4FI3F

Structure of vitamin b12 transporter btucd-f in a nucleotide-bound state
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
245
structure length
245
Chain Sequence
AAPRVITLSPANTELAFAAGITPVGVSSYSDYPPQAQKIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKVMWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFGINPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITGGPDQIPKIKQYWGEQLKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vitamin B12 import system permease protein BtuC
publication title Structure of AMP-PNP-bound vitamin B12 transporter BtuCD-F.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 65
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2012-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4fi3F01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4fi3F02
2RG7A 1K7SN 3AEQA 5JJ5A 1FP4A 3R5TA 4OXQA 2OGWA 4G09A 5GGYA 5KOHB 3PDIA 5BVGB 4WESB 4FI3F 5BVHA 2XUZA 3AERA 3MWGA 4OVKA 3EIXA 4TKUA 5M2QA 3AETA 4XPIA 1M34A 3ZKAA 4HMOA 5I4KA 4NNPA 3BE5A 4MX8A 3AEQB 1MIOA 4OXRA 3MFQA 3ZK9A 2R79A 2XQVA 3ZK7A 5KOHA 5BVGA 4PAGA 2ETVA 4WESA 4CL2A 4H0FA 4WZBA 1QH8A 1H1LA 2PS0A 1K0FA 3AETB 4XPIB 1M34B 3K1AA 2OV1A 1M1YA 5M3BA 2MINA 1L5HB 1MIOB 4MDYA 3TEFA 3LHSA 1KAHA 4HMPA 4UDNA 1N2ZA 2YNMD 5M29A 4MLZA 4WZBB 1QH8B 2OV3A 3ZK8A 4MO9A 2XH8A 5HDQA 3MD9A 2YNMC 1H1LB 2WI8A 1L5HA 4TKVA 5B58T 4H59A 1KAEA 2PHZA 3K1AB 3PSAA 1M1YB 3BE6A 2MINB 2QI9F 2Q8PA 2M6LA 3ZTTA 4WN9B 4G07A 1QGUB 4WNAA 5CX1A 1N2CB 5CR9A 4GICA 5JOQA 4LJSA 5KOJB 3PSHA 4TKVB 1EFDN 2WHYA 4B8YA 3TNYA 4WN9A 1G20B 3U7QB 3AEUB 3NU1A 1QGUA 3AEKA 2XV1A 1M1NB 4LS3A 4WZAB 1KARA 5HX7A 1N2CA 3CX3A 1K75A 5M34A 4M7OA 4WNAB 4UTPA 5CX1B 2AFIB 5GGXA 2AFHA 4HN9A 2M6KA 5KOJA 5KHLB 5JG7A 4FNAA 4INPA 1N4AA 1G20A 4FKMA 1G21B 3AEUA 3U7QA 2Q8QA 3AESB 3R5SA 1M1NA 4WZAA 2XDQB 4INOA 2XY4A 1QH1A 3AEKB 1XVLA 2PS9A 2AFIA 1K2VN 3HXPA 3MINA 2AFHB 4N01A 3EIWA 2X4LA 3HJTA 1G21A 4UTOA 2O1EA 4ND8B 3AESA 2R7AA 2OSVA 1TOAA 4BBPA 1N4DA 4UDOA 2XDQA 3GI1A 3TLKA 3LI2A 4IRMA 5FLYA 1PSZA 1FP4B 1QH1B 4PM4A 2PS3A 5JPDA 1ESZA 5AFSA 3UJPA 4FILA 4DBLE 4HMQA 3MINB 3MWFA 2PRSA 4ND8A 3PDIB 4NNOA 4K3VA 1PQ4A 5BVHB 3AERB 3HH8A 3G9QA 4TKUB
chains in the Genus database with same CATH superfamily
1TCUA 3KB6A 4WK0B 5CTAA 5JSFA 2CYCA 1KTIA 3QFTA 3N75A 2XSZD 2GZSA 4EA7A 1Z3IX 1HZJA 1H2WA 2IGBA 4QU5A 4YRRA 5BNZA 5BYBA 2FPWA 1EVKA 5AM0A 1Z13A 3RIHA 1WXHA 3SQNA 1MZVA 3RVQA 3HJFA 1C4XA 3PR3A 3N2LA 2I1QA 4UBIA 5M2QA 2BFAA 3NV7A 3ZY3A 1E2HA 2ECQA 1E1DA 1N92A 5D2CA 4AZWA 1JV2B 4E13A 2PYDA 3QOYA 1ZIPA 5ABPA 3LIPA 2C9CA 4KXNA 2V7EA 1PWYE 1R0KA 2A9OA 3KDSE 3OEWA 4LIPD 4UU8A 2CXTA 2J31A 4OH1A 3ECSA 3TL2A 5L7WA 3UTCA 1M5UA 4W1QA 2I54A 4WZBA 2PT5A 5FR1A 3SF8B 5LPNA 3VYWA 4H7KA 1SUSA 1YXMA 3DE2X 3E7XA 3LLMA 4WA8A 1P29A 3ELYA 2CXRA 3HBAA 3V4LA 1GAQA 4P80A 1TB4A 4V0OA 4J2TA 4PAOA 1YOVB 3OG9A 1U94A 4EZIA 2WIGA 4G5SA 1KDTA 3VJKA 2JFXA 4PC7A 1GCUA 1Z4MA 2F90A 3VU9A 3RS8A 4U63A 3V34A 2IE8A 3L5KA 1JRLA 2UYCA 2O14A 4KDFA 4ZALA 1XQXA 2EW8A 2F4NA 3KTAB 1OLSA 4V0RA 4WUTA 3TF5A 4P93A 1NVBA 4XFDA 5BSRA 2VP6A 2JAWA 3P32A 1EUZA 4EENA 1XYVA 2WF7A 4ZT6A 5AKLA 3TRFA 2RSLA 5DULA 3T7IA 3K6KA 3MS2A 1E99A 3DOUA 4TL8A 4Q05A 3QEJA 4DM7A 5CD1A 1NLFA 3I1IA 2PL3A 4ZQCB 5F7ZA 1JMKC 1EXDA 2FSIA 2D0DA 1GZVA 4R31A 3LGXA 2JAOA 4KDEA 2L18A 3FJ1A 1W2WB 5FUQA 1T2AA 1M8JA 1G2QA 2IYTA 2RCYA 4PAMA 4E0BA 3KVNA 1H0SA 3DMNA 3HDTA 4G5HA 4PYIA 5EJEA 1BGWA 1P1IA 2JZNA 1YBFA 4X6XA 3O4FA 4D8UA 5EJ6A 4R4JA 2WFMA 2P8JA 4KO3S 4PZDA 3TFWA 4IJUA 4QUEA 3S2FA 1AGRA 1BGXT 3O92A 1AGYA 1DAMA 1VSVA 1MVOA 3II6X 3WZLA 1M6VB 4Q24A 4POAA 5AW2A 3R20A 4Q37A 4PYOA 1Q1EA 3U62A 4D5GA 4P2BA 4GR4A 1A9QA 4AK9A 3U6KA 1UEJA 1X1CA 3JYLA 4RXTA 3K72B 2EZUA 4QYSA 2ORYA 2J4FA 2A0YA 2O6LA 3GBSA 4HS9A 5P8WA 3WWZA 2AFHB 1K6MA 3R3YA 5DNUA 2Z5VA 4E70A 4RJLA 1Z5ZA 3A3OA 3HFGA 5C8XA 2E5WA 2XE8A 5JAMA 1LD3A 3DHYA 3H8VA 2C54A 2ISCA 3TR6A 3NGXA 3ZZ1A 5JALA 1X8LA 1FC0A 3Q7PA 1DPGA 1NAIA 2WAOA 1UZNA 2A4KA 3HUUA 2O3TA 4KSYA 3R7DA 1MC1A 2WJJA 3DDOA 2NPFA 2I3BA 1YNSA 2CMHA 3LUDA 4ZN6A 2NP6A 4NMLA 2ATCA 4NV3A 4I1RA 2QAGB 2YCBA 1C4KA 3DAOA 3WWOA 1E79D 2CLOB 2J9GA 3DE4X 3G2QA 2PH5A 4IJKA 5B3JA 5HFJA 1EWRA 1IN7A 4MRNA 1AZLA 3FCEA 2IIVA 3LBIA 4ZCQA 5L4SA 5BRNA 3HRHA 3PU6A 4EEKA 1Y48E 5C5DA 3CEPB 3I6QA 3IL2A 3AR5A 1TC2A 3G7NA 3LAWA 4JLJA 5HZMA 3EVGA 2XUZA 4AKIA 3T3PB 3LQFA 4ZO9A 2BGTA 3BGIA 5DYYA 5KVVA 4B3FX 2YFYA 3KLMX 4ARSA 4FFNA 4G9BA 4YNBA 3T7DA 3C6QA 5FI0B 3Q1KA 4QRDA 3RHZA 2HWYA 3GLRA 2CLCX 1NLZA 4HLUA 4ZV7A 5LWQA 2MR6A 3BXPA 3A05A 1QB7A 1VHWA 3L7JA 3IKVA 5JVDF 1X0VA 4DCPA 3LCUA 4IXTA 1W73A 3CH7A 3D7LA 5HKLA 4TS3A 3TFOA 3H04A 1EK5A 2EG5A 3VR3A 2IFTA 3BAFA 2H1VA 1FU4A 3A3PA 5FHQA 4A2CA 1SU6A 4TZKA 2H0RA 4F11A 2IKQA 2IK8A 1JVNA 1EI9A 3TNDA 4BFXA 2BR5A 3I6IA 4WJKB 2C5FA 3L49A 3R5KA 3T9EA 1FLVA 5J4YA 4L5BA 1K7CA 2XTMA 3SR3A 1DHRA 4R0NA 1PQPA 2F48A 1QMPA 3KELA 3T7RA 1ZD8A 3EZNA 5AICA 1NJ6A 1G7TA 1I4LD 5U4QA 5CH3A 2J3KA 3MGKA 3ZWQA 5K45A 1FPQA 1OAOC 1Z18A 4JOCA 1M0SA 3PYXA 3IT1A 4A3SA 1AHPA 1BH6A 1KAEA 3HFSA 1DPFA 5FP0A 3OJFA 3HA3A 5KYUA 3IESA 