1ZOIA

Crystal structure of a stereoselective esterase from pseudomonas putida ifo12996
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
275
structure length
275
Chain Sequence
SYVTTKDGVQIFYKDWGPRDAPVIHFHHGWPLSADDWDAQLLFFLAHGYRVVAHDRRGHGRSSQVWDGHDMDHYADDVAAVVAHLGIQGAVHVGHSTGGGEVVRYMARHPEDKVAKAVLIAAVPPLMVQTPGNPGGLPKSVFDGFQAQVASNRAQFYRDVPAGPFYGYNRPGVEASEGIIGNWWRQGMIGSAKAHYDGIVAFSQTDFTEDLKGIQQPVLVMHGDDDQIVPYENSGVLSAKLLPNGALKTYKGYPHGMPTTHADVINADLLAFIRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords esterase
publication title Stereoselective esterase from Pseudomonas putida IFO12996 reveals alpha/beta hydrolase folds for D-beta-acetylthioisobutyric acid synthesis
pubmed doi rcsb
source organism Pseudomonas putida
total genus 107
structure length 275
sequence length 275
chains with identical sequence B, C
ec nomenclature ec 3.1.-.-:
pdb deposition date 2005-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zoiA00
1MX1A 2XQJA 2D5LA 3GBSA 1DX4A 4X91A 2UZ0A 2HDWA 2WHRA 4LYEA 2C58A 4WY5A 5ALSA 3LS2A 1A8UA 4C4YA 5AKEA 3JYHA 5HKBA 2QUAA 3ZWQA 1ODTC 3FVRA 5LIPA 1CV2A 1K4YA 5CURA 2ORYA 4KYVA 2EEPA 4XWGA 5C8ZA 2ZJ6A 3DKKA 3FYTA 4X93A 2QVBA 4K6KA 4UBIA 4BBZA 1Q0ZA 3D2BA 4W1PA 3WA6A 3VKFA 5D3ZA 3DD5A 4GWLA 5J3JA 3C8DA 5CBKA 4X95A 2C5GA 3HABA 3QMMA 4WFIA 4ZWNA 4GI1A 4BCCA 4CIBA 1AX9A 2AJDA 1TAHA 4B85A 2ZYIA 4MYSA 5CW2A 2ZYSA 4OPMA 4Q3OA 2I3DA 3BJRA 3G02A 5AI6A 3AUKA 2QXTA 3C5WP 5LZ9A 5T4HA 2WHQA 2HA2A 1CUDA 5AK3A 4W9RA 3G0CA 4Q1VA 1EINA 3HEAA 1YAJA 4BZZA 1CUHA 3G0GA 2PBLA 5ALLA 4OB7A 3IBTA 5IVDA 3MUNA 4LKOA 2WFMA 1GKLA 4LYDA 1VA5A 2O2IA 4X92A 5EGNA 5IKXA 1QO7A 2HL6A 2H1IA 3ZLTA 1UK6A 2JGKA 3H2JA 4C88A 3DEAA 4E15A 3O4IA 3HI4A 1JFRA 3W06A 4LHEA 4AO8A 1W1IA 3D59A 1GT6A 3DDUA 4HAIA 5JAUA 2XE4A 1XZMA 4PSCA 4BTLA 5CH8A 5FUMA 5KWJA 1QJ4A 3R3WA 1MX5A 1CIJA 3UUEA 4I3FA 3BE8A 1XQVA 3WWDA 3C6ZA 3R40A 2GZRA 4Z49A 3WK8A 4B81A 1LPBB 1OXMA 2RONA 4GBGA 1BCSA 4E46A 3NWOA 5LZ5A 4FBMA 1A88A 3FOBA 4BE4A 2JGMA 1XZGA 1R9NA 3W2TA 5CTAA 2JF0A 1NU8A 1VLQA 3JWEA 1QIDA 1HL7A 5BV7A 3LIPA 1LPPA 5KBYA 2WIFA 1H2WA 4Y2UA 2OGZA 4K5QA 3H2HA 1VXRA 5AKKA 4X7BA 4Q05A 4MXDA 3L1IA 2VSQA 4W1QA 1UKAA 1WB4A 4LIPD 3BIWA 4FBLA 1U65A 4X6YA 5AM4A 4PNZA 2GBIA 1AURA 2Y6VA 4MEBA 4H7JA 5FRDA 5DYTA 4IO0A 3HLKA 3Q8WA 2XMGA 1XZBA 5HFAA 4N8EA 4BAGA 2QM0A 4OYYA 1W76A 1QOZA 2XUKA 2VA9A 1EK2A 2W6CX 1L7RA 3VJLA 1DWOA 2OXEA 1XKLA 5JARA 3CN9A 3AZPA 3PFBA 4H7EA 4EY4A 1I6WA 1BRTA 2YYSA 4ZV9A 2WUFA 3E0XA 2GYUA 2O7RA 3W05A 1Q83A 1Z68A 1YB6A 2Z5GA 1YS1X 5AKYA 3SC2A 1VOTA 5LLSA 5HF5A 2FJPA 2IX9A 4KRXA 3DJYA 5E4JA 5FLKA 1DT3A 1TIBA 5EHXA 3ESBA 4B84A 2OGTA 2QMQA 5JATA 3QZUA 5LYYA 1MX9A 1SCIA 1B41A 4FKBA 5AICA 1N8SA 4D9JA 1XQXA 2WHPB 5AKJA 5CMLA 5HQ3B 1ZD4A 4DMCA 2Y2VA 1ODCA 4YPVA 1WB6A 5HKAA 2C7BA 1KU0A 1SCKA 4AZ0A 1LGYA 4EBBA 4UBJA 3WI7A 1M33A 3P2MA 1MPXA 3PUHA 1ORVA 4PSUA 3N0TA 2WG1A 1YA4A 2HA4A 1XROA 4AXBA 4QWMA 4J0DA 3WJ1A 2B4KA 3IVMA 4GLBA 4P08A 3WWEA 2ZSIA 1UZAA 1JT2A 4JH0A 1HPLA 2J4FA 4INZA 4Y2PA 4F60A 3PI6A 3PICA 1QIMA 4KE9A 2I3ZA 4KJXA 2BUCA 5LZ8A 2VF2A 1ZD2P 4C87A 2HU7A 2DSNA 1CR6A 3T52A 2WLSA 4RGYA 1F0NA 4CI9A 5JZSA 4ZI5A 2XQFA 1EDDA 1ZGCA 4NZZA 3BWXA 5ALRA 5EHNA 5AOBA 4HRXA 5E4TA 4B83A 3QPAA 1FFCA 2J3QA 1TQHA 4H35A 2B9VA 3KWJA 4MQLA 4MWTA 3C45A 1G5FA 2JGJA 1CUCA 2CZQA 3DOIA 3LIIA 1GPNA 5LKAA 4GHWA 4OYLA 5AOAA 1H2ZA 1IVYA 2G63A 5ALZA 2QKYA 4X97A 4DNPA 3NGMA 1DX6A 2XI4A 5ALKA 4HXEB 3D2CA 3G0BA 3DCNA 1E5TA 3SK0A 4L0CA 5AM1A 2Y6UA 4AB1A 5D3KA 5FPQA 4BC1A 1QLWA 5ISMA 5ALPA 5IH7A 2B20A 4PQEA 2H9YA 4FHZA 3D2AA 1E3QA 4PW0A 1DQYA 3B5EA 3O9MA 4GDMA 4EHBA 1EDEA 3A2NA 1JU4A 5LZ7A 4GW3A 2DHEA 4BDSA 4BDTA 1SOMA 3ICWA 2RGUA 1YASA 1CUIA 2V96A 3O4JA 4P92A 4QDZA 5JYCA 3IUQA 4PV7A 4DSAA 5AM2A 3UUFA 1LZLA 5JD5A 2WTNA 2RHWA 4X3CA 3QMWA 4J3JA 1WPRA 3PFCA 1JJFA 4J0CA 1THGA 2Y2UA 4ZV7A 4FWBA 3VVLA 3R3VA 1ZD3A 4Y2TA 2VQ6A 5JZ9A 2OQIA 5AKLA 4BAZA 5ALJA 2DCMA 5AKHA 4AO6A 3E3AA 2XUIA 3AFIA 4J0HA 2H7YA 2VJAA 4DNOA 3PF8A 5CH5A 4BP8A 4BATA 1IUNA 4B0OA 4I19A 1UXOA 2HA3A 3WZLA 1EK1A 4K6GA 3G9TA 1MNAA 2EDCA 5SYNA 3OOSA 1RWQA 1GPKA 2RHTA 2YXPX 1YCDA 4U2FA 5ALDA 2I03A 4UFNA 3F97A 1UOPA 4WFJA 4CFSA 5LZ2A 1Y37A 2PKYX 5I8PA 4ZGBA 1QIGA 3S2ZA 1Q84A 1IUOA 4TGLA 1D07A 3F9CA 1XZEA 4MQMA 4DNQA 4NS4A 1TCBA 4KAAA 2E3JA 4CIAA 1WHSA 4J03A 1QIKA 4O08A 3TRDA 1JI3A 1AZWA 3DLTA 4WCVA 3BF8A 1L7AA 4B9EA 3E4DA 3G0DA 4FFWA 3EF3A 4FLMA 5JALA 2O7VA 4B7ZA 1CLEA 3WIOA 1P0QA 5FDFA 1XZDA 2DQZA 3FYUA 1XZKA 4X6XA 3L1HA 2VT6A 4P9NA 1C7IA 4J0JA 3PF9A 5AOCA 4H7FA 2WJ6A 2V9ZA 4M0MA 2XUPA 4ZREA 3MUOA 3TGLA 5KREA 1R1DA 1XZAA 2G5PA 2FX5A 4J0GA 3OURA 2OAGA 3IB3A 1YSCA 3IIIA 5FOQA 3STTA 3C6YA 3MVEA 1PJAA 4UBKA 2C4HA 1DT5A 4PO3X 4BAUA 2GBFA 3FWHA 1DWQA 2ACEA 3LLCA 1IZ8A 1XRPA 2G4LA 2ZYRA 4Y2QA 2YH2A 2DFPA 1LPMA 2PSDA 5K3FB 3DNMA 2JEZA 1A7UA 1MAAA 5ALHA 1TCCA 5AK6A 4UFPA 2XUOA 3ESCA 3I1YA 5AH0A 3WL6A 4XIIA 3STYA 5JIBA 1LBSA 5HFNA 5A7HA 4OSEA 5AI9A 1C7JA 1R50A 1XFDA 1GZ7A 5D7BA 3HC7A 5DNUA 3I2FA 3WYNA 2WFLB 1P0PA 3IUJA 4GXNA 1CUBA 2XT0A 1XLVA 4DIUA 3FLEA 2OQVA 1T4MA 2O2HA 2WU3A 5BWCA 3OPMA 2PU7A 4FNMA 