2QTTA

Crystal structure of arabidopsis thaliana 5'-methylthioadenosine nucleosidase in complex with formycin a
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
248
structure length
248
Chain Sequence
SEILRPISSVVFVIAMQAEALPLVNKFGLSETTDSPLGKGLPWVLYHGVHKDLRINVVCPGRDAALGIDSVGTVPASLITFASIQALKPDIIINAGTCGGFKVKGANIGDVFLVSDVVFHDRRIPIPMFDLYGVGLRQAFSTPNLLKELNLKIGRLSTGDSLDMSTQDETLIIANDATLKDMEGAAVAYVADLLKIPVVFLKAVTDLVDGDKPTAEEFLQNLTVVTAALEGTATKVINFINGRNLSDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 5'-methylthioadenosine nucleosidase
publication title Molecular determinants of substrate specificity in plant 5'-methylthioadenosine nucleosidases.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 80
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature ec 3.2.2.9: Adenosylhomocysteine nucleosidase.
pdb deposition date 2007-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qttA00
1A9PA 1ZOSA 1RXCA 5EFOA 4DA6A 1Y6RA 2QPLA 3MB8A 4EB8A 3FOWA 4L0MA 3GB9A 4P54A 2AI1A 1RCTE 4TXJA 4BMXA 1PR2A 4LNHA 4D8YA 5JPCA 4RJ2A 4WKBA 1YRYE 3IOMA 4WKPA 4DABA 3PNSA 4DAOA 2HRDA 1LV8A 4QATA 4EARA 4F2PA 1B8OA 4JWTA 1A9SA 1K27A 1TGYA 3K8OE 1V2HE 2HSWA 1A9TA 3DDOA 1JDTA 1CG6A 5B7PA 5CXQA 1PBNA 1ODLA 2BSXA 1U1CA 3MMSA 3KVVA 1WTAA 3DJFA 1T8WA 4R2WA 4D8VA 1T8RA 5B7GA 1Z39A 1Z5NA 3PNPA 1V48A 1Z5PA 1YBFA 2HN9A 1V45E 3BJEA 4ECEA 2QSUA 1TGVA 4PR3A 4GLJA 1G2OA 2Q7OE 3OOHA 3LA8A 3E0QA 3PHCA 3BSFA 2ISCA 4E1VA 5EPUA 4D9HA 2GUWA 1RXYA 3ODGA 3P0EA 3DF9A 4QASA 4R2XA 1LX7A 1RYZA 4F3CA 1U1EA 2OECA 4IP0A 3D1VA 1CB0A 3KUKA 1JDSA 3OF3A 3KHSA 3PHBE 1Y1RA 2OXFA 3OPVA 2I4TA 1JE1A 1RXSA 2QTTA 1JDZA 3OZEA 5F76A 1K9SA 4L5CA 4G41A 1OU4A 4GMHA 5IU6A 4DA7A 3C74A 1JPVA 3NM5A 1PWYE 4QEZA 1ODIA 4UC0A 3KVRA 1Z38A 4G89A 1PW7A 4OGLA 3DP9A 5F7OA 5C80A 3KU4A 1U1DA 1JE0A 1V4NA 1YQQA 3OZCA 3OCCA 1ODKA 5CXSA 4YMLA 4WKCA 3P0FA 4MCHA 1T8YA 1PF7E 1Y1SA 2XRFA 5F7XA 4TXNA 1OTYA 1K3FA 1PR1A 2IQ5A 3F8WA 1SD2A 1M73E 3NM4A 4NY1A 4MARA 4QFBA 1VFNA 3IEXA 5F77A 1TCUA 3QPBA 3FB1A 1Q1GA 3FUCA 3UAVA 4F1WA 3OZBA 3GGSA 3BL6A 4L6IA 1A69A 3EMVA 5F73A 1NC3A 2ON6A 4BMZA 1N3IA 4TXLA 5IFKA 4NSNA 1A9OA 4L5AA 3ENZA 1OVGA 4WKNA 1Z33A 1Y1TA 1Y6QA 4GLFA 4YNBA 4BMYA 3FAZA 1T0UA 3T94A 1TCVA 3OOEA 4TTAA 5EUBA 1RR6A 4FFSA 4OJTA 4DARA 4YJKA 1NW4A 4QARA 4WKOA 2QTGA 4NS1A 2A0WA 2I8AA 4DA0A 3UAXA 3TL6A 4OF4A 5CYFA 4R31A 4D98A 1RT9A 3UAYA 1Z35A 4TXHA 3UAWA 4TTJA 4LZWA 4LDNA 4M3NA 4L5YA 3O6VA 3FNQA 5CYGA 2P4SA 3LBAA 3O4VA 1JDUA 4GKAA 5F7JA 2A0YA 5B7NA 5CCEA 5F7ZA 4PNPA 4LNAA 4JP5A 1U1FA 1TD1A 1LVUA 3SCZA 5DK6A 2OC9A 1JDVA 1RXUA 4H1TA 4U2KA 5K1ZA 2AI2A 1PR4A 1OTXA 1PR6A 1U1GA 4BN0A 1PK7A 1OUMA 1SQ6A 3OZDA 3UT6A 4DANA 1ULAA 2PGAA 2RJ3A 1B8NA 4OEHA 1YR3A 4OGKA 3EUFA 1RSZA 1Z36A 5I3CA 1SJ9A 4K6OA 3UAZA 2OC4A 1A9QA 4TS3A 1ULBA 2A0XA 2QDKA 1T8SA 1ODJA 1ECPA 3NBQA 1PR0A 3EEIA 1OV6A 3E9ZA 4X24A 4M1EA 1V41E 2AC7A 1VMKA 1JYSA 3INYA 4D8XA 1V3QE 4LKRA 4TTIA 3BGSA 1FXUA 5FAKA 3KVYA 1Z34A 1NC1A 2A8YA 3LGSA 5CCDA 1Z5OA 4DA8A 5B7QA 1ZL2A 2AI3A 4F3KA 4MCIA 3NM6B 5KB3A 1PKEA 4TS9A 2B94A 3U40A 3EUEA 4M7WA 3DPSA 3E9RA 4I2VA 1I80A 4JOSA 4F2WA 1VHWA 1QE5A 4TXMA 1JP7A 3ONVA 1RFGE 5ETJA 5F78A 4TYMA 1C3XA 4G8JA 1A9RA 4OY3A 4KN5A 4DAEA 3K8QA 1XE3A 1YQUA 1VHJA 1PK9A 1PR5A 2HWUA 2H8GA 1Z37A 1SD1A 1Y1QA 4YO8A 3FWPA 4QAQA
chains in the Genus database with same CATH superfamily
3NYQA 1BHSA 3ZBUA 2W2KA 1EKXA 4M88A 1HDEA 2PRJA 3SR4A 1WDLA 2P2GA 2O2HA 3ETNA 5ENZA 1N4AA 3UZUA 5I9NA 1OJ7A 3X1ZA 4B09A 4WDQA 1OLXA 2J32A 3DOIA 3HU3A 3NT5A 3RUCA 3V00A 1N1GA 3L77A 1I94B 3H5WA 2O54A 3HZOA 2C5EA 1RWKA 2ZKIA 2HC9A 4RJJA 4UW9A 3VVMA 1YCFA 3UYLA 5JSHA 1UANA 3BH0A 3TLCA 3VSEA 2AE2A 5TJ9A 2CLHB 2Q6KA 3DONA 1F0PA 2O0MA 2YICA 3GLRA 3R9XA 3HSKA 3TNJA 3KV3O 9ABPA 3HBFA 5G0SA 3IALA 3UM9A 1PFUA 1CJUC 2BGWA 1X1SA 4KGVA 2B0CA 3J7TA 2C3PA 1CR2A 4ZEOA 4YCCA 1YDGA 2DAPA 2GBCA 5JSFA 4KQKA 2XKKA 5JVDA 2G76A 3GZ4A 3U9TA 1AZWA 1G3UA 3DE2X 4CPDA 5CXXA 3E1KA 4INJA 3V4ZA 3JQAA 4OGGA 2C7RA 1R8QA 3IGFA 4WCVA 1MX5A 3CNNA 2GLUA 3EG9B 4NFLA 1IBRA 1S2NA 2GESA 2ALJA 1OZHA 5DTIA 3LOQA 3TLXA 3PDCA 1LPOA 2WM2A 3Q7TA 4BQIA 4F46A 4LDRA 4PAQA 4MB2A 1RZRA 1MDFA 3REFA 3DGFC 1VRVA 2CZQA 2PD3A 3PWKA 2M6KA 3N53A 3G9TA 1W75A 2IPOA 1W36B 5F52A 3B7PA 4YCLA 3KZKA 3AR5A 4MW2A 3DV0A 2HU2A 5HIMA 3ZXYA 1IBSA 3K0CA 4OYHA 2JJ2A 4F4IA 3A6KA 2PRYA 2W00A 1QLJA 1E4VA 4J6FA 5KQLA 4KXQA 5A7FA 2WF7A 3DBRB 3RC8A 3I23A 2N47A 1TQDA 2C7PA 2RGBA 4UOEA 1IOZA 1SBYA 4MQ6A 4XLTA 3NWBA 4URFA 2C42A 1FRVA 4DC1A 1JQAA 4H08A 1C3OA 3DCNA 3DEJA 2JBAB 4R2WA 4D8VA 4JBWA 1SQ5A 5H82A 1WBJB 1G3RA 2JIDA 1QRSA 4FZRA 3D3JA 1NP3A 9LDTA 2AHRA 5DM70 3DMYA 3GA7A 4I4TF 2EBFX 1B73A 2XWJI 1DRKA 1TEHA 1LEHA 1V45E 1QP4A 2JFUA 4MQLA 2ZG6A 3GWGA 4CXMA 5JADA 4LI0A 3NV9A 1TGVA 3I04M 3KJZA 4CMEC 5EKTA 2JLVA 4AS1A 4A26A 1TA4A 3Q6NA 2YV2A 2ZSEA 3IEUA 4A0SA 1P1KA 2GUGA 4RL6A 4C0KA 1Q0LA 4OLJA 2XUHA 3WYEA 2VTBA 3CUEF 3NUQA 3SF8A 2GF9A 2VAPA 2Z5VA 4TTVA 4WOPA 3CINA 4Z0PA 2E5WA 1M2NA 2VDOB 4P86A 1L8LA 3KJHA 3FFTA 4Z7NB 4H17A 4Q9IA 5JT1A 1XRSB 5J2TA 3ODGA 1MW9X 2B2NA 4LFAB 1NI4B 3AEUB 4F9FA 1RAGA 1FLVA 