4FI3F

Structure of vitamin b12 transporter btucd-f in a nucleotide-bound state
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
245
structure length
245
Chain Sequence
b'AAPRVITLSPANTELAFAAGITPVGVSSYSDYPPQAQKIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKVMWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFGINPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITGGPDQIPKIKQYWGEQLKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vitamin B12 import system permease protein BtuC
publication title Structure of AMP-PNP-bound vitamin B12 transporter BtuCD-F.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 65
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2012-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4fi3F01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4fi3F02
5KOHA 2YNMD 1KARA 2XDQA 2XUZA 1K2VN 3LI2A 1QGUA 3ZK7A 4MO9A 3ZK8A 3ZKAA 1ESZA 5CR9A 3HJTA 4HMPA 1KAHA 5FLYA 3TLKA 5I4KA 4WN9B 4WNAB 5CX1A 2XH8A 4FKMA 4K3VA 4OXRA 5B58T 2ETVA 2PRSA 3G9QA 3R5SA 4WN9A 4WNAA 4PAGA 3AEKA 3TEFA 3R5TA 5BVGB 1M34B 4NNPA 4CL2A 3AEQB 1PQ4A 1G21B 3AETB 2PHZA 3GI1A 1M1NB 4FI3F 4TKVB 3U7QB 3AEQA 5GGXA 5JOQA 2M6LA 1G21A 3U7QA 1M1NA 4ND8B 4GICA 4TKVA 5M3BA 1FP4B 1N4DA 1G20B 3HXPA 3ZTTA 4ND8A 5BVHB 1FP4A 3MWGA 4UTPA 1L5HB 2R7AA 4LS3A 5KOJB 2YNMC 2AFHB 1L5HA 5M34A 3MFQA 4MLZA 4LJSA 5HX7A 5KOJA 5AFSA 2AFHA 2OGWA 4NNOA 3UJPA 3NU1A 1K75A 4H59A 4BBPA 2M6KA 3K1AB 1TOAA 2MINB 1MIOB 4N01A 5BVGA 2PS0A 1N4AA 1M34A 3K1AA 3AESB 1XVLA 2Q8PA 3HH8A 2RG7A 5HDQA 3EIWA 1MIOA 3AETA 1QH1B 4OXQA 2QI9F 4M7OA 3AESA 4B8YA 2OSVA 3AEUB 4FILA 2R79A 1PSZA 1K0FA 3LHSA 4DBLE 2AFIB 5JG7A 3AEUA 1G20A 4G09A 4INPA 4UTOA 4XPIB 4UDNA 4INOA 3TNYA 4OVKA 2AFIA 4IRMA 5BVHA 4MX8A 4TKUB 5KHLB 2WHYA 3AERB 1KAEA 4XPIA 1M1YB 2XY4A 4WZAB 4TKUA 3PDIB 3AERA 5JPDA 1M1YA 1N2CB 1H1LB 5M2QA 4WZAA 3PDIA 1QGUB 4FNAA 1EFDN 2X4LA 4MDYA 1N2CA 1H1LA 2XQVA 4G07A 1QH8B 5JJ5A 2MINA 4WZBB 5M29A 2PS9A 3MINB 4WESB 4H0FA 1QH8A 5CX1B 2XV1A 2O1EA 1QH1A 4WZBA 3MINA 4WESA 1K7SN 3PSHA 3MWFA 3AEKB 2OV3A 2OV1A 4HN9A 2PS3A 3CX3A 3ZK9A 3PSAA 3MD9A 3EIXA 5GGYA 4PM4A 1N2ZA 5KOHB 2WI8A 4HMQA 4UDOA 4HMOA 3BE5A 2XDQB 2Q8QA 3BE6A
chains in the Genus database with same CATH superfamily
2OORC 3ZE9A 1J33A 1UQUA 3CR3C 5K8TA 1ZLYA 1E3QA 2DFTA 3H2IA 3GQBB 3Q1LA 4YRRA 4A6EA 4IF4A 4IHJB 1EBUA 4NMXB 1P9WA 1QIJA 1ZZEA 2FPKA 1U90A 2IDMA 2IU6A 1DUVG 2IOQA 2P1DA 4G6ZA 2UYGA 3L8GA 5CR9A 4MKRA 4AG3A 3MCVA 4ZYWA 3WE7A 1KAHA 4U2KA 3DS8A 2I65A 1OLOA 1OGYA 1ZX1A 3PUXA 1CEXA 2XNDD 2B25A 3UJBA 4EHFA 5EMNA 3E7PA 5J1TB 3VSCA 5J5AA 1JA1A 4CUKA 1ESDA 4P8RA 4MJLA 2HU2A 4GI2A 4M55A 3V4RA 3DLBA 4I4IA 2GARA 1P1JA 4K6FA 3SXUA 1O6GA 1TVCA 1AO0A 4G3XA 1YOVB 4LVNA 1LVUA 3EXFB 4LGMA 2IY8A 3DEAA 4DJAA 5C5IA 3KWJA 4MKZA 5DT9A 3R1IA 5G2OA 2PJRA 2ZBDA 4X63A 1Y4AE 3NGXA 4NYIQ 5JXGA 2PBLA 4G1EB 4MWBA 3R7AA 2A86A 5M3BA 2ZRGA 5GZ3A 3FXAA 1JG3A 1RI5A 2FUG6 3HDTA 1U5CA 2WUVA 5F2KA 3T9EA 1E6WA 5LCXA 2OSBA 1GP2A 2IYNA 2ZCUA 3FFAA 1VL8A 4B6JA 3UFBA 2YWGA 4YRNA 1QHSA 1VG1A 4LJ9A 3CW8X 1N1GA 1ZWLA 4CLOB 5CT8A 2IU4A 2JH8A 2CVQA 4C20A 2C9CA 1IN7A 3ZWBA 3TLEA 5J2UF 5DK6A 1Z5UA 1Y5NA 3CH6A 3JQDA 4WY2A 5JS2A 3D6MA 1IJBA 1GFZA 3UB3A 3BCRA 3PD7A 5CT5A 5GJVC 1SBNE 1BH6A 3ND9A 1CUIA 4TL9A 2UAGA 4AQDA 4BAGA 1A9SA 3W8RA 4KU4A 1YQEA 2Q9AA 4US0R 1DTEA 2B98A 4RK5A 2R8ZA 4P3PA 3H05A 4TLEA 5H5JA 1TK2A 3INYA 4O2BF 2ZEJA 2CLFB 4JQOA 4QGBA 3H1FA 5JZMA 2IXFA 4DRZA 4QUGA 4NJEA 2I3BA 3R7WB 1OBHA 3V7NA 1J56A 1EHCA 1HT0A 1PK9A 3AERB 3KZCA 5LQMA 4BO7A 1M1YB 3E9ZA 1T2EA 1JNYA 1PL8A 4A6DA 1L5VA 1QF9A 4WA7A 4FZVA 2M6RA 1E2IA 5DTMA 4E11A 1V7PC 3R7FA 3EWIA 3UMCA 1U0OC 3FDIA 1EUQA 1USGA 3OJWA 2HPHA 2BBSA 3TCNA 4KSCA 1MENA 4BFXA 1XRMA 4ZHSA 1LB1B 1QGOA 4X54A 2G70A 2PZAA 5C53B 1XZDA 5I5EA 3O5AA 1FUIA 2AI3A 1U9YA 4FDTA 1W93A 4JEIA 1CZKA 3RHTA 4AMUA 1VCHA 4D1YA 3IKTA 5ER6A 4JT2A 4WESA 2D0IA 1L5LA 3IUYA 3FBTA 4X9XA 3P0FA 3P4XA 4JA2A 3FVVA 1W8IA 1XMPA 3EVBA 4LZZA 4AXXA 3MJTA 2HA7A 2MMGA 4BP8A 3HXQA 4BPBA 2OZEA 2PTGA 3T1TA 4MI6A 4IHAA 1H2EA 1SIBE 1PS8A 1T43A 1I2DA 5G3YA 5KOHB 1IXYA 1L5FA 3DKKA 4ZDJA 4LC1A 2B8WA 3GOQA 4M99A 2FZGA 4MPPA 2AN4A 5DXJA 2FH5B 3WKBA 2HCTA 1KI2A 4WLNA 1KI6B 3K30A 4F11A 1E4EB 5KVCA 3C6YA 5I9BA 5JY6A 2CZQA 1K6XA 1K2VN 2I7XA 2G4CA 5AI4A 1JT2A 4PRYA 2IWHA 1Z83A 3LL4A 2VAWA 4IH9A 3D0QA 3GDFA 1XXLA 3GFGA 4GECA 1Y48E 2AOXA 3CLKA 2DWOA 1NQ5A 4K46A 1SXJD 1TCUA 2PMKA 3R0XA 1GGKA 2JFYA 1R7RA 1XJ5A 2OWEA 3K9HA 4A2CA 4EKYA 1EP1B 1ZCBA 5DK4A 4FC6A 3ER9A 4MP3A 2GEDA 4W1QA 1W5SA 5MN5A 1Z6TA 2WK1A 1EJ6A 2Q0QA 4NX2A 2H11A 2WTUA 4GOMD 4WFKA 5L51A 3CIFA 5I9LA 3JY6A 4CEJA 2XCTB 3O9VA 1IEWA 2NVUA 3KR2A 4RY9A 1J22A 5FTJA 2O2EA 5IT5A 1GZHB 3HUUA 3A6LA 2XMDA 4V38A 4QDUA 3AONB 4BKUA 3TSWA 3GT3A 1U02A 2SKCA 4IDHA 2BRUA 1TA0A 1R8SA 4LEIA 3LOUA 1UPTA 4BLRA 2HCFA 1JUDA 3I8OA 4KBYA 1LC3A 1NQOA 3H17A 5CHEA 2DVMA 2I1VB 2B4TO 3PFKA 3R20A 4G4SP 3GMIA 3SY8A 3FYTA 1T9DA 2H2AA 4OMUA 4RK0A 3OOJA 1CDDA 1TIKA 3H5LA 1AE1A 1EK5A 1Z3CA 1PR1A 5COAA 4OIMA 1K75A 4V3CA 4X7PA 4JH0A 2ZJ3A 4C43A 4LFBB 5HMLA 4CFSA 4HDNA 2AR0A 3F4KA 