3G0IA 5K3AA 2B61A 4QEKA 3I28A 2HFKA 2XMBA 3R3ZA 4BRSA 4J0KA 2WJ4A 1XQWA 1YB7A 1N5RA 4AZ3A 2VAVA 1J07A 4A23A 1BROA 1EDBA 1QONA 1MO2A 4JEIA 4WDRA 3U0VA 2WSLA 1X2EA 5CH3A 3R3XA 2P8SA 2ROQA 2HU5A 3WK4A 4DM7A 2BGNA 4Y9SA 3H2IA 4KRYA 5C8XA 1JJIA 5AM0A 4X90A 1BN6A 1QTRA 1DU4A 3PE6A 4U2GA 3WWCA 5EFZA 5K3EA 3H19A 2X8BA 3VJMA 2Y1KA 1VZ3A 3SX4A 4GECA 1G4HA 1E8NA 1QZ3A 3N2ZB 3I2HA 6YASA 3EQ8A 3DL4A 1U8EA 3DYVA 4BTVA 2WILA 1F0PA 5E2IA 3AZOA 3K9BA 1BU8A 1DINA 2QUBA 1CVLA 1FFEA 3IUNA 3QYJA 4JYMA 5C7YA 2BFNA 3WQHA 4XJVA 4NVRA 2C0QA 4KEAA 4G9EA 4MEAA 4B80A 3WK5A 2WUGA 5EHZA 3FSGD 2G5TA 3FNBA 5AKIA 4H7HA 4F5ZA 3OG9A 4AQDA 1WCYA 1QFMA 4MWSA 1XQYA 3G9XA 4BVLA 2PM8A 4DTCA 2HRRA 4C89A 1EB8A 2WIDA 5JASA 3NUZA 3QITA 2WKWA 1EXWA 4HS9A 1X2BA 1XKTA 4L9AA 5LKRA 4YX9A 1F8UA 2Z8ZA 1VXOA 3KD2A 5YASA 1XRMA 5CT4A 3W04A 2CBGA 4P93A 4F21A 5ALGA 5K5EA 3V1NA 1K63A 3OM8A 3RKSA 5JD4A 5CT8A 4QZVA 3F98A 2O2GA 2WTMA 4Q3KA 5FXMA 4G5XA 4OU4A 4AX4A 2WIJA 3AIKA 1AGYA 1JU3A 3ED1A 3LCRA 1XLWA 3I1IA 4JYPA 4ARAA 1JJBA 2VJBA 3QMVA 4X6UA 4CG1A 4KAFA 1VE7A 2X76A 5DTIA 1SFRA 2Z8XA 4BZWA 1QFSA 2XDWA 3BDVA 4CG2A 2DHCA 3F67A 3M83A 2PPLA 2RIPA 2J4CA 4E11A 2HHAA 4WDQA 5I9IA 3O95A 4L72A 4QDXA 1EVEA 5JAHA 4Y2VA 2ECFA 5HZGA 2FUKA 3V48A 4X00A 4G4GA 3WK6A 3X3HA 4Y2YA 2XUGA 2HRQA 1VKHA 2WU4A 4IH9A 3CXUA 1ZI8A 4C6HA 3QBJA 5ALWA 2QT9A 1ZIYA 1CUFA 3WK9A 5DJ5A 3WL8A 5JD6A 3I2IA 4UHDA 5K3DA 4DMKA 3LP5A 3O4HA 4RE5A 4A16A 2WFZA 1CQWA 3V9AA 2PL5A 3KSRA 1UOOA 1ZGBA 3STUA 4KE6A 5DNWA 2XUQA 3QPCA 1FFDA 4FOLA 4OD0A 2WHPA 3EQ9A 2WUDA 3C43A 3AIOA 2WG2A 3M81A 5ALXA 5H3HA 4N5HX 4H7KA 2GYWA 5BWBA 1BEZA 1P0IA 3O4GA 1LNSA 2PX6A 3DQZA 5ALUA 1CFJA 3C6BA 4IQ4A 2XLCA 3I2JA 3WL7A 5DYYA 4FLFA 3WIBA 1YA8A 3BL8A 1QIHA 2XQKA 3HSSA 2OLEA 1J2EA 4G1FA 2WUEA 1R4ZA 1XLUA 1ZJ5A 3V1MA 5HF6A 4C01A 5AM5A 1LBTA 1ORWA 1EX9A 2QR5A 2HA7A 2XMDA 4GEGA 3C8HA 2DR0A 1JKMA 1L7QA 1NX9A 1IUPA 4QA9A 5AI5A 3ILSA 5AK5A 4CCYB 1N1MA 4HVTA 2HFJA 4B6GA 3EIOA 5CT9A 3WKAA 4LXIA 2GBCA 5KWIA 3R0VA 4RPCA 3WZMA 2CKMA 4IH1A 4JUIA 1A8SA 4AMYA 4OU5A 4MJ3A 3WL5A 1NU6A 1GQSA 2XUHA 1CPYA 2QTBA 5AI0A 1WOMA 3BIXA 3UMJA 2XUDA 4UHHA 5A62A 3HXKA 5IVKA 4ETWA 3EBLA 4LXGA 2W22A 3TEJA 3RM3A 1GGVA 1UOQA 5AM3A 1BEEA 3VVMA 1WPXA 5DNVA 3VJKA 5K3BA 3KWFA 5I7UA 2OCKA 1ZD5A 4F0JA 1UKCA 1J1IA 2ZVDA 3A2LA 4N8DA 1UT6A 2PSJA 1QIFA 1RP1A 1ZICA 2BAGA 2XLBA 3FLAA 3H18A 2Q0XA 2BJHA 4EY6A 1TK3A 4W63A 1EB9A 5D6OA 4S0XA 4OCZA 1O6GA 5ALVA 3HACA 5FPPA 5CT6A 5CT5A 1QO9A 4BP9A 5EHQA 5LP1A 4V2IA 4WY8A 3OTQA 3WWPA 3H1BA 1CUEA 1K6EA 1LLFA 5T4BA 3M3DA 3YASA 5CRIA 2AJBA 3WMRA 2OCGA 1VE6A 5AO9A 3T4UA 1HLGA 1G42A 1MTZA 5FP0A 3G7NA 4DSZA 3IDAA 5HCUA 1Y7IA 4X94A 3GUUA 3CCCA 3STWA 4N8SA 1PFQA 3D5EA 3WJ2A 5AKZA 4MYDA 1CUXA 1LZKA 3WKEA 1H2XA 4Q82A 5JADA 3PDCA 4G9GA 4IH4A 3AZQA 1LPOA 2XUFA 1W4LA 1X70A 1JMKC 4IHAA 1Q0RA 1KU6A 3I2KA 2XQGA 2PVSA 4RNCA 4EA6A 1ISPA 3U1TA 2VEOA 3C5VA 4ZXFA 5EIHA 1BS9A 1EVQA 1YAHA 4UUQA 2QJRA 3ZLUA 3ANSA 4TVKA 1TCAA 1SC9A 2BCEA 4UBNA 1XZHA 1R3DA 4BE9A 4H7DA 5JAOA 5IVIA 2H7CA 2XMRA 2WQZA 4G8DA 5ALFA 4AMZA 3H2GA 2HM7A 3CCBA 4BCDA 2Z3ZA 2K2QB 2JIDA 4FLEA 4LXHA 5A6VA 5C8VA 4QDOA 5F4ZA 3AILA 3BJMA 5HK8A 1W52X 1XRLA 2PU5A 4N5IX 2OGSA 3O0DA 1YS2X 1H2YA 4KACA 3AIMA 1N5MA 4DYHA 5LZ4A 3WA7A 2ZJFA 4CG3A 5K3CA 3WKCA 2YASA 2IITA 3D3NA 3MGAA 4OB8A 1CUAA 4OUKX 4UBMA 4X71A 1WB5A 1JMYA 1TKRA 1HKHA 4BVKA 1W75A 3SWWA 2C5FA 5IVHA 2QXUA 5T4EA 1R9MA 5ALOA 3WKBA 3AINA 4K2AA 3TJMA 2XMZA 3D4LA 1CUSA 2JGIA 4G4JA 4B9AA 1IZ7A 2ES4A 3HZOA 2CUTA 2XMCA 3WYDA 3GELA 3FAKA 3D7RA 1XRQA 3W9UA 2ZSHA 7YASA 3CN7A 1K8QA 5K3FA 2ACKA 3I6ZA 1E66A 4HRYA 2FJ0A 5AIAA 5ALTA 2AJLI 1UWCA 2R8BA 4XX1A 3ZV7A 3M82A 1FFBA 3IUMA 2BUBA 1MU0A 4EB0A 1DTEA 2Z3WA 1HDEA 1USWA 1P0MA 4U2CA 1E8MA 1FSSA 1W6RA 3WLAA 2VTVA 1MN6A 3STVA 3DOHA 4QWWA 3R41A 5DTJA 2PUJA 4W1RA 1H23A 3PUIA 1UK8A 2WFLA 3DS8A 1VZ2A 4OB6A 2WIGA 1XZIA 4A5SA 1J06A 1KEZA 4M0EA 5A71A 2CJPA 5EIEA 3RK4A 2WIKA 3VISA 1FFAA 1MJ5A 2VJCA 4YASA 2OAEA 3RLIA 3G9ZA 4DLNA 2ZJ7A 2QZPA 1CUZA 2EDAA 4FMPA 4UHFA 5HF8A 3O9VA 1HBJA 1DQZA 4YK7A 4KE7A 4QLAA 2PSEA 5AKXA 2CEKA 2RAUA 2WG0A 2VATA 3FVTA 3C6XA 1R88A 4HTAA 1F6WA 3S8YA 1BN7A 1K5PA 3I6YA 2XQIA 4EUSA 2HA0A 3ESDA 4Y7DA 5AJHA 1HQDA 3R3YA 1CUVA 5FKJA 4HXGA 3OC0A 4BC0A 4G8BA 4RE6A 1CUWA 2H7XA 1XRNA 1EI9A 3I2GA 4EY7A 1ODSA 4KR0A 4J7AA 2OCLA 4CCWA 4H0CA 4TPKA 5AI4A 2JEYA 5BOVA 2HADA 3WK7A 1ZIXA 4H18A 4ZRDA 3ICVA 2HA5A 4W1SA 1S8OA 5AK4A 1CUJA 2HU8A 2GYVA 3A70A 2JGEA 5EIAA 2JGLA 4ROTA 3I6MA 3D0KA 4AN1A 4E14A 1CUYA 1ACLA 5T4FA 3R3UA 3V1KA 3F96A 2V98A 2XUAA 3HYSA 4WFKA 3GROA 1U4NA 4HZGA 2JBWA 4JNCA 2VT7A 2C0PA 5HF9A 1SCQA 1EHYA 3G8YA 1XRRA 4C4XA 5ALMA 4UPDA 5AIBA 1XZLA 2CB9A 3ANTA 2X5XA 4QNNA 1H22A 2OPHA 2OCIA 3H04A 2XMQA 3K2IA 1PV1A 3B3QA 4QE3A 2VAXA 1AKNA 1RYYA 4BB0A 5SYMA 2IIVA 4BCBA 4UHCA 4G4IA 5C81A 1LPAB 4U2BA 4EY8A 1LPNA 5CXUA 4UHBA 4DNFA 3H1AA 3V1LA 5AHXA 3RARA 4BVJA 3IURA 2BKLA 1CUUA 4QDTA 1GXSA 4QLOA 4H77A 5HQ3A 3ZI7A 4WJLA 2R11A 1XZCA 1QIIA 2JGFA 4KAJA 1BCRA 3EQ7A 2AJCA 3FCXA 3L1JA 4G8CA 4EY5A 2V97A 4ITVA 5ALNA 1ZJ4A 3HRHA 2QOEA 1T2NA 5ESRA 5ALYA 2PUHA 3C70A 2QRUA 1UK9A 2HA6A 5AI8A 