2G07A 4IY1A 3L0YA 3GRKA 4YCNA 2NIPA 4ILEA 1RPAA 2NQ2C 2DSTA 4MUFA 2DPLA 1HE3A 3ST7A 1U65A 3LDAA 5CEFA 2CYAA 4BRZA 1PGOA 3OE7D 3SWWA 4INOA 4TKUA 3RQSA 5M5BA 3P4XA 4L0DA 4D7AA 3E03A 3I6ZA 3L4EA 3MRVA 2QR2A 3OLQA 1QYIA 5E38A 4AU1A 3RU7A 5EUMA 5HKKA 3WLRA 4E2FA 3IUEA 4GHWA 1C4OA 3EIXA 1FFYA 4YDQA 1HEYA 4ERNA 1I6WA 2FPSA 2QMYA 3BAZA 1IBKB 1K7SN 1NBME 5KS2A 4BFLA 1YZUA 2A94A 8ATCA 4EO7A 1WY5A 2CFSA 2JHPA 4PLHA 3AX6A 4WBXC 4UNPA 3GHHA 4EEZA 2A1UA 3WLFA 2FA9A 3AT1A 1U0HC 4IGAA 2FOIA 4S1PA 3L92A 5KCZA 5JU6A 4HGRA 2QRKA 1Y1KE 3CRMA 1ZUWA 3FUVA 1W29A 4MVJD 4OHUA 5E6SB 5F76A 5FUVA 4FE3A 2BKEA 2C98A 3Q3HA 1Z82A 2XA9A 1NR1A 4DCVA 3DEYX 1FF9A 5E4FA 3DFIA 1C5KA 2WG2A 4FZVA 4KBGA 4PZCA 4R1OA 3PEFA 1KZHA 3SHWA 1DOZA 3LDUA 4PQEA 3UB3A 2FVYA 3WL4A 1YOVB 3REGA 3HA3A 5H9VA 4EVQA 4ZYVA 2EKBA 3KT6A 5G3YA 2A3RA 2NMVA 1ZONA 4BVEA 1RXEA 3S2ZA 1R8XA 1K68A 2M9MA 3CR3C 4O2AA 4O0MA 3BSWA 4OSEA 1CIJA 1JR3D 2D1RA 5AIAA 1YIDA 4MWEA 1X7WA 3VNBA 1MR3F 4TTSA 2GM3A 2Z4RA 1AKMA 3T5PA 3L04A 1E6LA 2PO5A 4LVCA 4YMGA 3R4CA 5FBZA 3ZQ4A 2Q7DA 2WJIA 3B9PA 3WA6A 1FJXA 4HUJA 3W5SA 3MTEA 5CFQA 1D8AA 4D0LB 3OQMA 3CJQA 1U5BA 2R60A 1LJ8A 1AT1A 2B21A 1RZ3A 2QRGA 4ON9A 5C80A 1NW5A 2C20A 1TUIA 2D5LA 3QTLA 4M8KA 3ZQ6A 5BUCA 4PG7A 2TYSB 2X2FA 3FVVA 1N9GB 1SXJB 2ZYSA 3VV2A 5H3HA 4KPFC 2HCRA 4OAQA 2IIVA 4RA6B 4EKDA 3R41A 1AZTA 3VNVA 3HY6A 3INNA 4OJQA 2QVYX 4D92A 1HX7A 1N2EA 2XOEA 2Q99A 3PBKA 3QEBZ 3PNVA 1HMPA 5CLLA 3I2KA 3EZ9A 3RUDA 5DTRA 2HQ1A 3MHPA 3AJRA 2O0JA 5HBGA 2C2XA 3OWOA 4NULA 3ZE8A 4OLAA 4UVEA 2HQRA 4HWSA 13PKA 4MGIR 1WD7A 5FO1A 3O8QA 1S0UA 3UT5A 2R1VB 1EM8B 4U0JA 1J97A 1POWA 1Y1SA 5D84A 4KRFA 2WOJA 1RADA 4GMKA 1QANA 3DLCA 3E3AA 4IDNA 4KQWA 3ZVRA 5B4UA 5JC1A 2QUAA 2REXB 3MS4A 3FR7A 5EIHA 2AEJA 4UEJA 2H2GA 4URYR 4E33A 1MO5A 2ZAYA 4JYBA 1GXSA 4QREA 2B69A 2WV9A 4Q01A 3FGPA 2PX5A 1EVJA 4CV0A 1YC5A 2WPDD 4JSRA 2ZVJA 4OHVA 1E2BA 3LQ4A 4OQFA 5DBGA 5K51A 4DE5A 5JAUA 3P9CA 1N5OX 1ESEA 5F77A 2E4UA 4ZVLA 3K96A 1G291 4UE2A 5AVSA 3GA5A 2OCLA 4N6NA 2Q4BA 1QGED 3CE6A 2WF9A 4RK4A 4UFPA 4ZQIA 4C5BA 2ZPAA 4MB6A 4ZCQA 4UNQA 5HCUA 1SUEA 2VO1A 1AF4A 1JI0A 2QSYA 3OZVA 3C1UA 4GKKB 4KXUA 1H8EA 2NZVG 2OSBA 2PKXA 3BXFA 4NK4A 2QAGC 5KVCA 3LY5A 1QZXA 4HMOA 4U3JB 1TZBA 3RVMA 4DM7A 1N3IA 3IAS1 4F91B 5K8IA 3AESA 3DNFA 3E7WA 3T3EA 1JEAA 2QP9X 2R6HA 1DOHA 2DVMA 3KSZO 5CVDA 2EGGA 3H87A 1VCIA 4IOKA 4CDRA 3P9QA 1FXWA 2O2IA 1ZSVA 2A4KA 3GT4A 1WF6A 4NONA 1SZPA 3OC6A 4BKPA 3U3DA 2MTBA 2AWOA 4V3CA 2O20A 3D4OA 4IG4A 4J4HA 1UPTA 2BHLA 2IU4A 1QCZA 4AS2A 3O4JA 3ROGA 4W7IA 4MV5A 4MR7B 4PLFA 4ZT3A 1ZINA 3SMVA 2QRMA 5LQDA 4Z4EA 1OV4A 4PLVA 1T4CB 3OJFA 1B0UA 4EATA 1V5IA 4AJJA 2IYSA 3B5IA 3IESA 3T35A 1DKQA 3FDIA 4H1HA 2QRUA 1GIAA 4RD6A 2OHGA 1J21A 2KJQA 3DG9A 2EQAA 2DRIA 5IM4F 2YJGA 3UG6A 4OHBA 4A03A 1KAHA 2JAUA 1Z9BA 1CJVC 3GCWA 3T54A 2IYYA 2VJYA 3PWSA 4A0GA 3HP4A 3HJFA 2JD2A 4IXMA 4Z1MA 1XWFA 2EGUA 1QRRA 2D4AA 1TQ4A 4KACA 1I32A 4Q12A 1JFFA 1ZK1A 1P29A 2G36A 2GAAA 3CSUA 5BQFA 3KPJA 1C9DB 2YHIB 2WVHA 4N82A 2BP7A 3BWYA 2FMIA 1NGSA 4C2BA 3V1TC 4JI2B 3UQYS 2D5CA 3THOA 2NYUA 4I50F 1EEXB 3B52X 2GM4A 4J49A 3H1PA 1MCZA 5K3SA 3RAGA 3T1YB 3Q5GA 4QTYA 3HFGA 4CN8A 1C9NA 3KFVA 1A95A 1FFSA 3A1NA 4IDPA 5I5EA 4L15A 3U4IA 121PA 4RO0A 1SVUA 4TMTA 2CFIA 3MM4A 3R75A 3O4VA 4J0GA 3SBOA 1ZM7A 3E5RA 4S12A 4DF3A 5KYTA 1ZGGA 4NZMA 5E1OA 5EPEA 3ZU2A 1VI2A 3CLRC 4CLRB 2C83A 2J4CA 2P91A 4BO2A 5K3FB 5JY6A 4W99A 1M0WA 4YRNA 4HNRA 2YV3A 3PLRA 2HMVA 4ND8B 3KEGA 3QTTA 2YWHA 3CVYA 3BD9A 4EF4A 4QYTA 2PL9A 3BE8A 4JZKA 1NNSA 1ZIYA 3GH1A 2I8CA 2WM8A 1ZH8A 3OZTA 5AVZA 3U60B 4Q4JA 1G66A 4KH0A 5ADHA 1NYRA 3DZCA 3RUAA 3B36A 2QD5A 4KOEC 1CPYA 2YFYA 2W98A 4CTNA 1OZGA 3EVNA 1RXVA 2AJCA 1MQSA 1VMEA 2J9XB 1OFUX 4IWNA 1SOAA 2Z8YA 4XD7D 5JSZA 5KMGB 3A4MA 3R7NA 4FGUA 3C3WA 3FPLA 1GZ4A 3IQIX 1MC4A 3EGWA 3JAMA 3U62A 3QYAA 3LO8A 5DNWA 4YCMA 4E6EA 2DWUA 1WUKS 2WWXA 5EE5B 3AJ9A 4UQOA 4U02A 1NXOA 3CEPB 3U7GA 3R0IA 1Y6FA 4GQAA 1W5TA 1F48A 2HSEA 1XZ8A 1P1CA 5K3DA 1QO7A 2JFPA 1VA5A 4I6GA 3BBPA 4ZOCA 1ULAA 3NIGB 5JFOA 3U31A 2CVOA 3H1FA 3WTBA 1Y6GA 1KYIA 3MTDA 3VPAA 3AKCA 3DBRA 2DLDA 1NVBA 2I22A 4KREA 1PJ4A 1PV4A 3QUQA 5H7XA 2MSNA 3Q9UA 1FSZA 5K2OA 1DCKA 1J56A 1CS4C 3D31A 4L9WA 3SYNA 1EFPB 2I4MA 3ESXA 2OO5A 4B74A 3CEAA 3QWAA 5TV2A 1LS6A 4E5MA 3AVOA 4QUBA 3UKDA 4DJFC 4HJRA 4AS3A 1W85B 3EMDA 4L8FA 4CV3A 4FC6A 2QROA 4B3BA 1WB5A 1Z4PX 5HS4A 1R0LA 2O9JA 2OC4A 4IBOA 3A25A 1T3HA 5K8CA 2GKSA 1VLJA 3BBLA 4P22A 1IXSB 4BLQA 4CFZA 1XLTA 5IJWA 2C31A 3IKTA 1ULBA 2CB0A 2O2JA 1V7ZA 2VUTA 1KQPA 1TDJA 1WW3A 2IYRA 2Y1KA 3KR9A 1K2WA 3VR3D 4P4GA 1XCGB 1YRHA 5TVKA 3WWPA 4EG7A 5ALVA 1YMVA 1VE9A 3EOZA 2Y99A 3PZBA 5JZMA 1GGMA 4MDYA 4I3HA 4B47A 3LG2A 1S2MA 4FKMA 2WUVA 2QPOA 1PR0A 1OV6A 2VCHA 1XQXA 3A1UA 2Q4EA 4OB8A 5BSFA 1N3YA 1MQ8B 1KYYA 2TMDA 3H65A 3SZRA 3HHPA 2PKCA 5DKFA 2JFFA 1N2IA 2OHVA 3H8JA 4NVRA 3ZQKA 3O8DA 5I7AA 4TYWA 1U2GA 1CJSA 4NH0A 3F96A 3KZXA 4R1NA 5DFAA 2GCEA 4B76A 5GVRA 1B14A 5H70A 4N3CA 2PGLA 1NWCA 2JLBA 2O1XA 2XYQA 1YKSA 3CKKA 4NS4A 5D3ZA 1DAEA 1UBJS 2GETA 2W37A 3VJKA 4OX9Y 4NV0A 4Q1DA 3SYKA 2HBYA 3M83A 3QKWA 3RTCA 2UZAA 3V48A 5EXSA 