2FZEA 3STHA 4F92B 1FXSA 2BHTA 2HA0A 4JJAA 1Y1RA 2VTEA 4B85A 5BVGA 3PXCX 4RL4A 4HWTA 2X5XA 4H1UA 3P0RA 4XM2A 4WY8A 1Y8RB 1CRWG 1YSCA 3VAAA 2CXUA 1OA1A 2GK7A 2I2WA 4D9JA 2BJVA 1D5WA 5LBIA 3DMTC 1T29A 2UUCB 4MK4A 1OH8A 4X00A 2OL4A 4JHXA 3WC4A 2YS6A 5JHHB 1XTVA 5JCOC 3L4BA 3X43A 3CW2A 3QOXA 4DRYA 4LOAA 3WK6A 4LKRA 1SUEA 4QOHA 2AFVA 4OL9A 1Z45A 5KTTA 2WVAA 2PZJA 3NASA 3OE7A 4QFDA 3SDSA 4B7CA 5JMTA 1JHOA 5FAKA 1E98A 1AN0A 4Q9NA 4EG1A 3FCUB 1XZFA 3E22A 3MBKA 3I4LA 2R97A 4DOMA 5B3KA 4Z9BA 3UJ3X 1VKOA 2J45A 3RVRA 1YO6A 3SI7A 4Z7OB 1MV5A 2AQ8A 4TS4A 2ADOA 2VBGA 1FUUA 4QC2A 1ZSYA 2Y99A 3G8AA 3HVHA 2PT5A 4IH1A 4Q4DA 4PLWA 3HO8A 4GVXA 1ULBA 3EEOA 5FI1B 3H5AA 1Y3AA 4JL8A 2ST1A 2INGX 4FFDA 3HSKA 2CLKB 3REFA 2BEUA 2P30A 3EUFA 3E7FA 2NO6A 3RARA 5JSZA 4TOIA 4CGYA 2I3AA 4JI1B 2ZT7A 3HYCA 1PW7A 1JFFA 1TCCA 2P4EA 2P9TA 2WFAA 3GFRA 3Q2OA 2OO3A 1MFZA 4HZUA 4A03A 4BMPB 4JCCA 1T1RA 3OEHA 1Q14A 2G76A 3K6SA 4D9FA 4FMCF 4FOSA 2FR0A 5FJIA 1GFWA 4JEUA 4WKPA 2AV6A 1QDLB 5FTMA 1KJIA 3ZHVA 5MHTA 2B1QA 2PBRA 1TEHA 3THRA 3F5FA 5GIOE 2WYOA 4AYTA 4BFWA 1X86B 1I2CA 2V3WA 1KVRA 3PUZA 4C4XA 5C35A 1U65A 2CHFA 3RSHA 2IX3A 3PF9A 4EGCB 1CY6A 4KG7A 4EYKA 2Q1TA 3O4HA 1G8HA 2CF6A 3NVAA 2QN8A 4PX2A 3ONFA 3ONVA 1KOGA 1YQGA 3RVJA 4OIFA 5JDIA 3A25A 4QOIA 4OBEA 4X6YA 2OCKA 1DIAA 2R62A 4F3NA 4FYVA 4ZEVA 1GIAA 4Y67A 3EVGA 5C5DA 5J59A 1SD5A 1XTSA 4CL2A 5HA5A 3AFMA 1E8DA 3AT1A 1EK0A 2C31A 2AW3A 3QK7A 1GKYA 1MC8A 4OXKA 4A5SA 5JXWA 4MYDA 4ZOLB 5WRFA 2JFQA 3MJ4A 4COKA 1XK6A 1A8IA 1HE5A 1XLWA 3K70C 4GE3A 3TZBA 1S8FA 4BCCA 2WNHA 1VOTA 1RWXA 3NM6B 3SPXA 1GQSA 3JSXA 4QNRA 1U8CB 3W04A 3W5VA 5C37A 2X0NA 3PJDA 1GCOA 3GLHA 2ZZKA 2NOAA 4GR4A 2P65A 4OJMX 3VPFA 5EIOA 1FW8A 3T4EA 5HZMA 1MRSA 3E8XA 1US8A 5IJ0A 3OQOA 1VSVA 4N5NA 5FYDA 3MPOA 1A3CA 1JHVA 5KYUA 4UE2A 4P54A 4KPFC 4CKYA 1YB7A 4P2BA 5K6AA 3THXA 2AXEA 1B43A 1EE1A 5EA2A 4UBKA 4W5OA 1NLFA 4XJSA 5FJJA 2FW1A 3PKZA 4AWBA 1L4EA 4C6TA 4F5YA 3E2MA 4M86A 3GT4A 1PWHA 4TN1A 3G79A 1MZPA 2EFGA 4BMSA 1O4VA 3C3XA 3U7GA 3DQZA 3BRWD 1OD6A 4IG9A 2BDUA 3F7NA 1DC3A 1B73A 2OSVA 4RETA 2YJNA 1J6UA 4TVKA 4RL6A 4YH1A 3HB4X 1GUDA 2C9ZA 1H4QA 3ZJVA 5B36A 4YALA 3DOJA 4MIOA 3RGWS 5K6TA 3OT4A 4F93B 4U2BA 4BX0A 2Q5JA 1F3OA 2QVZX 1CR2A 4R31A 4RV5A 1XG5A 4YP1A 5F7OA 1BX1A 4OI0A 3JS5A 4CMEC 3NVKI 2J46A 2R8YA 1P4SA 1FNBA 1P44A 2EBUA 2EHDA 1L4UA 3C3WA 1GRVA 3HCEA 5EWLB 1LEHA 3EGWA 1TQ6A 4ZT3A 2WUDA 5DT2A 1QK5A 4RK4A 2FWBA 3B8HA 1A95A 1QGUB 1X39A 4FNAA 4Y2QA 1GY8A 1AB5A 2X4LA 1W73A 2QVYX 1K9SA 5AVKA 1XGKA 4DBZA 1KY5A 4X90A 5EIFA 5TDHA 5A4FS 2JK0A 4GVLA 4C30A 3VUFA 4QA9A 3H99A 4MUKA 4D5GA 4QPZA 5IKXA 3UT5A 1J0XO 1CRLA 2J31A 4CLDA 3ZLBA 1Q0UA 1GLVA 4TV9B 3ZZ1A 4AQ7A 1CQZA 2IZ7A 2VS1A 5TGTA 5HE8A 4JB2A 5U9CA 2V6GA 5DGXA 2VDJA 3KRTA 1DEKA 1JMVA 3RGGA 1M76A 1IZ9A 1GOTA 1NAHA 4KKXB 2YZMA 4Y2UA 3ZN2A 1GNRA 1DO0A 3FWHA 4IDNA 2PX0A 2H92A 1AXEA 4FZRA 2ECKA 3L6DA 4NCJA 5ALQA 4MGYR 2GCOB 4EA6A 2GCIA 2W90A 2ZWOA 2VHEA 3KT8A 3ADOA 4OQQA 3D8HA 4YT4A 2NPOA 4YXFA 2F3PA 1KE1A 3VYVA 5JXJA 1YZTA 4F8EA 3TECE 5JSYA 3IKVA 1HY3A 4JSTA 1UOQA 4L4ZA 1TUEA 4DS3A 1LKZA 4MQMA 4X1OA 1C3OA 7MHTA 2OCXA 3DJFA 3AXSA 1TM2A 2DAPA 2VRBA 1JAIA 2ETVA 2JGJA 2Q2NA 1II9A 2JRCA 8ABPA 3DLIA 2FVYA 2H9IA 4URHA 4CDMA 1XNRB 1Z82A 2GDJA 4Z8YA 2A1UA 4FQ5A 1MJGA 4DDVA 1A2OA 1M66A 1SCKA 3HCBA 3T4PA 4YPVA 2WM8A 2CLCX 4EO4A 2AMLA 3EG9A 1J90A 4V2IA 1NQUA 4PX5A 1CUAA 3E70C 3TPCA 2EG5A 1DJQA 4FHGA 1QLHA 2GAIA 2VKQA 3QIVA 4U8HA 1ID8A 5G0UA 1GVNB 1E3LA 4TMTA 3S5JA 4JJIA 5H82A 1PJRA 2D8MA 2GLUA 1E20A 2EG9A 1AXRA 3SYNA 1I33A 5LQJA 4OLAA 3WBBA 2CLIB 1Y6GA 3SJBA 3VNAA 3BRQA 1DTSA 2X9LA 4QHYA 5C0OE 4UTVA 1C9EA 3FPGA 3WGGA 2VTKA 3IVAA 1UKVY 5D1NA 1T5SA 2W6PA 2DKOA 2XEXA 1VZ2A 2VBFA 3R7NA 1VHTA 2PSSA 3T3MB 2BWJA 1XWIA 3KKQA 4G9GA 3VA7A 3AHJA 1PSZA 3ZBUA 1NLMA 1WV0A 1AG9A 3ZCRA 3N8HA 3N74A 1DNPA 2IZ0A 4KTVE 4FN5A 4UU8A 2PEYA 1X7WA 4IRMA 2HJWA 5IARA 3ZX5A 5ADWA 3WGQA 1T10A 2P2NA 3KPUA 1QQ7A 3C97A 3GCXA 4P83A 3VJLA 4L4SA 3VR2A 4UTRA 5AI9A 1Z2DA 5KWIA 2X8JA 4F3KA 2OUIA 1I0IA 4OPMA 1TM4E 3C2QA 4XGIA 2HWWA 2ZRDA 1P17A 3KJZA 1DC4A 3MTDA 2CL7X 4LHYA 4YCLA 2WIKA 2FA9A 3PE6A 1WXHA 3DBHA 4IXWA 1ADYA 2FWIA 2YYSA 4L0DA 5AIBA 3CG4A 3CWQA 3UMBA 5JZBA 4OJYA 5IS2A 5HKAA 3G13A 4Q1VA 4UAGA 5BSFA 2ATVA 1EFAA 4ECAA 4F84A 1BQEA 5H80A 3DWFA 2JIDA 5JJ5A 4GLFA 4IJWA 3P7MA 3VPXA 1OWMA 1RADA 4WESB 1TRKA 4Q7MB 5DYTA 1B8UA 4ALKA 3KP1A 1C81A 4YP5A 3VNRA 3HRKA 5IBCA 3KQOA 2ZZMA 1H2WA 1TJPB 1AQUA 3NBAA 1GA1A 3TIXB 2R2AA 4O1HA 2Q7DA 2P0EA 2W42A 1AKTA 1GTMA 1MO2A 2AG6A 2J5XA 2ZI5A 4YRCA 4L4RA 2ZTSA 4LXGA 4DA6A 1F0YA 2IYSA 4IQ0A 2W2NA 4JSYA 3SC4A 3CKYA 3KEFA 2JPDA 1IDOA 3I09A 2AZTA 3FZGA 1QYDA 4R1TA 4W63A 4CIXA 4E5UA 1OF1A 3DEYX 1HE2A 3N2GA 3IHWA 3M6WA 5CDYA 1EBFA 1NURA 4ZK2A 5K0EA 2POQX 4HH4A 1J24A 1OIWA 3WLHA 4BX2A 5HP4A 1W44A 4Y6LA 3USES 1Z5OA 2Q6LA 4I1OA 4DWJA 1GG9A 4BB6A 4N12A 5ALWA 2JCBA 4Y2PA 3OMLA 4FJ1A 1CULC 4MARA 4U5QA 2OILA 3ZLTA 4AROA 3FHLA 3GXBA 3JQ7A 3DR5A 4TUYA 1T9BA 5B58T 3BXFA 3SSOA 5AUPB 3PC8A 1LW7A 4CEJB 1BVHA 1U2QA 2NVUB 4Z9FA 1ECCA 2QS9A 4JLWA 1Q7RA 3TDKA 2PJZA 3UUGA 2HSGA 4HEA6 1ZIOA 4HTFA 