2AXEA 4J0IA 2AJ8A 2BUAA 1YR2A 2WM2A 4PSDA 3A2MA 2QS9A 5ALEA 5AP9A 3Q0TA 4U2EA 1OILA 3QH4A 4ARBA 4Q34A 3AJAA 5HK9A 4XVCA 3ZLVA 1ZOIA 4I4CA 2I78A 3KDAA 5DYWA 3DKRA 3E1GA 4M0FA 4PF1A 4DMFA 5FV4A 3VDXA 1THTA 4UBLA 1IMJA 4Y2SA 2GZSA 1QE3A 5EI5A 1XZJA 1UK7A 1FJ2A 1GPLA 2ZYHA 5JZBA 1QGED 3WWOA 1GQRA 4FDMA 5A7GA 1CEXA 1MNQA 2NW6A 3ZPXA 1ZI9A 4BYMA 3HJUA 4DMHA 1GKKA 2OG1A 3G9UA 5AKGA 3IULA 5ALQA 1CUGA 1DWPA 1ZI6A 1OCEA 5A7FA 1QTIA 2XB6A 5DLPA 3A6ZA 1ETHA 3H2KA 1WM1A 1VA4A 1QIJA 2DQYA 4B82A 2DHDA 5DWDA 4U2DA 1XZFA 3STXA 4CCYA 2QJWA 1E89A 3JW8A 4UFOA 5JAPA 3GA7A 3VXKA 2WJ3A 3QPDA 4Y2XA 2PSFA 4NMWA 5E4YA 4EZIA 2CMFA 2XUJA 3FCYA 1AQLA 5CXXA 1EH5A 1AMNA 1QIEA 3NOXA 1AUOA 2LIPA 2PSHA 4AN0A 1UFOA 4L3WA 3FYUC 3KXPA 5JANA 3B12A 2GBGA 1UKBA 1CQZA 1Y7HA 4K6HA 3FLBA 1CRLA 5A2GA 3QVMA 4FTWA 4C4ZA 1BE0A 1WHTA 2VJDA 1EA5A 3C87A 4Y2JA 4H7IA 4FFVA 1B6GA 2BGRA 1TRHA 3ESAA 1C4XA 4X85A 4Y2RA 3W9BA 2RI6A 2D0DA 3WKDA 3DL7A 1G66A 1O6FA 3QM1A 3FBWA 3DYIA 2XMSA 4FNGA 3KOOA 1MT3A 1ACJA 3H0CA 4DGQA 3FSGA 3FYUB 2HIHA 3IA2A 4QDUA 4Q3LA 4BRZA 1E8DA 3BDIA 3BF7A 4HXFB 2J3DA 4UHEA 1A8QA 1U2EA 3K6KA 3GFFA 3F8SA 4KE8A 3H17A 4AO7A 1AC5A 2ONCA 1VJ5A 4UBOA 4B0PA 1MAHA 3BXPA 5ALIA 1LPSA 3GZJA
chains in the Genus database with same CATH superfamily
2VWQA 1YKFA 3NALA 1GNVA 2MCFA 4X91A 1C9MA 3QFTA 2RFLA 1L7XA 5FPYA 3VHXB 3S2GA 3PDIB 4NU0A 4WASA 3LUGA 4ZEVA 2FPRA 3CJRA 1DFHA 4WY5A 1QPZA 4LJ8A 2H3EA 3NDPA 1ORTA 3K72B 1Z82A 1P1FA 2JJ1D 5AKEA 4C4YA 3U1BA 1D2RA 2QUAA 1WSDA 2H1RA 2P2YA 2HXYA 4FCTA 2EQ5A 4YIKA 1K92A 1N2GA 3X1YA 2VDNB 4E3ZA 2PBZA 2ZRPA 5TMDA 5JBNA 4TMYA 2XW6A 2X14A 2Q41A 1OAKA 2I7DA 2KLBA 4FJ2A 3KQLA 1FTNA 1I24A 1RPNA 4HQ6A 1WCIA 4MGKR 2QP4A 1C0KA 1EFCA 2IHNA 1LFAA 1UAAA 3L06A 1UM8A 5BQXA 2KYRA 3IJ5A 2HT6A 2IY8A 4OXRA 2XIJA 4EA9A 4QDKA 4X93A 2QVBA 4EATA 1KSFX 1Q15A 3NTVA 3DMTA 2P4HX 3SC2B 1Q0ZA 2RGYA 4U3JB 1T5TA 2RHBA 3H5WA 3USES 4BX9A 3CSUA 3WA6A 5C5IA 5C4MA 3UAZA 3PQDA 1M1ZA 4JL8A 2A0FA 1HNZB 2P65A 4G07A 4W8OA 3WO0A 1C7FA 1NLFA 1U98A 3BH7A 2QZSA 5JWRA 2C7RA 1REQA 4YJ2B 3MT0A 3V32A 5ARBA 5CBKA 4AJ1A 5IC4A 4QRHA 4X95A 2NSLA 1GSOA 2NIPA 2C5GA 3VYWA 2P4UA 1HFWA 3QMMA 1KJJA 1FS6A 4D9HA 1XO1A 3HDYA 4URFA 3JQAA 5H9WA 1JQLB 4KPUB 2BEUB 5DCYA 4JBIA 4B85A 1CHDA 1OLXA 5EN4A 3FCSB 5JSZA 4ZHQA 2YMQA 4D42A 5CW2A 1QF6A 1XD2A 4XIJA 1V9CA 3W5IA 4EL0A 5I9NA 5TQVA 3AVYA 1DC7A 3EPKA 2QL7A 3PXGA 4JEHA 1JYEA 1YMVA 2O8NA 4HYEA 3H5NA 1W25A 3DWEX 3E9CA 2I3DA 2KW5A 3ITEA 4PZYA 4Q7LA 4FE3A 5B2ZA 4R9VA 5DM70 2VUUA 5H3CA 3G02A 2H4XA 4OGWA 2JAHA 4HZIA 3QEAZ 2P9JA 4UHJA 2VDOB 3C5WP 1KAGA 5LDHA 2FF5A 1C9JA 1CIVA 2CLLB 5T4HA 3O8DA 4AYWA 5KYYA 4GMKA 3KEQA 1CJVC 4A91A 1Q0PA 5D01A 3TW6A 4MAFA 1TXGA 2ZZNA 1WAMA 4GG1A 4RKYA 4GOND 3WYGA 4Q3AA 3WNZA 5BSHA 4KR2A 1L5LA 3KPYA 2DUNA 3LLSA 3U4DA 3IERA 4NFSA 1SC4A 4ON9A 1P3JA 3EGCA 3M6XA 3ETCA 1QYCA 3PXDA 3DZBA 1R74A 1MZVA 1IOVA 1DOHA 1Z8FA 3B9RA 3DVAA 4PHGA 4YJDA 4GOOD 3WGLA 1XK7A 1LK0A 3HBFA 2O6LA 2PBLA 4WINA 1NZFA 3ZWYA 5JZOA 2PXHA 3JXEA 4PYRA 5AUNB 3AW8A 2WJGA 1HYQA 5SY6A 3MXTA 4RPIA 1FPMA 2FZEA 3TNJA 1G8KA 4MVCA 5EJEA 3Q98A 3FD8A 1NDUA 2M1XA 3WP1B 4BMDA 4XWKA 4YLEA 1QHIA 1LJ8A 5FA5A 1GKLA 2IF0A 1QWSA 3A6FA 4QOSA 2F90A 2VHCA 3I9LA 1FPQA 5DLDA 1HFJA 4ZVTA 1IYZA 4P38A 4EWLA 2ZPTX 4AUKA 1VHDA 4FZRA 3EXEB 1CZLA 3IAHA 3NAGA 3H2JA 1IN8A 1HT1E 2FF7A 4N7RA 4GPBA 4EJFA 3PNLA 3BIFA 1FP6A 4E15A 1BC5A 5CLLA 2NMVA 2FXVA 3AY0A 3K9QO 3ZHRA 5JCOC 1JEQB 3A26A 4YACA 3H11A 5FA6A 1AB6A 4HDSA 4NEGA 1JFRA 3VR3A 3FOFC 3O3OB 1W46A 2IVZA 821PA 3D6NB 4NICA 2IS1A 3D59A 2R1TA 1YJ5A 3B2EA 4P7JA 5ADHA 2PXXA 1QR2A 1IQRA 1G2OA 4PNHA 4PQFA 5TGTA 3S29A 3H2BA 3AI3A 1Z8NA 3ZKWA 4WBNA 2Q0HA 1TCVA 4MAAA 1KK3A 3M4XA 1O0SA 1T9GR 4JELA 2PKWA 3W7BA 1M8GA 3JQ9A 1Y4SA 1PJQA 3JZIA 1KR2A 1V43A 4G23A 1MX5A 5FQNA 4DJDC 3F7MA 5DNDA 3X1ZA 3E53A 3F78A 5B3LA 5J4VA 3L6OO 2XE6A 3FVQA 1ONNA 2DSTA 1J2RA 4NYMR 2NT3A 4C0QC 2O59A 2XGOA 3FFWA 4YMLA 3LL7A 3TUZC 3HSYA 4E5MA 1M1NA 4EGQA 1ADBA 1FLDA 4KPFC 1E3JA 1HOXA 5E2BA 3SEFA 1IEVA 1KFJB 3OCZA 2PWPA 2W4QA 3M0EA 5F7OA 2RONA 3B7PA 1HDYA 1L3BA 3CEPB 1LDMA 4E46A 4ZDJA 1O0BA 1H0HA 1JLLA 1Y9ZA 4MIYA 5CM8B 1JHRA 1OBVA 1HRKA 2XNKA 1DNPA 4MIOA 4AF8A 4H4EA 3DD1A 2JGMA 4QODA 4UM9B 1R9NA 1NXPA 3P4XA 3MSCA 1XEWX 5CHYA 4IINA 5CTAA 5GJCA 1H6CA 4BV9A 1Q74A 5LA6A 1Z56C 3M4ZA 4CKBB 4E6PA 5BVHB 1QHEA 3RAPR 1UMBA 3TE6A 4MGEA 3QU9A 1I7DA 2FQXA 2AW5A 4W8GA 3J80A 2F62A 4EUNA 1EZZA 3H2HA 2ORED 1XF1A 5A0FA 4N9QA 1L1EA 1EM8A 4YRAA 4Q9JA 1Y34E 4X7BA 2OB1A 1S4MA 4WWHA 1TJ4A 2VSQA 3L1IA 2JLXA 1KK0A 2XRMA 3IO5A 4E09A 1DCTA 1IJFA 3VTFA 1ILEA 2GK6A 4LTNA 4ZZ1A 4M6WA 4JENA 3W3ZB 1MIHA 1UEXC 4D5EA 5AVXA 4KH1A 1HYHA 3BAFA 3LPDA 3MPUA 2ZQYA 3J7TA 2AI2A 1JR3E 2GBIA 5AM4A 1V25A 2W6NA 1G1AA 3PGA1 3UMGA 1IFXA 2Y6VA 1F2UB 2LKCA 4LJKA 2Q1TA 3WQSB 1T5HX 1U0RA 2AQ8A 2EQAA 2X8LA 1QJCA 3QELB 4DLUA 3N75A 4J6FA 1W44A 4WXPA 4JLUA 1T26A 5FRDA 3TNDA 2V5AA 3GYBA 4DMMA 3UMCA 5AW7A 1X13A 1C0IA 5FJIA 5FPKA 1MRNA 4I50F 4IY1A 5K6AC 4NBUA 2VDKB 1NUSA 3B1FA 1MPTA 5CAEA 4BX0A 2W93A 1GZ6A 2X8WA 2CWWA 4I36A 4BAGA 1ARZA 1XMVA 1IBLB 3RVNA 3SCZA 4JN6B 1DV2A 1NW8A 2JAPA 2W6CX 3UYKA 