5KQSA 5D85A 1B6GA 1DAKA 4JH0A 4K9MA 2J7PA 4QUKA 5JCOA 1AN9A 1LJUA 4UBLA 1A9ZA 4WGFA 1ZESA 2WZQA 4L6AA 4LECA 4JYPA 3E8XA 4RJTA 4P0QB 1V8DA 4HWPA 1F51E 2N46A 2O3RA 4BZPA 4JEHA 5FUQA 1M0TA 4XGQA 4OV6B 3HR7A 4EABA 2NZWA 3K3PA 2BHSA 1SIOA 4LF8B 1Y4DE 2HV9A 4ALIA 1AGRA 2LRHA 1O5OA 4RSRA 1WX1A 4PAWA 1WUYA 2EP7A 2QM3A 1DV1A 2I29A 4I9NA 5LLDA 5JAPA 2X0FA 3UH1A 3HXMA 3B38A 3RFXA 5HZMA 4NK5A 2GCPA 4GLOA 5HZHA 2FZVA 2CHVA 5FOUA 5FJJA 3DEHA 3PT5A 4HGZA 4PLTA 5C5DA 2NNWB 3H5TA 4J90A 3GAAA 5C8DA 1T4BA 1F8FA 3NH9A 3M89A 3L8HA 4U6QA 2F1RA 1M2OA 2EARA 4FX2A 2B1JA 5L3VA 2SKCA 4GUAA 1C3XA 2P5UA 3ORRA 4Q3LA 1AA9A 5U4QA 3FYUC 1Q44A 3ZC3A 3IT3A 5KSOA 1CQPA 1IPFA 3PP8A 1JHPA 2W6CX 1QVVA 3MRXA 5DYIA 1AY0A 2QTCA 1P1RA 4EECA 5CDFE 2YQZA 3FWYA 5IDXA 6LDHA 3WLNA 3P1JA 1QNFA 3JAWB 4OMDA 1MJFA 1Z37A 1OIWA 3INGA 3HMKA 1IQRA 3BUSA 4XB1A 2I4RA 1ISFA 3LZ6A 4MVJI 1EWYA 4PHHA 4D9MA 2QUKA 2Y0DA 1LGYA 3FNHA 4DKJA 3JVUA 2YIJA 3Q40A 1EXMA 2GEKA 4R3NA 3VU8A 3L6BA 1ZP6A 4WGGA 4ZZ0A 3NWJA 3PUKA 3PTAA 4PC3A 3OTQA 1N9GA 3PA8A 3PB3A 3WWCA 3PX7A 4D3YA 1BGVA 3IOEA 4X54A 4XWKA 1NUSA 1A2BA 3BHNA 3FYSA 1L5VA 3RHTA 3Q3GE 3UW3A 4NOLA 5LB4A 1FTYA 1YD7A 2XXJA 2RC5A 1SU7A 2YYSA 4K5QA 4NPHA 1H0RA 2GJ9A 1T1IA 3BMNA 3DHVA 4TV9F 1RCTE 2FK8A 1XEWY 5JZVA 4UBMA 1EM8A 1X8JA 3QG5A 4HC4A 4JT9A 4D8YA 4R0VA 1JQEA 2PO7A 3OLZA 5BOVA 4LFBB 4CLEA 4CQLB 4HQFA 5FTMA 1YRYE 2NU8B 2IPNA 2IHYA 4KSCA 2RHTA 1N9KA 4XGNA 4FYKA 1A77A 3KS9A 1RPZA 2Y67A 3RR2A 1LZLA 3D0QA 1FYVA 3I4CA 2WIFA 3GRCA 2QTVA 2VPIA 3F3MA 4GOJA 3HCRA 2QRNA 4CL3A 4ABTA 2PSHA 2O4UX 4FDAA 4NZOA 5JS1A 3D8SA 1NVMB 3EZGA 5JYBA 4HGYA 3EB9A 2HMAA 1E89A 1RIFA 2GPWA 2WF5A 3IXQA 4RSHA 4XJXA 4E3WA 3BCUA 1L4LA 1AKTA 4TKVA 2JGAA 5HMMA 3PXGA 1PX2A 1TOAA 3WHIA 1ZGHA 4RD1A 4XRRA 3L8FA 4PZAA 4PYQA 5LZ4A 4XCXA 4JVSB 3W2GA 2WA2A 1UOOA 2FZ4A 3PX3A 5E9AA 3SLGA 3EAQA 4QBFA 1E5QA 1GGKA 1GSAA 4M87A 4QOGA 4QTZA 4H27A 4DLYA 2JG3A 1YT5A 2V4UA 1O95D 3NTXA 5JYDA 2IYUA 1NE2A 1T2VA 1XAJA 1Y3IA 2Y1DA 1TGYA 3T7KA 3TMAA 4EEXA 2XMPA 1C29B 2EXXA 2XDAA 2XB9A 3JZAA 4XGKA 4YXWD 1V2HE 4MW4A 1VPVA 4JEMA 4U3JA 3C14C 4DJJA 2AE1A 4YT8A 3IUYA 2QTMA 4PTZA 5A3VA 3WL6A 4DTCA 4YXFA 5AW4A 2ZUSA 1UKVY 3IQZA 4HH0A 3EDQA 4ME6A 1BS2A 2GVDC 2BTQA 3ELYA 5ICSA 1CCWA 4RD3A 5JCJD 4AKHA 5EJGA 3KVVA 2F2TA 1SKMA 4HXFB 2BY4A 2GVZC 2JFNA 2FEXA 4I8DA 4QJBA 4ZO6A 3SU8A 5JISA 5JNUA 1UEJA 1FBNA 1M2KA 2BMAA 3B7GA 3RREA 1Q0HA 1Z39A 2ZBFA 2I7CA 4JP2A 3PNPA 4REOA 1QHNA 3HY4A 3FFWA 1JVNA 4EX6A 1T4CA 1KJ9A 1X6VA 3J81A 1J7KA 4ENQA 2V9ZA 1F12A 3KBBA 3QA9A 3QWFA 2WLTA 5HIJA 3K0SA 2BSQA 3U13A 3INTA 2HBRA 3FPEA 3D6VA 2TSYB 3C3CA 3FGOA 5CM9C 1U1IA 1VRWA 1UJ6A 2UUPA 4KWIA 4YRRA 2YRWA 2A7QA 2F64A 4FYHA 1WXWA 4LY6A 4JLSA 3N8NA 5CB4A 3TNYA 1CZOA 4EM6A 2HGZA 1F17A 3Q3EA 4JQSA 1WMBA 3PHCA 5JWHA 3L6DA 1VSBA 5AOVA 2QEQA 3FKQA 4KCGA 3F6PA 4UMEA 4HXGA 1AB6A 3ZJVA 1FB5A 4J0FA 1IRIA 3JQ8B 5C5IA 2B6NA 2D06A 1JH9A 1JMYA 3P9PA 2XE4A 2O0KA 2Z56A 4WI1A 4EYEA 1RQ2A 1I24A 2A0FA 4B7XA 1H5QA 1P2BA 1HTWA 3D8HA 4G0QA 4KQMA 1R8SA 2CUNA 3EY9A 2BE7A 1RFLA 1Y0BA 2FCAA 1WOYA 5DT9A 2GWHA 4BDTA 5GIPE 1NLMA 1FYEA 2IUEA 3U4HA 3WBJA 1A8IA 1KJJA 3FTFA 1JA0A 3R4VA 5FO0A 4JBNA 5IAJA 3TEJA 2AGVA 4ASUD 1GQYA 1RPNA 4FU0A 4G2NA 4MMZB 4QVGA 4D6PA 4B73A 2Y9MB 4BCBA 2ENWA 4DW8A 4L73A 1QHEA 4X7RA 2NU9A 2JRLA 3PPWA 4LDJA 2QJRA 4RS3A 4C2TA 1QPBA 3SBDA 1VL5A 3P9XA 5C2JB 2FR8C 2KS6A 2O07A 2VSFA 3SE7A 4PO8A 1G9SA 2IYLD 4WERA 5AJYA 4AJ1A 4EFKA 4P84A 1G7CA 4WZ6A 3P5SA 2QTTA 3I73A 1EMDA 4L76A 5AVOA 1X42A 2OBLA 2YIMA 3LUHA 3PGJA 1OXSC 4Z0TA 4ZTZB 1U0LA 5JI3E 2Q5QA 1O0BA 6ABPA 1NVGA 3T5DA 2I8LA 1EHIA 2QP4A 4YCAA 2OPHA 3RGGA 1C1XA 1RM3A 1Q1BA 1X19A 2MT9A 3WICA 5CMLA 5IU6A 3GFBA 3T7CA 3GJ6A 3FDXA 3MOIA 4KQ1A 5EHQA 3ZLVA 4CDGA 1GCOA 1XU4A 4W7HA 3T9DA 3ZCSA 5JJBA 4QELA 4QWMA 5C32A 4UTNA 4A2PA 4Q7KA 4E09A 1BS1A 2L18A 4HBZA 2J09A 4ZGBA 1E3IA 3D59A 4RH1A 1XD2B 2EDCA 1QR6A 2H1HA 3CRQA 3I34X 4X1YB 3WLMA 5GTDA 2ACVA 3ZZNA 1BYIA 2C4HA 1PV2A 4M9QA 4UARA 3PGVA 4UD2A 4UDYX 3V33A 2EHJA 1KWKA 4C1BA 3HUEA 5TJHA 5C9ZA 4PZZA 4DEYA 5BR8B 1D0VA 5K8VA 1ZRNA 2C29D 1I2MA 4Q24A 3QFHA 3FTPA 4AMGA 4AKIA 1EFPA 1NVAA 3HV0A 4HFMA 4ZHQF 2XY4A 4EA6A 2PLRA 2XSZD 3GJQA 4HDQB 1CY2A 1DE0A 1H1LB 3EVAA 2H2HA 1D2CA 2C84A 4PC6A 4CIDA 3OCJA 2H0RA 4R9UC 5AFSA 4B4OA 3GLGE 5JAIA 3TBFA 2R84A 2IV7A 3DQPA 4IXNA 3TI7A 4I1UA 2VHJA 5LB2A 2I7DA 3ECCA 3THSA 3FOEC 1ZD8A 4OLHA 3OT1B 3C4QA 4RMNA 2CD7A 1Q92A 2ZSDA 3MTAA 4PQRA 1ESCA 2IHJA 4HFRA 4HXEB 4DEXA 2ZUBA 4YRMA 4FEGA 4N3AA 3W1WA 2UUBB 2BGGA 2IDMA 2FPWA 3FI9A 3NS7A 3N2EA 1E0AA 3GFOA 4EKEA 3NEAA 1DEKA 2HRCA 2KBFA 2HA5A 1GARA 2GK7A 5DM60 2F8LA 3A3PA 2O52A 2B1RA 2Y3IA 3GJ4A 1DQRA 1BROA 1SD2A 2GEJA 3HUUA 5K0LA 3SIRA 4NL4H 5DEIA 2OGSA 2BEVB 4KYIB 2VT7A 5A3SA 2XRZA 1ZHOA 5AW7A 2FN7A 2YXLA 4YS6A 1A1SA 2YW9A 1E8NA 1VPLA 2DFVA 2V45A 1ZIDA 3MT8A 4JVNA 1VDZA 4BRUA 2EF1A 4O2BF 2RGDA 4C4ZA 3KLNA 2PWPA 1JNYA 3A32A 3DZIA 2IEDA 1W48A 4FDMA 2FUG6 3OFJA 1E9DA 4DCSA 2A2ZA 1TJPB 2JFZA 2ON6A 4GOND 3TKLA 3KFXA 1NF8A 4DIUA 3PWTA 1E59A 5ALZA 5G0WA 1U2RA 4HTAA 4TXLA 1GYRA 1EFTA 1ORWA 2P9YA 4HG2A 3SPXA 3UB2A 4CG1A 1H69A 2ORED 1KQ3A 3I1IA 