3WLNA 2DBZA 4CT0A 4BY9E 4HLQB 4S1NA 3EXHC 4HNUA 3MIIA 4V0NA 4AJPA 4BQIA 1G21A 3AW8A 3PR3A 4ARCA 1C0PA 2AZMA 4P4UA 5C8YA 5T3UA 3RBZA 4BNNA 3O8RA 1X87A 1VE7A 4EQ6A 2E1RA 4N39A 5COQA 1Z38A 2O14A 4ZVNA 4KVGA 3RHZA 1DXQA 1JECA 1ONBA 3TQTA 1HLPA 5P8WA 1DJPA 4JT4A 3C5CA 3ZDQA 4D97A 1PYGA 4B71A 5CB0A 3GLIE 1Y7IA 4MUFA 3C8DA 4Q93A 3U1VA 1Q7TA 3KQNA 4WXRA 4RORA 4FOOA 5EINA 4JYMA 1VDMA 4IMJB 2Y1LA 4QOJA 1IQPA 1N0UA 2D7CA 4HDNB 2OHIA 1RYNA 2GLXA 3WRWA 3I64A 2O2HA 3Q9LA 4I0WB 3KTAA 1G3QA 2P40A 1MOSA 3ZWNA 1T4GA 3OIYA 2K7ZA 3P52A 2VJMA 4BJHB 5KCMA 4FCWA 4YYZA 3R40A 4YUZA 4NXNB 4R0NA 2VAVA 3VR4A 4JVMA 1NAIA 4AZTA 3TX2A 4PVCA 1W581 2PEZA 1JXMA 3IKJA 3FKSA 2ENWA 1XFAA 5AVYA 3FOBA 2HYIC 3V1YA 4DBVO 5JARA 1ZD5A 5IG2A 2AMVA 1XQYA 4ARZA 2BGKA 3SDBA 1H6BA 1I4TD 2P3QA 2XMGA 1POWA 3I9FA 3JVIA 2PLFA 3ZWOA 4ESOA 1YIDA 2C5EA 3IMCA 1XROA 1PUXA 3QY0A 4TKUA 3R4VA 1UWCA 4Z2YA 1ILWA 3S8MA 3IT2A 4ZXFA 2AC4A 5CVCA 1DEAA 3E22B 5EP2A 4CNQA 5JS7A 3HXKA 1QCZA 2VBIA 3AC0A 3AWIA 3ENNA 3G9UA 2O2SA 3GNSA 5CLLA 4ER5A 1VPDA 3AI3A 4UNPA 4RANA 4YB8A 1J70A 1U4NA 2X77A 2IEDA 4GX5A 3LGXA 2V55B 2JZOA 1KO8A 3ZWQA 3QVVA 1DELA 2BY4A 1ZS9A 2BEUB 1SBQA 4AO8A 3KFXA 3CSDA 1VKRA 2R8RA 2QVXX 3ZHOA 3EEYA 1G60A 1Z6GA 1MO3A 3BULA 4FVTA 4GNRA 5JSZB 4CM8A 2CCJA 4HZUB 3PGXA 4U0KA 4LDAA 2PWAA 3OQHA 4KGVA 4DMKA 5BP7A 1LJLA 1Q1QA 2A7QA 2A14A 3VUEA 1QQTA 4OK5A 3LBHA 5FEMA 2NU8A 3K6SB 4DUYB 2I9KA 3ZJ5A 4TMYA 2GK3A 1SG0A 2JAUA 4RIIA 1VYTA 1FQWA 4LF6B 5CP8A 4JI8B 1GGMA 3NOOA 4PO1A 3VNQA 5IKPA 1Y9DA 2ZVDA 1O94C 4MVJP 1CHNA 3QUSA 2QD5A 5TR9A 3L1UA 2I7DA 1A5ZA 1QX4A 3QE4A 3O8CA 4HVAA 1SU6A 5DGIA 1E9FA 4Q7QA 3W3ZB 4XYGA 3CRRA 4HZGA 5F3WB 1W4ZA 2RC5A 3C14C 4B8WA 1BTOA 3OCYA 5TRTA 4B7UA 4BNGA 3V3KA 1YRLA 4D3YA 3BFXA 4TLMB 4ID9A 3T0FA 3TR6A 3WP0A 1VKNA 4LI0A 3OETA 4N18A 4MGZR 2PWZA 5F21A 1W85A 1K92A 3AIKA 5F2OA 4JJGA 3AY7A 4C0AC 4DCOA 2ZBFA 4CF3A 3G9XA 5H59A 2VH2A 2RGCA 2X2FA 4NBVA 5C1BA 5JDCC 4UU1A 4ZT4A 1L7RA 2VWPA 1IB6A 1CXZA 3JZMA 3L7YA 4R84A 1SIOA 1BMQA 3DZGA 1CU1A 1MOQA 3IDZA 4L72A 4LWQA 5E9QA 3G7NA 5EYPA 4AECA 4EPTA 5JAPA 1Q1NA 1US8B 1OFHA 2A3NA 5IJ0B 4DNPA 3FDFA 1K89A 4ND5A 5KYUB 4IVNA 1Y8AA 3OQ6A 3D5EA 3W3AH 2Q3JA 4GM0A 1U9CA 4IKPA 1WOYA 4O2RA 4DSOA 3THXB 1ZJ5A 4CL3A 4DC1A 4KQWA 1CJSA 3GLFE 1T36A 2W43A 5HX7A 1F0KA 2J59A 3QUTA 1ABFA 4M88A 5SV2A 5KOJA 3CISA 4FYPA 2XVXA 2PGNA 3D8NA 4D8YA 2HCBA 2O05A 2R7NA 5CU7A 2GILA 2ZTVA 4B3CA 5JH7A 4LQ4A 4D3FA 1O9HA 2O7QA 3Q7IA 5AWFC 4PANA 1Z26A 1XHFA 3FSGA 2O1XA 3GL9A 1DC8A 4MLPA 4F1WA 3PC4A 4CCWA 2QSYA 3C6KA 4TTTS 4EUHA 1L9KA 1CY0A 4UE6A 1W49A 2JF0A 2QXYA 5JTTA 2FEMA 4JBWA 2ORYA 1UZAA 3KLMX 3ZQ6A 5CGZA 4QTYA 5JS1A 3B7WA 5CAEA 2FUKA 4Q3EA 3TW8A 4XVRA 5FD8A 1V8ZA 3TNYA 2WHRA 3BREA 1RWQA 3OO1A 1CIPA 3SE0A 3ADCA 3PQCA 5CJJA 2W4QA 4NWIA 4AMBA 3G8BA 4E15A 1T9KA 1WUYA 3D6FA 3PFGA 5F23A 4D8WA 2OHVA 2PO7A 1J2TA 1ZONA 3ILSA 1N78A 4P98A 2GXUA 3KB8A 4P0TA 3UWOA 5AVTA 2I6QA 2XWPA 1CP2A 2ZJZA 3SHFA 3WB0A 2XX3A 1W52X 5AOVA 1QRDA 2XDYA 2RMKA 3LT0A 4L6CA 4M76B 3G9ZA 1YR9A 2PD4A 5B1IA 1F1BA 3UT5B 4CWAA 1CVRA 1XA3A 4BZPA 2XV1A 4CT5A 3C6XA 3O0TA 3CZQA 1CQWA 1PFKA 4D5EA 2FE4A 2VUSA 1BJRE 1X7DA 2D54A 3JRWA 2HAEA 3X1JA 1GGHA 5ALEA 5CITA 5EJ9A 3OIWA 2MSDB 5J58A 2YW2A 2N75A 3FCEA 1TO2E 5EC8A 1OI7A 4DN6A 3WGLA 3D0OA 2WF5A 2HIMA 3A0RB 3KTFA 4C3VA 4RKRA 1U98A 2R6CA 2ZS8A 4FP9A 1AF4A 4P82A 1B6RA 5CNJA 5E8RA 1AMOA 4FEYA 2NTEA 2OOKA 2UYQA 3MT7A 1QC5A 4C5CA 2YIJA 4UBOA 5EHGA 4CU5A 2Q3HA 1JZSA 2WYVA 4KWIA 2OBBA 5AM3A 1C3OB 5JI2E 1FUYB 4QTZA 1A7KA 4H7FA 721PA 3TYXA 1T1JA 5T4HA 4IFBA 3I9V1 3UCFA 3EXEA 3CWCA 4DABA 4OMDA 3OE7D 3ML1A 3LUBA 4GBJA 4LMAA 2HO4A 4V39A 1UBSB 3ZNNA 2CVHA 4H6WA 4YAIA 1V8PA 5DIFA 1MPTA 1ZWKA 4H1VA 2CE2X 2MYTA 4HWKA 5I51A 5EIXA 1UC9A 1HM5A 1XNHA 2QNIA 1DBIA 3K2IA 4EMUA 1Z35A 3EG9B 3QKRB 3Q7SA 4IO0A 4F97A 1QRTA 1P80A 1R0ZA 2FZCA 2G1KA 2JI9A 4MRNA 2VG8A 1CB7A 1Q0RA 4BLOA 2QT1A 2HA6A 3COPA 4HN4B 5JD5A 1UBJS 1C0IA 2QN3A 3OF3A 5CVUA 5TPZD 3SQXA 1KH1A 1FOEB 3WWEA 4X8MA 3SMVA 3OEHD 1EX9A 2N9UA 3MJSA 1G0OA 1DJNA 4GLOA 4NH0A 4DMGA 3T5BA 1ZXLA 4FWTA 4OQMA 5AJUA 3SX4A 1N0VC 2HWUA 2ZM6B 5AKXA 1ECFA 1PJ2A 1RIIA 3UW1A 2ZRQA 4LNHA 3ZWMA 2DF8A 3NU1A 9LDTA 1LNQA 1JKIA 3OPQA 1KU0A 1N7IA 2WEKA 3KLPX 3PB3A 4XYBA 3NIFB 4PRLA 4RHEA 5EKTA 1UR5A 3NORA 4MRRA 4EG4A 1CF4A 5JAHA 4YAGA 4ZKDA 1JEJA 3V33A 3UFXB 3ZLVA 2WB4A 5CLHA 1SVKA 5D3MA 1BOFA 5FWXA 3NTRA 5J9FA 4ZIRB 4IPTA 4BV2A 1T15A 5C1IA 4NU0A 2PZGA 1KO1A 1H2ZA 1RAEA 3IOCA 4M98A 3TL3A 4UUAA 1X7WB 2QLLA 4I4CA 2XHEA 3IP9A 4RM2A 1WNFA 1T8WA 5JFOA 1GQOA 1AGNA 2JG3A 2R7LA 2X8JB 4XFKA 2Q0HA 4H4DA 4CLHA 1K8YB 3H7IA 1ZH8A 1KVTA 4CDGA 4YMVA 3GN1A 3DKIA 4G1UC 4D0RA 5EHNA 4R68A 4ER3A 5A5GA 3DBHB 4NOJA 1J0AA 5CYPA 5AK0A 4A91A 3ZWWA 1T8TA 2XWBF 3D4NA 2CEAA 2W7TA 3BPSA 1XCJA 2QLTA 4IZIA 3I23A 4OKIA 1PK8A 2KJQA 3I6IA 1D1TA 3C7KA 3CSSA 3AUUA 4RKWA 1ZIXA 4C4OA 1FS6A 5CBPA 4DR5B 3ZD6A 4M60A 3BDIA 4I9GA 2NGRA 2BFCA 1LZKA 1GD1O 2CJWA 3D8BA 4AIRA 4EW1A 2J0EA 1FNCA 1XFDA 2NX2A 1N3LA 3TOVA 4RHTA 1Y6ZA 1FMCA 5KTPA 3A9CA 3CZ4A 2IHBA 1OCEA 2D2VA 2Q3LA 2RSLA 4HLUA 4YR7A 2YIDA 1R3UA 3DM5A 4QYXA 5CB8A 3QMPA 