4P5EA 4QU8A 4E2WA 5J1SB 4PTYA 3VU8A 1XEXB 3HYCA 3JAWB 5HZMA 3KSMA 1XKLA 2GN1A 4GMFA 1CZRA 2GUGA 3SXUA 3AFOA 3OX1A 3PPWA 1N3LA 1ZCFA 3WLRA 2Y9MB 4H7EA 5J2TF 4E5DA 1LW7A 1JPUA 4NAVA 3BMNA 3DBVO 3TXYA 3QXSA 2PS1A 2QZ9A 5COAA 4HBZA 4Z9BA 5K8LA 3G6KA 5EY5B 1YC2A 2JFOA 5C2JB 2IHZA 2O7RA 2V0NA 2Q6IA 3KFXA 1NUAA 5CB4A 1RPJA 3DO6A 3KXDA 5EE3A 1QQ6A 1JSCA 1Z68A 3IS3A 5IBRA 4V0KA 3M1IA 5FO0A 2POCA 5KX5A 5LVAA 5LD2C 3QOFA 1BO6A 3NYWA 2GNOA 2SNIE 2Z5GA 1YU6A 1WL8A 3ZV3A 1DQRA 5KYXA 13PKA 1QYDA 5KQMA 1YS1X 2JJ8A 3CB2A 3SC2A 1VOTA 4I9FA 4EDFA 2JGDA 2YHIA 3F6YA 3NORA 2O8VA 1Q14A 2K87A 1JILA 2W9XA 4GMDA 5LLSA 2PDAA 3UK0A 1TVCA 4DV0B 1GYRA 4Z9YA 1PG2A 5DBIA 3P9QA 5JRZA 2AFIA 1YULA 2I2CA 2VJMA 1EGHA 1SKAA 3IR5A 4W5QA 2Z5VA 3DC2A 3JD1A 1WMEA 1WUJS 1XSEA 5FLKA 4D9MA 4JMLA 3FZNA 2GN4A 2O0JA 3WQRA 1TIBA 3G89A 2IW1A 1KARA 2VAPA 2JFPA 2ZRJA 3REFA 4B84A 1QG0A 5JYDA 2OGTA 3KTAB 1A72A 1DG1G 3P9XA 4H31A 4NV0A 2PGDA 1E63A 5JATA 5LLDA 4GOKA 1Q0LA 2YN0A 4U8GA 3BL6A 1YDWA 2B8TA 2UYGA 3IAM6 4YWJA 3C5CA 1I4LD 4KG7A 3VOSA 1TTTA 5FL7D 1BX0A 2AYYA 3MWDB 5EE1A 3F4KA 3DWGA 3R5JA 1RM5A 4LY0A 5KTKA 1FDOA 5G41A 5EMMA 1AG9A 3B13B 4D9JA 1XQXA 4RFSA 5EWMA 4TKUB 2CHVA 3MGKA 1D4OA 4LRUA 2EZ4A 4M7RA 4X1IB 1LC0A 2HUPA 2ZTVA 1WB6A 1C1HA 4K8OA 2YUTA 3T4XA 5HKAA 1MIOA 3KQUA 3FTFA 2E18A 5JNSA 2WD7B 3FOZA 1LS6A 3PJRA 2DB3A 1I2BA 3E3MA 3UTCA 4RH1A 1Z07A 4EBBA 2Q6OA 4IVNA 3UEOA 5BW5A 1XCPA 3T7SA 5K0JA 5KVSA 4UBJA 2B5OA 5BYBA 1RQNA 4PTLA 3ZEAA 2ODNA 2X9VA 3UJ9A 4DCOA 1DBPA 1Z4QA 1U8CB 1YA4A 2CCGA 3O75A 3FVVA 4AXBA 3DOEA 3HB0A 4N5NA 2GCIA 3PGLA 1AS2A 3L49A 4B7UA 5C18A 5KWEA 2C8KA 4OJKA 1ND5A 4K8RB 4TKLA 2NZYA 4R5MA 5LBIA 4D98A 3PC6A 3UGTA 2B4KA 2KLHA 4XTRA 4P08A 2AUNA 5GV7A 3MSXA 2BM8A 5KOHA 3Q2KA 4CLHA 1B2RA 2GPJA 1JT2A 1JTEA 1SOAA 2IU4A 2QYOA 3HBLA 3ET4A 4MUJA 2C5BA 2J4FA 1JDBC 4JC5A 4MI3A 1ZXLA 7REQB 4FJ1A 3D5QA 1M8JA 2QT1A 3KUXA 1NYLA 1XDGA 3M6UA 5KYUA 3WGKA 3E23A 3H3XA 4KXQA 4L2IB 2XB9A 3UG6A 2IYUA 3D6UA 2I4NA 3PICA 1PGQA 5AOVA 2EFDB 4KE9A 4KJXA 2V6MA 1BWQA 1RBMA 2BUCA 3LL4A 3ZQJA 3TXXA 3F3KA 1ZEMA 2Y1EA 4RQAA 4DB4A 1J5PA 1ZD2P 2C5SA 1BXZA 2G1JA 5TPWA 2DSNA 1F8FA 3NWJA 4Z6KA 1CR6A 3WRYA 4ZC8A 1AS0A 3MJFA 2LCQA 4C5AA 3GAAA 9MHTA 2VTEA 3B3FA 4NNJA 4BO3A 1F0NA 1Q16A 1GZ3A 1KMNA 3OOWA 2GLXA 1EYZA 1FYXA 4OH7A 4QGHA 2GBLC 4XFDA 4ZVUA 4EF6A 4ZI5A 1ZGGA 5IDWA 2XQFA 2ZS9A 2R2AA 3DDWA 1C9EA 1PJ8A 3U6KA 4NZZA 4PQRA 3A6GA 2F1KA 4AJHA 2QTNA 4LXTA 3P9NA 4C07A 4DEVA 4P2GA 4FMBB 2BVNA 5HMMA 3L5KA 1TPYA 1Y80A 1YNSA 3MJRA 5AOBA 4M22A 3AVTA 4XVUA 4QTTB 3PEUA 3EA0A 3QPAA 1FFCA 2TYSB 3MEQA 4LMAA 4E2ZA 3DUFA 3PCXA 2XCQA 1NZJA 1DG9A 2ZIVB 2ZWAA 3ZXYA 2VRCD 4BVGA 1BGVA 2GCEA 5K2OA 3KHKA 1ANKA 4BXOA 4IJWA 5BV2P 3EDOA 3AC0A 3TZKA 5EJ6A 1F2DA 3C45A 4KSBA 1FRNA 3IR6A 4UEOA 1WF6A 3ZR4B 1G5FA 5ESWA 3DLIA 2AEFA 4PY2A 3RAFC 1N36B 3UGJA 4ZJUA 3ZLJA 2A67A 1U9CA 4BUZA 2FOLA 1T1IA 1GQOA 3BZWA 1IZYA 4ENVA 1H0SA 4URWR 2FSHA 2PR2A 2QG6A 4A0SA 3EPLA 4G5OA 1VCMA 1GPNA 3VO1A 3K9HA 1J0EA 5AOAA 1Z4KA 4LW8A 1T6BY 4OJNA 2QN6A 3NBFA 3WVNA 3VC2A 1VSTA 3GWGA 3Q3GE 5JH7B 3FETA 2Q46A 3EISA 4A27A 1W47A 3THXB 4HGZA 3DZIA 3FPJA 3DKIA 2I71A 5GY7A 1CLUA 3KPWA 4LSMA 3MD0A 3E18A 1UBLS 2JDID 1IXKA 2FW6A 2WNSA 3NGMA 2XCSB 1P3Y1 4MUHA 1JAIA 3JD4A 5CVVA 3BT7A 2ZWOA 4HXEB 5DNYB 3TDKA 4WN9B 3D2CA 1ND6A 1VLLA 2H4JA 2D5BA 1LRKA 3DCNA 1BVRA 1E5TA 2QR3A 4UJ5A 1M8KA 4BKOA 1TEZA 2BM1A 1GNTA 3UKOA 3ZWWA 3M89A 5HTKA 2PHZA 3WGJA 1J8VA 4L0CA 3D0RA 4OY3A 3IKMB 3TZQA 1HKUA 2FRDA 4ICIA 3QVWA 3K1AB 3NR2A 3KUDA 5EESA 3CU5A 3OPVA 1K98A 3P52A 4F9EA 1TMGE 1I7NA 1T3LA 2H5EA 5FPQA 1W4RA 1YQWA 3A28A 2FPMA 2VYQA 4EUHA 4R6WA 4ZDIA 4F91B 1FZTA 1A8PA 2B20A 5SZHB 4PQEA 3EWNA 3EZ6A 1ZJWA 1WY5A 1BHSA 4CQMA 3IVRA 2EBHX 1IY0A 1CX9B 1AK1A 1YZGA 3RS7A 4IDDA 4XOUA 3UQYS 1JYFA 4POOA 2GNPA 4AY2A 1M73E 1X7DA 2QA5A 3EDCA 4RJ2A 1DQYA 4AZTA 2IOFK 4JP3A 1YACA 4WLFA 3HVHA 4PWYA 4G0VA 4YMHA 2OM6A 4OI1A 1EDEA 4BN0A 1VPWA 5LZ7A 4OLAA 2EF0A 4DIFA 1ZD8A 2J6CA 4RXMA 1CY7A 5BW8A 1A7AA 3WBKA 2ZUBA 1SOMA 2ZI5A 4RF5A 2P6RA 4MB6A 2C92A 1P9WA 1IN7A 5C8DA 4ISCA 4BGEA 2X9QA 1CUIA 3WBFA 3ZX5A 1O08A 2HO4A 3HFRA 1ECFA 2GVZC 1NXWA 1U80A 2B7CA 3VNVA 4XSVA 4IRXA 4PV7A 1Q20A 4DSAA 2NN3C 2QJFA 1GUFA 4RLSA 3CZRA 5K0EA 4MRAA 5F7JA 1FJHA 3UK7A 1E98A 1OXBB 2RHWA 1JG3A 4X3CA 3NNNA 3QMWA 1RPZA 2BC9A 2CFRA 1H05A 2NUBA 2ZGVA 4HR7A 4HEHA 4L4UA 3OJEA 2X13A 3HXOA 1I4OA 1M2VA 3MMXA 1YVRA 2W11A 2P9ZA 3B6JA 4IV8A 1NGSA 3D8RA 4BMXA 1BD3A 1H2HA 1QLJA 2WU0A 3R3VA 3NJRA 4YV0A 4J0QA 1ZD3A 4QPNA 2YIDA 4Z7QB 2HF2A 5KJCA 4URUR 2OP1A 1E2UA 3KCNA 4C4TA 2J0SA 2LDBA 3SICE 3L8EA 1FQKA 1XQ6A 3RBAA 4UM7A 3EEFA 1QV9A 4YB8A 3RT9A 2OQIA 3SFZA 4AUNA 4HNGA 2HT1A 1L7MA 1ZW6A 5ALJA 4CI0B 2HMAA 3MT9A 3K0EA 4AL4A 1GSIA 4BVAA 3LSYA 1TLTA 2DCMA 4JB2A 4AO6A 1QRAA 4ALMA 2XUIA 3AFIA 4GGOA 2QBYA 1JXOA 1V7QA 2O0LA 2OFOA 1YNOA 1G2IA 1TAGA 1NVAA 3R75A 4BNFA 1ECGA 5AJTA 5FBHA 3L8HA 5EXEA 16PKA 4ZPJA 4YV7A 5CH5A 2PX4A 3D6VA 4DXHA 1COZA 3IVXA 4BP8A 1B15A 1SVWA 3T1YB 2WYUA 2VNHA 2G76A 4X44A 4YPOA 3K32A 2QP9X 2ZB2A 2ZI6A 2IUSA 2QQ5A 3DTVB 3KEMA 3P20A 1U6IA 3DP7A 4UQOA 2PIDA 1Z0IA 3WZLA 3ZBTA 3FMVA 3R7BA 