4EDFA 1BDJA 4PWZA 4L5AA 2CXPA 3GJYA 3H4IA 3EXHC 3O1HB 1VXRA 4YMSA 3UW1A 4U9HS 1L0BA 1MIOA 2D74A 2BZSA 4KPUB 1D4FA 1KARA 1VBKA 4K40A 1E2NA 1RHQA 2PV0A 3NEYA 4KO3S 1LJLA 1PS9A 3WL8A 4DLNA 4JI6B 1E62A 1W59A 5KNCH 1DC5A 3DDWA 4IF4A 2Z8ZA 1KETA 4W1QA 5DU2A 3JYHA 4BV3A 2L42A 1JLRA 1NXPA 3BA6A 3EGOA 3F6CA 4DVJA 2FWAA 4UXIA 3X2EA 2DG2A 1C4KA 1R4ZA 2DQKA 2VG8A 4S3MA 1WZ2A 2V7GA 2G77B 4GSLA 1P0IA 4I4TB 2OV2A 5HFJA 5J3JA 4C6HA 4OQQA 5CT9A 3JATA 3MJEA 2FQYA 4MKFA 4ZT6A 4IL5A 4OF4A 3RRJA 4EW6A 3ADCA 4PRZA 1OAOA 1JLSA 3IULA 1BW9B 1R5JA 5K99A 1Y3HA 3U4GA 3UUWA 3ETJA 4A0QA 1NMQA 4Q3NA 2WPNA 4D99A 3AU9A 1UXIA 3BD7A 1CRQA 1L7VC 1OILA 2OE2A 3MQFA 4TXHA 4LRTB 3SJZA 3NRCA 5LQRA 1FY2A 2ZAIA 3MTQA 2OHOA 2OFOA 2ZEJA 4ZRNA 3QMWA 5KJ6A 4CGZA 3DOCA 4I5DA 2WHQA 3B8EA 5FQNA 4E5UA 1UEIA 4BUJA 4D02A 1PNQA 4OK3A 5FLXA 2I76A 2YXDA 3VC7A 1RKQA 1TW3A 5FA6A 1PR9A 1JG1A 3CVJA 5DHUA 3F73A 1KI6B 1FEZA 2XUOA 5AW3A 4NYJR 3K72B 3GK3A 1RE0A 1N3BA 2W2XA 1B93A 3L4BA 4F85A 3C3BA 3MIIA 2PJZA 1DUVG 4D4GA 4C7MA 3CG4A 3HADA 5E3JA 1WSWA 4KJZA 4OFZA 4B6GA 2NU8A 5LQUA 4NJOA 5EJ9A 3IR7A 4MGEA 3VR4A 3MGBA 1TQHA 2NSHA 1GL7A 1X86B 3DTTA 4JNCA 2F9LA 4YFVA 5BV0A 4XGRA 5CVJA 2J4DA 1P0QA 3LDFA 2G17A 1NQAO 1NX6A 4GVPA 3U39A 1J0CA 3PNKA 3IDAA 4NYIR 4QYSA 1NXXA 4NHEA 1KMQA 1D5WA 2B25A 5A4MS 1IZ7A 3OZRA 1AKVA 1NP7A 3IDQA 1PG0A 1HZZA 3BPSA 4M83A 5JXJA 3QZUA 4E11A 2BFBB 4IKOA 4WK4B 2HA0A 4IDDA 2PRSA 1PR6A 2ZIFA 3HB0A 3JVIA 5ALKA 1BMTA 4MQEB 4MA4A 3DYVA 4AJOA 1UJMA 4DXAA 4Q5IA 5IJ9A 1SQ6A 2G06A 1NF9A 2IITA 3ID6C 1KO8A 1WZNA 1TVMA 2WU8A 5EJMA 3BHIA 3FWKA 1EX7A 3GZNB 5H8WA 3WYNA 2FSSA 3WE7A 1L4NA 5AVRA 3IIKA 1E7SA 3T41A 3WLIA 5JNTA 3SKYA 3WY9A 4XQ0A 3UQZA 2EFDB 5EWMA 1A8HA 1I51A 1JTVA 3QBVA 4P82A 2INGX 2O50A 2RI1A 2VXYA 2X4IA 4NCHA 5AR1A 4F6RB 2GPYA 3HSYA 1I2BA 4YJ2F 1QHGA 2ZYRA 1W6UA 1Z36A 4P93A 5CH3A 3W05A 5ALSA 1MJ5A 1XMXA 2WKRA 3FUWA 3P2YA 4S1VA 2AKEA 3OQVA 1HXHA 3B6IA 3RC9A 2PVPA 1K3UB 5I9LA 4IGEA 2A84A 2A57A 3JD0A 4HDNB 3HU2A 4MA5A 4EG3A 4BFYA 2UZ4A 4RKRA 1XZGA 1KA9H 3KIPA 5ALNA 2J5RA 4L4RA 1V16A 1P0MA 1P9OA 2PUTA 2QTAA 2RCYA 4BO1A 3NCTA 1ODJA 5DNUA 5AJTA 3VSCA 3RFFA 4Q3AA 3SLKA 4RORA 1G8HA 3EEIA 3OHSX 2QJTA 2P67A 4QTTB 4V0QA 2P2SA 5IAEA 4BJ3A 1DX4A 1GAEO 1I4LD 1Q0RA 2JATA 2YY5A 2A5FA 3DDUA 3IDOA 3PVCA 5F9MA 5FWYA 4FWIB 1I3CA 1VMKA 3TRIA 1U0BB 2W6NA 4QKQA 2B92A 4B6RA 3IHWA 2XIQA 3D1LA 2DQZA 5TPWA 5IAGA 2Q29A 1CB7A 1DDGA 3KVOA 1YUMA 1SC1A 2FZLA 5ARBA 3JQ8A 5F35A 2D5BA 1XEFA 3BGIA 1EINA 4CT4B 2NTYC 3O4GA 4XVCA 2BEKA 1GKLA 2D8AA 2ERYA 4I46A 3EPLA 2WVJA 3IKMB 4KBFA 5FBWB 2A8YA 1MRSA 1Y8QA 1DNPA 4DJAA 3LGSA 2O7VA 1MFPA 4NFYA 1U2EA 2E21A 1RLJA 2PZAA 2RKBA 3IDZA 5DHRA 1JDBC 1MEJA 3ZX5A 4ZEMA 1RM4A 2GN1A 4IRMA 1S8FA 1S3SA 5IHPA 2HK7A 1IJKA 3R8XA 3WYCA 2GA9A 2NYAA 3P45A 4X3OA 4Y9DA 2WWVD 4KR6A 3I76A 3OOJA 1OFTA 1Q12A 2G8NA 1CULC 4KQXA 3G2JA 1U3VA 3KB8A 4FFVA 3QVVA 3TAXA 4FONA 4PG5A 1SKAA 2GDJA 2H4JA 4FYJA 4DN6A 3BWMA 3LPLA 1RAEA 3QV2A 2OSVA 3L7KA 4H7EA 3VJLA 4LXHA 1RI2A 4UREA 5EGNA 3BMQA 3LSYA 4C30A 1ZJ5A 1SIUA 2Z95A 4LRUA 2ZQ5A 1L4HA 1VKZA 3A7DA 3OJCA 2EDAA 1F0NA 3A4NA 3GCDA 2RHLA 3Q12A 3WL5A 4P0TA 1V3VA 3ZWYA 4Z49A 1IN1A 1C0IA 3HO6A 1PSDA 3FPAA 3ZHUA 2C7VA 2VCYA 5CYPA 4BLPA 3VHXB 1YQDA 4MVCA 1VHJA 1C8KA 1PK9A 4US1R 3O8BA 3HKBA 3ZOKA 3ADKA 5ER6A 1T1SA 1LNQA 3JARB 2HWUA 7REQA 1PDOA 4W9NA 5BN4A 3AB8A 3M6MD 1XD2A 2ZUWA 4XWGA 2ETVA 2JIPA 3E8MA 3OG9A 2HJ9A 3UOGA 3MG9A 4GC5A 3IQEA 1QF7A 3GRZA 4ATNA 3A9VA 4A15A 1GRVA 2IHBA 3QUAA 3UV3A 2ONZA 2VHTA 3UMRA 2IUUA 4F06A 1GG8A 2AXQA 1L7NA 1KZ1A 4EF5A 2XXAA 3NZEA 1QH0A 2D54A 4GWKA 2X15A 1YFKA 2GD1O 5D00A 1KK2A 5CRIA 3HVUA 1Y6RA 4E46A 2OGTA 3FZGA 2JIZD 1PEDA 4A91A 4ZKDA 2KQUA 2I6XA 4XSHA 4I50B 1OB5A 3DDCA 1UAYA 5KDLA 2WG0A 2IYAA 4KE6A 4W5NA 1MC5A 1K4MA 2PRZA 5EYPB 2YMQA 3W78A 4WLVA 2FFRA 3KWFA 5AKJA 5EKDA 4RBNA 5AESA 1MJNA 2CNBA 2FW0A 4LWOA 5UKDA 1BX3A 1PZFA 3GEGA 3VYSB 4DDKA 2GD6A 2JDIA 1UDRA 4KUEA 3IOMA 4WOCA 3EIHA 5CLGA 3SQLA 2H4ZA 2WTXA 1OF1A 3VR6A 4K3UA 1DQPA 3DE1X 2G70A 5REQB 1YJ8A 1QM5A 1KDPA 2IXFA 2ZUDA 1FJHA 3ILHA 2C9MA 1ORRA 4PSDA 4BZQA 3OEHD 1YL5A 3DD1A 4IUCS 2RK3A 2QGZA 1QVAA 2XE7A 2VF8A 3A9UA 1D1SA 1YK0A 3IBCA 3LQKA 3OU7A 3RS3A 3W3ZB 5JNRA 4EARA 1XTRA 3I1YA 1UPUA 3M6WA 3QXSA 2R48A 3CCFA 5EE1A 5HE8A 3GA0A 5KZMB 5JATA 1NPYA 1Y3BE 3PA6A 1XL0A 3DMTA 3FWNA 1KBZA 4WJZA 4NCNA 3LWDA 4IAOA 3FPHA 3KEOA 2ODAA 2BWJA 3N2GA 3UWPA 3WGHA 2CKDA 4TN1A 3T0FA 5AW6A 2G9RA 1BVYF 4GICA 3HBMA 3DL4A 4DQXA 2ZR7A 3MZ0A 4E21A 3M0EA 3LVFO 3AFGA 1KYQA 4I99A 3QEKA 3WK8A 1UJ5A 3JZDA 4Q9LA 1WUTA 2AOVA 4KXWA 5CFMA 4EL5A 3OZUA 4G1MB 1WV1A 4RZUA 2WSSA 3OQBA 5AM2A 2CLSA 1RMTA 2JIRA 4YIKA 1EDOA 3DVQX 1CXZA 4ALJA 3K4PA 2POCA 2WE8A 3V7YA 5B55A 5LL6P 1KO7A 2CHFA 4P7GA 5C8ZA 3U4QB 5EFZA 3DV9A 2R2AA 4WZBE 4IGKA 4CM7A 3VAZA 1LK0A 1QKKA 3THRA 4JP3A 1EUZA 1VLQA 3C15C 3RWBA 3B89A 5KYNA 2W4MA 1ISHA 1IG0A 5F1YA 2C78A 1SU8A 2EYQA 4OMCA 2A9QA 2I7XA 1L4MA 5DW3A 5T4HA 2IYFA 1SELA 2R25B 3LBHA 1RRKA 4CUKA 1N6IA 5I4KA 3K9WA 2A7XA 1D2GA 4FHGA 5IC4A 5LWQA 1U8FO 3MILA 3HDJA 2FE4A 4BIIA 2XGMA 4WPGA 2E6KA 4FHFA 4RFLA 2W6OA 4JOQA 3M82A 4WNAB 3KWMA 4G3XA 