2QTTA

Crystal structure of arabidopsis thaliana 5'-methylthioadenosine nucleosidase in complex with formycin a
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
248
structure length
248
Chain Sequence
b'SEILRPISSVVFVIAMQAEALPLVNKFGLSETTDSPLGKGLPWVLYHGVHKDLRINVVCPGRDAALGIDSVGTVPASLITFASIQALKPDIIINAGTCGGFKVKGANIGDVFLVSDVVFHDRRIPIPMFDLYGVGLRQAFSTPNLLKELNLKIGRLSTGDSLDMSTQDETLIIANDATLKDMEGAAVAYVADLLKIPVVFLKAVTDLVDGDKPTAEEFLQNLTVVTAALEGTATKVINFINGRNLSDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-methylthioadenosine nucleosidase
molecule tags Hydrolase
source organism Arabidopsis thaliana
publication title Molecular determinants of substrate specificity in plant 5'-methylthioadenosine nucleosidases.
pubmed doi rcsb
total genus 80
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature ec 3.2.2.9: Adenosylhomocysteine nucleosidase.
pdb deposition date 2007-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qttA00
2QPLA 1VFNA 4M3NA 4GKAA 4KN5A 1CB0A 1OTYA 1ZL2A 1ODLA 3OZEA 1VHJA 1PK9A 1YR3A 4PNPA 3UAZA 1G2OA 1RXYA 1T8WA 2OC4A 3U40A 1PR6A 1RYZA 3BJEA 5EUBA 5F73A 3GGSA 5IFKA 4D98A 5CCEA 3EEIA 4M7WA 4QEZA 1U1GA 1JDTA 4TXJA 4BMXA 3DF9A 2A0YA 1TCVA 1A9OA 3KUKA 1CG6A 5B7PA 1RXUA 4QASA 1LV8A 4BN0A 5CXQA 1WTAA 3BSFA 3E0QA 2ON6A 4DABA 4WKCA 4WKOA 1SD1A 2HWUA 4R2WA 1JE1A 4OJTA 3FOWA 1Y6QA 4MCIA 1T8YA 2ISCA 4H1TA 1OV6A 3DJFA 4LDNA 4LNAA 1SJ9A 3LA8A 1A9RA 3IEXA 5I3CA 3LGSA 1U1CA 2AC7A 3ONVA 4YNBA 3D1VA 2A0WA 4WKNA 1YQUA 4L5YA 1PBNA 1JDUA 5CYGA 4D8VA 5DK6A 1YQQA 4YJKA 4TXHA 1V2HE 4RJ2A 4D8XA 3OOHA 4GMHA 4MCHA 1V4NA 1RXCA 2I4TA 5IU6A 3T94A 1PKEA 1A9SA 1I80A 2AI3A 3PHBE 4TXNA 1Y1QA 4JWTA 2IQ5A 4DARA 3PNSA 4YO8A 2PGAA 4D8YA 4MARA 5C80A 4DA6A 3DP9A 1B8NA 1RFGE 4DA8A 2QSUA 2HRDA 1TGYA 3OOEA 4OGLA 3E9RA 5F7XA 1Z39A 1TGVA 2B94A 3O6VA 5F78A 3K8QA 3UAYA 1B8OA 5FAKA 3PHCA 1RT9A 3NM4A 4K6OA 3NM6B 1PR0A 1T8RA 1T0UA 1Y1SA 1Z36A 4LKRA 2OC9A 4F3KA 4LZWA 1JDVA 1U1FA 2H8GA 5F7ZA 3P0FA 3BL6A 1JP7A 4OEHA 5JPCA 4QATA 5F7OA 3SCZA 3EMVA 4TTJA 1A9QA 1ODJA 1ZOSA 4YMLA 1Q1GA 2BSXA 3FAZA 3LBAA 4DA0A 5EFOA 4DAEA 1K9SA 5CYFA 1PR4A 3OZCA 3KU4A 4P54A 2AI2A 2QTTA 4F2PA 1Z5OA 4X24A 1JYSA 1U1EA 4TS9A 4R31A 1Z35A 1RCTE 4L5CA 4TS3A 4QAQA 1TCUA 5CXSA 1U1DA 1LX7A 2A8YA 3FUCA 4BMZA 3FWPA 3NBQA 1PK7A 4L6IA 3DDOA 1Y6RA 1XE3A 3OPVA 4EARA 1N3IA 3MB8A 3DPSA 4LNHA 1Z34A 4JOSA 4L0MA 1SD2A 4QFBA 3TL6A 4F3CA 1OTXA 2XRFA 1RR6A 3QPBA 2I8AA 2QDKA 1ECPA 4D9HA 4ECEA 3E9ZA 3P0EA 3UAXA 1PF7E 1PW7A 2AI1A 1T8SA 4NSNA 5KB3A 1LVUA 4F1WA 1PR2A 1SQ6A 4DAOA 1NW4A 1V45E 1Z5NA 5CCDA 1ODKA 4GLFA 1JDZA 4M1EA 1YBFA 1PR5A 1YRYE 5ETJA 2Q7OE 2RJ3A 2P4SA 4R2XA 4DA7A 4BMYA 3KVYA 1OVGA 3NM5A 1A9PA 1Z5PA 4G89A 1ULAA 1M73E 4L5AA 3ODGA 3IOMA 4JP5A 3MMSA 2A0XA 4GLJA 4TTAA 4PR3A 1VMKA 4OY3A 2GUWA 3C74A 3ENZA 1JE0A 4G41A 4WKBA 4TYMA 3EUFA 1K3FA 1PR1A 3KVRA 3FNQA 1ODIA 1PWYE 5B7NA 1V3QE 3GB9A 3OZDA 3FB1A 1ULBA 4OF4A 1OUMA 1NC3A 4E1VA 3F8WA 1FXUA 4QARA 1JPVA 3UAWA 5K1ZA 2OXFA 5F77A 1OU4A 3BGSA 3OF3A 4NY1A 4TTIA 4G8JA 3KHSA 1Z37A 5B7GA 1JDSA 1Z38A 4EB8A 4U2KA 3OCCA 4F2WA 4TXMA 1RXSA 2HSWA 3EUEA 4DANA 3PNPA 4NS1A 3K8OE 1TD1A 1NC1A 4FFSA 2HN9A 3INYA 4IP0A 1C3XA 4UC0A 4WKPA 5EPUA 1A9TA 2OECA 1QE5A 3UAVA 5F76A 1V41E 5F7JA 4TXLA 3OZBA 3UT6A 5B7QA 4I2VA 1K27A 1A69A 3O4VA 1V48A 1VHWA 1Z33A 1Y1RA 1RSZA 3KVVA 4OGKA 2QTGA 1Y1TA
chains in the Genus database with same CATH superfamily
3N53A 2VEDA 4NZMA 3P8ZA 4U7WA 3WA7A 1JPUA 5E4FA 3NEAA 1QNLA 2AS0A 4FNAA 1H4VB 4B4UA 4PG7A 3ZJYA 2O2SA 3U48A 3DPIA 1G1AA 4D9JA 1XKTA 5DNUA 4RVGA 2HIAA 2BN4A 2Q1TA 2EG5A 4Z9AA 1G2OA 5JJLA 1W581 3QWBA 3L43A 3QF4A 2R25B 2OZLB 1P74A 3GLGB 2WUGA 3FF4A 2ATVA 8ATCA 3FPGA 3TTWA 1M2NA 1PR6A 1TYCA 4N39A 2V9ZA 2PZKA 1U98A 1WXWA 5KYYA 5EP1A 4QUJA 1LXCA 1XL0A 3TE7A 1GL3A 4DEXA 3PHJA 4RV5A 3CNQS 1ZUIA 2XBMA 2AQIA 1C1XA 2BL4A 1UBJS 1U2GA 2H48A 3K30A 2IIVA 4NNPA 2NPIA 3W78A 1NVXQ 3ZI4A 4C2BA 3DF9A 3K0SA 4UNRA 1RYHA 2G5CA 1TCVA 2C98A 4HGNA 4EJSC 2HW8A 4EAQA 4V38A 1WVIA 3MTIA 4R8SA 4MH0R 2JIOA 3PNMA 3TGPA 2G88A 4M38A 4OQPA 3H4VA 3KJIA 4KJZA 3RJ5A 2Y1KA 4Z4GA 1C3VA 3KAPA 2B8WA 3TRJA 1NUTA 4OMCA 4MDHA 3DVRX 4YRBA 3DAOA 1VHLA 2R6GA 4TLEA 4PWZA 1CP3A 2Q9CA 4Z3DA 3ORYA 1UPCA 3TKAA 3DKIA 3WLTA 1N9GB 1PBTA 2FQWA 4OXYA 4PHHA 4QO8A 1G6OA 4I1RA 4KQIA 5AKEA 1KYWA 1VGVA 3EVBA 1TM5E 1Z4JA 4R1MA 3UJHA 4DXAA 4PNEA 3R6LA 4LHVA 4C4SA 5K03A 3IOYA 4DJDC 1D0VA 4K05A 4CU5A 3IS3A 5F3DA 4ASUD 2OM2A 1RM5A 2P2SA 5TIIA 4GAEA 1ECLA 3KQPA 3U56A 4HPJB 3IR7A 1DTEA 1UBEA 4XUEA 5TGZA 1ESDA 4RDCA 4NE2A 5DSTA 1R2QA 1JQJC 2R8RA 2WHYA 1VKHA 4NAHA 2WA2A 4TUYA 1KK3A 4RQAA 5IULC 2QMQA 2Q2QA 1RQRA 2AX3A 1QZXA 2VT6A 4LRUA 3WI7A 1WDWB 2NO1A 1PJAA 4AJ4A 2O0HA 2RGUA 2DQKA 2D8MA 1EFAA 2WW8A 2KI5A 3VSDA 2VNKA 4OHBA 4P5DA 5FTWA 2IOHA 2P3QA 4P86A 3UAOA 4DV1B 3GLUA 3QEAZ 1SOAA 2BGJA 2XKBA 3BIOA 3MRSA 4R54A 4X44A 5E3HA 4WKNA 5LKAA 1U0HC 3A9RA 3OQVA 1Z29A 3QFFA 4Q9NA 2O6HA 1UDXA 2VJMA 1ZR4A 5IXYA 2ECOA 2GK3A 2IHUA 2IDZA 2OVBA 1S7CA 4QELA 3TEJA 3KR0A 4F96A 3OT1A 3UT5B 2Y0PA 4I1PA 3W5HA 1Q1BA 3EULA 3KYJB 1C3OB 1DJPA 4G0NA 4IFBA 1MORA 1Y3FE 1GWNA 4AL4A 1G21A 