2R00A 4ZYLA 3H86A 3LUHA 4B2PA 3UMJA 2ZS7A 3EBPA 5TVGA 1CF4A 3EUWA 5K0EA 2YY6A 4EO4A 2BFDB 3CYFA 3ZWKA 1Q16A 5E6UB 5K8VA 3WHKA 1MO6A 3KUKA 2CXNA 4B7CA 5E38A 5JECA 1CR2A 4YVFA 5ALLA 3IHKA 1P39A 5G3ZA 1D07A 2IX9A 3K0FB 4BFCA 2IWHA 3LL4A 3LOPA 3JU3A 4YDSA 1ZH8A 3NTQA 1G8GA 4XI9A 3GMTA 2WW8A 1L7VC 3PRYA 5I3CA 5ALMA 4U2KA 1MX5A 2HHCA 5I7EA 4PAQA 2F3SA 1JQDA 4WCFB 5HJ5A 1CP3A 1HSZA 3QTLA 4G0QA 4BFVA 5K2MA 3ZVRA 4MHOA 2GPYA 1F6DA 1QPBA 2H63A 3MOSA 2Q0QA 4FGJA 4ZWNA 1ZD4A 2IC5A 1WB4A 2QTCA 1H3FA 3VDMA 5C5EA 5HVNA 2PU5A 2VYNA 3ND7A 2WTNA 1EGAA 4V0NA 3D4BA 4B4OA 4KR3A 4LV8B 1ID1A 3GZJA 3T06B 2I9PA 1K63A 3Q5EA 3W0LB 4PF1A 2ZIUB 3ZJ5A 4HVCA 4YJ2A 1TMOA 5IVHA 2F1KA 3GZNB 3QE4A 3I64A 3Q8XB 5I4CA 1PG2A 1OILA 4Z0HO 5EY5B 5LOVB 4EIWA 1OMOA 4HVLA 2ZXEA 1OYOA 5K0LA 2OAQ1 4GPIB 2QX7A 5BSVA 3UJPA 3E27A 1TUBA 3TPZA 5TVKA 4MS1B 1R4MB 3D7KA 4H1TA 3D8BA 4HNGA 3I30X 2AF3C 5AMXA 3HXOA 5A5EA 1RWWA 2N47A 1KYXA 2WOOA 3PDUA 2GAAA 2QP3A 4FD2A 2V6IA 4LOIA 3AK4A 4OH7A 4N6OA 1XMIA 2PKRA 4RULA 3HFRA 4HUQB 5IAJA 4OXQA 3D8HA 4GZLA 2UUBB 4M46A 2VTBA 2IDKA 4EB0A 2GBPA 3NANA 1F2UA 3CVVA 1ZP6A 2ZFUA 1AV7A 2CYAA 4M0KA 2VZLA 3LCCA 4BNGA 5CDUA 5TQ0A 4O2LA 4P4SA 2HJHA 2ILVA 5ITSA 2GDZA 2NIPA 3ZDFA 4ZTUB 2YHIB 4HMOA 4FFPA 4QQKA 3KU1A 2HK6A 4Y2SA 1IZ7A 2ZJ3A 5IT4A 3KOYA 4YLYA 3OJEA 4JWKA 3FPBA 1T4BA 4KFUA 4QYWA 3HP4A 1T2CA 2WF5A 1PV4A 3H9CA 4KUEA 2MYNA 2VSYA 3CX4A 1J23A 1D0VA 4EPRA 5F23A 4JEUA 4RY0A 1ZRSA 1UFVA 5FF9A 5KWSA 1H4SA 1NQTA 3ILVA 2RARA 3IIEA 4W82A 4C0SA 4W9NA 3MYRA 1SY7A 2VNIA 1EFTA 3I04A 1P0QA 4CTMA 2O8BA 1DKLA 1M6YA 2PU7A 2WFAA 3O26A 2A92A 2H8KA 1DE0A 2JAQA 3NTOA 4P0TA 1XFAA 5FBZA 1EUDB 2OOKA 2H2HA 2P6PA 2XB6A 2Y77A 1W5FA 3LWZA 4L22A 4YRKA 4UDNA 3GJTA 3DO8A 2WM9B 1ZRHA 3IVGA 4OATA 5EWLA 4B34A 2HBQA 4TQGA 4MO9A 1JDVA 4OHPA 4TMWA 1TK9A 2GSWA 3AF1A 1Y8QB 3CUSA 4AMYA 2HQOA 4YCJA 4MYTA 5ICMA 1JEAA 1DBPA 1SVNA 2I29A 3H2ZA 1PX2A 9LDBA 5JYDA 1X86B 3ED1A 4ZVUA 5H1YA 5TQ2B 2NADA 4B84A 3P0JA 1NA5A 3T9BA 4WFIA 3Q3CA 5FORA 1BQ3A 1TLLA 3SJCA 3SZUA 5KI6A 3P5BA 5JVDB 2A5GA 2J3MA 4V1CB 2Z6UA 1GEEA 1VYVA 5I4IA 3NNNA 3PF8A 2J4CA 4M1OA 1KP2A 3TNYA 4NCBA 1J09A 1HWYA 2ZYUX 4ZJUA 4JP2A 3OE1A 3DM9B 4GOJA 4H9GA 4RA9B 4UDXX 2O1WA 5D87A 4DC9A 2X40A 1D4ZA 4PFJA 1N77A 1BSVA 1LRKA 5CG2A 1J20A 2QB5A 1SUDA 1MFZA 3ESZA 1W5SA 2WSBA 3HMQA 4INPA 3QBVA 4UEOA 4BN5A 1CJMA 2YXEA 1H8EA 1KSGA 1CKEA 3E1SA 3A6HA 3E7DA 3FJOA 3TRDA 3D6MA 4JQOA 2QD1A 1GG8A 5L6MB 1OXKB 4HQNA 1U2GC 3R77A 1NU6A 4XASA 3MJEA 5FOTA 1NSFA 3HUEA 5I8PA 2Z98A 4IO1A 5JROA 2DFTA 3AY7A 3TLJA 1RMYA 1JPUA 4TUYA 4WZ6A 3PJFA 4BMPB 3AF3A 2AOVA 1U28A 5KC9A 2H1SA 1UFRA 3R7SA 4FBMA 1R6AA 1NTOA 1O58A 2W70A 4KMSA 2AJCA 2XNHA 5MN4A 2V3WA 3D3JA 1JH8A 4OLJA 5CA1A 4FMCF 4G3XA 3LQ2A 4A6DA 1S4QA 4NWIA 2QUJA 1TJYA 1I14A 4Z3OA 2QRKA 2NXCA 2X9QA 2QHXA 2RB4A 4UM9B 1GT6A 3ZVNA 3EB9A 1P80A 4KXLA 4YRTA 1Y5NA 4KK3A 5CDGA 4D9NA 1SVLA 2DWQA 4NABA 3OMWA 4PHHA 4HUTA 4JR2A 2JAXA 3H11B 1EJ2A 1QG2A 1SHTX 1FP4A 3R5JA 2HA2A 4IL5A 5COBA 4BATA 3L6UA 1HZZC 3CWQA 1EHCA 3ESDA 3T7KA 3ZLUA 4YV1A 5BVGB 4DJ5X 1PNQA 3OEED 1QVWA 1L4GA 2VUTA 1S5PA 4LBVA 4BP8A 1G41A 3AERA 3HPQA 1GRVA 3MWGA 4O3FA 3C8DA 3Q9NA 3Q9SA 5F2OA 5JPCA 4RF4A 1AV6A 2CVHA 4MI3A 1DU4A 3DKPA 2AQHA 3LZDA 3U3DA 4DJAA 4ZYTA 1XRJA 3GEGA 2VATA 1WQ3A 2EZTA 2XAAA 3OKPA 3W6UA 1FJGB 3IR5A 2O1SA 4H60A 5DX1A 3LDAA 1ISMA 4M99A 5KYXA 1PT5A 2BFFB 5F4ZA 1NATA 2VVTA 2UVPB 5BNFA 2ORWA 4MB0A 2IV7A 2XB2A 2I8CA 1U63A 1GQRA 4K1LA 1SXHA 2VDJA 2X0IA 5AKYA 1KYVA 2FX2A 2MINA 3SBXA 4KDCA 2IU0A 3UOAB 3VYSB 4BU0A 1WHSA 1Z08A 2BGJA 2IXBA 2GEVA 2Y67A 3L4BC 4P82A 5LP6A 5ARDA 1OE0A 1G20E 1MUUA 1Y82A 4O3MA 3IMGA 3R0VA 4CM4B 4KMRA 1V35A 3DWIA 3EEBA 5IF9A 2B8NA 2NZJA 4EG1A 4PLPA 1I6LA 1JSCA 3VZDA 4JYBA 3OOHA 2IIBA 2QPLA 4A27A 1FF9A 3UMSA 1L5FA 1OZ0A 4GM4A 2Q4OA 1FFSA 1BD4A 1LF0A 5CK5A 4PQFA 4BX0A 1BFUA 1EFUA 1KDRA 1XZBA 3FR8A 3PUHA 5EP3A 5JZBA 1CLEA 3FUVA 4WY5A 1AUQA 5FUBA 1KJ8A 2IYNA 3DFZA 3ZEIA 3BZUA 3G0DA 1TC1A 5HCUA 2GPTA 2O2EA 2HRRA 4MYSA 4Y3UA 1N0VC 5A0FA 2O8CA 1WZIA 3I9NA 3NC4A 2CE2X 3OQVA 3IIJA 5EXTA 3DVQX 4Y6GB 3KU4A 4BVHA 2ATEA 5C8VA 2ZYWX 4FFSA 2IP1A 4ENRA 4CT5A 5DHTA 1Z29A 4N7BA 5FL7D 1RBMA 2HK9A 2PBLA 2W6JA 1SVIA 3JVIA 3OLXA 4RSHA 4YJHB 1IU9A 4ZRMA 5EGSA 4DR7B 1CVLA 1PDVA 2OO5A 3CH6A 3H9UA 4PG4A 4G5YA 1T2UA 4XIFA 1N4AA 3ZNNA 1X1QA 2IGTA 4B6PA 4C6RA 1KH3A 2ZIWB 4RMHA 3PLRA 3STWA 3GEEA 1YQQA 1SB9A 3I9OA 3LY9A 3LC0A 2DRIA 4XWWA 5DHPA 5EKTA 1HQYE 1GAWA 4EFDA 1M2EA 3EF1A 1XDWA 2DPGA 4XXHA 3KJHA 1NF9A 2YYAA 3FVTA 3QVOA 4BYGA 1YRWA 2C1XA 2JFZA 3G02A 3SVTA 4PCLA 5KVQA 4B3TB 1H2YA 2FP3A 2VFAA 5H59A 5IX8A 5L3QA 2PGDA 1W85A 2Z58A 3G23A 4HBGA 5DLDA 3ZNQA 1ZUNA 4QLAA 3TLKA 4B6JA 1YA6A 4XJTA 2C4UA 2REQA 1J9EA 1CUUA 2J3JA 4G81A 4MCHA 2ACEA 1MB4A 1XHEA 5ADVA 3DQQA 1KJ9A 1L5KA 5B7PA 1FS6A 1JWBB 5EEHA 3BKXA 2D0PB 4O2RA 4JU8A 3IXQA 4L9RA 5EOVA 1XZIA 3GG9A 1I30A 4IDAA 3ZV6A 2AG1A 1RC0A 2Q2WA 3THSA 4EGAA 3DUFA 5BP7A 2OGWA 3E8SA 4OJKA 2QMEA 4XWGA 3CZMA 4C4PA 5JW6A 1QZTA 4CDRA 2HV9A 2Q5JA 3HZHA 4LC0A 4YGYA 3T15A 1MRNA 4N18A 1SBNE 1GTRA 3FIJA 3B2EA 3WK5A 4P32A 1CFZA 4B43A 5ESXA 4K05A 3KT3A 4FD3A 