2RH5A 2ZT8A 3U2QA 4PN3A 1CUXA 2W5UA 4YIKA 3HFRA 4JNKA 4MEBA 1YONA 1EZZA 1WXGA 3ORHA 5DGHA 1GTVA 3N2GB 3FKJA 5DHPA 3RHSA 3VGJA 2JH3A 4W8GA 3ZYCA 3W5CA 1E62A 4H15A 5FBZA 2V6FA 1T2FA 4IICA 5B2EA 3W6ZA 3PHLA 3BAZA 3L2OB 1Z8NA 1OX4B 3HEBA 3CYFA 3IXMA 3VR5H 1SZPA 4IUYA 3DKVA 3SM9A 2ZYTX 1F3LA 1TJ5A 1GG5A 4LGCA 4EDFA 5T57A 1H93A 4J7XA 2H85A 3JQ7B 4JGIA 4TUYB 2W8BA 3MS4A 3RWMB 4UVDA 3BSFA 1O6ZA 4ZI3A 2G71A 3R8CA 1PR4A 2IY7A 1B6SA 5J5VA 4C0SA 2Q3BA 1PBTA 4IKOA 2CVOA 3L4EA 4G5XA 3HN7A 1YA4A 1E96A 3R5TA 1FSFA 3E23A 1UKYA 3FPBA 5JALA 4AZ3A 1LDEA 4UNNA 2D4HA 3L8EA 3ORFA 2DE0X 3F98A 4FGZA 4XWKA 1G21B 4EEXA 1R8YA 4ERNA 5K8CA 1Y7TA 4O4IA 3M6FA 2X0EA 1XIVA 3THOA 4EQ6B 3W6PA 2EBWA 3IP6A 4KN6A 1I3CA 5JJKA 1FVHA 4OB7A 2AEJA 2HA3A 2XVAA 4IR7A 4XE5A 1XJQA 5AI0A 4W5QA 2XNCA 1IUKA 5A6VA 5BN3A 1DFIA 3F6BX 4QM6A 2GYUA 3OLZA 4HFNA 4UMFA 2WY2D 3IAS6 2X19A 3GNLA 2AIRA 5F1YA 5BR4A 2VAPA 3ZH2A 1Q22A 3B1WA 3C6QA 3KTAB 3QFHA 4KQXA 1GEEA 5HBRA 4QUKA 5AIAA 2Y1OA 4UZSA 1ZAKA 2VJMB 3IEXA 1H69A 1CZUA 4QSHA 3ZHTA 1TZKA 1QONA 2VK2A 4MUXA 4PXSA 4FGJA 4TYYA 4DXDA 5KZMB 1SUFA 4HX9A 3DCJA 2FPPA 1ZP6A 4GS5A 2FFBA 1C8KA 2FW8A 1ABBA 1YB2A 3OOWA 1A98A 4GPBA 1JLKA 2LDBA 4JVOA 5T4FA 4YRTA 4LBYA 5JJBA 1R64A 1N5DA 2GJ9A 1LPNA 3PQ3A 4YJ2F 4ARZB 1WSWA 3WIOA 1Q0TA 4L9AA 1DO2A 2GM4A 4YMTA 2FMKA 5DH9A 3LFHA 2JKYA 4TKUB 2ISCA 5EIBD 1NUPA 2ZCJA 2PPLA 2YY5A 2IGTA 4MAAA 3DZBA 2ODAA 4XX1A 5A9RA 1PSDA 3AR2A 4LRQA 2EQ5A 2OYCA 5F73A 2RGUA 4HXEB 4N3AA 4E2XA 5CA1A 3BE8A 3NV9A 3F6RA 4KDFA 4REMA 1RXVA 2BGGA 4QOGA 5I3ZA 1IUOA 2H06A 1HZJA 4Z0TA 2P7HA 3B48A 5F52A 1AKUA 3K0CA 4E21A 1UBTS 2P8JA 1WKBA 1JE1A 1XCPA 2Q99A 2YINC 2Z9CA 3K5IA 4H0FA 4OA8A 4CM8B 2AG5A 3WKDA 2C4HA 4FEAA 3FLMA 5IXSA 3L8HA 2VPPA 3MT0A 1NUAA 1HNZB 3FTPA 2NU8B 2AE1A 3PRJA 5B1HA 2EERA 2G08A 5IAKA 2X6RA 2ZWVA 2ZBQA 3A6PC 3CRZA 3VKGA 2ZJ5A 1N7JA 3R75A 1YE5A 2IW1A 5CPBA 4B1FA 2XYGA 2YVUA 5BNIA 1VA4A 2Y67A 3HG7A 4Z3KA 3HUDA 3GRCA 1FVOA 3M5WA 3CPEA 1JU9A 3PV0A 4MA4A 5CPFA 5FI5A 5IC6A 2XUZA 2O8VA 3G7SA 3K6JA 3VO1A 1O5IA 3Q8KA 3NBUA 1YFKA 3PQ8A 1SK8A 3ODGA 1VG8A 2I22A 3CX6A 5IFKA 3GW8A 4FYIA 4O25A 2XD4A 1X1TA 2ZRFA 1VI5A 5E7JA 1KGSA 4N40A 1Y6QA 1TYEB 1ZI6A 2HPVA 2H2WA 1H6CA 1T4BA 1QK3A 4HYTA 1K08A 2P35A 4CMHA 1WPQA 3RH0A 3GOHA 1X3SA 4DTCA 4U1RA 1ZCFA 2C8LA 4GGPA 1W85B 2RBEA 4FYYA 4KXNA 1MP0A 1QGYA 2VC2B 4D6XA 4ZK6A 3CUEF 4D74A 4LN1A 1FS4A 4HNSA 1TECE 4ARBA 3W7BA 2PANA 4M8KA 1Q0SA 5TC4A 1GR1A 2LIVA 3B9BA 4H3HB 1LRKA 4HT3B 5K0TA 1NBOA 2ESRA 1UKEA 4MUYA 3GLTA 2PUJA 3A9TA 3N39C 3QBJA 4Y0AA 5EYPB 2QE7A 3SFZA 3V34A 1ZUNA 1RHMA 2WJ6A 3QNWA 4FT2A 4YX9A 5BMVA 2OBMA 3B9QA 3PEYA 1VPEA 3VZRA 1Z2OX 1J9GA 2HEIA 4LE0A 1O6FA 1T36B 2OCBA 3A1FA 3N6XA 5EERA 4EB8A 5KOJB 2DFNA 5KJ6A 4F4HA 2FP4A 5FXMA 5JH7B 3NBFA 2ZRPA 1YUBA 3AF0A 4PNEA 4PLVA 4AJ1A 3GWGA 5TX7A 1PNRA 3JRXA 2ARKA 1VQ1A 3I3SR 3HU3A 3OC6A 4BNXA 1DWQA 1FP2A 5EKSA 4B6GA 2Y66A 1M34A 2GZAA 4R2IA 1TQDA 3ZHBA 4F9EA 1X1SA 4R8LA 5CAEB 4EJSC 1T9GS 1X80A 3ZGZA 1U3GA 3TW8B 5L7YA 3W05A 3L8CA 4RZ2A 5K03A 1CS0A 5JG7A 2BISA 3RKRA 4DM3A 3QRWA 3MPUA 2YMPA 4YA6A 1PGOA 3FCOA 4TN5A 3LLUA 3UAVA 1NWCA 3S5UA 3TGWA 3C41J 3L0YA 1UMBA 4IS3A 4EJ0A 1AGRA 3LUHA 1FYVA 3RNLA 2ZS9A 4Y6RA 5JAIA 4MULA 3U39A 4WZAA 4B4DA 4N6GA 2H57A 3AILA 2VHXA 2QUJA 3FPFA 4E5VA 1ECBA 4KBGA 4B4KA 2HFJA 1ABEA 3UN1A 2OFOA 3C4QA 2D1RA 2Z2ZA 3IVRA 5H4HA 3PXXA 2OCAA 3SAJA 3NKVA 4ZWNA 1NI3A 4ZAYA 1XTTA 1DS6A 3IT0A 1T9CA 3G2NA 2BGIA 1E5TA 3NRBA 1DKQA 4KRGA 4UM8B 1K4KA 1EFHA 4V0SA 4ZC8A 1JF8A 4CM7A 2Y4OA 3SFTA 1UADA 1WETA 2XMSA 2FF7A 2QMQA 3C45A 2YKGA 1M33A 1VIAA 4UOQA 1I1HA 3AEKB 1J07A 3HM2A 3QVGA 4GC9A 5AUQA 4OLFA 3ZK9A 2Z6AA 2YYAA 4EO7A 1P3Y1 4L76A 3HA2A 3LDFA 3BYZA 1JBQA 3GFBA 5GGYA 1RNLA 4I4TA 3WBJA 1ATIA 4PSUA 4MYTA 4QREA 3VR4D 1IUNA 5A9SA 1JG1A 1QC5B 3AMVA 4WKGA 2R4TA 5TLSA 2ZI3A 1AUVA 1ZW6A 2EBFX 2QAGA 3F3MA 3R77A 2COUA 4JMPA 2PZBA 3JWEA 3F5QA 1NMYA 4LC9A 3S0JA 2GCEA 2VXBA 1QZZA 4MO9A 4AMVA 3T4XA 3EQ9A 2YWDA 3G2JA 2QP4A 3EEIA 2VJKA 1VSUA 4TYQA 4AD8A 4CMCA 2AG1A 3GV0A 3OLCX 5DWQA 3EXEB 3F9RA 2RJNA 2XMZA 3V8RA 1Z8FA 3VKWA 1J4AA 4PR0A 2FLWA 4AWXA 4ROSA 3S99A 3UWKA 1ODFA 2PAAA 2UZ0A 2GBGA 1JU3A 1QHEA 3GJQA 1XZKA 2E87A 4II7A 1HYGA 1ZBQA 5EUBA 4BLWA 2JI8A 1ZGCA 3H3FA 3H8SA 3LC7O 5BYBA 5CFRA 4UTNA 4YUXA 1C8LA 1DOZA 1O6CA 3QI7A 2OO5A 3SS7X 2JCSA 3PC3A 4S24A 4JY7A 1P7YA 3TG8A 1LK5A 1PQ4A 2YFYA 2P9QA 3NHAA 1P4HA 4Q03A 3HEMA 1F12A 1PFVA 2WP8J 3KUXA 3RUIA 4Z7NB 4COOA 2IP4A 1V41E 2XQGA 3TAHA 1KDPA 2RB5A 2NAFA 1AM4D 1E2LA 1RPTA 1ZCJA 5BN1A 5L7TA 3J81k 3RS7A 2AFHE 1N6RA 2OFWA 5AJTA 3QLVC 1O54A 1R8QA 2X4DA 2IU3A 4QXQA 3I5XA 4X8HA 2X3UA 2ZB2A 1PV1A 3BL5A 1TLTA 2HH9A 4RIHA 4YACA 5EEGA 1OILA 5E2AA 1GT91 3FNQA 1EB9A 1R00A 1IATA 2GWHA 2X2EA 5B53A 2AG8A 4JHLA 3UAXA 1PF7E 4YBZA 5LP1A 3C8ZA 1H2AS 2GEFA 1CHDA 3C87A 2HBYA 4YJHA 2FW0A 1Y7HA 2GGSA 4IWNA 2O5CA 1PJTA 4D81A 3MK31 4YDRA 3S55A 3C5WP 4LF7B 3JZAA 4IOJA 2FWAA 1XVAA 1TTHA 2QPTA 3Q9NA 4PY2A 3A1EA 5D3MB 5EQFA 3CV3A 4P6VF 1M67A 1FZQA 1EFTA 2E4UA 2GK4A 4JIMA 1CVLA 3MMNA 4W4TA 9ABPA 5EJ7A 4L4XA 4B2YA 2Q9UA 4EVSA 3ROGA 1RXWA 4JOQA 3U80A 2RG1A 2JDIA 4JP1A 4C7MA 