3L02A 1WY7A 4K9DA 2QTCA 2W2OA 1XLTC 2WE7A 4RXMA 2BONA 5JTUA 2NUAB 3TUJC 4DIEA 3QSYA 2XZDA 5ED0A 5D85A 1G6KA 1YE8A 5IUJC 1YL6A 3CF4A 2GERA 3FETA 3GEIA 5AM5A 5BMVA 2XE6A 4EH1A 3DAYA 5IX8A 1EXWA 1U7HA 2JCXA 5KWSA 1LRKA 1WW3A 3G1UA 1A82A 4L6AA 1Q7BA 2PUWA 3OZXA 1Q0UA 1Y82A 2YHIA 3V42A 3JQQA 3SICE 1XRPA 2V03A 1G3QA 4UW9A 1C4XA 4JJIA 3RSQA 2A4KA 1KQNA 1SFRA 1RWVA 1Z5ZA 3CV3A 4TXNA 3TIVA 4JA0A 4FGJA 4U7TB 1NMZA 1OWLA 4HQOA 4RH1A 4JC0A 4Q4HA 5ALEA 3GLRA 3ANNA 3O94A 3ABRB 5EMMA 3EZXA 1QV7A 4TWIA 5ALSA 5A3VA 2DQYA 2DGDA 3KJHA 4V0MA 4LJKA 4GPTA 421PA 4XTRA 2D2XA 1C1HA 4UOEA 2J09A 4CEJA 3VHLB 5JH7F 3DP9A 3T3PB 1B8NA 1RFGE 2TECE 4M1SA 1EA5A 5IUKC 3QUAA 3QVWA 3SX2A 2XYVA 4LZZA 4ZJUA 4XIIA 4HX5A 5DYTA 1E77A 1O95D 5LQJA 3SZLA 3LXRA 1JEYA 5TQ0B 4CKCA 4Q05A 2IC5A 3T0FA 4N76A 1YJAA 2B3DA 3ZY4A 3H2HA 3LPMA 4DQ0A 1L3IA 3HU1A 2OQRA 2BGRA 4Y9SA 4HB4A 3U60B 1GPNA 5C0OE 3UANA 4C6TA 4CKEA 1DG3A 2C5EA 2B69A 1FUKA 5FOUA 2QY6A 5D01A 3DVAA 5KDOA 3D6NB 3STVA 3CN7A 1E1KA 2YQZA 3MRXA 5AVVA 3E18A 2IHBA 5LZ7A 3DP7A 1XI2A 1YB6A 3TSZA 2BZ1A 1QGYA 1W5BA 2ROQA 1E4EA 2IZOA 4UU8A 2I80A 3IMFA 3K0CA 3ROTA 1IXKA 1MR3F 1GGNA 3BMQA 5DGTA 4AK9A 3OLWA 4DADA 5AMXA 4ZTBA 3DB2A 1OPXA 4G0QA 1I01A 3FDZB 5AJVB 3SU8A 1WMDA 2VP2A 4Q4CA 3DL7A 1T36B 1EFVB 2GNPA 4IICA 5ALPA 2REQA 3LL4A 3VVBA 4GWGA 3QEBZ 5FPKA 2Q3JA 4QO7A 3HMQA 4HNQA 3IRUA 5L4LA 4RTOA 3KX2A 1D2RA 2OK8A 1KVUA 1UK9A 2VNSA 3A6EA 3KPWA 3PGXA 4ZGGA 2JEYA 1NJSA 3EMVA 2XCSB 3C6BA 4KO2S 3OX4A 4S1VA 4BVHA 1ZUNB 2AJCA 1M1XB 1YR6A 3PRKE 5F2KA 1S2NA 4KXQA 2WWGA 5EERA 3CVVA 1IUKA 1RP7A 3BD8A 2H1OA 4JL5A 3W04A 4DF3A 4DB2A 1RYYA 3OE1A 1IXSB 2VP4A 3BE8A 4RO0A 4EY5A 1T9CA 1UH5A 4BKPA 2IS2A 2CSUA 1N6OA 2HREA 2OHOA 2Q4BA 5LA6B 3G0HA 3COZA 4TMWA 2YFKA 5E6SB 1G8JA 1A7KA 5FNVB 3G9QA 4LG1A 1RXIA 4MKRA 4R2LA 2YMMA 1EQAA 1D2GA 2ZXEA 2H5JA 5JYDA 5EMJA 3PSHA 3MCUA 3L0OA 2Y66A 1V5EA 4WNYA 2PMEA 3ESXA 1J8QA 4NYMQ 1ZK2A 4M8NE 5EIBC 4ADSG 1BMTA 2C29D 4B74A 3AHGA 2ZXUA 3EXIA 1CQZA 3PKIA 4Q39A 2HLDA 1PS9A 3KCQA 2Y1EA 1QKJA 3KOZA 2Q5EA 1KI3A 3VGPA 2LRHA 721PA 4QDUA 1XQYA 2IA5A 4N8EA 1RLOA 1AMOA 1ZCFA 2JJ1D 3I1IA 4CIAA 2DWQA 3I2JA 4M9SA 3LHDA 3VTZA 1EK2A 3UC5A 5IBRA 1T25A 1N2SA 1EUQA 1YK1A 1HETA 4JENA 1GSAA 2BFDA 4RPJA 3C5WP 2XNKA 2XRMA 2ZRBA 5FULA 5DI9A 5KOYA 4KBFA 2IBTA 4G25A 2AG0A 4DCUA 2JI7A 3FGNA 1TX4B 2VJCA 3ZW8A 3DVAB 4CV2A 4YREA 1BX0A 2BW0A 1A97A 1P2SA 1USGA 1AGXA 3E58A 3JQ9C 1QHEA 1DAGA 4O1MA 1I2DA 4TSFD 5F21A 5FPSA 5CFQA 5DNYB 2WWYA 1PK7A 4LF9B 4Q4AA 4S2UA 3BORA 5E6RB 3ZHSA 1NQWA 4B79A 2BKEA 3QXHA 3FCXA 1HYEA 3PIRA 1JTEA 4TV8B 4DLTA 3LZ6A 1W0CA 1T6BY 3O95A 4P2BA 2QPTA 5IRCD 4TTPA 4B81A 4KWTA 3HK2A 1YDEA 3TRFA 2QXYA 3N58A 2QTBA 3W1VA 3MJRA 4HFNA 4I4CA 2PBZA 2QUAA 4KGXA 4CJXA 3BJRA 1CLUA 4HEJA 4EM6A 2HTEA 4KE7A 4CF3A 3H5RA 4YY3B 5BNTA 3IYLW 4HZUB 5B3JA 1ACJA 2RI0A 1RJFA 3CBQA 3PP8A 4JVNA 1MDFA 3QF4B 2QD1A 4Y6PA 5DU2A 3BKWA 4I9UA 1P4GA 5IVHA 1SD2A 4JQOA 5ALXA 1IN4A 3W4KA 2OMKA 2CE7A 4PZLA 2VK2A 3OZUA 4AG6A 5ITWA 1Z2AA 4NJMB 5FLEX 2LXNA 1JSLA 4R1TA 5A7FA 4R71A 3LF2A 3VV2A 4EHLA 4EPTA 5KKNB 3CPSA 3SSNA 3TOZA 1N77A 4HDSB 4NRDA 3TX2A 4A15A 5FTJA 3BDVA 2VH2A 3N6RA 1P5ZB 4WCFA 2XMPA 5PGMA 1UBHS 3N76A 5AM3A 4B3HA 4TSKA 4H16A 3L1UA 2G07A 3MTGA 4DMKA 5DIZA 4NSNA 4KOAA 1TYEB 1LF5A 5COBA 5KB3A 5HFAA 1YE3A 2JI6A 2CZGA 2CBXA 4ASUA 3QX3A 4GOMD 1L4GA 1OX6A 1Y5IA 3D6JA 4HDMA 1ADGA 1W8DA 2X4LA 3MB5A 3QLJA 1ZG3A 1W93A 3IIMA 1M34E 5NLLA 5REQA 3VR3D 4OXNA 5B58C 1SUPA 5IKPA 3X1XA 4AC9A 2H06A 2G40A 2G4VA 5DM2A 4J0KA 2HY7A 2JS7A 3RTCA 3LOUA 3PD7A 4K9OA 4GMKA 5TRTA 2C2BA 3S3TA 5K01A 5CHYA 1E4VA 2A5YB 4U2CA 3VSCA 2WYWA 1QH1A 3C8ZA 3J81k 1TPZA 2WAMA 3LA6A 2A7QA 1V35A 3ZD6A 5HQTA 4JBIA 1QGUB 1J21A 1DADA 1U2EA 5KINB 2CBGA 1CF4A 1S4MA 2W2VA 1E79A 1T6YA 3AIIA 5JZMA 1HM5A 1TMKA 1E9DA 4G85A 8MHTA 2BBWA 2JGDA 2REBA 3S1SA 3QPUA 1XP5A 2XUPA 3PR3A 2AJBA 3HXLA 2I1QA 1VZ2A 1SEVA 4HSEA 4S0XA 5EWMB 5KNBD 2PKRA 2M6LA 3RSHA 4KUGA 5I9IA 3MD9A 2GXSA 1JHYA 1RHRA 1RQNA 1Z08A 2C61A 2IEIA 3QEJA 2HDOA 1MIOA 4QTYA 1T29A 4HAOA 2VDJA 2GCPA 2PUTA 1VSQA 3DTYA 2XQIA 1FS4A 2Q5FA 1PP4A 3I5AA 4NESA 3U13A 3RIEA 4OL0A 4PGAA 5D5HA 3RBZA 3UUFA 1I2BA 4EAAA 1WLYA 2PJDA 2VPPA 3AC0A 4GX0A 4MPDA 2ZIGA 5AOBA 1L5OA 3SYNA 2IUSA 4NX2A 1XHLA 1LDBA 1P81A 2Y6UA 2R48A 1K3FA 4YYZA 1WA5A 2ZRMA 1ILWA 1F2TA 1I3OA 1SXGA 3DVLA 5G1NA 4JI1B 2Z2XA 3NO4A 1XO1A 2IXGA 1CIPA 2WM3A 5DULA 5JZ9A 3ICEA 1SHKA 5GV7A 3U7HB 5F1OA 4EW1A 2J0SA 2WK1A 3GJQA 3E2MA 2PRJA 2A9JA 1IEWA 4X20A 4DPLA 4LTDA 4DOMA 2KMLA 5ESXA 3QW2A 3HNRA 1NDUA 2J3EA 1N75A 5GJCA 3HA5A 1PWEA 1T9HA 4HNRA 4Y2HA 3SIRA 3V8VA 3AB8A 2OHFA 4JB0A 1BKYA 4FOOA 2X3YA 5CLQA 5HSGA 5ALHA 1O5OA 4DR7B 1OUMA 3VA7A 2QVXX 4R9NA 4NYIR 4RGYA 2X9VA 3OKAA 2UDPA 3PHGA 4OU5A 5CVUA 3REQB 1NG9A 1KO1A 2RBKA 4KYVA 4YALA 3BAZA 2XX3A 1NAHA 2GRAA 2DWUA 3L1KA 3QMWA 1JIIA 2XBLA 4OAPA 5KREA 5FOSA 5ICMA 2QYOA 3V9AA 3ZQJA 5D84A 5JQGA 5KMGB 1M0EA 1KKUA 5K45A 2XYRA 4HWOA 3VHXB 3DXXA 3LRXA 2IY8A 2NSLA 4FFBB 2BUAA 1DIBA 3GPBA 4CMEA 3FKSD 2NAPA 1E9SA 4U2EA 2VAXA 2ZDHA 2ZBGA 1FFXA 1ZWKA 2R6ZA 2XR1A 2IPLA 3KR2A 4U2KA 1SVUA 5GJWC 3HEAA 1OBOA 4BLSA 4Q1DA 4F2WA 2RHHA 