2QTTA

Crystal structure of arabidopsis thaliana 5'-methylthioadenosine nucleosidase in complex with formycin a
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
248
structure length
248
Chain Sequence
b'SEILRPISSVVFVIAMQAEALPLVNKFGLSETTDSPLGKGLPWVLYHGVHKDLRINVVCPGRDAALGIDSVGTVPASLITFASIQALKPDIIINAGTCGGFKVKGANIGDVFLVSDVVFHDRRIPIPMFDLYGVGLRQAFSTPNLLKELNLKIGRLSTGDSLDMSTQDETLIIANDATLKDMEGAAVAYVADLLKIPVVFLKAVTDLVDGDKPTAEEFLQNLTVVTAALEGTATKVINFINGRNLSDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-methylthioadenosine nucleosidase
publication title Molecular determinants of substrate specificity in plant 5'-methylthioadenosine nucleosidases.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
total genus 80
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature ec 3.2.2.9: Adenosylhomocysteine nucleosidase.
pdb deposition date 2007-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qttA00
3PNSA 1M73E 1ZL2A 1WTAA 1Z5NA 1SD1A 1RCTE 3KVVA 1PW7A 3ENZA 1Z37A 1Z38A 3OZDA 4TS3A 2XRFA 1V48A 1RSZA 3DPSA 3PHCA 1T8YA 2HSWA 3OZCA 3OF3A 3BSFA 4WKBA 5ETJA 4QEZA 1U1DA 5K1ZA 1Y6QA 3BGSA 1Z33A 4QAQA 4FFSA 1RXSA 3OZBA 4TXMA 1RXYA 2AI2A 5F7XA 1RR6A 5EFOA 1V2HE 3SCZA 1YRYE 4LDNA 4GLFA 5CCEA 4WKNA 1RXCA 5F7JA 1ULBA 3NM5A 4D98A 4BMYA 2AI1A 1A9RA 2QTTA 1TGVA 5B7PA 5KB3A 3BJEA 4D9HA 1CG6A 1ECPA 3MB8A 4LKRA 1I80A 3KU4A 4LNAA 4GLJA 4F1WA 1Y6RA 5F7ZA 3DJFA 3QPBA 4BMZA 5EUBA 1NW4A 3ODGA 2BSXA 3DDOA 1PF7E 1PKEA 1TCUA 4EARA 5JPCA 5CXSA 2RJ3A 2B94A 1VHJA 3UAYA 4TXJA 3PHBE 4R31A 1B8OA 1ODKA 1Z5OA 1PK7A 3T94A 1YQQA 1LX7A 1OUMA 4YNBA 2OECA 3P0FA 3EUFA 4F3CA 4H1TA 4DA6A 3U40A 1V45E 4NS1A 1YQUA 2A0WA 4TTAA 4DA0A 5IU6A 2QPLA 1VHWA 3E9RA 1PR5A 4EB8A 1RXUA 3LBAA 5B7NA 3TL6A 5F76A 1NC1A 2HN9A 5CYGA 3C74A 1NC3A 1PK9A 1PR6A 4BMXA 3LGSA 2IQ5A 3EMVA 1A9QA 4TTIA 4G89A 1SJ9A 3NM6B 1PR0A 4L6IA 1JYSA 4M3NA 5F78A 5CCDA 1TCVA 1Y1QA 4JP5A 4F2PA 4OGLA 1K27A 1OTXA 1LV8A 3OPVA 4K6OA 1U1FA 2AI3A 3KVRA 1V4NA 2ON6A 3MMSA 2A8YA 1T0UA 1VFNA 1T8RA 5B7QA 1V3QE 3GGSA 1T8SA 1Z34A 1LVUA 4D8VA 5DK6A 4R2XA 5EPUA 4DAOA 4LZWA 1VMKA 4OGKA 4YO8A 4DARA 1YR3A 1JDZA 1U1CA 1ODLA 1YBFA 1Y1TA 2H8GA 5B7GA 2HRDA 4JWTA 3OOHA 3NM4A 4F2WA 3O6VA 4OY3A 4P54A 2I8AA 2Q7OE 1A9OA 3KUKA 3K8QA 3EUEA 4GKAA 3OOEA 4DANA 4L5YA 4WKPA 1ODIA 4MCHA 3IEXA 3DP9A 4ECEA 1JPVA 4LNHA 5C80A 1PBNA 4PR3A 2HWUA 4QASA 3IOMA 1JDTA 4IP0A 1K9SA 2QTGA 1A9PA 4G41A 4QATA 4OF4A 2P4SA 3PNPA 1A9SA 1A9TA 1SD2A 1Z39A 3E9ZA 4L5CA 1Z35A 1CB0A 3FNQA 3LA8A 1RFGE 1C3XA 4QARA 3D1VA 4M7WA 4TXNA 2A0YA 2OC4A 3UAWA 4DA7A 4RJ2A 1JE1A 2I4TA 3F8WA 1PWYE 2OC9A 3K8OE 4WKCA 4MARA 1JDVA 1QE5A 1TGYA 3INYA 3UAXA 1Z36A 4TYMA 2OXFA 1FXUA 3BL6A 1RYZA 4DABA 3FWPA 4E1VA 5I3CA 5CYFA 3KHSA 3UAZA 1RT9A 4G8JA 4X24A 5F73A 3GB9A 2A0XA 1JDSA 4YJKA 1PR4A 1T8WA 3NBQA 1JE0A 4M1EA 4BN0A 1OU4A 3EEIA 3DF9A 3P0EA 4NY1A 4D8XA 3OCCA 1JDUA 4NSNA 4MCIA 1G2OA 4PNPA 1ULAA 4R2WA 1ODJA 5FAKA 5IFKA 1N3IA 2QSUA 1SQ6A 4QFBA 4TXHA 1OVGA 1Y1SA 3E0QA 4GMHA 4OJTA 4L0MA 5F77A 3KVYA 1OTYA 2PGAA 3FAZA 1V41E 2QDKA 1XE3A 1Y1RA 1Q1GA 4U2KA 1B8NA 5CXQA 1U1GA 1PR1A 4D8YA 4DA8A 3ONVA 4YMLA 2GUWA 1OV6A 4TXLA 4TTJA 4JOSA 3OZEA 4I2VA 1K3FA 4UC0A 1ZOSA 2ISCA 4OEHA 3UT6A 5F7OA 1PR2A 3FB1A 4L5AA 1U1EA 1A69A 4KN5A 3FUCA 4TS9A 4WKOA 3UAVA 1JP7A 1Z5PA 3O4VA 4DAEA 1TD1A 3FOWA 4F3KA 2AC7A
chains in the Genus database with same CATH superfamily
4UVDA 1L5SA 3H05A 2AZDA 3VDMA 3HS3A 3D43A 1MOPA 1XOIA 2ODAA 3IUPA 3WB0A 3WRWA 4JYZA 2HD4A 1SRRA 1U8AA 4YT2A 5JCJD 3A1EA 1U0LA 2Q3BA 1HT2E 4UBKA 3ETNA 3C39A 3E3NA 1CY1A 1N8KA 4X6YA 4L5BA 1E63A 4IVRA 3IBTA 4BMSA 1GN9A 1XNGA 3C48A 4ZVNA 1EGAA 3F4KA 4YAIA 2ZJ1A 5JIBA 4FDLA 3VVLA 2EZTA 2H5EA 1JJBA 3KK0A 5BSUA 3C6ZA 5AKKA 3EAFA 1P45A 3RF6A 4L07A 1Q2XA 2L19A 3QBDA 2VJMB 3VZCA 3QKRA 4KPUB 4BTVA 3D8SA 3GVCA 4LZNA 4OM8A 1SK8A 4EIWA 5KVSA 2A9RA 4H1WA 2V3WA 3DAHA 4XTCS 2JLSA 2Z9CA 1YULA 3NX4A 4E5NA 2CBZA 4JAVC 5DTRA 1JXAA 1VJ1A 3GXBA 5IXSA 2J45A 1WCXA 1EVQA 1UDXA 5JD3A 3NXSA 2XTZA 4JBLA 2J3HA 1XMSA 3UMVA 5CITA 1YBMA 1TZKA 1JJ7A 2XEDA 2XI4A 1CSEE 3IESA 3FCUB 3GJZA 3AILA 1UWLA 4K8RB 2PGIA 1WHTB 5HFJA 3ETDA 3N2GB 1UK7A 4GPTA 5E3IA 3DBHB 3E35A 3RUAA 5G02A 5JU6A 2GFQA 4ZYTA 2GILA 3QEMA 3KOZA 3IVXA 1EI9A 2DTXA 4JVOA 2Q46A 2NV2B 3DV0B 3NZEA 2IXDA 3I6ZA 2JBAA 3HY6A 1H0KA 3IPCA 3PFGA 5CIWA 2PFSA 4L8FA 1ZOOA 2AJCA 2AVNA 4KE8A 2I6GA 5IKEA 5JSUA 2JGIA 1JEDA 1DHRA 1QGUB 2Y92A 4TWJA 4Q1FA 3Q8KA 1Z8DA 3N7UA 2QA5A 1PS9A 4R84A 1THTA 1V0JA 2OO3A 4UE3S 4CEJB 4INOA 3M49A 4N5HX 4CV0A 2FZLA 4KC0A 1SB9A 4C08A 4EW3A 5HIAA 5TB5A 1SULA 1CEQA 1JT2A 1T15A 2G40A 4BX8A 1XG5A 3GWZA 3QV2A 5DLPA 5ECWA 2DC1A 5G0VA 4WTOA 1U8YA 2QORA 1SQ0A 3R0IA 1K6MA 1MDBA 2HXYA 3LBIA 5JD6A 5DK4A 2W8ZA 2INGX 1XYYA 2ZOSA 2CXRA 3HM2A 2BPOA 1GFIA 3A9UA 1RMTA 2R44A 3KTDA 4CLHA 2E37A 5ABPA 5B7PA 4BTEA 3COYA 2RHMA 1YR8A 3WHIA 3F97A 2BFDA 4Q24A 1SPBS 4O08A 1D6MA 1N9GB 2F43A 3G23A 5JWRA 4C87A 4XYEA 5COQA 1THZA 4AROA 2NV6A 4HRAA 4LOKA 4ENVA 4S05A 5K8VA 4I2NA 4RIHA 4GDMA 3UFXB 1MBZA 2VWQA 3CF2A 4Z5XA 2VNKA 3BK7A 1E6EA 3L7CA 4S12A 4BUCA 4NE2A 4EAAA 1FF9A 2JD1A 2Q6OA 1RZUA 1J9EA 1UPXA 