3FPFA 2V6GA 4ZC1A 3VR0A 4ZGGA 1KWGA 5C34B 5HRAA 2RAFA 1KQFA 2ZRCA 3HDGA 4MWCA 3WGYA 4RGBA 5D6NA 2IIPA 3OJWA 2BONA 5KDDA 4G0YA 4WNIA 3O47A 3THXB 1OZFA 2GSDA 3TRFA 3W2HA 4CEIB 1VYUA 1GOTA 1PT5A 4ER6A 5ALMA 1KFBB 3GJ7A 3MNFA 4YMVA 1F2DA 4GX5A 5B1SA 1V5GA 4GECA 4DLWA 2BIFA 1M76A 4QDXA 3B12A 3RS5A 4CIXA 1HQKA 4QJIA 3GYBA 3D8NA 1DTWB 1NBMA 3MIZA 4FMPA 1KI6A 4JLNA 5G0UA 3KUKA 1JDSA 1LXCA 1P2UA 1ZOPA 4KE8A 1L4EA 1KTIA 1BQ4A 1KMIY 1W5BA 2ORIA 4P4UA 2DPGA 2WFLB 3GLKA 4EJMA 1PL6A 2XZOA 4V24A 1YQXA 1QO0D 1QXSA 3IOCA 3VO2A 3MLEA 5HPYB 3KPVA 2XOXA 5DNDA 5EE3A 2GYVA 4U4AA 2YXPX 4KDRA 5TT1A 5KUTA 2VJDA 4X60A 4BNMA 2XEXA 2VIIA 1XYYA 1QJCA 4IKPA 5COBA 4XB6B 4E5DA 2RMKA 4Q4DA 1Y8ZA 5A0TA 1V1MA 2PXXA 5EHNA 1ZXXA 3INRA 3DFMA 4L5CA 3H84A 3PKIA 3R6LA 2ZJ3A 4M7RA 5IXYA 1JDNA 1TZKA 2WNIA 2Y27A 3ADOA 1EAMA 3PJDA 4FBLA 4G41A 3GDHA 1O6GA 2H8KA 3JYQA 2AVNA 2X86A 2NV0A 1E9EA 5C3UA 2ZI9A 4I2NA 1T2AA 3C74A 3R3WA 1PWYE 1QFYA 4FE7A 1O87A 4K26A 1BMDA 4MQEA 4US0R 1ONNA 3I0MA 3F97A 3H2JA 1JWAB 3QJYA 4P81A 5HHTA 5DBHX 4R6WA 4I6EA 4D4LA 1S2GA 4IW3B 1M3SA 1WLSA 4TZ0A 1N0IA 3NHZA 2X3FA 4TYQA 1DC3A 4MO2A 1HURA 1O95C 2LWIA 2ZRBA 2X0JA 2VAXA 2ZVQX 1QDLB 2PT5A 2TMGA 5B1IA 1NVVR 4BYGA 2WWYA 2G67A 1CETA 5KI6A 4ZDKA 2QLNA 4I55A 3F9RA 2XUDA 3M6FA 4K9NA 3WAGA 4AZSA 2W8ZA 3EW9A 3PCTA 1K7CA 5IKOA 3ZE7A 1IJEA 2OZVA 2NLOA 4TMVA 1QIKA 2HD4A 3H9BA 2KE5A 3I9V6 5HP4A 3COWA 3D2LA 3QY0A 4LOHA 4KN9S 3W4IA 3DBOB 4HDNA 4AKSA 2BEWA 1AOXA 1ZDMA 1EBUA 3PQFA 4PBRA 4XVHA 2FP3A 2XMGA 2XYVA 1L4GA 1F2TB 3LM8A 4OH1A 1F9EA 1CUCA 3E22A 2REQA 3BM5A 3GC6A 4M37A 4GO1A 2ZZKA 3UV6A 1T8YA 4PX2A 2GQ0A 1H8HA 3RJ9A 5C37A 2VJLA 3IAEA 1QKIA 1BJKA 1TCCA 3KQNA 4NWIA 4GI1A 5D3MB 5I7SA 3ESAA 3Q41A 4TXNA 2GHRA 2HU7A 3AFHA 2NYVA 4ENUA 2IW1A 1Z5UA 4L4XA 4TV9B 2XCTB 1AGYA 1K3FA 4HRXA 1J2RA 5IMBA 3KKMA 3EVBA 4B3GA 2OR3A 3AVUA 3CXUA 1EXWA 3OBBA 4HADA 3Q5DA 4GDFA 3O7MA 3OM9A 1B6TA 2C03A 1VHDA 1ZCAA 2C2ZA 3D6JA 1X3LA 3DBLB 4IYRA 1GG9A 4UASA 3LKDA 3QSGA 4ZKEA 2FPRA 4JXJA 3E70C 1BCRB 3ZIDA 3PCRB 1O03A 4KW7A 1Q1GA 3OFND 5AM4A 3DEAA 4FGKA 2FE1A 1RLTA 4FUTA 4AO7A 3RU2A 1PT6A 1F5SA 4G65A 3I8OA 5CW2A 4GX2A 4BVLA 1JWLA 1T4GA 4YB8A 2UUCB 4LYFA 3OU2A 1VXOA 1J8VA 1A2QA 2QTFA 1NC3A 3BCSA 2RHRA 4ARZA 5KOYA 4WTOA 4LYDA 5G41A 3CRZA 3SFZA 1D2RA 2DFPA 2G0AA 5AVXA 1WMAA 3UV7A 3I1JA 5AH0A 1IYZA 1YJAA 2GEBA 2SHKA 2VKQA 2WHRA 3D6UA 1N1MA 1UMDB 2PIDA 4K05A 4Y2PA 3TECE 4C4AA 4F7DA 3PXBA 3I28A 2J85A 4TQGA 3JYPA 4FJ2A 1XROA 4OMFG 4IEEA 4YV0A 1KVQA 2XB2A 5FNVF 5F98A 3UGQA 2HK8A 1LDGA 1X1DA 4MVJH 2IY7A 4X94A 5DNCA 3RUHA 3TLAA 1UBRS 4AG6A 4OI2A 1CZLA 1IMOA 2V4ZA 4O08A 4TTAA 5KYKA 3PHIA 1FDOA 1NQVA 2XQFA 5HDQA 4ZIRB 1P5HA 1RPTA 2EW2A 4JUDX 3IE2A 5DP2A 1ADCA 4WY8A 3WRWA 4QOSA 4BZXA 2A0WA 3ZJYA 4B4DA 4IJQA 3WJ7A 4OP2A 1XPJA 4U7FA 4RKFA 1RI5A 2VCEA 4XUDA 4CTKA 4IV8A 4OA8A 4UUPA 3FGNA 4EY8A 3K0HA 2KI5A 3A06A 3MPOA 1NONA 3MXTA 1Z2EA 4YP6A 2LV8A 1U02A 4JJFA 3TLEA 1HYBA 3WGQA 2ONCA 4M0CA 5IC5A 3ZX4A 5IM4A 4G9EA 3HBJA 3WYBA 3EZ7A 3H9QA 1BWRA 2QBYB 1P9WA 3ZKAA 5LDGA 4LZWA 1XEXB 2VHZA 3F90A 3LW7A 2NQ8A 4L08A 4RM3A 4ZARA 3UCFA 4UAVA 3OFKA 2GH1A 5AWFC 2QENA 4CKWA 1O9GA 3HJHA 5CYGA 4Q82A 1E1NA 3M6LA 3UB4A 2LKCA 3FOAA 5A4JA 1TQ6A 4I50A 1GPKA 1D1PA 3TB6A 5JZSA 1SD5A 4JBYA 1AS2A 2XCIA 1FRQA 2Y6UA 4RTPA 2DHDA 1G20E 3OJLA 2NN3C 3TKAA 1VE3A 2C57A 4JHXA 4RTMA 3TQRA 1UMKA 1EK6A 1CC1S 1KHHA 3A6GA 2ZDQA 3P9YA 4X3CA 1WXHA 2VOJA 3UTDA 3L07A 1Z8HA 3QOXA 3NV7A 2FLWA 4GQBA 3PFIA 4ETNA 2IDJA 2QU8A 5CCEA 2YNMA 2WJYA 2BKXA 2RHGB 3G2LA 5DX1A 3ZE2B 3ZY5A 4B71A 4LNAA 3PD7A 2P4EA 2C5GA 2DE0X 2PJDA 3PRKE 5H3CA 1QP7A 1YUNA 3O0DA 1P1BA 5F1OA 5CVEA 4QPZA 3VBCA 5TSDA 3SGLA 4RF5A 5EQFA 2YJZA 1T5DX 1IH8A 1BEEA 3T1QA 1C0KA 1ESMA 3DMHA 3EQ9A 4B1FA 2CC2A 2I78A 4JK3A 1OC2A 4DLKA 2AVDA 4OREX 4Y1FA 1VLHA 4BQOA 1C0EA 1TD9A 1USUA 1XKQA 2CGEA 2V7QA 3CUYA 1UT6A 4FS3A 1I5EA 2XW6A 3A4LA 3G8DA 2YWXA 3ZEAA 1TYEB 4MVJF 3M4XA 2XR1A 1QB8A 3ABRB 5JG7A 4A2WA 4YLGA 4JASB 2IOFK 4LMBA 1F1JA 3EIQA 1OUMA 2JBHA 4D46A 4DTIA 2L0XA 3E81A 3O83A 1GPBA 1HNNA 3KSBC 1LH0A 3SE0A 2GEUA 3WOHA 4W5RA 5JSKA 4INPA 1C8LA 3TTXA 5JMOA 1R3UA 2BKLA 2FNAA 2HNBA 2KX7A 3I5UA 1NDUA 1PI3A 3I9LA 2QE7A 1JEQB 2VRCD 3NQ41 1R8JA 4G0ZA 4H7JA 3LX6A 1E3WB 2WWGA 3V8VA 4TL6A 2X1LA 1SKBA 4BUCA 3OA0A 2EOAA 4BVHA 3K4HA 3WRVA 4ER7A 1JSZA 3EUFA 4P34A 3TM4A 4MVJE 1I2ZA 4MWDA 5H68A 3RPEA 3ZZ0A 1IHPA 3G13A 1SJ9A 3SJUA 4X64B 1L5WA 4BZZA 2QMEA 3RSSA 4HQNA 5L6MB 1KY3A 2ZVDA 4XX0A 3TXXA 3O3NB 1R12A 3OSZA 5J1TB 1XO1A 4OYLA 3SZUA 3VBEA 4ZHQB 4YT2A 5JMWA 1NU8A 3QLUC 5IYZA 4X45A 1U7OA 4UUMA 4BYMA 5ELMA 5D5PA 2ZGVA 3KSRA 3UJCA 1P5JA 3T52A 1JR3E 1MG5A 5BNTA 2C8JA 1IIBA 2YWCA 3TQSA 3EXFB 2QPAA 1W581 3HM2A 2FX5A 2HNAA 4XFJA 1R74A 3FDFA 4E5NA 1KFCB 5EIWA 3SDZA 3O03A 3QE0A 2G0NA 4XR4A 5GOZA 3E7XA 3EOAI 5TGZA 5TR9A 3PVZA 1T5SA 2EW1A 4G8CA 1SZJG 3TLYA 3FDZA 1U28A 2ST1A 4HXYA 4XDHA 2BGMA 1O5TA 3T1VA 4DY4A 4EHFA 1J8YF 1PSWA 1V3QE 1XF1A 2HREA 5B3AA 3DLAA 5DIFA 4HB3A 1DDIA 4AIIA 5M04A 1AG9A 1INLA 1EB8A 1BSVA 1E66A 2UYGA 3O38A 4PAMA 2I65A 4RE6A 5FF9A 4CQMB 1JU4A 3THXA 5TMBA 4CEIA 1Z6GA 4FE4A 2RAPA 4J91A 4PGGA 4J1TA 2PD4A 5MGBA 