2QTTA

Crystal structure of arabidopsis thaliana 5'-methylthioadenosine nucleosidase in complex with formycin a
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
248
structure length
248
Chain Sequence
SEILRPISSVVFVIAMQAEALPLVNKFGLSETTDSPLGKGLPWVLYHGVHKDLRINVVCPGRDAALGIDSVGTVPASLITFASIQALKPDIIINAGTCGGFKVKGANIGDVFLVSDVVFHDRRIPIPMFDLYGVGLRQAFSTPNLLKELNLKIGRLSTGDSLDMSTQDETLIIANDATLKDMEGAAVAYVADLLKIPVVFLKAVTDLVDGDKPTAEEFLQNLTVVTAALEGTATKVINFINGRNLSDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-methylthioadenosine nucleosidase
publication title Molecular determinants of substrate specificity in plant 5'-methylthioadenosine nucleosidases.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
total genus 80
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature ec 3.2.2.9: Adenosylhomocysteine nucleosidase.
pdb deposition date 2007-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qttA00
1LX7A 1RXUA 1SJ9A 1Z37A 4PR3A 4TXHA 1QE5A 1Y1QA 2A0YA 1YQUA 3MB8A 3OF3A 3BJEA 1PKEA 2H8GA 3LGSA 4X24A 1JE0A 5B7GA 3E9ZA 5CXQA 3OZDA 4TTIA 4BN0A 3OZBA 5K1ZA 5F76A 3OOEA 1PR5A 3OOHA 4NS1A 1Q1GA 3UAYA 3DP9A 2OC4A 1JPVA 3DDOA 4LNAA 1YR3A 4TXLA 1PR0A 1RXSA 1Y1SA 3IEXA 4DABA 1A9SA 5F7ZA 3BSFA 4TXNA 1OTXA 4F2PA 1JDTA 2OECA 4YO8A 4TTJA 4EARA 5F7JA 4F1WA 5CXSA 1VHWA 4OF4A 3D1VA 2OXFA 3P0EA 2AI1A 5IFKA 4M7WA 3FAZA 1V48A 1T0UA 1T8YA 1Y6RA 3ONVA 4RJ2A 1JE1A 4QAQA 4F2WA 1N3IA 2QTGA 1G2OA 4M1EA 3DF9A 5B7NA 4DA6A 5ETJA 1RCTE 1Z39A 1A9QA 2AI2A 1CG6A 4D98A 3DJFA 1B8OA 1TGYA 4L5YA 4M3NA 4L5AA 1A69A 4L6IA 4YMLA 4H1TA 3UT6A 4YNBA 2QTTA 3NM6B 2BSXA 1CB0A 4TTAA 2A8YA 2ON6A 4TS9A 3C74A 1SQ6A 3INYA 1K3FA 5CYFA 1JDVA 1RYZA 4BMZA 3FB1A 5B7QA 1Z35A 4F3CA 4D8VA 3KVVA 5FAKA 3OCCA 1VFNA 4GLFA 1K9SA 4WKBA 4PNPA 3E0QA 1Z38A 1LV8A 4JP5A 4DA7A 3UAWA 4GKAA 1U1GA 1YQQA 1ODIA 4OJTA 4DAEA 3PNPA 4WKNA 4DAOA 4DANA 1JDZA 1TD1A 2RJ3A 5EUBA 1OTYA 5CYGA 3P0FA 1ULAA 2HRDA 3EEIA 4D8XA 3PHBE 1K27A 4L5CA 1OVGA 5EPUA 4NY1A 3KVYA 1PR4A 3QPBA 1PR2A 3UAVA 1PWYE 1PR6A 4E1VA 4LKRA 4FFSA 1V45E 3FUCA 2B94A 4ECEA 3DPSA 3KU4A 1I80A 1Z5NA 3F8WA 4LDNA 4P54A 4WKPA 2IQ5A 1A9RA 1PBNA 3GB9A 1PR1A 1V2HE 4F3KA 4JOSA 4R2WA 3OZCA 3SCZA 4TXJA 4DA8A 4MCIA 5F7OA 5CCEA 1SD2A 3FOWA 1A9PA 1OUMA 2QPLA 4QARA 4OGKA 1Z36A 1TCUA 3FWPA 4OY3A 1NW4A 4D9HA 1T8WA 3TL6A 2A0WA 3ENZA 4BMYA 1RXCA 1V3QE 2P4SA 4UC0A 1U1FA 3K8OE 1XE3A 1Y6QA 4G41A 4WKOA 2QDKA 4K6OA 3FNQA 2HSWA 4LNHA 3ODGA 3T94A 3UAZA 5CCDA 2HN9A 4TXMA 1Z33A 2QSUA 4D8YA 4JWTA 4GMHA 1RT9A 2I8AA 1T8RA 5I3CA 5IU6A 1V4NA 3BGSA 1T8SA 4I2VA 3O6VA 1JDSA 1M73E 1WTAA 4QASA 3OZEA 2PGAA 5F7XA 1RXYA 4G89A 2A0XA 1RSZA 4QATA 5KB3A 4MARA 3MMSA 3OPVA 1YRYE 2Q7OE 1U1DA 3UAXA 1ZL2A 1U1EA 5C80A 1Y1RA 5JPCA 1U1CA 1ECPA 5F78A 4YJKA 3IOMA 3KUKA 4GLJA 4BMXA 4LZWA 1Z34A 1ODLA 1JDUA 1Z5PA 3EUFA 3PNSA 4R2XA 5EFOA 1OU4A 1Y1TA 2I4TA 3KVRA 1YBFA 3NBQA 1NC1A 4R31A 3E9RA 1PW7A 4TYMA 3GGSA 3K8QA 1OV6A 1NC3A 1ODKA 1PK7A 4KN5A 1JYSA 1B8NA 4DARA 2OC9A 2AI3A 5DK6A 2XRFA 1TGVA 4IP0A 1SD1A 4G8JA 3LBAA 1RR6A 1A9TA 4TS3A 3BL6A 3NM4A 4OGLA 4NSNA 4DA0A 5F77A 5B7PA 1TCVA 3LA8A 4WKCA 3EMVA 3EUEA 4U2KA 1ZOSA 1VHJA 4QEZA 1FXUA 1Z5OA 4EB8A 1ODJA 1V41E 4MCHA 2ISCA 3O4VA 3U40A 1A9OA 3KHSA 4L0MA 1ULBA 2GUWA 4OEHA 3PHCA 1VMKA 1LVUA 2HWUA 1C3XA 1JP7A 4QFBA 1RFGE 1PF7E 5F73A 3NM5A 2AC7A 1PK9A
chains in the Genus database with same CATH superfamily
1DIAA 4Q00A 4D26A 1FY2A 4ZDKA 4HBZA 1DCMA 1SJ9A 4JGBA 4JWKA 2Q3CA 2XODA 3KQHA 1YVPA 5BQOA 2YXPX 2DBRA 1PHPA 3RUPA 5A9SA 5KX5B 1Y1QA 5LQAA 1M8GA 2PFSA 2XNHA 2RIPA 4PG4A 1LJ8A 3DZIA 3DOOA 3P97A 1KYTA 3CR8A 3JR3A 2HJWA 4G9EA 3OZXA 3H9UA 1W88A 1YIAA 4K6CA 4XYGA 4XQ9A 2C2MA 4WDRA 3I9KA 1FMTA 4M0KA 4JLPA 4J91A 3W4JA 2IEYA 1DRVA 4KLZA 2VXBA 1RCUA 4JJ6A 3MCAA 2V4ZA 3HVUA 4C2UA 5DXFA 3FYHA 5C8YB 3I04M 2PM8A 2QE6A 2V8BA 2XF8A 4PGFA 5K8UA 4TZ0A 2V6GA 2C9YA 2P2GA 5C4MA 4G24A 5DHQA 5FXMA 1F0NA 2PX8A 3ZKWB 2CVHA 5DX8A 2NXWA 3QE3A 1PR5A 3L4BA 1BMFD 3IMCA 1OXXK 1Z08A 1JHUA 2HV9A 4PO8A 4KHPB 3WLPA 1CY4A 1FTWA 3CA8A 2ZRFA 3IJPA 1Y89A 3EGOA 2B5WA 5HCIA 5C3UA 4I66A 4JP1A 1HDEA 4MQMA 3NV9A 1TCCA 3OF2A 1PI3A 1TF7A 2CXTA 4JI8B 4IDNA 4DMFA 2OFFA 1MTZA 1P3DA 4EUKA 4DSTA 3NHLA 1LPMA 2WHYA 4DADA 2KS6A 3G2QA 3T6KA 1TC2A 1J21A 1NHGA 2VDWB 4DMUB 2ZR0A 4P7FA 1GR0A 3N8NA 1BC5A 1Z6PA 3I1JA 1VJ0A 1MAVA 3KPYA 1JFVA 3OZIA 3WRXC 3AFMA 3X3HA 3J81A 1E2JA 3BSFA 3F7MA 3OFSA 4TXNA 3RS2A 3UJPA 4F2DA 3W5DA 3RKUA 8OHMA 1C0IA 1PQ4A 2PRSA 3FR8A 1BMDA 3MTGA 3H99A 4B2YA 1CJBA 1MC8A 2OECA 2FQYA 2QRZA 4OXRA 2Z2XA 3BIFA 3QFCA 3ZE9A 3DO6A 2OGZA 1G9XA 2FMIA 4RADA 4CQLA 1TM4E 2J59A 4LC9A 3KKMA 4QSMA 4PLFA 4I55B 2NPOA 2X8BA 1IYZA 3DKIA 4ENRA 1G5FA 1KBZA 2IT1A 3TVDA 4PV7A 3RFVA 3WLHA 2O59A 2ZW9A 2HI0A 3L0PA 2C3OA 2IY8A 3DM5A 2BEUA 3BMNB 3OKAA 5C5DA 1C5KA 4AULA 4ZJYA 5GP1A 5EEGA 4R2IA 5FOXA 1CIJA 4DXAA 3MLBA 4Q3NA 2ZBVA 1UODA 3UMJA 4C04A 4FNOA 4ZODA 4AF6A 3F8TA 2XECA 5DF1A 4NRDA 2MSNA 5AVJA 1Z2DA 1EUCA 1RPAA 2AUTA 1LBTA 3K5PA 4HN2A 4MPRA 1RP7A 3TAHA 3TNDA 3Q3IA 4J6EA 3U39A 1QE0A 4KIJA 4OREX 1SKBA 4DLUA 5EUCA 5DGHA 5IYZF 2C0CA 1ZM3A 2QR3A 3ND9A 3ZPXA 3RS3A 1CKEA 1NFFA 