4FI3F

Structure of vitamin b12 transporter btucd-f in a nucleotide-bound state
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
245
structure length
245
Chain Sequence
AAPRVITLSPANTELAFAAGITPVGVSSYSDYPPQAQKIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKVMWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFGINPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITGGPDQIPKIKQYWGEQLKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of AMP-PNP-bound vitamin B12 transporter BtuCD-F.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Vitamin B12 import system permease protein BtuC
total genus 65
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2012-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4fi3F01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4fi3F02
4WESA 4H0FA 4TKVA 2Q8QA 2RG7A 2MINB 5M29A 1N2ZA 3HH8A 2PHZA 4TKUB 4XPIB 4ND8A 2M6KA 3K1AA 5KOHB 4DBLE 3AETB 3PDIB 1G21B 4MX8A 3HJTA 5B58T 2XQVA 3MWFA 4MLZA 4PM4A 5M2QA 2AFHB 2PS9A 3NU1A 1M34A 2PS0A 2WI8A 3TEFA 5KOJB 1PQ4A 3LHSA 4MDYA 1FP4A 4CL2A 4ND8B 2AFIA 5KOHA 1N2CB 3TNYA 4WZAB 3AEUB 1XVLA 4HMQA 3AESB 2R79A 4WZBB 1M1YA 4GICA 4NNOA 4INPA 1G20A 5KOJA 4UDOA 2QI9F 5M3BA 2AFIB 1N2CA 4FKMA 2XY4A 3PSHA 3AEUA 4OXQA 1KAEA 4LS3A 5CR9A 5CX1A 4G07A 1ESZA 5JOQA 5JJ5A 3AESA 2MINA 3CX3A 5BVGA 3UJPA 1M1NB 2Q8PA 2XH8A 4H59A 5HDQA 4XPIA 4UTPA 2X4LA 4HMPA 1QGUB 1G20B 1G21A 2O1EA 3AEKA 3PSAA 3R5TA 3AEQB 1KAHA 3U7QB 1H1LA 5BVHB 4OVKA 4G09A 1M34B 4MO9A 4OXRA 4INOA 2PS3A 3ZK9A 5I4KA 3MWGA 2XDQB 4PAGA 1EFDN 5AFSA 1K75A 1QGUA 3AERB 3MD9A 4WZAA 2WHYA 1QH1A 3G9QA 3U7QA 1L5HB 3LI2A 5BVHA 3HXPA 4LJSA 4WNAB 3GI1A 1PSZA 1N4AA 4WZBA 1M1YB 3TLKA 2XV1A 3EIXA 3R5SA 2OV1A 2PRSA 2M6LA 5KHLB 3AERA 3BE6A 5GGXA 5HX7A 3AETA 4N01A 2ETVA 2OGWA 4FNAA 4HN9A 1QH1B 1K7SN 1N4DA 1K2VN 3MFQA 1MIOA 4M7OA 4WN9A 4WNAA 1L5HA 5BVGB 3EIWA 4NNPA 1M1NA 3MINB 2OSVA 1QH8A 4UTOA 4UDNA 2YNMC 3AEKB 1FP4B 3ZKAA 4FILA 3AEQA 1H1LB 5GGYA 2OV3A 5FLYA 3ZK8A 4FI3F 4K3VA 2XUZA 3ZK7A 4WESB 4TKVB 1K0FA 1MIOB 3BE5A 4WN9B 5M34A 2XDQA 3ZTTA 1KARA 3MINA 4TKUA 1QH8B 4IRMA 3K1AB 3PDIA 4HMOA 5JG7A 2R7AA 2YNMD 4B8YA 4BBPA 2AFHA 5JPDA 1TOAA 5CX1B
chains in the Genus database with same CATH superfamily
4Q24A 2ZJ3A 3RRJA 1L4FA 4LZWA 4A0SA 1QCYA 1UXOA 4LDNA 5IKMA 4YV2A 1SZCA 1WCIA 4EHHA 1PK7A 1QK4A 4IDHA 2ZVPX 2G08A 2ZYAA 3MM4A 3NTUA 4XEHA 4ZOLF 3RFCA 3VNUA 1OV6A 3FYSA 2DUUA 3W9SA 1KRXA 2GA9A 1Q83A 3NKVA 3QWFA 1JDTA 1GZVA 1T5TA 3WIBA 1W2WB 4QG7A 1H2WA 5BV1A 3OFND 3IAM1 4EW1A 3HO1A 1DFGA 5CM9C 4X8OA 1TQ8A 4JWKA 4DANA 2I2XB 2GM4A 3L84A 1ZXLA 2HWWA 1BTOA 3DLPX 3GN2A 1NJSA 1Q1QA 3ZX4A 1U1CA 3RK1A 5A4FS 4RL4A 4K03A 2DHCA 4GU5A 5IK2D 3GEBA 1KJWA 1TM1E 2IHUA 2ZDHA 4Y0AA 2OT3B 4NMLA 4UJ5A 5BSEA 3KSAC 1Q17A 2IQIA 1VL8A 3PIIA 5FUVA 5C1PA 4HAYA 1U7WA 4NEQA 1GNPA 1KPGA 2CDBA 3CUUA 2VJMA 4H35A 4OP3A 1S8FA 3QE3A 3U7GA 2IHZA 3PX7A 3U4QB 4LCJA 4DA0A 1NW7A 3VISA 3MTIA 5BN4A 2XRMA 4F97A 3A6PC 3TZQA 2P77A 2PX2A 4RPJA 2ZTUA 4RH3A 4XDHA 3BKXA 2Y4NA 2ZRLA 4MMYB 4KVGA 3LT5A 5C32A 4CEIA 1W5TA 2BM0A 2A4MA 3H1PA 3MTAA 4RA9A 4NCHA 2FZ4A 4H59A 4HX2A 4WUTA 4V0QA 5I6DA 1VSQA 2D8MA 4C88A 1FP1D 1OTXA 3DW3X 5GOTA 2JZCA 3V8QA 2PY6A 1OY1A 1R6XA 3EVDA 3I2JA 4QT4A 5LBTA 2YOFA 1RACA 2DFPA 1O7JA 1FVFA 4I3GA 3THYB 2ZRAA 2Q6LA 2M98A 2GI4A 3IAXA 4MWBA 1K3TA 1ONOA 1ZK2A 1J2UA 4I9HA 3UG6A 4EAQA 1YFJA 1G98A 3M1YA 4KAJA 3A2KA 4YI3A 4DCCA 1MAWA 1P72A 4EELA 1HLFA 1T9HA 3EZ2A 3ITKA 4MS1A 4NBVA 1O5TA 2E0IA 4V3BA 2B9VA 3SI7A 3RKUA 1FJ2A 2MSWA 3R4CA 3L6EA 1E2MA 2R60A 3UMJA 4ADSG 2YFKA 4EW3A 3FR8A 3RUFA 1XMOB 4NCAA 4GRAA 3FYDA 1J09A 5F7JA 3CVYA 1UBTS 1GR1A 1UP6A 3JD0A 1FMFA 2MSNA 4NS4A 1YQ9A 3BXPA 2E49A 2QVLA 3RJMA 3G0GA 1ZW6A 3ANSA 1IMOA 1KY5A 3BE6A 1PDVA 5G2OA 5JC8A 1L3IA 4F4JA 2O52A 1KJJA 4DVGA 1QWSA 1CUSA 4FW9A 1XPRA 3D8HA 2FN3A 3OCXA 4ZVUA 4HT3B 1XRQA 3QBDA 5EPEA 4D4KA 4JI7B 1UFRA 4IYRA 5HHTA 3D6FA 1AS0A 3ZNQA 1MA3A 4WVFA 4BJ5A 3NJ4A 4UAJA 3AG5A 1TEZA 2VVTA 1T34A 3ZH9B 5EE5B 1F5SA 5DHQA 1VCIA 2C8JA 4P4UA 3CEMA 5MF6A 2UZ4A 1FDUA 1RADA 1AF4A 4UM7A 2L69A 4WINA 1E2DA 2G4CA 1ENYA 4IUCS 4JI5B 1V71A 1VIYA 1S3IA 1GZDA 4YRFA 3P0JA 3K9WA 3OHSX 4DGQA 4EENA 3GZNB 1B00A 4YPOA 1U63A 2AFHA 1AHNA 1T35A 3LFUA 2NU8B 1RWPA 4YJGB 5FPHA 1RWQA 5SZJA 1ZYUA 4FHDA 1A9XA 3HXTA 1RKVA 2ZRQA 4LDQA 5KDLA 3LUCA 3R6WA 4AX8A 2VTBB 2YZNA 4FE7A 4XPIB 2R7MA 2YZ7A 5P21A 5FR1A 2V0CA 3E3MA 3IYLW 3ND7A 3D2BA 