1KSJA 1ORHA 3GUYA 1IB0A 2ZRDA 3OP4A 4JJZA 3V7UA 1K2WA 2YCBA 2CHVA 4LYEA 1C1YA 1IXRC 2P0EA 2JBHA 1YT5A 4DLUA 4TQUS 3OTQA 1ISGA 2FUKA 1M1ZA 4LDAA 4ONEA 2ODAA 5BWMA 1D5WA 2GLXA 2QXUA 3DEKA 2XQJA 5FTKA 5JRDS 5KJCA 5CH3A 4ICIA 1FQOA 1DSSG 3SI7A 2OAQ1 3K9FC 5KDDA 3CVXA 1OHHD 3RNOA 4BFLA 5BSKA 1VXOA 2IEGA 2Z30A 3KXKA 1O94A 2ZPTX 1T36A 4XH9B 4HRXA 1OFUX 1V43A 2PWZA 1BJRE 4BJ3A 5CA0B 1GL7A 1H8ED 1G3RA 2EEPA 1IHPA 4L27A 3R3ZA 4YRFA 4D9FA 4E6EA 5LQMA 2GWHA 1V1MA 2YOFA 1QDLB 2QUIA 3PB3A 4TXLA 1LPAB 4J75A 1U65A 4TZTA 1QHHB 1D2AA 1JKXA 1B42A 3ENNA 3I04A 5CLIA 4JMLA 4ZO9A 4MHTA 4HGZA 5DO9A 4F2DA 5JJCA 3CNLA 4UU0A 1SPBS 3MCAA 3A4IA 1CULC 5E0OA 3TZQA 1DKQA 1SQFA 1UPXA 3BC1A 4TL9A 1VL2A 3DV0A 1E32A 4WZAA 4ZQFA 1ZPDA 1SHZA 3PX7A 4YXWD 5JNSA 4QHSA 1I9CA 4XSHA 1BSVA 2WD8A 1LFAA 4J43A 2OHIA 3N9IA 4E70A 4Q1FA 4UUOA 1SCUB 2V3VA 3QLUC 2H07A 3W3AH 2AF3C 3UENA 3I39X 1DRWA 1RWNA 5JCXA 4J16C 2A6PA 4HEQA 4PNPA 4GR9A 1ZMOA 5EHQA 1Z28A 2YMPA 2RHOA 3DTVD 2J3JA 4M9RA 3RREA 4FFDA 1U7XA 3AW9A 3PSAA 2VQ3A 2MWMA 4R2KA 2XD9A 3GXOA 2H1IA 3F47A 1HFEL 2RG1A 4MVWA 2PRIA 2BYTA 3DMHA 3IEVA 1Z5GA 3B9BA 3JD2A 1QE0A 3IP9A 1EEHA 3IQEA 3S6JA 3VOSA 1NUSA 4QFMA 1XPOA 4MVJH 5I7HA 2QZ4A 3SKYA 1UJ4A 5CCEA 4N5IX 2BE7A 1KRHA 4P3YA 3TQQA 1U1GA 2IUYA 2GILA 3WRYC 4BDSA 1JA9A 4OP3A 4TXJA 5D5PA 2B8JA 1KYYA 4K1XA 2QMYA 5AJWA 1E2LA 1B1CA 4BQQA 1CG6A 1KOJA 1NHGA 4HG2A 4CI9A 5EFZA 4H7JA 1S8AA 4UZSA 3JZMA 4PINA 2C0PA 3FYCA 1M1NB 5M3BA 1KWGA 2QMZA 3D8TA 1HDGO 3PPVA 1WTAA 1YC2A 5GJBA 2XUJA 4DLXA 4AZ0A 3VAYA 1N33B 5A4DA 2ON6A 2WUWE 3W2FA 2EL7A 5DCUA 1B93A 1XVAA 3DL4A 5D1NA 1Y34E 3D4PA 1TYBE 1EFDN 1A72A 1U02A 3PUXA 4JEIA 5EUMA 3ZBUA 1H1LB 2XB6A 4D0RA 1MT0A 2DBVO 4IJMA 4HB2A 4UHKA 4L74A 2C2MA 3QVOA 2RHBA 4B71A 1YRAA 3HPRA 3SYLA 3RVDA 4R8KA 3I8OA 4ZU3A 2GZ2A 4BKOA 3EISA 4WK4B 5AW3A 2RHWA 2DXIA 3E7XA 3HL4A 1FLVA 3ZBQA 2DP4E 1AM4D 1KZ1A 1T34A 2EBFX 2ZUUA 1DCMA 1GN9A 2R7KA 2CUTA 4DSNA 1DJQA 2ZJBA 3M1LA 4HXFB 8AT1A 1K6JA 2I4RA 2IW1A 4M86A 4N12A 5AXCA 2DHDA 2JCYA 1SJ9A 2RH8A 2JJYA 3IEKA 1DRVA 2FFAA 1CB7A 3NJ4A 3PXEA 2HEIA 4KMRA 3GG2A 4AFNA 1BS9A 1IDN1 2F6RA 4LYAA 4RKQA 4U9HS 3ZE0B 3T1HB 1K63A 2Y93A 1IOZA 3ANYB 1KI7A 2YV4A 1ZM2A 5CJJA 3I5YA 1IIBA 4V3CA 3EVZA 3WJ7A 1DS6A 1MB9A 1E66A 2JD0A 1X8KA 1J1ZA 1QV6A 3OKPA 5IJXA 3W3ZB 1TF5A 4BXOA 3NS7A 1YVRA 2VRCD 4ZAFA 4I19A 2C4KA 1M6EX 3AJDA 2QX7A 2VZ9A 4ZDWA 3HS3A 3OQIA 3FZQA 5CIYA 5T4HA 3CBGA 1G8PA 3W5CA 4DJJA 1GU1A 2B7LA 2PT9A 4BX3A 4HNTA 2QVZX 3HB4X 4HBGA 2QYHA 3PDIB 4XFKA 5E0KB 4BO3A 1II9A 3I1YA 3GUCA 1SQGA 1ZH4A 1NP7A 1OXKB 1EGVB 2FSGA 2NG1A 3HCPA 1P72A 4L57A 4TRRA 4XYEA 1KJQA 2GJKA 3AILA 5FI0B 2HFJA 2QRLA 3I01A 4KSBA 1T0BA 3INRA 3IV6A 1FJGB 3AJAA 1E2KA 1Y3IA 2ZAYA 4MAAA 2R9VA 2WTXA 3GFSA 5B30A 1KMIY 4F71A 2VA8A 3K9BA 4UQPA 3URMA 3TRKA 3IV7A 3MT9A 4OXXA 5DLPA 2Y05A 5EWJB 5BYAA 4S05A 3IEMA 5JH7A 4U9IS 2IHYA 1UJNA 4EG8A 4OPMA 3ZVLA 2WWTA 5FBRB 1BOFA 4JR0A 4R1SA 1EFPA 3AEQB 3OBBA 4W1SA 1Y48E 3H18A 3HCEA 3Q9UA 5DWDA 3PHBE 5H82A 2GPTA 1UWLA 4G0MA 4JQCA 3FW1A 2WF7A 3BH7A 5AYVA 4BZZA 2XTJA 1QM5A 3HYNA 3KSDO 1G7TA 2ZS8A 2ZBFA 2HX1A 3OLVA 4D4HA 3ZCPA 4EKYA 2GCNA 3IQXA 4WQMA 1XEWY 1V6SA 2C8VA 2DFLA 1MIOB 4B85A 4P7FA 5D7BA 3O74A 3T54A 2QJOA 2WJZB 4DEVA 4RTPA 1MO4A 2OO5A 5EMKA 1V1RB 3JPWA 1P0MA 1CUEA 5G0SA 4BNLA 4HKTA 5SY9A 3MS7A 3R7DA 2JRLA 2NZVG 1I32A 1KYVA 4Q4LA 4JEHA 4AF6A 1QIEA 1WCXA 3EODA 3WDMA 2QL5A 3F67A 5G3ZA 1USWA 1Z0ZA 3NANA 3QPVA 2OQ2A 1QJCA 3M1AA 1SVWA 4AROA 2QZZA 2FW1A 2DBQA 2QVGA 5KJ1A 2W2PA 3PHCA 4YAJA 4ZKEA 3UA3A 3TINA 4X8HA 2SBTA 4QLBA 4G0XA 3OTOB 5IAGA 3UBTA 3C1OA 2JJ2D 4GRDA 4YUXA 4R84A 2XNDD 1GA1A 1ZI6A 2HA7A 3H84A 4B6JA 3IT0A 3N28A 4GM0A 4MEAA 1BA3A 3X2SA 3R8FA 1T0UA 2RAUA 3I72A 3JAKA 3AVYA 6GPBA 2RHRA 3CF0A 5ESRA 2FLVA 2V45A 1DIGA 4EB0A 4XYGA 1PDOA 3ULKA 5AJTA 3ZQ4A 2RGAA 1H93A 3ZW7A 2O8EA 1U1FA 3C7AA 4KB5A 4PRYA 3N0XA 3QBEA 1WOMA 2EP5A 1UBCA 4K3UA 3FCEA 3R40A 2A7XA 3ELYA 4CNBA 1LPMA 1Z7YA 5ANRB 4ZQBA 1NNI1 1GYQA 4HNGA 5KEIA 3FNRA 5JD3A 4MVJI 1T3SA 2Q3EA 5K0ZA 4RENA 4DQLA 2BGLA 3E9QA 2W6QA 3N6VA 1E3TA 4S12A 5JNTA 1UDBA 4H27A 1ZCZA 2DY1A 2NU6A 1IG3A 4RIHA 3RJ9A 4DYVA 3WNZA 4JQYA 3CKKA 4TLDA 2XUGA 3NHZA 5TS2A 4XPZA 4IZHA 5EFOA 2JIZA 1H2HA 2DFNA 4RVSA 2FRXA 4FFRA 4KN6A 4LWOA 1XF9A 2Y1FA 4DAEA 3RFVA 5G0WA 5FJIA 3TXAA 3EH1A 1M66A 4MYCA 1U9CA 4D9NA 4BFZA 4G0VA 1ZJZA 1VL5A 3AM5A 1SIBE 3CGWA 1F60A 1WOYA 3EXHA 4CODB 2W00A 4EW2A 3RBVA 1A5ZA 1P61B 2ZYVX 2ZBDA 1BDJA 4KPUB 4B47A 5J58A 4OLBA 1DWPA 2A88A 3LDUA 2OPBA 2JLVA 2XYGA 1Q2XA 5HIMA 3ZWMA 4YRSA 4FFLA 3N2GB 3TTUA 5KYNA 3R0VA 2P90A 1FUIA 3VDNB 2A3NA 2Y99A 2I9KA 5KYVA 1DAEA 4OFZA 2QM0A 3EW9A 4L5CA 1IXZA 5A5FA 2O19A 2GN8A 3W1EA 5CTJA 2WMDA 1W4LA 3TX6A 1R9JA 5FWXB 7MDHA 2BEJA 2K2WA 2GBCA 1HYHA 1MC4A 2OTCA 4TROA 4Z8XA 4MVJE 1CZUA 4ZAYA 3C7TA 4L76A 1HLFA 3KDPA 5AHOA 4CVNA 3B2NA 1UT5A 1R5NA 2XB4A 3GFRA 1XKXA 2G63A 2G9UA 2TMYA 4PGFA 3R0QA 2O9JA 4ACBA 3PX2A 4KPEC 3JVIA 5DBOA 4M22A 4Q93A 4QODA 2IWRA 1UPTA 2H4JA 2ZTVA 4OP1A 1VDMA 2YIVX 4RA6A 3FZEA 5EIOA 3O8OA 1DJMA 3ND7A 4NZNA 1PJ2A 1ZNZA 4BDTA 2WFMA 4TN5A 3AUAA 4EP1A 2BJVA 2R2AA 3WOVA 4E2FA 5I9LA 4BNIA 1KU0A 2GM5A 