3LGXA 4LRWA 4M7PA 1I10A 5CCDA 3L7LA 5DWQA 1RRMA 5IP5A 4NC9A 4XXHA 4EA8A 2FJPA 2EBHX 2TS1A 2FXIA 4GZ6A 3VXKA 3NVAA 4EFDA 4BLOA 1DTWA 3L02A 1SRRA 4DSUA 3F9IA 1JILA 1NJFA 2FVXA 2HL6A 2WDZA 3DFZA 3NM6B 2G8LA 3OTWA 1G5PA 4J16A 4O2BB 5HQ3A 1JIKA 2E4XA 2NT3A 2Z43A 1MB0A 4JMPA 4KE9A 4OJMX 2IKQA 4S1TA 5E1BA 3RIXA 4EGAA 1EQ2A 4DMCA 4IDCA 2IU0A 3ONEA 3DPSA 1TM1E 2ERXA 2G5CA 3VDNB 5CDTA 2HDHA 5TXGA 2DWCA 1YBMA 3IMEA 3VOTA 3LVQE 3QLVA 2P5YA 5ECDA 5DGTA 3IP7A 3GGGA 1I2CA 1YQWA 4FIZA 2GZMA 2EJUA 2UXBB 4EA9A 3L5OA 3ZDBA 2VDQB 5M7EA 1MVOA 3ZD8A 4INAA 5CDFA 3D3WB 1KI2A 1T1RA 4L75A 2WABA 3V1KA 1CYEA 1P2SA 5YASA 2DPXA 3O3OB 4TYYA 5K03A 2QY6A 1IQPA 1UL1X 4L3WA 3UOAB 1EFKA 2XRYA 4F8YA 2CV0A 2GXUA 3CNQS 2R66A 3THWB 1UC8A 2GXSA 1JZQA 1ZKDA 1E69A 1TT5A 5DSZA 4EOGA 5ITZA 4GE3A 4X84A 3LYLA 4TMZA 2ZOSA 1GR0A 2LDBA 1FBTA 1UM9A 1CUBA 2O0LA 5J9FA 4RY0A 4MEJA 3VRHA 3HABA 2BR4A 3PTZA 1L1RA 1FZQA 4NP6A 1XD8A 4N3GA 2ZUTA 4E5YA 1JVBA 2I6SA 2R68A 1CVIA 3K6KA 4F97A 1Y7PA 2PN1A 1X1RA 3I52A 2BOVA 1VBMA 1NNUA 1HBJA 2J9ZB 4O1HA 2Q5HA 5FV4A 1EUCB 4PYNA 2BJWA 1L2TA 4ZK6A 4YQEA 5IZCA 2IHUA 1RRPA 3ENWA 1WCXA 1HO3A 1FRNA 1ABFA 3GT0A 3GAMA 2BR3A 2OWEA 3HS3A 3IA2A 4L2IB 4Y0NA 3GCXA 5FBKA 4HNGA 5E95A 3OM8A 3TVDA 3FYTA 3GUUA 1AE1A 5EAIA 4EMBA 4AB1A 2HXSA 5IS2A 1PZGA 1XVAA 3K0FA 1ZVJA 4C0QC 1X2EA 2DJIA 2NVUB 3ZEIA 1XCBA 2E0IA 5DGXA 3A6DA 1F2TA 2A67A 2AI1A 2YASA 4IMPA 4MKZA 3VU3A 1XZKA 2LE0A 4YX9A 4MUEA 4N7BA 5HZGA 2AOWA 1GUZA 1LF5A 3HO1A 1IPHA 2ZB3A 4AO8A 4MTLA 3OKPA 3HXTA 2FCRA 1EE2A 2H5JA 4NMWA 1SIBE 4DQDA 4ZOLA 1E63A 4WWHA 4ZPJA 4NDZA 5MN5A 2XBLA 4CG0A 2Y93A 3CEHA 1DUSA 3KUXA 3QPDA 5JYCA 1ZGCA 4MULA 2E1PA 1W4AA 4TV9A 5DYYA 3HYLA 2Q4RA 5CA0F 3ZE9A 1IXYA 3AR3A 3HCNA 1VPDA 4MWTA 1QIMA 1P6QA 2VF5X 1W7AA 1G5RA 1C14A 4DILA 3ILVA 2PLNA 5HQJA 3JYOA 3WGIA 4B7ZA 2B78A 4TZTA 5TNXA 3M9WA 4JP8A 1NRJB 1BCRA 1EGQA 4B3CA 1S1MA 3BORA 1DKMA 3AL2A 1X2BA 3R7WB 5FBRB 3TUZC 2EFGA 4PLZA 2NUTA 2EL9A 2G9VA 4B4UA 2FW6A 2P79A 4G97A 3PFCA 2QA5A 4HEQA 2Q49A 1TKAA 1F1BA 2I6FA 3ESZA 4OBXA 3SICE 1Q22A 3DS8A 3E35A 4M4SA 2QXYA 2AW3A 1FP4A 1Y6JA 3HFSA 4MH0R 2V3CC 1H2FA 3AZQA 3FJ1A 4XZ3A 3D3EA 1YZHA 5AKIA 3UGTA 4HTFB 4NU8X 1OWOA 2V7VA 3W3AD 4GBMA 2Q41A 4QZVA 1SVMA 3MWEB 5CM2Z 4N41A 4CMJA 1TO2E 4PF1A 5FUMA 3LNCA 1J06A 5ENVA 4CCWA 5EMKA 4DPKA 1Q83A 3IJPA 2BF7A 2FDRA 5EERA 2HJHA 1T0IA 2EKQA 1Z5PA 1DRVA 4GFDA 3D1JA 3ZNOA 4BFUA 3Q7PA 1UBHS 5I45A 4I1YA 2O7NA 3EVEA 3GP5A 2O7RA 5BSTA 3EF3A 3LLUA 2NSJA 2V6MA 1LI4A 3S6JA 4OKIA 3ONDA 4PC1A 4ZVQA 4DIBA 5EIFA 4H7FA 2FMFA 2JCBA 3FTCA 3H9UA 3LA8A 2XEDA 3MJDA 2X0RA 1MC1A 2ZRKA 3NHUA 1ADGA 2RK6A 2FN4A 1UMBA 3KQWA 4N47A 3K9QO 1XKTA 5E4TA 3DKRA 3WMEA 4N4AA 4AWBA 4LOIA 3W2TA 4BUZA 5LYJF 5JARA 2JKYA 4MPPA 2XQKA 1GFSA 3K2BA 2QZZA 4RVGA 2PWBA 3UK7A 4F1JA 3ZJUA 1I1QB 4D96A 1JBEA 2X40A 1S02A 4PLWA 1DRWA 2XKBA 3F8TA 1Y33E 1HOXA 5GONF 1LX7A 2XE6A 3D3KA 1LPNA 1XDGA 4J7UA 4MRVA 4ND6A 4US2R 1CNEA 1H66A 1VECA 1N9ZA 2QRVB 3A3YA 5AKEA 4Z0NA 5TPZA 5F23A 4UTVA 2Q3DA 3H1AA 4J75A 4N5HX 5DHAA 2CF6A 3LKZA 5EP2A 2W6ID 3H5NA 3ZH2A 3ZCQA 4MHTA 1GG2A 5CFLA 3Q87B 3VDXA 4JXZA 1OT5A 1VM6A 3RTDA 4Y0VA 5BN3A 4LKOA 3O5AA 3R0JA 1JZSA 4JJEA 2JCYA 1XQ6A 3DTVB 4GMFA 3ROTA 1DCTA 4BO5A 1Y48E 3X1JA 1QYXA 2WWWA 1CEQA 3PK0A 2PHZA 4EMUA 2XVYA 1RWVA 3ESQA 3L3BA 2OXFA 4KGDA 1X7GA 1A72A 2ZUUA 1OFIA 2ZIZA 4O3FA 4U7DA 1Y80A 4FFPA 3HR8A 4MJXA 4YMUA 4QYIA 5CK4A 1E92A 2ECQA 2GM9A 4IO1A 3RFTA 2YBEA 2P2YA 4RWEA 3W8RA 3X1KA 1W5AA 1XMSA 1BXZA 5JXIA 4NICA 1ZHFA 4AROA 4RE5A 2I4OA 1PAUA 3I0ZA 3KLPX 3LP8A 2VNHA 3P9IA 4UJ3A 1FDVA 2FUG1 4YT4A 3E3OA 4L9AA 5K6AC 3Q8KA 1TFUA 1ESDA 1AO3A 2G80A 1GKUB 3K35A 2H65A 4X1KB 2X41A 5DT2A 4E13A 4YEDA 4MSUA 2VVTA 4F9EA 5KWIA 7GPBA 2OHFA 1JPVA 3DE5X 4HAIA 4XVQA 5ESRA 2H52A 1CUYA 3FHCB 4I0WB 4YP9A 4ACAA 5I4BA 1W4BA 3GRYA 2CVZA 2J3LA 1BGWA 2WYHA 3MAGA 4IHQA 3UHJA 1G59A 3G2NA 5CR9A 3Q98A 4L4ZA 5EJAA 1XDBA 2GWRA 2SCUB 1QGUB 3OQJA 3UENA 1PG2A 1Z7WA 3GZJA 3IT0A 2Q5JA 3TAHA 3DP9A 3BG5A 2DCMA 2GAFA 5HSGA 1E3WA 3AHGA 3OQ6A 2CHEA 3IP3A 3U09A 3KG2A 2VNSA 1X8LA 4CMEA 2IY8A 3NHJA 1YQEA 2OCBA 1FDIA 2FPGB 2OM2A 3GLGA 2ZCJA 2YFKA 1WPGA 3T99A 1GGFA 2VSNA 5CTAA 5TQVA 1EM6A 1PDVA 2BMFA 1Y9DA 3EC7A 1HPLA 3OIYA 1SRQA 1Q50A 2C3UA 2OZPA 4YRFA 5K3OA 3L06A 1G19A 2ZE7A 1R6VA 3OZCA 4BNYA 1TKBA 1P2DA 4QEDA 1HYEA 3MWGA 5ALYA 4F96A 1XT6A 3RSHA 1G98A 3R7LA 3TW4A 1Q1AA 3O8CA 2GM5A 1ZPDA 3F6YA 5CXSA 2VFAA 3HDVA 3IQDB 1U7ZA 1P4GA 2B61A 3EF1A 3NATA 4WKCA 5H3LA 4YMHA 3CU5A 3LL4A 3ACCA 1WB4A 1VGRA 2CJXA 4RD0A 2XRFA 5B4VA 2WIGA 3DEIA 3NT4A 4KKVA 4OLFA 2PYIA 1NMZA 4FFMA 2ZIUB 3BXPA 1FMFA 3FNRA 4AZWA 2ZSFA 2LIPA 1K66A 4LMRA 4QPDA 3SP1A 2P27A 2Q5LA 2VDWB 2WAAA 2J8ZA 2XZLA 2R6CA 5AT1A 4JLOA 1OYWA 2O8DA 5BUQA 4Y2GA 4NJEA 3T8YA 1W34A 3UT0A 3ZTWA 1VFNA 4JJGA 4WBNF 4UCXA 3VNQA 2OESA 3GFQA 2Y71A 3AVPA 1IXRC 1L8AA 1X9IA 1PZNA 4J0JA 1HTTA 3HQ4O 1UBLS 1LLQA 2ECOA 3KR1A 4ZA2A 3ELWA 3WP0A 2JKZA 1NOJA 2IT1A 2QGNA 4JJ7A 3HZZA 4RKYA 1GFIA 5JPDA 1TMGE 1VOTA 1TLFA 2WJPA 1VI6A 5A7GA 3MBIA 5KVAA 3OU6A 2R5FA 3TEMA 3OTIA 3SQMA 2R7AA 4NCJA 4O2BA 3HXQA 4PYIA 3GBSA 2BZ1A 1H2BA 5IFKA 4RKWA 3KKEA 4M1TA 4JP1A 