2AEMA 3WGKA 4X3CA 1IXRC 4EO7A 4CDNA 1P91A 2Q1WA 3AG6A 4XH9B 3N8IA 3H2JA 5E8RA 4PC1A 2HGSA 2J6BA 5TGZA 5MFZA 2X0JA 2V6GA 1RI2A 3HSYA 1LK0A 1QVZA 3FLBA 4EDHA 2J67A 1RYMA 2GDJA 1B43A 3K4PA 1U8EA 1ZAKA 4FMCB 4NS4A 4DA9A 3B9QA 4Q1FA 2VRCA 3O4HA 4MQ6A 1NVMB 2JFBA 2LIPA 2WJZB 4NESA 4L9SA 2X13A 1L5GB 3FOWA 1ZGJA 1BZYA 3HEMA 2XLCA 4Z7NB 3RAPR 4YCCA 4WDQA 3SHWA 4HXGA 3VPSA 1PJ8A 4YROA 3E1KA 3V1YA 3FNGA 1DBRA 3DOOA 3EGIA 2X6RA 3KOMA 4KQGA 1RU3A 3AIKA 5JC1A 2ZR8A 1J39A 1NFFA 1U7WA 5ALYA 4K6GA 2LDXA 1A8HA 1TRHA 3E9ZA 1TXGA 3GRCA 4J3FA 4EB6B 1FE8A 3F73A 4RZUA 3EZFA 2NQTA 2ET6A 3EVCA 4LRQA 3WZMA 3KE9A 4ALNA 1E32A 1ZN7A 2VF5X 2WSYB 4ER6A 2JFNA 3F1KA 3NV9A 1IRXA 3RU7A 1F2TA 2HMAA 3B1KA 4GPBA 1CXZA 5JAQA 4FFOA 1A7JA 1FQJA 5JNUA 2F3RA 3VYUB 2QD3A 3F2VA 4QUBA 4Y2VA 5ALQA 1RHQA 1B41A 1Z4NA 4GIBA 4R1LA 3JQAD 4XYGA 3UUWA 1R0BA 3NHZA 4D0GA 3UHJA 3QV1A 4U2FA 1BKSB 4ZGWA 4FONA 4P3OA 1PQWA 1Z63A 3EVZA 3G2HA 3KFLA 1KDYA 3V7FA 1CHNA 4BCDA 4YPVA 4GMXA 3QIVA 3CISA 5F2NA 3EK2A 3R24A 1ZLXA 1F7VA 2ZI5A 5M34A 4O8ZA 2VJPA 2GM4A 2C00A 4LQLA 4LYGA 1EBUA 3SWWA 2ZUBA 4KO4S 1WPXA 3KQKA 3DZJA 3HLTA 1XYGA 3AV3A 2G72A 4DJTA 2ZVPX 2I91A 3ZD8A 2X0FA 1BXKA 3P26A 1C9JA 1M1UA 1OYWA 3BE4A 5ENVA 1GNLA 4RPIA 1FTWA 5HF5A 5IN5A 3KNZA 3AP3A 4WZAA 2HJRA 3LC1O 5EE1A 3RTGA 3TTSA 5IANA 1ULHA 3B5JA 4Q3EA 1UZAA 1M34E 2HX1A 1MU0A 3NBMA 2LKDA 1PZGA 1Q1QA 1Z0DA 4W63A 3RK4A 4DA4A 3ICQB 1A9SA 2IPMA 3UV7A 4LK2A 3GJ7A 2CLIB 1FP2A 4IFIA 3D2LA 3OZRA 4HATA 3CLSD 4W8GA 4KIUA 1BWQA 1FRFS 3T7CA 4CZ2A 2HNBA 3KC2A 5E9QA 2J5BA 5KDLA 3VYRB 2RMKA 1AA9A 2WWVD 1EE1A 3TDMA 4JVNA 4TWBA 1RHJA 3VR5D 2B5WA 2I65A 1X7WA 4UXHA 2C5HA 5JMPA 2VI5A 5J4VA 3TTXA 3GLIB 1N33B 2GF9A 2FQYA 1DADA 3FAKA 3WK9A 4E03A 5AYVA 3T0IA 3ONDA 1E61A 3FYUA 2AC4A 3OFKA 3WX0A 7ABPA 1GPAA 3ZY5A 4G37A 1XKXA 3B3FA 3CLHA 4JEMA 4DFDA 1VMDA 4QOHA 2P6RA 2YJ3A 4J7XA 3R7NA 2PQMA 3F6CA 4I0WB 4JKOA 2IOHA 3IP5A 4M8IA 1Y6JA 4KQHA 4MUHA 4NCKA 3DL2A 4P4GA 5B5SA 2A9JA 3PXXA 3GL9A 4L9WA 4R51A 5FYQA 3ROQA 4D0LB 1W49A 3FYHA 2FLVA 4C2BA 2JLXA 1OLOA 4JODA 4HWTA 1XJWA 3ZH9B 3PC4A 3A6EA 1QGYA 2OFXA 4QNNA 2FPGB 4EP1A 1I1HA 1KKLA 2QSUA 3BIWA 4JP3A 3W5SA 3CRRA 1H8HD 2JFUA 1ZINA 4PTYA 4CT0A 3DLAA 4EUSA 4GUAA 1Q1ZA 1K1EA 3FYCA 4KQJA 5DMXA 3IIMA 5JI3E 3FMGA 3Q98A 4K87A 3QG5A 2NXNA 4IQ0A 4LYYA 5HEKA 2DG2A 5AUOB 2LP4Y 1G6KA 3W5DA 2W2PA 3W8RA 3WSTA 2R6R1 1Q6YA 1PWHA 2FN7A 4UE6A 5SY6A 3V8QA 4CKBA 2GD2A 4YRBA 1U99A 3I58A 3CVYA 4U0JA 4UHEA 3EJ6A 1KKUA 3AF6A 2X9NA 3DO6A 1WXFA 3ISTA 4PG6A 4TT3A 4CMKA 5JASA 3OI7A 5J5CA 1U2DA 2C5GA 1FQWA 3B48A 4TTPA 1XI2A 2IOFA 3TZHA 4U7FA 1BO6A 3MT0A 3FTNA 4MXDA 1Z8FA 3LUBA 4QJIA 4YUVA 1A9TA 3KKNA 5IBRA 3E1GA 3DKRA 2R62A 3MJVA 1NDUA 3REQB 3ZCSA 2PT7A 3HFJA 1UM9B 2WIBA 2X8BA 3OQIB 4KVFA 5IBCA 1UK7A 2RAFA 4WN9B 5IZCA 4QODA 2QMOA 1Z8DA 3RS5A 1X7XA 4YRNA 1ISGA 1H0RA 3W3AH 2ZIZA 2L19A 1GCOA 1WKBA 1BHSA 1HLDA 4XB1A 4H4DA 4IIXA 1SUFA 3L8ZA 1PVVA 2VPYA 2B92A 2PX6A 4L8GA 4RPJA 1ZKDA 4Q0MA 3LU1A 4P4UA 1ZC4A 1SUWA 3LUPA 3D6JA 1XALA 4RELA 3TSAA 3WKAA 3I5MA 1APBA 4F3RA 1USUA 1MV5A 4YGXB 1M0WA 4Z0TA 1U6IA 1MG0A 4P31A 1H5NA 1WUYA 5IJXA 2WICA 3Q7IA 2CFTA 4DV7B 2W37A 1T6BY 3OPVA 4ENUA 4JXJA 1MJGA 1PGPA 1WHTB 1UAGA 4G85A 1E3IA 2C4NA 2IEDA 4HDNA 1G20A 1QCCA 1GLNA 4FKMA 4QXQA 3SS7X 1R12A 3UXMA 1U2RA 5ISMA 2IUUA 2DPMA 1SUCA 2OZVA 2QTBA 4MW7A 2X9LA 4LHXA 4EBBA 4GSLA 4LV6A 4M1ZA 5YASA 4A0GA 1ENYA 3N9IA 4LJ6A 4F21A 1KNQA 5TGTA 421PA 3CURA 4Y1RB 2P6NA 3KSAC 4MEBA 4YMUA 1XDSA 2ZKIA 3BB4A 4NC9A 5B36A 3VJLA 1ZL2A 4RVUA 2EXXA 1KYZA 4PR3A 5CH8A 4DLNA 1I3OA 3V6LA 4N12A 4JI3B 1PLJA 1VSTA 3QTBA 3QPAA 2WU3A 5IFKA 4DMKA 2Q6TA 3IBTA 1E3QA 1Z8HA 3JYNA 4LE2A 4U2GA 3TH5A 2JHPA 2V03A 4NP6A 3WKCA 5CFLA 5IKMA 1DZ3A 5LZ5A 3A1CA 1TVMA 1GKIA 1QOZA 1JKJA 5TNXA 3WYEA 3DNFA 5FNVA 4ZI7A 1RD4A 1XJ0A 4BE9A 4QLBA 3AEQA 2WSLA 4XCQA 1X70A 1P77A 1UPBA 2Q45A 3B9RA 4UBNA 5CNIA 2RHRA 4AP6A 1TPYA 4B3JA 5IU6A 2C2OA 3VDRA 5DM70 4A1FA 1THGA 2ZR9A 3PIIA 4MJ7A 2AFVA 1N5RA 3JQRA 3EUFA 3UMFA 3TI7A 3EXFA 2QT1A 3HKCB 3QXCA 4EZBA 3W5BA 3LHFA 1B6GA 1SCBA 4B5KA 2J0SA 1FXWA 3QUBA 1KQOA 4K3UA 3ICVA 3C7TA 4GDFA 3LCVB 4ZCPA 3RUPA 2QKYA 1JJAA 1XCLA 3P97A 3BB1A 3OCJA 1JSZA 2X4DA 3K9LA 4EB8A 4HX9A 4HPJB 1ZQ9A 5A1JA 1MQAA 1GDHA 1V0JA 2NT3A 3L18A 4X9XA 3LQRA 4UQLA 2ZUWA 1PL7A 1GV1A 1S0UA 1GPMA 2DQSA 2NXWA 1X7ZB 3EUEA 3NRBA 3NKVA 3U3ZA 5DP1A 1GZ4A 1R6TA 3K1AA 2FZGA 2F3QA 2QUBA 3F67A 3KQVA 1U90A 2HSEA 4IGKA 4M2LA 4QYTA 4I6GA 5F77A 1KMCA 2EBWA 2OXFA 1HE1C 2ZIFA 3Q7QA 4I3HA 5AIBA 2AIRA 1ABBA 2CMGA 4PSDA 1GLVA 5DM0A 2IJGX 5F21A 4BJHB 1JYEA 2FPUA 1Z0JA 1T3HA 5AM1A 1ZGHA 5REQA 1HMYA 1Z2DA 2X2EA 3JS5A 5CPBA 3UCFA 5KHOC 4JU9A 3R3XA 1OX4B 2COEA 3AB8A 1E60A 4RANA 5KJEA 3WNDA 1K7XB 2ANBA 2X1HA 1CB0A 1AK1A 2VDQB 5FXMA 4DVJA 1TYCA 3WRVA 4CYMA 5AHKA 4C30A 4WN3A 3W6OA 1WNFA 3L05A 3WYCA 5IAEA 5GMOA 5BXYA 3ZDCA 3RTCA 2E82A 1Z6XA 4XDHA 1JU9A 3G8BA 3HG7A 4G01B 4KLZA 4WIAA 1WU7A 2VYVD 1Z34A 3E53A 5DM1A 3EDYA 2B4RO 3COPA 1VKNA 4U8GA 3ZHBA 3LCRA 5TPWB 1WX1A 1X77A 2F3TA 4BVBA 1STOA 4M0PA 4TWIA 4EPXA 4QNRA 1VI2A 4BQRA 1FXSA 2Y4OA 4G0MA 5GJCA 1OYYA 1ZGZA 2OUIA 1NJ1A 1R1DA 2YKGA 