1JIQA 2BC9A 1EZZA 1WUYA 5CXSA 5AM0A 1FFCA 4X1YB 3RFFA 2PE5A 5IJAA 5A71A 3HN2A 1EAYA 4ESOA 2HLPA 1ISMA 4MDFA 2A5DA 4JOBA 1HZZA 3SHVA 2BYTA 2HREA 1UM9A 2PGDA 3GUYA 3ZV6A 5IEJA 1PV4A 3NPAA 3UAYA 5FPPA 4RGYA 1SXJE 1FS5A 2GF2A 2I9PA 3M4JA 4R31A 1B8OA 4OL9A 1PO7A 2OFOA 3QVJA 4KXLA 3VR5D 4Y6GB 4E5YA 4J6EA 3WL4A 2QROA 4R7ZA 3B6ZA 4ZO6A 1EM8B 1PG2A 2BFMA 3KQOA 3LY5A 3O8OB 4UAJA 5DM60 5LZ2A 4R83A 4OLBA 2JAPA 1UWCA 1WEKA 4XD7D 5CXUA 4RVSA 2FFAA 2JFHA 3NHPA 2XMDA 1J2JA 3NFRA 4B3BA 4P93A 1O6GA 2IXFA 5KZMB 2P3OA 2VL7A 2QVYX 3KVNA 4XUEA 2YFYA 3RGWS 1XD9A 1XTSA 3BWYA 2KQUA 3EEYA 4FGLA 4HN4B 5G0SA 1PQUA 1HGXA 1PEAA 1PIWA 3HB7A 4FXOA 4MVJE 5IKMA 5AHOA 2OB1A 4L16A 5B4VA 1U63A 5AW8A 3AG5A 5BN1A 1SVWA 3LT2A 5KCMA 1MF7A 6GPBA 1VI2A 4LY9A 5JMOA 1G1AA 2J32A 3OD5A 3BULA 3A2LA 3OEHD 1SCJA 4U2CA 3OQBA 2A0FA 3NKFA 4F21A 1IN5A 3H0EA 1B2LA 1V8OA 3HFGA 3IR5A 2X5JO 4UHEA 4DA0A 4C7JA 2X8JB 5EJGA 1UFKA 2FZ4A 2NG1A 4QXAA 1IN8A 3ZK7A 4KQIA 3UMSA 5FRDA 2PZ8A 3CN9A 5JG7A 1GAWA 1XEXA 4J9UE 5LZ8A 1H3FA 4M0EA 4J2OA 4BKPA 3CLSD 2YIVX 3R3ZA 1J2YA 4KVZA 2FF5A 1MMFB 1PP4A 2P6PA 2GCOA 1P6UA 5IVIA 4YYZA 3UQYS 2PFGA 1JVNA 2ZT7A 5FPKA 3W1EA 1PR6A 2PLAA 4L9WA 4ZXPA 4QNNA 4C1BA 4PSAA 2AEFA 2ERCA 4A15A 5ALQA 1H05A 2ZBUA 3GLKA 1A9QA 3IP3A 3FPEA 1A96A 2P78A 3GDOA 2OA0A 1P7ZA 2XGOA 4NYIR 4F6RB 4FWIB 4LRSB 5TJHA 1KDVA 2FHPA 4TL9A 1EWVA 2FFJA 1F51E 3SZRA 4EY6A 3H2HA 4FKZA 3I3OA 4FONA 4F11A 5LD2B 2P0AA 1N0HA 1Y1QA 2PMCA 1FQKA 3AF0A 1RHJA 3C7DB 4Q9DA 5IZCA 4OGLA 3IKTA 3PXEA 1J4AA 2GBGA 1FYDA 1FUYB 1NZJA 4U2FA 5C8YA 1NLFA 2HF9A 1XRSB 4WECA 2I0FA 2ZJ4A 3DXXA 1LK7A 3EQ2A 4NYJR 2VF8A 2EG5A 4Q3OA 2D2FA 3F6PA 1GZ5A 2H2FA 1G2IA 3F6BX 2NZUG 4QOJA 3N5CA 5JJCA 3K70C 1V4NA 1S8NA 3VJRA 2LWIA 5FIUA 5KNBD 1AGPA 2A4KA 2VPXA 3H99A 1VMDA 2A8YA 1DQRA 3NXKA 4FDAA 3T54A 2BGWA 2A30A 2HI0A 1XF1A 2O20A 4LHEA 1E59A 3DYBA 1W44A 3FVVA 4IMRA 4KUHA 4V0LA 2P3SA 4WOKA 2PT5A 2QLTA 3A4VA 3F7MA 4IDEA 1BVHA 4JXJA 4C7OA 1KRXA 5FA8A 3VR2A 5JHGB 2X9VA 2GF9A 4F8YA 5KWJA 2NO5A 2AFIB 1VG8A 3G2QA 2FOLA 6PFKA 3ME5A 1E64A 3K0KA 4WCDA 2W2KA 2C1EA 1QTIA 4KUEA 1Z3CA 3R7WA 4HNVA 2Z6AA 2CNWA 2V7BA 1R5JA 2WF5A 2FPOA 1VE6A 1P4SA 1CZOA 2X19A 3CG4A 3CLKA 3K0FB 4Q3BA 4HY3A 3VMMA 1ID8A 4R71A 1JG3A 4WXYB 2HLDD 1SEVA 2EV9A 2A0UA 3PHHA 4XFKA 5AJUA 1QKKA 3D3KA 3PXDA 2X2FA 5AW0A 3CWCA 4MB2A 1RWVA 1N2HA 4WN3A 3WBFA 3A0UA 4F2WA 1OBHA 2PL5A 4JELA 1WZEA 5AVSA 1XN4A 2EQAA 2ZUDA 5JTTA 2GYUA 4A2PA 1YOVB 2EYQA 1QTRA 3EEFA 4EM6A 2O2GA 1IU9A 2H48A 2MSEB 4U5QA 2BGGA 1R74A 1NF2A 2AJ8A 3K8QA 1M67A 5U4QA 3W6ZA 1EXVA 5CG1A 1NG9A 2DETA 2ZYSA 2DFPA 1RC0A 4ZRDA 3N59A 3TZQA 4EJ2A 1V16B 1NSYA 2GJ8A 3ZXSA 5ALWA 3KB2A 2YZ7A 3LBFA 3TR6A 3Q10A 1TIKA 1LRKA 1NJ5A 4DSUA 2UYHA 2FG7C 1N2EA 4UEKA 5EP3A 4DPKA 2OHHA 4BNMA 3ZWBA 1CP3A 4E94A 5JSZA 1GAXA 2IYLD 2JDIA 2JPDA 4R1TA 3V4VB 3VV2A 2PMEA 3RVLA 3BORA 3ZE7A 5FNZA 1LQTA 4TQUS 5F64A 4QEDA 1BKYA 2L82A 5F98A 2G76A 3PXUA 4M88A 1E9AA 4ZYWA 3M6VA 4GG1A 5EE1A 5A0FA 4Q05A 2H00A 4L8YA 3GLFA 2X5XA 2BJWA 3HP1A 3ZWYA 1JW9B 4PV7A 2I1LA 1D1PA 4YN3A 5K2MA 4LTNA 3T7KA 3V1LA 1NN3A 4ALIA 2AF4C 3P32A 5JMWA 5SV2A 4Q4HA 2DQ4A 2P8JA 3D8RA 4MRMA 1UOEA 1XZEA 3GRYA 1HNWB 1ZVQA 5I9LA 4QUAA 3A37A 3KQYA 3PRKE 3WA7A 1G21E 3CMMA 1M1NA 3U4AA 4RLHA 1J0XO 4ND3A 4M7WA 4TXNA 4B8ZA 3WG9A 4IJ6A 4TSRA 1EFVB 4J7UA 3NBZC 3SDZA 3AVWA 1NF9A 3G2MA 5HHTA 1WMEA 3E7FA 4IDDA 2WTBA 4KZKA 3ROEA 2PK3A 3B1KA 2FSFA 3Q5DA 5TVGA 3RRNA 4AY2A 1MJGM 3TGPA 5KSOA 4LXYA 1P9OA 4H3VA 1P80A 4IVNA 4F6CA 3JYOA 2H51A 4OHZA 1EGVB 2APJA 2AN5A 1Q44A 2R6R1 3BBLA 3G2LA 3IDAA 5AHXA 1VSTA 1EBFA 4O4JF 5L7YA 4AC9A 1NMQA 3MGBA 4OSOA 3GG2A 4ZVTA 3AI2A 1T9ZA 4LJAA 3GF4A 3O94A 3U4DA 5AM2A 1DGQA 2FDCA 1ZBDA 1SZPA 2V97A 3A10A 3TKAA 1FXUA 3FF1A 1RYZA 3IV6A 4YCMA 5KQRA 4QE3A 2HL6A 4QGBA 5JR3A 1QB8A 2VQEB 2NO9A 4MDEA 3BRWD 1P33A 1OT3A 5CFRA 2Q2NA 3WFJA 2MHCA 1PRYA 4OHXA 4GYKA 1ICEA 3VKUA 5C2JB 2O8EB 3CEHA 4RVHA 3PPYA 3L41A 4EG5A 1WUJS 4PICA 3M2TA 3MOSA 4C4TA 4WVFA 3R5JA 2LE0A 2E5FA 3IVMA 4PX2A 4ZK2A 3LT4A 1X7HA 3L05A 5KNDD 1BD4A 3ABRB 1CWUA 5HK8A 1SBZA 4PQGA 1SK9A 1OLSA 2P9BA 2ZRQA 3L4SO 4GPAA 1VLQA 1ZICA 1Q1BA 4R8VA 3LUCA 5AW3A 4CM6A 2Y1LA 4KHZA 2XJ4A 5IT9A 2Q3LA 4Z9YA 1HNXB 2GS9A 1DTWB 2W0MA 2GTPA 1T43A 3RSZA 2C9OA 2FGJA 5AJVB 3Q3HA 1P72A 1L6RA 5BPHA 2XCOA 4WFQA 1DZ3A 7YASA 2YJTD 3RBAA 1S8OA 1GR1A 4R0VA 4DQUA 4TMVA 2JCYA 2JK0A 3N0VA 4NCXA 2XEXA 2MYPA 3O8LA 4HN9A 3QF4B 1NURA 2XE6A 1EVKA 2ZSBA 1WVIA 3HXQA 4ZHSA 4KRFA 4E11A 5A4MS 1FDRA 5ALOA 3RSQA 5CVJA 3BWCA 4AF6A 4ZQIA 4D25A 4FYHA 2G5TA 2YWJA 3GN2A 2XZLA 1QRAA 2COUA 3KZCA 1E1DA 3K32A 1V41E 3Q3CA 4NMXB 4TLAA 4XIYA 5CB4F 3V2HA 2ECPA 2VEOA 4DM7A 4KVGA 5AVXA 2QR2A 3UJ7A 1AN0A 1NJ8A 4F06A 3W5BA 4IILA 3S4YA 2IU4A 1LBQA 3CEPB 3O4GA 1HYHA 3U26A 2A3RA 2CFTA 4ETNA 5K7SA 2WE7A 2O5VA 1OD6A 4UQOA 3VPGA 1XO1A 4FFVA 3DEJA 4YMLA 2Q27A 2C20A 3DZKA 2CMGA 3AYXB 4ZIRA 2FSGA 1BD3A 3K0CA 5T64A 3RAJA 4RLSA 4WVLA 2ACWA 2ISQA 5D01A 4F3YA 2HK6A 2OZKA 3DEAA 4MJ3A 4UHHA 1E8MA 2P2GA 3C5WP 5BORA 4A36A 1YB6A 1K66A 5I45A 1OB2A 2Z1NA 1W29A 4JV5B 2WTEA 3IMKA 3QPAA 2REQB 4ZPJA 2FWJA 3RAEC 3EXG1 3QKRB 4DT1A 1WSDA 3LBHA 4NL4H 5EEGA 