5DSZA 4BNHA 4D4MA 3ILHA 2JHCA 5DN6A 4NNOA 4EHLA 1P45A 3L3BA 4YREA 1AV6A 3TFQA 4I4TA 1OHHD 2FPIA 4CN9A 1YRAA 4RGQA 3VNSA 4U7DA 3TR5A 2XNCA 4TXHA 5FL3A 1CQIA 1WE2A 3OOSA 4RZQA 4XGKA 5DE3A 5DMXA 3TUIC 1GPKA 4EYSA 3UJNA 2BP7B 2YXPX 2HRBA 1YCDA 4U2FA 2IHKA 2I03A 3CF2A 3HGMA 3F97A 1VCNA 1V1RB 5L3SB 4IFTA 4XZ3A 3MCWA 1QMPA 2IXEA 1Y37A 1X77A 5B7GA 1B8UA 2PKYX 2QD2A 3LGSA 4A1OA 1FA9A 2Z6QA 1IZ9A 4I1PA 1A5AB 4RPLA 3VDQA 4RKRA 1HFEL 1ZJJA 3N53A 2F4VB 4RTOA 1S3FA 3FNEA 3V8PA 3G9QA 1XZEA 4ER5A 1UFKA 2BRUC 3DT8A 4L1KA 2PUCA 4MKZA 2QX4A 2AA3A 3DE6X 1N3BA 1TCBA 2ZAIA 4HGRA 1TFRA 2YNMA 4ZEOA 4WXYB 5E1DA 1W4CA 1VPEA 2PS9A 2V55B 1FFXB 3JSXA 3PXEA 3R77A 3RJMA 3SYKA 5K0TA 3PL1A 5L8VA 3LG2A 5BSFA 4WK6A 4M9UA 5F3RA 1ZQ9A 2R4TA 1FUYB 3SG0A 3AF6A 4PPFA 3NX4A 3ADCA 4RANA 3BF8A 1X86B 3VC1A 5JTUA 2Z98A 1ZM7A 1E1MA 3R09A 3OPYI 3QWAA 5CLHA 4EVIA 1RBQA 2Q5CA 4FZ5A 2M6LA 4GOMD 2QZZA 2J0QA 5CCXA 1PRYA 1U2DC 1WUYA 2DWPA 3M9XA 4CKWA 2O7VA 3HJRA 3HY6A 1B4DA 2I3GA 2XQVA 3ISVA 1P0QA 1W0KA 1RQPA 1IXYA 3JALA 5T3UA 3UOWA 5LOVF 4X7MA 4HEA6 2PBFA 3FDZB 3RH0A 5B7PA 2B83A 3RB8A 5BORA 2ZKIA 2ZW9A 3LAWA 2HSEA 1SU7A 3FYUA 4NENB 5CYOA 5HKLA 2V45A 2X5NA 2P77A 1Z5GA 4I8DA 1C9KA 4R8SA 2B1GA 3GR6A 1C7IA 4J0JA 5E7IA 3TBFA 3V8MA 5AVUA 2HDNB 4A8TA 1H65A 5HIAA 1E0JA 1D6JA 4JIGA 2XUPA 4RFLA 3MUOA 4XM2A 1X38A 1KJIA 4JCOA 3N7UA 4FYVA 4A8JA 2C00A 1FDRA 3TGLA 1KY2A 1R1DA 5THQA 3BHMA 1K3UB 4HY3A 2BELA 4FS3A 1WCXA 2YIVX 3UWPA 3QUSA 4PVCA 3EJWA 1IRIA 4MGYR 5BT8A 1Z2DA 3IQGX 5DYNA 3IB3A 2YXBA 4G0PA 1JB9A 1NKTA 4WIAA 3WBJA 4MW7A 4UCQA 4ZU1X 2NQ8A 1P1BA 5REQB 2VBFA 3ZD7A 5D84A 1IY8A 1YFKA 3ZBQA 5IW8A 4AS2A 3F6EX 4NIMA 1T1SA 4IIFA 1C1XA 5F12A 2GBFA 2K5UA 1T6ZA 3PDHA 4NCKA 1JKJA 1V1MB 3LX8A 4DKJA 1CRWG 4MRPA 3FFAA 2AMJA 3NC0C 5KTTA 1IZ8A 4BP1A 1ODKA 4PYOA 3VR5H 2ZYRA 2P6MA 2PK3A 2OM2A 3EMDA 4ND8A 2DERA 2DBZA 1U2ZA 1SZCA 2PMDA 3QVSA 5EZQA 1LPMA 2HWWA 2OD9A 4EPYA 2OP0A 4Z5XA 2A0KA 3DNMA 4DLZA 4DV4B 3ODPA 3K16A 3H8WA 2XITA 2PZKA 2WF9A 4TT3D 3U9TA 3VDNB 5KTOA 4KTVE 4MO9A 4GX2A 4MRSA 5AK6A 5EUQB 5KS2A 3AFNA 2M6KA 4R8LA 3IV9A 4CR6A 3KP1A 4H6PA 4D79A 1C9YA 4JLDA 4JQYA 4BV2A 5JSHA 4IXTA 4XIIA 1T0JB 1KAEA 2QPOA 3MWLA 1JR2A 1Y5LA 3Q7EA 2F55A 3JRNA 2PCLA 1QCYA 1XTQA 2DWCA 3ZGZA 1IHXA 1DCKA 1NC1A 1KDRA 4YCJA 3V1TC 1X1CA 1WXEA 3UHFA 5B1DA 3H0KA 1R50A 2HC9A 4D3XA 1U9JA 2WYIA 4BFUA 3D4PA 1VKRA 3VOBA 1JS1X 3VU9A 5DNUA 5IJZA 3OJFA 4P0PB 3PQ3A 1NATA 1DB3A 1XN1A 1ZVVA 4UUBA 3IDFA 3TECE 5AFSA 1R0SA 2B4YA 3BERA 4BB5A 3ABRB 2OILA 4O59O 1UM9A 1QU2A 1WKVA 2ZYGA 4RMGA 5JNLA 2X6RA 5HBGA 2FJUA 3RQSA 4QRDA 5JO0A 1SG0A 3OZ7A 5A3VA 1XRSB 3B2NA 5EMNA 3K0BA 3PXAA 1MEEA 4R05A 3OF5A 5JECA 3NIDB 1BHO1 1E2KA 3GJRA 4IFIA 2JLWA 3THWB 2P27A 1Z7BA 3DEZA 2FI1A 3HYTA 5KINB 2VDRB 4BNXA 2O2HA 1ZD1A 2WF7A 4IIXA 5BWCA 1UZLA 4MS3B 5FUYA 3UPTA 3Q7RA 5FV7A 4UD6A 4TUYB 1PDWA 1JECA 3I28A 1ABFA 2HFKA 4YCLA 2JVIA 2DP4E 2R6DA 3PC2A 3R3ZA 4CEJA 1NBAA 3NHRA 5BSEA 2DR2A 2WJ4A 1XQWA 3EW7A 4O2BB 4Q1AA 2YVQA 3BEDA 1J07A 1EDBA 1XL0A 3U0VA 2O2EA 4Q9KA 4IKOA 4X7RA 4Q6WA 2WSLA 5AVRA 5FIUA 3GH3A 1I3NA 3EWAA 1X2EA 3GAMA 3OCJA 3LC0A 1XF9A 2ONZA 2ROQA 2X8JB 4PPQA 1JR4A 5J2UB 3GVPA 4KKVA 3TKLA 2BGNA 1R0KA 2DY0A 5CEJA 1Y3AA 1X8XA 2ENWA 3ZQUA 2ZR0A 3S68A 2O23A 4PYKA 1NF9A 1CZKA 3O8OB 1NN0A 3RFXA 3UXEA 4YUXA 2CYCA 4R1SA 3OQOA 3ZWKA 3AJRA 3EVFA 3QLVA 1RMTA 2GPYA 2JIBA 3VI3B 4F2GA 4MGHA 4Q3DA 3RQIA 1QH0A 2FG7C 2H1CA 2OK7A 3KDPA 5C8XA 2MYTA 1JIKA 2GJ8A 3HUFA 4MV4A 3JQBA 2BE9A 3PE6A 2QYSA 4ZHQB 3S70A 2H31A 1Y3DE 1JF8A 1UZMA 1XBTA 1ZESA 2QTRA 5EFZA 3H19A 4J7CA 3ZHUA 4QRIA 3IPAA 4GXRA 4P31A 4YA6A 5K3EA 3D8BA 3VJMA 3DLAA 3KYDB 4Y7CA 4E3WA 5L51A 2DLCX 4R2KA 3MLAA 3SX4A 3VHRA 1Z35A 3R3SA 1G4HA 1V4NA 4FGWA 4CM8A 3N2ZB 1QZ3A 1DX9A 3EGOA 1EZ1A 2XCUA 4IQ8A 1E3TA 5DM0A 3IX7A 1C4WA 2P6PA 2IDZA 3W5UA 1EAYA 1SCUB 3M33A 2X22A 2R6AA 3DAPA 3IQWA 5K8TA 2EGGA 3NPMA 3P4YA 2NU8B 3E05A 5E4FA 3TYXA 2WWYA 3KWMA 5FNVF 3W2FA 1ORHA 2O3QA 3HP1A 4ZTBA 2VJLA 3HCDA 4M87A 4QYWA 4XYGA 4F3YA 4YT2A 3QXXA 3SE7A 4WMLA 4BMZA 3EYAA 2IXAA 3I30X 3I61A 3H2ZA 1XDBA 3RYHB 3VV3A 1HE5A 1NVKA 2FZCA 3ZWAA 3FR7A 2H1SA 3UMMA 1YA6A 4D26A 1PR6A 1N32B 3D7MA 2R6JA 3K9BA 1M5TA 4AROA 4ZRNA 1WXQA 2JLRA 2GFIA 3IUNA 4ROSA 3KLNA 1CD5A 4H15A 2BFNA 4C06A 5C7YA 1M2JA 3PBKA 4E1AA 4XJVA 1E62A 1PL6A 4EMUA 4CM1A 1HT0A 1O2DA 4KXWA 4MEAA 4J76A 1TD9A 5JO9A 3SSOA 3T1QA 4B80A 3OLYA 5C1PA 1US8A 6LDHA 3JYNA 3B70A 2VRNA 2FW1A 4LGVA 3GNQA 3V4FA 5BSKA 3FSGD 1U8AA 3GRRA 4PO8A 5AKIA 3E7XA 4B2YA 1VE3A 2A84A 2I87A 3GDFA 3GRZA 4EH1A 5IEJA 2YV3A 5I01A 3CRRA 4ZCPA 2FPGA 3JYOA 1BDJA 3SIPA 3I3SR 4AQDA 3G9XA 1RQLA 1E58A 3NIFB 4XJSA 4JYBA 3I5UA 2D5IA 1K4MA 2PM8A 4RXTA 5DNEA 3V2IA 4DTCA 2A9FA 2HMUA 2GZHA 1EWTA 2HRRA 4C89A 5J47A 2YDYA 1KNXA 1KVTA 4NARA 4HB0A 4A2QA 3NUZA 4BV3A 4UVDA 4D41A 4BVHA 1NMZA 3QITA 1HO3A 2WKWA 3W2HA 3A31A 1E2GA 1EXWA 3WIVA 1QQBA 1F17A 1X7XA 5BY2A 2EFCB 1E64A 2VQSA 5ICFA 1XWWA 1G291 1G8MA 1SR8A 2X2FA 4X24A 2OBBA 2AFRA 4F21A 3CVOA 3LRPA 2QRHA 4O25A 3TLGB 1Q95A 4B8YA 5DM60 3B1KA 1SCBA 3Q8MA 2ZITA 2D4HA 5D8DA 2DFTA 4OA8A 1PT7A 1NJ2A 1EG7A 3I5MA 4LCBA 3V1NA 2GYYA 3LXUX 2B35A 3T38A 