1Z0KA 3ZCRA 1KSHA 2G7ZA 2H5IA 4BWFB 2OVBA 4XOIA 3VPXA 3S8YA 3KZOA 3OBIA 1NVUQ 1R50A 1IBMB 2PLWA 2B3TA 1HC7A 3U0VA 5CFRA 1LK7A 3IFSA 2VUHB 1ZN2A 1OASA 3NOXA 1A76A 5FT9A 3S40A 3X1YA 1THGA 1V2GA 1YR7A 2AG0A 1MFZA 3ONNA 4PINA 4ZZ1A 5CA1F 5J4KA 1AUXA 1VL8A 2IOFA 4RLHA 4F8EA 2ODEA 4DIMA 2XCRB 1KRXA 1RHUA 2QN6A 4OJTA 5FX2A 2RGCA 1PGNA 1QE3A 5FA5A 1A98A 3FF1A 3UOWA 1QRAA 3NU1A 4G0UA 2POQX 4P3XA 3ZHRA 4OLBA 5EXEA 3T7IA 5I7UA 2ANCA 1I8TA 2EWWA 5E7JA 3THWA 3G5LA 1Q0TA 5KQGA 3EZNA 3O92A 5A2QA 2CMKA 3K15A 1M6VB 1LNZA 4V02A 1IRXA 3U48A 1MF7A 2DTEA 4DL9A 2CHUA 3ZDFA 1L5RA 5KTYA 1HKUA 3FZYA 4WHMA 1RD4A 5FOXA 2I3GA 4DT1A 1ODFA 1KVSA 4NCIA 2CJPA 3AUUA 2PUDA 3GRFA 1E1QA 4K2AA 4HDMB 1C7JA 5ALFA 3JPWA 3RSGA 3JXEA 1D3AA 1EUYA 1Z47A 2PCJA 3DWEX 3EHDA 3IUQA 5CIQA 1GTJ1 1N1EA 4L2IA 2H5LA 4ZU6X 2K87A 1QIGA 3LCCA 5FTKA 3T06B 4QDKA 4AKEA 4MRMA 1XMIA 1ZA2A 1TC1A 1PGJA 3GR6A 3RS4A 1QBGA 2NVUA 3AETB 1XJ5A 3QMVA 5E0OA 4MUYA 4J76A 2B35A 4L0CA 3UJDA 4F45A 5G1PA 4R8SA 2WHPB 3PHHA 2HCFA 4QSMA 5J4LA 1R0KA 5IRCD 1V5FA 2FLKA 4X93A 3A6FA 1KK0A 4Z6KA 4G1UC 2P8JA 3L5KA 2FZWA 3KXDA 4O4HF 4WLOA 5BVHA 3W79A 2OTCA 4JY7A 1R0ZA 3HJUA 4ZXPA 4EGJA 4HKTA 1YH3A 1MN6A 1Z8DA 2ZE8A 3LL7A 4MS1A 4XTRA 4C7BA 2HUPA 4F5YA 5NULA 2QAGA 4BLVA 3HA5A 2COKA 2V0NA 3NCHA 1JDVA 1T6BY 2CMGA 2FDXA 1NBIA 3FCCA 5BW4A 1YFJA 2HYIC 3ZWMA 2CWDA 2FSPA 6PFKA 3GDWA 4QNMA 4NNPA 3BJZA 1QNLA 2XUAA 3TZKA 2AUTA 1DC4A 3O95A 4IZIA 3IS3A 3M4ZA 4LK3A 3HJBA 1WG8A 2ZJ8A 4OHZA 5BMVF 4PIMA 3S28A 1N2JA 5DCUA 2RI0A 2GO7A 3OZDA 3DEFA 3WLPA 3W77A 3ZK7A 2Q3LA 3NGXA 5A02A 1JXAA 2CHGA 2EP5A 3FETA 4KO2S 3G0DA 4F5EA 3TDMA 5DE3A 3NKLA 2HJWA 2ISQA 4F4HA 2B7LA 1R18A 1ZC4A 4WFJA 1EFVA 2EV9A 3PE6A 1Q3TA 2AOUA 2XAUA 3LC0A 5E2IA 5EXPA 2WY2D 1QQBA 1BQ3A 2WKSA 4G23A 5BOSB 3G5AA 3ER9A 3MWEA 4G5RA 1T3LA 2I6TA 1WVGA 1B0ZA 1LBIA 4BX9A 2NO0A 4EKIA 1MX9A 3KKLA 1JV2B 5DK4A 4OBBA 2AC4A 2OPBA 4LHZA 4Y18A 1NJ1A 2BI4A 3L79A 3GFTA 5CGQB 3WXMA 2O8FA 1WCIB 3DZJA 3E15A 2AF4C 4X95A 4JLMA 1QAQA 1SB9A 1YL6A 4MGZR 4UVHA 4CLDA 5IBCA 2DUJA 3K1AB 1K8XB 1DAPA 3NUZA 4RCVA 1SEPA 4NLLA 2G09A 2NV2B 3F6EX 4LXIA 2ZB2A 2RC6A 2UYQA 4FQ5A 3NC1C 1FDWA 4KGXA 1WPXA 1X7XB 2JFOA 5BVGB 1BDBA 1UEXC 1GNPA 3FCYA 3WGTA 4CKZA 5HILA 2R8ZA 2HRBA 2EYUA 3NTVA 3ZWNA 1XXHB 4U2EA 4ZAZA 4RZQA 2BHRA 2X5NA 5HOQA 2JRCA 3A11A 3F9CA 2I3ZA 4JLUA 3BJMA 1RZVA 1K98A 4KODA 4NEQA 2GZ1A 4B83A 5JCZA 5BV2P 1JLHA 1SCDA 3WLHA 3CLUD 2WG1A 3DULA 4J3FA 1ORTA 1OFHA 4OHXA 2FRXA 1XZEA 1OXUA 3LLMA 3GCZA 5ECWA 3VPGA 4XI9A 4NG5A 3HDYA 2BKAA 3KUUA 4YALA 2APJA 1U7WA 5AXCA 5KNBD 3O2SB 2R1ZA 3OQIB 3BF7A 4KR0A 4F8JA 4UU7A 2PSDA 3HBAA 3R3HA 5DDIP 3SVZA 1V26A 1I36A 2JI9A 3WHLA 5LKAA 2OD2A 2BBOA 5IANA 1W1UA 1LSJA 1TJ5A 2E85A 2MSCB 4C9BA 4BTEA 2O1EA 1L1EA 2PZMA 3GQBA 1UKBA 4PW0A 1QR2A 5H02A 3F2VA 3QNWA 3STUA 5J5VA 1VCNA 1VHWA 2H5EA 3FMFA 2PT7A 5IWAB 4XUGB 1E6EA 1YQGA 4RJIA 3TOVA 3HYSA 2QXUA 4K6CA 4HRVA 2NU6B 2VF7A 4MW5A 2IJGX 1KKMA 3WWYA 2Z9DA 4TYMA 4Y67A 5JQWA 4ZAXA 1A9RA 4YJ3F 2J3EA 3RSQA 2UVQA 1BHQ1 3OPYA 4QYXA 1QGOA 4JJZA 1YZQA 2XJ4A 5FNVB 4BVJA 4ZJUA 5MF6A 5DNYB 1Q91A 2CUTA 1YV9A 4HWGA 5DOVA 4OL9A 2XUPA 3V2GA 4L02A 3T7RA 3VTKA 2NUPA 2EKZA 3KELA 3DUFA 2ORYA 4OHYA 3V46A 3NYRA 1B1AA 5JIBA 221PA 4MS3B 1Q21A 1M33A 1Q11A 5BMOA 1L9XA 4KK4A 2A0KA 1QGUA 1X94A 3DZGA 4QOFA 4AX8A 5K4GA 2UUAB 4V39A 4TZKA 2XDYA 1YA8A 1OT3A 3DHWC 1J2TA 3L8DA 1BS9A 1K0FA 2BI7A 4DYDA 4B3RB 4IJUA 1YB1A 4H6WA 4UXJA 5FPYA 2CNOA 4M1SA 1TLLA 4EFLA 5LKRA 1E1LA 3FKSD 2MSWA 4IJWA 4JJAA 3CZAA 2OZLB 2Q62A 2QPLA 3SBXA 5HKAA 3QF4A 1KYZA 2XWQA 1M5RA 3G8BA 2IDZA 4ICIA 1LDEA 1M8FA 3I9JA 2OENG 2O8BB 3FNIA 3CEMA 3P9SA 3OP4A 3GW8A 4JXKA 1PFWA 4KU4A 3GHYA 1THTA 1A8QA 2CT8A 1PFKA 5FEUA 3KB6A 2ES4A 2QYOA 3DAPA 1CUDA 3SQWA 2E49A 2DFKB 4Q3OA 1Y4ZA 2C54A 3ORHA 4YJGA 3K1JA 3UUFA 4CV1A 1M2JA 1WL8A 2AWNA 4WKBA 4AMYA 4LVNA 2CJWA 1JMKC 1A71A 1L3IA 3ND6A 2NM0A 2RE8A 1KGSA 4LZPA 4MPRA 3SXPA 1ND6A 2BMJA 1ZA1A 3IBTA 2QX8A 4PEVA 2P90A 4ZCLA 2RH4A 1SBCA 4I6JA 5H9WA 1N7JA 2Q3MA 1OTHA 2EZTA 4JI0B 1E5XA 2AX3A 5AQ1A 5EKSA 5IUJC 4F4FA 4OQNA 4UU8A 2ZUEA 3ESCA 4MEBA 4WESB 1J0DA 3E5HA 1F4VA 2AR7A 2MR6A 4C1NA 4YPOA 4I9UA 4RZ3A 2RGYA 4FOOA 5FLYA 3M4NA 4A5OA 2PZBA 1MGOA 1NULA 1MO2A 4W8OA 3M8KA 4EQZA 3OWHA 1K7XB 2GPAA 4TS4A 1K27A 1GT6A 1PJ2A 3SFVA 4C88A 5ITSA 2CFRA 1N6OA 4W7SA 1WQ4A 3WBFA 4CL2A 3HMQA 3KTAA 3LLVA 1XNJA 1N6KA 2YVLA 4HVCA 2NACA 2BL4A 3GVXA 1KH1A 3P52A 1UINA 5FWDA 5HG0A 5EJ5A 2ESRA 2VQEB 1U3DA 3FYUA 5JD6A 1E79A 1ML3A 3GJRA 1IY1A 4M76B 2BTEA 2C9ZA 2CE7A 2OCKA 3TINA 4WZBA 2FAXA 3QX9A 3SFTA 1XTVA 2VZ8A 4M7OA 1N2OA 3OZGA 4RV9A 1HA3A 1ORHA 1SR8A 3LYHA 5DSTA 4MVJP 1WCWA 4RPIA 4A73A 2WMDA 3WLKX 3KKKA 2R1TB 4G0MA 4OQZA 4AJ4A 4E7PA 3HXPA 3BJEA 2EZUA 2JCSA 2QVXX 1XJQA 3CURA 3ZI0A 2P1RA 3ETLA 2VNKA 2O2EA 1M7BA 5EJEA 1IL0A 1KDZA 1AD2A 5FWAA 1RWMA 2AFHE 2WIKA 2Z2JA 1O96B 3DXXA 5DXAA 5EG5A 1NW9B 4WCFB 1Z22A 4D56A 5AVVA 4LRQA 3AEKB 1OLSB 4X8LA 2A78A 2J30A 4A27A 2WFAA 4DUGA 1M6VA 4AJPA 1OCEA 1P7WA 1TI7A 1VMIA 4MI1A 3I9V1 2PIAA 1P7CA 4MRAA 2C8LA 1RZUA 5IT0A 3TI9A 2L19A 2ZE6A 2WT4A 4HZUB 5T3UA 4BNXA 1SXPA 2JIBA 1MAWA 1T0BA 4ISCA 3PDIA 3S7TA 