3AEKA 2HEGA 3G9TA 3C39A 2OCGA 2RHDA 2WFLA 4JA0A 5HILA 3EC7A 4AZ0A 5TJ9A 1RZRA 1GSIA 1Z6PA 3EC1A 3NAQA 1S3FA 1E1MA 3E22B 1F0NA 4NDZA 2IKSA 2VN8A 1YL5A 3EAFA 4IDHA 5DOVA 4BKQA 3R3SA 2VHVA 2OXIA 3BOSA 1SCJA 4FC7A 3U7QA 1EAMA 4UARA 2OCDA 3G79A 1S96A 1N9ZA 2UUOA 3DEZA 3QUTA 1YK0A 2MT9A 3GVIA 5FA5A 2Z2XA 2HADA 3ZXIA 3PXDA 4ER0A 3WLLA 1DAEA 4GMHA 3Q41A 1K2VN 4WSOA 3STVA 3N3BC 2JGLA 1YHZA 2Q1XA 1EFAA 4B6EA 4ZV4A 1QZZA 4F93B 1NQOA 2ZRQA 5ICGA 1XN4A 5T8KC 4EX6A 2IODA 2B94A 4LTNA 3QUQA 4ZT2A 5KINB 3GUYA 4ZMBA 2G5TA 2BGKA 2H5JA 3NHLA 3W3AA 4JKIA 4MA5A 4EHNA 5IJ0A 4X84A 4DABA 3KX2A 3ZHUA 2BFPA 5F51A 4DBLE 4BBAA 4TGLA 1ZD3A 4O2BA 4Q6WA 5AW9A 4IKEA 4LN1A 1ZK1A 2YVUA 4MA0A 1MLDA 4MB6A 2AJTA 5BW6B 4A1OA 2EW1A 3GQBA 4DREA 3EN0A 4YT8A 1K92A 2WIAA 2YZMA 1YBHA 2GEKA 1PR5A 1DC4A 1Q7RA 1J90A 1JQLB 1X6VA 1Y5RA 2BPOA 5KYGA 4RD0A 4OP3A 2FHSA 3T4UA 3L0PA 4MUKA 2FEPA 1WW8A 3P96A 1QLHA 2R85A 4FI3F 4ZT5A 1U3CA 3T5BA 3DZGA 2IPXA 4BNVA 4OKSA 1KA9H 1M34A 2HMUA 2RKBA 4UREA 3IUEA 3OZWA 4WCVA 5DP2A 2RHJA 2ZDQA 5JJBA 4OX9B 4KNYA 4CMHA 2GJ8A 3VI3B 2CHVA 2XQVA 1POXA 2HMYB 3K9WA 3CZ4A 4FNOA 1Q57A 1YZLA 1SD5A 2I2CA 3PQ5A 3VPXA 4JUBA 3UO8B 4BEVA 3SVZA 3VAZA 4JENA 3E2PA 5IFLA 1NXWA 3H3JA 1OH5A 1IHPA 2WJPA 3L6RA 4D9KA 5D5QA 1KC3A 4A5OA 5F9FA 1ZHOA 4R2IA 1WAMA 3VVLA 1A9XA 2JDID 1WXDA 4IWYA 2I5PO 4CMCA 1PGQA 1A5TA 1KMHA 1R9GA 1VRWA 2D2VA 4C1BA 2IYVA 4CTKA 4BLRA 2QQEA 3D1JA 5EESA 4A4DA 3WMRA 1YB4A 4GKVA 1C2YA 4C01A 2VAMA 3TOVA 4W1SA 1U3DA 2OBYA 3FNIA 9LDTA 3M0EA 4O25A 4OK3A 4K0KB 5DLYA 2HJSA 4WMLA 3ITDA 2R7KA 4DLUA 4LY6A 4D7AA 2CLKB 3MVEA 1VYTA 1E1KA 4GAEA 1ZM7A 4LGYA 3ZQJA 4CDGA 1DIGA 2BKVA 3OZIA 1J0DA 3KL4A 1DTSA 3G3EA 4KJXA 1R74A 2OE2A 3HP1A 4X71A 3ZGYA 4F8EA 4GQIA 3LKBA 4PNEA 3PSHA 1U5BA 2FUG1 4UNNA 1WBBA 4AUMA 4J16C 1UZUA 2X2PA 4NBKA 3RYHA 3WLKX 4R0MA 1ABEA 3EAQA 3D1LA 2Q9BA 5C1DA 1QHHB 5FBWB 4RK7A 3RSQA 1C3XA 4GS5A 1OIWA 1N25A 2RKWA 3IQDB 1ZXXA 1N5OX 2EGUA 4DRXA 1TJ3A 2R68A 4C3UA 3ZBTA 5HZKA 4C5AA 1T5LA 4DR1B 3T5PA 3EDRA 5IAGA 3D3KA 1D1PA 4INJA 4YMSA 5JI2E 2Z9BA 4C05A 3D0RA 1CEYA 2ZS9A 1OH8A 1P1KA 1FW8A 3K53A 2OZKA 3HU3A 2AFIA 1VPLA 2B7LA 5AH0A 2Y1WA 5CITA 4GP6A 5DHRA 3AHIA 2LVBA 3ED5A 4LTDA 4UZEA 5DNWA 5BV8A 3HJTA 2W2KB 2CVOA 2IXTA 3OIYA 2WWWA 5F1PA 3MAGA 4F3KA 4DUGA 5IMBA 2VT3A 2IZOA 5JZSA 4HWKA 2PT9A 3TZLA 1U7OA 1RM4A 4IZOA 4OD0A 2HY7A 4E51A 1PZEA 3RIEA 3HBFA 2Z56A 2VPWA 2CJWB 1WPQA 3L0BA 1Z6YA 2DEUA 1JI3A 4RS4A 4CE6A 2IEYA 2D7JA 3DS8A 4E94A 4FYHA 4GOLD 4OHYA 3GNSA 4Q7LA 3TEMA 1U2SA 2HDNB 1XDZA 4YRFA 2WSSA 3SJZA 1ZWKA 2HSWA 5AJXA 5JAPA 5IHXA 1SXJB 1X7YA 1BH2A 2BR4A 4GC5A 4GSKA 3CRNA 3JWGA 4B46A 4OLFA 2IYWA 2XHEA 3WLHA 5FEUA 5FQNA 4K8OA 2IQ5A 1VHQA 4R2LA 1JQJC 2YHAA 5SZKB 3NIDB 4YMLA 3IAS1 3R9XB 3CNOA 2O7SA 3BTOA 2IPLA 3DNMA 3PNBA 2FPIA 3PX3A 1KSFX 2ATIA 1NJGA 4R2HA 1XSEA 2WLTA 5TMEA 5KOHA 3ESQA 1N2SA 4FVTA 4NZYA 4X44A 3IXMA 1T3TA 3MXTA 4XX1A 5K0CA 5T6MA 3NONA 2IZ7A 3COWA 1QRRA 3ZUGA 2DBRA 4P58A 2VO1A 1OX6A 1YJAA 4XQ9A 3AETB 2Q50A 1KQFA 4OOFA 2Y2VA 3TX6A 3HDVA 3CKMA 2FGKA 3C24A 3DPUA 1SVUA 5FD8A 1UC5B 2O3SA 4PGFA 1TQ2A 1LXCA 3DT9A 4QRIA 1ZZEA 1ZISA 1YSCA 3MWYW 4CF5A 3OIFA 3CO5A 5A3SA 4D41A 1WW3A 3AUSA 1JLKA 3KUUA 4Q48A 4K9LA 1LW6E 1T6NA 1XWIA 3DMPA 4R8SA 2JH9A 4LMBA 4XR4A 3KJNA 4YMWA 1R6BX 2UVDA 4J3JA 5DGXA 1GKYA 4GX0A 5DX0A 2JJ1D 1U7HA 3G2PA 3KJFA 4KP7A 1UODA 1V8FA 4DW8A 4URUR 4BKUA 4TWAA 2C77A 1E7WA 3AM4A 3Q3GE 3RGGA 1L8QA 2J48A 3L1KA 4CM9A 3OQMA 1WZEA 3WFIA 4UCQA 4UFOA 1SRQA 3G17A 1DEXA 1H22A 1N5DA 4GI5A 4KQFA 2I7DA 2XMRA 4BZZA 4C4RA 4NATA 1KI3A 5BUQA 4MGHA 4YJFB 4JBWA 3TWOA 2E37A 1XP5A 3SR0A 4C07A 1EUYA 3LXXA 4D3XA 4DDMA 3WL7A 2BF7A 4KPUA 3HVHA 4C0WA 3TRJA 4UTPA 4ESVA 1V39A 4X92A 2GLUA 2BM8A 4Y0AA 3EODA 2M6KA 4CXMA 3RSSA 5LYJA 4BO4A 4WBSA 5E6SA 1AGXA 4MIEA 4QPJC 2VH1A 4ND1A 4A8JC 4IKPA 4EKEA 5I45A 1PHPA 2CFOA 3GLGB 5HOQA 1PGOA 1V9LA 1IIBA 5DTIA 1QG6A 3HKBA 1UAYA 1Z4LA 1UM8A 2AZDA 4R6XA 1HTBA 3DFMA 3LDFA 1K4KA 2BVNA 2G4CA 3D4IA 4JUDX 4HYYA 4YP9A 1YQUA 4FMPA 2X0RA 4KUGA 4LVNA 4IJ5A 3DBLB 5B58T 3TUZC 1A8PA 3IBFA 1KY3A 3L1UA 4X3OA 3H17A 4UJ3A 4HDRB 3UHPA 1M0EA 1BS9A 4NQZA 5DCUA 1YS6A 2XF8A 5C5IA 2IZ1A 2GGSA 5DBFA 4CMEA 4CT4B 3QBJA 1NP6A 4YJGA 3UW1A 3DBHB 4M0FA 3ITNA 3T6KA 4UATA 2X7HA 3MGAA 4KGVA 4DDWA 4P35A 1DC3A 1BW9A 3IPRA 5F3RA 2H2WA 3FUXA 2PX8A 1GSOA 2EBFX 3A06A 3GR6A 2Y66A 4YRQA 2ZM5A 1IMJA 1FIUA 1YBMA 1TMGE 1Z38A 3ENNA 4HZUB 3UOWA 1ENZA 3GRYA 5JCXA 1QGOA 3UJ9A 3V4ZA 1DQNA 2XNDD 1GDTA 2IHKA 4IIGA 4Q1DA 4BTEA 3BMOB 1I33A 4RK5A 4BWFB 2NNWB 3KTDA 3EFEA 2QY9A 2JBHA 4XLLA 1GXSB 4NEQA 2VP5A 4HWSA 2AZTA 1WZCA 4K9MA 4MPTA 4AJJA 2NTVA 3ZY6A 3IYLW 4UFNA 3HO1A 1CY4A 3ANMA 2JBAA 4WY8A 4RK0A 4XA8A 2JI6A 2FJ0A 3JVEA 4V02A 4B75A 1W2HA 2XIJA 3GEDA 3ZKAA 3KZOA 2WMOB 1PGJA 4XFKA 2XUGA 1RMQA 3V00A 3WRYC 1SKYE 4UAJA 1FUKA 3COZA 2E5LB 1YD7A 3H9JA 3PNLA 3MT9A 2QSYA 3FMPB 3JPWA 3A4YA 4IDCA 3TEJA 4HDSA 3VNQA 1D1QA 2PMCA 2WFZA 3E81A 2GERA 1RJWA 2J3IA 3VR1A 2IELA 5MGBA 3HO8A 3SQDA 3PTAA 3DHNA 1EFLA 5MGNA 3HKEA 3LRTA 4IVQA 4ZVVA 4D99A 7REQA 1E9EA 3PX7A 3ID6C 1RWNA 1F4PA 3OPYA 1PF7E 1K97A 1P17A 1GUDA 1R00A 1WMEA 2PM8A 2RCNA 