3UV7A 5CDTA 3T5AA 2A7XA 3O3CA 4O1IA 4UTNA 3GHHA 4M54A 1RXUA 3RC7A 2SCUA 4MW0A 3UF0A 2ZT8A 2PTGA 3VSAA 2XTMA 2EZTA 5JCZA 5CT8A 4QZVA 5KQRA 3I6IA 4RKWA 3UT5A 4TXLA 4EJSB 2Y3IA 1XP8A 3GZNA 3CVYA 4GR4A 4OU4A 4PGMA 3UWSA 1KYXA 2FUNB 3QX9A 4PAQA 3V3TA 2H59A 5DXJA 3KLOA 3T3DA 2FE1A 4AXXA 3PE4A 1NI4A 4W6ZA 4E21A 1O0CA 1ACMA 1A5TA 1DFGA 1FUEA 1WXXA 1AZLA 3ED1A 3KJZA 2WV9A 2O5CA 1CR0A 3LCRA 3BFJA 2G17A 3ZWVA 3WGGA 4RTQA 1JJBA 3I01M 1IBSA 2NVOA 4P1ZA 1CS0A 4CG1A 4KWTA 5A4DA 3HBMA 4BNDA 2X76A 1U5BB 3SYMA 5DTIA 3BRQA 3RFTA 3CISA 4F86A 5KYNA 5LWHA 1TECE 1OYVA 4RK1A 2VA8A 4DAEA 4EB6A 2NWQA 1JGTA 2V6BA 2XDWA 1Q7EA 3DF7A 2UKDA 4RA9A 3WHKA 4FFMA 2ASEA 5HSGA 4IXNA 2R0QC 2O2CA 4M53A 3IBGA 1YF3A 1R7RA 1MA0A 1KR5A 2PPLA 3RSCA 1QLHA 4I55F 4HWTA 5FTWA 3I76A 5JMTA 1FMFA 4YCAA 1E69A 3HR4A 4DRZA 3H9JA 4V0MA 4NK5A 3V2HA 3HDGA 4PYIA 3TS1A 1D2AA 1RQGA 4MWDA 1FFGA 4XSGA 3KJEA 2MYUA 4CF4A 2FG6C 5E9QA 3IE0A 5DX0A 5HZGA 2FUKA 3GT7A 1SOUA 1G9SA 4WKPA 4HG2A 3UPUA 1KI3A 2EKPA 5GGYA 3SPXA 1OT5A 3BGOS 4K9KA 4G4GA 3EUEA 3MWEB 4G81A 4D9BA 3MYYA 5E7QA 5LUBA 2GXSA 5H4HA 1H4TA 3EDRA 4O4IB 2BFBB 1CY1A 2PT7A 1VKHA 2FDRA 3FUCA 3WX0A 3LD9A 2J32A 3RS2A 3E5NA 1WW3A 2OO3A 1P9LA 3KG2A 2BKUA 2XVMA 4Q18A 5FBWB 1T0UA 1S6YA 4K26A 4ZGWA 2PT9A 4O4LB 2WINI 1Z29A 1ZIYA 1CUFA 2V6JA 4Q66C 3IOEA 3CIOA 3IXQA 1PBTA 3PNVA 1U3DA 4G01B 2PRSA 4HK4A 4IIYA 4P4NA 2W6OA 4QPJC 4WXEA 4YDQA 3HTXA 1EM6A 3BJZA 3I2IA 2ZUDA 3BORA 1KKUA 1R15A 2JFWA 1P7YA 1XFAA 4RE5A 4CDGA 4HV4A 3KVOA 3EHEA 1QHHA 2DTXA 2JJQA 3L07A 1QRDA 2PL5A 3OZWA 5B57C 5HIIA 1AK9A 3GU3A 5K4AA 3KX2A 4CCAA 4D0GA 1ODLA 4LF9B 3LVQE 1PD0A 1KZ9A 1ORIA 1ZGBA 2XECA 4Y1FA 3AXSA 3H13A 4YI5A 1P2SA 1YB2A 1B0AA 4NP6A 3T35A 2XUQA 4PC3A 4UCWA 4I50B 4FOLA 1NSFA 4YDRA 5E3IA 1R0BA 3LECA 5KVVA 4FGKA 1BRMA 3DDSA 2WUDA 4BKMA 4YYZA 3AIOA 4QM6A 3BS4A 1FVFA 2O1EA 2FQWA 1ZNXA 3A9WA 2RG1A 3MJDA 1Q2UA 3HBAA 1W59A 1I0ZA 1QFZA 2C83A 1WABA 3DV2A 4RLFA 5IJXA 3I1JA 1RYNA 1IDN1 2BZ0A 4QAQA 3BJEA 3QFFA 1P2TA 4H7KA 4H3HB 3QIAA 4KQWA 1JXQA 5GAJA 1C1DB 1BEZA 1G8AA 1NJSA 1L8QA 1YVEI 1C8BA 1ZINA 2HMYB 4K40A 3QOXA 4P6VF 3GG9A 3MCUA 1JVSA 3MRVA 3DQZA 5DYGA 4ABYA 2BIFA 4YP6A 3K6SA 1FSPA 4CGYA 2IEZA 1JEAA 1Y9EA 3VR3D 1DUVG 4EKDA 1YRHA 3MYRA 1OFUX 3CGWA 4B5LA 3VV2A 4B4WA 2RJ3A 4P81A 4HNTA 4ITUA 1SNYA 3CUTA 3EASA 4U7TB 3V8QA 3B5IA 5BRJA 4V1CB 2D0PB 4LY6A 2ZJ1A 4PM4A 1IWBB 1X0XA 2HSWA 4J1NA 1VYVA 5CFQA 4AUEA 3CVUA 1YA8A 3RKUA 4N0MA 3U7IA 3BL8A 5KC9A 4D8WA 3DDNA 4FHDA 1IN4A 1ST2A 3EAGA 3QE3A 1C50A 4DEXA 2VEDA 2G7MC 3L18A 4MX8A 2Q9UA 3BMXA 3GLSA 3RUPA 2G07A 3C4QA 4BUCA 3R9KA 2OA0A 4ACAA 4MWOA 5FPSA 3U56A 1LLCA 5GPBA 4MYHA 3MCVA 2R66A 4RDXA 2DG2A 2DT8A 4MRMA 3WB9A 1N5JA 4LC0A 5GM1A 4AIRA 1ODJA 4CG0A 3LYHA 4FGUA 2QXYA 1PJ3A 2EKQA 1UMKA 4MV5A 4O2AA 4WHMA 1LBTA 2EJVA 1OY1A 1GGEA 1E5VA 2DZDA 1SUSA 3LWZA 4NZMA 4CKCB 5TS3A 4ZZIA 5CFZA 2Y1WA 4BQOA 2G9UA 2DR0A 4NX2A 1JKMA 5EZ6B 3M6FA 3A14A 4X1KB 4M8NE 1IUPA 1Z0SA 3PVZA 4HSEA 5AI5A 2FFJA 2GOYA 4NABA 1E61A 5AK5A 5G3YA 2FMUA 2JANA 2QTFA 1IQ0A 4TYQA 4U8HA 5BO5A 3JR3A 1N1MA 4QVIA 2CFOA 2R47A 1R8QA 2NPFA 3FGNA 3LTEA 4HVTA 4IKPA 2HFJA 4Y8VA 5DM2A 2XX3A 4D8UA 5J2TA 1K5DA 4CMBA 2Q4RA 1SIBE 3F6SA 1LDYA 1N2JA 1R0XA 1WTCA 2J67A 1D9XA 2R7MA 3BBPA 1RJFA 7GPBA 4YMTA 2KWIA 2DQKA 3ANYB 3EIOA 4OATA 5KPJA 5CT9A 3F4LA 2JBAA 2PWBA 4LXIA 4YRNA 3R0VA 2E4VA 4BN4A 4KBFA 3H5AA 3RS3A 4RY2A 3HKBB 5KSWB 4GVPA 1FXSA 2GEKA 4JLNA 1IWPB 1YQGA 1D4AA 1GKUB 3DOFA 3DL2A 4LZOA 4W5WA 3SDZA 5KEIA 2CCKA 3TQTA 3C3CA 1E9FA 1KVUA 4IH1A 1F1BA 2EHDA 3BE5A 4J4TA 1EK6A 5KOJB 4KYIB 3WRXC 1RFLA 1Y9AA 4FXOA 4LZJA 3LUBA 4TL7A 4F5YA 4KBYA 3L8FA 4AMYA 2DLNA 2P69A 2XYPA 4OU5A 4D0LB 2GZAA 4TWZA 1QRUA 3BGIA 2WF5A 1NU6A 2XUHA 3A1UA 1CPYA 3ZH9B 2JIPA 1NRIA 4DR3B 3A32A 4WCFB 5FX2A 3LUPA 2FK7A 3H5RA 1UBMS 4ZQIA 2PUTA 4M98A 3K71B 3BWCA 3AKEA 2JCGA 1W2HA 3ANXA 1K5GA 5DW0A 3W1VA 1T29A 4Z3KA 3EBLA 4CM7A 2W22A 2BMJA 4UATA 2OBMA 4UTZA 2X0FA 3CVJA 3TEJA 3ONWA 2B94A 4BUJA 4QHYA 2C96A 3EIFA 2VTBB 4MKIA 1C0EA 4EHDA 1XA4A 3GVCA 3QKRB 3DGFC 1E5XA 2Z08A 2W71A 3CE6A 4ANFA 2GF0A 3AMVA 1JG1A 2GX6A 3PP8A 3BRCA 3PQ6A 2ZUWA 1GEEA 2MSEB 4HNAB 2O8DA 1LVUA 3G3EA 1TLFA 1UKCA 3OD5A 4DDWA 3SIWA 3AQIA 1J1IA 4RCZA 3IXLA 3A2LA 2QQGA 2CEAA 2F1HA 1IRXA 4P34A 2J07A 4EFMA 1LKZA 3KJXA 4P7FA 1E4EA 1NOIA 1TJ3A 3G79A 2FEKA 3BQMB 1J2UA 3H18A 5G02A 2QVCA 4PXYA 1OLUA 4F85A 3G0OA 4MA0A 1KSGA 1E1YA 1MFZA 2YWXA 4ZCLA 5K6RA 3KQHA 2VPTA 1RJGA 2FR8A 2VSFA 3QTBA 1GPBA 3FM9A 1XHLA 4Y3UA 4CTJA 4QELA 4TVSA 4EY6A 4J43A 1TIKA 1KRHA 1WXHA 3S1AB 5HUHA 1Z5UA 4DV1B 2BEWA 2VDWA 3AUJB 1ISSA 3HO8A 2G1AA 1KRXA 4QUIA 1Z5VA 2SKEA 4NE2A 3BREA 1I2CA 2J30A 2ZU0C 3DV0A 5G1PA 3RI3A 4B48A 1P6QA 2N0SA 1GJRA 2F67A 2NZWA 3EUFA 3KKZA 4RSRA 4W4TA 2Y05A 3H6GA 2XDQA 1C9NA 4W82A 4UUPA 3WLLA 2QTCA 3HWSA 5EP3A 1H94A 1SELA 3A1EA 2HJWA 2HGZA 5JV5A 5A5VA 5CT6A 3NO4A 3ETLA 2IZ1A 3ELYA 3DMTC 3G2MA 3OEYA 2C82A 3TI9A 4ENUA 3G1TA 3Q6NA 3QHPA 3R7NA 4S1OA 4B3SB 3VKGA 1PO7A 4XD7A 5E2AA 3BHNA 1NX6A 5BWOA 4IJQA 2A86A 4LMRA 5K99A 3OTQA 3QVKA 3V80A 3QE2A 4MGZR 3WWPA 1HYBA 5A0TA 1Z75A 1PVVA 2ZJ0A 3R5KA 5B58T 2XGJA 4MVJH 3H9EO 4KQIA 4HD8A 1CUEA 