2PTGA 2H7YA 2X1HA 1JIUA 4HAYA 3A58B 1N25A 2C4MA 3HUEA 4IGIA 2F55A 1O95D 1O8CA 3RU2A 4BX0A 1QGDA 1Y0BA 3IP6A 3N7TA 1M2OB 4KIUA 3H5VA 1FE8A 3PQEA 4UU8A 1I3MA 4RJTA 5KOHB 1XVAA 2X1MA 4BVAA 1PNRA 1S1MA 3NHMA 3UJHA 2XNKA 3GJ3A 5CFPA 1JEQA 4AMYA 1FLAA 1G3IA 1F7VA 5HKKA 3MTBA 1U9IC 1SVLA 5K01A 2R2AA 1Q7BA 3SYMA 2HBYA 3NJRA 3GLGB 1GUAA 1VMIA 3F2VA 3H2IA 1E0DA 1HMYA 4FI3F 3KE8A 1MT3A 1ZAYA 3P9RA 3JQQA 3QEMB 3QRWA 3QY0A 3JQEA 3ZWMA 3MCWA 3L46A 3NHSA 3GARA 2WMYA 1GNRA 2XPCA 3CLUC 3MIZA 4EB0A 3MWLA 1EVJA 1E8DA 2QUJA 4BO6A 2KS6A 3ETJA 1JHQA 3TDKA 5C81A 5I7VA 2HJVA 4B45A 2YHIA 3ZWVA 1OXKB 1FFYA 5EWLB 5BVHA 4TRNA 1VDMA 1HE1C 4DR5B 4E5PA 3LDFA 3NAQA 4IKPA 3HJGA 4PZCA 4DA9A 1Q15A 2QTLA 2IDJA 3QG1A 3VNBA 2YRXA 4YAJA 3DB1A 3I05A 2IP2A 3I9MA 5LN1A 2PBZA 2Q2VA 1S01A 3DTVD 3IA7A 5EZQA 4B4DA 4CMIA 4FLEA 1B1CA 4TYQA 4O3FA 3U7FB 1H8EA 1KDPA 2CDRA 1RBZA 3KVVA 5DX8A 5HDBB 2EBUA 4W8HA 4AZWA 5HW0A 1CPYA 4BNDA 3S3TA 4P0QB 3R1IA 3QENA 4HNQA 3HJAA 3SS9X 1U0EA 4XIIA 1YQXA 3H1BA 1IBKB 4JXZA 1VOTA 1YK0A 4N40A 4ZAYA 5TARA 2R60A 2YFHA 1L1QA 1RBQA 3SBDA 3JWGA 4JDPA 3WRYC 2B1IA 2XRFA 1R0YA 4E09A 2WZQA 3UAOA 2VC2B 4WJLA 2BFDB 4GI2A 3FPCA 5EQFA 5KNLA 1KS2A 1CHDA 3OWOA 5JO0A 2F43B 3HABA 3WBKA 1SBCA 5B64A 2XTNA 3WJAA 2FYTA 3EH2A 2V4ZA 5DU2A 3M5WA 1ARZA 2AKEA 5EFZA 1L8QA 5G53C 1QDEA 3TIIA 3R7DA 1PU2A 1U99A 2JAOA 4QEZA 3P2JA 1MH9A 4ZVPA 1U1DA 1CUYA 1DV2A 1GARA 3MJTA 4MB6A 4PE5B 3RRXA 3TW8A 4KPGA 1GLGA 5AUPB 1SVNA 1JWBB 2NU7A 3D6VA 3ESZA 4KX5A 4P4NA 3VO8A 3BIJA 1PTJA 1VLMA 4YHBA 2VAVA 1ZA2A 4A8JA 3OEEA 1CJCA 2C0CA 3ADPA 3OX3A 4G0XA 5JVDA 1T3TA 3GQVA 2IY9A 3TD6A 1F0PA 1TYBE 1ZH0A 4NBWA 2G5PA 4P3XA 2NNWB 4LC1A 1GNQA 2QRVA 3TZ6A 3LT0A 1NVAA 1U3VA 4ZEWA 3V4OA 5KQGA 2QTFA 5JV5A 1MZPA 4II2A 3O83A 4GWLA 1BS2A 1E0JA 4ROSA 2AXQA 4AVYA 5C3UA 1I4EB 1HO3A 4G4GA 4LKOA 3NH9A 1CTQA 1TLLA 4WDQA 1J09A 3C7CB 3JD3A 4PG7A 2ODWA 4RHCA 1KZ1A 5E3HA 2CK3A 2JNWA 2LVBA 4KE9A 3EIWA 1EFUA 1KEPA 5EHGA 4JI3B 5KYUA 4EUKA 3CX8A 1GR0A 2UYOA 3GAZA 3I2KA 4YIKA 5GV7A 1PS0A 3MHPA 3T5TA 1WM1A 3GVPA 3TRHA 1L5VA 3B1XA 2ERYA 5D3ZA 1XXLA 4Z4FA 4Z2AA 2DBZA 1NMXA 2RGNA 1U0OC 4BMYA 4D79A 5J2TF 5AKZA 2J46A 4EW2A 3MWKA 3ONNA 1MB0A 1GJRA 3VR6H 5J2UF 3LG2A 2Y2UA 1KTVA 1C3OA 3BAFA 1U0JA 4MVCA 1YZHA 1Y8ZA 4ZC1A 2XD9A 2VDPB 4OHUA 4XJVA 5B1SA 1UIMA 1EQUA 2KWIA 5FUQA 4LKRA 3A1WA 4UE2A 3THOA 3VR3A 3BXGA 3KU4A 3R4CA 5EKTA 2EHDA 4D57A 4YASA 1HYQA 1V8DA 3DFUA 1E2QA 1NNI1 4EA6A 1CUHA 1UIRA 2OXRA 5LDGA 4N0DA 5E0KB 4D44A 5J4HA 4TMYA 2W43A 1X42A 1V47A 1U65A 1NZFA 1TA4A 3L7OA 4B48A 4TV8F 2DR3A 5JPIA 2FPKA 2IXEA 2QTAA 3KG2A 1NUQA 1TCUA 4Y98A 2P2CA 1QGED 2HA7A 1MXHA 4BJHB 1KY2A 3PUJA 1QNLA 1R0RE 1VJTA 4FDTA 3LYUA 3SIXA 1MG5A 5AUOB 5KWVA 2W2NA 1R0CA 1VHJA 2WWGA 3HA5A 3FPGA 1WY5A 3I9OA 3CKMA 3U81A 1MA3A 1YR7A 2WQ7A 3LYAA 4DGQA 2GN9A 2WNIA 4EUSA 5CA0F 2DPGA 4CKBA 4NF2A 4MUNA 2X5NA 1Y5IA 4X97A 3A6ZA 5C8YB 3U1VA 4NBUA 2VHUA 3TSZA 2H3HA 3BZWA 3JALA 2AQKA 3PNMA 3HU2A 1KARA 4Q1BA 3C3CA 3VSBA 3PJEA 4RZXA 2C5HA 2WV9A 1X80A 2OKCA 1M8PA 2YMPA 4HFJA 2AJLI 1XA4A 2VWPA 3ABIA 3ZWXA 4M8IA 3FKSA 3V1UA 3WKDA 2LUOA 4GR9A 4GRDA 5EEHA 4WLVA 1RBYA 2FKAA 4UKDA 1VCOA 1L5GB 3L1UA 3ZU3A 1I2CA 3WV4A 3WZ2A 2VJBA 1EUDA 2YICA 3RJTA 3ZI7A 1DQNA 1WB4A 3D7NA 2Z2JA 1NE7A 4WBNB 1T5TA 1T9DA 3TIFA 4ZOAA 3I5MA 2W2KB 1DEHA 4F4FA 5JQGA 1T6ZA 1ZOLA 2XE7A 4Y2XA 3R7WB 1ZGBA 2XDYA 5H16A 3RAPR 4ENSA 2CLCX 5KOIA 4QTZA 3PX2A 3TUIC 4AJ4A 2Q3JA 3SQMA 1POXA 1R4NB 1UJNA 1VKJA 2ZSDA 3KQSA 5TY0A 3S2FA 2MOKA 2XSZA 3T4UA 4R1OA 4AAYA 3A1CA 1PDWA 3HUDA 3VBCA 1K7EB 1VJ5A 3KZNA 2YKGA 4D3XA 3LDUA 5P21A 1LK5A 1BHSA 1IN1A 3FPLA 2IYFA 2PVSA 2LD4A 4JNKA 3EOZA 4Q00A 4V38A 4MGZR 4LJ4A 2QX8A 3A6DA 2ESRA 3SMQA 4AYWA 1WKVA 3GEEA 3F9CA 4YWJA 1AQUA 1JLLA 3RM3A 2CL7X 2ZT5A 3V00A 3P0HA 4L6IA 1OH5A 5D87A 2G09A 2QW0X 2ACEA 1QNFA 4DLUA 5ALSA 3UUEA 3NDRA 2X42A 1X2BA 1BEUB 1JKJA 1RM0A 2YH2A 3DULA 3FPJA 4R3NA 4JXXA 5JSZB 2YXLA 1K27A 5I7AA 4D0LB 2H4ZA 3G0OA 3JQPA 4UHFA 3G6WA 4BWVA 1UF9A 2E4AA 3A9TA 4G6ZA 1KZ9A 4QO7A 3L6DA 2JHFA 4PS1A 3GHYA 4JVNA 2PFKA 1MQSA 3V4LA 3WI7A 7ABPA 3GJ6A 3HFJA 2NT4A 1SXJD 2FR8C 1E9BA 3TOXA 2WNSA 5IAOA 3VDRA 4OK6A 1FSZA 3EPRA 4PO1A 1VCHA 1FMCA 1GP2A 4A92A 1V3QE 3CA8A 2R7KA 3KPJA 1DUSA 1ZNQO 2Q4TA 1JZQA 5A5GA 1R6TA 1ZKMA 2W2LA 3CRQA 1M1NB 5EPUA 3AUSA 3ZCXA 2WKPA 1N8TA 4EMUA 3S8MA 1RHMA 3TEMA 3ZUGA 3KJHA 4JQCA 3CRZA 3D4IA 3BYZA 4D4HA 3N2EA 3C8UA 1VKOA 5HYVA 3B6IA 4JLKA 3X3HA 1ODLA 4MVJD 3MNFA 3CRW1 5HJ7A 4KQGA 1CUUA 3M1IA 1Z45A 5FBLB 5JHHB 2FWAA 1R50A 1CE8A 2DXIA 1KEEB 5CB0A 1W47A 3T7AA 1WMDA 2X9LA 1NATA 2OD9A 4L9AA 1KR5A 1V37A 2WHEA 3SX4A 1UANA 4EFNA 4WERA 2KLHA 3CISA 3LIPA 1E2NA 4H15A 3RYFB 2H7CA 3RKRA 4W7SA 4GM0A 4H9GA 1Y9EA 5SY6A 4QYXA 1P19A 5FT9A 4B34A 4D81A 1L4YA 2EBHX 5BR4A 3C3BA 2QJRA 5A7FA 1IXSB 2VN8A 3GFFA 3I5UA 4BX3A 1P5HA 3AHGA 3AINA 3GNTA 4Q9IA 1JEYB 1SZDA 2WI8A 3HCRA 4PPGA 1QO7A 3LMKA 3G5LA 1AK9A 4C4OA 7MDHA 1SVSA 5GZ6A 3WTBA 4OXNA 3NUZA 3RT1A 4D5EA 3KXPA 1TD9A 2C4HA 4IWNA 1DSSG 1MJNA 1FDOA 2PAFA 3OI7A 4PR3A 3OMLA 4DILA 4F86A 3BEOA 3L49A 2NACA 3QSYA 1RFLA 3LPMA 3IR6A 3W9UA 1ECCA 2GA9A 5GVRA 1WSAA 4OXKA 1YTUA 4B3SB 4PG4A 