4BQPA 5BPHA 4P7FA 1QMPA 3GPLA 5BPFA 5IXYA 2CD7A 1EFPA 3RVSA 4EUFA 1QNLA 4OJKA 1H0HA 2AZTA 3A32A 3GFPA 1L2TA 2HU7A 1M6VA 3MNFA 3PIRA 1C14A 2AN1A 4GX1A 4IG4A 1E4VA 1JPJA 4OB6A 3GO4A 1QG0A 5CK4A 1U31A 1USGA 4TN1A 3HEBA 1SUPA 4QJ4A 2QAGC 2BUBA 1HKUA 3OIFA 1NKSA 4UMFA 1GCUA 3MTBA 3ISVA 3ZUGA 5DI3A 2IZ0A 1KY4A 3R0ZA 4GICA 2OMEA 5JD3A 2HYDA 5KU1A 1KZGB 4YJHA 3ZNNA 4RQUA 1PHPA 3FVWA 1WXXA 1YQUA 1AHIA 1WW2A 3GWGA 5EJGA 1R18A 1A9RA 1IIBA 1KAEA 1IHUA 4DLRA 2PXXA 1OVMA 3E4DA 3E9MA 1ZK1A 1ISSA 2VC2B 3P52A 3UJPA 2ZWVA 1XCMA 3SJUA 4DCJA 2CK3A 3EQZA 2FFAA 3HBAA 2WE8A 4ZCIA 2KM1A 3W6NA 3LQ4A 3VPXA 1CETA 4ZGGA 4Y8VA 2RGWA 3K9NA 2QV0A 4H31A 4TS3A 5T41A 5DM0A 3SQXA 5IXSA 1AZSC 4G2NA 3TQSA 5TIIA 2P30A 2HRDA 2E4XA 4YAEA 2P9ZA 4YRPA 4CU5A 5D00A 5LZ2A 1Q3KA 3AU8A 4PC6A 3TECE 1MB2A 4Q6WA 1PEDA 4P7JA 4ROSA 1IJEA 3N2LA 4B4DA 3OZEA 3TTVA 4KXNA 5IKXA 4S0ZA 1JILA 2P3QA 2VJAA 2Q6KA 2GRJA 3QUTA 1C4KA 1CUGA 1SK8A 2ECPA 4JXKA 4NYMQ 3THOA 4L3WA 2CHQA 2IXTA 3I5YA 3PLRA 5EE1A 4MR7B 3CTPA 1OBVA 5F2KA 3V1MA 2OORC 3O5AA 4N01A 2JJ1A 4LDAA 4ID3A 2C99A 2I7VA 2WWWA 3FCAA 3L6BA 4RJIA 2AQHA 2BMWA 5CVVA 1GPNA 1Y9JA 1VJDA 2GT1A 1P7PA 4CM4B 2ATCA 2EATA 3N70A 2QBYB 5B3AA 1D0SA 3NM6B 4XM2A 5KNDD 2UDPA 1O58A 1KGSA 4ROTA 1F5NA 3DOJA 2GPBA 4XUDA 2FJ0A 4MQMA 4JI4B 3QUSA 2E85A 2VRNA 1VHDA 1XUOA 2CWWA 2I9PA 2NM0A 3JCZA 3V7FA 5GONA 1EFHA 2JPDA 1L7MA 2JJ1D 4DCVA 1G8FA 3IUQA 1JLHA 2EG9A 4BUZA 4JB3A 4DDMA 5LR6A 4AUMA 1OWNA 4X44A 3QEAZ 4CIXA 2R62A 2VDQB 4FWBA 1AQLA 4GRIA 1CEYA 2H48A 1AA9A 2XF2A 3LUKA 5C8YB 1A9ZA 1JQBA 3LK7A 3O2SB 4LC1A 2GBGA 1YE8A 3CISA 3HH8A 4RZSA 1TKRA 1NXPA 2EKDA 4LI3X 4MYUA 3HLYA 4PG6A 4YMGA 1J00A 3DKKA 5KYKA 2J5BA 4CKWB 1QP7A 4IKPA 1JR3A 2X42A 5HM8A 5E1BA 4HDMB 3ST7A 1QKJA 3WOVA 4A8PA 1C0PA 1CEXA 1QMGA 3FG9A 2YW9A 5HJ2A 3RIGA 2PL5A 4II7A 3CZCA 4GDMA 4JQYA 5JYBA 5TMPA 2ZYUX 4BWYA 4MLPA 3O4GA 1AC5A 4QTXA 5H8WA 1JAIA 4G1CA 3HDVA 2DH5A 3BB1A 3HCEA 4BCBA 3DD1A 4UTVA 1HTTA 2FW8A 3JAWB 3HWWA 4OQDA 4EH1A 3UV6A 1RPAA 2ATEA 2YXEA 5EZYB 2PRYA 2IFTA 4JBLA 1Z83A 2LWIA 3A1EA 3DOFA 4GX0A 1Z8HA 4QU9A 3GP8A 3JR3A 3Q41A 1M0SA 2VK4A 3UAGA 4B45A 4PNEA 3S8YA 1Z4NA 2BHTA 3M4JA 1ICEA 1E98A 4H7KA 4Q3DA 3WLTA 1WD7A 4CKEB 2AFIB 5I7SA 3I42A 4BIIA 3GPCA 4ZOBA 1WDKA 2C8VA 1NV9A 4QU5A 4BQOA 4F84A 4BRSA 1SUSA 1YQTA 3JU3A 4DR2B 3SF8B 2C5LA 4LJKA 1EM6A 2ID4A 4RLFA 1SOVA 3FSRA 2QRVB 2G1JA 5EXDA 2F4NA 2Y1FA 3NXKA 4HRYA 1P1BA 1TA9A 3G5MA 2IOFK 1TQ4A 2FHSA 2X0RA 3VDXA 1JYFA 5EMKA 1ZH8A 5F7OA 4PINA 1QIMA 2GJ4A 5JDCC 2X3YA 1PJZA 3NFRA 4CL3A 1NBWB 5GZ1A 2G9QA 1LX7A 1K6EA 4YP6A 4N4AA 3B1JA 4D80A 1H66A 1NYTA 3OBIA 1RJ9A 2GN4A 3TXYA 4GGOA 4WDRA 2J32A 2PWZA 7AT1A 2BGKA 2ZYWX 3WRXC 2FETA 3OJOA 3LGAA 3OTHA 1OKKD 3Q15C 2O2IA 3O3NB 2X0FA 1LK7A 4JBNA 4XUEA 5H68A 3BZWA 4YJ2B 3R9WA 5HYVA 1CFZA 1N5KA 1UXKA 2QXYA 3EC1A 2WKWA 4U63A 1MOSA 4V0ME 4WLNA 3OIVA 3UB2A 4KZPA 4AG5A 2A4KA 2HSEA 4UUAA 1K8XB 5A7GA 3UGTA 3TQIA 4BRWA 2PEZA 4EY5A 1VIMA 1QHGA 3P0EA 2OLEA 4TTSA 3TPZA 2NWQA 2XPCA 2YFHA 4CQMB 4IKOA 5KJCA 1YBMA 3E48A 1L5HA 4QFMA 3CR3C 1RPZA 2FY8A 1IN6A 5IASA 3D0KA 2YMMA 4BB0A 1J1UA 3EJWA 1NI4B 3WG9A 4M1KA 3RAFC 3LWBA 1E8DA 4IDDA 3PTZA 1PYDA 3W4KA 3T5TA 5K0FA 4LJLA 4ZJZA 4TV9A 3LY5A 1R27A 2Q3BA 1Q1ZA 2XX3A 3BL5A 1Z8DA 2X9GA 3MD0A 2XMPA 2Z2YA 3IXLA 4IP0A 1L5GB 1HFJA 4YRKA 1ZFNA 1R7RA 3HB1A 1GTRA 4EAAA 3MWYW 5C7OO 1HTWA 3B8EA 1G7SA 1SU8A 2PPLA 3HR7A 4FU0A 4RVSA 3EGIA 3EEIA 1KI8A 1XNHA 2P27A 3GJ0A 3RSOA 3ZJ5A 4PAQA 2COEA 2BF7A 2WZDA 4NU6A 4U02A 3TIVA 3FTCA 4MW9A 5E6UB 2QTLA 5JMWA 2IBTA 3QVGA 3FZYA 4GE3A 2O5VA 3SJAA 1YDEA 3T3PB 2IZ7A 3QXJA 4RORA 2XXJA 4EEXA 4L72A 2FK8A 3OPVA 3SZGA 3NWPA 4HS4A 3KSRA 4D74A 4DARA 2GTHA 1TDJA 1V6SA 4DR3B 3B5IA 1U2SA 1WW8A 3HKEB 4OMDA 4HJRA 3H5TA 3I0ZA 4WZBB 4C7OA 4P35A 4QELA 4LXUA 3UFXA 1B8VA 1QAOA 4GQAA 5C4IA 4FHCA 3NM4A 1DARA 4KPUA 5DWQA 5HMMA 1WDWB 5A62A 4RV5A 3N3BC 3G59A 1NDUA 3C1TA 1Z07A 2AMFA 5CAEB 1TI7A 2QIPA 5JC1A 1A2BA 3SK0A 2NO5A 1S4QA 3H65A 3KJFA 3QFFA 4TROA 4JR0A 4LPSA 4Y9SA 1R6TA 5LQMA 3ORQA 1Y7LA 3RARA 1W0JD 4ITUA 2YJNA 2X2OA 1WMSA 4D81A 4YRAA 5JY1A 2PYDA 3AL0C 4Y30A 3TRDA 4FMDF 5BV0A 3GMIA 4G2TA 3E5HA 4PYJA 4ZV4A 3CEHA 3DHVA 1XRMA 2C7PA 2J30A 1GPKA 3HL0A 2FA9A 3QV2A 1UPCA 3ABRB 4PIPA 4DDKA 4ED9A 4DV6B 1RABA 4MRAA 2NUBA 4DJAA 1IDN1 2QL9A 4LYEA 3E9DA 5KNDA 2PD4A 4WIAA 3IELA 4M1TA 1M2FA 2VDOB 4F92B 1WULS 5HJ5A 1NDQA 1T1JA 4XIJA 2NUPA 4RTQA 2YUIA 1DTWB 1VMDA 2BIFA 2GLXA 1HQDA 3ESXA 