4RDIA 3KK0A 3OU2A 4NSNA 3ZUGA 2FFQA 1D0SA 2JLYA 3AR8A 721PA 1FLAA 1N0IA 2CKDA 4X45A 3M3DA 2GZ2A 3C3JA 2AJBA 3VYVA 4DYDA 4O1MA 2UZAA 3QWFA 2G4VA 3TKAA 1NHGA 4TKVA 1NJ5A 4JDUA 3HA7A 2IRWA 4I9GA 5AO9A 5H16A 4OJYA 4WJZA 5C52B 4ZZ2A 4CF5A 4YJGB 1CR2A 3NGXA 2VQ3A 2K6GA 3LY8A 2I4OA 1VGRA 1L7VC 5I9MA 5GOTA 2I6UA 2J59A 4OREX 4WZBB 4YRTA 7MHTA 2QAGB 2RCYA 3CONA 3IEPA 2QVGA 3OPYB 1HLGA 4ZK2A 2YJ4A 2PYZA 2AR9A 4BNZA 4BO9A 2EJUA 2W2OA 2NT4A 3WJ7A 4TMVA 5JR3A 3L0YA 3WMWA 3VPAA 1F7UA 2J3EA 1Y7IA 3IOBA 3OD1A 3SIXA 3TQQA 3STWA 4EM6A 1W85A 3SDBA 2Z1MA 1ZAYA 4F97A 4DDVA 4BASA 3SC6A 1ZC3A 2GD2A 2V59A 3F0TA 3AVQA 3WJ2A 2H1LA 2Q2NA 5EZYF 3ZH2A 3ZDYB 1N0UA 1YOVA 2YRFA 3C8MA 4LZPA 1P81A 1CUXA 2QAIA 3GLIB 5AVTA 1H2XA 2X86A 4DOMA 3IUYA 5CA1A 1G0NA 2J7PA 2VRBA 3MRXA 3CF6R 3E7FA 3QVGB 1PTJC 2AOVA 2HCRA 2HMVA 5KZMB 4F4FA 4JEUA 1M7BA 3BVPA 4Q47A 5CM2Z 1DSSG 4MR9A 1MB4A 3KZVA 4WI1A 1IBKB 1F0YA 1YL5A 1Q0RA 1YJCA 1KU6A 4Z53A 1M74A 4QYTA 3CR7A 4AQYB 1ISPA 4CXMA 1GN9A 3X44A 3T9FA 4BV8A 4CKZA 1CEQA 4J2HA 3ZI4A 1CHNA 2VF7A 1U7ZA 2BGKA 2PFGA 3ADOA 3KKKA 1Z33A 3MG9A 1KYIA 4IBOA 2UUOA 4IDQA 4LGYA 1K7FB 5BMVA 2AXQA 3ESRA 4N54A 5F3DA 4Z4GA 3ELDA 3FYCA 4J0FA 4JFAA 1N9GA 3ONFA 3WMFA 2QJRA 2OHHA 4HFNA 2E4ZA 3UOGA 4LN1A 4UBNA 3U62A 4D74A 5IS2A 2GAOA 4BECA 2I62A 2XMRA 1Z4OA 1KOJA 4DPLA 3HYRA 4C29A 4AMZA 1PNTA 3QI7A 1O5IA 4FINA 1C3XA 4Y1RB 4R41A 1CF4A 2E55A 2Z3ZA 2K2QB 1Q21A 2DUWA 2PKCA 3BAZA 1Z7WA 3C3YA 3PDIA 4GR5A 3GJZA 1FJXA 4C3ZA 2VUSA 4HZUA 3A1WA 4NJMB 5F4ZA 3TLEA 2AC2A 3BJMA 3PC4A 3QOWA 3IH5A 3JQ9C 3UGKA 1Z15A 5ECYA 1OW3B 2TMDA 4F2HA 2HEIA 3OA2A 3NHFA 5C8YB 3AHHA 3DUWA 4URVR 2O8CB 1HTWA 3OTOB 2GXQA 2AFVA 1Q7BA 4B79A 1M6WA 1Z6XA 1YS2X 4QQKA 5AW5A 4JJGA 1H2YA 5ILGA 1T8SA 3L4EA 5IYZF 3L8MA 2PPVA 3ZBUA 2GCGA 3V8RA 2DWQA 4LPKA 1GPDG 2ZJFA 3OEWA 2I6XA 4I8XA 2Q2QA 2JAXA 3WKCA 1RWBA 2QM8A 3LDHA 3DC7A 3MGAA 1DP4A 4OQQA 3BXXA 4OB8A 1HE8B 1R5OA 4DZRA 2ZIXA 2EKBA 4BPRA 1Y6FA 1JQBA 3KZMA 4ITRC 2J46A 3V9PA 2XJ4A 3RWBA 2QTVB 1OR8A 1QU3A 2W2PA 4U3JA 5LMNB 3LYUA 1TQ2A 4C4AA 3W3AH 1LCIA 3GOHA 5H02A 4ZMBA 4ALLA 4DIOA 4N76A 1IHUA 3QUQA 2C03A 2L0XA 2IHBA 5MDHA 2ACVA 3LBAA 3L79A 2XCIA 5CLJA 4NDAA 1R9MA 2EG5A 3WKBA 4P80A 4OK6A 2HLDA 2V3VA 4H9GA 4K2AA 3AT1A 3K0HA 4R0VA 3WGOA 1S8NA 3TJMA 1O5TA 1JQ5A 2XMZA 2QUZA 4QUKA 3KQMA 3RUFA 2A3NA 1GOTA 1Y8RA 3L0ZA 3LT4A 1S2NA 1L4LA 1KMQA 2BEUA 3T5GA 3NKVA 1FMTA 1JH8A 1PQ4A 1GN8A 1FVHA 2CUTA 1EJ6A 4F4IA 1TF7A 4CQMD 5KNCA 4OMCA 5T8KA 2HR1A 4LQLA 4Y6OA 5JQGA 4N48A 5H7XA 1DZ3A 2V8BA 1AUXA 3W9UA 2ZSHA 4IR7A 4B0PA 4L75A 4F3TA 1YHNA 4JI1B 1G8SA 2QMYA 3T5TA 1W8DA 4EB6B 3FMIA 4BFXA 1SA0A 4ZQEA 4MR7A 5C31A 1WW2A 4IZHA 1NI5A 2IZ7A 1CQJA 2AJLI 3AI7A 3DZGA 2VL7A 1UWCA 2L2QA 2R8BA 2VK2A 3KELA 3KB8A 3KHSA 4GQIA 3D0QA 2P9TA 1BCSB 1ATZA 3BZBA 4NBRA 4RPGA 1YQEA 1WQ4A 1U9IA 2WZBA 4WZBE 4GYYA 3KT8A 3KKMA 3SXPA 1SG6A 2Z3WA 2VP4A 4I4IA 2C59A 3FSRA 2PRKA 1KBOA 4ND4A 3LQFA 1CRPA 4KB5A 1ZM2A 1UDBA 1I3LA 3OIGA 1U4SA 4WNIA 5IAOA 4I8IA 2GJAA 1CIPA 1P17A 1MDFA 2VCEA 1MN6A 1G8HA 1T10A 2X4IA 2CBZA 2F3TA 3RV3A 3OECA 3DOHA 3PV0A 1ZSVA 1QGUB 3QA9A 1IBRA 3PFNA 5AQ1A 2X1HA 4L08A 4P22A 3OJCA 1K6XA 5DTJA 1V7ZA 4W1RA 4AMVA 4CIVA 3EEIA 1O8CA 2O2YA 1O3YA 2BR4A 1JLMA 5DWQA 3DVLA 3PUVA 4KDFA 2PO5A 4UNQA 2Q0SA 3GLIE 1EFTA 4MKGA 5F2EA 3LY7A 1NLUA 4I0WB 2JH9A 2NNWB 1CNFA 4LXXA 2WYVA 2REXB 2XOKA 4M9ZA 4MIEA 1HWYA 4N3AA 4R40A 4ZVQA 4B7XA 2AYXA 3LNCA 3JD0A 1P5HA 1GDHA 1U6JA 4JT8A 2AK2A 3RK4A 3WDLA 1QGAA 2WIKA 1C3EA 4ZAXA 2BF4A 3IBFA 1R00A 4Q3CA 1MC1A 2B78A 4MRNA 3Q7PA 1Z8DA 3H1FA 2KBFA 2YOHA 4V03A 3IDOA 2VJCA 4IGAA 5EL0A 1ABBA 3PTAA 1UBHS 1W1UA 2X6QA 3CQ9A 2YVLA 3G9ZA 4B2PA 3AR5A 3RFCA 1MCZA 4HAOA 1NQUA 1JEQA 2X5KO 2EDAA 3OEHA 5AHKA 3DA8A 2FXIA 4CRWB 4RQBA 1HBJA 2PVPA 3KV3O 1DQZA 1IJEA 3JVIA 3LZDA 4YK7A 5A03A 3THYB 2Z2ZA 3C2QA 1HYEA 5FOUA 4AJEA 2AH5A 2HSZA 1T1EA 3V4ZA 3BRSA 3DJFA 1FTYA 4HMQA 1PV4A 2GRUA 4V02A 1DG3A 1HT2E 2H08A 2JK0A 3H2YA 3PG5A 4FP9A 3NBUA 4EGFA 2ZE6A 5DN6D 2ZDQA 3DMFA 5EXXA 1T2CA 2RC5A 4UEKA 2NU9B 1JP7A 4WERA 5HTOA 4PYNA 2PWYA 2HRZA 4EUSA 2RGGA 3QYPA 4IO1A 4O63O 3ROPA 1T8TA 1YR6A 3O4VA 4IMRA 4WECA 1LLDA 2FN7A 1USIA 1G8PA 1V3QE 1HQDA 1NBMA 1SB9A 2Q1WA 5AJHA 1D2EA 1DELA 3AJ9A 3D7LA 1G5HA 1KJNA 3DG9A 3OCXA 3R3YA 5FKJA 3WV4A 3I6QA 3SMQA 3PGJA 3RIMA 5BSGA 3P2JA 5JRJA 3P7MA 1W73A 4HQRA 4X61A 4RE6A 4KQHA 3B6ZA 3N6VA 4Q4HB 2W4MA 1TIPA 3K92A 2IELA 1F06A 2H7XA 3OQJA 4PWZA 1DTWB 2PJUA 1DJNA 2YNMD 2YMMA 2YY6A 4YAWA 2HI0A 4DHWA 2XD9A 1H93A 4R1QA 3TVDA 4GE3A 4RVSA 1NQVA 4AMBA 1ZP6A 5JNTA 1ODSA 4MUIA 4PNEA 4JLOA 1X1QA 1JJVA 1BIFA 3DB1A 3RYFA 1SK8A 5BWMA 1VPDA 2YW9A 2AI1A 2FZGA 4MQBA 4CT4B 1R37A 4J7AA 3KSZO 3FB4A 4QTUB 4RVNA 2R4UA 5H5JA 5TF0A 3KYBA 4PU0A 3SBXA 1XDDA 5JVDB 4Q37A 8OHMA 4F56A 4RGVA 1YZYA 2FE4A 2Z6VA 2Z8YA 3IP5A 2HADA 2AQHA 2QTMA 1RRVA 1AQJA 2VSYA 2Q3LA 4IF6A 3VU3A 3HCBA 1EFHA 3WYEA 3ICVA 5KKCA 1YK0A 3QY9A 3B3GA 3O94A 5JXJA 3AH8A 2JHGA 3CPSA 5JZSA 3PXBA 1KC1A 1ZIPA 4MZXA 3P32A 5F73A 1FRQA 2ECOA 2GYVA 3A70A 5EEGA 2V6IA 3ZY2A 2CL7X 1EGAA 5CB0A 3WAJA 5B30A 4NK4A 5EIAA 4CNQA 2XPCA 4ROTA 3MHTA 2O8EA 3IV6A 2ZJ2A 3OFNA 3WP0A 1NJ6A 1EUZA 1R8YA 