4JLJA 4BS9A 4PFSA 4QA9A 3KUCA 2HCTA 5I7RA 1IM2A 3V4FA 3DEIA 3G13A 2R3SA 3BE5A 1A9SA 3QBJA 1I4OA 4V0NA 4IIUA 4LJ8A 4Y2TA 2O52A 3EIEA 4L5CA 1TM5E 3I5XA 2I4RA 2JZNA 1U31A 3A6EA 4QUBA 2J41A 2YV1A 3OZIA 2GYVA 4DDHA 5LR6A 1K5GA 1D1TA 2RHDA 1ELOA 3QNMA 3V8VA 4RWZA 1UBGA 2VQDA 2AK3A 3LQQA 2WICA 3P9YA 4YJFA 3L06A 4H59A 4EMTA 2JZCA 1VPEA 1T1SA 3GLFE 1W88A 4MRNA 2I3GA 3U9SA 3O8RA 4DC1A 1YT5A 3M6LA 3DYVA 4IHAA 4W99A 1EVYA 3L0PA 1HT1E 2EZ8A 2CSUA 3Q8XB 4I9HA 1DEKA 3VOSA 3ZKAA 2IXGA 4ODIA 4JYAB 4HZUB 3OZRA 2Z57A 1GPYA 5CGQB 4ZICA 3EWIA 1N5JA 3T7RA 4Y2SA 4RCYA 1F2TA 2C84A 3FB4A 1M2JA 2VI5A 3VPCA 4FDVA 4YA6A 3P2KA 5JBNA 3BGIA 2RCYA 4ZHQB 2MIIA 3OA2A 4G5QA 3R5XA 4S1VA 3KT6A 4JI4B 4GKVA 1GQSA 4DABA 1TEZA 3QLUA 1ATZA 3KTAB 3F7OA 3QU2A 1E9CA 3LRXA 3OZTA 3K4PA 3R0ZA 4WA8A 2C9ZA 2QM3A 1CZRA 3OTIA 4P4GA 1J8DA 2VTBA 3PPWA 5L3QA 1LSUA 2DYKA 3WKAA 1U2DC 1P2GA 3M82A 1BN7A 2EZ4A 4X24A 1LBIA 5TMEA 1P8JA 5KOYA 1LA2A 4EF4A 2A0XA 3WLNA 1HM5A 2COEA 2ASVA 3DYIA 3FFTA 4OMUA 2B4YA 4XWTA 3O2NA 2B9VA 4RHTA 1MQ8B 4DT1B 3ZLVA 1SR8A 1A2KC 4JLBA 1MRZA 1ZU4A 1AZSC 1TM3E 3B9PA 5IVPA 5JMTA 3X44A 1V8BA 5DDIP 3P0EA 4GPZA 4IZ6A 1NVTA 5K4AA 1GU0A 1EUYA 1W5FA 4ID9A 1GVHA 4EY7A 5CCXA 1OWOA 1U9ZA 2QRPA 5TGDA 2HHJA 4FZJA 1G2OA 1NW8A 4NU5A 4UU7A 3KEQA 1JEQB 2R1TA 3ISTA 5ALDA 3A31A 3U3MA 2PL3A 4N1AA 1OXXK 4FHCA 1BU8A 1ZK2A 3RDPA 5D8DA 1GUFA 1BOFA 2I2WA 1W5TA 1JQDA 4HNHA 1Z2AA 4LGCA 4CM9D 4D9FA 3L8ZA 2QNIA 3E3OA 1P5JA 3SF8B 1T36A 2W6NA 3KZMA 1B6TA 3TZLA 4ZODA 4JUIA 1E1QD 3SNHA 1M3SA 2V96A 3O82A 2J9YB 3E7XA 4OJTA 4CI0B 4EQ6B 3PPXA 5E4TA 2VNSA 4AI6A 2ZLBA 4N39A 3QIAA 4B33A 3UV3A 3U44A 2UXBB 4TYPA 4B71A 1DIGA 3U4MA 4XVCA 1S0UA 3IQIX 1K7CA 4RTMA 3QJYA 4OBXA 4E4YA 2G7ZA 1AMNA 4PQYA 3P0RA 4ZDJA 5CXQA 1VHQA 3KJFA 4KNYA 5I47A 3GZNB 1V5EA 3E7DA 1WLYA 1YDMA 3NEYA 5CG2A 1HR0B 2O2HA 1YVEI 1SVKA 3EA4A 1E20A 1VYVA 2A86A 2QQ5A 1CVIA 3PTLA 1UMCB 2GBCA 4B6JA 3HJHA 1L7MA 2QG9A 5DOZA 4M9QA 3DWIA 1GAQA 4OM7A 4EJSB 2DH5A 4BNDB 1BHO1 1Z4KA 5TE9A 2WJ6A 3CW9A 1UXHA 3UWDA 3FYDA 1PGNA 2QGFA 1CT9A 4QPNA 1DJPA 2OZVA 1PYGA 3KLMX 4OQDA 5C5DA 2IUTA 2J48A 1OX5A 5EESA 3ZCTA 1XWIA 3CRVA 1A2OA 5A3JA 1DZIA 3I0NA 3A2MA 1O6BA 1L7AA 1KQNA 1GPBA 4IJWA 5BNWA 3BXPA 5KVAA 4WNYA 5C5EA 2I66A 4BVHA 4BV9A 3ZDQA 1T2EA 1Y1KE 5HUHA 3DEHA 4FKMA 3TDNA 1DXOA 1G9XA 2O0KA 3EC1A 3FCEA 3KP1A 5CNIA 5CUQA 4DGSA 3G02A 4RA9B 3BD8A 3ZS8A 3WYNA 3FB1A 1BE0A 3ZXYA 2R00A 1K6JA 3BL5A 4EL0A 4QGGA 3N3AC 1LY1A 4ZU6X 2JH9A 3OE7A 2FX3A 5T5QA 2QUHA 1FNNA 3TW8B 1JAYA 3VH3A 9ATCA 1XJCA 2NU7B 3T3HA 5CM2Z 4HNGA 1E9RA 3AG6A 3E81A 3PVCA 2WD9A 1E3WA 4U02A 4A91A 1UP4A 1IJFA 4A8JB 5JVDB 5G0TA 4YRCA 1TD1A 4PLGA 1N1EA 1OQAA 4FCTA 1OFGA 3V42A 3P20A 4O4HF 5BW8A 1GGEA 4QYWA 2NAPA 4A26A 4QPZA 1ZM2A 2H1FA 4TQAA 3NDBB 3KBOA 2FPMA 3PPIA 1ZJWA 3H42B 4ZA2A 2LTAA 3EEQA 5MGNA 5C7YA 4RD0A 4I1OA 1RRPA 3GDWA 1TLFA 2HGSA 2HMVA 1E2IA 2NVUA 3IBFA 1ZL2A 3QUCA 1HYBA 2WW8A 1YD7A 1A5TA 2QPOA 2YS7A 4KAAA 4MOWA 1Q20A 5LXTF 1OI7A 2VYNA 4CKEB 1Q2UA 3LJKA 2CJFA 1GZSA 3CPSA 1G9TA 2HLNA 1WXGA 3D2CA 4G4SP 4BWGA 1E5TA 1ZRSA 3O03A 3IO3A 1ZNXA 5GV8A 2NSHA 2TMDA 5EXSA 3CH7A 3DVQX 1BROA 4JJ8A 2OHJA 4MI9A 3RC1A 3RHTA 2CMDA 2R8BA 1Q0SA 1UJ6A 3PA6A 1V7ZA 4J2HA 1NVKA 1Z38A 2VF2A 3MRVA 1OZ0A 5BWOA 1KQFA 5JS8A 4X63A 3QE3A 4TMTA 2WF9A 3GJTA 1KSFX 3FYUC 1DOHA 1EVIA 3N8IA 3N6XA 3Q2OA 2HDNB 4IHKA 4PU0A 2SKEA 4RDHA 4P32A 1GU1A 1Y9DA 4LFAB 5IWAB 4Y1RA 4OMCA 1KO7A 4YQZA 2ZBEA 2IELA 4HHEA 2QWXA 3A6KA 4JC4A 3RV3A 1U2GA 4G1MB 4EF5A 1ZITA 3BA1A 1HE2A 4QUJA 1TU4A 2G71A 2I6SA 4HKTA 1AKQA 1BFUA 1QIDA 1WW8A 3M4XA 2QP4A 3E61A 2C61A 4FLFA 5ETJA 1S3SA 4NJMA 3PGLA 3W5JA 1QYXA 4A0HA 4KNWA 1O96A 2C78A 1KP2A 1KVSA 2CXNA 2QM7A 2NZ2A 5AMXA 3RANA 3KT8A 1G6HA 1GQ2A 3OZBA 5DSTA 1D0VA 1BJRE 2HSEA 4PRYA 4AKSA 5JAPA 3FIJA 2AW5A 4YVFA 3ZW7A 1N78A 2MJLA 4ER3A 2G04A 4DUGA 2F3QA 2X4IA 2EXXA 2Y1DA 5EWMB 3OM9A 2G6TA 2OXEA 1PDOA 4CKBB 4BZQA 4F12A 2WNHA 4WADA 5EJ8A 4YCNA 1CJMA 3WIBA 1WABA 1O0BA 5DTJA 3WB9A 5KNCD 3CIFA 3PNBA 2B4KA 2PANA 3HGQA 1MB9A 2O2CA 5E6RA 1XZMA 3QTBA 2XNCA 1RJGA 1YRYE 4JUCA 3SIWA 5I51A 3WYCA 3C6YA 4DNFA 1ODTC 2A94A 2YASA 4OU5A 3A70A 2VZEA 3LX4A 4UUMA 2F3RA 2VP9A 5ALLA 3DLIA 1ULBA 5F7JA 5A6SA 3VKFA 4U00A 3IQHX 1MAVA 1SC9A 2FNAA 2J6HA 3SKYA 1MB2A 2P4HX 3WTCA 1GXSA 5K0JA 7MHTA 3E7PA 1QCCA 4RK0A 4GFDA 5I9IA 5C51B 3UXMA 2CF6A 2WINI 3CNBA 4BBPA 1DJOA 1Y5MA 5A4JA 3TNJA 1ZM3A 4CMJA 2ZB4A 5JH7F 3EPHA 5EJAA 2CL5A 2P90A 4NWIA 1NQXA 3R7FA 4K3UA 3IAUA 1KYTA 3SYKA 1Y6JA 3ZDBA 3VO2A 1P2UA 1FQOA 3TW6A 3I6BA 4V0QA 4C20A 3GRZA 3FLEA 5A4FS 1GGKA 3NBYC 4PYMA 2O19A 1R6AA 1IH8A 3B8HA 1UDBA 4HUJA 3GUUA 4M6WA 1EFDN 2ODPA 1UXKA 5BXYA 3B1YA 4CTJA 1DRKA 2QP3A 2ZYHA 4AUMA 3W1WA 4E1VA 1GPWB 1A9ZA 2BSXA 4GZ5A 5LLDA 2EVWX 1P6XA 3DDNA 2Q2WA 3HCWA 4J3NA 4B6RA 2PXAA 4MR9B 4G81A 1YQEA 3EYWA 1FLVA 3LA6A 1D8AA 1UBTS 2AMYA 4OX9B 3H1EA 3TBFA 2ZJ2A 4Q1AA 4E70A 3T4PA 4M60A 5TF4A 3HCDA 4ME6A 3TVTA 1GA4A 1XSEA 5E1OA 1SUWA 4EITA 3ZQKA 2IHJA 4RMHA 2BMEA 5CB8A 1YDFA 2Z04A 2XA9A 1JKJB 3DKKA 4LEIA 1YVRA 3BCSA 2RB5A 2UDPA 1U7OA 3D3QA 2NTEA 1H94A 3GZTB 4KXNA 4LMBA 3ED1A 2XUJA 3UJDA 3GPIA 3TL3A 1YFJA 4X7BA 4ZMBA 1TMKA 