3L2OB 3O0DA 3PDJA 3LIPA 4WVLA 1GRNA 5EOVA 4DLLA 2ODPA 2JAHA 1WSWA 3MS2A 4BIMA 1NW8A 4Y0NA 4D99A 4RJTA 3WBBA 5B64A 2DT5A 3AM1A 2WZBA 4KR3A 4ZT2A 1PFWA 1WZ2A 2XODA 2ZT5A 5A71A 1DWQA 3HCDA 1D7AA 3DCYA 3PUXA 1PCXA 4ZODA 4YASA 2PXAA 2FWRA 1BDHA 2P91A 3COZA 1ZPDA 5CFOA 1WNFA 2GFIA 2VDNB 3CNQS 2PFKA 5KYUA 1AKWA 1C0EA 3GHYA 3ZKAA 4MWZA 2RBKA 1XDZA 3L93A 3O9ZA 4F1WA 5L7TA 2YICA 1YASA 3HVUA 4GD3Q 3D8SA 1PGPA 4A26A 1HDOA 3DEJA 4O1HA 1UMCB 4S1TA 4MWSA 5DNDA 2O1WA 1GTJ1 2XDQA 3CRQA 3K5IA 3AYZB 1JIVA 4BLOA 1C1HA 2C7QA 3P9SA 4Q7QA 4D92A 4BXOA 2HUPA 3WIVA 2RBEA 3M70A 1EWVA 2VHVA 5H7XA 4B8YA 1JXOA 2JKVA 1ZH6A 2QQ0A 5JD5A 2QX4A 4PC1A 5EJ6A 3MTQA 2R8OA 3S1AB 3BAFA 4EGSA 4IIEA 4WPGA 3RYCB 3AHGA 2G88A 2H51A 2FK7A 3KHUA 2A5YB 2R4UA 3DCNA 2Y1KA 3IVXA 2Q1WA 3JR7A 3RODA 1G9TA 4ND8A 4ZFNA 1X7YB 3AR4A 5DHRA 5ITSA 2QTMA 3U3MA 3LDFA 3FNHA 1A9SA 2ZCJA 2PQ0A 3K8QA 3EDYA 4MGKR 5CW1A 4C03A 1XLVA 1H9BA 1GQ2A 2XTAA 2XYGA 2WI8A 3BX1A 3RSZA 5B3JC 4LF4B 3ZDFA 1PZNA 1H5QA 3BTOA 4ZEXA 1P1IA 1XZLA 3AR5A 3D7NA 1IK4A 5LQAA 2ZTMA 2W8BB 2I7TA 4GOLD 4L07A 2J87A 1ADJA 1HE5A 2YRWA 3LBNA 4PGFA 4YCAA 3ZY2A 1PFVA 3CHYA 2HRRA 3R0JA 1SD1A 2QRZA 2YWXA 3IL2A 2BVNA 2JCXA 4GQBA 4L57A 1NVTA 1PL8A 1E5QA 1Q1AA 5AW0A 1NF3A 2B1RA 3PKJA 3DZ8A 3D8NA 3NASA 1XB2A 3MMZA 4G1FA 1UIMA 2I6UA 3V2UA 4MWTA 2AW5A 4ZKDA 4JXZA 1DWUA 3TMAA 2CUTA 2DWPA 4K1LA 5FA6A 1EXNA 1MORA 3TDMA 3UJ7A 4BV2A 1VE5A 5FV4A 3LLVA 1XG5A 4H17A 4YREA 1F2UA 1T2DA 4L9RA 1UZNA 5LP6F 2ORED 4EWLA 4HQRA 1L5NA 1U9CA 3VNVA 2B99A 5ECYA 2FDXA 1EVJA 3LK6A 3PSAA 3TO5A 2WJJA 4X0EA 4A0FA 2AYYA 5GJWC 5BQ3A 1V6CA 1Q16A 2DRIA 3H6KA 4M8LA 5JHHB 2PTHA 3NTLA 2VPPA 3OZDA 4MS3A 4R81A 4A0HA 4TVSA 5C7IO 1I13A 3P27A 1BMQA 3FBTA 3S8EA 4MEJA 5JZOA 1KS9A 1P7WA 1U4NA 2XNHA 4PONA 1C7JA 5J4HA 3UVEA 3PPVA 1TJPB 3DE4X 2PL3A 2X6TA 3GI1A 2OO3A 2JFFA 2Z3ZA 1N4AA 4F2HA 3PLAE 4PCLA 3MT9A 2OGUA 1RJDA 4IOLA 5E1MA 2C98A 5TT0A 4QTZA 1FRFS 3SQLA 5LQRA 4PLZA 4V2UA 1RBYA 1XX6A 3IQFA 4KAFA 4PBRA 1CERA 4D5EA 5C52B 2EQAA 5LOVB 3Q7EA 2BHLA 4AS1A 4NAVA 1K06A 4PFSA 4AO8A 3U80A 3OUUA 3JSAA 2E4YA 5LBIA 1GZ4A 4B7XA 3ZR4B 5IZCA 2TMGA 2I8CA 4E88A 5L8VA 3OO0A 5KWEA 4RA9B 3JQAB 2EF0A 2HCTA 3NH9A 5ALQA 5I01A 3V97A 1F6BA 3H86A 4YQZA 2X0JA 2OO7A 3PL5A 5C5IA 3VRHA 1V0JA 3BD9A 4DUZB 3MGAA 1NQAO 3IBGA 4MUYA 2BDUA 3O38A 4YUWA 2QRJA 3WSVA 1EE1A 1BS2A 4LN1A 1TFUA 3ZU3A 4CN9A 1ECLA 3CNBA 4ZTZB 2EJBA 1EMDA 1TW2A 1WL8A 2XJ4A 1N75A 2RGCA 1BH6A 1AGYA 4H60A 4IGAA 4EA9A 1ZM7A 3K2BA 1YB4A 2G40A 1I6KA 1R9NA 2H2WA 3OT1B 2BM1A 1SY7A 3QPAA 1EJBA 3JASA 3ETEA 3RC9A 3NDPA 1PSWA 4GPD1 2DETA 4JUAA 4MVJE 3KEGA 1FTNA 5HBGA 5GJVC 1Q3HA 5KTYA 1H2FA 1M2HA 2VZ0A 2JNWA 3ZQJA 3CRZA 3D7SA 4XWKA 2KBFA 2VA9A 3N2NA 2G9NA 2DQZA 3HVKA 2BFAA 1Q5PA 3IEUA 4BUJA 3KV3O 1XP8A 4MV0A 1SBIA 1BXGA 4XB1A 1SBNE 3SZUA 4G67A 3RYFB 3P4XA 1ORVA 4W6QA 5A2GA 3OCCA 1U02A 2VHEA 4IHAA 3RPEA 3S3TA 4R1LA 3UAYA 3DNPA 4O2BF 3VYUB 3W5BA 1I94B 4NXMB 2Q4OA 1P44A 3SHVA 1EGMB 1FUUA 3GWZA 3JQ9C 3LA8A 5GQSA 2BOVA 3L02A 3IP1A 3VYRB 3FETA 4E3ZA 1I6MA 1IHYA 2PH7A 1N2CB 1GXSA 3L7MA 4WY2A 2G1PA 3CS3A 1RAAA 4TKLA 4TYYA 1R4MB 2GZRA 1MW9X 1ONNA 4G1VA 4ALIA 4O4JA 4I2VA 1O87A 4JOQA 3W6ZA 2DM6A 1YWGO 3LRXA 2DKFA 3O1HB 4JT8A 4NCKA 4RKFA 3U4HA 3N7UA 5K8CA 1QQAA 4QUAA 2PMEA 1XAJA 4Q9LA 2QZ9A 3NTXA 2V97A 2L82A 3E35A 3CZMA 1KMHB 4JT4A 1IC6A 2C7GA 4HUTA 4TQAA 5ANRB 4ONEA 2EFCB 2FHPA 1NBIA 5E2IA 4BEVA 1IPFA 3A37A 3RB8A 2KPOA 3MLEA 2ZUEA 5LMNB 1DOHA 5CM2Z 3ZBPA 2O7SA 3DHEA 5K45A 3NAQA 2GEFA 1GTZA 1PVVA 4GLJA 2VJNA 5C37A 2GKGA 3C74A 3NIGB 5FBVB 1R12A 2AEJA 1KEZA 3ZDRA 4KREA 1EP1B 1SQ5A 4MAAA 4Y98A 3QFRA 4GLOA 2YN2A 3HKBB 4YUVA 1QGZA 2GPNA 2QVXX 2Y0DA 1F20A 1NPDA 1G63A 2CVZA 2HNAA 3LRPA 3UEOA 3UCFA 4BP1A 4C4RA 4HX9A 5FTNA 5I5EA 1GAJA 4FFOA 4RNCA 1H05A 2ACVA 1KTVA 1NM5A 3DE3X 2AK2A 2VSFA 3AO0B 5J2UA 2NT4A 5AHRA 2DULA 4EVIA 5C9ZA 3VKHA 1S8AA 5DP1A 2M6RA 5I51A 1V3UA 3AKDA 3A9WA 3FX2A 1HE3A 3AXSA 4R9NA 1CT9A 2Y9PB 3EIOA 3OQJA 5I9TA 2PUFA 4C6TA 4F5ZA 5F7ZA 4OQQA 2QE7D 1NBAA 3BMQA 3GLIB 1YQXA 2LV8A 2MSCB 2IX9A 3ZW9A 3A4IA 1ZH2A 3E9ZA 5G0WA 1J99A 1EAMA 2ZQYA 1Q0RA 2W6ZA 2ZIVB 3B9QA 4EMUA 3ZDXB 2QAGB 3OCZA 4TT8A 4AMBA 2W6ID 2FF7A 3DOCA 2R84A 2I80A 1V6AA 2O3SA 3OQBA 1Y6ZA 2YZMA 1P81A 3NKFA 4R8KA 2ASEA 3WLKX 4RD3A 4TLBA 4LJ9A 5EVJA 2NXWA 1NVDA 4ZEWA 1L8LA 3MK31 4IJ5A 3JV7A 3AI3A 4URUR 1F06A 2HFKA 2FKAA 3RT9A 2PO7A 4UVGA 2QUIA 3EW7A 1VDZA 3INRA 4FT4A 2NTEA 1ZRMA 2BISA 2H4FA 4QO7A 