3AEUA 3KKEA 3OPVA 3A6KA 3PJEA 4PE5B 3TCKA 3V8PA 2YX1A 1QH8A 4BQSA 1DCTA 4CQMD 3U7FB 4OD0A 2Q0QA 3DPSA 5JNUA 5HKBA 3V4FA 1L1QA 4LNHA 4OG2A 4WLNA 1GZUA 3TAUA 1BTOA 4M0DA 4QJ3A 1KQPA 3I09A 1WZCA 4QVKA 3B3FA 2IYFA 3HN6A 3VOBA 1D4OA 2HCJB 3AGQA 3HFSA 1Z5VA 2Q0SA 1MZPA 3R4CA 1Z6QA 1S2IA 3D6AA 2YDXA 4IHAA 4HDNA 2PRYA 5BPHA 2DERA 1QCCA 3K09C 3BQNB 4MKIA 1QTRA 3GWZA 2Z2YA 1NMQA 5CDFA 3V4OA 2PA3A 5ALQA 1BDHA 3HCAA 4IDPA 3S8MA 3LDHA 1YIDA 2I3DA 5BYJA 3I34X 1NM5A 4MZDA 4E6PA 3ZLJA 2HO4A 1ECPA 3NT4A 4WOJA 2AKEA 3ZE2B 4AY5A 1CUIA 2B1GA 2C1XA 3DZJA 1JJFA 1OZAA 5AQEA 3T5PA 2PS1A 2C9ZA 3M3HA 4P81A 2IX9A 4FQ7A 2HHAA 2QSYA 3L5KA 1E3QA 2HHJA 4L8FA 4LF7B 1PR2A 2HWWA 1Z6AA 2QRVA 4LF8B 4IH4A 1Z5NA 1V0JA 2W2KB 3C5HA 1E3EA 4TMYA 5HF8A 3U9TA 4AB1A 1JWLA 2WHRA 3LLSA 2O5RA 3FB4A 4I8IA 2FKAA 1TTPB 3WLIA 2P4HX 3O4FA 1RC0A 2W2NA 3TW6A 4NBTA 3GD7A 1GR0A 3MCTA 2GF0A 3EVDA 3QTLA 4K1LA 3W4JA 3BE4A 2RJ3A 4OHUA 1DBIA 1WMSA 4HF7A 5HS6A 2P2ZA 1FDWA 5FA8A 1RXWA 4OM7A 4E4RA 4OTZA 4BV3A 3FVWA 3HBLA 4F93B 3WMWA 3FN4A 1ZGCA 2IU3A 1AF4A 1W8IA 4RTQA 3IOCA 2CLLB 4C1NA 1QVZA 3GMSA 1W5SA 1Z88A 3WRXA 2EIHA 1XD9A 4QGAA 4ZOEA 4ZV7A 1NI5A 1RHKA 3DZ8A 4G23A 3TQSA 4DQKA 1W88A 3QLVC 4DNFA 4ZC8A 2H85A 3GJ7A 2FSVC 2IIBA 2MTBA 2VPTA 4W7IA 4R9VA 4CLHA 3ANMA 3ZH9B 2A0XA 1FXWF 3TFQA 2AE2A 2X76A 2J9YB 2GXQA 4GXNA 5E2IA 1C0LA 4DKJA 2BFEB 4QQRA 1BS2A 5HDBB 3LCUA 3V46A 3MWGA 5IP5A 2VDWB 4BZWA 4UDXX 4KI0A 4MROA 3MF4A 5B2ZA 9GPBA 2W6JD 2YQ4A 3LSYA 4X60A 4EVIA 3FOZA 1W75A 2ID9A 3T7EA 4UVEA 4PTYA 1P5JA 4YLYA 3KYIB 2QXTA 5FO0A 3G0OA 1KL7A 1VZ3A 3EG5A 1EMDA 4PIPA 3O2QB 4HX9A 3W6OA 4RTRA 2GD6A 3I6MA 4LJ9A 1SCJA 4O3MA 4M7OA 2IHZA 2YZ2A 2XNHA 4ESHA 1JILA 2RB4A 1SVOA 2G9RA 4D2IA 4UVIA 1KR5A 2VSXA 1MJGM 3C5EA 1CE8A 2HQOA 3SVTA 1F7VA 3I6QA 4FGZA 1QC5B 4JD5A 5ERXA 5JD5A 4NG5A 5BW6B 1RYBA 4E5PA 2PS3A 4YMVA 2QW0X 3DD5A 2O7SA 3RWBA 4ZYZA 1Z4QA 5JWOA 1H69A 3PFHA 3NKLA 2IF0A 1OFIA 4CMAA 2ZRNA 4EZBA 2FWAA 1K6EA 5AI0A 1PFYA 2C00A 4N7JA 3OU7A 2XVMA 2MYUA 3ZUPA 1MABB 1IH8A 1N6PA 3V2HA 4D80A 4DIBA 4MQ4A 1IWBB 2PTHA 3ZU5A 2PT6A 3TOSA 4YMSA 1NI4A 3FJYA 5AVUA 4YFYA 1N2EA 1Q7CA 2N1BA 4C7BA 1FSFA 1U2QA 3ZGVA 5HKKD 5AW1A 4ENTA 1BJTA 4K86A 1CBUA 5IVDA 2VNIA 4A23A 4WNIA 3ESYA 4ZRNA 2O23A 1M7GA 1YZYA 3C3JA 2JIPA 4GBED 3RVMA 5J9FA 1J97A 5FOVA 4K9NA 4PR0A 3H5AA 2VTDA 4MJLA 4F21A 3REQA 4DHWA 5IYZA 5K09A 4Z1MD 1XQ9A 4ITVA 5EINA 3ANSA 1IHXA 1GAJA 3NP7A 4WUTA 1TIPA 1L4NA 3VPHA 5FUWA 1HUQA 2W2LA 3PS9A 3WMXA 3M89A 3KDSE 2IYPA 3NASA 1RRCA 5KC9A 4FYJA 2P9EA 4FXOA 2XOXA 5EAIA 4UMEA 2ZSHA 3HBNA 1Z0JA 4J3FA 5D7NA 1XU7A 3KJNA 4D1YA 4XA8A 5KWIA 4EJSB 3JQBA 3O7MA 5ARDA 3ZWKA 2F8TA 5IJZA 1OYYA 2GN9A 3M6XA 2RC5A 4CKZA 4D0GA 3C24A 4PONA 4X65B 2Z1MA 1BH6A 1JNXX 4JJ7A 4AI6A 1X1RA 4PN3A 1LSSA 2B9EA 3WL7A 4C20A 1P17A 4BZQA 4ZARA 1JHXA 5AK0A 4DV4B 1NJ5A 2IPNA 2WINI 2JARA 3D1JA 3RVOA 3F4LA 1XRQA 4KQEA 4Z5XA 5B7QA 3T0GA 4CQMB 1K27A 2G08A 3K35A 3HYCA 4I1SA 1RBYA 5AUNB 3E9NA 3R74A 1E8DA 2HBRA 3LFUA 1PEAA 1U5BB 3E8MA 1UQRA 3PIDA 1YCGA 2CD7A 1KO7A 4E5SA 2VKQA 1OX5A 5LUBA 3EUWA 4BRUA 1EK5A 4G1UC 2P2LA 4OHCA 3W2IA 2XKJE 3L7IA 4CG1A 1ZJ4A 5HIIA 2WIBA 2QKYA 2CXTA 3STHA 3A9VA 2CCGA 2RK3A 4ZOLB 3ABOB 3N7TA 1ORDA 3EIFA 1W1IA 3NBFA 4MQFB 4L4RA 2RH4A 4I0WB 3R2JA 1EAYA 4E32A 1TE2A 2C7GA 2CCKA 2QAGB 2H0RA 2IYOA 1P9RA 3H5LA 1FOEB 3C4JA 5LOVA 1VI6A 3O38A 2GZAA 2XT6A 3LO8A 3ZDBA 3ADPA 1Y8RA 1I3CA 4EUKA 5JO0A 5JNLA 4H7FA 2D7JA 2QNRA 3KZ1E 1P3Y1 2ZB3A 5EXTA 3NWPA 1HEIA 2FI1A 4BNJA 1EUCB 2BKAA 2EGHA 3DUFB 1PQWA 3ORHA 3GCZA 1V71A 4PX9A 1QSGA 3IFSA 1WMFA 4JFAA 1PJZA 1PQUA 3R0IA 1PWHA 3FVVA 4FKBA 5F3RA 5GZ1A 2ZUFA 1RPZA 2YS7A 3BXZA 4YAOA 4B4DA 1P2DA 3TZLA 3HBFA 3CLVA 5IDQA 5B7PA 2RHJA 3PVCA 2HYIC 2Q45A 3OM0A 4AP6A 3CONA 4BNZA 3A1VA 4EBFA 3HN2A 4MI3A 3SXJA 2F3SA 2AOXA 3E0QA 3IJPA 3IPAA 1K7SN 3ZGOA 4BAUA 2PUAA 5I45A 2OSVA 2W6ID 2HDNB 4GP7A 4M37A 4WKCA 1DQPA 1H3NA 1R4MA 5TGTA 1PLLA 3U19A 3B70A 5LPNA 3H2YA 4UE6A 1JA1A 2WU8A 1GGFA 1KQOA 4XQCA 3UPUA 4WOBA 2QLJA 2ZUVA 3QPWA 1E7SA 1Y6QA 2BFCA 5H3HA 2QW1A 1P73A 3E15A 3W7AA 1X80A 3WMFA 1AKMA 4HPWA 4X64B 1ZU5A 1H23A 4F4JA 2ISCA 2JCGA 3HBJA 1AU9A 1YBMA 2IVZA 2RGNC 3OZTA 5C3UA 3VTFA 2G72A 2ZR9A 4YWHA 1PNVA 5ULLA 3VV3A 3EARA 2WIJA 3LH5A 5G53C 1UKZA 3ID6C 3RIGA 1PCXA 1C41A 1JFFA 1H4TA 1AD2A 2BCEA 2OXEA 3HN7A 4R8MA 3TQCA 4IGKA 1S01A 2W42A 4PANA 4L16A 5F1PA 3UAGA 3MD0A 4ES6A 4MYTA 1EIWA 1A5AB 1XDWA 3NXKA 5BYBA 4CM9A 3GLQA 1XD8A 3ZWCA 4IDNA 2Q6KA 4QU0A 5I3CA 1A8HA 1CJSA 3IJRA 3M6LA 2Z1DA 1VJRA 3HQ4O 3I6YA 3N5CA 3Q3VA 4GHWA 2C4WA 5M2QA 3LVFO 3EHEA 5JSHA 4X7MA 3K94A 3MNFA 1MH1A 4F72A 2QEQA 3O9ZA 4II2A 4QECA 3G9XA 4FCTA 3N2IA 4MQMA 4L5IA 3VUFA 2R60A 5AVSA 1LI7A 4ISBA 2HXYA 5SYMA 1IJBA 3BYZA 4A6DA 2K7FA 2VRCA 3BRQA 3HCNA 3G2PA 1YAHA 3FUTA 1CUBA 2AWOA 3NRJA 1SR8A 2RMKA 4Z4HA 3SKVA 2QYSA 5FH9A 3KOYA 4ZRMA 2IYLD 1FDSA 2DWPA 1IU9A 2PVPA 3CKYA 3GRVA 2IXFA 3I9OA 3IXLA 2A0FA 3GRAA 4MP8A 2C5GA 3P9XA 3BMOB 3T1YB 3NU1A 4HFJA 3Q3EA 5F2NA 5KKAA 3DMNA 1WDLA 4MPTA 3AVOA 1A8UA 5B2FA 3WSVA 2CJPA 1U6KA 2Q2OA 1W73A 3H2JA 3A8TA 3O8QA 1H2RS 2O5VA 3G88A 3ONWA 1IN1A 2Q46A 2GEVA 4ZZIA 2G0NA 3R1IA 3BFXA 2OFPA 1C3OA 