2YTZA 2JGEA 2O4CA 4LVUA 1Q6ZA 2W2NA 3EH2A 4UAVA 5T67A 3TTUA 4BEWA 2Y92A 2OV2A 1E1LA 3LDGA 1M8KA 2XQGA 4MW6A 3OPNA 4DYDA 3KPUA 1V26A 4ONEA 4XFJA 4YAGA 1NY6A 3P2YA 4KI7A 5C53B 1UBJS 1U0TA 2IHVA 4KK4A 3BWBA 4D8VA 2OK8A 3HE3A 2AVDA 4GZ6A 3EXHA 3KKOA 2OYRA 1Y6FA 4E5UA 1G7SA 1XAGA 3MWDB 2BR3A 3GPDG 4B74A 1PS9A 4F56A 2XVZA 3L07A 1H1DA 4EA9A 2I2XB 4LFAB 4L0MA 3VU0A 1IOVA 3MWLA 2ZTHA 1N2CA 4L8FA 5FUVA 5LQUA 1YVPA 5AJYA 3BUSA 4HB4A 2HIHA 3JQEA 4KYTA 1L4FA 4H3HB 4H77A 1RIFA 4M8SA 4ALIA 1C7ZA 1W1WA 5AKZA 2HHAA 4OKNA 1P1BA 1VL1A 1D8TA 2CLFB 4A82A 1KIFA 4Q7EA 1FJXA 3D5TA 3GRVA 2R1ZA 5HG0A 3AJEA 4GW3A 3U7JA 1D0SA 4KPFC 4BRZA 1V6AA 4KG7A 4UZSA 1M2OA 1UMKA 3FWYA 1HZZA 1JVBA 2H2AA 1VCNA 4G4SO 1MB2A 2V1XA 4LW8A 1BWRA 4J4TA 1ZIYA 2ZIXA 6ABPA 4R41A 2FE4A 1YI0A 4ID3A 2GF2A 3WK6A 3ROTA 4J3NA 1YFLA 1XU7A 4R81A 1OSNA 4WQMA 4DIOA 1Q20A 1VB3A 2YNMA 3H6GA 1ZK4A 3BD7A 3RSOA 3MJSA 3QE0A 2V7GA 2PLWA 4MGZR 1D2HA 1QH1B 3GA5A 3OAAA 3F3SA 2CKDA 4PM4A 1KKMA 3GQVA 5CYOA 5EQFA 2QDXA 1D6SA 1PZMA 4N6GA 2HA3A 3NHKA 4DCNA 1MQ8B 1CC1S 3M5PA 3O4IA 3RH0A 5FHRA 4R8VA 3QKTA 2I33A 3O2JA 4L28A 2IF0A 3BHNA 2C82A 2QPAA 2XYVA 3DCYA 1TU3A 3KRTA 4MPJA 4PPNA 5JHHB 1U3WA 4W99A 2WR8A 1PUJA 3BTSA 3FWKA 4JJ8A 1T34A 3QLJA 1WB9A 4A8HA 3LZ6A 3AF0A 2ZZKA 3W5HA 1JXMA 2Y0DA 1MT0A 3D6VA 3EPJA 4YT5A 4AROA 1KJZA 2ZBUA 3K7EA 4BLWA 4EG7A 2LKCA 3ESRA 4D1YA 1RYNA 5AOBA 3CRW1 2X86A 4HYEA 3N0RA 5JO9A 3BE5A 1SC3A 4DLLA 5CA0F 1C3JA 2IY8A 3ZE9A 3OTOB 4D3YA 3IO3A 4FWIB 1KFJB 2O0MA 3VUFA 2DWCA 2VAXA 4QSMA 5DI3A 3I12A 2ZRFA 1NT4A 3ZHOA 1M8GA 1XK6A 4A6EA 2DECA 1J42A 1A76A 2VL7A 4YCLA 1ONPA 5AWFC 2PG3A 5AXBA 4URXR 2Z43A 4D8YA 3NASA 1NI4B 4R1SA 2OHVA 4XUEA 3F90A 4OFBA 5DTRA 1QVAA 5EG5A 4DQLA 4A15A 3BL6A 2J7PD 3BYZA 4MDYA 4OHUA 2V0CA 3HEBA 4RZHA 3IEIA 3JD1A 1CEEA 4GU5A 3VOSA 3QLVA 2FGJA 4D9IA 4EI2A 2IVFA 5K05A 1OKKD 3FPJA 3NUGA 3PFKA 1N2ZA 4KJZA 3OEYA 5K8LA 2XMDA 4D80A 3C5WP 1GCAA 3DE7X 2GJ9A 1O94A 3BC1A 3RR2A 4RGBA 3AOGA 4DV1B 4E11A 3SIPA 1YONA 2R8EA 1DRKA 2O1XA 3QXHA 2E4WA 2Q6KA 3SJ7A 4JVOA 4XW2A 3V8RA 3OZSA 4OIFA 4MWCA 4R71A 3OHSX 3EA5A 4M1SA 5K8CA 4ZI2A 4HPXB 5CK4A 3Q1LA 3QYJA 1C30B 3OCWA 3TUIC 1JYSA 3O9VA 2QIOA 1ZUIA 2FA9A 3KAPA 4KXWA 1MPXA 3GH3A 3GZTB 4UHFA 5B4VA 3R3UA 1Q7TA 4RJJA 3LX8A 1ZVVA 1KOLA 1NNSA 1O9HA 1R8SA 4L16A 1TM5E 1Q0RA 2PZMA 3KYCB 4UVEA 3MQ4A 1OBCA 1KZGB 3PNSA 5EIAA 1ISPA 4ZYYA 3IV7A 2AOUB 3TNFA 1GNSA 5CT6A 4FGZA 2B3TA 2TYSB 3SHTA 1JN0A 2Z2KA 2VPQA 4RD3A 4U2DA 3TQQA 3IVAA 1WVGA 2FE1A 2IOQA 2EJTA 4LSMA 5DYIA 3T3HA 3GLIE 2DB3A 4I4NA 1RAGA 1X8JA 4O0MA 2W2LA 3RVSA 3LL7A 4ZA2A 4XEUA 2ODTX 4OQLA 3ZDZB 1HE8B 2V9CA 5JCJD 1RP1A 2C9BA 3NH9A 3OEHD 3FDIA 2CD7A 3KJZA 4JEIA 3EXIB 3A2LA 3LPLA 2UUCB 3FPFA 3EIWA 3T4EA 1N2JA 1N6IA 4F1KA 4LRTB 4ECEA 3G1TA 3Q3JB 1T3GA 2CNWD 4QARA 4IH9A 1DKRA 1UZLA 1VSBA 2GAOA 3INNA 3KQPA 5JNRA 3P2JA 1Z26A 1Q14A 3D6AA 3GFGA 1OXBB 3KYDA 2YY7A 3AONB 3TRHA 1HE4A 1QFSA 1MG5A 1SUEA 4BPBA 2Q3BA 4RAOA 2MMGA 2YS7A 4PSVA 2A8YA 4B4UA 5CLFA 1KYTA 1XD2A 1NNLA 2GSDA 2AQKA 3FDXA 4RACA 4UE3S 2YZ2A 4CTJA 3NBAA 4JV5B 2WIFA 1GR0A 4CL3A 4ZK6A 3VQTA 1Q1AA 2HCRA 2UZ1B 4MUXA 3H6KA 3VAAA 1R0XA 2Q3HA 1IOZA 3OOEA 3WO1A 1RYDA 5H7XA 5HTKA 3PIDA 2VS1A 2A35A 4FSDA 3VU3A 4DIKA 1ATZA 4ETIA 1Z0UA 4YXFA 3NB0A 5C1IA 1P2DA 2XW6A 2QRMA 3VH4A 5JYBA 1KI8A 3OZDA 3QVJA 4OGWA 1JA0A 4FZVA 4CQLA 1GPJA 1Q0ZA 2NUPA 1ZO8A 1C8LA 4M76B 4XB2A 1J7JA 4XDGA 3QUAA 3AILA 3LRPA 4DF3A 3I42A 4JJ7A 1NPYA 2NN3C 5JZ9A 1IQPA 3OLWA 3VKGA 1FSPA 4NL4H 4M88A 1EH5A 5CEEA 1I36A 1T4CA 1VA4A 2YIVX 3QH4A 2TECE 1CY1A 1JDZA 3SLKA 3TKLA 2ZUEA 5FOVA 4H7EA 5FJJA 5JCOA 4DARA 3BTUA 1E5XA 1XRQA 3IMFA 3L0ZA 2VHQA 1HXHA 1KP3A 2O8EB 4KO8A 5TF4A 4DPLA 4LF7B 1DQSA 1TE2A 4AQ7A 1MA3A 2R1UA 3M49A 5CVDA 2B0JA 3VKHA 5IJZA 3L8CA 4Q00A 5KYUB 1I1QB 2YWDA 3AF2A 4FQ7A 5DLQC 2B5VA 2EJVA 5DGDA 4ZOBA 2GOYA 3NP9A 4L51A 4NBSA 1S3IA 4R69A 5AXDA 5A9SA 2ETXA 3MD9A 4RZ2A 2FY8A 4Q3OA 3ORFA 3S40A 4NLLA 4EYSA 4LJ9A 1Z22A 4TUYF 1OPRA 5D1NA 2WV7A 3ONNA 1IXZA 2AJDA 3C5VA 3KHSA 5AM4A 2Z2IA 5F35A 4XLZA 4DRYA 3KHTA 4HC4A 2B8WA 3H5VA 1NMYA 2CBZA 2D8AA 3ZXXA 5IDVA 5CA0B 5CA1F 4AICA 2HSZA 4WOPA 4TYPA 5BQPA 3ER9A 3SM3A 2BGWA 4W5NA 4PYQA 4QFDA 3WMWA 4FC6A 1RSZA 5HMMA 1TJNA 2O2JA 3BL8A 1JDTA 3DDNA 1QQ7A 1II8B 2YHUA 2VUSA 2FFBA 1BEZA 1ORDA 1GZHB 3UJCA 4BRSA 1I5EA 4EK9A 5CAEA 2X8AA 3UW3A 1E6MA 3RJZA 3NTUA 1L5QA 3E3OA 2V6MA 1CQJA 1N5LA 2WHQA 3CXRA 1A9OA 2Q0SA 2A3RA 4HLNA 4UUBA 2BM9A 2BF4A 3MTJA 1JFVA 2DQZA 5JFOA 1NQXA 2YDXA 4KQEA 3AC0A 1A97A 3P9XA 3RUIA 2BFEB 2B5OA 4ZRDA 5E6RA 4LJYA 5BV7A 4HEHA 1B74A 4UEWA 3UK7A 5FOQA 1IXYA 3NM6B 3L02A 3CG0A 3R1IA 4EITA 1VGVA 4ZVRA 4F12A 4INZA 2CMFA 3LX6A 4P3YA 4QT4A 1BVHA 1M7GA 3UV3A 2WNIA 1NMSA 1PJQA 1PR9A 1S4MA 1XQ9A 4QXPA 1ZI8A 1TUBB 2C9OA 2AC7A 2DM6A 3PDWA 2ESRA 2VK4A 2ZTVA 3QU2A 4PRZA 5CFQA 3KLNA 2Y1DA 4JVLA 3AHHA 2G71A 2BAGA 3H16A 4Y6QA 5FO1A 3HXTA 1B0PA 3UH0A 2W6IA 1MOZA 2ACVA 1TM7E 3QELA 3QTTA 4OHRA 5LP6F 2IUEA 1N2GA 2YHSA 2X5JO 3AJ9A 2GK3A 5DN9A 1L1FA 4BJ3A 2J45A 4BEJA 5JPDA 1A9ZA 3MXOA 1M2HA 4J0FA 2K6GA 1M5TA 4JMLA 3WGZA 1IUOA 1RBYA 1K8XB 2C9ZA 3HH8A 3RU9A 3G9QA 2HU8A 2PPVA 3IQXA 