2GCEA 2JLVA 4NWIA 4X3PA 3R7FA 5AW8A 5IUNC 3VR4A 4LF9B 1YZVA 3Q6NA 2ECFA 5LFAA 1KOGA 1BMFD 3T35A 4X64B 4FONA 3ZHTA 1GA4A 1TQHA 4FDUA 3B52X 1E0JA 2ZJ1A 1ORHA 4DAOA 2RGDA 2VDVE 3LKBA 3LOUA 1R66A 2WU8A 2AXPA 3LUGA 4KQFA 1XWIA 2GN1A 2G6TA 2QROA 3SHQA 3T9BA 2BEWB 2GBLA 2V8OA 3AFHA 2HDWA 1SXJE 1A5SB 3L92A 3WKEA 1X87A 5D7BA 5JRJA 2PS0A 1MO6A 2R00A 1IHPA 2OHHA 3GN1A 2HWKA 4GYKA 5HIMA 1ZISA 3NDRA 3L7OA 4D3ZA 2ZYTX 3P0RA 5LD2C 2BEKA 1WPRA 2Z58A 4I46A 4D96A 4UMDA 2W0MA 4HQOA 3UT5A 2H2DA 1Y1SA 4PBTA 4LXIA 5CBPA 1ETUA 3WDMA 3O1LA 4OJQA 3N05A 1U7TA 3JRXA 4QOEA 4RWEA 3GHHA 1U7HA 2MSDB 1KEEA 1ABBA 3UGJA 2F8LA 4HWRA 2B69A 3HRHA 1Z6YA 4X90A 5TF4A 3WL6A 3FPLA 5EVCA 5C8ZA 1XVIA 2QT9A 2YVKA 1U7UA 2QP4A 1PT6A 1DEOA 3HCFA 4MZXA 2VP5A 2WA1A 5E95A 3BWYA 4BTVA 5B7GA 16PKA 2ID9A 4DW8A 1UPAA 2C04A 5BR8B 4BYGA 1JKJB 3UJDA 4CN8A 4BDTA 2IITA 4FBMA 3OCYA 1DX9A 1XAHA 1AX9A 3LC2O 2HSWA 3TAUA 4R2JA 5HRCA 4J16A 4EY8A 3K8ZA 4IIGA 4FNOA 2QG4A 5KHAA 1Q22A 1XMXA 3ENKA 3MCWA 4B75A 2O8VA 2F9LA 2R65A 3WICA 4BFYA 1DMSA 2OXRA 1LS1A 3A4NA 4CIYA 1NUHA 4LHXA 2O23A 4ZT4A 2WTEA 1ELOA 4CTKA 4MA4A 5KO2A 1P4HA 3KELA 3ZWYA 3F7TA 2Z1DA 4B34A 5BSHA 1S1CA 1Z8FA 1N0WA 2BFDB 2GXQA 4KQ6A 3UATA 3CMMA 5K3BA 3T9EA 1E92A 4NOMA 2HCJB 2WINI 1I36A 1F6WA 3B1VA 4YHHB 4QGFA 2FFBA 1DIOB 1QFXA 1ESMA 2I2DA 1A96A 1I4WA 4NPAA 3GLQA 1WHSB 3AERA 4YRDA 5BSRA 4C0XA 2G07A 1E96A 1KL7A 4KZKA 5EKSA 4ZAYA 4XFDA 1K7SN 3TB6A 2FEXA 2PSDA 4NG4A 3C8DA 3DXFA 1VOTA 2W22A 1N7IA 3EIWA 3EXFB 4GT1A 1QVRA 1ZNWA 2J1LA 4KLNA 2J0EA 4NNPA 4OG2A 1RYBA 4QBGB 3U40A 3D81A 4RMNA 1NUPA 3UXEA 4DMGA 1MJGA 2FOLA 1W88A 2ZAMA 4OGKA 4TMXA 5J4LA 2XRZA 4WJLA 3ILYA 2X0DA 1GXSB 5JI3E 3T5AA 1ARZA 2QMOA 4BNZA 2O8NA 1X1QA 2BMDA 1ZGHA 3ZIDA 2D1YA 4QO8A 3I53A 2BH9A 3P20A 1XMVA 1Y48E 4YGXB 1IUPA 3O8LA 3CH6A 4ZO4A 3H18A 3I3SR 4MYRA 1JN0A 4B6EA 1GZ3A 3EX7C 4RSGA 4MTLA 1LPBB 1QZZA 1RXYA 3SC6A 1JSLA 5FWXB 4QHSA 4QGAA 2YNMD 3HBJA 4CNQA 4HBZA 5CB0A 3CJQA 4FFBB 4C04A 4UTNA 1P2GA 4UEQA 3SS9X 3TD9A 4YJ2A 4GKKB 3HDQA 1FP7A 1PUXA 4B4KA 4KUEA 1WTCA 2GZHA 2GJKA 1G3QA 1C0IA 1KSJA 1PWHA 2HRZA 4KXMA 4ZVQA 4CT5A 4C30A 4HUQB 5GZ3A 2NNLD 2XUHA 3SVTA 2GD2A 3V1KA 1OXSC 1PL0A 1U1DA 10MHA 4MPPA 5ARCA 2CUNA 2VJYA 1IXRC 5BRNA 2ZBPA 4U7JA 1KI6B 1PJCA 4ZXFA 3UIEA 5KOJB 4BU0A 3M5CA 2Y71A 1TCCA 3LRTA 1A5BB 4H7HA 4R1SA 4UHEA 4R16A 4HQLA 3RTEA 4PNPA 4AJJA 4AS2A 4YRTA 1EUCB 4J0FA 3THWA 5HK8A 2IELA 2NUPB 2FEKA 1ULHA 2FV8A 4Z4IA 4R5MA 4EHJA 3KVRA 3DBHA 4GM0A 1JSXA 3WFIA 2QRVA 4CKXA 3EPHA 3OPNA 2GM9A 3QQ5A 3RU9A 1SCQA 4GQIA 1G7RA 5BO5A 1DKQA 3T3DA 4M9CA 1O1YA 1GFSA 4V0LA 2C9CA 4Y2QA 1JEAA 2IVZA 2J0UB 5LOVF 2AW3A 5JI2E 3E22B 2JHAA 2WWRA 2B4KA 1FUEA 4FOPA 4QATA 5IKPA 1Z5PA 2Q7XA 2Q8PA 4ZWNA 3HPQA 4GWLA 3GLHA 3IUEA 4PHHA 2E18A 1UAGA 2PGOA 3OQIA 4HAIA 1C7QA 1Q7CA 4RMJA 3R9IA 4YMTA 1OBOA 1ZO8A 4ZDKA 3K6SA 5C0OE 5DCYA 4J7AA 4ARBA 4KDEA 6PFKA 3IPCA 1GHTA 4A6XA 1RE0A 4WZBE 1T0BA 4LGCA 3GP3A 3C3JA 4IM7A 2AJBA 3UW3A 4ARSA 2RAUA 3ZQKA 4D9EA 4L3OA 1A4XA 3TH5A 2AMYA 5AYVA 1OFUX 4J6EA 1AN0A 2BSXA 3RRFA 4DABA 3MWJA 5I8PA 4FUQA 3ICCA 2R3SA 4HNAA 4ZU1X 1YE3A 2P65A 4GS5A 4X1OA 2QX9A 5JXHA 4EF5A 2W2QA 4MKGA 3LT1A 2POQX 4TXMA 3P26A 5KBYA 1TAUA 3HY6A 5EQFA 3QIVA 2FRDC 3URKA 1SPXA 1RLMA 1YR7A 1KXZA 1QH1B 4BE7B 8GPBA 5AHXA 1NN0A 1FVXA 4IZOA 1MH9A 1X14A 2KHZA 4QAQA 5L7YA 2C2WA 4ER5A 2ZSJA 1G2OA 4LJ8A 4WQMA 3LCRA 2H54A 1U8AA 4UE6A 5A3JA 5HOEA 3ZI0A 5E2BA 2W00A 3M82A 1P5RA 4P4LA 5C1BA 1E4EB 4NOKA 4JR1A 2PH5A 3RLFA 1YCDA 4PPFA 1M2EA 4E2FA 4MYTA 3O26A 7ABPA 3PRHA 3EXHB 3M6IA 1IFXA 2Z1NA 2CBZA 1I1OA 3ZD6A 1E4OA 5CHYA 5CG2A 1N33B 3CE6A 2HREA 2V7TA 1SH7A 3WYCA 2GS9A 1FTYA 1XK7A 4K9MA 4D41A 4CE6A 4MQBA 4QXPA 1DKPA 5MN4A 1BJTA 2Q5FA 1GRVA 1CY1A 1NZFA 2GPTA 3CT4A 3FDZB 4HDKA 4UM5A 3X2FA 1DO2A 1LK5A 1NUUA 4I66A 3R7AA 4B3FX 3ESDA 1PT9A 3G2KA 4PLPA 4LEIA 1CRWG 5E7MA 2O6LA 4ME6A 1TA4A 1M2GA 2OGSA 4PIVA 4X1YA 1I32A 1OYOA 2GBCA 5CNJA 1MPTA 3KB1A 3K71B 3T12A 3FZGA 3O8NA 4IL5A 2P0EA 2JGEA 2PGJA 5AHWA 4CUKA 5A4DA 5KC8A 5IHXA 3EFEA 3DBIA 1LH0A 3DBVO 3C6MA 2NQ2C 1KK0A 3WGHA 1XV5A 5IDXA 5KOIA 3N2EA 3V2GA 4M7PA 2QRNA 5FT9A 4RLHA 1XK6A 1I2CA 1Q84A 4PYRA 2G63A 3KCQA 1NR5A 1P4SA 1JXQA 1WHTB 1W9MA 3EF3A 5FTMA 5AJWA 4ZHQA 5MDHA 2IH4A 3QFSA 4OAPA 1KYXA 3C3YA 4W8GA 1UAAA 3E2MA 4HQ6A 3PC6A 2XOKA 1BX1A 1Z39A 1C7ZA 2X6RA 3CBGA 3N0RA 5FADA 2UUBB 3OLZA 4DMCA 4MK4A 1EP9A 2Y93A 1CUAA 1MO3A 5FLEX 2X77A 3BCRA 3TF5A 5FI3A 5ITVA 1KJZA 2FFHA 1EIZA 