1P7ZA 2O7QA 1JQBA 1JG2A 2D1RA 3FFXA 4MHSA 3TQQA 1W25A 1UXKA 5FA6A 4MKXA 4OHKA 4P4SA 4D98A 1DWOA 4NYMQ 4H1VA 2EFJA 4MYHA 1NONA 1MB2A 3GWZA 2GFQA 2GSDA 3WGUA 3UK6A 3AR7A 4D42A 2X4IA 1DX9A 4WGGA 2VP0A 4EPRA 1P4HA 1NP3A 3KZ1E 2G70A 4JB2A 1TQ4A 1Y8AA 2EZ9A 4JJIA 4POAA 3OFVA 1DIOB 4LOHA 3MRSA 1GAQA 1UKEA 2JGNA 1U94A 3SQNA 4AMBA 3TTWA 4RTOA 2EF1A 2HJVA 2NVUA 3CWCA 3M9LA 3HSSA 2VH2A 2BZGA 1RAIA 4UUQA 5A5FA 4B85A 5PGMA 1T0PA 1CB0A 1H0KA 4QGBA 3VH1A 4M6WB 4A3SA 3B7PA 2JLAA 4K05A 3DGEC 3I01A 3G9ZA 3KHTA 4F6CA 3R7WB 1P1FA 2FEWB 2QN8A 5ALMA 5HG0A 4AZ0A 1P7CA 1KPIA 4ETNA 2XD4A 1R0SA 2NXJA 3VC3A 4DCPA 3GVHA 4X90A 3KB8A 4HLQB 4BMZA 3FSJX 5B7QA 1JX6A 2FFJA 1NXVA 1WVIA 3NJ8A 3RIEA 4MWGA 1UBKS 3I4CA 5DOVA 1UIMA 3MJRA 3FYUC 1E3TA 3RHFA 2IRWA 1QOQB 4LRQA 3UANA 1DEOA 3V7FA 4R5MA 4US1R 3F8SA 1W8IA 3H3XA 1HFKA 2NW6A 3ORQA 3PEVA 4HSGA 2P1DA 3KUCA 4KWCA 1K9SA 3FYDA 4PCUA 2YRXA 3ESCA 2BMVA 3KVNA 4QUIA 4BFSA 1Y5RA 3OFKA 3CS3A 3KD2A 2D5AA 3LX4A 4P7KA 3OJ0A 2R1VB 4U7GA 4X93A 4LXQA 4P3KA 3MWYW 1IOWA 2A88A 3RVMA 4BIMA 4OLHA 3BZUA 1N4AA 2GZAA 3U4AA 3SIRA 1C2TA 5HZMA 4JC5A 1OI3A 4WY5A 2DFLA 3CUEF 3G9TA 4ZXFA 5AP9A 5IEJA 1LDEA 1JB9A 3PNPA 1VPTA 1LKZA 3EC2A 1R5JA 1NI4A 1SQ0A 4DZTA 3U17A 1C7QA 5CB8A 3IAHA 4FYYA 2ZR7A 4KAAA 1DBSA 3D4IA 4BHTA 4RORA 2ZTHA 1MB0A 1KIAA 4X1IB 2IL1A 3OC0A 5A6SB 3QEBZ 3O8QA 1JAZA 2HRDA 3MTJA 2H2GA 4ADSG 5KQPA 3IEIA 2XT9A 5ALGA 3U44A 1NE7A 1NT2A 4P80A 5MN4A 4S35A 3C0KA 2VK2A 3BWBA 2ZYAA 4FXPA 4OQFA 1BMQA 4HWOA 5FYDA 1O58A 3JSAA 3WGVA 2Z56A 4RSHA 3ZZUA 1PR4A 4LUCA 4NOJA 5J58A 3SYLA 2XUDA 3WDKA 1YZHA 3NIFB 5DLEA 1CEYA 2ERCA 1OPXA 2W37A 3WGNA 4H1HA 4QTTB 1J8VA 4E03A 3QLUC 3FLEA 3GVCA 2ZRPA 3IVAA 4TV8A 5DMXA 3CLHA 1ZO8A 5DOZA 2DECA 3SN6A 3L7BA 4I3FA 2VNIA 5GPBA 3VKFA 1UZLA 4EYQA 2Q3LA 3ESXA 3NETA 2HF7A 5ES3A 2WZQA 5TVKA 1L5LA 1V95A 3KTOA 5JJIA 1A7UA 1IHYA 3IUBA 1N8TA 5BR8B 1QGZA 1P5FA 2KSQA 3FE2A 5T3UA 3OM9A 1NF2A 4LF5B 1IUPA 1WPRA 1LVGA 2FOLA 1ZH0A 3DC7A 4TQGA 1IONA 4RQBA 4JA0A 3GCDA 2QI9C 3C43A 1K63A 1C1HA 4MKHA 4B2LA 5H82A 3ZY4A 2DFKB 5F2EA 1T13A 1YNOA 1K7XB 1P6QA 4CHTA 2BEVB 1U7PA 4M86A 3BWVA 4YJ2A 1ND5A 4NAHA 2WU8A 4L3OA 4AY2A 1SHJA 3R0JA 1JWAB 3RRYA 3UWOA 4W8OA 4CHGA 4FEGA 4JJ7A 4I1SA 2VR1A 3VPFA 3CUVA 1ZRSA 1NG1A 4GX1A 4BNDA 3MAGA 4D6YA 3QBTA 5IKOA 5IRCD 2B37A 3STTA 1XVVA 3R6WA 3CR3C 5CCEA 1GZVA 1SD2A 2YZ2A 3ND5A 4I4IA 2ROQA 4KXYA 3DJYA 4IRMA 4RUKA 2VK8A 3VH3A 3ZU5A 3ZN2A 5I01A 5M5BA 2QNBA 2PR7A 5KUTA 2D13A 4ANFA 2BEKA 4X3CA 1EGMB 2WM9B 3LWBA 4HVTA 4Y18A 4FGKA 4FYVA 2VDOB 4XYEA 3CQ9A 3KXLA 1OXTA 2NO6A 2D5IA 4IGAA 3KFVA 3TNYA 3V3KA 4K0RA 3J7AC 1EVLA 4AUKA 1G3IA 1RHJA 1DGQA 2Y1KA 3GFRA 4TL9A 1Z6AA 2H4FA 1X3LA 2NZ8A 3C6MA 3JALB 1QH1A 1IOLA 1U6IA 3BFVA 3DBHA 4IJMA 2RJOA 4YRLA 5CLHA 4XIIA 3WY9A 1ULZA 2IOFA 1YSCA 3VPCA 3MB5A 3V00A 5LA6F 3AILA 1M2NA 1N6IA 3PNOA 4D5EA 4Z6KA 1XDUA 4QRIA 4N0PA 2XGJA 2GZSA 1TA4A 4AM8A 3FYUB 3EGIA 4J0GA 1NQ5A 1NTOA 2BMDA 1MOQA 5C5EA 5LYJB 3CO0S 4HOYA 2I99A 4BMVA 2KMLA 1H93A 4KIWA 3LL4A 4EG0A 3BTUA 2GCOB 4YJFA 5LZ4A 4Q3CA 1UJCA 3UWDA 1I36A 5CVDA 4LC0A 2VUUA 3IURA 5E9WA 2W71A 3N3AC 1PS8A 2J9ZB 2JCGA 1DWQA 1R00A 3RWBA 4J76A 3AFGA 3D8TA 2HN9A 2CCKA 5HK8A 2MINB 1IXYA 4BLUA 4O4JF 4RGBA 3HGTA 3JQ9C 4EELA 5HIJA 2B83A 3I3OA 4WIAA 1SC6A 2OUIA 2VDNB 1YZYA 3TSAA 5E1BA 5FTNA 1ISGA 5D5QA 1JU3A 4L9WA 2LKDA 5CDFA 4CG2A 1W0KD 3FWHA 3PSAA 2CXOA 3ZOKA 1KH1A 3EXIA 2V4UA 4JP3A 4V39A 5IAJA 3Q1LA 3ZE1B 3NVDA 4I2VA 4IF6A 2ZXFA 1UBJS 3FKSD 1XZ8A 1MRNA 3P0HA 1US8A 5JSQA 3BICA 3MYRA 1WUJS 2QPAA 4ZIRA 1ZUNA 3FPEA 3A14A 2R6R1 3KELA 4GOKA 2PZLA 4JEUA 2EQBA 4UEKA 2DKOA 2ZPTX 3NBAA 5B5SA 3X1KA 2C5FA 2HHJA 2I2XB 3QX7A 4RGQA 1PR3A 4YASA 4RA9B 1QNFA 5A4KA 5KTOA 1X1BA 2AN1A 1DEAA 5GIOE 2WJPA 4F3NA 4CCSA 2DWPA 3WLEA 5TS3A 4P7GA 1K97A 4I9HA 3PEYA 3CTMA 1EGAA 3L6RA 2YW2A 3C4QA 4AT1A 3CB4A 4ZYYA 1DCTA 1F51E 3GQBB 1QMGA 4YI3A 2CF6A 1SM4A 3GFQA 3LUAA 4Y2YA 5L4LA 4CETA 3KKEA 4DT1B 4FM9A 2BGJA 4O4HB 1TVCA 3WBJA 1T0IA 3B5JA 1DU4A 3EWAA 1MHPA 2ODEA 3OLCX 3V32A 4KU4A 3KB6A 1MZPA 4LY6A 3PJRA 1W52X 2A5GA 1LGYA 3C5HA 4FKBA 1N2CE 4FGUA 4P35A 2Z04A 4A2WA 1NWCA 1MORA 1RWWA 4E6PA 3EFHA 1VKHA 1QXSA 3AXSA 4ZYUA 1A8IA 3ULKA 2EATA 2ET6A 5EHNA 4LRSB 3VKWA 1U3FA 5DWVA 3RYFB 4KO1S 3VC1A 2DWCA 3KWJA 5EFOA 5JHHB 3R5KA 4ISBA 5KYXB 3DAYA 1T3TA 2FMTA 1VG1A 1RKQA 4IDOA 5HHTA 5JNSA 1CUZA 3GPIA 3ZD8A 1ZIPA 2XW6A 4MQ4A 2R8RA 2D7JA 2PKQP 3QLJA 1WG8A 4DSOA 2PZKA 1O03A 3KZOA 1YDEA 4B1FA 5L3VA 1RDFA 2Y9MB 2QV0A 4V0LA 5LUBA 4C7BA 2VSQA 3IE0A 1ZSYA 4MLDA 4U02A 2Q62A 5FOTA 2SKDA 4P22A 1U0SY 1WQ1R 3WGMA 4ALIA 4EFNA 2QMOA 4BO1A 4YRBA 3TTUA 5H16A 1AGYA 3OZSA 2ZJ6A 4RXUA 2JRLA 4CBVA 1BA3A 1KFBB 2OLJA 4MTLA 1FX0B 1JLLB 5CCBA 3HBJA 3KR2A 1E9VA 3HA3A 1K8RA 3HP1A 4JQZA 3PTZA 4AJPA 4BNLA 1GSIA 2P1RA 2JAUA 3OEHA 4DA0A 1JHMA 2VHJA 2B4TO 3OD5A 3Q0IA 4YRDA 4QECA 5B7PA 2BGWA 4OQNA 5I51A 4UM7A 2REXB 2WSYB 3LUKA 1PV2A 1CUEA 1MW9X 1FXUA 2KB0A 1H42A 2NVBA 1W30A 1AMUA 4F86A 1S2LA 1AQYA 3WDSA 4EAQA 1XDBA 2XOKD 1F2UA 1RPNA 2FFRA 4U7DA 4MJLA 1A9OA 1XTQA 4E5YA 3J7TA 5DW0A 1EBBA 1EP9A 2INGX 1Z15A 2WIBA 3V1UA 4CM8A 4NU8X 2XNKA 4W5TA 3L4KA 4P4UA 2Z9DA 4M98A 