4CMGA 5CXXA 1G5TA 1XDBA 2HHHB 1P1HA 3D2AA 4NCBA 3JD0A 3A6KA 4Y2GA 2IOFA 3IVMA 5FWYB 2Q1YA 4CEHA 3LPMA 4BQOA 1NIPA 1BQ3A 1XZLA 2WDZA 5LLDA 2N47A 1DRWA 4BNKA 2ZWMA 4KXMA 3A9RA 1YUNA 1K66A 1B3BA 4FJ0A 5AVVA 3N5CA 3LRTA 4I50F 4XIFA 1NXVA 1OREA 4HQFA 2BDEA 3RRZA 5CBPB 5A71A 2B94A 3AVXA 2WFZA 1YU6A 2BFCB 2CJWB 4HNAB 2WAAA 1J0CA 2WJPA 3ZY3A 5DXFA 2XVYA 1I7SB 1ANKA 3B5JA 5FBQB 3F1KA 1SY7A 3ICWA 3S2GA 4X62B 2FQWA 1KNQA 1WABA 3MUFA 3OICA 4MPTA 1R6UA 1ORDA 5UKDA 4U3JA 1HTBA 1KJNA 1OHHA 4UDXX 4A5OA 5IU6A 4UULA 3WJAA 4BJ6A 5LOVF 3H16A 4B4OA 3NAMA 4EFDA 2VFAA 4FGLA 4IY1A 3WMRA 1VSBA 5U4QA 4P38A 4BVFA 2DWQA 3FSGD 3FGPA 2YY7A 3Q0IA 4XRRA 5LIPA 1LUAA 1I2MA 5LA6F 1U04A 3HCCA 2CHGA 4NV3A 4ND2A 2C2OA 1P3DA 3W77A 4FI3F 3OT1B 1PQUA 1QG2A 1UDCA 4CR7A 4H08A 3ASYA 2HLHA 1IIBA 3CWZA 1H0SA 1T5IA 4PLHA 1S2IA 4CMIA 1WP4A 3HPQA 4YVFA 4MJXA 5G02A 1T6BY 2OP1A 1U7WA 1HOXA 1OJ7A 2PBZA 5JANA 3U7EB 1K8RA 2W8BB 4P5DA 2O2XA 4AJHA 1HGXA 4KP7A 4U7DA 1VG0B 3VTZA 2H4HA 3WQHA 4Z5XA 1NSYA 4RKYA 3YASA 1TADA 2EZTA 1QIMA 2JATA 4KX5A 3PGLA 5K4AA 4ZVPA 3EDOA 4AZ3B 5CVJA 4BXOA 1Q6ZA 2NXCA 1Z06A 1KI7A 2EDCA 2ODTX 2HRDA 2PFSA 3COVA 3L05A 4QX6A 1KI1A 4O4IB 2A8YA 3FX2A 5HS6A 2G09A 2G8NA 5BW6B 2XWSA 2GN2A 3T99A 2FMIA 3RUEA 3AKYA 3AM5A 2GVNA 3NC4A 5E9JA 3S2UA 4MSUA 4TTQA 3IT3A 5IJAA 2KQUA 2RHRA 5JD3A 3QV2A 5CG1A 1P77A 4EA9A 3O93A 3VHXA 4CEIA 5BN3B 3D6NB 3JWHA 1JQ5A 1VKZA 3B1JA 2QTVA 4RABA 3UMSA 2WA2A 3SM3A 2RGXA 3KQTA 4J94A 1KAMA 4AJ2A 5HQJA 1PU2A 1HTTA 3GAFA 5KPJA 1D4FA 3LPLA 5D3QA 3W0LB 4IGKA 3DEJA 3CNBA 1JDBC 4WCFB 4FIZA 2ZJ7A 2E18A 2VP2A 1P4RA 2PMWB 4GI3A 1U7PA 3FHCB 4GMXA 4NNOA 4J29A 3T7JA 4AKEA 4EF6A 3ELYA 4H59A 3RTDA 2EFCB 3IVCA 2BMWA 3I3OA 1JQJC 2FPPB 3P0HA 1C3VA 1E3IA 5D86A 3I61A 4HB4A 1J06A 1ONNA 1OXUA 2J48A 4ZI5A 2CT8A 1LTQA 2FZ4A 3T7EA 4JLVA 4CEIB 2BFDA 4BFVA 2QZPA 3M0EA 2W00A 1AXGA 5HJEA 3RAJA 1I94B 2IS2A 3AJ9A 5COBA 2F67A 4BKPA 2JFPA 3KJNA 3LXXA 4HPWA 2FPUA 4XGQA 3AB3A 1MH1A 1LSJA 3ZZNA 3TPZA 3QU2A 1AKQA 3A3KA 3RRFA 5DNAA 4QBKA 1ZPDA 3MLBA 3QKUA 1RM5A 4E4TA 5CA1B 4Z53A 1BGXT 2PRYA 4OGGA 4A0HA 1R6VA 3GLQA 3ZV4A 3FPLA 2GNOA 4B82A 3I30X 4H3SA 4TV8A 3E4CA 1OAOA 3U17A 4JUFA 3UB4A 2JASA 3DR3A 1ZM9A 2CBZA 1CZHA 2WZCA 1QKIA 5ADHA 4DV6B 2OESA 1IXZA 1HT2E 3KS9A 2CXHA 4UASA 3QYJA 4FGWA 3ETGA 4OOEA 3TQIA 4RHFA 2XKBA 4WZBA 3EAFA 4EF4A 5IVPA 5AOAA 2QLNA 2UVDA 2FF5A 2JLCA 2O3JA 3T7SA 3IP3A 1KO4A 2BHSA 4LYAA 4BAZA 2QHXA 4ITUA 1XZCA 2E1PA 3GC6A 3PNOA 3PCXA 3UJ8A 4CG3A 4NCAA 3EE6A 4LRYA 1QHXA 1VCOA 3NB0A 1EUDA 1XYYA 4I9NA 4PAMA 4XD7A 4R1PA 4RKEA 2X4IA 1V7CA 3G5AA 3SS9X 3A9VA 3SHTA 1KVUA 2D0PB 2J4DA 1YZUA 1Z9BA 1Y3FE 4K9QA 3M3HA 4LJAA 3N5KA 3R5KA 1F1JA 2GZ2A 2RGBA 1W7AA 1X1DA 2CEKA 2HO5A 5DM0A 1UJ6A 1G6Q1 3AFGA 4DIBA 5J23A 5F9MA 3BIJA 1N34B 1S7CA 1M2EA 5A1TA 4NBUA 1UEIA 1ICEA 3L1JA 3T7KA 4D80A 3HUFA 2GM3A 1IEVA 5PGMA 5DN6A 3CPHA 5DYWA 1DKLA 2C5BA 3AGPA 1CUBA 1DLIA 1JSRA 1NVMB 2D1SA 2RHTA 4WXHA 3AG5A 3RYTC 3D4LA 3G5MA 3SZ3A 4CUJA 5I7VA 2RGWA 3EIHA 3CE9A 4H27A 1ENOA 4BJ5A 3KSRA 3D7KA 3RVPA 5SY9A 2NP7A 4Q4JB 1BIFA 4F60A 4FNMA 4Y6SA 3JQRA 2YX1A 2PL1A 3WFJA 1V5IA 2OBXA 4TMWA 3AR6A 1I6LA 2H17A 4HB3A 1ZUNB 2J6IA 4MINA 4YECA 1M1NA 3PGMA 3FETA 1L5SA 5BMVB 4JBNA 4NARA 3GPBA 4WVFA 1MHTA 6AT1A 2V54A 1CUWA 2BVNA 1NVVQ 2RHJA 4WGGA 3WL7A 3E5RA 1NQAO 4BZWA 3AIIA 1XTBA 1YZGA 2X3YA 4WAUA 1WW3A 4OBWA 2GXQA 1YDMA 3DOEA 3RREA 2X4GA 4B0OA 3LDUA 3HJCA 5A3JA 3IQXA 3AP1A 3JWPA 3FI0A 1SAYA 3MN1A 3GGGA 5B7NA 1PT6A 1S5PA 2QOEA 1Q0QA 1BDIA 2E6UX 3CUWA 1E77A 1R0KA 2VDWA 1QFJA 2O0HA 5J43A 1KORA 3O9ZA 2VSYA 4PVDA 1X80B 1H66A 2QVCA 2R5NA 3S4YA 3NI2A 1YDWA 2D5AA 2ICAA 5EJIA 5LIRA 1CS0B 5E4FA 2R1TA 4NY1A 3H1AA 1K88A 5A04A 3PJRA 2IBTA 2RH4A 2ATIA 2BTEA 4DUGD 3UJCA 4OMCA 1PHPA 2XBMA 5BSGA 1UMBB 4Y2XA 3NUGA 1RHUA 4CKXA 4DLZA 3EZGA 2I6XA 2X0RA 4BO3A 1PYOA 5JQGF 1II8A 3HCFA 1WLSA 3I92A 3ITEA 3KU1A 4ZO9A 1A97A 5IN5A 4WZAB 3VYUB 1D2CA 2WVJA 3SJAA 2QLBA 3GHYA 3BIOA 1X19A 2RKBA 3G8DA 3DE6X 1Z5GA 1Z6AA 1BKSB 5T4EA 5JUWA 5TPZA 1QTIA 4FLFA 3TQRA 2UZ4A 1RDFA 1D9XA 2W2KA 4ZAXA 3TD6A 4HQ0A 3ICCA 4JB3A 3NHWA 4IOLA 4QHTA 1CP3A 1U4SA 2ZUDA 4QO8A 2VK8A 5FBWB 3KZOA 1FC0A 1NBME 1KFJB 1N2HA 3SGLA 5AVWA 4KZKA 4S2EA 3RABA 3AKCA 4QU8A 2FZ5A 2HF8A 1SOUA 3UUWA 3FAKA 3QEMA 3ZHXA 3QVGB 5HILA 2PMDA 2WTAA 4S1VA 3SC2A 2OKGA 1GV1A 4NP6A 2OV3A 1YJXA 3K0BA 3KFLA 1YCGA 1H4VB 5EQTA 1NNSA 2F3UA 2BFEA 1OR8A 2CVFA 2WQZA 4G5FA 4I4TB 2HXGA 1M83A 1E7QA 2K6GA 5BYJA 5BXQC 4D8UA 4C0HA 1S3GA 3NYRA 2JBAB 2AWOA 5A9SB 2C9DA 1R6TA 3I4CA 1TT5A 2ATCA 4GWKA 3UATA 1VPLA 2IYAA 2QAGB 3RUHA 5JVDA 3SZRA 1ZD1A 2OE2A 2ZXFA 5ECWA 3V42A 4L8VA 3QE9Y 1GZSA 1GLNA 1K06A 2ONZA 2XA9A 3CKLA 4DCGA 1EMDA 1KY2A 4ENQA 3TQOA 5K2OA 2EW2A 3BRCA 3EA5A 4MQFA 4DLUA 4PHFA 5HRCA 5LBTA 1NLYA 1ISIA 2WWTA 1H9BA 3OJEA 3WICA 4ZAZA 3LM8A 1H0HA 2ADFA 4ZODA 2O54A 3LY5A 2D13A 1NBAA 4D57A 4ETWA 5C3MA 5CXSA 2Z8YA 3LGSA 4TS3A 1PX0A 4KQ6A 3ET5A 1BW9B 2ZOSA 2C3PA 4UXIA 2HTEA 4NQZA 4WE3A 4OBXA 4Q3NA 2P6NA 3K9NA 3PT9A 3N53A 4M9QA 2CNLA 1M6EX 3BFVA 3DE7X 1TM7E 3IUEA 3DD5A 3DFKA 3ONNA 3UMGA 4HDCA 3O4GA 4PPGA 4HD8A 3IUBA 3WJ7A 2H3EA 2FQQA 3K20A 3RIYA 