3VTFA 4ERXA 3FHCB 4E4RA 2UXCB 5CLLA 3FDFA 2F4NA 4IZHA 4KQCA 2HCBA 2ZYWX 1Y9JA 4R8LA 4CCYB 3Q7RA 3IE1A 4LVCA 1P7YA 3AVXA 3JXEA 2C07A 4KRGA 3LH5A 5IC6A 4TVBA 5F2NA 5JLAA 2BFAA 2F7SA 2C9DA 4O2RA 4B7CA 1YU6A 1FMLA 1MRSA 3OMXA 1YR9A 2D1RA 2G88A 3HA3A 3VGJA 5FH9A 3W8NA 1LGYA 1WW3A 2Y2VA 3BMQA 2ORED 4JSRA 2HM7A 2YJZA 4CIYA 3TBKA 3BFKA 3ZY4A 1IZ8A 1U0HC 3ZVKA 3MWGA 4QXRA 1XEAA 2EL9A 4IS3A 4B3XA 3KEOA 4NYJQ 4X64B 4HB3A 4JUDX 1KJQA 2JHPA 1DKPA 2O1EA 1N9ZA 1Z83A 4EB8A 3NORA 1XHLA 3GFQA 1REQB 4MWTA 3PX3A 5K5EA 4K9MA 4RVCA 5EL0A 3AOGA 1M8FA 1CE8B 2LR0A 3IVGA 3PC8C 1GHTA 4MR7A 5HDQA 2W7TA 3SM3A 1PUXA 1LH0A 2GAJA 3IPYA 2AR0A 2AWOA 3KU1A 3AFNA 5IW8A 5K8CA 4RADA 5DPMA 3RU9A 4HVCA 1H1DA 3AY6A 1QHEA 2OXCA 1P8AA 5BYJA 2XUDA 3CT6A 1KGSA 2CFSA 1FMJA 1OROA 1TW3A 2X6RA 3BEDA 5B1HA 2VUUA 4TXMA 2E2WA 1JYSA 4C4YA 1YBHA 1IYZA 2JLCA 5FTKA 1OWPA 1U8XX 2BMWA 2K6GA 3EJWA 3EW7A 3QYJA 5HILA 2HMAA 1RAIA 2YYSA 4LXGA 3W2EA 3EGOA 5FEMA 4GI1A 1ST2A 2FQYA 1PZNA 1SZCA 2OAGA 2GPAA 2XQGA 3K2QA 2RAPA 4FWBA 4L4YA 2AMFA 3COJA 2P9QA 4L28A 2P9JA 1LV8A 3KT0A 2YMLA 3G7SA 3W5DA 1GL6A 3A26A 2GN0A 3HC7A 1NTOA 2WJZB 4IH9A 3EG5A 1S9DA 3LUKA 5AK0A 3RARA 4DC9A 721PA 5K6RA 3ZDAA 3V9PA 5E2AA 1UKCA 1DEXA 3REQA 4CM3A 3IJPA 4ZT6A 4H7FA 2XDQA 1CP2A 1K4YA 3GK3A 2OB2A 3A3YA 2O8CA 4ABYA 1WUHS 2YUIA 2JKYA 2QV0A 3NNNA 3JYLA 5HE8A 1T5LA 2JH8A 3NW9A 1RRKA 5ENVA 4PSKA 3GD5A 3QLVA 3PHGA 3PCXA 3F5DA 2JGFA 1UKEA 4HF7A 4ESHA 1L5HA 2HEIA 1DC7A 3UTCA 4AJJA 4O3MA 3H8WA 3TCNA 2AKAB 4DREA 5AW4A 4YJFB 3DDZX 1XP8A 5CBKA 1SCIA 2VJYA 3H5AA 4KMMA 5JXHA 1W88B 1XZPA 5KWIA 4K05A 5EHXA 2MDTA 3EZGA 1OH8A 2PD4A 4Y2JA 3TVYA 2FRDC 3M6WA 4NZZA 2BRUC 4KO4S 3AF4A 2NU9B 3WKCA 1X1TA 3DP7A 2P5SA 2RK4A 3K92A 2VVTA 5H68A 4BP3A 4LRQA 1N36B 2I9KA 4RHEA 3COZA 4PX9A 3QNWA 2C4TA 3LI2A 3MQFA 2X3YA 2YN2A 4PC2A 4KQ1A 1IQUA 1AKTA 2ATCA 3N0WA 1JA0A 1PX2A 4N47A 5DTEA 3COVA 3ZU5A 4YLYA 2WFLB 4JYMA 5ISMA 1JQAA 1Z06A 4X6UA 3KL4A 3VAYA 3K73O 2WJ4A 1NLZA 1W4ZA 4O02B 5FL7A 3LU1A 4DYDA 2JCXA 5MFPA 4DV5B 3ZGZA 1FSFA 5J4LA 3BZUA 2QM0A 3P2OA 4KYTA 3KXIA 2GEDA 2ZS7A 3OIWA 3R77A 2FEWB 4FFLA 4FPXA 4J1SA 4MCHA 5HBGA 1TDJA 1TKBA 2C92A 1AUOA 5I9SA 4A2WA 3DP9A 3FWNA 4CMEC 3RAFC 4O2LA 3DF7A 4DLTA 2ZIEA 4RELA 3E27A 3GXOA 1ZD5A 2IOYA 9LDTA 3P2EA 4FFPA 1DKUA 4B6OA 4NPHA 3NG1A 4EI8A 4G97A 3HYNA 5G40A 4M7RA 4NS4A 3A9CA 1DKMA 5E9WA 3CLTC 1CULC 1YI0A 2ETXA 1B43A 2Z4RA 2P6OA 3NS7A 2XB4A 2G8NA 3UT5A 3DZIA 1NWHA 3HO8A 1X39A 4M1QA 3H2KA 2EW2A 2WEKA 1CV2A 2O2JA 2HEGA 3NP7A 4GRIA 2ZPAA 4ZCLA 1E1KA 3CO0S 4KMSA 4YACA 5AKJA 4LE2A 3VR5H 7AT1A 2IYSA 4NTZA 2QDXA 2R1TB 4HEA6 4QQRA 5DNUA 1A27A 5EZ5A 3WLOA 3A6JA 1E6MA 2I54A 2ONKA 4M9CA 4EFKA 2HHHB 3NPMA 1WDMA 3NBKA 4Q4LA 4M76B 3G17A 1N5IA 3HJCA 2W83A 3P71T 2AUTA 1T36B 4URXR 1YS2X 4NJEA 3G8AA 4RSMA 3CLSC 5ALHA 3VO1A 4EG6A 821PA 3QYAA 5BT8A 1C8VB 3LHDA 5H81A 1IRIA 1S5PA 3UK1A 2GN2A 4GQBA 4WZBB 5ALGA 2GRAA 5HTKA 3SZGA 4ZO4A 4IHJA 1GGNA 2OO5C 4YV7A 1M9NA 1YJ8A 1HKUA 3VTKA 1AKWA 2TECE 5HGXA 1G41A 3KQPA 3BFVA 4ENUA 1OZHA 4RD1A 1FIUA 4LNUA 5FI5A 3U7IA 5M34A 1L8AA 5IUNC 3GJ5A 5LU8A 5I01A 4RE5A 5ARCA 1NFRA 1ZJ6A 3B3QA 2XUQA 3A3KA 1ZD8A 2C2MA 4K28A 1HC7A 1P1RA 4O25A 5BQOA 4CZ2A 4DQLA 3FDXA 4WJZA 4EY3A 1TQDA 3LHFA 3DWEX 5IABA 4EYSA 3EXHA 2IL1A 3FH0A 5CH5A 3AL3A 4AWXA 1GNLA 3W7AA 4Q9KA 5TT0A 1Z2CA 2OHVA 1FCJA 4GXNA 4C89A 5JD4A 3KYCB 1NQOA 3P9PA 2HHCA 2HK7A 3VR2D 4E1AA 2HAEA 5IDWA 3A1TA 4C29A 4MS3A 3RE1A 3V2GA 2AMJA 1STOA 2JAXA 3P2MA 1QH8B 3MCVA 4BQEA 1JE0A 1UZAA 4E5MA 5FHRA 4QECA 3ZE1B 3ROTA 4L6CA 1YE5A 2QMOA 5E8RA 3WZMA 3AEQA 2ZRKA 5E0OA 1PZEA 1UBOS 3R7NA 3C1UA 1FA9A 1X3SA 2ZYAA 4LC9A 2X23A 5FI1B 5B2ZA 5BN5A 3K0HA 3C24A 3FPSA 3EIUA 4PYRA 1AD2A 1JG1A 1L5KA 5BQPA 2V7WA 5KTNA 2EJWA 3L1VA 1Q1NA 3CPJB 4G65A 4EX7A 3U3DA 2HYIC 8ATCA 2J0UA 5FAKA 4YAGA 1HQKA 4NHOA 1LTQA 1LTKA 3IBCA 3V1NA 3A1VA 3L79A 4EGSA 3DMDA 2CCKA 4S04A 1TI7A 2P9YA 4L50A 2YTZA 1APBA 2WAYA 2WF6A 1JS1X 1QDLB 1CQWA 1CRQA 3GPDG 3K6JA 3OHSX 2F62A 3WGJA 1RQPA 2HZ7A 4HEA1 2GR9A 1VBNA 3AHDA 3MOGA 4QDJA 3PWTA 4ID3A 4LG1A 4R2MA 1ZEMA 3EDRA 3G89A 3NHBA 3MCAA 3ER8A 5LB4A 1I7DA 2JDID 5DMHA 1T3SA 3LOPA 2EC5A 3RS4A 3VKHA 4U2KA 4QPCA 1ZDMA 3WO0A 4PVCA 5U4XA 4HGRA 5H4HA 5KBYA 2WHPA 1BMQA 3JTMA 3RS0A 4H60A 1FSGA 1Z5VA 2P79A 4YROA 4PZUA 5KWSA 3W2GA 1BGXT 2CXTA 1H5NA 4XYLA 5CDGA 5JCZA 5T8KC 4GL4A 3C8HA 2HSJA 5SZIA 3UMYA 1TEVA 2ZJZA 3SXUA 4D4MA 2VBIA 5EYPB 1CVRA 2YRFA 1F9AA 1FUIA 2PX2A 4Q3DA 4ECAA 2QTVB 5K0EA 2BDTA 3ORYA 3DAPA 3QVWA 3UPDA 4OHOA 1HTTA 5DT2A 2GJKA 3TOZA 4F71A 4HLUA 3I0ZA 4JOSA 4QFDA 1VLZA 1CUAA 1ZD1A 1AXGA 1NM5A 2F1RA 2IXAA 1MENA 3AM1A 2SNIE 3Q7SA 4YRMA 4D42A 3CTMA 3CYFA 2V74B 3EB9A 3AJAA 4H6WA 3K9BA 4IGAA 4JI0B 2OZEA 5FUVA 3NFYA 2D7DA 2ZJOA 1PWZA 3JRNA 1JECA 5H3LA 4XLZA 4UZSA 5F7OA 2FZWA 2OCGA 4U4AA 5LZ4A 1D7AA 2VAWA 5ED4A 2KHZA 2AHRA 3MWFA 2MSDB 4WWHA 4BZPA 1YGYA 4NJMB 2VNHA 1WZUA 2B4AA 1UAAA 4AJ2A 1U9JA 4PX3A 3T5BA 3IH5A 2K2WA 4GGPA 4R81A 5IYZF 3SPXA 1NFFA 5JJ5A 1XVUA 1M1YB 4LGMA 3C3KA 4FSXA 3BTOA 3UT0A 4AFNA 3MMPA 4DLVA 5C18A 3A9WA 4XARA 1AQJA 3D0OA 2C4WA 3A4IA 2O5RA 2I87A 3GN1A 4F4DA 4LOLA 2W2VA 2XB9A 3L7NA 1VP9A 1EIZA 