2P9TA 1V6CA 4MK4A 4OBEA 5FI5A 1BXRA 1ZITA 2O5RA 4BNUA 4TQAA 3N2KA 1VMKA 2ZYHA 3FZNA 5EIOA 1LRJA 2BUBA 1BXGB 1E2PA 2R47A 3QXJA 3I6MA 5F73A 4KIUA 4EKEA 1VA4A 3HXQA 1Q7BA 2HC9A 3IVMA 4WCVA 4KH0A 1F9EA 2PRYA 3RKRA 4M1KA 1LUAA 1NW7A 2DFNA 4ALKA 4B3GA 4IHKA 1QQ6A 4CYMA 1E3QA 3OEED 1QE5A 4ZU3A 4CMCA 2JK1A 2RHJA 2JFVA 3HJHA 4JSYA 2PZEA 4PPYA 4YJGB 2A0YA 3EVFA 3L6EA 1XN1A 5IWAB 2VDQB 5IJXA 3PDWA 2BYTA 2V59A 3BQNB 1T4GA 2WG0A 3DBLA 2OLKA 3HR4A 3T7SA 4JCOA 3QOWA 4Q03A 1C50A 3A70A 1ECGA 4FBMA 4UM5A 4UBJA 2PQ2A 4DIUA 5B7GA 2IZ1A 4LRTB 2BHSA 1GV1A 1O96B 2J6BA 3W6ZA 1CRPA 1UMDA 3BL5A 1ICEA 4AXXA 2IBTA 4GSKA 2UUBB 4E30A 1EQAA 4NNOA 3T7CA 4CIXA 1OX4A 2IP2A 1TW3A 1EINA 2Z5VA 3PUHA 4ROSA 3QPCA 5JYBA 3KNZA 1Q17A 3P9IA 4EEKA 2IYOA 2YY5A 4XJVA 3OOHA 4RZ3A 4CT5A 4DN6A 4X62B 4CF6A 3D7KA 4AS1A 5LCXA 1Q0HA 1XKTA 4JJZA 3NOXA 3Q3VA 1F1JA 1MJGA 2A1TS 4LXIA 4DDUA 5KX5A 1AGRA 4CV1A 1H05A 1EFPB 1Z4OA 3IH5A 1Z8HA 2Z6VA 3WLNA 1ZFNA 2WJHA 3DEYX 1LX6A 2HYDA 3BXOA 2H4YA 2ZSEA 3PFBA 4CIBA 1QRDA 4ZRNA 5CFLA 3PFGA 3IQIX 2YV4A 3LSYA 2OV8A 3UPDA 2PX4A 2WI8A 1PFVA 3Q12A 5HJEA 4GMDA 3ZDXB 2GK7A 2JFBA 2ZE5A 2JIZD 4GF5A 2CNDA 3K0FA 2QRLA 4XD7A 4XM2A 2V7UA 1HZZC 3TYXA 5ALVA 1SBQA 1BCSB 1G8AA 2BFWA 1LDGA 5GJCA 1A9SA 1CUJA 3A4TA 3OJXA 1FQWA 3SZRA 1H3FA 5EI5A 3IFSA 1JF8A 1LSJA 5C8YA 2B99A 2ERYA 5J2TB 3EGCA 5B57C 4JJEA 1D2HA 1JDTA 1YR6A 2I6FA 3AKZA 5CUQA 3AVYA 3LZDA 2OGUA 5H83A 3V8EA 2L19A 4FYIA 1ABEA 2IU3A 4UTZA 1ZM7A 2H4XA 5C4GB 3M6LA 4DM7A 2Q8QA 4LJ9A 4UBKA 1E6KA 4NE7A 1DZ3A 3WGJA 2I4LA 2C29D 1B00A 3D1VA 1U31A 1M6NA 2DM6A 5EPEA 4QOEA 2Z08A 4QBTA 3OLWA 1R4NB 1M72A 3B9PA 1PZMA 3JQEA 2IVZA 3CLRD 2XXBA 1TADA 5EPOA 3EWIA 5BVHA 4RJ2A 1T2VA 3UB4A 1C1DA 1B1CA 3BHIA 3HCBA 3ZGOA 2YJTD 1KRWA 4IGKA 4OQXA 3T1YB 1NQWA 4WSOA 4QTZA 4B40A 3WGYA 3MGAA 1U7UA 4G63A 5C4IA 2VDWA 3D6JA 5MDHA 4HFRA 5TQ0B 3I42A 1OB5A 3SVLA 1RXEA 3MUNA 1Y5MA 1G2OA 3NBFA 3DQPA 2DKFA 5AUPB 2C3MA 3WB2A 4O2AA 4I3GA 5CA1B 1J33A 5AQ1A 5ITZA 4Q01A 2QU7A 1KAMA 4HNTA 2PS3A 3ZX5A 2XUJA 1IY2A 1MO6A 3R3HA 1UPXA 4P92A 4N5LA 4YGXB 4DA6A 1RE1A 2XY4A 1UBSB 1WVMA 3I0NA 2PMEA 3A10A 3HU3A 4XTCS 5K03A 1NN5A 3MT9A 3KJXA 1LRLA 1WP9A 2M6RA 4NNPA 3W06A 5IC4A 1OT5A 1R3DA 2PGNA 3LBYA 1RRFA 3NC4A 2JFWA 1J8MF 1HE2A 4M53A 1UCFA 2ZT6A 4MKFA 1J2UA 1DEKA 1QO9A 3PDCA 2XOEA 4X61A 3PFNA 2FW8A 4PYNA 2PMWB 1OC4A 1PEYA 1K2WA 1Z9BA 4UAUA 3TVYA 2TSYB 1NUTA 2YS6A 1N5DA 1ZRMA 2XGGA 4PWZA 3UG7A 4R3NA 3ZXUB 3LO8A 4HS9A 5KVAA 4LECA 4M9XA 5AJZA 4RMJA 2XMPA 4L8VA 3B6MA 1LFDB 3BORA 4EQ6B 2JLYA 1YC5A 2I66A 4NWIA 3PHLA 3RNLA 4NCBA 2YJ5A 4PEVA 4DCMA 4D0RA 2IU6A 4K87A 3EEYA 1ZGCA 2GBFA 3AEUA 3QTBA 1ZICA 1NVXQ 2BMEA 4KPGA 5A7HA 3GAFA 4BGDA 1JLHA 4EGSA 5IJWA 1VHLA 5K4GA 5AXCA 5B12A 1JDVA 2Z0MA 4P34A 4FFBB 3PGA1 4ZO9A 4PXYA 1VGVA 1O8BA 1XA3A 4TV9B 5DMHA 5IT4A 1NSTA 4RD6A 1ZAYA 4PG5A 3DDZX 1O54A 4FZJA 2G8LA 3W4IA 1HDGO 1FZQA 3IUJA 2M9MA 5AI8A 4M1MA 3GDGA 1PNRA 1SRRA 1AXEA 1HWYA 4IH9A 4BZQA 5KJ1A 5DNUA 3U7RA 3V1TC 3WRWA 5BSKA 2PANA 4I9FA 1T5BA 2Y1EA 3TOSA 2W8ZA 3K94A 5E7QA 3TD2A 1MQSA 4LFCB 1N1DA 1NKVA 3O2NA 5DM1A 2VWQA 4DC0A 3HB9A 4PNPA 4ZQCB 1CDOA 1EX1A 2QTVB 3TXYA 2CXNA 1HE3A 1B0UA 1P39A 4M6WA 4J1SA 3TZEA 1QVWA 1TZBA 3GA0A 4PHTA 4WWHA 2AN9A 3P2KA 1WCWA 2I7TA 3IPCA 3Q3CA 4IJ5A 4Q19A 3H1GA 3UXMA 4W5NA 4B34A 4DUYB 3FPFA 1NSYA 3VTAA 2ATEA 2H2HA 3N6VA 4G8BA 4BMDA 2RJ3A 2HMUA 4YAKA 4QGGA 1CQWA 1G55A 5JASA 1MUUA 4QHYA 4WRRA 1XO1A 5FA5A 2JHCA 1NLFA 2G0TA 3DC2A 4KFUA 4QHSA 4R5HA 4A1OA 3RTAA 4BRWA 3G0GA 4TTTS 3IMFA 1T9GS 2BRUA 2P5TB 1M34E 4LWZA 1X39A 4WACA 1O9BA 2V03A 3QVSA 4WZAE 1QF6A 2FWNA 1XRPA 2ADOA 2D1FA 5DBGA 1D2CA 3JD3A 5SY4A 4AD8A 4MUJA 3ROPA 4D9FA 1YK0A 3ZLJA 4QUKA 4C0AC 1YDFA 3FLAA 3PX3A 4QDKA 4WCFB 4ZTZB 4COKA 1SBHA 1U2TA 3ONNA 4V0SA 4EENA 1WOYA 1IN5A 2BUCA 2DT8A 3HN7A 5CLLA 4AMUA 4BBJA 5JBIA 2UAGA 1KEZA 2QD1A 2R1VA 3AJ9A 2Z95A 3E1KA 4TMZA 4U6NA 1M83A 2R4UA 5LL6P 1QGYA 3A05A 2QT0A 3OJEA 3OOYA 2Y0PA 3I37X 3QPBA 3PTLA 3R8XA 4CMGA 1EZ1A 3IX7A 4DC9A 1EFAA 1BDJA 5EJFA 5F9FA 1AQUA 5CDTA 3PWKA 4XR4A 1AGNA 5DN9A 1RWBA 3OU2A 4QOHA 2IWRA 3ZQ6A 4DMMA 3EDRA 1ID8A 3C3CA 1A9YA 1DTWB 1G6KA 4GL4A 1CYEA 2GH1A 2O2ZA 3QWIA 1GNVA 4GS5A 4E12A 1TEHA 2RC6A 3FM9A 2IEBA 5AI5A 1R6AA 3KT0A 4X1IA 2V55B 2HGZA 1N3LA 2VP3A 5A6SA 3N7TA 4G37A 4YT2A 2YDYA 2BEWB 2NXNA 3GHHA 1VLZA 1X92A 3VKUA 4IIFA 1W19A 2NO4A 3RVLA 4CM4B 5KWEA 1J0EA 3FVWA 4M0CA 2WM3A 4YRCA 3R7LA 2C2WA 5AVTA 1ABBA 3G7UA 4BGIA 4DLYA 1G19A 4ZREA 4DM3A 3RIHA 3JQAB 3O84A 1PBNA 4FUQA 2JLSA 1B74A 1A96A 3OURA 3HVKA 4URYR 4OD0A 3RBZA 3WSWA 1KZ4A 5AJVB 4EJMA 4BMCA 4GX5A 4DGSA 3A37A 1N4DA 4LWOA 1FE8A 1U8AA 4MWZA 1MJNA 3KKOA 4TXJA 3KB2A 1JMKC 3BXXA 3JXEA 3RU3A 3BSYA 5IC6A 3VHXB 3CCFA 3QNMA 4OK5A 4ZKDA 3WL5A 1EM8B 1LK5A 1VJRA 3ANTA 5TJHA 1DVRA 3WNQA 2QJRA 2X1MA 3AL3A 1XTBA 2AYXA 3AWDA 2YMQA 2R1TB 3EVZA 4DPMA 3B6IA 3GLFE 3DV9A 4MQ6A 1VBMA 5REQB 5TMDA 3QVOA 1PEKE 5F2OA 2GRJA 4ABTA 2B3DA 2PK3A 1L5NA 2I7VA 4Q93A 3A6EA 2H63A 2WA2A 2JEYA 3UFXB 3ZQJA 1FU8A 4OTZA 3PDIB 4PZ0A 3R20A 4BU0A 4EG5A 1DT5A 1FP4B 3JWIA 3EHEA 2F8SA 4QFCA 4PS0A 3ENZA 2Z9BA 3BF7A 3EBPA 3N53A 4MW6A 3V7YA 4BMYA 5FOSA 4HRVA 4RO0A 