1UMDB 1NBWB 1T10A 3VZBA 4BB6A 3NT5A 3LHKA 1QCYA 5JS6A 3AB3A 2WZCA 3BTUA 3HJAA 1M2VA 4U0KA 1W87A 5FTMA 3C3CA 1FFYA 4PQEA 5EJ7A 1QVRA 1QB8A 4L4XA 1W96A 3K9NA 1DC7A 3GRRA 1PHPA 2CHUA 2PNFA 3R0ZA 3VPAA 4DA6A 4DV3B 4DNQA 4XCQA 3OCYA 3CE6A 2XWPA 3R7WB 2SCUA 3FI0A 4DA8A 1MVOA 2GQ0A 3ZHUA 5J1SB 2RH5A 2YHIB 3EQ2A 5IAKA 3KQNA 3W5VA 2YXNA 3GJXC 4MUYA 2AC2A 4A2CA 4DWVA 2I6GA 3OEEA 3GFTA 2EFGA 2PZEA 1RYEA 2IOFA 1U81A 2RC6A 1QG0A 3L07A 3AT1A 4LXTA 2YRFA 3TFWA 3QX9A 4NDNE 5CITA 2R44A 4JC5A 4D9MA 1NT2A 2BHLA 3A6FA 3ABQB 2O2ZA 4WZBB 3OJXA 1Z17A 2VS1A 5K3SA 1W1UA 4XQEA 3ILSA 4EABA 2G1PA 1R10A 1T9KA 1XP8A 5I9MA 2RSLA 1RWOA 5FAKA 1O94C 1QK4A 4JNCA 5DE3A 5H4GA 2VBCA 1AS0A 4XEUA 5G40A 5T7BA 3WQHA 1YDMA 3FDJA 2QN3A 1GNPA 2ACWA 4JX9A 2O20A 4RULA 1UBTS 4BGEA 3PLAE 1QC5A 3C4VA 5JRZA 2DT5A 2GBLA 1TK9A 4X9XA 4B4WA 3S2YA 2ZAOA 2FB9A 1QLJA 1R6BX 3RFFA 4AKHA 4CLOB 1U3UA 1FF9A 2PSHA 4OXQA 1YVUA 4M1ZA 3RTEA 4ND7A 4XDHA 4YCMA 3AFMA 4LZWA 1ZZEA 1UOOA 1QB7A 1T5HX 2XQVA 3VM6A 3WIVA 3MM4A 1LBSA 2H2WA 4EECA 4RANA 4U9UA 3M6WA 5FEUA 1E9RA 3OI7A 1I6LA 4HLQB 1H2FA 5J5VA 2Z43A 4IPTA 5ADWA 4JKYA 3C6QA 4R69A 3GLKA 3T3HA 1WD5A 5GWXA 1FNCA 2H17A 3CUEF 3I2FA 2IT1A 4BNXA 5IHPA 3PGA1 3VVMA 1Q12A 4YJ3A 4Z9BA 5JMPA 3N75A 4DR1B 1NX9A 4EQZA 4Q24A 4D5EA 3ZOZA 2GZ1A 4J49A 4EA6A 1IY8A 1H2XA 2FMFA 5IYZB 1RM4A 1KNQA 3V8RA 4Y1GA 3ACCA 4GI7A 3M5DA 1XJQA 5IXJA 4MS3B 4CF5A 1UQUA 2X5OA 4R83A 5U9CA 3H17A 1ILEA 3KT8A 3SOZA 3KZMA 4Q18A 3FYSA 5ERYA 2ZB4A 4L50A 1ADJA 4CKBA 4CKWB 1XDSA 1YU9A 2HKIA 3KSRA 1SZJG 2XNCA 2BTQA 1I4LD 3E0XA 4IH9A 1GAQA 1RRPA 1UKBA 3O0DA 1HK7A 3ASUA 3IEPA 1MNAA 4IJ5A 4KO1S 4EW3A 5JTTA 4B80A 2W71A 1QVWA 3DKPA 2VCHA 4OSOA 2O06A 5F33A 4BX8A 2B82A 4GYYA 4BUJA 3HKCA 4QSMA 4EGQA 2Q4OA 3NAGA 4A0SA 3EGIA 4YCNA 5I8ZA 5IS2A 4JV5B 1IEQA 1OLXB 2XVZA 5JV5A 4EPYA 2ODNA 1K5PA 4QNNA 5E1MA 2OYCA 1MXHA 3KSZO 1W6UA 3S29A 4OQFA 3ICWA 4IXWA 1ZIYA 2BGUA 3UG6A 4MV0A 3PCTA 3WWZA 4A0HA 1U2DC 1LX7A 4REQA 4WV3A 3JU3A 3W3AA 4PVDA 3UV7A 3HJCA 4ETWA 2AK3A 4KK3A 2AR7A 4G1MB 3DO6A 5C7LO 4CM9D 2YXBA 1ZGHA 4BNTA 3Q11A 2J5QA 2YUTA 1FX0A 2I62A 4FS8A 5LZ9A 2FDCA 2WUEA 3PC3A 1N6KA 4LXYA 4TSFA 1RHQA 3WY9A 5ECGC 3T52A 1TXGA 4K88A 2W93A 2XPCA 1SKUA 1Z0AA 2XV1A 4YJ2F 4GI1A 5LP6F 2V4MA 2G4LA 1C4OA 1NN5A 3FWNA 1DPGA 1QYIA 3OPMA 3IOBA 4WLUA 2J07A 2CB0A 2VYVD 4CCAA 5CFMA 5I8WA 3QG1A 5J5CA 2CEKA 3VHRA 5JHGB 4N40A 3WB9A 1W9MA 1ZD2P 4M1QA 3VAAA 5JXJA 1Z0DA 2IOQA 1RAFA 3K1AB 1ZUD1 4ZOQI 4UVGA 4H3SA 3IEIA 5T4FA 3ROQA 3N3AC 2PWPA 1JIQA 3C1TA 4FX2A 1NW5A 4UBJA 3A1NA 4NCXA 3DMTA 4WUVA 5DGCA 3AUJB 4EL0A 3Q85A 2AT1A 4JI2B 3CJQA 1WXDA 2OG1A 3DR5A 4LMRA 8GPBA 4FSXA 3IQIX 4BV8A 2E4VA 1TZBA 3NDRA 4J3NA 4JVOA 1P9NA 3MAGA 4BNYA 2HXSA 5KYUB 3IILA 1JPNA 2UVQA 3PHLA 1GO2A 4MQ6A 1LVUA 1UL1X 1Z4KA 3E35A 4MRSA 2P1DA 4DLZA 5JYCA 3R6TA 4FW8A 3QI7A 1F8YA 4IFTA 3Q72A 3A4VA 2NZXA 2W6MA 4X54A 5J40A 1D07A 2A5DA 2PMKA 4RADA 5EEHA 3T7RA 1DRKA 1XNHA 2UVPA 1WLSA 4GWLA 3T5CA 2B7BA 1BS1A 3VYVA 2VUUA 1NBHA 4NULA 4RTLA 2I7CA 1G66A 5DSZA 3G8DA 5KOHA 1L5WA 3UCFA 5K0FA 4Z7NB 1HRKA 1PFWA 2D00A 2XCUA 3PQ7A 1W85B 4DA4A 4RFSA 2J6IA 3GGGA 1DJNA 1QYDA 2NZWA 4MWOA 1D8TA 1YFZA 4XR9A 3ZX5A 2A84A 3A6HA 5HG0A 4PFSA 3ZKWA 1L4BA 3JRXA 4UNIA 2Z8YA 3RUIA 4UDYX 3A05A 1U80A 1BRTA 2C0CA 1ML3A 4FD2A 5IVIA 2X0NA 2J3MA 1A7UA 5H81A 1BAPA 1KORA 1C9KA 1KEEB 1JFFB 2FGKA 3UMJA 1KQGA 3KEOA 1AQ6A 4KN8A 4YRMA 1M8PA 1K7FB 1MAWA 4TYWA 3ZBPA 1TDJA 2PZBA 3CPEA 3DWIA 2PX8A 3KNZA 1KOLA 4RJTA 1CS0B 1CUJA 3FSGD 4DG5A 1ELOA 4YDHB 4Z3KA 1QGZA 3COJA 1J25A 1XQXA 1OFGA 2VXCA 2VRWA 4GOND 3DKRA 4RACA 5DV9A 5FFFA 4CTJA 5LBUA 1RLJA 4EHIA 3D8BA 1E1NA 3T12A 1CQPA 4EY3A 5JBIA 2ZJ7A 1K0UA 3KRTA 2ZRCA 1CP2A 4FOLA 2NVUA 2YZKA 3RO7A 3JZDA 4LE0A 1ZP6A 1UFVA 3KFLA 4UU7A 5DM4A 5AO9A 4J0IA 5BWCA 1EUDB 1ZIPA 2R5WA 2XRYA 1FQKA 3G68A 1PFKA 3HU3A 1R50A 1Z0SA 4RGBA 5EIFA 1XXHA 4J4TA 1G38A 1E1CB 4V2UA 1TCBA 1UAAA 1N7JA 2Y4OA 3DS8A 4HX2A 5HZHA 4BMDA 4DGSA 3RYCB 2P6OA 4R2HA 4ENVA 1Q6ZA 2HQ1A 1Z6YA 3CB4A 2BI4A 3IODA 4GOJA 4B6PA 4Q82A 13PKA 2XXAA 4JQSA 1WBJB 4FX5A 4QBIA 2VNJA 4KE8A 4JU9A 4CRWB 4YJHB 3ZGYA 4J2TA 1LNZA 1USIA 1SIOA 3BF8A 1JB1A 2VA9A 3ZWOA 4E09A 2HHLA 2NV6A 2HT1A 4H18A 3I2GA 4FMCB 3JPYA 3COVA 1IL0A 1O54A 3OZDA 4OQ4A 4LJAA 4HATA 1DZ3A 1FP7A 2PVSA 1P7WA 2C2OA 3CWCA 3K6JA 4LNUB 4F4FA 2D5IA 3IP5A 3G8YA 4PPGA 2ZRPA 2JD1A 3W90A 1SWWA 4OV6B 1LSJA 2HD4A 3E9DA 2BF7A 2ZVQX 3GVCA 3GQBA 4JOCA 3TZKA 4JH0A 1NASA 3LYLA 4ALIA 3ETNA 1I3NA 4DQUA 3OJFA 4WLFA 3OF3A 1YBVA 4DEYA 1JEYB 4Z8YA 4MRAA 2FCRA 1D4FA 5BWNA 1C3JA 4B0OA 4J4BA 3GEMA 3WGHA 1KE1A 1GNQA 2E18A 3OM1A 1B6SA 1U0JA 3PBKA 4P5PA 3WSTA 4IXTA 4UAVA 1X7WA 3PT5A 1P7VA 2R4TA 3A27A 4J9VA 4Q3KA 5AI8A 3RFCA 3TQHA 3BXOA 2PA0A 1UFQA 3HCOA 4JP8A 4UFOA 3DT6A 4CM5A 5CLFA 5J2UA 2C77A 1DOAA 2VWPA 5JAZA 4QGFA 4MVCA 2W2LD 5BVHA 4ZVTA 3KLNA 2Q9AA 5FQNA 1EINA 1QPZA 1Q57A 3KM0A 4MVJM 4CIWA 1U3VA 1GFZA 1YS6A 3MTDA 4OIMA 3IVCA 4Z1MA 3ZHYA 3C3YA 5EZYA 5LBIA 3HXPA 3U5TA 3WADA 2JJ1A 2BBSA 4PFJA 1PDVA 3M1YA 4BLVA 3WLSA 1CZRA 1DQYA 1FTNA 3DE2X 4AO6A 1SN7A 4QWMA 1YR1A 3I2YX 1X1QA 2JVJA 3S81A 1EM6A 3HUDA 4KXNA 1OU0A 2ADFA 4KPFC 4H7IA 1MLDA 