QD2A 1Y7LA 2H29A 2Q5LA 5D3MA 4B1FA 1UBLS 3VSDA 2QI9F 3H75A 5I7UA 3K0SA 4GRAA 4B46A 2HJHA 4PTYA 2JC3A 1USGA 3AESB 3GGCA 4F56A 5LNK1 5A5DA 4CL0A 3KAJA 1T3HA 5C1BA 3LVFO 4COKA 1ID1A 1S1MA 1W94A 1RAGA 3ESAA 3QWAA 4INZA 3OZAA 1SK9A 4BQRA 5IX8A 2J5KA 1GR1A 3UGKA 1ZIDA 1N5KA 2DBQA 3GLTA 3U3MA 5HILA 2YWXA 3OCVA 4PC6A 2VJMB 3RU9A 2N1BA 2VDLB 2XUZA 2P5SA 1GA1A 1E5DA 4E6EA 1D4OA 1B26A 3SJBA 4Q21A 3AIIA 4B84A 4EGSA 1IDOA 5HZMA 1LC0A 3MG9A 3W1EA 4BPBA 2H06A 1QPZA 2NPOA 1SHUX 1K9SA 1U7ZA 2Q6LA 1P5FA 1LWOA 5EGNA 4WFKA 3ND6A 2QJWA 5G1NA 4MTCA 1U65A 2HF2A 3KJIA 4UCXA 2JGNA 3SSOA 1HT2E 4JB3A 1K5HA 1QC5B 3TRIA 3VM6A 4NXNB 2FEWB 2XE6A 4ZVOA 3HHEA 1N5DA 2AWOA 4LVUA 4JI4B 1L5WA 3FVQA 4KR0A 2O1WA 3WGLA 3ETJA 5H4GA 3GVIA 5CB8A 4PO9A 3V8MA 2ZYHA 1GPJA 4JJ4A 3REFA 4AI6A 5ALUA 3I52A 2XB9A 3PDUA 1NG1A 1E64A 3LF1A 1WO8A 1JR6A 2HZBA 1E9RA 1R5OA 1WTCA 2J7KA 2EJTA 4LRTB 3SR0A 4AJKA 2ORED 2XVAA 3E5HA 4K1XA 2ZDQA 4YV2A 3MTJA 3HUFA 4E12A 1JR3E 1E89A 1H1DA 2FV8A 4M9XA 3AIOA 1ZL0A 3OP1A 2GERA 5AVWA 3NMUF 3QK7A 2W2LA 2OXIA 1QH0A 5K0TA 3CCBA 4MUBA 2AB0A 2JJ8A 3PD1A 3UYKA 1ZXBA 5LIPA 3AL0C 1ZGBA 5F7ZA 5G2OA 2VKQA 1LVUA 1R0ZA 3COSA 3HR7A 4CV0A 5HKKA 3JQFA 1W35A 4CDNA 5IUKC 3D1JA 3MIIA 4A2PA 1FNDA 3ASZA 1WE2A 4KGZA 2QLLA 3PC8A 2Q29A 4ZHQF 1R0KA 3L2OB 3IR5A 1EE2A 4BLWA 2R6R1 4AP6A 5ICFA 2C83A 4EBFA 4MS3A 2O3TA 5CIYA 4GM4A 1WZCA 2VTBA 2XKJE 1KU6A 1NUHA 3FMIA 3RHFA 5A4KA 3LT2A 3LUGA 3GZNB 3LYLA 3BG5A 3N28A 3QF7A 4L27A 3INYA 5IJXA 4BVLA 1Z5VA 1Y34E 5AM4A 3TQOA 1I51A 4RVHA 4Y9RA 2WP8J 2ZG6A 4JNCA 3FAZA 3P32A 4KRGA 4MS3B 5HS6A 1AE1A 4MVJA 3CZ9A 5DK4A 5CDTA 1JJIA 1KBZA 1RJ9B 2WVAA 2FEPA 2P9BA 3D3JA 4RKFA 3ASUA 4TSKA 1Z0KA 1O77A 3AT1A 3N6XA 2ZE5A 1TJ4A 4C3VA 4JVNA 1VLVA 3CJQA 3LPDA 4WSOA 3E48A 2JAQA 4RF4A 3L1VA 5BVHB 4U39A 3I5AA 1ISRA 1H2FA 2EBFX 2P9JA 2FZCA 