4B2IA 4UC0A 2AN5A 2WYVA 1JHOA 2PQMA 4G85A 1BRMA 2O8VA 2GEVA 2I4IA 4NG5A 4MQLA 2GN0A 5TQ2B 1YF3A 3CRZA 4B44A 5I7AA 1IATA 1Y6QA 3EQ9A 2GUGA 4JLNA 4BNZA 4ZHQA 5LMCA 2QY6A 5AI4A 4ZT4A 4NU6A 2IYPA 4KBGA 3UJDA 2VYVD 3DWGA 3X1JA 2GD6A 4Y6RA 1NXQA 4FX5A 4Q1AA 4K6OA 2ZUWA 5JBQA 5IVIA 2CWWA 4IZIA 4KCGA 1HT1E 2OFOA 1KYWA 4WA7A 4XVUA 4N65A 5LC1A 4A7PA 3T41A 2WJJA 1TCAA 1E79A 4TT3D 4BNFA 4BCBA 2FUCA 3CT4A 2NVWA 4M0EA 4WINA 4NDZA 3TX6A 2W2TA 2F8TA 3QPDA 4KFTA 2H51A 4QGHA 1QRUA 1MT0A 3WIEA 4DJFC 2ABWA 4EPXA 2OM2A 1Z33A 1ADFA 2LKCA 3EIEA 4GR9A 3TRFA 2JIOA 2VNJA 3OT1A 1Z7YA 5F98A 2CY0A 3W5VA 5A3RA 4WESB 2I3DA 3T5BA 1Q0UA 3IT0A 5HKKA 1Y48E 2FZLA 3HYNA 3LIIA 4AKIA 3DZJA 1B1AA 3EXAA 5DIFA 1T2NA 3AHHA 1W94A 4TM7A 1QK4A 4BYGA 4JJAA 5L51A 4NFHA 2H07A 5EZSA 1X1QA 2NQ8A 3L7YA 2EBFX 4BN5A 4ERXA 1GAXA 1JVBA 2WHPB 3A1UA 4LDZA 3TSCA 1IJBA 2HX1A 3QP9A 5CPBA 1PV4A 2O2HA 3JAKB 3BK7A 1RBZA 1APBA 1EWQA 1ZJZA 4YBRA 3TW8B 1PL8A 2JI9A 2OFPA 4OGWA 4WOJA 3U7EB 5FQNA 3VHQA 2AVDA 3LCRA 4RIEA 5KC8A 1EIZA 2P77A 1I94B 2Q7OE 4GLBA 4HX2A 5KCMA 4PLPA 2FSVA 1EDBA 3WYCA 4GBED 4EHJA 4ROTA 1QUEA 1YFKA 3NKLA 5CX4A 3L07A 4HDRB 1GPYA 3AG6A 3H5WA 1VIVA 3VR4H 1DX4A 1GRVA 2XD9A 4YRKA 5B2EA 2Y68A 5LZ8A 1M2OB 2V0GA 1IEVA 3OZGA 3H9JA 5DASA 3VYWA 3OCUA 3AHJA 2IPLA 2AKAB 1MU0A 5JMWA 2CLSA 4YRNA 2ZAYA 4P3NA 1T1SA 1D9XA 2BKAA 3T35A 4Q39A 4DA4A 3AONB 1EEHA 2I4NA 2W6OA 2GPNA 1UPBA 2I8CA 5I5EA 1Q0QA 2XUKA 1II9A 4QKQA 1KOGA 5JSFA 1GU0A 1U3GA 1WHTB 2Q99A 1I5RA 1X74A 1DG1G 3VYRB 3QOYA 4CLRB 1P7PA 4RQUA 3DLCA 1KEEB 1AQLA 1L4LA 4MVJM 2P27A 3ZGZA 1MAAA 2QE7D 4E4TA 1T9CA 3AXTA 2CKMA 2IW3A 1XXHB 1CUVA 5KIAA 2P1ZA 4JX8A 1MGOA 3IUMA 5DSZA 4IMJB 4AQYB 3TBKA 3R7DA 3HKBB 4KN5A 1M1ZA 1ZC3A 2WJWA 3B6JA 3EYWA 2ZR9A 4DT1A 1OW3B 3BB1A 1F6BA 3HJRA 4O4HA 1E9CA 1ZN7A 3GJRA 5CTAA 4YQFA 3K70B 1SU6A 4S1VA 5EJ6A 4G0VA 2I1QA 5M2QA 2DPLA 3RJ5A 4Y2TA 3HJAA 4XWKA 3LBAA 2OO7A 3PFKA 2VRWA 2BZ1A 5J43A 1MRZA 2HLDA 3LYLA 1AMNA 2DR0A 2VJAA 5K6TA 3D8UA 4X65B 3VR6H 3PPIA 3H2IA 5GMOA 1KJ8A 3TWOA 2R5WA 3RYFA 1X7WB 1N77A 4O8CA 4U0KA 3L7MA 3RSFA 5KYXA 4IS2A 3GMTA 4XVRA 3KQTA 3HK2A 1RI3A 2RGNA 4E2WA 3WRYC 4MVXA 3H97A 5IG2A 5KNCD 4BZZA 4EB8A 5JPIA 5COBA 1JL3A 5JCOC 4PFSA 1WXGA 1UJMA 4BQPA 4UTRA 2Z6UA 3RRFA 2OV2A 3MRTA 3FIUA 3IP9A 4K2AA 3FBGA 1QGUB 4ONEA 5A04A 3ADDA 3D6HA 3AUAA 3E35A 1ZD8A 3EDYA 3OQIB 1FRNA 3A9VA 4RWZA 3FJ1A 5LWQA 2FPKA 2PTHA 4US2R 3R23A 4MVJD 2X0EA 1HC7A 4LBWA 1EFUA 1I5OA 1L6IA 3DBVO 3OPYI 3CNOA 3CSSA 3S2GA 1W49A 2QLNA 4WNYA 5IM5A 5IABA 1JLLA 1SQSA 1F14A 3H6KA 4DV5B 4F9TA 4KGXA 3VRHA 1O8CA 3DVRX 3F7NA 3WMFA 4EL5A 5BSFA 3T3OA 2AC7A 2UZ1B 2W6NA 3NJRA 4WDQA 2O2YA 3I9LA 3UN1A 1LJLA 1G7TA 1H2XA 1K8YB 1XEWY 2YOFA 3QVLA 5HR5A 1A88A 3TJRA 4JASB 2YYAA 3PLNA 4N49A 3SKVA 3TM5A 2FU5C 4TTSA 4HNVA 1TAQA 1T5IA 4ZCTA 1H9BA 1I3NA 3HVIA 1ZOPA 2WA1A 3K0HA 2XMRA 1GQSA 3RSHA 1IEQA 1O95D 2B34A 3FDFA 4HLNA 5CVTA 4FC7A 1F8XA 1UPCA 3LGSA 1TX4B 4PYMA 3RCBA 3ZU3A 1YB1A 3QKWA 4GSLA 1G21A 2OO5A 4D9MA 4ZDWA 1JPJA 1XPOA 4Q3LA 4F46A 3ISJA 1V3UA 1TMYA 3A6DA 1I1HA 1IN6A 3D4PA 1TAHA 1EB8A 3LHSA 4A8JC 1HDZA 3DDNA 3LXMA 4ID9A 1G4UR 1NASA 4IJUA 1C9DB 3FOBA 4IJWA 4R0NA 1CUGA 3B2EA 5BSRA 2IOHA 5CW2A 1OR8A 1KJQA 2ZB2A 5I6DA 3AUSA 3E7PA 2PIDA 1Y7LA 4DKJA 5C34B 1BXGA 1NYLA 3DNPA 3HXLA 4TV8F 2XQGA 4F5WA 5F76A 8ADHA 3UMYA 1TJ4A 3FFBA 3G3EA 1CBUA 4GPTA 4ZO7A 4X64B 5DNYB 4GGMX 2X9QA 4AZWA 3RSZA 1Y3CE 1Z7EA 2RSLA 2WUVA 2YJNA 1D9ZA 4PPNA 4Q47A 3A6JA 4H2DA 3TCKA 2Q9UA 4MWDA 3K71B 3OQJA 4O3MA 3OSZA 3R9XB 1Z0FA 2X22A 3CLSC 1PJ3A 2MSCB 2PU5A 4FOTA 2KE5A 3BL8A 4YJGA 1PR0A 2J5XA 4Q24A 2OAQ1 3VU9B 1Q7EA 2XNDD 4WZZA 1DHRA 2HBQA 3HHPA 4RDHA 4ND5A 2QUHA 4CT4B 4BU1A 4FYWA 1I13A 5H3CA 1NURA 3G17A 1VE9A 1ZOLA 3BIJA 2NX2A 3VZQA 1QJCA 1E2BA 1QO0A 4M1TA 3GBPA 1HH4A 1NXSA 1GFWA 2C1XA 1J2YA 1Z4QA 2PKXA 3PEFA 1O96A 1G17A 1T6BY 1XK6A 2R2AA 3SNKA 2WP8J 3UYLA 4F2PA 2GKSA 5JCPA 2GAFA 5F23A 2H06A 1GT6A 4HDOB 5IHPA 3PHJA 4Z4EA 2PX2A 4X7MA 4D8TA 3WGQA 2AOUB 1NW9B 2C97A 3AUKA 3TEFA 1DRKA 2XDYA 1TEVA 2WD7B 4FCTA 1NUAA 4AWBA 3QSYA 1Y8ZA 1YL5A 4KRXA 4ZI3A 3A4IA 1UUFA 3NW9A 4OF4A 1YRBA 3P0EA 2AEEA 2F64A 2AI1A 4W1SA 2VF2A 4XFKA 3R3XA 3UK1A 1JAYA 1EFPA 1XL1A 5HZHA 5IFKA 1F7UA 4C05A 4IGEA 1GPH1 2DJIA 2XUAA 1HE4A 4JD5A 2DLCX 4HN4B 1SCKA 1DQNA 1JFRA 4WADA 3SGLA 1UDCA 1XLTA 1CQXA 3LG2A 1AZSC 4ND6A 4KZKA 3E3MA 1QVVA 1MMFB 1QC5B 1NU8A 1OKKA 3M1AA 1FB5A 2GCPA 4I19A 1XQ1A 1RLIA 2WOJA 4HGRA 4JNCA 4PC6A 4F1JA 2Z3WA 4KG7A 3GJTA 1FQOA 2PXXA 3B51X 4FMPA 2ZB7A 3L6DA 2PSFA 4M1QA 5JR3A 4EHBA 4YI5A 5FO0A 4KXVA 1D8TA 3WR5A 1PLLA 4D9NA 3A7EA 3R9IA 2HCBA 3GYBA 2QRHA 1JB1A 1YZTA 3BBLA 3D7LA 2WZCA 1R18A 1WHSB 1SOAA 3ZX4A 3S1SA 3V4FA 2P78A 1OXVA 3VR4D 4CV0A 5LKRA 4N6OA 4GZLA 3VTZA 3DMTC 4QG3A 2FG5A 2BDTA 1R4NA 4BNHA 1HT3A 1AS0A 1KAGA 4P2GA 3ZQ4A 4FOLA 3UWSA 4DYVA 3DUWA 3QLEA 1IPHA 4WNCA 3W04A 1FMFA 4RKYA 3O3MB 1ZS9A 3GFVA 1FFXB 3RFXA 4YMLA 3P2YA 3R6TA 1XK7A 3EMDA 4N7BA 1Q91A 3UT6A 4BLQA 3RK1A 1G98A 3ZU4A 2QTTA 2G25A 4HQNA 4IQFA 2H1CA 2LRHA 3BE8A 3CJTA 3CO5A 4FR0A 5HILA 5L3RA 3ZYZA 2N1MA 3PT5A 1PYOA 2P6UA 4TKMA 3WLTA 5TQ0A 2WYHA 5I7SA 3C5CA 3K9BA 4TTAA 3TQTA 3ZXXA 3RBAA 