3D6VA 3UAZA 2K2WA 4OGWA 4AKSA 5E1BA 1V95A 1QFMA 4MQLA 5J2TA 2QAIA 3TLYA 2VF4X 3JR7A 3QOWA 3QX7A 3OU7A 2J6HA 4LJLA 4AJJA 2HI0A 5EMMA 4ESEA 2R751 1NFFA 3BIXA 3KQKA 1MTOA 2EIXA 1U2ZA 4XWYA 4B31A 4JC0A 4FB5A 4ERXA 2XE8A 3WZLA 5CA0F 4AS1A 4BHTA 3QG1A 4PR3A 3ZJUA 2EP8A 2IS6A 1FSPA 1R8XA 3WDKA 5KYTA 3SQWA 2ZIAA 1Y6JA 2OKCA 2QJFA 4N3NA 3Q9UA 3VXKA 3EIWA 4GOXA 9ATCA 3R6WA 3R3HA 1YJQA 3AHCA 5FFMA 3HBAA 2EKLA 2QIOA 3ZD8A 1R0BA 3BMXA 2ES4A 2GN4A 4G5YA 4JN6B 2VUHB 4O2LA 3VHLB 4ZAGA 2L82A 1L8XA 1VIVA 2C9OA 3OUUA 3ZWKA 3QWFA 1XLTA 2JLRA 2AFIA 4LECA 4GPEA 4CEHB 5IH3A 4R1UA 4RFLA 4HATA 3O38A 1Q92A 2C97A 3TUZC 4G0WA 4HAWA 4UEJA 3EFEA 3EDQA 1YS1X 3M70A 1PFWA 1JDPA 2HF9A 2QE7D 4JLAA 1TUIA 3FRHA 4QBGB 4U2FA 3NHFA 4MPRA 3RODA 1TTPB 2IELA 4RS3A 3TKYA 5I4CA 4ML3A 5EE3A 2VJOA 3WZMA 4BUCA 2ORWA 1Z0ZA 3MM4A 2F90A 3JVVA 3L6UA 1GZ6A 1E89A 4U3JB 2EGUA 3U9LA 4RULA 1Q2XA 4DW8A 1U2GC 4HEHA 2EZ4A 3EW7A 3OZEA 4NZZA 4Z7JA 5B3AA 4EMBA 3COJA 5AKLA 1VRVA 3QIAA 2XIQA 4J0KA 4BOYA 3OVMA 4HN9A 2V03A 3BE4A 4JB0A 2GN0A 4NZNA 3DEFA 4YRIA 1R4NA 2ANBA 2RGRA 3DQPA 5GAJA 5ITZA 5AVSA 4KIUA 2HA5A 1U7XA 5AXAA 4CMIB 3UMMA 4G0MA 5LD2B 5LQNA 2KSQA 5IBQA 3NWOA 1R8JA 1ENYA 2XOXA 5AMXA 4URYR 2ZUFA 3COZA 1QG0A 3K8YA 1QQBA 2B83A 3RU9A 4Q4HA 1INLA 4WBNF 1SK9A 3D1LA 3PQ2A 2CLOB 2GTHA 1GN8A 2OV8A 1P3JA 3CONA 2ZUWA 2V6IA 4FHDA 3VC7A 5AM2A 4RGBA 1EQ2A 3NKLA 4CV0A 5CX1A 3I9NA 3HXMA 1YIAA 1WXIA 4KMOA 1OGIA 2HIHA 4BXOB 4HNQA 3EIEA 1P29A 4KAJA 6GPBA 5IEJA 3O6VA 1UBOS 3CUVA 3ZOZA 1ZGBA 4J3NA 2JBWA 2MSNA 1QO9A 4H35A 3PRKE 4X61A 1LI7A 4AYXA 4JLNA 3E4DA 1MC4A 4TTSA 5HJ7A 2CDBA 3JALA 3WDLA 3EGOA 3FPEA 4J3FA 4KE7A 4R9RA 1OC4A 3HY4A 4G0QA 2HSEA 3Q2IA 1OI4A 3JYOA 5C4IA 1NJFA 1L7EA 2FGKA 3QLJA 4PGHA 4UPDA 3LV8A 3ESRA 4HLNA 1PJLA 2PUEA 2DMRA 2X40A 5FNZA 1IJKA 1WCXA 1XXHA 3ULKA 2C1XA 4EI8A 4QJ5A 3WYFA 1AQLA 3OFKA 4BMZA 2ZPUA 3DHVA 2YMLA 3FIUA 2C2KA 3F4BA 5E1OA 4BQFA 1S2NA 2PUVA 3B3AA 5DP1A 4JLKA 1W2GA 2KWIA 2NO7A 4Q4LA 5E0KB 3VX3A 4CLEA 3W5HA 4J0FA 3O8DA 5KYNA 4FR0A 2BFDB 4GF5A 3G02A 5BR7A 1A76A 3H1PA 3WGOA 1FYWA 2Q4TA 2XB8A 3P9XA 1HFWA 4GOKA 3K9LA 4A8PA 1QNFA 2BSXA 2QM8A 3DF9A 4LOHA 1ZD8A 2WHXA 3FHJA 1SA0A 3H8WA 5A7HA 2N0SA 2D59A 4PZLA 4I3FA 5K8IA 3R41A 4KYVA 2NACA 5HE9A 5DBEX 1Z36A 2AT1A 3LPAA 4TV8B 3LUDA 4PCUA 2VNKA 4IHJF 1PI3A 2P11A 3S2SA 1E94E 2IE0A 4RK1A 1RM4A 3EN0A 1AURA 1D6JA 1ETHA 1V3QE 1WJGA 4NMLA 1KS2A 2OQIA 4JS0A 4MR8A 3VPCA 1L4HA 4WZBB 2V1UA 4JJ6A 2VZ9A 1EG2A 1VE1A 2VNAA 3BDVA 1VYUA 1NX9A 3GAAA 2BFPA 1QH1A 2GCPA 3B3FA 1NYRA 1O9GA 1U8TA 1KK3A 2YFHA 3HKEA 4MH0R 4O0MA 5LB2A 1L8QA 2ZUTA 4A23A 2O19A 2NAPA 3A7DA 1E4OA 3E9DA 3O2NA 3DL0A 3O03A 4FEGA 1ZHHA 1EUDB 2DHEA 4MHSA 1QDEA 2IUUA 1QYIA 3H1GA 2VYQA 1GNTA 1H22A 3EYAA 2VHQA 1N2SA 2FSIA 2H16A 3JYNA 3NEYA 1RZRA 4XSGA 2Y2UA 4PINA 1HL7A 2W93A 5DYNA 4V03A 5YASA 1KA9H 3AY3A 1YGYA 2WU3A 1VL5A 3MWLA 1Z29A 3BK1A 1P60A 1X8LA 1RE1A 5ED4A 1P8AA 3NHMA 3JQBC 4ZCMA 4IUCS 2JDID 3P9RA 4KNWA 1QCYA 1UINA 2VLBA 3RVLA 2P90A 1GRCA 1DKRA 1RM0A 3GLRA 3ADKA 3O95A 1QYWA 1RAHA 4DTIA 3FA2A 4NMWA 2PZEA 4JBYA 4BRSA 1QQAA 3L02A 4I8DA 2R25B 4L74A 1N36B 1CSEE 3AXTA 1SBZA 4F3YA 3Q3JB 3RJMA 2H59A 1ZMXA 2VSFA 3BZBA 4OXNA 4PHHA 1Z3IX 2CXSA 4X8OA 4LBVA 3BZWA 3LQ1A 2ZE6A 4L8YA 4MUGA 4NNPA 3UW3A 1K5PA 1NW8A 4CU2A 3M6UA 5JS6A 1F6DA 5LPNA 2ZM5A 3RVOA 4CL8A 4DYHA 4RTLA 1M1NB 2PS1A 2ZTMA 4BU1A 2G1PA 1SCAA 3IIIA 2Y27A 2WWRA 4G0OA 2DR2A 2H4XA 2NO5A 1OHHD 1UT5A 2Q1UA 1I32A 1NHWA 2XDAA 2BCGY 3HNOA 2X5NA 4KW7A 4O0LA 1N4DA 4QUJA 2PFGA 5A4JA 2VJYA 1U3UA 1KQ3A 1X92A 2XQFA 1VLZA 2HV8A 2WDPA 4C6RA 5B4UA 4KR6A 1C8BA 2WJAA 5TMEA 2XSZD 1RWOA 1GL7A 3QPAA 4BLPA 1JG2A 1LV7A 1BKYA 1Q1EA 3H7AA 3HP1A 1DDOA 3AV3A 1R16A 3F7OA 1OTYA 1DE0A 4QG7A 5CD9A 5KVQA 4NABA 4JQSA 1WZUA 2VDWB 1CZOA 1QAQA 4O8ZA 5G0TA 3NANA 4BBPA 1QIGA 1TPZA 1ZINA 3ME5A 3QG5A 4OHZA 1U0JA 2G7ZA 5AXCA 3OE4A 4ZP1A 3SHOA 4C29A 4ZYXA 1AQNA 3PZBA 1Y3HA 3UV6A 1JR3A 2ZJ2A 5FPTA 2G83A 2IV3A 2JIZA 2RG7A 2R1TB 2GBCA 3EIOA 4N7RA 3AETA 2G0AA 4BNFA 1ZD2P 4DCNA 2X13A 3AJEA 3EXIA 2VJAA 3VPAA 3W2FA 2DUUA 3ZTYA 4Y30A 1H4TA 2EFEB 5JC8A 2EW8A 3BHNA 2O3TA 2CFOA 1II8B 3EBOA 1N2CE 2G9VA 1E1RD 2DBVO 3EUAA 2PVCA 3A14A 4EO9A 3IBTA 1R6DA 5TMPA 2C7QA 3EXG2 3P2IA 3SX0A 5TMBA 5AW7A 1E2PA 2G5GX 1GWNA 1XLVA 4DM7A 2VPXA 4J6EA 5LQAA 4BZQA 4B3HA 4PBTA 4OM7A 4P7FA 2J87A 1Z56C 3FR7A 3V4SA 3TDNA 2P9BA 2GXSA 2W2KB 2C7OA 1JH9A 1NVGA 1VLHA 1T3TA 1B16A 2R1VA 1A2BA 3QVLA 5LMCA 5I7AA 4KYUA 4P2GA 2FXVA 3MYRA 4RHUA 3I8XA 4C2AA 4MUMA 2FW7A 3RFTA 5I9NA 2E5FA 5JRDS 3QEMB 5M29A 1PBNA 4M0FA 3GPLA 4HNGA 2X2PA 3MTIA 1PUJA 1ZR4A 4E3WA 2V4UA 4EY8A 3U1BA 2Q7XA 4G4JA 4IIJA 1K7SN 5JISA 1RQNA 3ECCA 5FHRA 5AKKA 1DGQA 2MOKA 2ZANA 1EX1A 1GL6A 5C7LO 3IGFA 4YT5A 5BQ3A 5KAMA 3G2HA 3FCSB 1P6XA 1TT5B 2ZUVA 3FR8A 3W6OA 5JVDB 2H0QA 2QD2A 3DE4X 2AN9A 2FPMA 1GZVA 2CUZA 2VNJA 2Y1EA 2Q5FA 1VHWA 4NFYA 5CT4A 1N2EA 2I3ZA 2IUEA 4HQKA 1OROA 2EZUA 3HKCA 4NFHA 2AX3A 3SKVA 4EM6A 2IOFK 4R9NA 3T7CA 5ALJA 2IS1A 2YWBA 3N76A 1Y1QA 5JW6A 2Z3ZA 4CKBA 4MQFB 4PIPA 4BB5A 5A3QA 3CLVA 1K3FA 3HBFA 5H9WA 1NM5C 4Y1GA 2IH5A 3QELB 2BBTA 4D43A 3DPUA 4ZGGA 5KU7A 5AVUA 3Q8LA 2ASVA 