2IXBA 2WDPA 4EHAA 4EY4A 4RZ2A 5GGXA 4BV9A 4Z4HA 4UBIA 2PQ0A 4CM6A 1JS1X 3OZBA 5J2TF 4OHZA 4HPXB 3Q2KA 4CIVA 3K7EA 4EEZA 4LXYA 2JJQA 4EHBA 1HDXA 5AKLA 3RD5A 3RTAA 5A4MS 1CNFA 2P6MA 1EXNA 1L4KA 2EFHB 2FRXA 2QSJA 3FRIA 4JXXA 4QLOA 1U0RA 5BQOA 1PNTA 3GJQA 3ICVA 1R9GA 4DMUB 1CFZA 1T36A 4D7AA 4EVQA 1UBHS 1CV2A 4DLZA 2IEZA 3GDHA 1ECGA 4R1TA 2PSJA 1YJ8A 2ZJ8A 3C85A 1DZIA 3A6GA 5FI1B 1XKLA 4CV2A 2YIJA 4V0KA 4IQ4A 4H6PA 4XQCA 1DG3A 1LPAB 1J0XO 3RKRA 1CX9B 1HOTA 1G17A 1VL2A 5DLEA 4JLSA 2BFDA 5AVSA 3QX3A 2WUVA 5CT4A 2E5WA 5JFGA 5BNTA 4H4CA 1VSVA 4RKEA 2H1IA 4Y2VA 2RBKA 2MMGA 4GXNA 1O95D 4B8ZA 1O2DA 2CLKB 4RFSB 2X41A 4Z51A 3AMVA 2WWHA 2VQ3A 3OAAD 1JR2A 2P3OA 4XPZA 4B85A 1G6OA 3UFBA 2AJTA 1JW9B 1H85A 2O48X 3BB4A 3I9V1 3O2NA 2Q6VA 1EFTA 4IQ0A 3M3HA 2V6BA 1ZC3A 2YRWA 4KGXA 1GRNA 5HM6A 2QF7A 1GGEA 1AKVA 5EQJB 4TL6A 4FW9A 4Q1DA 4EG3A 2ETXA 3HVHA 4DQLA 1ESEA 1EPUA 4NOLA 4RHYA 4CV3A 4Z7NB 4L85A 1UEXC 4XUCA 2YIDA 1WNTA 2L18A 3IVGA 2P8SA 4CLDA 1E2PA 3TXAA 3FDZA 3ADDA 1NWCA 3G3EA 1XRPA 1D2MA 1MB4A 4IFBA 3IXLA 3Q7IA 4IV8A 3JS5A 5HCIA 4FHCA 4OB7A 4XWWA 1SKMA 4C2BA 3PDJA 1HRDA 4YVFA 2NUAA 2ZJ0A 1G4UR 4TKLA 1R5BA 2XUGA 5KSPA 1OE0A 1P0MA 5TS3A 4CRWB 1KEEA 4BY9E 4X71A 1PZEA 3BGIA 2VDVE 3OT1B 4LX0A 2ZKIA 2DFPA 5CK5A 4H08A 4RD4A 3BFPA 3UV3A 1NC3A 4CYMA 1VOTA 1HNWB 5EWMB 1LTKA 2PGXA 5DV9A 4KSCA 5AQEA 2YWGA 2X1LA 3EA0A 1IATA 1QH1A 5AKEA 4BVAA 2M32A 3BCSA 2Y76A 1N7GA 3HDJA 2Y1LA 2GLTA 4YRAA 1KEEB 2JGFA 3DVRX 4RXMA 4ZVMA 4DNQA 1JNXX 1P0PA 2WR8A 1N0VC 3Q8WA 4X65B 1RVV1 1ZITA 3FKSA 5AR1A 1B8UA 4BKPA 3NH9A 1Q6YA 4R1SA 2WTBA 4ZI7F 2F4VB 4PZEA 1OC2A 3KLNA 5KC8A 1ACJA 1JHQA 1PLKA 1WDMA 5BN1A 4GPTA 4WPGA 5DBFA 1ADYA 4Z99A 1DEKA 4DJEC 1FS6A 1T5BA 2IEYA 4MVJI 1RJFA 5GIPE 3QVGA 4OVKA 2P30A 3MXTA 1YZVA 1XK6A 3PLRA 4IS3A 1U2RA 1WLYA 2W2LD 1H05A 4KNWA 