5CFZA 1I33A 1L0BA 4WXEA 3DZBA 5CLFA 5THKA 3KYBA 5TDHA 3ETJA 2YNMC 3CNLA 1A7KA 4GBJA 3CY6A 1SPBS 2QSYA 3WVNA 4G2NA 1SRQA 3BWDD 3ADKA 2XKBA 2XCOA 3H4TA 1ZJJA 3WL3A 1KVTA 3DHNA 3HCFA 2Z1DA 4AMVA 4GPZA 2GM9A 1QPBA 4G4IA 3Q5EA 4HC4A 5H81A 1ADYA 1IHDA 2VA8A 1PZGA 3C8UA 4NULA 4ZJUA 4GI5A 1IMOA 3OE7A 3JQDA 4CIVA 4E70A 3AVQA 2O4CA 2HPAA 1QHEA 3D3WA 3M34A 3VDRA 4GI3A 4B43A 2QYOA 5FPYA 1XTVA 4X3PA 2ZJ4A 1DADA 4Q02A 4WKBA 2J5QA 4XTRA 1RBMA 3E8XA 4TZTA 4A8JB 4HADA 2YH2A 2VJPA 3K1TA 3QENA 5E9JA 2AD1A 2H18A 2R65A 4FDTA 5EIAA 4D7AA 4U63A 5IUNC 2C9CA 1A95A 3VJKA 1XQ6A 4BNKA 3A2MA 5B3AA 1Q6YA 5DB4A 1TMOA 3GFOA 4DLXA 3G1WA 5CHYA 1BHQ1 1R0XA 1U2DA 3HA7A 4G97A 1SOWA 3N5CA 5AVVA 3ZD6A 5CH3A 1B2RA 2BM8A 1SXHA 3TLBA 3W90A 1JXQA 2OZKA 1PJBA 3KUXA 4YRFA 4FFBA 1C8LA 3H8SA 4L85A 4Q5IA 4UE6A 5F2KA 3WLIA 4AUEA 2GQ0A 1LDBA 4ITVA 1G1AA 3W77A 4RTQA 2QUJA 3ZZTA 1ZCFA 4U7FA 5TARA 2OGTA 3K2EA 3A9SA 4PLGA 1JKFA 3TZHA 3I76A 3S2ZA 5C7IO 2CLCX 1O0SA 2ETXA 4UHDA 4AX4A 4OLJA 3LV8A 4D25A 4ZZ2A 4WD3A 4ZI2A 1YBAA 3WAGA 2VDVE 4PY2A 4R8KA 3PJDA 2H5IA 3PHBE 3TR5A 3HKEB 4L5CA 4EQZA 3DNFA 1GY8A 3IXQA 2DXIA 1UEIA 4PNHA 3I01M 2W2PA 3ZNPA 4B83A 4ZANA 3K9QO 4DQXA 4EYOA 4R7GA 5INTA 1Y3AA 2PT5A 2Q2QA 4IOLA 4PGAA 4XVCA 4QM6A 4A6EA 4NATA 4I5IA 3CF4A 3ZC3A 3LY7A 2GFIA 2JGJA 4G26A 3SBOA 1KYYA 5EC8A 1HQCA 1X8LA 2G67A 2WVHA 1W5TA 3U4QA 3ZHUA 1X77A 1J8DA 2Z4SA 2HQ1A 1S9HA 1Z6GA 4FIZA 1G4HA 3H17A 5THXA 1ADCA 3T1HB 3FSGA 3BA1A 2G9NA 5DCWA 3FTFA 3ZIAD 2OUKA 4TL6A 3SBXA 3HADA 3C14C 5AW5A 3NVAA 2I3ZA 1JALA 5CA0A 1M5RA 4KR7A 3PFCA 2G9QA 3KQQA 1O9HA 2QX8A 5B37A 5SZIA 1ZNWA 3TS1A 1C30B 1JNYA 3A1DA 4LDNA 4FDAA 4WCFA 1W4AA 3ZCPA 5JJCA 1DJNA 3LP8A 3WKCA 1L4HA 3BH0A 2HDHA 4YBZA 3T9EA 3N28A 4RW0A 1CW2B 3BC1A 1VJGA 1P61B 3CLUC 2RB5A 1KNQA 1R8YA 1RWPA 2NO0A 5TS2A 3AIMA 4E5UA 3UJ9A 3K70D 1M5TA 4DA8A 1Z22A 4ETIA 3TMKA 1CY2A 3P7MA 4M99A 3DOHA 5BW4A 1U0JA 2Q9BA 2I55A 5IXYA 4MICA 5DPMA 3SZ3A 5CP8A 1OUMA 2O5VA 3AFIA 3DLAA 2IE0A 4RFSB 2H29A 4EFMA 3V8NA 1I2AA 3B89A 3UW3A 2H9YA 3GIDA 5AK0A 1XNHA 2IV7A 721PA 4FCWA 1ZMBA 2RGBA 3ED1A 4UDOA 2BEWA 3IP1A 3BCSA 3KQPA 4OXIA 4CM4A 3TLXA 4INAA 2EC5A 4GSYA 1RYEA 2G36A 2YWDA 3BG5A 3G79A 4Q15A 4Y6PA 3R7AA 4PSKA 1Z2PX 3EEFA 4HDMA 2FPGB 1E1QA 4B47A 4YXWD 5K8JB 2XHEA 4YRIA 1OBHA 1BE6A 1K7SN 4JMPA 2RKBA 3W4KA 1R9NA 3IQXA 2H4ZA 2FPIA 5ULLA 2F17A 5YASA 1GUZA 4E5DA 2H7XA 3GUVA 4HCJA 5HFAA 5EMNA 3DOCA 4OPMA 2J30A 1B93A 4C30A 3MNFA 4LSMA 3ZW9A 5IVPA 3KLPX 1QH0A 3KAQA 4QJIA 2EFCB 3DKRA 5EJAA 1NJFA 2CK3A 1YQTA 4NFLA 3V80A 2Y05A 3VHXA 4EF6A 4CEJB 2DUMA 3CWZA 5G41A 2E6KA 2BN4A 3ORYA 1FFCA 1XN4A 4EO4A 4L3WA 4V0MA 3RBXA 1VL2A 2R1TA 2ZT5A 4JVLA 3Q2OA 5REQA 1MJHA 1RAAA 4UM9D 4NZYA 1KDVA 4HGQA 5KX5F 4JLOA 4R8RA 1XTZA 4TWZA 5DGCA 3M82A 3V4OA 3SE0A 5E6RA 4RIHA 1OYOA 4TXMA 4C6TB 4MZXA 3PDIA 2HY7A 4YLGA 1FP4A 4KZPA 4UHEA 4B32A 4TKVA 1YRQA 3FNBA 1CVRA 2DHDA 4AP9A 2GJKA 4XQCA 5EYPB 3EOAI 3W8NA 4CTJA 4JWTA 3BDVA 4PN7A 4GT1A 2YQZA 1OYYA 5CURA 1MFPA 1R0YA 2QL7A 3GOHA 1T8RA 3PD1A 1X1SA 3B1KA 2GK6A 5KAMA 2ZI9A 4D0SA 2AMJA 3DEZA 4X7PA 1ISSA 3W5SA 4BRZA 5C8YF 2ZRGA 1HF3A 3P20A 1RAHA 1RMTA 2FEKA 2G6BA 3LGXA 2QQ5A 4QASA 4UASA 1I6KA 4HDSB 1X42A 1T9BA 2XJ9A 4QT0A 5TY0A 3ZV5A 1SXIA 2B78A 4GMGA 1IOVA 1K0UA 4CMJA 1VHTA 4EHKA 4UMDA 1ECCA 2GMWA 1ZJ4A 3JWPA 3SZMA 4NYMR 5KB3A 3ZLVA 5LP1A 1WSWA 5LPNA 5AM3A 4YRQA 1RM0A 4DLAA 1JHZA 1D6NA 2NN3C 4C3UA 5KNBA 3U6BA 2BJHA 5KSWB 1T24A 1JZQA 4UUPA 2MMGA 4EPWA 4CT0A 1DAGA 1H6BA 3HG7A 5BR1A 1OPRA 2HJGA 3TIIA 1CK4A 5I9NA 1DFGA 3EE6A 4JK3A 2JGEA 4C0LA 3OP4A 4WESA 4JYBA 2Q5IA 3ST7A 1AKYA 1JHPA 2EQAA 3LLMA 1LWOA 4I7EA 4YO7A 3R3WA 4NF2A 3FDXA 2G76A 4HDKA 4LOJA 3QH4A 3W5IA 1GNRA 4O2AF 4DBLC 2UYCA 1DDOA 2CD9A 2RMKA 2RC5A 3GJ3A 3MILA 2L42A 5FNVA 5I9IA 1JHVA 1IZYA 2VHQA 2I9PA 3HB5X 3OT5A 4L5IA 4MKIA 1E1CB 2GXUA 4W8GA 1LEHA 2HRZA 2RGWA 4FT4A 3TW8A 1MA0A 4R2XA 4D9GA 5FWYA 4TL7A 3L79A 1JFTA 4PXAA 2W4QA 2HXGA 2FK7A 2VT7A 2AYZA 2ZWMA 1UBRS 1A27A 1QHGA 2F1RA 4QUAA 2EP8A 2H1SA 5DGXA 4GI2A 3FETA 2IKSA 1TM5E 2SICE 4RIFA 3SSNA 4ZYTA 4HDRA 3H4MA 3ZCSA 3L5OA 4NCNA 4LHSA 1E64A 2K7FA 3K4QA 3I1FA 5J4VA 1FJGB 1MKYA 4G1UC 2DF8A 2RK4A 1D1PA 4X8OA 2N1BA 1R8QA 3FNEA 1PUXA 4JJKA 4MLPA 5FX2A 4X66B 2C2ZA 4DARA 2MYUA 2WFLB 2R8PA 3KXDA 3V42A 4RTRA 2P75A 5EUQB 5D3MB 3ZH2A 4M76B 2IE8A 3KT6A 4MV3A 2LD4A 1XYYA 4MUFA 4C14A 1KQGA 4P0PB 3H11B 3NRBA 2R1ZA 1HK7A 4ZCLA 1NN1A 1JWBB 1U80A 2LP4Y 4D74A 1ICIA 1V1JA 5ALUA 3GEHA 3OIYA 3BX1A 3ICWA 4ER7A 5E95A 1ZMXA 2O3TA 3I34X 3ZWMA 2QRQA 4CLRA 3FY4A 5HF9A 3P8ZA 3P9YA 4DWJA 1Y6JA 4L57A 3ZHZA 4CCYB 1FMCA 5CD9A 1BZYA 5T7BA 2ZSJA 5EKSA 1D0VA 2XZTA 2XTAA 1R7RA 1RNLA 1Z5OA 4AO6A 1XXHA 3LHFA 5BOSB 1YJAA 2GZ1A 3AIKA 4H7FA 1V41E 2C99A 1RJFA 1DPFA 5ARBA 2BP7B 3C7TA 3ZJTA 3H5VA 1HQKA 3W9UA 1JPNA 1PL6A 1QHXA 2IZZA 3TQIA 1U90A 3ND8A 3WFJA 3HKBA 5ABPA 2W2XA 3TGLA 1SZJG 1QRAA 1XRQA 1U5AA 3F97A 1W5BA 5JD4A 1FYDA 2GWRA 4AZTA 3FGNA 1QV7A 4RCYA 4OYLA 3A1FA 1WUYA 1TMGE 2ZT8A 2WJ4A 1SCDA 3HRHA 4DMGA 4YTEA 4NMLA 4EG1A 4UNQA 1RFGE 2V6BA 2H1RA 3V48A 2DPGA 4WLUA 1FFGA 5BSWA 1HZJA 1L7AA 3HZOA 5IVHA 2FVYA 2WYOA 3LNTA 5HE9A 5LIRA 1ZUIA 4NZPA 4HEHA 