1PR0A 5F9MA 4CFSA 4DT1B 2ZE7A 4N18A 3OA0A 3BBPA 4OM8A 4WT7A 3ZU5A 3CKYA 3LUAA 1KO5A 3UYKA 1Y9AA 2QV7A 3PD1A 4Q3KA 4DQDA 3CLSC 4K5QA 2ALJA 3T7AA 4YCNA 3BWCA 4IOJA 3GLGA 3ZYZA 1DJMA 4L75A 3ZHUA 4FMCF 1QAQA 3RREA 4Z4FA 4UE3S 1MXHA 5F3RA 1A5ZA 2W6PA 1NQ5A 2XHZA 3JY6A 2E89A 3C7DB 1VG1A 2OUIA 3GFOA 3H2BA 4BB6A 1HYQA 5KJ1A 1QUFA 1E94E 1ZG3A 2Y76A 4FSDA 5IFKA 1SWWA 2C5HA 3M0EA 5LDGA 3REOA 1A82A 2FW6A 4ZALA 3TJMA 3FNRA 4D02A 4DM4A 4JEMA 5MGBA 3DL0A 4EG7A 4I3FA 4PG8A 3RTBA 1DBPA 4UCFA 4DSTA 2C7OA 1U7DA 1VB5A 4BTLA 3I34X 3FAZA 5A5DA 2HJHA 1T25A 2EHJA 2FDRA 4Z4CA 5HKKD 3BM5A 3SYNA 3FM9A 3ZQ4A 1FY2A 1Z82A 2FSHA 2OOSA 3GDFA 3SXJA 1IBMB 5JWOA 3CLVA 2QTVA 1DTSA 3EWIA 1VPEA 2Z6UA 5HTKA 5B3JA 1Y82A 2H5IA 4KMOA 3WL4A 4A8JA 1TTQB 2WM9B 5A5EA 4R31A 3I5XA 4M0MA 2AE1A 4EHKA 4YXFA 4DUYB 1EB9A 1LJ8A 2BTOA 2YR0A 4RKQA 1ZUHA 4DSAA 2FZ5A 3GJTA 3IAUA 1ZY2A 4FGWA 4RPIA 3BXGA 2UZ3A 3R09A 2PUBA 3LLSA 4M46A 3GFVA 1N2EA 3FDJA 3E9YA 5E4JA 3K0CC 5B6IA 1T36B 1RSZA 3CRNA 5J47A 1KAMA 2I67A 1KYQA 3CG4A 4F2WA 1V7ZA 1GQRA 1KMHA 3HKCB 1RCFA 4EY7A 2O7RA 2HMVA 4XQ9A 1KSFX 3IILA 4D4MA 2OP0A 2PMWB 2QW1A 3Q8WA 2E4AA 4R4JA 4IH4A 3ZE9A 3SSNA 4YAKA 5LOVA 1C50A 3TMKA 3UGKA 3TGPA 4DR7B 1PKEA 3BJZA 3OJLA 2VZEA 1BCSA 3HJTA 3I8OA 4FQ5A 3UPDA 1ETHA 1QX3A 5FKJA 1G64A 4GDFA 1DQYA 3MSXA 3WVNA 3C85A 4ZZIA 2ZRNA 3EH2A 5JCOC 4LHSA 2PNJA 2WC1A 2WPDD 3U3DA 2MSEB 3WLPA 5CEFA 3DA8A 1AQJA 1U0NA 1WDLA 1X8KA 2VNHA 5GM1A 1V7QA 3EAGA 3RYTC 1XDSA 2NYVA 4LHYA 3WWZA 4RFLA 1Y37A 3G0DA 3H9GA 2NXCA 4NE7A 3HA3A 4W9NA 4L5CA 3V4RA 3OZWA 2ZRJA 4Y2SA 3SX0A 1RYYA 3SDSA 2NO0A 1GCAA 2LNDA 3T1NA 4I08A 5KSOA 3EMKA 1L4NA 3I4FA 2VQEB 4JVMA 4G85A 3FHTA 2PSSA 3FTDA 8AT1A 1CZUA 1XMJA 2ZYSA 1L7RA 2HJRA 2PGNA 1LDEA 1E77A 5CMLA 3I9KA 3NRBA 1H3EA 3DMHA 3FPJA 5CIQA 1QU2A 5JLJA 2I6GA 3RGGA 4PAMA 4Q0MA 2QJTA 1E3SA 3DH0A 5G1NA 4PQRA 4CM8B 1XTQA 3RIHA 4ZAZA 2IJGX 2XKAA 4ZEVA 2VKQA 1J07A 2Y05A 4TXHA 3HKDA 3KG2A 4P53A 4LJRA 2XB2A 2XVXA 1FRQA 4R7ZA 5DBEX 2RHHA 2M2IA 1RBZA 2FPUA 1JQEA 3WGMA 3ISJA 1E1CB 4F1JA 4TWZA 4L8FA 2RJOA 1KMQA 2HHLA 4G09A 1IN8A 4LVUA 2JEZA 2G4VA 1OYVA 3OSZA 1C30A 1TZCA 1WKCA 2QE6A 2IP1A 3E8SA 4YQYA 3VU0A 1GG5A 1E60A 1ZD3A 4EZBA 5LNK1 1U7PA 2O07A 1ZS9A 2D0DA 1XQVA 3H1TA 3DOOA 3RQIA 1UWVA 2GK4A 3MMSA 1L5HB 2PPVA 3DNMA 3KT8A 1ZR2A 3C3CA 1V5WA 3QLTA 4HNHA 3VZPA 1P8JA 3QENA 3C8MA 2P0AA 3BVPA 2G76A 5JDIC 1W35A 1X3LA 2XVAA 2A9RA 1KMCA 5TQ2B 2PGXA 5JWHA 1ADFA 3GCWA 4WKGA 1NJFA 1HZZC 3E9CA 3H9BA 1O6BA 5ESRA 1EVIA 1U3CA 1I4LD 4D46A 5BVGB 2D5IA 4EFNA 4AKSA 1CYDA 4OQEA 4EA7A 3AKZA 1E5DA 3RBZA 3B7GA 4WL0A 1GPDG 3LYAA 4KK3A 5DLEA 4REQA 4EI8A 1U8TA 3RHSA 1BGWA 2AZDA 4MUBA 4EA8A 2QUJA 3VOTA 4DFDA 2VDPB 1EUZA 3L8HA 1HSOA 2ODTX 4UE2A 3SHWA 4DQ0A 1CU1A 1JBQA 3DF9A 3H2GA 5T67A 3RIEA 1YACA 1OLUA 3RAGA 1B23P 2AQ8A 1YNSA 1EBBA 1ZONA 4PYIA 2Y6VA 2FCRA 3A9TA 1B2LA 5AOVA 2AG8A 4AZ3B 3OZAA 4HL6A 4TWIA 4HRVA 2X40A 1L1FA 1VHWA 4HQKA 4W99A 1MX3A 4KQJA 5L3QB 3AWIA 3SF0A 1RPNA 1SU6A 3TINA 3K4HA 4J8PA 3WB0A 4B73A 1TUIA 1Y1PA 1T24A 3QTTA 4DBLE 2Y3IA 3EASA 2Z8YA 3GGGA 1LLUA 1TEXA 3K4PA 3TKLA 4PYNA 1BFKA 1NP6A 1G0OA 1UBRS 4OGFA 1KQPA 1UODA 2CYBA 3PUKA 4BX3A 2HN9A 4C7XA 4JU9A 4UAGA 2PXHA 4LMAA 5JIBA 3QLUA 1QGOA 2AN5A 3BXEA 3E7XA 2YWRA 4L4ZA 3ND9A 1FLNA 2PU7A 2GZDA 1QF7A 1CZNA 3AT1A 3EZFA 1G5FA 4F04A 3LUBA 4YCDA 3T7TA 3R5FA 3QMPA 3CLHA 3H7IA 2G3YA 4FGZA 4G1MB 2OB2A 5NLLA 5CCXA 1UFQA 4J3NA 5JCJD 3PGKA 2IK8A 2PUAA 1K6JA 1RCUA 4FGUA 3N2KB 7MHTA 1SBYA 2P41A 4UHDA 4JCOA 2PFSA 3CLSD 4OGWA 5F78A 5TDHA 4ZT7A 2D1RA 5KQRA 4BO1A 2UYYA 1MO2A 1V8BA 2ZFUA 2QQ5A 5AKJA 1X80A 3BCUA 1S9DA 1IB0A 3OZCA 1VPDA 2WHPA 3JYNA 5B55A 5AW6A 1M0TA 4BBZA 1IEXA 1OOEA 3TWOA 5JY6A 1RRCA 1TAQA 2AEEA 3NHKA 1TVMA 3WL8A 3ZWQA 5BWNA 5E9QA 1JZTA 2QKYA 1P29A 2HA7A 3L0OA 4LQLA 3PQ8A 4X1IA 4QUBA 4B1FA 5B30A 5IABA 4MRNA 2Q6OA 1ZNZA 3DEHA 4CMEA 1RTTA 5K9ZA 4DPLA 4HH0A 4YAIA 2RI0A 3KJNA 2N9UA 1BKYA 3MGBA 2JD2A 3K09A 4OM7A 4BKOA 2QLBA 1BQ4A 3C3MA 1CIPA 1JKFA 1OGIA 1GP2A 4CMCA 4G0XA 3EY4A 3OLXA 1LNQA 3I9JA 1TX4B 2AH5A 4MUXA 2WYOA 4KDCA 2WYWA 3PWZA 1MJFA 1N2BA 2CXXA 3GY0A 3I32A 4L5IA 2VPXA 3QFTA 3U61B 2B5VA 4F2GA 3M6LA 5FBZA 5TEWA 3VPBA 4EBBA 4DDVA 3KB6A 2Z2IA 4X94A 3TLKA 3V4ZA 4QDKA 4B3GA 2R1TB 2O7NA 1J6UA 3GMSA 5EUQB 4C0SA 1U5AA 1DO0A 2XB8A 4XD7A 1N0IA 4OF4A 2VEDA 3FTNA 1NZDA 4H7DA 1VYUA 1H0KA 2R6R1 4NOLA 3OX3A 1MDFA 4ZYWA 5AT1A 2G83A 5LP6B 3VA7A 1TC2A 4FHGA 4JNCA 1N4DA 1M0EA 3DKVA 3BA6A 