4PW0A 5BW8A 1G0OA 3P2KA 3PR2B 3LQQA 2O07A 1FDTA 4UZFA 5A5VA 2J0UA 3H8VA 1VXRA 2XYGA 1IM8A 1E3TA 1M2OB 1N1EA 2AUNA 5CVEA 3QNMA 2M6RA 4RKWA 3ADOA 3TAXA 2DAPA 1TF5A 1GPMA 2NTJA 2TS1A 3AV3A 3FFTA 4W7HA 1GU1A 3AERA 3RYTC 1K6MA 4AAYA 2CVQA 2XGMA 2ZBEA 2DG2A 1K8XB 3ADCA 4KC0A 4HEHA 1L5SA 4BRWA 3D8BA 3HDTA 3UAZA 4RKYA 4ZPJA 3TLBA 1K92A 2B2CA 5EKSA 1F0NA 5JEDA 2GEDA 4N01A 5B4VA 1C1YA 5ALZA 1N36B 3RVMA 4ZEWA 1H42A 3I2HA 2J0UB 1G3UA 2C4UA 2EV9A 5AW7A 1I7DA 1H93A 4YO7A 5B1DA 2ZCUA 4GKVA 2PUWA 4R2WA 2PX6A 4ANFA 3D2CA 1UOQA 3W7VA 1QYXA 2WJGA 1V4NA 5FOSA 4CR6A 4CW7A 3U16A 2H0AA 4R1UA 2BDUA 4QZVA 3PBKA 3B7WA 1BJTA 4LZLA 3UOAB 1QUFA 2PIDA 3IR7A 3NYRA 5CA0F 1W1WA 4ND2A 1RWNA 3G9ZA 4FEAA 4G5RA 3GLIA 5ED0A 1WDLA 3LK6A 4YMTA 4GWKA 1EINA 4KDCA 4C14A 2OFOA 4S2EA 1KE2A 2NNWB 5ENDA 1E2NA 1U0LA 3DVAA 4CFSA 4DAOA 2C7QA 1SD2A 5AJYA 4GP7A 1DKUA 4M87A 3AB8A 4F92B 3LCCA 1Y3BE 4FKMA 1DFGA 1J2UA 1P4GA 4ZYVA 4DLYA 4EJSC 5IP5A 2NN3C 2YOGA 4M0CA 3V55A 1I2DA 2VNAA 2I9PA 3F0TA 3HA2A 3QWHA 2UUAB 1QU3A 4AG3A 4D9CA 5AXDA 4H7PA 1ZSVA 5LJLA 3A1FA 3FWYA 4BTVA 5J4KA 1CRLA 3CVUA 4AZ3A 5IEJA 4PAWA 4YA6A 3ES9A 2CLOB 4OFWA 2B0CA 4LRSB 4MUJA 3GFGA 1QF9A 3BX1A 1TFRA 2IEIA 4WINA 3REOA 4BNKA 3IL2A 1K98A 1NIPA 2FZ5A 2Q5OA 1UQUA 2OO5A 4TTVA 1F5SA 3EF3A 3N2KB 4QXMA 4TYMA 3S81A 1XHLA 1NQOA 4K46A 3ZGXA 1XTPA 1RW4A 2I6UA 4FXPA 3PRKE 3PSAA 4YT5A 4OIMA 5CG1A 2ZETA 4AZ3B 3EISA 2VJQA 5CP8A 3RSLA 2PSEA 1LDEA 4Q3CA 4CIAA 2ODQA 4ER3A 5TPWB 2QLBA 5UKDA 2GF0A 2QHXA 1TJNA 3OC0A 2ZQYA 3EVAA 4O25A 5HIKA 3EDCA 4H18A 5CA1A 1VBMA 4CMEC 3RVKA 3GRCA 3KSMA 4PSVA 1GGMA 1F8XA 4HMPA 4JKYA 1CRQA 1YZ3A 2C78A 4A10A 2WHRA 3E9EA 3UA4A 3IDFA 3GEHA 4TKUB 4DRYA 1ZMTA 2OV1A 3CEJA 421PA 4DLTA 1BS9A 4U7DA 3Q9LA 2FZVA 3T7TA 4DBZA 3WIEA 3GUYA 2Y1OA 3EEFA 4N7RA 2C0CA 4QEDA 3F7TA 5CA1B 3WJAA 5IF9A 1OILA 