2BN4A 4EVQA 1PD1A 2UAGA 2QQ0A 4ZDKA 3DAFA 3I32A 2F3UA 4FK8A 5K8UA 3V3KA 1L7EA 3LDHA 4NU0A 3SMQA 2CFSA 4DLSA 4MVWA 5JZMA 1YASA 5JDCA 2R0QC 3RTEA 4ZTZB 1GAXA 2HPVA 1G0OA 3G2IA 3V97A 1WA5A 5GZ6A 2ZSDA 3AG5A 3K73O 4KR9A 3OX3A 1E2NA 4XIIA 4R98A 4RTMA 3N8GA 1Q5PA 1OHHD 2JCBA 1MABA 2DC1A 3CT4A 3NLLA 4HG2A 1UEIA 5BOVA 5INTA 3GLUA 3QVWA 1T35A 1C1DB 1CIVA 2NYUA 1E9BA 2BJVA 3RC9A 4Y6SA 5GINE 3WLTA 2O8BB 1QCZA 4AJIA 2GD1O 2JGRA 3ZQ4A 3P0RA 4OL0A 4HRXA 1CUJA 2A0WA 4ZZIA 2YJ6A 2IZZA 4B82A 3RK1A 1T3SA 1PNVA 3L0OA 3VJMA 3G85A 4Y1GA 3W2TA 3W5UA 1EVZA 2WJ6A 1FVXA 1VIVA 1NMEA 3IAM1 2V59A 1YMVA 3KJIA 3N0TA 4CV1A 2B2CA 2GRAA 4ICIA 4F3NA 1GADO 3GXBA 1TAHA 2HFKA 1BXGA 4OLBA 1P44A 4JL5A 4BMCA 2AMJA 4MWGA 4L5IA 4Y6PA 4UULA 2FWNA 3TR0A 1RIIA 4P0PB 3SYMA 1E1NA 4P3NA 4X00A 1E69A 1L1EA 2IP2A 1LCIA 4G89A 4V0SA 4CLOA 1VKRA 4P8RA 2DCMA 1Y1LA 1NN5A 2VWQA 1BJKA 4J2OA 5U1PA 1H65A 3MAJA 4JSYA 5CLIA 5EVCA 4DIMA 1KEWA 5LL6P 4ARZA 2OENG 3DMGA 1ZCAA 4J0HA 1EWTA 4KVAA 3VZBA 2XJ9A 3ROXA 2XSZA 4K5QA 3WLAA 5JJCA 3IBCA 3E7FA 4LXTA 4AB1A 2HW8A 4F96A 1LK5A 3PPXA 3TIGA 1P5ZB 4LJ4A 4YIKA 1Z5GA 2PSFA 5I3ZA 3NOQA 3LLSA 5MDHA 3ZY4A 4HPWA 4D0RA 2ZCUA 4IX1A 2BISA 3MPOA 4TTIA 4O5OA 5EE9A 3OCVA 4FYWA 1RDFA 4RMGA 2XKAA 4QNMA 5ALEA 4FLMA 3SZOA 3UKDA 2P5UA 4CIXA 2EW2A 1QSGA 1N2HA 3E5RA 2CL7X 1VDMA 3O0TA 1XPOA 3HHPA 1JQEA 2W8BB 1FB5A 4TUYB 2WNSA 1D5WA 3FROA 4PX2A 1GZ5A 4C21A 2H7VA 2OHHA 1AXRA 3BJRA 4IIHA 1E2DA 3C3BA 2DWUA 4NYMR 5CA1B 1Y1QA 3CLRC 5E2BA 2R4TA 4RHEA 5HDBB 4EI8A 2B9EA 1A72A 1ARZA 1L3CA 1OIVA 1O77A 5JADA 1PVDA 2M32A 3S2EA 1JA9A 1WMDA 4I1PA 3KKEA 1NG1A 1V3VA 1UIRA 3RROA 1T24A 3W2EA 5L3SB 1FP4B 1U7UA 1QV6A 3UVEA 4BTVA 1E1CB 3KWJA 2BTQA 1CS4C 4ZT7A 3JVDA 2EFCB 3WLJA 3AERB 2REBA 1Y9DA 4UM7A 3ETCA 1QFXA 4RW0A 5JEEA 2VXBA 4YUZA 4FHDA 3RBXA 1RMTA 3M7IA 5FUXA 4AY4A 5B1EA 1AK9A 1P62B 2H7CA 3I8SA 1E6WA 3GLIA 1U8FO 1H42A 3SE7A 1C0EA 4L02A 4N5HX 5KYXB 1SUBA 1GN9A 1N9KA 2HFJA 2QTGA 5IC6A 3WLNA 1N8TA 3TX2A 4D97A 1DFGA 4YAOA 1NXOA 4NENB 3SZRA 1D2GA 1OZGA 3B12A 3KQWA 3L0IB 4ZP1A 3ZHYA 1Z35A 4NQRA 2FVXA 5BN1A 1L8AA 4DAEA 1E8MA 3AI3A 2VK2A 3LX5A 4CLHA 3O73A 3VZPA 3W8EA 4P3KA 4KXXA 1JG4A 4UBMA 3EF3A 1PS8A 3FHLA 4HQOA 3WL8A 1UDXA 1E9DA 2Q4BA 4L5AA 3FY4A 4EPYA 3UPTA 2RAUA 2J08A 5F7OA 3U0BA 2BWJA 2IQIA 1EP2B 1GGMA 4MW4A 2WAXA 4RCVA 2OK7A 2ZBPA 3M1AA 4QYMA 5G1OA 5DNCA 5BPHA 4J1QA 2PMWB 1EUQA 4KODA 1X1AA 1YKGA 1HK7A 2IYUA 2DPHA 4BV3A 1H9CA 4M36A 2XWPA 5DCYA 1C2TA 1TD9A 1VPTA 5EI5A 3E9DA 5KU7A 1XLWA 1KEKA 2JANA 3RRYA 3HYRA 5FNZA 1PYGA 1P0MA 4BLPA 4H59A 1FLDA 4TKVA 4CCAA 4Y2GA 3OC0A 1HDYA 1O6BA 1CYEA 2OCYC 3GMSA 5ECWA 4CIAA 3AUXA 2XWBF 2GXQA 4S3MA 1AMOA 1W581 1NHWA 4ZFNA 2OBNA 2Z83A 3MWJA 1VECA 4M9SA 3RUFA 3V1MA 1ZJ4A 4LZAA 2VPPA 5KQLA 3DTTA 1E79A 3CZPA 1VKOA 5TQVA 1ZI9A 1G0NA 2Q2QA 1L4UA 3RV3A 1EJ6A 1N2XA 3CZQA 3UWMA 3E9YA 5GQSA 4Y8VA 1PS0A 1N2IA 3M6WA 4OAQA 1I7DA 4FEAA 4WAUA 5LLDA 4A36A 3H7AA 2A94A 4YCDA 4A26A 3NDPA 5K7SA 2C2WA 3RHTA 1IZ0A 1I3CA 5BN5A 1WUJS 2HLHA 2O8DA 3OCUA 4DJEC 3ESBA 4NZNA 1GGKA 3JD4A 1UFQA 3WIOA 3OJWA 3RUEA 1U0BB 5AW6A 3BEOA 5L3QB 1Y8ZA 1L7QA 4Q3AA 1ADBA 1W85B 3GJRA 1GNTA 4OQ4A 3VR4D 1ZN8A 4TS4A 4X8OA 1OH6A 1F1BA 1ZN9A 4HDAA 5EE0A 1KZ1A 2P35A 5H02A 5FLXA 2REQB 4LOJA 3HSKA 1UQRA 4KAFA 2IS2A 1ZM4A 2JVKA 2OC4A 3IPYA 4O4JA 2VCYA 4G5RA 4H4CA 2X4IA 3NT5A 1TYZA 4ZPXA 1RBZA 2OD2A 4O33A 4COOA 1OFGA 1W0KA 1SOMA 2YC2C 1CY7A 3P9NA 4GNRA 3ZHRA 4F9EA 3K2IA 2V55B 3ODGA 2RGAA 2J46A 4YECA 5CDYA 4F04A 1I3KA 3PEEA 3VGJA 4Y0VA 2ZJAA 4UJ5A 2JLWA 2ZROA 5E4JA 2GAJA 4H7JA 2C4MA 2YQ4A 2P9ZA 3H9QA 5LB4A 5ALVA 4PZEA 4GH5A 4KWCA 2RGDA 2D7CA 3IDQA 4GI7A 2BHRA 3UOGA 5EIFA 4K6MA 2BKLA 2V4UA 8LDHA 2ZM6B 4UTZA 3U9SA 5KWVA 4IH1A 3HNRA 2GZ2A 3KQHA 2CCKA 5IAAA 2GBFA 2QLBA 5LUBA 2DFNA 2QT0A 3I5XA 5EN4A 3FUWA 3FUUA 4REMA 3UJ8A 1D2AA 1OI4A 1ZMXA 1BKDR 4JS0A 2VSQA 1QR2A 1ELOA 2JKZA 3BBPA 1S1CA 3GJYA 4LXYA 4MWTA 1LI5A 1URPA 1W25A 3NEYA 4PX9A 2PXCA 4C7JA 2ZPAA 3WXMA 5I01A 3ZDAA 4GP9A 3L9WA 3O75A 5B6IA 4L73A 4OHFA 4YMGA 3O0DA 4KSBA 3KXLA 5H68A 3WK4A 3GVHA 2YH2A 5H3LA 3RFTA 3L1IA 3W90A 4KWEA 4DCOA 1NX9A 3AKCA 2XR1A 3EEQA 1FBNA 1I51A 4WY2A 1MEOA 5TSDA 2XUPA 1EZZA 3QEMA 2ZUDA 4K6CA 1NJ8A 2XGMA 4PG7A 4YV7A 4QJBA 2FUCA 5IABA 3LK7A 2Q3MA 1Y5MA 4I2VA 2VDVE 4ZDJA 2HQRA 3U7IA 3JR3A 2B25A 4G97A 1SCUA 4L3OA 1YC2A 4OL9A 3BQ9A 1FMLA 1RXIA 4C0QC 4X66B 1Q1GA 2OB1A 3K09C 1DWPA 2XB4A 2XMBA 3SSOA 1COWD 1ORTA 2RGXA 2DUUA 1QP8A 3CCBA 4FDMA 3UA3A 1RHRA 2QW1A 2A9RA 1F2TB 1BCSA 5ETJA 1ZEMA 3EXEA 1PJLA 3D8TA 4N3NA 3RHSA 3VX4A 3WLMA 3ZD7A 1ZGBA 2RK6A 3N8DA 5LSAA 4FWTA 2DUWA 3SNHA 1SCNE 3OE5A 5BW5A 3A6JA 2XOKD 4MQBA 1AM4D 2CE7A 3ODPA 4M9RA 1OLUA 1YOBA 1TW3A 5EHNA 2DPLA 2VT7A 3EX7C 4LECA 1NC1A 1I4TD 4LXUA 3T7TA 1F1JA 3TFQA 1BE0A 1JMYA 4I1IA 3BS4A 1TECE 5L4NA 4RDHA 2BFBB 5IRCD 1PR6A 2AKAB 3CE6A 2ZWVA 3F6PA 1WG8A 3KJGA 1QYDA 1XJCA 1WPGA 2EKBA 4G0ZA 5BUCA 2IHZA 3TXXA 4XYEA 3CW9A 3I8OA 1GFWA 1N5IA 4WZAB 5KKAA 5AVUA 2YICA 3QBTA 4RM3A 3WG9A 2IBSA 2G17A 1CY0A 2OLKA 2YCLA 1T2DA 1JQ5A 4QXOA 5DEIA 2C59A 3PA8A 4BAGA 5K3EA 3HCRA 1QC5A 4H1WA 2R7MA 2C0PA 5A02A 2NU6A 2HD4A 1P4SA 4AX4A 2F55A 4UM8B 