1QE5A 1U3FA 3QU2A 3TL3A 5UKDA 3CY6A 1RKXA 4ZMRA 3WB2A 2IIPA 4G8CA 2WZBA 4J7AA 4EI2A 2P3SA 2PKYX 3QXGA 4G4IA 1YQTA 5KTYA 2ZJ0A 1FSSA 2YL2A 4TS4A 2PYIA 5AVQA 1G41A 2H1CA 2IU0A 2D0OB 3EYAA 1CEXA 2PE5A 3DOCA 3ZIAA 3OQMA 1UP4A 2PTGA 3FCAA 3V1NA 1C1XB 1L5ZA 2VBIA 2PSDA 4REOA 5BUZA 5B1EA 1B14A 3DBLB 2JHPA 2XMCA 1FL9A 3K32A 3TRDA 4RDXA 1IQPA 1YJCA 5B1HA 2V97A 2ZE7A 2G4CA 1DAFA 4FSDA 2Y1WA 1GSHA 2BMVA 1VYVA 3L7JA 3RSFA 1XVLA 3T6KA 1SUDA 1GTG1 4B32A 1KK1A 3UWPA 3F8TA 4R9UC 4D44A 3EPJA 2CB9A 3BD7A 1JLLA 3CZAA 2Q5LA 4KAJA 1I51A 2YOHA 2P65A 4A6EA 2BZSA 2P3LA 3M9XA 3GCDA 2EKZA 3EFEA 4JBHA 4Y2JA 3LLVA 3GRZA 5EMLA 2QTVB 3E9EA 3FE2A 4F46A 4QU9A 3VBEA 4BP9A 4JLJA 2ORYA 4U6QA 3WS7A 5CIQA 2BFDB 4I81A 1TMGE 3MJFA 3PDWA 4TWAA 5FADA 1MOZA 1T9GS 2ARKA 2FN9A 2FFRA 3LPDA 4D98A 3M5CA 2PN1A 5CAEB 4EHKA 1J0EA 3AUFA 3L8GA 4RHEA 1BDMA 4EGAA 1CZHA 3NHBA 3NHPA 3JATB 1ESZA 2ECPA 4Q9IA 5JCJA 2HHCA 2WG0A 5MN5A 1H3FA 1W36D 4FB4A 4HXGA 5AK6A 3TVYA 3T3EA 3N2ZB 1R0KA 4Z9YA 1Z9BA 4TV8A 4UNSA 3CXRA 1J7JA 1KYZA 1Q7RA 2ZI4A 3MA0A 4LHXA 4PLVA 1YCFA 4O0MA 1VLLA 3JAWA 1TVMA 5J23A 2VT7A 3MJCA 3SQXA 1B3BA 1LGYA 4QTTB 4RTJA 1U7WA 2HBZA 1I2AA 5DHUA 5AM4A 2PLNA 3DEFA 1EVEA 1XRMA 1Y1PA 2C94A 3PD1A 4IHJA 5CT8A 4B9EA 1QONA 3QU9A 4HGYA 2TRSB 5FFMA 1U0NA 3H1EA 1OA0A 4ALKA 4MIOA 3G8BA 3OESA 1Q0QA 2BJHA 1FU7A 5JS7A 3GT3A 3O1JC 2DB3A 2WQ7A 2V5AA 3CO0S 1GITA 2Q6TA 5FEMA 2VP0A 5LIPA 2I5PO 3UK0A 2ZIUB 7ADHA 1RC1A 2NN3C 1XWIA 2RI6A 3DEHA 4KG7A 3KKLA 1GDHA 3D5EA 3OE5A 3P5BA 5CA1F 5CM2Z 5LR6A 1UXJA 2WOJA 4TVKA 2A9FA 4RD4A 3DC7A 1QKIA 3KPJA 1Z0UA 1DV1A 2Q5JA 3A32A 3G49A 1JS1X 1FLDA 3SE0A 4BQFA 2LCIA 4NBUA 2YV3A 4ZVQA 1AH2A 3D1VA 3D6TB 2GT1A 3RSLA 3IP7A 1JQ3A 3FR8A 4GOLD 1TAUA 5DRTA 1U8TA 1MAVA 1CSEE 1WRBA 2EGGA 2JW5A 2BH9A 2NZJA 1O4WA 1I9GA 2H00A 1IOWA 2Z08A 3PNBA 3NTUA 5CJ2A 3S2FA 4QVIA 4WXYB 1IC6A 2QAIA 1CLEA 2R79A 3TJRA 3V6MA 1JDUA 4BFVA 4UUAA 4TZ6A 2I6FA 2FG7C 4IQ4A 5B4TA 5J2UF 5JADA 1MJ5A 3B6MA 1UFKA 2CFIA 3ZV5A 2BFPA 3HE3A 3RK4A 2WBLC 4M54A 1DG9A 2CDRA 4PYJA 3F98A 3JTEA 2AEFA 2Q4RA 2P11A 2Y1GA 3ELWA 1VE9A 4L0CA 2E85A 1HFJA 2D5CA 1WDMA 3A6JA 3WWOA 1VP9A 5BNIA 2QN9A 2VH5R 5ENDA 5L7TA 1ZGJA 3ZE6A 1ZSNA 2VJAA 1N2JA 4RVHA 2EEZA 2X9LA 4HLUA 4M4SA 4MKHA 1P4RA 4MIEA 1OZFA 3VR5A 1XDZA 1SAYA 2IUEA 4HNAB 5C8YB 3CH5A 3R3UA 3KR1A 1HSZA 3AESA 4TYYA 5CVDA 5DHAA 5DWQA 5H59A 1Y1QA 3UHPA 4JWTA 4Q3BA 4YRIA 4HLDA 4Y2XA 1YB5A 1YZHA 1RAAA 4GPD1 1V8BA 1XB2A 5DI3B 5DNEA 1SWVA 4HI0E 4Q37A 4HWPA 3RS5A 5ARBA 2GUGA 2IXDA 3E7PA 3KZVA 4I6JA 5DHPA 4NV1A 3ZIAD 4M1YA 3IAHA 1WBDA 2OGUA 3UGTA 2BM8A 1C7IA 3E70C 4H7KA 8ADHA 4KQ2A 4RM3A 3GO4A 2PDAA 4QTUB 2QX4A 1XVVA 2PFKA 2AOTB 3NH6A 1P18A 3OTGA 1RBZA 4R9SA 2QNIA 1FCJA 3LIPA 3W7VA 4B48A 4EYSA 4IEFB 3OKFA 3BRWA 2BRUC 5EC8A 2ORVA 4UD6A 4RA6B 5L4SA 2YRXA 1L8XA 4DIDA 1Z39A 4U3JA 1TGVA 5F78A 3PR2B 1LNQA 4NOKA 1WDTA 3R7BA 2PX5A 5FNVA 2LKCA 1GSOA 4IXDA 4NWIA 2E4ZA 3PCRB 1CRZA 3I4CA 1RZUA 3QK7A 2BE9A 1ZQ1A 3A4TA 4HWGA 3IKVA 5K4GA 2VUTA 1A4RA 5DXFA 4YFVA 1Z2NX 1B8PA 4MRVA 3CXUA 3HSKA 4FZ5A 2B83A 2PS0A 2CHEA 3PIIA 3NVAA 3C3AA 4HFRA 4CR7A 1EWQA 1E0JA 1Z36A 3K0AA 1ES9A 1KY5A 2HA0A 3FOAA 2O8CA 2DYKA 4JBLA 1EB9A 1JDVA 2H8GA 4KIJA 2WTAA 3O4HA 5JQGB 3DLAA 1IAQA 4FYPA 1YUNA 2WWWA 1M74A 5DBFA 1UK8A 5LXTF 4BGDA 1YD7A 4EUFA 1E2FA 2ZIZA 3OY2A 5A04A 1E2DA 3VNVA 4LYJA 1NZJA 3KJGA 3KKMA 1E3WB 3CLHA 3TKLA 3IDZA 1VL8A 1ZGAA 3PF9A 2ZZNA 4AVYA 1OIXA 3RVKA 3QX7A 2WFAA 3LPNA 3IL2A 2IOYA 1D09A 1BE0A 4DCOA 2E6KA 2JL1A 4XJXA 5AIBA 4IKEA 1JIXA 1X7XB 3MXOA 4GI5A 5SYNA 3T61A 3ZVRA 3UK6A 4ZYVA 1TA9A 2E89A 2YBEA 4QUHA 1YACA 1XJCA 2VPYA 1MAAA 4X3CA 1K9SA 2D5BA 5C8YA 3EXG2 2B8TA 1PFVA 1Z07A 2O3SA 1T1IA 4MZXA 1C2YA 4TVOA 4IOLA 1UK6A 3BT7A 1B0ZA 4UM5A 4WI1A 2GA9A 3BK7A 3GJ3A 2NWQA 4MLDA 3O47A 3TOCA 4EKIA 1NFQA 3K72B 4ZI3A 4IRMA 1F6DA 3C97A 3MUNA 3GP5A 4BO4A 4MPJA 3RRMA 1EGQA 1TQHA 1UKVY 2QTLA 4TS9A 1KE2A 1Z35A 4KGZA 2DHRA 4R8VA 1E96A 2QX8A 3FMIA 4H2DA 4MKGA 2W8BB 1FP6A 4GYKA 3HRHA 2C5AA 1T9DA 4TS3A 4C7JA 3ZHVA 1WO8A 2B30A 2H2FA 5GMOA 3QH4A 1MQAA 4D43A 1B3RA 4XW2A 1L4KA 5K5EA 4I3FA 3T5AA 3KAQA 4MWSA 1VBKA 1DU4A 3DQZA 1Y3AA 2EKBA 1UC8A 3GF4A 3PC2A 4QE3A 1WJGA 3ZDEA 1VCOA 2AOUB 4E0BA 4BEBA 1VQ1A 4KN9S 3CRMA 3HKCB 4J07A 3BGDA 3DFIA 4W5JA 1P9LA 1NSTA 5BNFA 4QRHA 1KVSA 4WDQA 1DEKA 4AJEA 4ND3A 4BX0A 3ZI7A 2PLRA 4L6IA 5GM1A 2I7DA 2C31A 3ZHBA 2RAPA 5DHRA 2WSIA 3KQVA 4IXNA 5CT5A 1NZDA 4LJ4A 2UZIR 1CF9A 1XE3A 3HFGA 1ISHA 1Z0FA 4HH0A 2PQ2A 1E92A 2YWDA 2L19A 3MB8A 3TIXB 5B12A 3RROA 3PRJA 1IJKA 5LMZA 1X7HA 1AA6A 1O5IA 3EPPA 3GLFA 1C7JA 2VF2A 1AGRA 1M6NA 4UEJA 1WZEA 2BMDA 1EWYA 1BCRA 1QDEA 4MNTA 4QOEA 3ZKWB 2ZP1A 1YJ5A 4QIHA 1C4WA 3EC2A 4R0NA 2YQ5A 2EKQA 1GGJA 3IC5A 2VQFB 2H18A 3TL6A 4BNDA 3JRWA 3V7WA 3RV4A 2HNBA 3VPCA 1CQJB 1KZGB 2WTEA 2FN7A 4RZIA 3R3VA 3FOCA 4HN9A 3ZLTA 1AHHA 4MUJA 4YQEA 4LBWA 3TLAA 4JLSA 3SS9X 5B58T 5AHXA 3MPUA 3ZNPA 2JFXA 2WZQA 5HX7A 3W8FA 4NCBA 3IELA 3FOBA 3HB9A 4JQZA 1XG5A 1IZZA 2N9UA 3UF0A 1BKDR 2DUNA 2JCBA 2YRWA 2HF7A 3M6IA 1C1DB 3JXEA 5KWVA 1SQ6A 3JQ6A 4PM4A 4DCCA 4UHCA 3ZJ5A 5CNJA 1RWWA 4M36A 1CU1A 3ILXA 4GLFA 1T0PA 4KXUA 1D8AA 2X41A 2ZRAA 4UM9D 3EPKA 