1U2RA 3KQPA 1U94A 1DJLA 1YZUA 3QELA 3D0KA 4BLRA 3H4TA 1ZGAA 3U3DA 2AT1A 3BD9A 2FPXA 3AJEA 3GNSA 2XZDA 1XMQB 1ACLA 4TWIA 1KJQA 5E6SB 5K0LA 3WRYC 2GH1A 3F96A 4AZ0B 3RVBA 1ZAKA 2D5CA 2B7BA 3GROA 4TZTA 3EAFA 3SZ3A 4KXNA 4DFDA 3B38A 2GF9A 4OHVA 4Q7EA 2IDJA 3T3PB 5K4GA 2X3FA 2F3SA 1KY4A 4HZGA 2H2FA 2VFAA 4KPEC 4JNCA 2VT7A 4KR6A 2C0PA 1JPVA 3FXAA 2OUKA 4NH0A 2OY0A 2QRVB 2FQ1A 3R20A 5M3BA 1EHYA 1T1JA 3UJ3X 3QX3A 3EPRA 2HXSA 3SXJA 1PS8A 2CD7A 2X7XA 3KUKA 4DJAA 3MBKA 3GZ4A 2O6HA 3U9SA 1OV6A 3WLJA 3NASA 4YRJA 1RM3A 1C2TA 2F8LA 3HDQA 4Q6BA 5LSAA 5FUVA 4CR8A 2AEEA 4RD4A 1VSBA 2XMQA 1N6PA 2H16A 1M2EA 1AT1A 1I01A 4R1LA 1C80A 1P9OA 1UCFA 1UXHA 2PX0A 3FYHA 4MRRA 1HF3A 5FNVB 1Z2AA 4KQ1A 4QQ8A 3K96A 4ZO9A 5KNBH 4D4IA 1LBIA 4WNYA 2VDJA 2G6TA 3O91A 1R16A 2NSDA 3OQ1A 3EZ9A 3VHLB 3K5HA 2IIVA 4QIHA 2FCAA 2QYHA 3G8DA 4MS4A 4BCBA 4DYVA 2Z57A 2RGBA 1OH5A 1NMXA 3GH1A 3VDRA 4CDMA 3ZDQA 4MVJE 1W88A 2PT5A 1V9SA 5EWLA 3RVLA 4U2BA 1CRQA 3UICA 1JIUA 4CKEB 4C01A 3GGDA 1OBHA 1PJZA 5JAZA 5KB3A 4DNFA 1PR3A 1OI7A 5IJWA 1RC0A 3ROKA 1G7RA 1PNOA 1BYIA 4MNTA 3V1LA 1RHQA 3U09A 4WLEA 3JQFA 2DUUA 4PPGA 3AKZA 4IKEA 2OK8A 3NC1C 3GP8A 2C2ZA 2CD9A 1U3VA 2FRDC 3MJTA 4PX3A 2JFGA 3FF1A 3PSHA 4BFZA 1CY8A 1KFKB 4TTTS 1X7GA 2F1RA 3N2EA 3TOXA 1M0TA 4BX2A 4YCMA 3MAGA 2OOSA 3NM5A 1TGVA 1THMA 3IVGA 1ISRA 2JA1A 2Y77A 2XZPA 3OOJA 4H77A 4LKRA 4M9RA 5DHPA 5BR7A 5DN9A 1KFEB 2R11A 4F3KA 1NY6A 4HF7A 2C9YA 4B1FA 1D2GA 5I51A 2VXCA 1XZCA 1NPTO 1XJ5A 1DBRA 2LRHA 2VYND 3R5SA 4FEAA 4GP9A 1XTTA 2RGNC 2F48A 3FI9A 1MT0A 4LJLA 5B4UA 3R7LA 1HOTA 2OKGA 4NNPA 1NONA 2ATEA 2MIIA 5EUMA 1MQSA 2CYBA 1LF0A 2YV5A 4UAGA 1G9TA 2PGXA 4GLOA 5DVZA 1ZJ4A 1NZDA 2PJRA 1G21B 1JWAB 4LCEA 2O5EA 1T2NA 4CV3A 5ESRA 5L3QA 4QICA 3HZRA 4FFDA 2IWHA 4WACA 2YXEA 3C70A 2O1WA 3TTXA 4FN5A 3ZVNA 3VPBA 4RENA 2GB4A 2BUAA 3QVJA 3STHA 3X1KA 4TV8B 4EPTA 1QZUA 2ZBFA 3OSUA 4XQ0A 3MWYW 1K8RA 3WC4A 3ZI0A 3G5MA 4DRYA 2B34A 1RYHA 1EFVB 3IAS1 2Q99A 1FP4A 3IT0A 2C2MA 1VLJA 3CYFA 3PB3A 4PSDA 3A2MA 1JTFA 2D00A 3S1LA 4QNRA 2CE2X 3UMSA 2AQKA 4RTMA 2X0KA 4Z1OA 1UUFA 2AIRA 3U4GA 1GNLA 3Q0TA 1PJ4A 4IDEA 3DW1X 4GM4A 3HGQA 1AUPA 1DO8A 3AO0B 4HH3C 1RRPA 3KQQA 2I65A 2XZLA 1Z5PA 1T34A 4O6VA 4HC4A 4Q34A 4DJTA 4YRMA 4RHEA 1QR6A 3NW9A 4AZSA 3M1YA 3M4JA 4QYMA 2MHCA 1OWOA 4E51A 2CNDA 2ZIAA 4LJSA 5IPFA 4BFVA 4CMKA 4RKQA 4C7OB 3KTFA 4ZQFA 5I9SA 3VPHA 3Q10A 2CFTA 5FEMA 2GPBA 1VDZA 2BWJA 4UCXA 3L6UA 2MSDB 2I78A 2QG4A 5DYWA 3VZRA 3DKRA 1E0SA 4JNKA 4DMFA 2G70A 2YJ5A 4ZI7B 5AVJA 2FLWA 4ONEA 5KMGA 1SD5A 1XKQA 4KXFB 2IBSA 2GZSA 4NCHA 2EFEB 2GR9A 2QVLA 4BBJA 3Q7QA 1UK7A 4PFKA 3A6DA 4MZDA 1FJ2A 3LQQA 4UC0A 4X1YA 2EF1A 3TDMA 5K0FA 3AY6A 1EEXB 4UDNA 3RABA 1ZH0A 3H8VA 4FHCA 4CKYA 4F4DA 1K88A 1T4CB 2DRIA 2Z83A 1NVFA 4XD2A 2B2NA 4HNVA 4S1NA 1SHKA 5K0BA 2BI8A 3CX8A 4FDMA 2RBKA 1CEXA 4R2WA 5A7GA 2I1QA 2R5NA 2BOVA 3BH6A 5ITSA 1H5NA 2OG1A 5L7WA 2IP4A 3G9UA 4CNBA 5FEUA 3HHEA 1V3UA 3HDVA 3RREA 3L7AA 1YQDA 1ZVQA 1I0IA 1FZQA 2F17A 5FBQB 1EGVB 1QRRA 2AN4A 4JI2B 1L7EA 3MB5A 3PUXA 3M6MD 2WV7A 2WOJA 3QKUA 5CNIA 1AVTA 2X0EA 3IIMA 3THXA 1P0FA 1XD8A 5EIFA 5AJUA 2VP0A 5EJ9A 2H63A 3A6ZA 1K9SA 2ISQA 1A2QA 3E58A 3BD6A 1VG9B 5K20A 1X19A 3EC7A 4O4JA 1WM1A 5L3ZA 1DARA 2VHVA 1EX1A 2DQYA 1HTTA 3T5BA 2YFYA 3NONA 3U40A 4B82A 2QTGA 5DWDA 2ERXA 1MDBA 2IYSA 2YNMC 2EP5A 1H5QA 4GZ6A 4I55A 4LA4A 4PRZA 4L8LA 3EPHA 4Q21A 3RVJA 1J9EA 1AA6A 1AN0A 4U7WA 1DO2A 2GAIA 3E1KA 5E9JA 1VPLA 2B92A 3KQOA 3EXFA 4GLLA 3RRXA 3VC3A 1LK7A 3A9TA 5CDSA 1C8VB 3QPDA 3UWMA 3DBHA 4NMWA 1GZSA 4XDGA 3VO2A 2XA9A 4X3OA 4XLTA 3K7EA 2WYWA 3FCYA 4CYMA 1CB0A 5CDFA 1K4KA 2HBYA 2PX5A 4ID9A 4Y9DA 3DP9A 3I09A 1V47A 2ODBA 4EENA 1S7GA 3FI0A 1WWKA 3GBPA 3QVXA 1QV7A 3NVDA 4OX9Y 3TX2A 5DU2A 2ZULA 2LIPA 3G5TA 5DBGA 4XLZA 3U4CA 2PSHA 1HEUA 2H5IA 4I66A 1ZRNA 4O33A 1FTWA 2BBOA 5MGNA 1ZLXA 1F8GA 3JTMA 3W5CA 3LC7O 5LB2A 2NZXA 4PLHA 1G20A 3FYUC 3AM4A 1ESDA 1LDEA 3MINB 3LDAA 2QX8A 5A05A 4QPCA 4BWFB 3AOEA 5UKDA 4AKIA 1CQZA 5FD8A 1P2UA 4IDGA 4CV2A 3ND9A 3FLBA 4EHNA 1M76A 4KP7A 1V4BA 4QATA 4Q24A 4Z4EA 1N5KA 2JFXA 1N6KA 3CLUD 2NVUA 5F9MA 5SY9A 2ZP1A 2GSDA 1E9SA 3EJ6A 3N0WA 1A2BA 1Y63A 1I36A 5L95A 1JV2B 2IEYA 2V7PA 1BE0A 2ZZKA 3WYFA 5BP7A 5IULC 1H8HA 4L7QA 1G0OA 4MQEA 3I4LA 1GQFA 4F9TA 1EA5A 3C87A 1AQYA 4HWPA 1JFTA 4FFVA 4D6YA 1MJFA 2WABA 5BOSB 2YIJA 4R9NA 3G68A 1VHWA 2A4KA 2O1SA 4Y1EA 3K5WA 1TRHA 2GN8A 4FDLA 2P2GA 2D0IA 4BQRA 4QVGA 3W9BA 3QUCA 3QXCA 1VKNA 1YR9A 2RI6A 3EIUA 3IB6A 4HX9A 4RELA 1GUBA 5H68A 5HIMA 5J4HA 3K9FC 1VB5A 3NVKI 3IEMA 3GJ5A 2JI4A 3GHYA 4GC5A 3AVUA 1E1RA 3RS4A 3FBWA 4D97A 2AKEA 4ARSA 1YMUA 5LQKA 2R1VB 4Q4JA 3V7UA 1JZTA 3CJTA 1HG0A 4L73A 3K0AA 3ECAA 5FYDA 1ZCAA 4CL0A 2H4ZA 2QD5A 4YGXB 4BRUA 1XCLA 2OV6A 3FY4A 1PK9A 1Q6YA 4UTOA 2Q3CA 1OLSB 4FFBB 5KPDA 4QDUA 5FOSA 5EYPA 1C0PA 3WR5A 4BRZA 2REQB 3Q2IA 2Q3FA 3H2SA 1J5XA 3AEUA 3BDIA 3N58A 4LFCB 4NATA 4DL9A 1EVIA 3CH4B 2ON6A 1M1XB 3DNPA 3GY0A 5ITWA 3GFFA 1P33A 4ZCMA 2WWWA 2AVDA 1GCIA 2OCDA 4I46A 4KE8A 2OBYA 3N8DA 1DLIA 1ZBQA 3H17A 4AO7A 3OI7A 2Z43A 1NYTA 4XCQA 1B2LA 1G1MA 1VJ5A 2VJYA 3OCYA 1ZIOA 5AXCA 3A4LA 4D45A 3VSEA 3ABSB 3AXTA 3PRYA 3E48A 3AFHA 3EDMA