2JIBA 3UWSA 1FMFA 1S3GA 3TBHA 1B73A 3CF6R 5KUTA 4WMLA 3O9VA 5K45A 1ORWA 3ETCA 4C7BA 4MWSA 1W2GA 1FDWA 2VBGA 3IEKA 3SC2B 5AVKA 1P75A 3KDSE 2W5UA 4HNRA 2XCSB 1RAAA 2A33A 3G9ZA 1JLKA 2G82A 2YY7A 3I9NA 3TOSA 4PYOA 3WIEA 1G8MA 2VSYA 2DR0A 5IDXA 2VUIB 1PTKA 1QMGA 2BISA 3ROPA 2Y1OA 3S2ZA 1MX1A 2CLHB 3IXMA 5A6SB 3SD7A 1RCTE 5B3KA 4WQMA 4BMOB 1PD0A 2ZRFA 4ZD6A 1PYDA 1SQFA 1XRLA 4ZVRA 4WCVA 3R9WA 3LXRA 4FN5A 4B7ZA 1YU9A 2ZBGA 5GOZA 1OIVA 3U3RA 3VPSA 4M21A 4ACBA 2PX8A 1X1DA 2H4XA 2EQBA 1FW6A 1QGOA 1L5OA 3BD7A 1T9KA 1Q84A 1VE5A 4UM9D 3UK0A 4E3WA 2HRCA 4O4IB 1V48A 4B2YA 1DOAA 2E1RA 2VUHB 3DTTA 4QICA 3DT8A 3KR1A 5GONA 3W5UA 5FQOA 1F1JA 4D6YA 5FDFA 1BA2A 2OKGA 4NZYA 3CRNA 2Q0XA 2HSWA 4MTCA 4V0OA 4M6WB 2LPMA 3BC1A 2ZIXA 3HP7A 3NNSA 3JWJA 3WGNA 4BX9A 4HXYA 2IYQA 3ELWA 1F8UA 3HA2A 1RIFA 2R1ZA 4W1QA 2ONJA 4AN0A 4ATNA 1HURA 5CA1F 8AT1A 3A4LA 3ROQA 2QZ9A 3ZDDA 1OYYA 3LFHA 4L76A 4ZCSA 1QFZA 1Z0KA 4Y3UA 4QRIA 3OT5A 1GU7A 4C3OB 4JBHA 1A5AB 3KAJA 2DKNA 3S2GA 1Y8RB 3TRDA 3DDHA 3WE7A 4DM3A 1Z4JA 4BO4A 3OTOB 1CF9A 1C41A 3AEZA 3GLSA 4IUCS 4LWOA 2VO1A 2DUWA 4CDMA 3RYCB 5JAQA 2O2XA 4ND6A 3RS9A 3VC3A 1C81A 5A9SA 2JFBA 3TLXA 1EVEA 1II9A 1UKZA 3LHIA 1GD1O 2HR1A 5MN4A 1XNQB 4MROA 3WL6A 2QAJA 2ZSUA 4EJ6A 1TUBB 2C31A 1H2ZA 4KO8A 5EFOA 5EVJA 5H0IA 2XY4A 1DKNA 4UM8B 1DC8A 5HK9A 4QGSA 2E6KA 2OCLA 3FFBA 2YNMA 2ZI6A 4LZAA 2XT0A 1PL0A 2BN4A 4KOAA 4F9EA 2Z5GA 4PZ9A 4LV8B 3PDIB 5DYYA 2HMWA 5C7OO 4DMUB 1U3TA 4XGQA 2JLUA 2JIRA 4JI2B 1G19A 1JUDA 3KWLA 5T7BA 2QMZA 3SNKA 2G83A 4BVBA 4U7WA 3NM5A 4FD2A 5HKKD 1E2FA 3LWDA 1X6VA 2H4JA 3T38A 3VR4H 1R00A 1CUXA 1ABFA 3FMPB 3BMQB 4I55F 3T3GA 1XWWA 1XCOA 4JLPA 4DIKA 4ILEA 3AR5A 2QTTA 3UCFA 4NAUA 1A0OA 2B1RA 3EHDA 2AD5A 1HLDA 4BAUA 4BYMA 2GASA 5FB3A 3ZKWB 4LF4B 1NG1A 2Z2ZA 4MPDA 4I8DA 3RWMB 4YAUA 4FNOA 5KX5A 1YK1A 4UJ3A 1L5NA 4IBOA 3NWOA 1BS9A 1UXJA 4RYDA 5B1EA 4MYHA 1VCIA 1IEWA 4B2PA 1EX6A 4OBEA 2WVAA 2HADA 3V5NA 3ESQA 4EYEA 2TMYA 2O8FA 4KR3A 3KS9A 2VDOB 4GZMA 2NO0A 3CB2A 3P52A 3PKIA 4QBKA 3WNBA 4MR7B 1WTCA 4UBLA 2ZVPX 2EX0A 2BTQA 3TW0A 1OXUA 1PI3A 5U1PA 1RXWA 3GEGA 1D2MA 2FHSA 2PT9A 4IIGA 1W5AA 1SEPA 1KI6B 1UP7A 2A58A 3K94A 3IILA 3R44A 4NH0A 4U9HS 4WA7A 2QJTA 1NKSA 4WEQA 1QANA 5ECGC 1O03A 5JO9A 4YS6A 5JDIC 3B36A 4YJHA 2GN8A 3QPUA 2QZ4A 1H8ED 4E2ZA 1X9HA 2JD0A 4DXHA 1EGHA 3CVVA 3F3SA 3PHBE 2GOYA 3RIGA 1LDEA 3LUJA 2F1JA 5FFMA 5DT9A 4B2IA 1KOFA 3A6HA 3ZWPA 4ZJPA 4UDNA 5JCPA 4GNRA 1YFZA 3C15C 4CR7A 2Y6VA 1GPMA 4FIDA 4K6FA 2F2TA 4M38A 3ZGXA 1V6SA 2IGTA 3TLGB 4EUNA 4V0MA 1IUKA 3OPYA 5DYWA 5EE3A 1TJYA 1U0SY 2QN7A 5A3SA 1KSJA 4BFCA 2CVZA 1DJNA 4FBMA 4Q34A 3BIXA 3W77A 1DIBA 2GPNA 3VPDA 1NI3A 1NJFA 2HRBA 1Y33E 2E0IA 2YV3A 4BFVA 2VJQA 2G7MC 6NULA 3B82A 4QDZA 1JPUA 4RV9A 4ZAXA 3E18A 3DNPA 3IUMA 5ECYA 4EDHA 4WK4B 2NVOA 1VB5A 4JEIA 3H83A 4JUBA 2IUSA 3U9LA 3UATA 1MLDA 1SOAA 1TF7A 1SKYB 2YJGA 1UBNA 2QTBA 4IEIA 1ZO8A 1GO2A 1QH1A 4YJ3F 1YQ9A 2OGWA 2QPLA 1P81A 2BFEA 1AE1A 2B4RO 3E9RA 3FBGA 3H2YA 1HBJA 5EWJA 1Q50A 1KJ9A 4FFOA 3JD4A 3LD9A 2J67A 5K6TA 4QU8A 4PQRA 4IF4A 4KWHA 3QEOA 2R62A 1DXHA 3AM5A 2C3OA 1OMOA 1DAKA 5GM2A 3P4XA 3LE8A 1H6AA 4BU0A 1IXYA 1P1CA 2WSSD 4F9GA 2OORC 2IU0A 1BDJA 3WGOA 4GNKA 4O4JA 3FBWA 2CK3D 2IQ5A 3FYCA 4Q0MA 3UGJA 3OD1A 4TMFA 4NESA 1H3EA 5K03A 3NIWA 4NYMQ 3LGAA 1IEVA 1FFBA 3EGXA 1CK4A 4HOYA 3S8YA 3AM4A 4IRXA 4CQJA 3L1JA 1PQ4A 2AYXA 2BEUA 3HA7A 2DTEA 1COZA 4K03A 1D1QA 2GA8A 4XFDA 3TXXA 3JSXA 1HYGA 1Y3CE 3N8KA 1TFUA 4KQXA 5K0ZA 5KTRA 2V0CA 1E5VA 1I2ZA 1L5FA 1TCVA 1YB2A 3JARA 1ORVA 4I8IA 2JFQA 2HIGA 3PRYA 4W9NC 1GLNA 3PYXA 1X7DA 1RLTA 2F3UA 3AOEA 2MMCA 4UNPA 3CIOA 5K8UA 1QS0A 3ZOKA 3V7NA 4PAQA 5DSXA 4AMBA 2FI1A 2FPRA 3VR3D 4KJZA 3QLEA 2C2KA 5JBIA 2O2IA 4IZOA 4NBNA 3WB1A 4DBLE 2PZKA 3JQFC 4JB3A 3QELB 4ILKA 1JPJA 1WQ3A 1YVUA 2YWEA 3FHOA 3PWZA 4LN1A 4MLPA 4BJ3A 2PRZA 1ZN8A 2Y0EA 3A3NA 4ANFA 1EHIA 4WLEA 2Q1XA 2W93A 5JSQA 1LVUA 1KJNA 1VE9A 2A4MA 2J9FA 4FR5A 4EZIA 1KAGA 2C8VA 2XODA 3T8YA 3OU7A 2BR3A 2HJHA 3AESA 3EZNA 5C0OE 1Z47A 4FCVA 4DG8A 2BP7A 4NJEB 4BC1A 4E5KA 4G3XA 1QPGA 3E1KA 4PLTA 2BF7A 3D5EA 1IBSA 1MO3A 4RKRA 1EQ2A 1XYVA 1BXZA 4IHJB 4EECA 4UHJA 4JLAA 1I4TD 4F85A 1F8FA 4I9GA 1VECA 1JALA 4NOMA 2HRDA 4QJ4A 1CZKA 2OGUA 3RFCA 3RVQA 4GU5A 1FEZA 1ACJA 1X0VA 2QUKA 1X74A 5CRIA 3JQ9A 2RI1A 2GUGA 4CQNA 3J7AC 5FNVF 1EESA 3O6VA 5BQ3A 1Y3DE 3N86A 5FBKA 4P54A 1MNAA 1C14A 1TQ6A 2RH4A 2YHBA 3EDQA 4CXMA 5FULA 3DB2A 5AM4A 3N76A 3IC5A 2Q6LA 3RT7A 4EX6A 1D4FA 3AW8A 3DO6A 4D3DA 3FKSD 2J6BA 1R8SA 1VE7A 2C98A 2P30A 3O0DA 3OOEA 3TEJA 4EPYA 1T9AA 1QE0A 1MU0A 3LO8A 1G5RA 2R4UA 3AKEA 4BFZA 1H4QA 1LNZA 3ESYA 4LHZA 5AJWA 1BTOA 4JVMA 1AUQA 1J20A 1Y5LA 4UARA 2CLDX 5LQUA 3U4CA 5BW4A 1Q6YA 2GKGA 1VDZA 3DE4X 4OV6B 3SJZA 1ENYA 3CCBA 5K51A 3VZRA 1JJFA 3SMVA 3WAKA 1BQ3A 1L7QA 1O6CA 4PZLA 4IL5A 3I01M 4XRGA 5L95A 2W11A 1QPZA 5IM5A 3V1MA 3BMOA 4P80A 3RUIA 1LQ2A 4XW2A 2QXUA 2WDPA 5E1BA 2MYNA 1RRFA 5DHQA 1XJ5A 4RVUA 2XSZD 3ZD8A 2AF3C 4TZKA 1KO4A 2H0RA 3ET4A 2C88A 3JQRA 3ML1A 3R5FA 4UDYX 1Z5ZA 2EEZA 2GDJA 3K5WA 3VC7A 3E23A 4E15A 2P3LA 2PQ0A 2QEQA 3FI0A 1ENZA 2DQZA 3H1TA 1KDRA 2FUCA 2IEBA 3C14C 4DR2B 1JR6A 4EKDA 2Q4BA 