3G0GA 3WVNA 4J2OA 1DUVG 3WR5A 4PAQA 1J1IA 3BIJA 5KYXB 5KPDA 5IW8A 3EZ6A 3OUZA 4ZO6A 4BUZA 3BZUA 1JXQA 4LF4B 4PU0A 4QPJC 2HADA 4QU8A 4P0QB 1GUDA 2VHCA 4MRMA 3UFXA 4Z4FA 2FPLA 1YU6A 4JJFA 2PJUA 2CYBA 4AG5A 4A3SA 3DFKA 1SXQA 4KLRA 5EA2A 4AS3A 1SKYE 3EF3A 2DVMA 3A4MA 4XDGA 3KKOA 3D5QA 2QK4A 5DZSA 1VB5A 4KHZA 3DFFA 4IDDA 3CFYA 2OQVA 4CI0B 2NO0A 5C3MA 3IDOA 4A16A 1ZLYA 1ZK1A 5FR1A 2AOUA 2VYCA 4B09A 2XDQA 3HA7A 3X3HA 2JIBA 1Y6FA 1W46A 2LDBA 2QR2A 5E6SA 3LQ1A 4Q3LA 5AXAA 4BFXA 2P4EA 4CMCA 4TMXA 3JQAA 3OEWA 1PNTA 1W4CA 4LI3X 1IK4A 2O1XA 1G9SA 3W9SA 1ADYA 2ZYRA 3TXXA 3VGJA 4OHMA 4D41A 1CPYA 4EA7A 2MJLA 4EO9A 3ENZA 3IP8A 2UXBB 4E5UA 3PNVA 2CEAA 1MO5A 4TV9B 2Y1LA 3AM4A 4AZ0B 4NKRA 3THYB 2VCEA 1DLIA 1XZ8A 2R00C 3DQQA 1T5OA 5HILA 3UICA 2Y8EA 3NBYC 5C8DA 5K8CA 1OHHA 2AD5A 3UNXA 5AFSA 1B2LA 1QH9A 4MQEA 5HP4A 4WAUA 4OLFA 4WLVA 4A4DA 2QRJA 1KARA 3KSUA 4AMZA 4ARIA 5DYIA 3G7NA 5EJIA 5TQ2B 4DBLC 5AVRA 3NUGA 1DXOA 2C4UA 5A4MS 2PQ0A 4ARAA 3BZBA 4F9FA 3CEPB 2W2TA 3ON5A 1Z5UA 3FLEA 4BE4A 2D59A 4DBZA 4DDHA 5CFNA 1BQ4A 4IJUA 4B5LA 3C70A 3T4EA 2GN1A 2WUFA 1ZGBA 2II6A 5FXMA 2FOXA 1SBTA 3FR7A 4KXMA 3SD7A 3T15A 5KX5A 5GADl 1C1DA 2PRSA 4I1OA 2J4FA 4WY5A 3RYTC 4G84A 4E5KA 5D3QA 1N5IA 2C7BA 1R12A 4JUBA 1ITZA 4WY2A 1CJVC 3NFRA 3QBVA 1OGJA 1TL7C 4GX2A 4E88A 1ORTA 2NXWA 1RJGA 3HDGA 2UZAA 1K88A 1OE0A 4LHEA 1NJFA 4Z7OB 3JVDA 4FEYA 4G8JA 2AR0A 1ESMA 4HDQB 3SG0A 3WL4A 5IASA 4B46A 1QS0B 2BT4A 1QF7A 1Y98A 1Z38A 4RF3A 3ZGXA 1MOQA 4Q3CA 1E5TA 5EKDA 3O8RA 2C57A 1C0EA 4A27A 5KZMB 4TXMA 4BV9A 1MABA 2RKOA 1YRBA 4G6ZA 5I48A 3K1AA 2QQ0A 1EA7A 1JZSA 3QEOA 1M2VB 1MUUA 4WSOA 2NW6A 4D42A 4DDMA 2OZVA 1CVLA 3Q2OA 4DLYA 2QMEA 1MTOA 5CVTA 2ZUWA 2CDAA 2I2BA 3OX2A 2J5RA 4HAZA 1UOPA 5ILQA 3TIIA 4YMIA 5BW5A 5GVSA 1RRGA 2XE8A 3FNFA 1C3XA 1E18A 1SNYA 2JAXA 1AQUA 3WHLA 1F2DA 4JX8A 2VRBA 1SHLA 1JSRA 4NV0A 3AY3A 4GRAA 4Y9TA 4OFXA 2ZYUX 4UPVA 1PZHA 2BV3A 4QBGB 1JRLA 1Y7HA 5F5LA 3L4BA 3MN1A 2MMCA 2PL9A 5FAXA 3TG2A 4IYRA 4PWYA 4QDKA 5LLDA 4P9NA 4CEJB 5JECA 2AQKA 5L6LB 3PLRA 3WQBA 1ZH2A 2J6HA 3GV0A 4I3GA 3V4SA 1HE2A 3FJ1A 2X40A 5EPOA 1U7UA 4E5DA 3PG5A 3WLPA 3P27A 1V48A 2FSFA 2Y9PB 3COYA 3HO6A 4H4DA 4CN8A 4Q34A 1U0OC 2V7BA 2ADMA 4KVZA 2G8NA 4UNPA 1UWKA 1NXXA 2VL7A 1MX1A 3ABZA 3ISVA 3PGLA 3RS7A 3DM5A 3AFHA 1Q83A 3WDSA 3DBIA 5IK2A 2R6R1 2QMHA 3KTFA 5KNLA 3BB4A 1Q0ZA 2EFHB 4ZRDA 3LCJA 4JEUA 1A50B 3WNCA 2FW0A 2OXTA 3V5NA 4L5JA 5B3KA 3PWKA 2BOVA 3OFND 4FUTA 3WG9A 2H4ZA 1ZL2A 4IJWA 2PH1A 4K03A 2C9DA 2FUG6 2WU4A 4I6EA 4YVFA 1ZS9A 4ENSA 3G2QA 4N48A 3C1UA 1E5QA 3HP1A 1BZYA 4L9WA 2FUCA 3HYRA 1V1JA 2Q07A 4JL6A 4XWYA 4BGVA 3G2IA 2BGIA 4L9AA 2YWFA 3I4FA 4I5FA 1P60A 1KI8A 5DEIA 2ZIEA 1A8QA 2VBFA 4GNKA 4O1HA 2XH8A 4RMNA 5BMVB 1Y1LA 1XLUA 4DVJA 3NFYA 4H60A 4HUTA 5EWLA 2WB4A 3ZZ0A 2C42A 2H9YA 2V7XA 2WYOA 1Y9DA 4OLAA 2NUBA 1OX4A 1R0LA 3LL7A 1M6VB 2J08A 3L46A 4P4UA 1A9OA 1YRWA 4ZALA 3UJCA 2P77A 1P39A 1X9IA 4ETIA 1HFKA 3PV0A 1TT5A 3TF5A 3RH0A 1J39A 1LV8A 2ASEA 1HE3A 3MINA 4NU5A 2EWVA 3GROA 3LUCA 4BN0A 1N2IA 3LDFA 3KU1A 2CJXA 5FPPA 4C5AA 1X9HA 2ZRKA 2AZDA 1Z0KA 1ENOA 3F1KA 2NTNA 2QRZA 1YUBA 3IP1A 3L1IA 3L1VA 3WDLA 4N3AA 5JUWA 1JIVA 4I7EA 1G19A 4OJNA 5FO1A 4E03A 2BFOA 5FLXA 4R1OA 2RHLA 8LDHA 3Q12A 3R3WA 4J1TA 1UBOS 4C2UA 1QQ6A 1ZESA 4J90A 3RRYA 1P62B 1GZ6A 4X45A 1QRTA 4K9KA 3G89A 4M6WB 4NS4A 3NNSA 4ZZ0A 4F4HA 3C85A 4GGMX 1E0SA 4LHWA 4XAQA 2X8WA 4V0ME 3DM9B 3GY0A 4R41A 5KWJA 3MUFA 1Q0TA 4GKVA 5IF9A 1Y89A 4Y67A 3VKWA 2PKXA 3ZLUA 4QUDA 5FDFA 2XTNA 2CNKA 1A96A 3YASA 3HYTA 3AHFA 4H3VA 2WUDA 1PZMA 5CNIA 2J0EA 2YN4A 1NOKA 1YULA 3L05A 4JIGA 4N4AA 5AD1A 1H9CA 1BD3A 3RHZA 2A0WA 5E8RA 4Q12A 1JXOA 3GFBA 1XGKA 2V7QA 1RDFA 4O2AA 5DCYA 2EP8A 2W4MA 3BHJA 4FONA 1O0BA 2AIRA 2P62A 3OQHA 4GIBA 3WFJA 4YJ3B 4X1IB 1NA5A 1WPGA 1X2BA 3BF7A 1XPJA 4RY2A 2IH4A 2TMDA 3QMVA 2A1UA 2QLNA 1FIUA 2FPIA 5JATA 1YC5A 3SHOA 4DJ5X 5IDXA 5JCPA 1C8BA 1DBPA 1G3UA 3WWCA 4GKBA 4DNXA 5L3QB 1YCDA 3UYLA 1MGOA 3O4RA 5CA0A 1FVFA 1XJ5A 4HDRA 3U31A 4B84A 1L9KA 3T1NA 2AKAB 3HCDA 1NXVA 1GKLA 2TMKA 3CEMA 4NBLA 2MU1A 2GF2A 3VZPA 4HFMA 1ZH6A 5IPFA 1C3EA 1VJTA 5IK2D 3EEOA 2BTQB 1UZNA 3Q3HA 3QV2A 5ESWA 3UK1A 5C8XA 1N8SA 4ZODA 2JAOA 1ZL0A 2V5VA 2YVUA 5EHGA 4C4ZA 3V1YA 2YJ6A 2XDWA 1ZITA 1BX3A 1Z2PX 2ID7A 3B13B 2IQ5A 2B8NA 2HCTA 2OO7A 5CVJA 3WIDA 5KQRA 3RFTA 1IY9A 2HRQA 3FSGA 3CNBA 4RZSA 3W2TA 3MBIA 4BAGA 4JYZA 2Z9CA 2IBSA 3ZEAA 2MSLA 2CL6X 2HXGA 3GP3A 4H4CA 1E61A 4D8YA 4Y2GA 4R6XA 1L3CA 1TZKA 4EKDA 4W5QA 3CLTC 4M2LA 3LYUA 4MJ7A 1WP9A 4U39A 4Y6GB 1L1FA 5DDIP 4CLRB 1R0SA 3UJNA 1PV1A 2XUZA 2V6GA 3CX6A 4LTMA 2VHXA 5ALYA 1PVDA 4UFPA 3PQ3A 4BMCA 3VISA 1OTHA 4MTLA 5GAJA 3I62A 2ISQA 3PDCA 4P98A 3TLJA 2WPDD 3GJ5A 4M8SA 2EW2A 1CUSA 1EE9A 2OBBA 2Y1DA 4AUEA 1CJMA 3SJUA 2BTEA 1P3DA 3L0DA 4EFLA 3E2PA 5BWLA 1LBTA 2ZREA 3SC3A 3FPAA 5C18A 4BEWA 1ONPA 3BXFA 3D8UA 1E2EA 4ZN6A 1SXJE 3T4UA 4BVAA 2GTPA 4MV9A 3MTQA 1VJ0A 3WGNA 3NM4A 3R41A 3LT1A 2BR4A 4BV2A 2ZBPA 4NC9A 1VA5A 4X8LA 4KPYA 1HYQA 2HK6A 2QMOA 3L84A 2ORED 1QG2A 3CT4A 3TQFA 1T8RA 2P9BA 1XT6A 3BAFA 5THXA 4F5ZA 1KP9A 1I6KA 5L95A 3PC6A 1VHTA 1TQ4A 4XJVA 1BWRA 2IYXA 2OC9A 3EEQA 3N2GA 3NP9A 4L3WA 