3I32A 4JC8A 2BDTA 2CLHB 3LG2A 1P6UA 2OCPA 3PD0A 1JFLA 3MNFA 1HDGO 3WIUA 1NP6A 1L0BA 1MUUA 2B9EA 1D0SA 3EK2A 1UBHS 1ACJA 3ECSA 2V0CA 1PL6A 3CGGA 1C9NA 3RSSA 2WRZA 2CL6X 1YC2A 4H7JA 4HS4A 1MDFA 4LJ7A 2CLMB 1ZD9A 3W5SA 2V59A 3WV4A 4BQQA 4DEVA 4ENRA 3RS9A 1FDTA 1O0SA 4Z4QA 1W9HA 4TYMA 3OIVA 3X44A 3PGJA 5HOQA 2VRCD 5KQPA 2GOYA 3RVNA 4Q9HA 3DYVA 2E89A 2FEKA 5IP5A 3K9FC 4H7DA 1QVZA 3AJ8A 3FFBA 1KJJA 2WUGA 5EQDA 5H3HA 2PT7A 4A8JA 4ZYYA 3LY8A 2AW5A 2C1ZA 1GU7A 2QTFA 3CZMA 4F3TA 4MUJA 2OQRA 1S2MA 4DPMA 3NOXA 1KYZA 3OECA 4PO3X 3FWYA 3JYHA 1JKMA 1T0PA 1SVWA 2IPXA 2OK8A 1UBUS 3ASVA 4OQEA 2QNBA 3RUAA 4XVCA 4LXXA 3WG9A 5KC8A 4X6UA 2RI1A 3TZEA 1PR3A 3VTFA 3W1VA 4PLZA 2WJWA 1ADBA 1XVTA 1NRJB 1OH5A 3KYCA 4CHGA 1KOJA 2DU8A 2P5UA 3K1JA 4D9KA 1X94A 3QQ5A 2HA2A 4LUCA 4Q1DA 4R0MA 1BNCA 2PSFA 2Q3CA 2QQFA 4Q3CA 5C4GB 1HDCA 3IBGA 1C7QA 3QENA 5ALYA 4YRDA 4HVLA 1KPIA 1SHZA 3WRYC 2QLMA 3FPAA 3HUEA 2JLBA 1W6RA 3BXGA 2D5LA 1RR6A 1XP8A 2YWXA 1XN1A 3BD6A 5CJ2A 3DE1X 4RTMA 4PG6A 4ZKEA 1G4UR 4FN4A 4PZYA 1BVUA 3TM4A 4HXGA 1ZOSA 3BB3A 5FTNA 4DBLE 1WWKA 2AFIB 2WNSA 2BHRA 3D4PA 3QWHA 2WWIA 5I7EA 4TQGA 4IDEA 4Y2TA 4QRHA 4XLZA 4JA0A 1DG1G 1JQLB 3MQ2A 3V6MA 1XWWA 5ALPA 2VHCA 1T6YA 4V1CB 4KSYA 1TKAA 1BU8A 3DLTA 4RTQA 3EVAA 3LCVB 4W8HA 4EHIA 1P9OA 1Z4OA 2AN1A 3ZXIA 3NT4A 5AW1A 2A5JA 2EX4A 1H42A 4OP3A 2QR3A 4AI6A 2HWXA 1RZVA 3FG9A 2AUMA 3PXUA 1BZYA 4GPD1 1QP8A 5C5CA 3NYQA 3UJNA 2C20A 1BWPA 2CW5A 3OQMA 2PQ2A 5LZ9A 1YKFA 5LZ2A 3NIGB 5DO9A 1TKBA 3A4VA 1AGPA 1E58A 1RLJA 4P7GA 1F4PA 2P3SA 3O94A 2L18A 1NBIA 3T1VA 2J3MA 3AOGA 3KT0A 3TSCA 3TE7A 4AS3A 2VZ0A 2O0JA 3K94A 4HUJA 5EVCA 5G1PA 1ND6A 2UZAA 1DUIA 3B38A 4M0EA 1GZ3A 2OZVA 1W9MA 3UK6A 2REBA 4HV4A 4LWZA 5JCZA 3I83A 1ENZA 3I9KA 2I6GA 1L5YA 2X9NA 2ZKLA 3OP4A 4JZYA 4ZOLF 5EKDA 5FYQA 5JPIA 5FL7A 5FQOA 2ID9A 4Q4HB 4MW0A 4UBMA 1BHQ1 3QFSA 3SZOA 2WD9A 1E8NA 3H75A 1P81A 1C2TA 2E4WA 3LP6A 2B0JA 2FHSA 2PXHA 4FX2A 4KWEA 4BQSA 2Z56A 5I9IA 4EITA 3O3NB 5LU8A 3A58B 3CUYA 3KVVA 5TS3A 3B1YA 3SLGA 1AJEA 5LNK1 3VC3A 2GO1A 1X1AA 1V2HE 4KIJA 5AW2A 3D6HA 4FKMA 4BASA 4XIJA 2AF3C 4PHGA 1GARA 2V9ZA 3DBLA 4D96A 4M53A 3IAEA 4HAYA 1MAAA 3VU3A 4MGEA 3U1TA 1FQKA 1D2EA 1A4XA 1NYLA 1NUHA 2HJSA 2PX3A 2Q07A 1NGSA 2QK4A 4OQZA 4UQLA 1K8ZB 3JALB 4UPEA 2HK7A 1E0DA 1TEXA 3WB2A 2GSWA 2VP5A 3FLEA 3H8JA 7GPBA 4XRGA 4K9NA 1FMTA 1KJWA 2OY0A 3I58A 4QFBA 4FSDA 5DM2A 3BEOA 3OM1A 3OPNA 3UJHA 4DIEA 4KREA 2AXQA 4QFMA 3HVKA 1PJSA 4JI5B 4WACA 1CB0A 4M22A 3S81A 4G86A 4IJMA 4NZYA 2YBDA 3DT6A 2JAPA 4MVJF 3KSAC 1RRFA 2R44A 3V80A 1J2RA 1ZEJA 5L3QA 1F4LA 1QGAA 2OGZA 3C6MA 2FPIA 1VL6A 2Z98A 4CVNA 4M49A 4URUR 4C22A 1AH2A 3PE3A 2I2BA 1IXSB 4HAVA 1TUGA 4YUYA 3VAYA 1ACMA 2H9AA 2VQSA 4MRAA 1ZRHA 3GROA 4UW9A 4S1WA 1Y82A 1M1XB 3PGA1 3VH2A 2HMVA 1G9TA 1JB9A 1L7DA 4UVGA 3E0QA 3UIEA 5LDGA 1NY6A 4PLCA 3LWZA 3QHPA 2BFNA 2FUEA 3SNKA 1AO3A 4DV4B 2DHDA 1UJBA 2IU0A 1Z0IA 3JSAA 4DLVA 4L5IA 2OVFA 2XMBA 4KDRA 2Q4BA 1SA0B 3WGZA 1GGFA 1TZMA 3TGLA 2IODA 3E27A 3DP9A 1KR2A 1V4BA 1EGHA 1W2WB 2JHFA 4AJKA 3CUSA 2RIPA 4C1BA 4L50A 1PO7A 4MX8A 4X20A 3TIVA 1NNEA 4V0LA 2CDCA 3Q3EA 4B34A 5L3SA 3EPKA 1XZJA 1ISMA 2ZSJA 4EL5A 3COSA 1OI2A 3BICA 1VHDA 2PQ0A 4KRXA 4LZJA 4HGRA 5IULC 4GHWA 4B7XA 3OPXA 4H31A 1AVTA 1N2OA 1CZNA 2PYZA 4MA0A 2MYPA 1TYZA 2H1IA 2JH9A 1HSOA 3L8ZA 1JTVA 4Z1MD 1SXJC 1YTUA 2CXRA 1DV2A 1DFHA 1JZTA 1E5VA 1PZXA 1Y5RA 2I3DA 2I4LA 4MR8B 3WSWA 3W5DA 3BFJA 4FBLA 2IHNA 1ZU4A 2GB4A 2Q62A 3DEIA 4YEDA 1KVQA 3EEBA 3HKEB 4F21A 1SRRA 1L7AA 3A04A 4D9CA 4DAEA 3S27A 5KJ1A 3FWKA 2ZBEA 4TSRA 2OC9A 3TZQA 3ROKA 4UOZA 4B32A 2NO4A 1T1SA 1DQZA 1DBWA 1GRNA 2BT4A 2Z2XA 1A8HA 3HB9A 2QTGA 3K2QA 3SR0A 2DBYA 2XDWA 4BFCA 3UBTA 2XRZA 1FRVA 1QVVA 1CY2A 4S3MA 3D3WA 4GUAA 3Q3HA 4IG4A 4KKVA 2B1GA 2G88A 3UJPA 2JJ8A 5CFZA 3H9GA 5T67A 4QT4A 1TX4B 1R1DA 2ONCA 1B42A 3V1MA 3ROQA 421PA 4PX3A 2Z3WA 3PJEA 1BN6A 4MO2A 3VVMA 5JATA 2HSDA 1U9IC 2YWFA 3CF2A 4RWZA 3VVCA 3BFPA 3DZJA 3H9BA 1NOIA 2R11A 1DXHA 3CQ9A 4FFOA 4J2HA 4BO9A 2W2LA 4I3HA 1GTRA 3RLFA 2YHUA 1XRSB 4ZQGA 1QYRA 1RKXA 1OPXA 2QKYA 2RGDA 1AA6A 2I34A 3FOZA 3DBVO 3CPSA 5FP0A 3UHOA 3AHGA 2PX2A 1UBEA 3KSMA 4GXNA 4TM7A 3DAFA 3TLGB 3VDRA 1J9EA 4EPYA 4NBKA 2WT8A 1X9GA 3ADPA 2FB9A 1K3UB 1IHUA 3F5DA 1DAKA 3R0JA 4P4SA 2PLRA 2H48A 4KFSA 3KX2A 4L1KA 4XFDA 3WNQA 4F3CA 1NMQA 1GRQA 3GEPA 4GRIA 2E4VA 3I76A 3GRRA 4Z4IA 2R6GA 2ZXEA 5EZ5A 2VP9A 4UARA 5IC4A 3I04M 2EVWX 1ESCA 3DE3X 3EVFA 2GBLC 2HJRA 2V65A 2QG6A 1RYBA 4IAOA 4LGVA 1WXDA 5L40A 1KDRA 2Q5OA 3K09C 3GCWA 5LZ8A 3EGEA 2P69A 4YMHA 2QZ4A 1GYPA 1WOMA 2ROQA 3QU5A 3U4HA 1PJBA 2JIBA 5BQ5A 4Q3BA 2NM0A 3MBOA 2QP3A 1VBKA 5DTQA 1KXJA 2CMGA 5BN4A 3N3AC 1KE2A 4DIOA 4J0DA 4E30A 4G56A 1UM9B 3M4JA 2FFAA 3N7AA 3CXUA 4B76A 4RCYA 1VJGA 5ERGB 4IXTA 1A9OA 2NU7A 3VR0A 1DI0A 3FYUA 1KAOA 3WV5A 4ZQCB 2EX1A 3UANA 3VKFA 1GGJA 1L4MA 4O3FA 2OC4A 3V8PA 5LMUB 1SXJE 4U00A 3EPLA 521PA 3LOPA 5DHUA 3ZDDA 3RV4A 5HXAA 2QTRA 1YVPA 4WLVA 1EZ1A 2B5OA 2C61A 4Z9AA 4YXWD 4B75A 2XI4A 1IZ8A 2DSTA 3MWKA 1GDHA 2DKNA 4BX8A 4Z2AA 5ICSA 1BHO1 3WLLA 5BVHA 1WBJB 1E2NA 1E32A 3FTNA 4PG5A 4BMXA 2PFKA 2SBTA 3WIEA 4GM1A 1ZM7A 4YJ2A 5I8PA 