1NBAA 3CVXA 1ATIA 2OV6A 3BJRA 3WGJA 5ERGB 3SHOA 4LOJA 4CLHA 3U7FB 3FSGD 4UHCA 4C29A 2C2KA 4XX1A 4ZI7F 1COZA 2FHPA 4DXHA 1UK8A 5K4AA 1N0HA 2AB0A 5DN6D 2WQ7A 1GTSA 2B4RO 3IMFA 3NR2A 1ZCFA 2LCQA 3UG7A 3GELA 4FYPA 5DHTA 3PL5A 3JASB 4OG2A 3VYVA 3F7TA 1XHFA 4HP8A 2CXUA 3WNDA 1E6MA 1TW2A 4KMRA 4AYTA 5K6TA 2D4HA 1TE2A 3RKUA 2O48X 4A36A 4CR6A 2XVXA 1W25A 1R4AA 1GPLA 1Y1RA 4AZ0A 2Y0CA 3PXEA 1JPNA 3TB4A 3EDYA 3HN6A 1QORA 3D4IA 4JLBA 4LAFA 3HXKA 4MUHA 4B4VA 1IATA 3F71A 1UP7A 1FJ2A 1W2WB 1UZUA 2OV4A 4Q47A 1JE1A 1GGJA 4NG4A 3A3NA 1WCV1 1NSFA 3UPTA 1YMUA 1E7YA 1X0XA 3BXZA 2VPXA 4XB2A 3JWHA 3RVLA 1ZK2A 3PGLA 3KETA 3GLIB 1XMOB 3VGPA 4OFBA 2G9ZA 3BKXA 3AXTA 4O0LA 1D9ZA 1FRZA 1O94D 2IRWA 1C3VA 4ZT7A 4YH1A 1WDTA 1WXEA 2V58A 1J4AA 1K06A 4K1XA 4ZREA 4H35A 3W7VA 1KOGA 3B1WA 4FOSA 2XTJA 2AJ8A 1TA0A 1B1CA 2GTIA 2R751 2XDQB 1S8AA 1Y98A 1T43A 2QM8A 1EBBA 3IC5A 3IUBA 4NU0A 2BFFA 2DWOA 5LQJA 3K0AB 1Y1PA 4MP3A 4D9JA 4CLXA 1SY7A 1E77A 2ATXA 4EPWA 1IUOA 3A7EA 4JUFA 4BGIA 2ZLBA 2I2AA 2RH9B 4G5SA 4MV9A 5F2KA 1H9AA 3T1HB 4KIJA 3WK5A 5FD8A 3UXHA 4Q1FA 4DV7B 3IIMA 3U3XA 2OLEA 3EGCA 3JZFA 4JBHA 2ZTUA 4PPYA 4BASA 1N6RA 1W88A 3KR0A 3L0ZA 3OETA 4JOBA 2H59A 1J20A 1CTQA 2QS9A 3BS4A 4MJLA 4R3WA 2D62A 5DLEA 3EYAA 5DCWA 2C3YA 1IZZA 2QR3A 1O8BA 1ZBDA 3FIUA 3GAFA 1SWWA 1NWHA 4D26A 3KYDB 1M2HA 2IYTA 2MYNA 3BIXA 3KCNA 5FV7A 3ZWPA 1EUQA 3G49A 3BWEA 3X1XA 4JLVA 2O2ZA 4MYCA 3ZE0B 3KHKA 3WB9A 4HX2A 3GV0A 2JJ8A 1FU4A 1HMYA 4P58A 3VSDA 4O02B 1QIHA 3ORQA 3N2KB 4MCHA 1CKEA 1LUAA 1V25A 3I2IA 2YV4A 2R8XA 3I01A 5E7IA 1W9HA 2W8BB 2GZRA 5BN1A 1Z4MA 2WYIA 4DR1B 3ZNNA 4K9LA 2G82A 4DWVA 5DTEA 4GWLA 1DPGA 4KDFA 2ECFA 1UZNA 1EQAA 4WXRA 1QPZA 4LF6B 5DM1A 4OHPA 3SEQA 2ONKA 1E2LA 3NM4A 2IBMA 2NTNA 2WU0A 2VBGA 1FVXA 3HCFA 5FFMA 1BD3A 3SEFA 1FYDA 4GPD1 1VYVA 5KWVA 4G5OA 1CLUA 2FR8A 1SULA 3F5MA 4HYQA 3VPCA 5CA0B 3V8EA 1BZYA 1FL9A 5U4XA 1TF5A 3KT3A 5A5VA 5C1BA 1B23P 4L6IA 1NN3A 2Q3BA 3EMVA 1OFVA 2DBZA 2OXRA 1GFWA 1HV8A 2DU8A 3B3FA 4B7CA 4BS9A 4AWAA 4YUZA 5HGXA 5LJLA 4DR2B 3CONA 5FOQA 1C7ZA 3DAFA 3NTOA 3OQIA 2EFJA 1L5KA 5LP1A 2FN8A 4UKDA 4PCUA 3OIVA 4XVRA 3U1BA 4Q21A 5JZBA 3O1JC 4CM1A 1KSJA 4P8RA 1CNMA 2A9JA 2YY6A 1NN5A 3L6UA 4D74A 1A4XA 4LZJA 4LK2A 1U3FA 2HA3A 1Y4SA 3OE1A 2AFIB 3KSUA 1POXA 4AD8A 1OFUA 4KMSA 4PX9A 1MLDA 4M1QA 3FUUA 3VVBA 5C4IA 2C1EA 4GLFA 3BWBA 3C7TA 2VH2A 2QZ9A 1G3QA 3VO1A 2EJWA 4KQGA 5THKA 3P26A 1YVEI 4R4JA 4TLDA 2C9YA 2UYYA 4GOKA 4QPCA 3GEDA 1TLTA 3BSYA 1GZ6A 2NUBA 1UM8A 1T8PA 1R00A 3RROA 1J24A 4KX5A 2BPOA 4BLSA 7AT1A 2QTGA 2XPCA 1ZRMA 4JJ4A 1NVFA 2AXEA 1XRNA 2Q28A 1KI9A 3PEEA 1C7EA 2I8AA 1GTG1 4HQLA 4E30A 2HMWA 3UAXA 2X5KO 2NP6A 4MDFA 4Z3KA 1GY8A 4CKCB 5FB3A 1ZNYA 4ZPXA 2DFLA 4AUEA 2ZSHA 1RE1A 4AAYA 2B8JA 2QRLA 2IVFA 1WEHA 4PLCA 5L9AA 3ZW9A 1E3DA 3F4LA 1FVFA 2ZAMA 3GVPA 4LSMA 2DLCX 4NOMA 3RVOA 3WKDA 3BVPA 2IL1A 1G1MA 3OA2A 3GARA 4IM7A 2PCLA 2ZJ6A 4ZI2A 1FOEB 5LYJB 4JGGA 1W1IA 4ND5A 2OZLA 4O2LA 4REMA 3UEOA 1G20A 5C4GB 1KJWA 2YCBA 2HLDD 2P4SA 1MOZA 1Y3CE 2BFDB 2VDLB 3SZ3A 3T1TA 4ZU3A 3T3PB 2W6MA 4D9BA 4G4SP 1FC0A 2I03A 3AEYA 4N3BA 5GONB 3VU9B 2XODA 3PNOA 4U2DA 1KO4A 3TO5A 1ZAYA 1SM4A 2PKQP 4BN4A 3CJRA 2A5DA 3I45A 1FRFS 4XM0A 1KC3A 2BV3A 4HOYA 4QAJA 3TR0A 1YGPA 3QHQA 4IIBA 3ELUA 3AWIA 4MAMA 3IB3A 4GKVA 3G59A 4Q3DA 4RSMA 2N0SA 2OG1A 1U5CA 2IXDA 4EPRA 2PQ2A 3B2NA 1OMOA 1EAYA 1H6DA 4UU1A 3W9BA 3DNMA 4L50A 4RANA 1LVUA 4S0ZA 5JDCC 4PICA 2X76A 3KL4A 4ZVTA 3OE7A 1W35A 3TR5A 1XZQA 3AV3A 1U3UA 4G5YA 2PSSA 5F5LA 1R37A 1Y4UA 3ZVNA 4H1TA 1HDCA 4OGFA 1GRCA 2YZKA 2CCKA 3TLJA 4NABA 4LY3A 5JVDF 2ZUCA 4CV2A 3EXHA 1BVHA 4ESHA 3UC5A 1P1JA 5E7QA 4HF7A 2R6ZA 5EJFA 1PL8A 2C5BA 1P6XA 4TWRA 4D57A 5HZKA 3ZVMA 3O1LA 3IAM6 4N18A 4EH1A 4JBGA 1WM1A 3IUJA 5ES4B 2DR2A 1ZZGA 1H93A 2NW6A 3TZLA 2IZ1A 3R09A 3L1VA 2VP2A 3AR4A 3HFRA 4MVJA 2HIHA 1R15A 1B3BA 1UFOA 4G8DA 4MITA 4U63A 3WBKA 5B36A 3LCMA 1N78A 4CEHA 5JD4A 2DTDA 5FA8A 4YPFA 4HB4A 1GPUA 4DA9A 3PUYA 1VE7A 4ZRDA 2WF8A 1MGPA 5DYGA 5HF6A 1AO0A 4RETA 2BYTA 1YDEA 2AL7A 5JNSA 3M9XA 3H1BA 2WJ3A 4M8NE 2JLRA 2FPIA 3RYCB 2B2XA 4RHTA 4YHBA 2VPWA 2XNDD 1U0GA 1JR3A 4U2BA 5J40A 1YUBA 1S3FA 3K70C 1C9JA 1YS9A 1XWWA 1OFGA 1SFRA 1XHLA 1M1XB 2MSKA 4M1OA 4RW0A 4ZJZA 1G8PA 3KJGA 3QFFA 2Z3WA 1IY8A 4D9IA 2QDKA 5A4KA 3TWOA 4EKNB 2NX2A 4L85A 1ND5A 1SOMA 2G5PA 3EARA 4MINA 4R1LA 4ZTBA 3IBYA 4NU6A 3P9NA 5CX1B 1O96A 1O58A 1E2HA 3HB5X 1GNTA 2X5OA 1T8TA 4M1EA 4DQVA 3IV9A 3M3PA 4QGHA 1OBOA 2VP9A 1PUIA 4ISBA 4AY3A 1SC6A 2DUWA 4NOKA 4Z3OA 4G63A 3ZVLA 2DJ5A 3DTNA 3PEUA 1Y4AE 4BQFA 2P6OA 3DHYA 4FNAA 4WXEA 3AY7A 3PHJA 1XYGA 2J5XA 1Z25A 4DCGA 3BGSA 5BQ3A 2HOQA 2C92A 3Q5EA 4MLZA 1DI0A 3ZH9B 1J9EA 1JNXX 4G1FA 4LRXA 3X44A 5D3KA 4EZEA 3B5EA 3KYIB 2VTKA 1Q7BA 3L6CA 3QXHA 4IEFB 4KQCA 1N6HA 2IEBA 4AP6A 2J9YB 1SVWA 1YZFA 2CD9A 2OK7A 1QYDA 1TFRA 2W2QA 3BD8A 2BFCB 1Q19A 3DBIA 3PRJA 3T3HA 2MINB 2PVSA 2NSYA 2ADMA 5BSGA 4DA8A 1IQ0A 2JNWA 2YJ6A 2E89A 1DV2A 2G72A 4N65A 3TW0A 3V2UA 2ZATA 2CXXA 3P9RA 4R54A 4WBNB 1WHTB 3JASA 4TL8A 5CFPA 1KC1A 2WAMA 4PQGA 2GTHA 3RHFA 1YKFA 2VBIA 1MW8X 1P3JA 1G41A 5E8JA 2WPDA 1RHMA 2JCVA 4LQCA 1IM8A 1BE8A 1ICEA 4YVFA 1J0BA 3B6KA