1NJ5A 2HWXA 2RBKA 5EIHA 4B1FA 2EDAA 3R8XA 3WJ1A 5BUSA 1ZSNA 4MP8A 4TLDA 1GL3A 3CWZA 4BTLA 3T1YB 3H0CA 4RYDA 1FNSA 2F17A 2Z2ZA 3EVBA 2GRUA 1B42A 4LE1A 4LXHA 4RJ2A 5H4GA 3KSUA 2KW5A 2DBYA 1QX4A 4TMYA 3IE1A 4OTZA 1NURA 4DILA 2H31A 3ZCRA 4J07A 4KE9A 1LX7A 4EY3A 5JAOA 2C7RA 1GVHA 2AD5A 1L7RA 1TEHA 3VC7A 2X6TA 4M8KA 3FGZA 3GGJA 4D4KA 2AMFA 2C99A 1PK9A 1ZBDA 3GAFA 2I7XA 5JRZA 4R8KA 5AXCA 3T9DA 4F4FA 4I9NA 3IUBA 2FW8A 4KE6A 3U2QA 4PEVA 4INAA 4UEQA 3BK7A 3U1VA 4AF6A 4Z4HA 3BZWA 2CNNA 1J9ZA 5G0VA 4JLMA 1FX0A 2C57A 2CN1A 2ERCA 2FRXA 1WWKA 3B7PA 5PGMA 4PHCA 3ZWWA 3O2QB 3RS2A 3BRCA 4BJ6A 1NR1A 3GCDA 4JLBA 5B1SA 4AC9A 3WYDA 1BMDA 3PNVA 1ZBQA 4BHTA 1BE6A 1NXXA 4QREA 4B83A 1UBHS 2EATA 4IIDA 3HB4X 5FWAA 2IPNA 3AJRA 4G56A 2RHGB 5DTEA 3M9WA 3C3AA 3BWYA 3VC3A 1M1XB 2Q27A 5BSFA 1Q0TA 1AXGA 5I9SA 1WETA 3K70C 4U3JA 3LBNA 3ZXSA 4H0FA 3WWCA 5C1PA 2B1RA 2B98A 2WKSA 5CNJA 1KJJA 1IFXA 3C3YA 4B9EA 2ZK7A 4PPFA 3DCIA 1K0UA 1WCYA 4AJ4A 4OSOA 2AFHE 2G36A 4QUAA 3MD0A 1H2HA 2ONZA 3VO1A 5LB2A 1XWFA 5A0VA 2P62A 4ZYXA 4CG3A 5GM2A 3DOHA 5JDIC 3CBGA 1SUIA 1X7XB 4BKPA 1I5OA 3L92A 1J8VA 2JFFA 2Y9PB 1Y4UA 1M1ZA 1UXOA 1HDGO 3GLFE 3ETNA 4YFYA 3M34A 1DWUA 4ETMA 3Q8WA 4DWWA 2XB9A 5H5JA 1P61B 4ZZ3A 2ODEA 5KMGB 4KKVA 1MXFA 2R4UA 3HLYA 5KX5F 3MIZA 2CHUA 3WZ2A 3KB8A 3OX1A 3THXA 5EZ5A 5EJ9A 3DXZA 2FOXA 1KWGA 4MJLA 3LFUA 5J2UA 2XXAA 4C2TA 5BSEA 3RBZA 3O93A 1W35A 1FRNA 16PKA 5JOQA 3BRWD 2Q5CA 2V0NA 5A1TA 2WWFA 4UDYX 2Q8NA 1XQ6A 5CB6A 2GCOA 3PGLA 3N2KB 4YIHA 1DS6A 2ZPUA 1G20B 1QGAA 3GCXA 3OEEA 3LVQE 4NF2A 4YT2A 1XNQB 4L4SA 2QA5A 4ZPJA 5HX7A 4GI1A 5DYTA 3I73A 4TROA 1JIKA 2XWJI 4UEKA 1YA8A 1BS2A 2QLJA 1ACLA 3HU2A 3TBHA 2K5UA 4N3GA 4XRGA 1K3TA 1F20A 1J8YF 4JL8A 3BK1A 1ZIOA 4HAYA 4CR6A 3K30A 3KR2A 1TZCA 2CLHB 1JKFA 3DT8A 4Z5XA 4CLRA 3KKLA 2ZJ0A 4K7JA 2AG0A 4HGYA 4J9VA 2YJ4A 1V3UA 2D5BA 3CEMA 3GDGA 1DXOA 1IC6A 1UBEA 1Z2CA 4IDDA 3TL3A 4PGGA 2VLIA 1DQYA 4KWIA 4M22A 3DA8A 3HYNA 1Y1TA 3QU5A 2IL1A 3GDOA 3UV6A 3AKYA 3LECA 5EHQA 4BC0A 1SURA 3V4SA 1U0NA 1REQA 2RGGA 3EUAA 3NHWA 1DOAA 1Y9AA 4GG1A 3W79A 2QUZA 4LWZA 2QL5A 4U7GA 3U4GA 3L6CA 4AJNA 2PZFA 3CIOA 2N3ZA 1O9BA 4QGBA 5LJLA 5LN1A 1H94A 1MJNA 2QTHA 3WAKA 4OV6B 1L8OA 2JL1A 1VQ1A 5EUBA 5IVIA 5C46F 1N1DA 5DNYB 4DUZB 5BMVA 4D8TA 1TI7A 3EXFB 2ZSBA 3N6RA 5LQKA 3U7GA 4TKLA 3EXG1 1WCXA 2Q29A 1QIGA 1ZD5A 2J3DA 1JLMA 4RIGA 3VR5H 3EPHA 4V0QA 4PLFA 5JTTA 2AN4A 3FKSD 3CNEA 2HF9A 4MEAA 1ZJJA 3B6EA 1LBTA 3IV9A 3GNTA 1EP9A 5BOSA 3OPYI 4QA9A 2Q1SA 3NIFB 4R68A 1NWCA 3ZX4A 1V45E 2PUAA 4RIEA 3FJYA 1Y89A 3WDKA 2P5YA 3SYRA 2OAGA 4I1VA 4Z3DA 1JSRA 2D62A 4BVLA 1FSFA 5B1YA 2ZBVA 5LMUB 2GTHA 4RHTA 3EYAA 1F38A 3A9WA 4K9NA 1C7FA 3M33A 5CLGA 5FL7A 3TZBA 3SR4A 4DY4A 2G7ZA 5AVVA 3FCAA 2FWAA 2XBUA 1YDHA 4DQDA 2PUGA 2B2XA 1QMGA 3KKPA 1QQBA 1XV5A 3UMMA 3SFVA 1KP9A 3ICOA 4TL9A 4OAPA 4ESOA 4IUBS 1WXQA 3QITA 4NAUA 4U7JA 2X1MA 1NVKA 2ZRIA 4X63A 3T1VA 4HNUA 1ZJWA 2VOEA 1I1OA 3CZCA 4R3WA 5DCLA 1JSLA 4N47A 4KYIB 4ZZ0A 1USIA 1O89A 2A5JA 1Z0SA 3GFRA 5JNLA 4IVPA 4ZJPA 1NMQA 1EP1B 5I47A 3ZV4A 3SC3A 1ICIA 5CIYA 4ZCTA 2BT4A 3OZBA 1KQGA 3M4NA 4OQPA 3I9KA 4Q03A 1V48A 2HCJB 1F0YA 1LSOA 3GP5A 3CMMA 2WQZA 3HJUA 4O1MA 3V4VB 2EKZA 5EIXA 3H5IA 3DMYA 2BKEA 3GLSA 2FXIA 3OMLA 5FPPA 1R9MA 4QOFA 5GJVC 2PQ0A 5HCNA 1CETA 4HFJA 4IXMA 1NVVR 4RY9A 2FNAA 2FOLA 4JQYA 3JD2A 2G1KA 5DWVA 5BN3A 2R8ZA 4PE5B 2W6OA 2IZ0A 4CQMD 1KO1A 2BMEA 3U7QB 1QIHA 1NVVQ 1GLGA 2LNDA 3SXUB 5J2TF 5FWYA 1SA0A 1N1MA 3ZV3A 1GUBA 2CYBA 1PJCA 4MIYA 4HO1X 5CFOA 3J81A 4B4VA 1XZGA 4G5OA 3S28A 1KWKA 2G25A 1AS0A 3RAEC 4OOEA 2ODQA 1TIKA 1V5EA 2P65A 3EZ9A 13PKA 1IAVA 3LUGA 4WRRA 1IK4A 2IW3A 5CPFA 2RB5A 2YWFA 1K6EA 3GDHA 4CN9A 2V3VA 4D81A 3GHYA 3FYDA 2A0FA 3PFHA 1HLPA 1R0LA 3N6XA 2ZXUA 4ISCA 2ARKA 2J07A 1AG9A 1VJDA 3CJTA 1Z5UA 3K5HA 4OU5A 4RGYA 4RS3A 5IJ0B 2B69A 4PINA 4EB3A 3LT0A 2PE5A 1T13A 3FXAA 4Q4LA 4TZ0A 2R7AA 1CZOA 1Z4PX 2A7QA 2C1EA 4C43A 3KPYA 3IP8A 1YI1A 3PT5A 3VSCA 4D45A 3PNOA 4ND6A 2YN2A 2ZB4A 3NHPA 1EJBA 4WK6A 4AWXA 1LLQA 4M0MA 4DEYA 1IOWA 1SXQA 1ILEA 4LJKA 3RFCA 3L0DA 3NYWA 4QUKA 1J0BA 5ILGA 3WRWA 3ZDYB 5C32A 3EDOA 5D3MB 3CPEA 1CR4A 1Y7PA 4A92A 3DTYA 3P9KA 5AK6A 3M2PA 4XIJA 5EUQB 4EQ6B 3S1SA 2E48A 1XDDA 1H9AA 2DSTA 3O1LA 4R1NA 3JQAA 3CM0A 3WAGA 3ZU4A 2LUOA 2ZWIA 3QWAA 2WIDA 4MVXA 2DPXA 1NQVA 1O96B 1RWXA 3RTBA 4DMGA 4ZGBA 1JNYA 1R16A 1NLUA 2YX1A 3U4QB 3OM0A 4RD2A 4UUPA 2ZT6A 4BN4A 1YOVA 3RTDA 3EY9A 2AN5A 1R15A 2OFPA 3G2LA 1A9XB 4Q01A 3O95A 3TM4A 4AURA 4Q7QA 1P19A 2QRJA 1KOFA 1Z16A 3KZKA 1YNOA 2PY6A 4MV0A 2DSNA 3BKWA 4F3TA 3FCXA 4HXFB 1Z7EA 3UANA 2WABA 3FB1A 4HDCA 4CM5A 4B48A 1XG5A 3MK31 4BO1A 5A7FA 3JRXA 1NFQA 4LZZA 4MVJF 3LC7O 3TMYA 3T99A 1DEAA 3KTAA 1LDEA 4JC4A 3TIFA 4HH3C 4D4IA 2Y71A 3HVUA 1VFPA 2UVQA 1J5PA 4AM8A 3OIDA 3CS3A 3HY6A 1QANA 3PR2B 5TV2A 2FK8A 2X0KA 3HY4A 2YUTA 3X3HA 1RJDA 1UK8A 1NVDA 4Z86A 1XT6A 4KFSA 1FEZA 3EZXA 4DPKA 3OVMA 1QVVA 1L4YA 4WECA 3ZKWA 1EEXB 2JRLA 4FBGA 3VR5A 2V7XA 2PTHA 1QKIA 2SKCA 3M5DA 4KU4A 1U5BB 2CZQA 3D6HA 3QNWA 2FB9A 4IAOA 621PA 3IQGX 2JGFA 1S2DA 3G2MA 3GJ8A 4QLOA 2VZ9A 2FETA 1CIPA 3UAGA 2BTEA 2XCQA 3LA6A 4RV5A 4JL6A 1PO7A 2IZ6A 