1J1UA 1DEXA 3N28A 1N0IA 4OHPA 1XP5A 3PXEA 4DJEC 2JGNA 2XB9A 1FDWA 2AMFA 3VSBA 4H6VA 1U94A 4NENB 2BZSA 2R1VB 4FIDA 1S2GA 1C2YA 1K6EA 2OAP1 5FAXA 3GDGA 4E31A 1Z34A 1TC1A 2OFPA 4W5NA 5BNTA 4BLVA 3KQMA 4O8CA 3LYUA 1MHPA 4IDFA 4R05A 2QG4A 2OAEA 2IEAA 1XRQA 2XYHA 3D0RA 2ERXA 1PT9A 2L17A 2YV4A 1DC7A 3HSSA 2AOVA 1IHYA 3GJRA 3NNDA 4LPKA 4F06A 2NLOA 4C4YA 1MB9A 1NT2A 2I8CA 1NVUQ 4TX1A 3PQEA 4WN3A 3VTKA 4UCWA 5FF9A 3C8UA 5K7SA 3C4JA 3PSHA 3TBHA 1DCFA 3ZTWA 4GGMX 4JX9A 4M1KA 3K96A 4ENUA 3IEKA 3JATA 4E0BA 1QB7A 4LHXA 4M1MA 4RPIA 1RAFA 4JVSB 3W8NA 2FEXA 1KRXA 1IC6A 1RRGA 1HLFA 4QQ8A 1G42A 2CCGA 1DAOA 5JCPA 4CNBA 1L1FA 1HR0B 3F8WA 5L3VA 3EF1A 2X1MA 3N0RA 2RAVA 2A0KA 4K6MA 3O4VA 1O4WA 2V7VA 3RT7A 1ESNA 1XCMA 3FNHA 3P20A 1J20A 2AMJA 2VNSA 4G89A 4U2EA 3RVSA 4DEYA 5DE3A 4Q4CA 1Y5MA 3ZJYA 4KWHA 1EVZA 2YYYA 4R1MA 1OYYA 3JTMA 4TPKA 4H7HA 2Y6VA 1G5HA 4WW0A 3FUTA 3HJHA 1P62B 1XHEA 3V7WA 4EUEA 2H5LA 3PCRB 1RHJA 1ZNYA 5KYXA 2B1JA 5LQCA 2A2ZA 2FQYA 1I14A 4GYJA 4MOWA 4I8IA 5CT9A 2VDNB 4YP7A 1IULA 1A7JA 4RA9B 3WLQA 1HNXB 5CDHA 4ZOAA 1I3MA 4NMMA 4OHVA 1MQSA 3BSWA 1M5RA 1YTLA 2O59A 4RHXA 5CYOA 3U40A 1HKHA 1AKEA 1WZIA 3OJLA 1JVBA 2FX5A 3KEOA 5LDDC 4G85A 5D00A 1F9EA 2FMTA 1I4EB 2FKNA 3CN7A 4A8JB 1YQDA 3WP1B 2OQVA 1YRHA 5EMJA 4JDUA 4F71A 4BNIA 3TLMA 4QE3A 1OVMA 3S2IA 3EMDA 5BWNA 5HRUA 1EKXA 3R5JA 3GVXA 4DG5A 5M7EA 1Y3IA 1CQPA 1Z33A 4K6OA 3GLGB 3KYCB 3QNMA 3WYGA 5A5DA 1JXAA 4TT3A 2DWPA 4HFJA 4MGKR 1YL7A 5IAAA 1P18A 3TTSA 1RQ7A 3HFJA 5MF6A 2OXEA 3X1KA 2QG9A 2YOFA 3E9QA 4NSNA 4U9IS 1SVIA 1AHNA 1M3SA 4MGHA 1LW6E 3U7FB 3WTBA 4UPVA 3H6GA 1Y3BE 3PEVA 4IGIA 4ZVQA 5KSOA 3NWBA 1KH3A 1TVKB 1P1FA 1E59A 5ESXA 1R0WA 4KGDA 4CETA 2C78A 1M1YE 5IVKA 3W2IA 3QX3A 5K0JA 5JSFA 1TU4A 3Q7TA 4ZDKA 5DRTA 2WIGA 1H05A 2OD9A 2AFRA 2QMYA 2YN2A 3A2MA 1V3VA 2QUKA 1C9YA 4J7AA 4D0NA 1F5SA 3DZFA 4UEWA 5BSUA 1L7QA 1V5EA 4L8FA 4N9WA 5H81A 3U3XA 4LYJA 3THYA 5LUBA 2REXB 3QEAZ 1NVKA 1TJ4A 4C7VA 4B46A 2C0PA 3AV0B 3L9WA 3DMTA 2BZ1A 3PENA 4MV4A 1J7KA 1JLRA 4JUBA 4PCLA 5FOXA 1Y7LA 3I05A 1NR7A 5JCOA 1CKEA 2Z6VA 3RIXA 5IXYA 5IK2A 1Z0JA 1N8SA 2XCRB 3PJGA 2DR3A 2MSEB 4HZIA 4F6CA 1VCIA 5REQA 3O92A 4BNYA 3BQMB 5K3FA 4JFAA 4HFMA 4MUEA 4CTJA 2BM8A 5FOSA 1WDTA 4C03A 3DDHA 2IDKA 5L4SA 5LYYA 5EXSA 3C3EA 2ET6A 3K05A 1RYHA 5HNKA 1JR3D 5IUKC 1UXJA 3LOQA 5D01A 1PGJA 2JIZD 3WB9A 3PL1A 4YY3B 3KU4A 2PLNA 2ZYVX 1GRRA 5G0SA 1P72A 4P4TA 3UNXA 4P80A 1KJ9A 4LCBA 2NTYC 3KTDA 4R5MA 5FTLA 1G59A 1RKQA 3KBOA 4B7ZA 2BFMA 1YJ8A 4GZLA 1W46A 3RUCA 1ORHA 2FOXA 3L84A 4I1UA 4LOKA 4JI7B 3JAKA 1UJNA 4JK3A 4TXLA 3CGWA 3MGBA 2AG0A 3DBLB 1Z68A 1ZN2A 1II0A 4MV7A 1KFCB 3OU6A 4X94A 3L9XA 2GN8A 1KQGA 1PSWA 2IUSA 4HWPA 3T95A 4LSGA 2XNJA 4MQ4A 3TL2A 1K3TA 3CRW1 1YGPA 3TJZA 4MUNA 2C00A 2GD1O 1KIFA 1KVSA 3ROZA 5BQXA 2ZSUA 2IYTA 4JROA 1IN1A 1N3BA 3GIDA 3HHEA 4P4NA 3W2GA 3DMHA 1QP4A 4IIGA 1E2HA 1IHOA 1A4IA 4R1LA 1V8OA 3GRAA 2I3GA 1CNMA 3NTQA 2QTMA 2VF5X 4AF7A 2AJ8A 1N75A 5DSTA 2ZYWX 1RABA 1W30A 1JIXA 1MJGM 3OQ1A 1FYFA 3O3CA 4JZKA 2WP0A 2GDZA 2J9GA 3HLKA 5L3QB 4TTIA 3DXXA 1PDWA 1VA5A 4N8DA 5AKGA 4CQLA 1I1NA 3L7JA 1W36B 4FK8A 4ALLA 1A4UA 1Z13A 1RFGE 2J09A 4KAFA 4CIWA 2DSNA 1BE8A 1EFVA 4MS4B 1ZK2A 1E5DA 1XO1A 1WPGA 3LNCA 1B1CA 3DL7A 2RAFA 2MINB 2YWCA 4EYSA 3DGFC 4A3SA 5DMXA 3QLUC 2WSMA 4UUPA 4NU8X 3OAAA 1OPRA 2VPYA 5GOTA 5GONF 1CW2B 4X71A 2GA8A 5EI5A 1M9NA 3K7EA 2XKKA 4JKIA 4KLCA 2GMWA 2JFNA 4ES6A 1DBPA 1N1DA 5ALGA 3TQSA 2A33A 2BPOA 4DV0B 1L1RA 5L3SB 4EGSA 2NMVA 2JD2A 5KOYA 2HHLA 9GPBA 3EXG1 2Z6QA 1VBNA 1UC4B 2YR0A 2VYCA 4QARA 1VJ1A 3B9PA 1PR9A 1LLCA 2R60A 2ZRIA 3MWDB 4FQ8A 1VLJA 4DQKA 2ZSFA 3GEMA 5IJ9B 1XELA 1E4YA 3L4SO 3FUXA 4QYTA 2C59A 4UBNA 3KVNA 1IB0A 5I01A 4AAYA 1GPYA 2TMDA 3GRKA 4QAQA 1W2HA 2BUCA 2C99A 4TROA 4NCNA 2IUFA 4GBMA 3O2SB 5TXGA 4JC4A 1YD7A 5CVDA 2E3JA 3S2EA 4I50A 5ALSA 3C5EA 1F06A 2QM7A 3H2HA 3K53A 3F5SA 5KDOA 2FUNB 5BV2P 3L4KA 2P67A 5CHYA 2XZTA 1BQ4A 1EM6A 4NS4A 5NLLA 4MYSA 5JLAA 4RTSA 4ZEOA 1VTKA 1XNGA 1HEYA 2JLSA 4U6NA 1H2XA 2JIRA 5EP4A 3G0IA 4B4UA 3D3WB 4OX9B 1S4MA 2YZGA 1NP7A 4ZCIA 3GG2A 2NW6A 4MCAA 4P08A 4BYMA 4J1QA 3F9IA 1D6MA 3IFSA 4HMOA 5CYGA 5I3CA 2EATA 2NYRA 5K8LA 3BE6A 1N9KA 2GAFA 3DP7A 4OGLA 2HQRA 4UAJA 4BKMA 5LA6A 3RHFA 2F1HA 3HY6A 5T6MA 2GUGA 3RBAA 3T5GA 2VHYA 1XL1A 1R0RE 2HF7A 4Y2YA 5J63A 1KYTA 3CN9A 1IJFA 4AP9A 5JC1A 3CMCO 3G8YA 2XE4A 1D6SA 4JBGA 4LCEA 1Y4UA 1YFZA 2H2GA 2JFUA 2OM6A 3BGSA 3QXGA 4HWOA 2JAWA 1MMFB 3HU5A 2XB6A 2RHMA 4MCHA 3NP7A 4Z1OA 2I4NA 1U28A 3I6YA 1NRWA 3H5IA 1E9AA 3FHTA 4JXJA 3SBXA 3PICA 4P4SB 2BFWA 3FLAA 3H11A 4NQRA 2L69A 4S2UA 1R6AA 4CTNA 3EZ7A 2P9HA 4IXDA 3HB7A 2GZ3A 3CJQA 3KT3A 3LMKA 4HXFB 5AT1A 4J0HA 2HRCA 1A8PA 1GGNA 3HCWA 4ETNA 1NX6A 3T5CA 3DDWA 1Y9AA 1RM3A 2VK4A 2IIQA 3AEQA 2YMQA 3A05A 4TGLA 3FOAA 2Y71A 1MAHA 1Z7BA 2GH1A 2HDNB 3ZWAA 3QVWA 4X66B 3N7UA 1C7IA 1QE0A 2AC2A 2H2IA 1G20B 3D8SA 4LG1A 3IP8A 3VR4H 1XL0A 3WR5A 2FCAA 5ALTA 1QYCA 3E5MA 2P9GA 1VG9B 3Q6MA 2IT1A 3AUAA 1KHTA 1X15A 1TZBA 4Y6PA 2DBQA 3G2LA 3SJZA 4Q37A 3RROA 3UXMA 4EQZA 5M34A 5EG5A 3ASUA 2AUNA 2C9BA 1HURA 1XJ0A 2FLKA 1N9ZA 1PEKE 2NU7B 2JL1A 2NPIA 2RHDA 2PRIA 3DOFA 3FYUB