2WFAA 1X7WA 2EJWA 4KO3S 5DT9A 1ZI9A 1Z37A 1T8TA 1UWCA 5JISA 1W0JA 3UUEA 1ENYA 4M88A 3ZDQA 1FMJA 4B31A 1O5IA 4EY6A 3EVBA 3L0DA 1P9OA 1WW8A 2GASA 2HXYA 1D04A 4E1BA 2YYZA 4FKZA 3ICEA 5EERA 1I3LA 2X3UA 1E1MA 2AJCA 2XYQA 2QTNA 1EPUA 1U3UA 3PNLA 3KKKA 3LOPA 2GF0A 3D31A 1VM6A 3MC1A 4ARAA 4TLMB 4F4JA 1OI2A 3H9GA 5FKJA 4J0FA 3BSWA 1Y1LA 3O8LA 1E6WA 1JTEA 4MQFB 5L45A 3OQIA 1J99A 5JCJA 4MR7B 2DFDA 2HIHA 1PGOA 1R6UA 3DKPA 2YHBA 4OGGA 4CN9A 4EGAA 3LS2A 1KJ9A 5EJ2A 1YQWA 4BLPA 3LHIA 1U2GA 2B7LA 4AC9A 3FCYA 5KHLB 3VSDA 2Q4EA 4AG5A 1ZW1A 2ZUVA 3IQEA 4QBFA 4U2DA 4RTMA 3FKJA 2Y9PB 1R6TA 4I2NA 3RO7A 1JR3A 1NMQA 1JDJA 2AZDA 3F2VA 4ABYA 2X5KO 2UZ1A 1Z6QA 2AQ8A 3JQCA 4RZXA 3RV4A 4F9GA 1RQLA 1EDEA 1FPMA 3AZPA 4PPFA 2A0FA 3L1HA 4QU5A 3ZK7A 3DP9A 2AX3A 2OC4A 1V4BA 3M2PA 2A84A 3DB2A 3ELBA 1VL5A 2PX3A 4HSEA 4MEBA 5K7SA 3R24A 5LKAA 1E5DA 3BXPA 3THOA 1LA2A 2OBLA 1TZCA 1RAGA 1HEIA 5H3HA 2HUPA 4H60A 1HRDA 1OASA 5BWBA 5ESDA 3N6RA 3T3PB 4N6GA 1L7XA 2F59A 2NYVA 4OQ4A 1OAKA 4W1QA 2H5LA 4I1OA 4U9HS 4JENA 2RARA 5JTTA 4DABA 3Q3GE 4NPAA 1RQ7A 2RONA 1JW9B 2DUNA 2XGSA 5I7RA 3GRPA 1MO5A 3GN2A 4UULA 3AOEC 1ODSA 4DDKA 1O97D 4PLYA 4XEHA 4ARBA 3UGJA 3I6ZA 4RK0A 3R7BA 2GXQA 4Y6OA 3JTEA 1L1FA 4BNVA 1XQ9A 5EIBC 1UM9A 5KDLA 2KPOA 1U8ZA 3DYIA 3VC2A 3VO8A 2PSHA 4EX6A 2WC1A 4MV0A 4R71A 1VPDA 2A35A 2QLFA 2UUOA 3AESB 5EIFA 3SYMA 1UKZA 3MWGA 1ULTA 3L7LA 4JC4A 1DMSA 4NAUA 2ECOA 3AX6A 3QOFA 4MMZB 5ADHA 5FBKA 1MD9A 1UXOA 3FMVA 3KBOA 2QT1A 4Z4QA 2D5CA 4K0KB 4COOA 4TMYA 4OJNA 1NYTA 3QVKA 2YWXA 5JZ9A 3OEHD 1J42A 1M1YB 1MH1A 3IBSA 4JBGA 1L4EA 1RKUA 1T9AA 4U9UA 3LF1A 2W2LA 4KH1A 1FSGA 1SXJE 1XZQA 1XZPA 2P2ZA 2C4VA 4PYJA 3UHJA 4M0DA 2QSZA 5ALSA 1YE8A 2IEAA 4ZHQF 1V9CA 2J9RA 2G17A 5KMGB 2QMEA 1JT2A 3BXHA 3C6QA 1MJGM 2AOUA 2JEOA 2J5KA 3B7WA 4IH1A 4U7PB 1UXGA 4IIJB 3QFFA 4JBNA 5FULA 4UEOA 2CF5A 2PD6A 2CUTA 1QF7A 1Q1NA 2QRJA 4JLBA 3GIWA 3O93A 1AHIA 3KT3A 1VYUA 2VK1A 2YRWA 3B12A 4L2IB 4K6MA 1FU4A 3DB1A 4PZAA 3EK2A 2Q4TA 4RDXA 2GA8A 4HXGA 1KVRA 1HNWB 4LFAB 3A4MA 3KTFA 1HYGA 2H31A 4A8HA 1K7CA 4J4TA 1ULSA 4DIMA 1VL8A 1KI9A 2P69A 4G5RA 1YA8A 3L6UA 4YALA 3IEKA 2FEMA 1NMXA 2GLXA 1WZEA 4PR0A 1QC5A 1E2QA 2C94A 2QVLA 3LQ4A 4EJFA 2WTUA 1W36C 3AY6A 3SE7A 3OO1A 4IO0A 1QGDA 4I81A 1ODFA 3DO5A 4FOPA 3KEQA 3QQPA 1JQLB 1X9GA 3U09A 3BXGA 2X6QA 2RHMA 2BGUA 3I72A 4OSEA 3RYIA 3M9XA 3C3MA 2HYIC 3DSRA 1V43A 5T8KC 2JFQA 4PGGA 1KDZA 4ZOEA 3FB1A 4HLUA 4JI2B 1NVMB 2WE8A 2WTMA 3LY5A 3D0QA 2AG0A 3ACBA 3F6BX 1CFJA 5TQJA 3A3PA 5FAKA 2OAEA 2W90A 1E5QA 4YHBA 2J0QA 4RVFA 2AZ4A 1S2NA 4AYTA 2WWVD 3DFUA 4GLFA 4QQKA 3RR2A 1T26A 1Q1BA 1WBBA 4IRXA 2DUWA 1C9EA 4LOLA 1UBFA 1PJAA 5E0OA 1FFXA 2JJ2A 4XAQA 3RE1A 2HNAA 3LQ1A 4ARIA 2PS0A 2IH5A 2X0DA 3HDQA 5NLLA 4EO9A 2WU0A 3P71T 4AJLA 2Q49A 1GL9B 1GTMA 5I7FA 2PUDA 3ISTA 1KMHA 1KU0A 3D6MA 4MI1A 5DE3A 3E1GA 2JH9A 3REQB 3EMBA 3T06B 2H6EA 3ECSA 4X54A 1OH8A 5LDGA 1GG5A 2UXCB 4QNRA 3F98A 3LKVA 1F0YA 4BE4A 4OJMX 3VGJA 4XB6B 1C3EA 5KKCA 4RKQA 1G18A 1LC3A 1NW3A 4EW3A 2YMMA 4GWKA 1AKMA 1L8OA 1U3CA 2QTWB 3PTAA 5F51A 2VNKA 2WTAA 1J5XA 4XD7D 3DL7A 3CJQA 1MNAA 1T5LA 4BTEA 1BIFA 3QJYA 5KNDH 1L5KA 4EKNB 1SVLA 1RRGA 3LKDA 1ORWA 4IMIB 1FVOA 1KKLA 3TIFA 5LR6A 1FRVA 2KLBA 3SZLA 3UJBA 2JI4A 3HCWA 3G9UA 3WSTA 1TUEA 3DMDA 1G0OA 4MA4A 3SYNA 3M0EA 3R3UA 3YASA 3FNRA 2EJTA 5AXAA 1RADA 1YZVA 4DYDA 2X2OA 4MVJP 4A10A 2QVXX 1BVYF 1MF7A 3AJEA 3L77A 2ZYSA 2P6NA 5TEVA 1NVGA 4V3BA 5FUVA 4B8YA 3WZMA 2KHZA 4BWVA 4XWOA 1NN0A 5HA5A 3THXB 4YV7A 2QM0A 4P7JA 1PYDA 3BREA 4Y2HA 3N0TA 1NY5A 1GU1A 3H86A 3WI7A 3QNUA 4BKMA 2I34A 1DWPA 4O4HF 3ECAA 3HCEA 2HUNA 1U8CB 1M1NA 2QORA 4PGHA 3ZCRA 1E9RA 3L8YA 2FSPA 2H9AA 3K15A 3TSWA 2AF3C 3DEJA 4Y2JA 2F8LA 4RGVA 4GGOA 5EE3A 5ILQA 3STHA 4E07A 4QGAA 3QU2A 4MEJA 2AB0A 4ALNA 4UCFA 5LQKA 2O2EA 1JUDA 2QPOA 1GA6A 5KJ6A 1MO3A 4Q1CA 2H1OA 1ZK4A 3S4YA 3VV3A 4NCXA 1XTTA 1ZCZA 3FCXA 1ZU4A 4INOA 4NFSA 2AQKA 3KQKA 1JKJB 1LLQA 4P3OA 4B3TB 4UBMA 1MOSA 2WKWA 2XYVA 1KMCA 1F9AA 3EOBI 4RZSA 3JQ6A 3M89A 1CT9A 1NI3A 1S2OA 5F4BA 2CXRA 2O6HA 4F6RB 1JWLA 3GFFA 3F3MA 3QVXA 1G2IA 3ZIDA 4C6SA 5LMNB 3EBLA 2ZS9A 1VHQA 2FFHA 3U7HB 3LE8A 3UJ8A 4L08A 3E0XA 3AM4A 4KJZA 4BO2A 4KR3A 4GZ6A 4DCJA 1DRJA 2VHWA 1SBYA 1QMPA 4J9VA 4QPNA 1CETA 2FEAA 1Z82A 3AR2A 3O73A 3DZDA 3R0ZA 5KYVA 1PR1A 5A4MS 1L7EA 1NMSA 2P2NA 3Q7PA 4ZVTA 1LPPA 1SQ5A 1BHSA 4PCAA 5HGXA 4FK8A 4JR0A 4GKJB 5JJKA 1E99A 2PRIA 2QUKA 4OH7A 1THMA 1UP4A 3K05A 1XIVA 3RC2A 3U31A 3SCZA 1EK2A 3LLUA 1DOHA 1X38A 4ENSA 2KM1A 1EZ4A 4ZV4A 2BKLA 5CLJA 1OI4A 1XVTA 3HN6A 3ZDYB 1P7WA 3ZHQA 4DRXA 1MXHA 3PQEA 4L28A 1L4GA 2O5CA 3VPAA 2PAFA 3RC3A 4WK0B 2KLHA 3H1EA 4GP9A 5DZSA 3C6BA 2X6RA 5BSUA 1E9DA 5AW3A 4D4IA 1SN7A 3R6LA 3QG1A 2ANBA 3S6JA 4FMBB 1QVAA 5IK2A 1W36B 2JLQA 2QN7A 3ELDA 4RHEA 4D2IA 5HRUA 2O1WA 2YXBA 1JEOA 1C30A 4JR2A 1DZIA 1XTUA 3AI1A 4U2FA 3PQDA 2CE2X 4LDJA 3RS8A 4BKUA 1V8OA 2M98A 3K5WA 3L7AA 2D3WA 3OA0A 4CMEC 5FADA 5BW8A 5JPDA 3PQCA 2CKDA 1Z2NX 4XEUA 1A72A 2FKNA 2SCUB 4JI5B 3H6HA 4O4IB 1SXPA 2UYHA 1Y37A 3ETDA 4WZ6A 4PFQA 2JBAB 2IZOA 1X94A 3ZGYA 3V5NA 1DMRA 4OAPA 4G4JA 3R3JA 2IEZA 3I9JA 3QYFA 2OILA 4E22A 3GLHA 2IS4A 4K8RB 1A5ZA 