2KJQA 3IX7A 3QE9Y 2QP4A 2XECA 1H85A 2QE7D 4S12A 4DRXB 4PO9A 3UH1A 3ZCXA 2B7BA 4Y9TA 3C5EA 3DMTC 2CDRA 1EGHA 1YB2A 3TCKA 3SC4A 2ZRGA 3Q12A 2EBHX 1NE2A 4ZGGA 2I78A 4RNDB 3AR7A 1BVUA 5IHPA 2JI4A 3REOA 2AFIB 1ILWA 1H8HA 2AFHA 3EIEA 3K0HA 1EU1A 3T3IA 4BLTA 3ETGA 2CZCA 1UDAA 4YMIA 4ZYWA 2W4IA 3ETLA 3PNKA 2F64A 4ES6A 1RKQA 2Q8QA 2DXIA 4CLXA 1Z0IA 2XOEA 3TK1A 4EHFA 3GNQA 4DIFA 3GLFA 1FBTA 1JE0A 4JELA 1L1RA 2W5UA 2ZT8A 4DXAA 2PN1A 4MINA 3RSFA 4O1HA 1YDFA 4BASA 3I9FA 1KMNA 2BGNA 4JB8A 2EWMA 2BELA 1X9HA 3MTIA 4QECA 1HL3A 2TMKA 5AVZA 4S24A 2R9VA 3LYLA 4LF8B 4MR8B 1KE2A 3RSGA 1IWOA 5J4HA 1R2QA 3PVSA 4US1R 4EVRA 4GWLA 1SOVA 1UJ5A 2HXYA 4EHAA 3A9RA 2FW6A 1GL9B 3GPCA 2ZJBA 4LMRA 3BXGA 1J7KA 4B3MB 3ROGA 1P4JA 3MRSA 3GFVA 3MWFA 3CZ9A 4U02A 1M7HA 3HXMA 3ROKA 3QEOA 2VTEA 1A2BA 4FCCA 2G67A 2Q46A 5JEDA 2PCJA 3QWFA 1JXOA 5KQMA 2FWMX 3E5HA 3DP9A 3V2HA 4KGZA 1QAOA 2QVXX 1ZRNA 3Q88A 5JYCA 1X8KA 5BQOA 4Z54A 2AR0A 3F5FA 1PWXA 3L7OA 5KOHB 2IH4A 1X0XA 3JYPA 4WNCA 2G70A 3GVPA 3I9V1 5JRDS 1VDZA 2KYRA 5ALKA 2CJYA 5IW8A 4RWZA 5EKDA 5ITZB 2WJGA 3SK0A 3BQMB 3OSUA 3K96A 1GSHA 1H93A 1JHOA 2VEDA 4JT2A 4BMDA 4Q93A 2IXEA 3ELUA 5CNMA 3JPYA 5E4TA 5K6AC 3I3OA 4KTVE 2CVZA 5IH7A 3UB3A 1B16A 1U9IC 2WHRA 2B6NA 3ANNA 3WBBA 1YUBA 3R2JA 4KUHA 2ROQA 1Y37A 2QK4A 1N1EA 4MMXB 2OESA 4XR9A 1YQGA 5FWYB 4RHCA 2CV0A 2Z3ZA 3HACA 1E2EA 4C03A 2CNLA 5LU8A 5TX7A 3HJBA 5ELLA 3LF2A 2B1GA 4JDUA 4QAQA 4LK3A 2HO5A 1IONA 4EJ6A 1Y3FE 5JTUA 2BFDA 1R0WA 1JR3E 5H70A 3C48A 3VPFA 3WKEA 4DZZA 4EX7A 3S68A 1I2CA 2XQJA 1N0WA 3AUYA 3O3CA 1LRLA 1WU8A 4HAXA 3GEBA 3K0FA 5LZ7A 3W5CA 2AGVA 5KYYA 1YU9A 1A2OA 3GEHA 2B4QA 1U8TA 1UKCA 1GEGA 2HJWA 4I6JA 5HKKD 4XIYA 4R84A 2CUNA 2PQ6A 2VK1A 2H1HA 3GRAA 4EKDA 5C80A 2RHTA 6GPBA 2ZUCA 5F9HA 4JOQA 4KPUB 1JBQA 2D1SA 3PFGA 4WCFA 1Z62A 2G8LA 1EFDN 2QW0X 2WB2A 1JYFA 1LV7A 2VHJA 2WWRA 1F0PA 1XCGB 4DOMA 1V8ZA 3LSYA 3L7AA 1OI2A 2IOYA 3UJ7A 2WU1A 2VRWA 4RADA 2IHUA 3B89A 3F71A 1OJ7A 5BN4B 3SX4A 2VHEA 3I1YA 1HQKA 4YJGB 5IF3A 8ADHA 2XBMA 2WJVA 3B78A 4OM7A 5LOVA 3H2SA 1NRJB 4NU6A 1U1DA 1DO8A 1F06A 2NO6A 2ZT5A 4IBOA 1K5HA 5NLLA 3GLTA 1SOUA 4A8PA 2RGNC 3AHGA 1BW9B 2QTTA 1SUPA 3FYSA 3JARB 3R3WA 1MC4A 4MS1A 1R4MA 4MW1A 4HNRA 5HBRA 5AHOA 2Y76A 1GZ6A 3ESXA 3SF0A 2DBQA 4UDOA 2H4JA 1U65A 3O7MA 4ZCMA 1XVIA 2WUGA 3IDSA 4HUQA 2XCUA 3IVXA 1B4DA 1XZEA 4NE7A 5F5LA 5FAKA 1MPTA 1HH4A 3C1OA 3ADDA 2IXDA 2QRHA 5ALFA 4XSHA 4QTUB 3B3GA 3QFCA 3JD0A 4N0QA 1TF2A 3ZWMA 4YJDA 4CM1A 3F5QA 1HEUA 1P1RA 2YHIA 5KQRA 5A9RA 2H4WA 1F4VA 1RXCA 4NDAA 2WA2A 2DKOA 1JW9B 1RVDA 1ICEA 4KPGA 3ZU3A 4D4HA 4UTVA 1FFHA 1Z2OX 4S1OA 1SELA 2XTNA 5BW4A 1Y8RB 1LW7A 1PJTA 1U9YA 2PK3A 3A1FA 2R8PA 1IY0A 2ZJ6A 3BCRA 2OGSA 3DDZX 5GP1A 4H35A 5KOIA 4U7TB 4OX9Y 2AZMA 2P2DA 3QF4A 3NXKA 1N0UA 4EW1A 5B12A 4X8HA 1KOJA 3N0VA 3KQYA 1U2QA 3IR7A 1Z6AA 4P5EA 2VNAA 5AKHA 2HWKA 5C7IO 5HQ3B 1F6BA 4DANA 2FN8A 1WCWA 1Q0PA 2R79A 3IEXA 4N8EA 5K6RA 1Z4OA 3HKEB 4OF4A 1XD9A 4BE4A 4C78A 4JVSB 2DZDA 1TT5B 1JQ3A 2C9MA 3JALB 2BUCA 3MEQA 4NZ9A 3CX6A 4PHTA 4QD3A 4BUJA 3U49A 2O7RA 2WJHA 1XQVA 1J9GA 3KAQA 5GJWC 2JLRA 4YONB 3OF2A 4YR9A 1I2MA 4O59O 1HE2A 3GRRA 3JQBA 3ILHA 2X7JA 1Y8QA 1UJ4A 1QQTA 4MLDA 3RRFA 1GNVA 1NM5A 1GL6A 4YYEA 4BLOA 3RWMB 2R8OA 3TLBA 2NSJA 4Q3KA 5TQ2A 3VYTB 5A0TA 5AW8A 3JQFC 2L17A 3CSUA 4L75A 3GJZA 1DT3A 2FG7C 2II6A 4PRLA 4V1CA 5JVDA 1NVGA 1VE3A 3KLOA 5THXA 3PTZA 1QORA 4YP6A 1NE7A 3EXHB 1Y5IA 1KZYC 4NMXB 2H1IA 4QEKA 4LSWA 4RIFA 3JZAA 3ZE1B 4Z4GA 4PLTA 4DZRA 1CUBA 3O3NB 4MW9A 4KKXB 1U4SA 2FJPA 3SKVA 3UQYS 5C1OA 4RA9A 2ZRAA 1XKTA 1T6YA 2F9MA 4FWBA 1N2CB 3R7LA 4F8YA 3N05A 4NEHB 2V7UA 2G06A 4JOBA 5AKEA 5G0WA 5B2EA 3WYGA 4LXXA 3CMCO 5ELMA 1SH7A 1YUNA 1WXXA 2A9FA 4PLVA 3HB0A 3VBEA 4PYRA 3AXTA 3BHMA 5K3OA 5LD2C 5AVTA 2IEAA 1Q0QA 2JLCA 4H6PA 2PV0A 2XV1A 5EHZA 1Y3CE 3O3OB 3CX3A 2AQIA 2EEPA 3KOWA 3DE0X 2QVYX 4W1PA 2P7IA 3GLKA 4HGRA 4HN2A 4L4XA 2FRDC 2IY9A 4KXVA 4P38A 3I0MA 5TXGA 2RBGA 2ZIXB 5AOVA 1VCHA 1L8XA 1WEKA 2B37A 3PQ4A 2BHNA 4GMFA 3TTVA 4MVYA 4MWDA 4J94A 4D8WA 3S6JA 4LY3A 5DYGA 5AXAA 2Q99A 5LQCA 3N8HA 1K6XA 5DXFA 3D4OA 5EC8A 3R9WA 2WV9A 4U7WA 5L45A 4TLLB 5KTRA 5D3ZA 3E7PA 3TOCA 121PA 1THMA 1Z4QA 2BC9A 1B73A 3UK1A 3E5NA 4F6CA 2SKDA 4RSMA 2JDIA 3EGWA 1TOAA 5TMBA 2R6DA 3CUVA 4AJHA 2D5LA 4Y9UA 4PQRA 3T1HB 3O03A 1RLTA 3GJ5A 1T9BA 4PVDA 2OC9A 2Z5LA 4J0JA 4MYUA 1YE5A 2ZT7A 3H8SA 4KGDA 3RC2A 1KJNA 2WYVA 4EFNA 3IVCA 2NUTA 4DLBA 1IUKA 5KYNA 4PU0A 1DC8A 3ICPA 1FCJA 1R3DA 4HK4A 1PV1A 3H1GA 2GKSA 1XHLA 3VU8A 1AZTA 1CQIA 4JFRA 4HRVA 2P6OA 2VJKA 3N8NA 2ID7A 2GM9A 4LISA 3V8EA 3LMKA 1K8QA 1XQWA 3OIVA 1QNLA 4LC1A 2BFFA 5DI3B 2W6QA 2M2IA 2UVPA 3OZCA 3QJGA 4IXNA 2YVLA 4I8XA 5GZ1A 3T3MB 2QQFA 2HGZA 4B32A 4M6WA 7YASA 4Q1EA 3OZVA 4WFKA 3S81A 2Y1CA 2QPOA 2A3NA 4DC1A 3PC2A 2PH3A 1M76A 1OBHA 3DBOB 4R7GA 5DXAA 3ZK7A 5C8YF 3U5TA 1A95A 2DQ4A 1SZCA 2GN6A 3B3AA 3HYSA 3PGJA 3WQQA 3KOXA 4LJ7A 3EHDA 4GGMX 2E9SA 2XCIA 3NDBB 1LWOA 2NZ8A 3ASUA 4MPPA 4M60A 3R3VA 5CXQA 3QX3A 3CW2A 1ZR4A 2P0EA 2YZKA 1JB9A 3BFKA 4L4RA 1PDOA 1XZNA 3GO4A 3NCTA 3OFJA 4K9DA 1XK7A 3TEFA 2NO5A 2HN9A 4N41A 1Q2XA 1LV8A 5GPBA 1JMVA 2PIDA 1P7ZA 3F74A 4M37A