3VR3A 1JJAA 4AU1A 3LBFA 4PWZA 2MIIA 3V8NA 1IN1A 1Q14A 2V7WA 4JYAB 3ITEA 4UNIA 3RNLA 1NUTA 3L79A 1GSAA 2SKDA 2VATA 3AF3A 3RLIA 5ABPA 3CTMA 3HVHA 4KVAA 1YZKA 5AW2A 4IQ0A 1MW8X 2IV2X 2GEJA 2R8ZA 4QARA 1P9NA 3EIHA 4LCEA 1VL0A 3RQSA 4AIIA 4FOLA 1ZN2A 5F1OA 5A7HA 3Q72A 5FBWB 1XD9A 5LL6P 3FCYA 5I9MA 4ARIA 3W2HA 3GUZA 2RK3A 2FG5A 2QRKA 4TKUA 3TSZA 4JGBA 4Z1MD 3OETA 5B12A 1T13A 5L51A 1Z6QA 1X1BA 1FFSA 2ACWA 4HVCA 2YFQA 4JU8A 1Z7GA 4D9NA 3EPPA 4RQBA 1SCNE 1VJGA 1W59A 1G1AA 1NX9A 2QQFA 4QHYA 3SLRA 3ZV5A 3AEXA 2LKCA 3TX6A 1QFMA 4RACA 1DCKA 5DN6A 1YGPA 4M0FA 1ZQ9A 3PDCA 3KYCB 5F52A 3VKGA 1QC5A 4K9PA 1RYNA 1JFLA 3BGSA 1V7CA 5LQJA 3SDZA 1HLGA 4UULA 1Z0KA 4DDWA 3RANA 3CO0S 3M3DA 2H5LA 1UL1X 2ZWPA 4XZ3A 4BN5A 1LPPA 2W2XA 3WJ1A 1P74A 1JA1A 2OFPA 3QXGA 1RHMA 5TQ0B 1J97A 1TK9A 2GZ1A 2IUEA 3FJYA 4HXEB 1ACLA 2W5UA 4QODA 5CPFA 3JALB 5IUKC 5UKDA 4DC9A 3Q3HA 1N32B 1NGSA 4O1MA 1L5FA 3BL6A 2ZIFA 1YHYA 4HDNB 2BBOA 3U7EB 3E2PA 4GBJA 1YQDA 4GZ5A 1TUGA 4YV1A 5CA0B 1UKCA 3MOSA 4Z9AA 1ADGA 1VFPA 3TD2A 1SG9A 2OYRA 2I4MA 3VVBA 1UBSB 4KITB 1GKKA 3U44B 4IJWA 4FKMA 5CLHA 2RHGB 3UMRA 1E2HA 2ZUBA 4WTOA 1LJUA 121PA 1YCGA 1J0AA 4OD0A 1H4TA 2WNIA 3PEEA 3D8TA 4DWOA 5BVGA 4IG9A 4O0LA 2AUMA 2O8DA 2QL5A 3JQBA 1NKTA 1MEJA 3NETA 1IY2A 1E1DA 4LHVA 4QUEA 3P2OA 4X3OA 4UQOA 4GR4A 1N7HA 3ZHRA 5AXDA 4RY2A 3AVQA 2RBGA 5EJ7A 1Y6FA 4PHFA 1AUXA 5CNMA 1G3MA 4PWYA 4TMWA 5EIBD 3Q8KA 1DBWA 2C4KA 1MHTA 4LC0A 1PJSA 4R9SA 1YR2A 3OC0A 1YZGA 1OA1A 2O3QA 1DC6A 3FNGA 3QM1A 4U1RA 3U3KA 4FYKA 1NU8A 721PA 3ASYA 4MDFA 4L8LA 1E4YA 2QAJA 2RGXA 5BN5A 1K4YA 3EH1A 5DTQA 1W44A 2CFRA 4K26A 5AHKA 1JHZA 4R1NA 3W3AA 2WYUA 1F1JA 2CFTA 2VYQA 1TYCA 3KLMX 3QJGA 5TVKA 3B38A 5K6RA 4RIFA 2Q49A 2FSIA 2VAMA 2AZMA 1HE1C 2HNKA 3IP9A 3LY8A 5ENVA 4CF3A 3H0CA 5CP8A 5FL3A 2MJLA 3TE7A 4OL0A 2Q62A 2VAWA 2JDID 3NTOA 4RHYA 1DIRA 3EGCA 4OQMA 4ZOCA 3CPHA 1XL0A 3IV9A 4QU8A 3RABA 3U3JA 4AG6A 2PH3A 2PZBA 1NBEA 4CM7A 4OBBA 4V3CA 1YB2A 4RD2A 1MBZA 3DE1X 3IPXA 2I3BA 4L0CA 4G4IA 4D44A 4F4DA 3NUQA 3AU9A 3HN6A 4M89A 4BNJA 5PGMA 1AURA 1FX0B 2X8LA 4MVCA 1IZ7A 2H4XA 2AA3A 4RK4A 3B1FA 1FNSA 2O3TA 4WK4B 4N3GA 3BIWA 4PSDA 3UKOA 2YN0A 1MJHA 1RAFA 1ODTC 1OX4B 1Y4UA 2H0QA 3NRCA 4Q02A 5LCXA 3TGWA 4FXOA 1PQYA 5K09A 1OXUA 4D9JA 5JMPA 4ZAVA 2O2SA 6AT1A 5D85A 3B70A 4TM7A 1E2PA 1YHZA 2M32A 3OZVA 4B85A 3BMXA 1UK7A 1W85A 3PNQA 2WHPB 2YMQA 4OQPA 4PCUA 3QHPA 4BFXA 1SVLA 1GWNA 1GTMA 1NFQA 1VCHA 2Q7DA 3UV3A 2QT0A 4B87A 1SXJD 3QVOA 3DP7A 1V1MB 5CK5A 3W8RA 4DBLC 4D0GA 1T2FA 1V3QE 3NTQA 1LBHA 2GPWA 1B6RA 1E3JA 1KY2A 3TUJC 5CEEA 4DR6B 1HTBA 1O97D 3M49A 2V74B 3WFJA 1WQ1R 4C4OA 2ZBDA 4MV3A 1Z62A 3OSUA 3QHQA 2I9KA 3HJFA 3VBEA 1DFHA 2PRIA 3HBFA 4HI0E 1E1YA 1V8OA 5AM2A 1PDWA 4X20B 4EOGA 4PE5B 3QELB 2O5CA 3HUEA 4L95C 1QQ5A 1MR3F 1PFQA 5EESA 1G5HA 1Y1LA 1YS7A 2VUIB 3JWGA 4UFOA 1E9EA 2OZLA 4GNRA 4NE2A 1HT1E 1MABA 2PBLA 3OUTA 1XFAA 4IS2A 2OAQ1 3OEEA 2HCBA 4QDTA 3VR0A 4Q6BA 1E64A 2Z2XA 3Q0IA 3ZZTA 4MROA 5L40A 3DC7A 1C9JA 3TNLA 5AKZA 5EUBA 3B7PA 4HLUC 3CC8A 4YLEA 3D3JA 4URVR 1Z74A 1UJ6A 5IMBA 1LQ2A 2EFHB 3V1YA 1HYGA 1JTEA 5I9LA 2WF5A 4ZVSA 5A4AA 4U9IS 1PV1A 4Y7CA 3GPDG 1MP0A 3TKYA 3AP2A 5KKCA 2QTVB 4JN6B 1T5IA 3HP4A 1TCUA 1QGUB 1IY1A 5IWAB 2J9RA 1MG0A 1W36D 2ZJBA 4FW8A 4X95A 4DS3A 2DF8A 3DC2A 3CKKA 2FWMX 9MHTA 5EIHA 1GGFA 2HMWA 5BQXA 3PJRA 1SGWA 3U17A 2GAIA 3K15A 2IPOA 4E3WA 2H6EA 3BTUA 2HFJA 1RYMA 1O57A 4AMGA 2DBQA 2MYNA 3RFVA 2GN0A 2QZ4A 1A71A 4BZWA 2P6UA 4ZKEA 4EG1A 3AVYA 1E0AA 1NI4A 2ZK7A 1Y1RA 1WAMA 3JVVA 3PUWA 2FKNA 2GNOA 1NLYA 2ZIXB 4WZAA 1LDNA 3ELDA 3NBFA 3NH6A 2YOGA 1QZ3A 3CLKA 2QENA 4ND3A 5AKXA 4GZLA 3T5PA 3ILVA 4I19A 5EXPA 5IJAA 1AHPA 3DAHA 3KLOA 3TIFA 4CMKA 1KR2A 1VHTA 2XTMA 3J80A 4TZ6A 1XRJA 4F71A 5CT8A 2NIPA 4RPLA 1NL3A 2I2BA 2CT8A 4IX9A 1EJ6A 1HQCA 2CVQA 2V9ZA 2EHDA 2I4LA 4H15A 4KN8A 1SXQA 4QE3A 3F6BX 4ABTA 3DMDA 2XWQA 2XDYA 5KWSA 3A7EA 3FKQA 4WN9A 3SBEA 3VR2D 4BAGA 1UBHS 1IY0A 1YMVA 4J0KA 4EEZA 3K0EA 3P32A 4JJAA 3W04A 3JWPA 4B2LA 3EXHA 3QVGB 3BREA 4P58A 5AVKA 1XZMA 3ZHOA 4DT1A 4QZVA 3NBAA 4CQLA 4HYEA 5AKYA 1XA3A 3L82B 4Q00A 2B8JA 5DNCA 1KZ4A 2H63A 1XU4A 3Q3IA 5EGSA 5I8WA 5HZGA 1OI4A 2GMWA 3H84A 5DIZA 4ND1A 1P7YA 1WSAA 4MJ7A 4OGLA 5K3CA 3OX1A 1J2TA 3PLNA 4EYKA 1PUJA 3RHFA 1X9IA 4B3JA 2PCJA 4E70A 3OPYI 2Z56A 4U8HA 5A4IS 1TFRA 1ZBQA 4S3MA 2G7MC 4IFTA 2VWQA 5A5FA 1WSBA 2GCIA 3C87A 5C81A 4MI3A 3VV3A 4C78A 2VYFA 1DCMA 4CM8A 2C3MA 5LNK6 5COBA 2IBSA 4H7FA 2IEZA 