2AWNA 2IDJA 1IU9A 1EVKA 1G7SA 1GVHA 2EEPA 1S89A 2RB4A 2X77A 1QOPB 2ZYUX 1TF5A 3ICOA 3NYIA 4BFWA 4JLSA 4PFJA 4F91B 2VEDA 4S2UA 4KX3A 1YQEA 1EX7A 3RT7A 5BV0A 2JGKA 3NC0C 3CX7A 2QJWA 4GX0A 4M7PA 3NC1C 4ZAWA 3PPWA 1A50B 4HGOA 1OX6A 2YMLA 4LXTA 4MYDA 4WT7A 3WGTA 1Z5UA 4ZO8A 1JIIA 4KUEA 3F0TA 4KMMA 4L1KA 1EAMA 3R9KA 2AK3A 3EF0A 3R6GA 4S04A 2ZUFA 4IDAA 5TVGA 3FRHA 3K0AB 2J08A 5MGNA 2LIVA 5JMOA 3QEOA 1DE0A 4EJSC 4OXYA 2MYTA 4TX1A 3FMPB 1VYVA 3DONA 3NBUA 1JDSA 3AL2A 4PX3A 2BI4A 1RJDA 4TYWA 1WTAA 2IU0A 3M49A 1KJNA 2Q45A 2QW8A 4RL6A 3ZK9A 4UQOA 5DHPA 2DH5A 2VCHA 4LK2A 4MI6A 3UMGA 2GEKA 3PJGA 3ZWNA 1KI7A 1MAUA 1P1BA 2XDQB 4I08A 4PQFA 3FPCA 1YIDA 2QXYA 1VI5A 3T5GA 3LRXA 4AUMA 5IW8A 4XYBA 3NAMA 1PJRA 1P8JA 4OM8A 2Y92A 1XRRA 4X1YA 2EKQA 2Q7XA 4C6TA 1QKKA 1SKUA 2XNSA 2G80A 2VSNA 5C80A 1L8QA 1KMIY 3ACDA 3M7IA 2GS9A 1LW6E 5EYPA 5IAGA 2YL2A 5HUQA 2P2SA 2WNIA 2WPDA 2EOAA 2Q4RA 3FUTA 2O14A 3IJRA 1KI4A 3OQVA 2RHBA 4TVOA 3VR5H 5I8WA 4NXNB 3LBHA 3JSXA 4HNUA 4MGEA 4QRDA 2PR2A 1NNSA 3GGJA 2XWPA 1TM3E 3HDJA 3FTEA 2EGGA 1Z17A 1X1AA 1DJQA 1ORRA 1GLGA 2FEXA 3ANXA 3NATA 4GEKA 4U7HA 3KKPA 4O25A 5J2TF 2DP4E 3O8DA 1AV6A 5B3LA 1U63A 1AH2A 2DB3A 1LTHR 4IIUA 1DAKA 4J16A 4OI1A 2VSOA 1GKLA 2AXPA 2YN4A 4WN9A 5J4KA 1WL8A 3O4IA 2V58A 1ESNA 2ZRDA 3AI3A 5DHAA 5B1DA 3U49A 4M9SA 1JJAA 2PUBA 4DCNA 4WLFA 1AO0A 2COUA 4MP3A 4IM7A 4FW9A 1NZFA 2I3GA 2VUHB 1JA0A 5DX1A 4EOGA 1ZR2A 1PJLA 1PG5A 4OHFA 2AFIE 2WAMA 3FFTA 4KK3A 1ODKA 4RZUA 5IPFA 1ENOA 1BYUA 4QRHA 5KHAA 1BWPA 1PK7A 1GP2A 1Y8RA 1V3TA 3NHZA 4KN9S 3WAKA 4DQDA 2ZI6A 3EF3A 4BFLA 4C4YA 2ZVJA 5KYNA 1EK0A 2DQ4A 4NS4A 1ZIDA 2A1TR 3KD3A 1JHYA 2AUMA 1PTKA 1I7PA 2RHLA 4GO1A 3ZDDA 3E18A 2ZITA 4WLEA 3TI7A 3UNXA 4D0NA 4DV1B 4KE7A 4CF7A 2QVBA 1FDRA 1UMCA 3BB4A 5CA1F 2ZCVA 2H7CA 1DAPA 1TMKA 2RK3A 3Q4GA 3RF7A 5L3QB 3RIMA 2APJA 3LDGA 3FWZA 2A94A 3I9NA 4JLUA 4KQ9A 5BSVA 4TLCA 3RM3A 4Z0HO 1E1CA 1QHNA 4W6QA 2FFAA 1UBNA 5I8ZA 4WKCA 1JJIA 2CB9A 2E89A 3CR7A 3SICE 4BUJA 5IDWA 3LCMA 1WCIB 1T29A 1E3EA 3DUFB 5FH9A 4L7VA 3LW7A 2ICAA 2IA5A 4K7JA 1X9IA 4NJMB 4ENTA 3LNCA 3MJSA 4YCJA 1W6RA 1TYCA 1QX3A 4UTNA 1E3JA 4MIYA 4NBSA 3U3XA 3QQ5A 5AM2A 5ALHA 5T3YA 4KPYA 2ZJ5A 1KDOA 2C57A 1IFXA 2C42A 1RLOA 4YRPA 2ONYA 5EXXA 5CB4B 1E79D 2CZCA 2OG1A 1W2HA 3QKRB 4R8MA 1K75A 4KUHA 1Z2CA 2R11A 2FW6A 2WFLA 2YIDA 2AG8A 4LBVA 2VHZA 3FYSA 3FUWA 4JT4A 1UC9A 1HDRA 3M8KA 3MXTA 4MB6A 1S3SA 5BYBA 3H05A 1XAGA 2C82A 3H11A 3KZXA 1XMSA 3OAAD 3N2NA 3P4YA 3USCS 5BWMA 3P52A 1THGA 1DBWA 2JZOA 4F4HA 1JFFA 3NHBA 5HKKD 2WJZB 3K53A 5FAXA 4D4MA 3SM3A 5CDSA 2C5EA 1NQAO 4BRSA 3GMIA 1RXUA 4KI7A 3UTCA 4PZCA 4BLTA 1Z5ZA 1NX9A 2C88A 4MUHA 3VPXA 4OI0A 2DE0X 1B76A 1GGKA 2VVTA 4O5AA 2JKZA 3CHYA 3GGOA 1XALA 7MDHA 5JEEA 3CUTA 1Q1QA 2OCXA 5EJ5A 2JIRA 4YXFA 1FLAA 1PNQA 5BOSA 1YQUA 3OF3A 2WUEA 1OGJA 3FCEA 3NH6A 3ZI0A 1PKEA 1R8XA 2H8GA 3L41A 1CZLA 2WMYA 5AM4A 3KV1A 3PDUA 3UT5A 4EJSB 2GCNA 1SVIA 2GNAA 4CMBA 1PG0A 2QAJA 2YVUA 3UXYA 4NBLA 1E7WA 3AM5A 3VDMA 4YMHA 5C46F 4KTVE 4OYRA 3KWLA 1E9AA 4DHEA 3GOQA 5EKTA 1DQRA 4DILA 2BGKA 2BFMA 2HCJB 3MMPA 4IJ6A 1LU9A 5D5HA 1X1TA 4FFMA 4ML3A 2NAFA 4HZUB 1HDCA 4J0IA 4AZ3B 4CQMA 2C7PA 4L22A 4L8GA 1UKCA 1YRHA 1WR8A 3W7AA 3F5MA 4BVJA 1JKMA 4Y0NA 3IESA 4HH4A 1EG7A 3ZHVA 2X7JA 1UC4B 2FSHA 2A9FA 2YINC 4XUCA 4JJFA 4NJOA 4TMXA 1UDWA 3RVRA 2Y0CA 2XOXA 2MU1A 3PPYA 1W9HA 1CS4C 1T2CA 1Z0IA 2BBSA 2OENG 5T4BA 1BYIA 4LGYA 4ZWNA 3S1AB 3ESQA 3H3FA 4Z1OA 4LPKA 5IT0A 2FPOA 2R5FA 3N75A 4RLQA 2Y1LA 3T1NA 4JVSB 4CODB 2IHJA 2PT9A 1KJZA 5CA0F 4UJ3A 3K32A 4DR2B 4BQNA 4UNNA 3CRW1 2PY6A 2CL5A 5JD6A 3L8CA 4DJ5X 1G64A 4MQFA 2W6IA 1QP8A 3B1ZA 4M83A 3RSQA 1YA6A 1REQB 1EXWA 1EI9A 4MR7A 5JNWA 4WXPA 4PFKA 4MR8B 1T3HA 4Y1RB 2GI4A 5LJIA 3WDLA 4ZXPA 1J20A 3OMWA 3VX3A 1ZSVA 3WOVA 4AF7A 1BXKA 4MWTA 4C20A 3GFBA 4AS3A 4DCGA 2QD5A 4PSUA 4EA9A 4EMTA 3V4RA 1QHHA 4TTJA 4ZVPA 3SLRA 4JLKA 5ALWA 4H7DA 4BFUA 3ZVMA 4DR5B 4IIHA 4C89A 3B38A 1L5WA 1VHWA 3HL0A 4XIGS 4DQVA 3CX8A 2BSAA 1P29A 2O20A 3QE4A 2G1JA 1NN3A 1RKXA 1XYVA 3I2KA 1ACLA 3QYAA 1T0UA 3WK9A 2HLDD 1DKRA 6AT1A 6YASA 5HKBA 5JUWA 2OORA 5GAJA 4V1CB 3THYB 1HEUA 4MUBA 3ZTTA 2CVOA 5JAIA 4LE2A 4BAUA 1NDUA 2RGAA 5FI3A 2VXCA 2FW9A 1XXLA 3PNMA 4W6ZA 4AJIA 2OCLA 2CVPA 3FCOA 2NWQA 1T9GR 2QTBA 2W8BB 1B14A 3MWDB 4XLTA 3ZD7A 1NW6A 1A5TA 2H11A 3GK3A 1CZNA 3QW2A 3R4CA 3D2LA 1W2GA 1HA3A 2PL1A 1V6SA 4NMMA 4GXNA 1R12A 1VE6A 2IZ0A 3L02A 1PL7A 2FXVA 2ZJ0A 4G0OA 3VVLA 4YRGA 5JXGA 5L40A 4TLLB 3O8OB 3HC7A 1Q7RA 4KL8S 3AUJB 4EKYA 4F7WA 4GVPA 2OD7A 4Q48A 3WWDA 3T7DA 1GITA 3ABZA 1YZKA 2XLBA 3SS9X 5JCZA 3AESA 1X7YB 1BROA 2HK6A 3R5FA 1P1IA 3FLBA 3N8KA 1DJPA 1KDPA 2AOWA 2HHAA 2BDUA 2IFTA 3HUTA 1SB8A 1G20B 4LY3A 4LTMA 2CJPA 5T64A 4EY4A 5B3JC 3K9WA 4TYYA 4AQDA 1RYHA 3HE3A 2IDZA 2BKVA 4KYUA 1Q7GA 1E96A 2IW1A 2QLMA 3BS4A 3CRRA 1ZIYA 4K2HA 2EVWX 4A8PA 5EGNA 1SFRA 2Y93A 3DTYA 3KQSA 3N2LA 3JQ8B 1NVKA 4LJSA 2OQVA 3H2HA 1H2ZA 2O3UA 2XRYA 1G3UA 3DWEX 3HUDA 1U3WA 3JAWB 5C18A 4H18A 8LDHA 4IQ0A 1E0AA 2HLPA 4FFLA 5DGIA 1WETA 3R5HA 1M0TA 2G88A 4E4YA 2QTAA 2OHHA 3F96A 3RVOA 2OHVA 4BKRA 4YN3A 5CJ2A 2CJWB 4RXTA 2XZOA 3C74A 3K0SA 3C7DB 1HOTA 3N70A 3CF6R 3KJHA 