3U40A 3PE4A 1HQDA 1QVZA 4X1IA 4X3OA 1IVNA 1Z74A 3G2NA 3KR2A 4XFKA 5GJCA 2YQ5A 1KR5A 4F21A 4Q24A 2ZBDA 3VDQA 2VYVD 2A1TS 1YS4A 3F47A 3AVVA 4I46A 1NYRA 3DDOA 1QZUA 5CFMA 2YV1A 3BMOA 2RGDA 1DTEA 1K97A 4EYOA 4U6SA 5JY1A 3KKZA 4HFRA 1U3CA 4XKJA 3H86A 3RVPA 4UATA 1M2KA 4IVRA 3VU0A 4XGIA 1P74A 1AKTA 3EGXA 2FTKE 1S2NA 2ATVA 3I42A 4YI3A 3OJXA 2O20A 1I01A 1N5IA 5FTJA 1BGXT 4BAZA 5KQLA 3U5TA 3H97A 4MGEA 1RYBA 1IEWA 2NT4A 3HCBA 4WD3A 1E20A 3VR6A 3VZCA 2CXQA 1WF3A 2DQSA 1N2IA 3BGOS 2VTEA 1C14A 2OPHA 5HNKA 1KI1A 3INNA 1Z47A 3GJ0A 1NT2A 4AL4A 4TL7A 4NENA 3ADBA 3HACA 5JJCA 4DEXA 1TL7C 3AL3A 3ZBTA 2VK4A 3L9WA 5GPBA 2DU8A 1ZBQA 3TEFA 3Q3GE 4X54A 4S12A 5FWAA 3KE9A 5D5QA 1K66A 2N3ZA 5B3JC 4G1VA 4MUIA 4QBKA 3E84A 3NKLA 4PF1A 4JBNA 5D00A 5JRDS 3MWGA 1CNEA 1C7ZA 3K9BA 4D1YA 1G2IA 5C4IA 1F48A 2CFIA 1E4YA 5ALQA 2FR1A 5HX7A 4H59A 1JFSA 2PR2A 1MGOA 2ENWA 2WIDA 3Q2OA 4GI2A 1QR6A 5FL7D 4DQ0A 3A2KA 1YBVA 3CWZA 1B16A 3FSGA 4L1KA 4MR9B 5HJ2A 4A0RA 4JBLA 4HKTA 1HLPA 4BX0A 3FSJX 1B76A 2WKPA 3L7JA 1N5OX 4FCWA 1F6BA 2GCEA 1NA5A 3EZ6A 2RHJA 1LW6E 4HAOA 3ZGNA 4D0GA 1UMCB 5MDHA 3IPYA 2HT1A 3WGVA 5DMXA 2FF7A 5EE0A 5IVPA 4OQYA 2BFFB 2IYVA 2IQIA 2R8YA 1NT4A 4P84A 4CTMA 1O6ZA 4IMJB 4NBTA 4N76A 3UFXB 1EQUA 3JAKB 3OUZA 2ZIVB 2LCQA 4KRFA 4NYJR 2NO4A 2X2PA 1FU4A 1KRHA 4E2XA 4LXXA 1YHNA 3UXEA 4E7OA 4YAKA 1K4YA 4BIMA 1X14A 2X1MA 3SS9X 3NDRA 1KVQA 3AKYA 5E9JA 4PN7A 4RCZA 1QGAA 4BAGA 1QHIA 3QPAA 2K7FA 3CRNA 3C6QA 3K31A 4XVRA 3LUBA 4BMDA 4FSHA 1N33B 5DNYB 1ZI9A 4PCAA 4ER0A 1ZYUA 5DTMA 3TDKA 4YR9A 3PHGA 2PTHA 3PT9A 5FV7A 1HLDA 5DOVA 1CDZA 1MDFA 3MAAC 4CPDA 3A1EA 1UFRA 4ZCIA 1YE5A 1S3GA 4ZVPA 2IH5A 1EG2A 5AJUA 1T0BA 1Z2AA 2WJAA 3FX2A 2ZAYA 3HJUA 3JASB 3PJGA 4X0EA 1V95A 3CR7A 3U7IA 3CLRD 3E1KA 1ISFA 1IVYA 1MU0A 4GX5A 5BYKA 1TAUA 2O7NA 2ZBUA 1NVDA 4U2FA 1KYTA 1SZJ