1KZYC 1KBZA 1RIIA 4FOOA 1DELA 2VP6A 1C9DB 3QNUA 1Z0JA 3RPEA 1W75A 4PCVA 4LDJA 2YOHA 4YRPA 3F73A 1EXDA 4IUYA 5H5JA 3V48A 3AC0A 2OOKA 3H3FA 2REOA 3LY7A 5FTMA 2EJTA 2VF4X 3Q7IA 3KLPX 4FMPA 4BV2A 4BQNA 2D59A 4Q6WA 3FNBA 1O08A 4GI3A 2IUUA 1HPLA 1FSSA 1PNQA 2WA2A 3AF3A 4MQ6A 3TFOA 4MARA 4CQLA 4PLWA 4QLBA 5HUQA 3QUSA 2NYUA 1AKVA 2B0JA 1A82A 2EF0A 3GJXC 3HJTA 5JXIA 5KQLA 4JI8B 4UCFA 1P1FA 1G5QA 1MDFA 1QONA 3FNEA 3H2BA 1U8TA 3WMFA 1ZHFA 3BL6A 1V11B 5AM5A 4RQUA 2O2DA 3EXEA 4TL8A 5EA2A 2H92A 2QYTA 3ISVA 4HSGA 4FHDA 4NECA 3SXUB 4X90A 1IHDA 1G8JA 1HQCA 2JC3A 5C1PA 1IM5A 1QIGA 2QX6A 2HQRA 1PJTA 3GVXA 4YJGA 5LZ5A 1F4LA 3DO5A 5DYGA 4YUXA 5CYGA 3E0XA 3OIFA 1BRTA 5JCOC 1ORRA 4RZHA 2W2LD 3GZJA 4GZLA 4A16A 3RO7A 1NUSA 4EYOA 4URVR 2ZZNA 4YJKA 1KI8A 2R4TA 5IZ4A 2GZ3A 1T3HA 2ZRJA 3CX4A 4F4HA 4DKJA 3G7NA 4G8BA 4CQMA 4UNIA 2DBYA 4GEGA 4A8HA 3KFXA 2Q28A 1PHRA 5FOTA 4ZEMA 1G5PA 2EKLA 3IMCA 1QHHA 1G7TA 4LK3A 2WD7A 2PL9A 5BWCA 2BM1A 3QKWA 2XNDA 1RZ3A 4HT3B 1RYYA 1EFAA 3ZY3A 2G80A 4F1JA 3IAHA 2CVQA 1H6DA 1GYPA 3CFYA 4JR0A 3UO8B 3ZGOA 2C7RA 1YDGA 1JLHA 2FG5A 4PNPA 2N46A 5J4YA 1L5YA 1UAYA 1TO6A 3O4HA 4AZ0A 2HYDA 4JMLA 2YYYA 3WLKX 1Z0IA 1Q3HA 3HN7A 1NXOA 3KAQA 2F3SA 1RHRA 3PTZA 4TXHA 2XRYA 3DW1X 3CVUA 1OVGA 3RWOA 1I2BA 2AFHE 3VNSA 4DMLA 4BMNA 1C3JA 5T4HA 3RB8A 3OM8A 2B6NA 3KVYA 2E87A 5BOSA 3RRFA 3LYHA 3STTA 3R20A 4V0KA 4QTUB 4M53A 4HNAB 4LFBB 1RP7A 5G1OA 3H2GA 3AHHA 5DNVA 2QL9A 1AM4D 3ACBA 3DE1X 5TEVA 1ID1A 3R8XA 2B99A 3UFBA 4BN5A 5LZ9A 1GWNA 1RJDA 4JQZA 1HI9A 2C59A 2DFNA 3G7UA 3JAWA 4L4ZA 1KERA 2XUAA 2AB0A 3G5UA 3VJKA 4DCGA 3CQ9A 4F5ZA 2Y8EA 2PJZA 2OYSA 2CHFA 2OV1A 4L5IA 4QGFA 5DGCA 2PZMA 4F4CA 5CIYA 3KJNA 2VKTA 2ZJFA 2HSZA 1DDIA 4GC9A 4BFSA 1IN6A 4HQNA 1SOWA 2FXVA 4XAQA 1P31A 5E4JA 5FCDA 2GCNA 2HCJB 3RASA 5KKCA 3K9HA 3PSHA 1SIBE 2R84A 1HT3A 1H42A 2R65A 2W0SA 5K09A 2ONCA 3GDFA 3IAM1 1L5LA 1S9HA 4BNLA 4U9IS 5KHLB 1K6EA 3LLVA 5J2TA 1CCWA 4N5MA 3AKCA 2E18A 2X9NA 4JEUA 1G7CA 1VBFA 5J2UA 4HTAA 1VZ2A 5GONB 4JJIA 4ES6A 3A6GA 2UU9B 2NPFA 3AUUA 4UEQA 2Z2XA 3GRKA 3AMVA 1P4JA 3JQ7B 4OIFA 1P5RA 1K7YA 1QC5A 4IFTA 3MTAA 5F1PA 3PWKA 3CZAA 3E22A 2WWRA 3USZA 3DUWA 4MPPA 4LRUA 1E3DA 1P3JA 2VJLA 4YRIA 5BMOA 1MVLA 1QH0A 1KMNA 1ZBQA 1U28C 2P67A 4L4SA 4LJ7A 1T0HB 1KIAA 2XUKA 3PQ4A 4OUDA 2D3WA 4LJLA 2DRIA 3RLFA 4B40A 4DLYA 1ZU5A 3QVLA 4TV8A 5HM8A 3A0RB 3KB1A 5FX2A 2JLVA 2PHZA 1NRXA 1JP7A 2JIQA 1VL6A 1Z6XA 5AT1A 1ISPA 1O58A 3O4VA 1JHXA 1CJVC 4CM1A 5A9SB 3V8NA 4P5PA 3CJRA 4IDCA 3V32A 1USWA 3IULA 1ZMXA 3Q0EA 3VNQA 4RS3A 5CA0A 1ZSYA 5E1DA 1PJBA 1UJ2A 4XJSA 1JEOA 4R69A 4U7PB 5LMNB 3SWWA 3FHLA 3N8HA 1L4LA 2HV8A 4EVRA 4L0QA 1C0IA 4OMFG 1K75A 1XLTC 4EFDA 2DHEA 4IUBS 1QAMA 3TRKA 5IN4A 4FDMA 1KZ4A 1ZZGA 3WSTA 1W2HA 5FR1A 1JU3A 1JHOA 3NCTA 121PA 1MG0A 1HTBA 3V8RA 4BU1A 1FC0A 2VHCA 3WIUA 2W70A 5JW6A 5DGTA 2WM2A 3T3NA 2H07A 4LDAA 2IK8A 1G17A 1V5WA 3KZOA 1ABEA 4UUQA 3M1YA 5H1YA 3L8YA 4G56A 5CVDA 3FRJA 3PQFA 4B32A 3UW3A 1NSFA 1VI5A 2JATA 2RDMA 4GBMA 3V97A 4AZVA 3IEVA 5KX5B 3IBGA 3ILHA 1JLMA 1NASA 3VPXA 3I32A 3DPSA 3PGVA 4OQQA 1U3FA 2O8FB 1J42A 4NNOA 3DVLA 3EW9A 1H1LB 3TR5A 2QS9A 3D3WA 3F2IA 3KOUA 3RTBA 2GWRA 2JI9A 3SYLA 1Q7TA 2HFJA 2HX1A 3B5JA 3E9QA 3B5IA 4XCVA 4E2YA 2BR5A 3MAAC 2AOTA 4WKBA 3HNOA 1PX0A 3O8DA 4F1KA 1KS9A 4CT4B 3AVYA 3N2KB 5LD2C 4B6GA 4HRVA 3KYDA 2IYRA 3VJLA 3EGDA 1TQ8A 3ZBTA 3CUTA 2HA0A 3NCHA 3DPUA 3T9EA 3B6MA 5D1HA 4YJHB 4BNUA 2XB8A 3OQVA 4IYRA 2YY5A 5GM1A 2D2EA 1GSAA 4R40A 4MA0A 4RA6A 1Y98A 1XCLA 1MV5A 1K98A 2JGKA 2QYHA 2O59A 5FO0A 1VYUA 1AU9A 1RACA 2Q0SA 1YE8A 4LXIA 1I33A 4HATA 4YMWA 1KZHA 1JWAB 3GHHA 5B5SA 1B8VA 1ZI9A 4J1TA 5IJ0B 3WR5A 4CODB 2VDLB 3DR3A 3FZNA 4EVSA 2PZGA 4N49A 2WWIA 2L17A 4OBBA 1MQ9A 3OPYB 2ZRHA 4DYHA 1H4SA 3PQCA 3WRVA 2I1VB 4I46A 3PNYA 2H1HA 2IT1A 5J43A 3V7WA 4NCKA 4GE0A 2BKLA 3U7JA 4A2CA 4C76A 1FL9A 2WLTA 1GTMA 5C53B 3DSRA 2VPIA 4D4LA 2IRWA 5EN4A 4W1SA 3P2IA 2GVNA 4HDRA 3LPNA 4TQGA 2JAHA 3BTSA 2NYAA 2QTRA 2VS1A 3AJEA 5DBEX 4BJ6A 3AKZA 3K2EA 2W6IA 1LVHA 1D9XA 1PD1A 4TKZA 3ZCRA 1KEZA 1EA7A 3OE7D 1QP4A 3AP2A 3N2ZB 3RYTC 4JA2A 1WO8A 3RKUA 2D0PB 3QH4A 4W82A 5IH3A 3QMVA 1CG6A 1QH1B 2VP4A 3ZHOA 3EUWA 1DBSA 2WWVD 1QZUA 3EVEA 3TQQA 1U5BA 1I80A 3NQ41 4JUFA 2PLNA 2RI0A 3O93A 3KSDO 3CUYA 4PWZA 5CK5A 3VMFA 5IANA 4FGZA 4LNAA 1OH6A 3I12A 1NIPA 1ZP6A 3FZGA 2XECA 3HDGA 1YASA 4NV0A 5EIOA 2J59A 3SEZA 2HF7A 3PD0A 2XB6A 3EIFA 2JK1A 1PZXA 2N75A 3LPLA 4P3KA 3FBTA 3TIXB 2PQ2A 3WO1A 3ADKA 2PMFA 5EE9A 5JPCA 1E96A 1XLVA 3HSYA 2Y1WA 1N5KA 1KZGB 3AWIA 3DBLA 2VFAA 2VYND 3K1ZA 2JLWA 4EPVA 3JR3A 3EGXB 4GWKA 1VHDA 2IEGA 4HB4A 1A98A 1WG8A 1KP9A 5HFAA 1TTQB 3OOJA 5FPQA 3P4UA 4BB9A 4V1CB 4M49A 3IUJA 2ZR9A 5DZSA 1DRWA 1EE1A 2FW8A 4OHMA 3F6SA 1PK7A 3KSRA 3ZZNA 3ND8A 4IXNA 4JJZA 4X7PA 4DTCA 1K88A 1WNTA 2DBQA 1ACMA 2SECE 2GN4A 4LHWA 5TGTA 1C1XA 2JGDA 3UXYA 4R1PA 1OUMA 1Z2OX 3KQTA 4HAIA 1QS0B 1E4EB 3GT3A 3R7SA 4K46A 3SBOA 2JL1A 1W9HA 3O91A 5C5CA 4B3IA 3DEYX 3P0FA 3RAGA 1SUPA 1DLJA 5H3HA 4F3CA 3FR7A 4Z4CA 1I1HA 3K7EA 2O2EA 4OOFA 4Q3NA 421PA 3HKCB 4NQRA 1HA3A 5AK6A 1SBTA 4QDTA 5FJJA 3ZEAA 4WKGA 1YC5A 4DIUA 3UOAB 4ENTA 1FDUA 4X3OA 1GG2A 2J9FB 3E5NA 