1COZA 4LE2A 4KRFA 3I04A 2PAAA 4IJVA 2Z6AA 1KMNA 3IKVA 1GN9A 3AETB 3BN3A 1OROA 1N2OA 1KXJA 6LDHA 3ZGOA 4ZYLA 1ZUD1 2WQZA 3PC2A 4UHJA 3RE1A 2ZKLA 2R4QA 3DOIA 2IDJA 1KDVA 3PR3A 1Q7TA 4GMHA 1A5TA 1JJVA 1KAGA 2Q5IA 2GRAA 4EO7A 3IAM6 3IDQA 1Q6ZA 4AI6A 2AB0A 3SG0A 3T5DA 3F97A 3GGJA 1DQSA 3AR2A 3H5RA 3V9AA 1U0HC 2VI5A 4REMA 4EYQA 5ALEA 3K05A 4M7RA 2AFIA 3JYHA 2WABA 1K4MA 2BE9A 2VXOA 1N1DA 2JA1A 4HVTA 4NYIQ 4O4JF 4HWOA 4L4UA 5G4KA 3ZWAA 4N0MA 3W2GA 1Y3HA 3SQNA 4DLWA 3CONA 3GVXA 5CRIA 3RD5A 2C5EA 3FOWA 2ORIA 3FPFA 3HFGA 4GZ3A 4PRLA 2E5LB 2JHCA 1R9MA 4MGYR 4MYCA 5HUHA 2PKEA 2IS2A 4AO7A 1XTBA 4BASA 4ZVRA 4K6CA 1J56A 2W90A 4NENA 1JDBC 3KT3A 3CX7A 5ILGA 1Q7GA 3IS3A 3L18A 2VDUE 2JLXA 2XY4A 1RI1A 2QJOA 4MKHA 1WF3A 1POWA 3W9YA 5CR9A 4IDNA 1MF7A 1SZDA 3B3GA 3BMNB 5JARA 3LDGA 1BWRA 1GAEO 1B14A 2NSDA 3LZDA 3K96A 4K3UA 3COWA 4UU0A 4ZOLB 4LJ6A 3TMYA 5K3FA 3PQCA 1UZLA 2AI3A 1FMCA 1E5XA 1SG6A 3ZEAA 1TTHA 3WB1A 5EXXA 2Y0EA 3D8RA 3NBQA 2MR5A 4WN3A 1BOFA 3H1GA 1GM5A 4B3SB 4IYJA 3QU5A 2NOAA 2QLMA 4KYVA 4EQ6A 3DHNA 4G9GA 3I09A 3GEPA 2ZE5A 1Y7TA 3VFDA 1TMYA 3E7DA 3FN4A 5FBRB 3D4OA 2RH5A 3EVTA 3O94A 4IIXA 5AO9A 2YIDA 4RJ2A 1I6LA 2GVZC 4J43A 1KE1A 5FTKA 4IRUB 4YIKA 4X60A 2JLCA 1Y3DE 1E8MA 3OE7D 2H1IA 1YAHA 1EQUA 3BMCA 3JSXA 5U1PA 1LGYA 4EQZA 4AZ3A 3ZS8A 1MZPA 1R6BX 1ECFA 5FBQB 2WWVD 4PG7A 1DIBA 1SBTA 1O3YA 1SQFA 5K51A 5I9NA 2ZULA 1XJQA 2V6MA 4XYLA 3Q4GA 1VE3A 1T3ZA 4XJVA 4Q3NA 1W75A 2CFCA 2FQ1A 5T8KA 4JX8A 3A27A 2LDXA 2H2AA 1VHJA 5FPYA 3IIEA 3FY4A 2OD2A 1QRDA 2CHVA 1FF9A 4DG8A 1T8RA 3AI1A 3JYPA 3M1AA 3OF3A 3TTTA 4MW7A 1L7AA 2PU5A 1E3EA 1DOAA 3S6JA 3TG2A 2PKXA 2C9OA 4DV7B 2DBRA 3NHLA 5REQB 2J48A 3D3WA 4ARAA 2BP7A 3EXAA 3RVOA 3HKCA 4GOMD 1ZKDA 1M6YA 3NNNA 1A9XB 1Q15A 3BTSA 4R3NA 5A4KA 4ASUD 3EG9A 3C0KA 2G70A 2CHFA 2GK7A 2FNAA 3CW8X 5BMOA 2BT4A 1AA6A 4R1PA 3DEZA 4BFSA 4JP2A 4RENA 4B33A 1OHHA 4F72A 3E5NA 4TL9A 1J49A 3KZMA 5FLXA 5A9SA 4XAQA 2DFDA 4OJMX 3GGSA 4B3TB 5JJKA 1FMLA 2VJLA 5FBHA 5IT4A 3AJ8A 4MJXA 4HK4A 4EMBA 2WTNA 3M81A 3RG2A 3ICQB 2G7ZA 2X5XA 1M2KA 4BLRA 2OL4A 3LTNC 1PLJA 3DBOB 2XQVA 1IM8A 1AIPA 1MC4A 1NT4A 1XRSB 4UHFA 3ZLBA 2RJNA 3NALA 2ZXEA 1X7HA 5ALDA 1ES9A 3GU3A 1MQ9A 2JAUA 1PJ8A 3TAXA 2D5BA 3GBVA 4I50F 3L77A 2X6QA 3ZD9A 1B93A 1D4ZA 1OIXA 4REQB 4UPVA 2JANA 2ZI7A 2NPFA 1HEUA 1BHO1 3H4IA 4AJLA 5HQTA 3NJRA 4EB8A 2D2VA 4EIWA 3H8VA 1A4RA 4F3YA 1VBMA 3HB9A 1K97A 5I7HA 1YULA 2B37A 3LGXA 6Q21A 4TYQA 5E6SB 4F38A 2JGNA 2BH2A 4I4IA 3W7AA 4AX4A 1D3AA 1ZU4A 1DNPA 1KI9A 1OF1A 3QITA 4HGYA 2XOKD 4MW2A 1HEIA 2FX5A 3AIMA 4KIWA 3VR1A 5B3KA 1XPOA 5DM60 2Z98A 1MLDA 3DR5A 4GBGA 3USZA 4BTEA 2G28A 4D9HA 1VDMA 1ZAKA 2SCUA 3QSYA 5HNKA 4TTAA 1G8JA 4M0UA 4GGPA 1G5PA 2AFHE 3QRWA 1IYZA 5HRUA 3ER8A 1K8QA 4G0QA 4KI7A 2JAOA 4WXPA 3EIQA 2CLKB 3DDZX 3OX4A 2VHTA 1XZGA 3JQ7B 3KNZA 4H6WA 5A5VA 1JTVA 4W82A 1G9SA 2I7CA 1B3BA 7REQB 3GQVA 4JLUA 2JI8A 3FWNA 4N65A 2X0EA 2G0AA 4D6YA 4C7BA 3R40A 4D4LA 2CBXA 5FO0A 1UOQA 2JASA 3OOJA 4RVFA 3REGA 1PEKE 1HK7A 3BFKA 3L49A 3PNLA 4DZZA 5HVNA 3TK1A 4R2WA 1M76A 4K0RA 4ZT5A 3OT1A 4UUNA 4NK4A 2GN2A 3OMLA 2CZCA 2G80A 1SOAA 1UWLA 2CDNA 2WE7A 3X1MA 5HZKA 4CF4A 2J45A 4CHGA 3JD4A 3EEOA 1YJQA 4QGHA 2ZRDA 2QXUA 1NASA 4WXRA 2DXIA 5SYAA 1U7XA 2P4SA 4E1BA 3TW8B 3OAAD 3KYCA 2G77B 5H4HA 1C4WA 4RM3A 1P8AA 1VYHA 3FB4A 3V4OA 2A5GA 3WK5A 3SWWA 1BD4A 5HOQA 4YRJA 2ETVA 2Z2JA 3JAKA 4KO2S 5TC4A 3T7EA 3VR2A 2RIPA 4JJ7A 3DE6X 2MWMA 4G89A 5CW2A 1NONA 1JR4A 3MS7A 2NPOA 4MULA 4QOFA 5A1TA 3K0FB 2X2EA 2IUUA 1SQSA 3ZCSA 4Z86A 2O0MA 3FNFA 1H6CA 1BHJA 2XECA 3N8NA 4X8LA 2CLEB 4FD3A 4K88A 4Y1FA 3HYTA 1XD8A 5CCBA 4WA7A 5FLYA 5G4KB 2VH2A 1K5GA 1T9CA 2H92A 3AZOA 2VP3A 3HEMA 2RHOA 1A76A 3L9XA 3SXPA 3WKBA 4YMUA 2Z4TA 4OHOA 1LV7A 4RGBA 1GLGA 2Z83A 3NAMA 4CM3A 3FHJA 2ODBA 4DJDC 2IE8A 4D9CA 1N2IA 2QM7A 4M36A 2BGMA 5ES4B 1X7WB 4X62B 4GAEA 1V3VA 2BN4A 2HBRA 4QTYA 2WTUA 5KTSA 2VPTA 3L4BC 2WSBA 3CXUA 4H3KB 5D8DA 2PZFA 3NMUF 2EYUA 3ZN2A 5GONB 1YR6A 2NMVA 2DWUA 5GINE 4KFTA 3N3AC 1NPTO 1WUTA 1CQIA 3E9RA 3GB9A 3WLIA 2VP2A 1TYZA 2WUGA 4UATA 4C4XA 4BX9A 3GMDA 5TX7A 2PH1A 1W5EA 5AJTA 1JJBA 3KSDO 4ZHQF 2P9FA 3R24A 1L8XA 1JKXA 4ENSA 4CQJA 1GZ7A 1TJNA 1O9BA 3ADOA 3GROA 5LIPA 1OPXA 2WFZA 3WP0A 3I6BA 2JGMA 2PV7A 1LBIA 3EGVA 4C76A 4FBGA 1Z2AA 1P80A 1P39A 3F6EX 4J90A 4S35A 1ADYA 3IO5A 4QU0A 4YMHA 3AVWA 2ADFA 1JHQA 1VMIA 4OMFG 1QIJA 2EQ5A 3IVGA 3LQYA 3R5JA 4JJFA 3VPAA 4YCJA 2WWGA 1UC8A 3OTWA 4GI2A 3UC9A 1UXJA 