4WN3A 4CQLA 5BORA 1AV6A 3A6ZA 2WPDA 1OGYA 2LD4A 3DL2A 2PUBA 5EXSA 4PAOA 2DSTA 5JPCA 3K71B 1XXHB 2XTAA 3IP6A 1G16A 2OBNA 4UARA 1B2RA 1H6BA 5H0IA 3QI2A 4RKEA 3RU7A 4EYEA 2CJWA 2PMFA 2R6HA 2L42A 2J9RA 3VC3A 1NURA 2VF7A 2Y0CA 3V8EA 1Q1GA 1YTLA 4EVQA 4QUKA 4A03A 2MYTA 1B74A 4XUCA 1YQXA 4WL0A 4CG2A 2Q41A 3FD8A 4FIZA 3ZDDA 1GKYA 4MUBA 5T4EA 2QUJA 1QP4A 5CYFA 1OXUA 2IYTA 4GGPA 5K2MA 3D02A 4DV2B 3ENVA 2WG2A 3BSWA 2OGTA 4AULA 3A04A 1UBUS 5KMGA 3CJTA 3CEAA 4IJQA 1ID8A 1X7YB 2A2ZA 3ZVKA 4O4LF 1TO2E 5JPIA 3BM5A 5D51S 3RKSA 1USVA 4DC1A 5LUAA 1G5FA 1FTSA 2GJ9A 2HIMA 1GQSA 2NM0A 3HB1A 3I37X 1BHO1 3OFKA 3P9IA 4RGQA 4S1PA 5ILGA 3IPCA 1Q11A 3NPAA 4QOIA 1PN3A 3G1WA 3ETEA 3KELA 3EY9A 3F6RA 2EARA 2VDRB 1XRRA 1YS7A 2JRCA 3E22A 2P2NA 4G81A 4HDNB 5GY7A 3K9LA 1T6ZA 1Q7EA 1EDBA 4NJEB 2OBXA 4RD0A 5F2OA 2H1FA 2QR3A 1V25A 2H9IA 1FP4B 2X0IA 3A1UA 2V8OA 3BSYA 1SBYA 2JHGA 3LFHA 4CHTA 1R27A 1NF2A 4IOJA 4P4LA 1UADA 3TCNA 1FDRA 3S5UA 2HGSA 4Q47A 2JIDA 3WKCA 2OR3A 3O26A 4B7AA 2OCAA 5CDSA 3OM8A 1QFYA 2ZB7A 1FW8A 2JVIA 2ZJAA 2HO5A 1K08A 1SUCA 3CCFA 3CUYA 4Z2YA 3V48A 1HNNA 3PGVA 4ZCTA 3DV9A 5AK5A 5ALWA 1U7OA 2Z2ZA 5T3UA 2RGYA 1COZA 3NBQA 2R65A 3O0TA 5G0TA 4BCBA 1F7UA 4NECA 2F3RA 3U26A 4CM8A 3SBXA 5SV2A 1N4AA 3RT7A 4F6RA 3OIGA 1NT4A 2J3HA 4FBLA 5AVKA 5IFLA 5LD2C 4CEHB 1OSNA 1FNMA 5HJ2A 3OPQA 3FVQA 3UFBA 5DTMA 4DCJA 4E5NA 4X1OA 1SGWA 4RUKA 2ZRLA 3IIKA 4YP6A 1GZ5A 2VSNA 2X2FA 4G5OA 1C4KA 1J0DA 1ENYA 3AF0A 5HQJA 3QE9Y 1X77A 2CXQA 4CCYB 1AUQA 2FUEA 5CLHA 4ATNA 1IHOA 3AI1A 5KSPA 2C4VA 2OLEA 2FX2A 4XGIA 1UOQA 3KVNA 1GTSA 1ABBA 1CR4A 4MVJD 2AJDA 1U0BB 2AVDA 5K0JA 2CJWB 1KZ6A 4U7FA 4ZT5A 2QMUA 3L8HA 1CX9B 3WHPA 1E6EA 1RR6A 4GFDA 4IG4A 3W34A 1NMXA 2PIAA 5LU9A 5E3JA 3AFGA 1LLQA 4XOIA 4JI6B 3EK2A 4CR6A 1Y3DE 4WA7A 5AUQA 1OH7A 1MX9A 2HWYA 2V58A 1YZTA 3UKOA 3WNBA 4K2HA 2FP3A 2NUAA 4YONB 5HFJA 3E9ZA 2A5FA 2MINB 1Z4MA 1CEEA 1TLFA 1ADCA 2XWQA 5C81A 2GZHA 1RNLA 3WP1B 3IKTA 3WL6A 4X8MA 1K92A 4RVFA 1Q21A 5C34B 1T8PA 1JECA 1F8XA 3UH0A 1QYRA 2BFCB 2V3CC 3KAJA 4M98A 4P4TA 1BNCA 1AIPA 3DKKA 2GPBA 3B9QA 3D7MA 1WMBA 2XODA 1KEUA 3K16A 3WWPA 3ZWWA 5CK4A 1UAYA 2EV9A 4GI3A 2Q6VA 4Z9FA 3U4DA 1BVUA 3E8SA 1USUA 3O1IC 4V03A 3GUZA 3L3BA 5JMTA 3I9JA 4EG7A 3JR3A 1TFUA 1GD1O 2IV3A 1TM1E 3LVBA 4DUYB 2IBMA 3ETDA 3SJCA 4P80A 1H6CA 1IZ7A 3LP8A 1A9PA 4DDKA 1JLKA 1WE2A 3EMBA 2VZEA 3K6KA 3RS3A 4GU5A 3BX1A 5FYQA 4EF6A 3THXB 5JI3E 1L7AA 1JWAB 3DKVA 4J8PA 2VI5A 4LJ6A 4OFBA 3JZFA 5IC5A 1T9AA 2ORIA 1OXMA 4O4IF 4OHKA 5U4XA 4N9QA 1Z56C 3N8KA 1HLDA 3SMVA 4L8LA 3T7IA 1WULS 3UM9A 3AINA 4ER6A 5L45A 1NVWQ 4OREX 4NQZA 5TPZA 1SQSA 3NTQA 3O1HB 1XNQB 3U7QA 4ARZB 3HU5A 1PG0A 3S68A 3KJFA 4E7PA 1TT7A 1IZ8A 1VCMA 3FA2A 2E4XA 5D1HA 4C04A 4GSYA 1WSDA 1L5QA 2A92A 2CLIB 4IHJB 1SC9A 4MS4A 2GMWA 4RIGA 1UJ6A 3U0BA 4YQFA 4E11A 3ZV6A 1M0SA 3IX7A 1T9ZA 2FYTA 5EPEA 4KXLA 3UJPA 5EGNA 2CHGA 2ZFUA 3LQ4A 1M2JA 3M33A 3EUFA 4BX2A 1QFJA 3ET4A 1IOVA 3EH2A 3DYIA 3DLPX 3N39C 4JT4A 1TZJA 2I3BA 2BP7B 2PAAA 1P6UA 2PGLA 5KX5F 3DDZX 1YOBA 4HDRB 1OWMA 1VIMA 1C0PA 2HF2A 3EOZA 4JGIA 4RIIA 4M9QA 3ZU3A 4AURA 1DBRA 5LQDA 5HPYB 3AF1A 2XF8A 3PUWA 1P3JA 2JGAA 4CBVA 2WR8A 4U7DA 4QQNA 5C5EA 1ZOIA 4LVOA 3IE0A 4B34A 1SOWA 3SR4A 3E7DA 3SM3A 3IAAA 3IUBA 1WUTA 5C31A 4QXMA 2CVPA 4YHBA 3NTLA 2X8AA 5IM5A 4B7ZA 3FH0A 4YRLA 2WWXA 3L6DA 1ADBA 2FFHA 2VJYA 2CN1A 3C3BA 3DCIA 3L8EA 2YZNA 3NHMA 4BBAA 1G3IA 5JVDF 1Q0RA 1E1CA 2IZ6A 3RIXA 3OZVA 3LS2A 1QOPB 2MYNA 1X87A 1E7QA 1XNGA 2FSSA 2OXFA 4H1VA 2B92A 4LZAA 3PUHA 5A6SB 4ZFNA 5ITVA 3X1DA 1TADA 1EJ6A 1NOJA 4ZOLA 3Q0TA 1JG6A 2C5BA 2Q0HA 2QQGA 3WKAA 2WAXA 1GPAA 5JJIA 1T5IA 1ZLXA 3V34A 4BECA 2QD5A 2CLEB 2Z4SA 5ECDA 2FRDA 3ROMA 4B44A 2P9CA 5HF5A 5K0BA 3ZJUA 4CNQA 3PD0A 5BR1A 1B00A 2NZ8A 3M8KA 2EW1A 1L7QA 3DCYA 2UUPA 2H4WA 1UFOA 1LPNA 1ZNWA 1BCSB 2YVKA 3L7DA 4IMRA 4PQRA 4UNQA 5I4CA 3EAQA 3C8HA 5CFZA 3CRRA 1DXQA 5F4BA 5J4VA 2B5WA 2WHPB 4NP6A 2J3DA 2C8KA 3T95A 2D62A 4K8RB 5E9QA 4NAUA 4KQJA 2C78A 2FX3A 4LAFA 4RZHA 3TNLA 1ZN9A 4YAGA 4QM6A 1T3ZA 2HN9A 4GQAA 4AMUA 1G4AE 1D03A 1TTHA 1PGJA 1KH3A 121PA 3K0CC 1XZMA 3RARA 2PJRA 3FM9A 1NJ1A 3IAXA 3UC9A 2OBYA 5DN6A 1BMFD 4X93A 2JK0A 4P3XA 3PQ5A 4R4JA 4BU0A 5L6MB 4Q00A 1FVHA 5JQGF 4RD1A 3FKQA 3FTFA 4NCHA 4D3ZA 2COEA 2IYEA 3JYPA 1AY0A 4QXPA 4PO8A 1EFRA 2RBEA 1PT7A 3MOSA 1VI2A 2YNMD 1QR6A 1SK8A 3CRVA 3LIIA 3LRTA 4O4IA 3OZBA 5F7JA 3U3OA 2FMTA 1V9SA 3LCVB 4I2VA 4AJNA 4YR9A 4JLAA 3EZ7A 5A6VA 4QFDA 4YPFA 5BW8A 1GRQA 1N5LA 3IKMB 3IR6A 2PQ6A 1XZHA 3L0ZA 3P9ZA 4KO4S 3DBRB 3PXBA 1QZZA 4LC1A 2M6KA 3IO5A 2VXYA 3W8NA 4MGEA 3ZHRA 1SRRA 2FZGA 3A7EA 3DDHA 3RM3A 5KJ6A 5FL7D 2BFAA 4D45A 1U2DA 1RYMA 1ZMXA 2KS6A 2DKNA 1Z68A 5BV8A 4BU1A 3PFKA 5DN6D 2J7PA 4E1BA 3HDTA 2B5VA 3EEBA 4MLZA 2OXRA 4DM3A 4UHHA 2WJPA 3UG7A 1SCQA 2AUNA 4BCDA 2Z98A 1RKQA 5KI6A 4EGCB 2RI1A 3L0PA 5EJ4A 2V6JA 2HHHB 2UYYA 1E3DA 2D0PB 5KTRA 2VTBA 2HNAA 4C0XA 4ZYXA 3B8HA 2OC4A 5WRFA 4XWWA 4AKIA 4KREA 2NOAA 1O8BA 3KXLA 1F48A 1C9YA 4RFVA 1RYZA 2ZWPA 1J09A 3LC0A 2ZSAA 3TQIA 1T43A 2GWRA 3USCS 3J7AC 3JD0A 3K3PA 2GSDA 1DHTA 2CNDA 3JQAB 3WDKA 6NULA 5E38A 3ZE1B 1SOUA 2BFBA 1A8PA 2I4LA 3CH7A 1IJEA 4Q7EA 5IT4A 5LZ2A