4AP9A 2WUVA 4B3FX 4GX5A 2ZSFA 3VR0A 4RD6A 3DL7A 3AESB 4V0ME 1QYVA 2XF2A 4EHNA 4MKFA 2FWMX 3T7JA 2YR0A 5IU6A 5DCYA 4WPGA 2B4QA 2IYEA 4F8JA 4LC0A 5IUKC 4BNFA 3D1JA 3MJHA 3L4EA 2W90A 3WLRA 4RSHA 3X1JA 4JR2A 4ZOEA 1ZUIA 4YAKA 2VHYA 4NOLA 4NE7A 4CIBA 1K97A 1TZJA 2C4VA 2E4VA 4XUGB 2I2FA 1U5CA 3TCXB 2B9EA 1KC1A 3HYRA 4ZKDA 3NHUA 4N6GA 4HRYA 1GV1A 1DBVO 3QVKA 5TQ0B 2RC5A 3W5CA 4Q9LA 5ERXA 4P2GA 5C1OA 1VE3A 2BM8A 1J21A 2V5VA 3EASA 4ND7A 2Q07A 3JQBC 4KZPA 1M72A 4ITUA 3JY6A 3E9EA 1ND6A 1E3QA 4HD8A 5GP1A 3U49A 3IOCA 2ZG6A 5HF5A 3T9BA 1I30A 4OXRA 3JASA 3MB5A 4F93B 2Q1WA 2WJGA 3LVBA 2PO7A 2VLBA 2CUNA 4W9RA 4AP5A 4DNQA 2C3UA 3ZZ1A 4IOKA 3STUA 3H97A 4F6LA 2I4LA 4H7HA 4J0JA 1YKSA 4CG1A 4IXDA 4MWBA 3SAJA 4K5QA 4IDPA 1DAGA 1XBTA 4MQEB 3PHLA 3T9CA 2XA1A 4MQFA 2WV7A 5FPTA 2DHCA 2CXPA 5CDUA 5HZGA 4IV5A 3C45A 3BH7A 4IY1A 4JT4A 3WRXC 4B7AA 1VM6A 2C2OA 2C4UA 3ZHXA 3PUWA 8ADHA 4OGFA 3UXHA 4DR7B 2Q5JA 4FW8A 3MT7A 1NOJA 2O07A 4G9EA 4L6AA 2IYVA 2ZIWB 1SCUB 3FTPA 3HYCA 4HFNA 3MAJA 1BVRA 5ALZA 1TM7E 1Q0UA 1RWBA 3JWIA 4FNMA 4TN5A 5DJ5A 2IYNA 3AEKA 1HSZA 3TB4A 4E46A 4AY5A 3ZDXB 1N0UA 4FOSA 4XOIA 2WTMA 1CEYA 2ZWAA 3RU7A 5JS2A 4JI7B 3LX8A 4Z8XA 3V1KA 4ZCIA 1U1CA 2CLMB 3P0JA 1Q0RA 2GERA 1Y1TA 1UPAA 2H8GA 3P26A 1WWKA 4MKRA 4LZPA 1OBVA 3BDAA 3DE6X 1SWVA 8GPBA 1M0TA 3W5HA 2MR5A 4MEJA 1XZDA 3JV7A 3PNQA 4RFSB 4CN8A 5LZ7A 1YZLA 2ZCUA 1QRTA 1A1VA 2C8JA 4AZ3A 2VAXA 1LSJA 1R0ZA 2ZRGA 3P9NA 5ALUA 3AHJA 3F1KA 5C7IO 1P3Y1 3ESDA 4H2DA 4LRXA 3CNLA 4CF6A 5HRAA 2ADMA 4WOJA 4KPEC 3FVQA 2D1SA 5JAHA 3RTGA 2JFGA 3EXEB 1XXHA 2D54A 4GKAA 1P1JA 1QR2A 1TCBA 4P3YA 1QFYA 1A4XA 1M8GA 1G63A 5TIIA 1SKMA 1N0IA 2VTKA 4TYYA 3FJ1A 3KUDA 2HC9A 2O8NA 4DCTA 2CXSA 3K2BA 4QODA 2XT9A 1K5PA 1UZNA 1RS0A 2DH6A 1JFVA 5IN5A 3CBGA 3V8PA 4YJ2A 4R2KA 1GY8A 1VSVA 4BVEA 2UXDB 4AUEA 1GZ3A 1P91A 1F0NA 2BGTA 3HB1A 4D9MA 4BFYA 3INTA 2OBMA 4MV4A 1IN4A 4P83A 1U2RA 1MRNA 2I4OA 1VC2A 3AFGA 3DZBA 2UVDA 4RX1A 4BLSA 5KQPA 3THYA 1VMAA 4QDUA 3HLYA 1RAFA 4F8EA 4FEYA 1USIA 1A8UA 1FS4A 3TN7A 3ABZA 3T9AA 4OF4A 2P2LA 3HCNA 3FHTA 3OEWA 2QLBA 5CPBA 4TVOA 3ICVA 1A9TA 1SD2A 2XTJA 3E9ZA 3SU8A 2J6CA 4CG2A 1X1QA 1C2TA 3QFRA 2L18A 1S6YA 3M5PA 1LPSA 5T41A 4M99A 1RZRA 1LJUA 1UT6A 2XWQA 1NI4B 2EJBA 2H5JA 3Q3GE 4K1XA 3RC3A 4PSCA 1PJAA 1ZN7A 4JBYA 2GAAA 2EOAA 4EG1A 3UAWA 3EGWA 5ICMA 5AK4A 3VZSA 1JE1A 1YHNA 1MKYA 2ZU6A 1ZVMA 3AW9A 4HBZA 4RKFA 4RPJA 2LNDA 3DGEC 4JJ6A 2GZAA 4ZI7B 2GEKA 2E5WA 2GK3A 4BMPB 2GLXA 1I6LA 3OU2A 3N0XA 4MWCA 2QZSA 5IC4A 4XQEA 3OOYA 1KMQA 4AX8A 2HTEA 3KQLA 2OHXA 1JDVA 3DFMA 4O4HA 4RZUA 3O8BA 2Z8XA 3HCFA 3JD1A 1Z8NA 4X66B 2XKJE 2PUBA 4DR6B 3OAAD 1EBUA 4Y1GA 4Y7CA 1VA4A 5C8VA 5IJ9A 2RD2A 2ONZA 3GNLA 3D9QX 3OFJA 5BSVA 1K2VN 1XMJA 2DHRA 4TYMA 4G63A 3ZE8A 1B42A 2I8LA 3IEIA 3EVCA 3OZVA 5FWAA 4DUPA 2VYQA 1X87A 3BBPA 4TLEA 5ADHA 3MMXA 3Q9SA 4M0CA 4Z99A 5LXTA 1U2ZA 4AK9A 3HO6A 5I3CA 1JG4A 4Z1MA 4O1MA 3FTQA 3WQRA 4HEJA 1KKMA 1RI4A 4JMPA 4M54A 4TZ6A 2RKBA 2XZDA 1JDSA 3I2GA 4WINA 4KWIA 4IXTA 4GI7A 4XD7A 4UHDA 1FRQA 1Z0ZA 1IWOA 4MVXA 2ETVA 3LRPA 1ZRHA 1KVUA 2I65A 1RPTA 1SQSA 1ZJ4A 3OCWA 2M1XA 3Q11A 3WNQA 1R9GA 1Q95A 2Z2IA 1BWQA 3SGLA 4PNEA 4H4CA 2ZW9A 4KGXA 1ACLA 2CDBA 4N12A 1N6HA 3M89A 3N58A 4XGKA 4MWGA 3PEYA 3SLKA 1K89A 3R3JA 1C9EA 2AFVA 1U5AA 3E22B 5BR8B 1PEYA 1ZD2P 1KIFA 1QIKA 3H75A 1HZZC 3FY4A 2HQ1A 4JXKA 4QQ8A 3PNLA 1X7XB 4RC9A 2HWYA 4RLQA 3RFXA 5IFKA 1K8RA 1P9WA 4OUDB 4JJGA 4US0R 4KU4A 1ENPA 1IVSA 3QWBA 4IIJF 5FL7D 3U7EB 4RTSA 3X1MA 2BFBB 1LLDA 2HBRA 3C4JA 4HN2A 4QOFA 3EYAA 1KMHB 3ESAA 3FRIA 4Q4CA 4V3BA 1QZ3A 3IUNA 2BUCA 3ZJVA 4NLLA 1YB5A 1CYEA 3MJCA 5B36A 3UC9A 3L8MA 1C0EA 1JDPA 1GG8A 2A59A 3EC7A 3VZQA 5ESWA 1BDMA 2F1OA 5T6MA 4FT4A 1CIJA 2C9BA 5CA0B 2NUPA 2WYIA 4CEHB 3I0MA 4AYXA 4S0XA 4CUKA 3MWJA 5CVTA 1TA9A 5EJ4A 3FCCA 2PR2A 5HQJA 4P7KA 2GCIA 5KKAA 2E5LB 1NHGA 3VU9A 2J08A 2Z0MA 1M76A 3BJIC 2QVLA 4EPXA 3PI7A 4GI5A 2O2SA 2JLQA 4CF7A 1S2IA 2A67A 1XVLA 2VDNB 2XDAA 4WNAA 4EHDA 4FHEA 4ZOLB 1X9IA 1PJRA 4O4LA 1XTZA 4PXYA 3MM4A 1ZGAA 3O3NB 4COKA 4UTVA 2GUWA 4INAA 3LZCA 4R8SA 2IY7A 4FHZA 1EB9A 1HV8A 1ZGGA 2RGWA 3H4TA 3QWIA 1GQFA 2H59A 4UTZA 1IOWA 1M6NA 1PYOA 4L9SA 5D51S 3TI9A 4JU8A 1T2AA 4D97A 4W6QA 2O8DA 1CDOA 1J97A 4Y6PA 3PUXA 5H8WA 5KVCA 3FPBA 4RK5A 3PFWO 5A05A 3LQ4A 4W5HA 4YQYA 3SEAA 1MTOA 4IIHA 2EW1A 5F4ZA 5DSZA 1C7JA 2OUKA 1RWMA 1ESDA 2OV8A 3ZTYA 3EBPA 1SU6A 5TPWB 2XQIA 4Q9AA 3ZZTA 4ARBA 5F2OA 3MN1A 2HT1A 2UZ0A 3BKXA 2XQJA 4B76A 4UFPA 4B3TB 3ND5A 3UW1A 2N9UA 1UPUA 3I8SA 4J3JA 4IXWA 1IQRA 3GNQA 4NBKA 3S5JA 2R47A 4NEQA 4E0BA 5CT6A 5CX1A 4C0XA 2EYUA 3WGHA 1P60A 5LQAA 2HNKA 2CVFA 3EGDB 2DWCA 4KMOA 1GFWA 3I83A 3CURA 4B9EA 5IK2A 1KBOA 1UH5A 2HLDA 4RA6B 1U2QA 1B93A 1U6IA 1GAJA 1YA4A 1CC1S 4R2LA 2JGMA 1H2RS 3QE2A 5LJLA 2XMPA 2FH5B 3EQ6A 4C6SA 4UCWA 5CH3A 1JILA 3O1JC 1CUWA 4I7EA 4IDFA 3E7WA 3AJ8A 2NUBA 2QVBA 4I4NA 2Q5CA 4LSZA 3JAKB 5D6NA 3UNXA 1DBQA 2M9MA 4H3HB 3WMXA 2PJRA 5L6LB 1F5SA 4ALMA 1RCUA 2B8JA 3MJSA 3W34A 4PLCA 5DRTA 4DF3A 4EATA 1DWOA 3LQ1A 5CW1A 2E4UA 3BF8A 3LS2A 1B4DA 4MWDA 3T0FA 5BMVB 1IXKA 2NXWA 2PSEA 1N57A 7ADHA 2YINC 3S1AB 1HEYA 1P4HA 3MC1A 1KIMA 4DKXA 1NBIA 2CJWB