2WMDA 4X97A 2CLOB 3SHQA 2ZSDA 4AKEA 3NT2A 3KQNA 4KRYA 3T3MB 1G5IA 1FTQA 4CFYA 3T52A 4DTIA 3D3EA 3TG2A 4U2EA 3IBTA 1GRQA 1JNXX 5EKDA 3DHYA 4MUNA 3QX9A 3WYBA 3B1XA 3A28A 4IIJA 1VKJA 3RF6A 1G6HA 2LVBA 2D2IA 3FN4A 5ALRA 4R51A 1QORA 4F21A 5JNUA 4XX0B 2QHXA 3JQFA 1I2DA 1NKSA 3MMXA 1WX1A 1XZMA 1IULA 2VJMB 3DWIA 4L2IA 3H8VA 4S0XA 3RU7A 2W2OA 1KH2A 4DZZA 4RPCA 1YJQA 1UWKA 2X9NA 4Q3BA 4H4CA 3O38A 4IWNA 4OQMA 5LXTB 3RAEC 1TQ6A 3E05A 1VPLA 5L3ZA 2G08A 4B3JA 1U4NA 3ME5A 1XQWA 5G0UA 1EQ2A 3B3QA 1L4FA 4ZVLA 4CJXA 1BG6A 1IRIA 4TUYB 3VPGA 2G1KA 4OQEA 4E21A 4NXMB 1LDYA 5C1OA 3D8BA 1HKHA 3AUXA 3K6SB 3UAWA 4FWBA 4RVGA 4M60A 3BJRA 4FMCB 5D6OA 4I8IA 5AK5A 4C2AA 3GFTA 1O0CA 1NM5A 4JQSA 2DT5A 4ND8B 4FB4A 4CDMA 3E7XA 4LCBA 4BJ6A 1BJTA 5A7FA 5FNVF 3UIEA 2L18A 4Q7LA 3JQ7B 1QO0D 3WQBA 3N76A 4DLLA 1T1GA 1LNSA 2RHCA 3IILA 1Q12A 4GPIB 3I52A 3M4XA 4RHFA 4A0RA 4E2ZA 5GV8A 1RZRD 4NCIA 3F9IA 2FZ5A 3MTIA 2YV3A 2CDCA 1KP2A 2P2DA 3WLFA 3MHTA 1GCUA 3ZK8A 1G5TA 5C1PA 5HVNA 3LBNA 4H0FA 4R8VA 4UCXA 4G09A 2REQB 4YREA 3LXXA 2I6UA 1U81A 4DXDA 1LDNA 4CI9A 1KO8A 4NY1A 1QLWA 5B53A 5DHFA 3VI3B 2V0CA 3ZU6A 2JD1A 3CEPB 3F3SA 3LVRE 2P90A 4L51A 5C8DA 5JH7B 4UAVA 1C29B 3KTDA 3EA4A 3TD6A 1RABA 3G5TA 3ZWWA 1YONA 2VDUE 3BJZA 1T9DA 2PUWA 4K88A 3RG2A 2QAGC 5DXAA 1TTTA 1AKVA 1TRHA 4S1TA 5F5LA 5JJLA 4CKCB 3HU1A 4JXKA 1IVSA 1T1EA 4QQNA 3RFUA 5AVWA 4XUGB 4E1VA 1VRCA 3PYXA 1OKKD 1Q44A 5HQJA 3PR3A 2R5NA 2J85A 3OFJA 4RF4A 4J1TC 4KO8A 3WLQA 3U7IA 1EWRA 1OF1A 2X0KA 1YACA 1YMUA 3NDIA 4EG4A 4N5DA 1WEHA 3VZBA 2MIIA 1MABB 2FSFA 1W0CA 3CN9A 3KE9A 4UNIA 1AUQA 5BV8A 3LCJA 1P7VA 2D1YA 3I5MA 2FRDC 1Z5NA 3OZRA 4K81B 4C4XA 2CLIB 1KC1A 4KQXA 5G4KB 1P6XA 1DPGA 5JC8A 4Y1FA 5HKLA 1Q0RA 1D09A 2XBUA 4YJHB 3LD9A 3THXA 3EXHB 2X40A 3RHSA 2IHZA 1MT3A 2ZVDA 2I80A 7YASA 5I4IA 5ALDA 1N5RA 1GN9A 2J7PA 2GPJA 5F9MA 2GK4A 4DQLA 1BDIA 4GYJA 3TR0A 3IDZA 3SC3A 1CP3A 4FI3C 1G1MA 2J0VA 3WOHA 4EUFA 2Y1CA 4KMOA 2EG5A 5EVJA 1NT4A 2WR8A 4D3XA 1UF9A 3FDZB 2I1LA 1MX9A 2B8WA 3NEPX 3Q2IA 1GPKA 1P7YA 4DBZA 4ZGBA 2TYSB 4OYHA 3TECE 4JS0A 4FWTA 3L3BA 2IYZA 2OCAA 2P6MA 4TZKA 3S2YA 4FBLA 4FJ2A 1U0FA 1I2BA 2IX9A 1K98A 2C2BA 2X13A 3ANSA 5ED0A 5AIBA 1JKJA 1FFAA 3NORA 1Z2OX 2PS9A 2EHDA 4HTFA 4D4GA 4BQSA 1JA1A 3VXKA 4B5KA 3OTOB 3O47A 3CW8X 4F6RA 2ZYDA 1HT2E 4X94A 1Z4IA 4ZDJA 4YWJA 4U8HA 2BOVA 4Q3DA 1GJRA 1ZGHA 4FS8A 4IFIA 3NALA 3PIDA 4QWMA 3CIFA 5E2BA 3QBEA 2ZYVX 5EWJB 1IZ0A 4Z8XA 2ZBQA 3OE7D 4Q1DA 5JS8A 5J23A 1M34B 1W4ZA 4WZAB 1LRKA 3OQPA 4FS3A 2YZMA 3WLKX 5EXEA 5L6MB 1C4KA 3TCNA 1G42A 1OFVA 2OHFA 3NBMA 4Q37A 3WYNA 1UEXC 2DR2A 3GZNA 2EWWA 3NX4A 4FGWA 3RS4A 3FBWA 2PN1A 4RZIA 3KLOA 3QX8A 3JZMA 3H18A 1Z3CA 3G8AA 3LK6A 4LJ6A 5JVDB 1SCUB 3I1YA 3EPJA 5ERGB 1M75A 1IIRA 4GIBA 1WSBA 3O4JA 1DFIA 4FYHA 3A1TA 3G0OA 2RH9B 4P86A 4PVDA 3MJCA 5C8XA 2V3CC 3QEJA 1M6YA 1YZUA 3OLXA 621PA 3DAFA 4HB3A 1YO6A 5JMPA 4G36A 4ZC8A 2HM7A 1BWQA 1ZU5A 2BUAA 2F9MA 2MCFA 3WJ2A 3UC5A 3WFZA 4ENVA 5FBZA 1BMTA 3DZ8A 1K5DA 2WT9A 4WGFA 1MOPA 3G7NA 5CLQA 4R41A 2GJ4A 4L78A 1FLVA 1L1QA 3GI1A 4PQYA 4P3PA 5T8KA 4PG8A 2XV1A 4KPUB 4Q16A 4Q9NA 1GA1A 1UJNA 2GESA 2SCUA 1N2ZA 2C2GA 3BGSA 4O4IA 4YJ3B 1QTNA 5EMJA 5JSHA 1AURA 16PKA 2JBAA 4M49A 4UREA 1CZRA 1EXNA 3LT1A 5L9AA 2DH6A 1TOAA 2XA9A 3INGA 3FPJA 3B3JA 3Q6NA 4D3DA 3QXHA 1ZESA 3UJNA 3CBGA 3ZLUA 1VMIA 2YVAA 1WKCA 1BQ3A 4EG3A 1D5CA 1PFQA 1JG4A 3NAZA 3GG9A 4GE0A 4BAGA 1QCZA 2G7MC 5JY1A 1CIVA 5KOJA 3MMSA 1R0RE 2J3LA 3DLBA 3WO1A 3JV7A 2GN4A 1T3LA 3W3AH 3VMMA 3LPNA 3PCTA 1Y3HA 1JSLA 3UAXA 3ZD9A 1SVUA 4Z9BA 5EQTA 1MHTA 1U1EA 1H9CA 3AR6A 2ZRIA 1Q7CA 4E5NA 3BIWA 2YBEA 1KC3A 4G6ZA 4TOIA 2C3UA 4KPFC 3ZZ0A 3P5BA 2HSDA 4E11A 3FSGD 5AI6A 3VDXA 5IZCC 1YE5A 3HDYA 4KQFA 4LQLA 4RVUA 3ZZMA 4B73A 1OJLA 5ED4A 1TQ8A 1U11A 2LDBA 3HWSA 4Y9RA 1R37A 1TM2A 3F67A 3WMRA 3GLKA 4Y7DA 3IOMA 3Q9SA 2X76A 5B1EA 1F38A 1HDIA 2CGEA 4JDPA 1IAQA 3D6FA 3QLTA 1SUCA 5GOTA 3T4XA 3O2QB 1BVUA 1TPZA 2Q5LA 2YMPA 5KWJA 1TF2A 3GLFA 2P5YA 3M6XA 4XIFA 3C15C 5IUKC 5C9ZA 3M1IA 3NHFA 2XDQA 2YY7A 4PRZA 3R5XA 3EGEA 1Z8NA 3K2IA 4YRJA 4IUYA 2UXBB 2BTEA 3T1VA 3LECA 4TYPA 4Q1VA 2Q0QA 4LF8B 3ZXSA 5L4SA 1EUDB 3VNBA 5K8LA 2G71A 2Q27A 1X15A 1AC5A 4KXXA 4PC3A 2RGRA 4J2OA 1NBIA 1J7JA 1WMFA 1G8HA 4RYLA 1SXJA 2LGJA 4HNHA 3JVVA 5FPTA 3RLIA 2F8MA 4YR7A 3RROA 3H5IA 1MQ9A 2IEGA 4JX9A 2J3EA 3QUBA 2PMDA 1JIKA 2Q6TA 5CYOA 4A26A 4P0TA 4BV2A 5D87A 4FXOA 1SZCA 2XRFA 4EITA 3P4XA 3PPXA 5FLYA 9LDBA 1XYGA 3D2CA 3AKEA 2R8YA 2XXAB 1PWZA 4G9BA 3OX4A 1GYPA 4A16A 4FE4A 1E1QD 3SEZA 3SKYA 4UHCA 2ZJ2A 3EULA 3K70C 1YU6A 4ND2A 3HEAA 3COYA 4RAQA 1VZ3A 1PFWA 2Z43A 1PO7A 2CVZA 1RCFA 4M7RA 1GCGA 2RHHA 1VHJA 4II3A 3F90A 4BNMA 5ALFA 3KEMA 1CU1A 3PP8A 4NESA 3N3BC 4FMDB 1ODJA 4JT9A 4HH0A 1Z25A 3RSLA 4IHQA 2I2FA 2CK3D 1GQYA 4RPHA 2OCDA 2W6PA 1E94E 3EUWA 3L0IB 5ALZA 4S3MA 2NV0A 5KS2A 3RS0A 4RTLA 4J1QA 3CLTD 4JITA 5FEMA 3BMOB 1MN6A 1Y9DA 2NT3A 1RP1A 5IDQA 5U9CA 5GTDA 1OH6A 2NTNA 3K96A 4QFDA 1T91A 2TMDA 3GO4A 3V7WA 1OYVA 2LIPA 4W9MC 5HCUA 3MLEA 4YC7A 3NKVA 5KSYA 1AIPA 1T0BA 4PHHA 2OXRA 3AVOA 4Q9DA 1KOLA 1H2WA 2AZMA 5E7JA 1GM5A 2ZIGA 4GU5A 1RPZA 3UICA 3UMCA 1LNZA 5I4KA 1Y3BE 1YKSA 2G6TA