4AZ0A 2GLUA 4QQRA 3UPUA 4LF8B 2ZUUA 3H8SA 3GFFA 2TSYB 3OP4A 4FOSA 9LDBA 2CMHA 2IU4A 4M76B 3TTYA 4DB2A 4H7PA 1C7RA 4MCAA 3UJ9A 4KN5A 4OX9Y 1EXDA 3EC7A 1C8BA 4OP2A 1CZRA 3BGOS 3N0TA 3ELYA 4G07A 4I4CA 4OXIA 1FNCA 3BDVA 3H05A 3A6LA 3HCNA 3L4BA 4X7PA 5DTMA 1G20B 2GNAA 4MPRA 3OQMA 4JI1B 1P2DA 3NVKI 4HDQB 5KIAA 1RRGA 2ZANA 1TQDA 4MV9A 4CKEA 4JYCA 1DBRA 2BP7B 2IKSA 2WAAA 2FR0A 3EEFA 1ISHA 4HSEA 4WXMA 1G8KA 2QD4A 1W0CA 2YWFA 1DBIA 1F4VA 3I73A 1CX9B 3DZFA 1JG7A 2R8EA 1TIKA 4JKOA 3S70A 3U62A 1OZHA 1D07A 4E6EA 1FOEB 3SNKA 1Z4OA 4WW0A 4C0WA 3G1WA 5IJ0B 2P5UA 2DOKA 5BYKA 2GSWA 2WQ6A 4IHQA 3G85A 1UDCA 3N7AA 4ZI2A 3IEPA 3RHZA 3UHFA 4DTCA 4BFVA 4I1OA 1Q1NA 3Q1LA 2REXB 2RKWA 4JSYA 4UAUA 1IVYA 2FZEA 2YQZA 3ON5A 3RKSA 1ND6A 3JPWA 2JH3A 2YHAA 2EARA 4Y2RA 2VJOA 1SULA 4C29A 3AB3A 4GOXA 3PA6A 3OZTA 3K72B 1KKMA 2D7CA 4JYBA 3ADPA 4RCZA 1V8PA 1R50A 4RNDB 2DHRA 2JJ8A 4B3IA 2WD7B 3KDAA 4QOIA 1OI7A 1OU4A 1TPYA 2ZDGA 1KI1A 3SQDA 1RKBA 4IHJB 4KH1A 3R3JA 4Y1EA 4I1SA 3UJBA 1SBCA 1XDUA 2QTBA 2ZSHA 2MCFA 1QOQB 4FDMA 1RHRA 2CXSA 3PFBA 3SLGA 4IXMA 4NOJA 1UADA 1XN1A 1G42A 2YVLA 4GXNA 2XEDA 3RJZA 1TCAA 2I1LA 3BE5A 3BD8A 5D1HA 4J1QA 5HZHA 1WUHS 1UT6A 1KFBB 2HHJA 3B85A 4RDCA 1FTGA 3WAGA 1OD6A 3LZCA 1N7JA 1WMDA 1CP2A 2BGRA 4KRYA 1O94C 4N6NA 3OMWA 3PDIA 3V1TC 2XUPA 1JHXA 2EU8A 3OE1A 5HF9A 3GLIA 4JP5A 4KGXA 4LNUB 4M0DA 1SBZA 5FUQA 2H11A 5IH3A 4DLPA 4HV4A 1B0PA 1P9RA 4B84A 5LSAA 4WD3A 5FWYA 2HWXA 4R01A 1UBLS 4KG7A 1DHTA 1E1KA 1IDOA 1FUKA 4Z7QB 1G2PA 4TL6A 4UBOA 4V38A 5CEJA 3K2EA 4QHTA 3Q0TA 4WASA 3G0HA 3V1NA 2XUFA 4A7PA 4RTLA 4E22A 1FSZA 3OICA 3Q2OA 4CV2A 4EHFA 1S6YA 1S0UA 5EWMA 1QQ6A 3VPFA 1KO1A 1KDYA 4XUGB 2ZUWA 3MELA 5D51S 1T0JB 4D4HA 3MJCA 3BJRA 2JRCA 2NO9A 1G55A 2ZIXA 3HNOA 1J21A 4WZAB 4DJTA 1LI4A 3D54D 4IPTA 2AR0A 2XW6A 3IALA 3NHWA 3PUIA 4BNWA 5JNVA 2BFDA 2I6QA 2QY9A 3GOHA 2YV1A 3W5CA 4Q3LA 4PYLA 1ECBA 1G19A 4XB2A 4FMPA 3VC7A 5IF9A 1FRVA 3HADA 5LLSA 3IQDB 1KQFA 4RHCA 1THGA 3C7AA 1CIVA 3LQRA 3K20A 2VQSA 4N9WA 4X6LA 3K8YA 2WMDA 4P31A 1J0EA 4YRCA 3DMYA 3EGDB 4FLEA 3G23A 1SXGA 4DQKA 2PS1A 1ZEMA 1N5MA 1VHLA 4KAAA 1NUSA 1VKOA 2PBFA 2LZ0A 3SSOA 4BZPA 2AFRA 2A1UB 2I4RA 2CHGA 1W88B 1PBNA 4Q4CA 1CUEA 4D57A 1ZNQO 4NZ9A 5LA6A 1ZUIA 2VNKA 2ONJA 4N7MA 2OBNA 4GMDA 4XCVA 3ESZA 1L7NA 5DHTA 3CO5A 3LC7O 4UU7A 3U48A 3GUCA 1PGNA 4GEKA 1ESNA 2QSZA 3N87A 1PBTA 2PUHA 1FDVA 4PFKA 2SBTA 2COUA 1NJ6A 3L0SA 4G0MA 4IDQA 2UVDA 4UOQA 3DZHA 1AKUA 4URWR 3WAJA 2AOUA 3FYUB 1QO7A 4NG5A 4Y9DA 1Y4ZA 3CX4A 4MVJP 1NF8A 1RVDA 2QUBA 2H1WA 2Q9AA 3FGZA 3PFKA 1LUAA 3AHDA 1RZVA 3D4PA 4HNQA 5J1TB 1W52X 4BO7A 4BQIA 2BFNA 2X14A 1KP9A 4Q1CA 3OLYA 3ZD8A 1O77A 3AHFA 1F0KA 5JCXA 1K7EB 1OI2A 3K53A 3TNJA 3OFJA 4CVNA 1K2WA 3H4TA 4PBSA 5BN3A 5IU6A 1YJCA 1RM0A 3IUYA 4LXHA 3A26A 1RPJA 2ECKA 1EX9A 3HZHA 5EFOA 3LCMA 4F9EA 2HDHA 2C5BA 1UMBA 4L7QA 5E3HA 5EGNA 4BPRA 1OXMA 1KA9H 1TIBA 1GKYA 2VK1A 3OZRA 2Z6VA 2R86A 3MRXA 1PL7A 4YLYA 4MVJG 2HJ9A 2RCYA 4RADA 2NU9B 4BNVA 1TF5A 1X1DA 1ZHFA 4ZXPA 4XM0A 5T4EA 1XELA 1WY7A 1ZC3A 3CRRA 3RFUA 5LD2B 2YWDA 4MV1A 1IQRA 4NAUA 4IGFA 4AF7A 2NSYA 2P40A 1KMMA 1CUYA 3C3DA 4AZ0B 4WFQA 1Z6GA 3F90A 3O7WA 1PJ4A 3QXSA 4FR5A 4LY6A 1PN3A 2Z0MA 1P73A 2JVJA 3NNDA 4ML3A 2GFHA 4Q19A 3VR5A 4TPKA 3BH0A 4WBNF 3DV9A 1T9ZA 2D5LA 3H9JA 4MV8A 4NJOA 4AUKA 3D6AA 2ZLBA 4AJ9A 3O2QB 3TYXA 2V5UA 2XJ9A 2LRHA 3WMFA 1HE8B 3SN6A 3T7SA 4EYEA 2X3FA 3KBBA 3UCXA 3OPYA 4RK1A 1ZMBA 5ICFA 1XTSA 1US8A 4D26A 3FWPA 5DCUA 5ALVA 1PR2A 1A4IA 3KQSA 3NB0A 5EP1A 1FP6A 3MJEA 3ZV4A 3N5CA 2XUJA 1DUVG 3PFIA 4L2IA 4V1CI 1RZRD 1QH0A 1UH5A 2OZLB 1DRJA 1O2DA 3MBOA 2O8BB 1QAMA 1GDHA 3ZC3A 2B5OA 3RSQA 3C4VA 4LOAA 1PI3A 4CIWA 1MMFB 4QLOA 1KAQA 3SEZA 2C2KA 1FFDA 1PQ4A 2ECOA 3MT8A 3O92A 2I71A 3E4CA 4I4TB 1X7YA 2CMDA 5EQDA 3VBCA 2XQJA 2I5PO 4NZMA 2RHRA 2XXAA 4KFRA 4R6WA 3COSA 2ACEA 4MPDA 1XVAA 1F9AA 4BQRA 2PX0A 5IN4A 2QNBA 4A2CA 4EJSA 2WB2A 2Q4BA 5J5AA 3PXAA 1CUBA 3QP9A 3KKPA 1AUVA 2Z08A 4C2TA 2RGYA 2BE7A 1ZD1A 2FZVA 2WPDA 4G0ZA 5FX2A 1MAUA 3QVWA 3EVNA 1II9A 2BUCA 3FE2A 1Z0UA 3GZTB 4EYGA 1ML4A 3KCNA 3DT9A 2F6RA 1IZZA 1KC1A 2RHCA 3UOGA 3VH1A 4BNFA 4D9IA 4UTPA 2VBGA 3R8XA 4FXPA 4E33A 3GJ8A 1W1IA 5BQPA 2WUFA 1NBOA 3D7KA 2AFVA 2FFQA 5A5GA 3D3EA 4RE6A 1WPXA 2JFOA 2XD9A 4YXWA 3U9SA 3ZBUA 4C6SA 1IG3A 4US1R 4DCMA 1GJRA 1XJ0A 3ZIAD 1I7NA 1SELA 4ND5A 1DEHA 2IUFA 1FDTA 3KJGA 3H4MA 3MWGA 4LMRA 3EQ9A 1DINA 1CEEA 2FSVC 3AH8A 2X1LA 3MJFA 2WD8A 2P9JA 3C4JA 2IYLD 3KSZO 4O2RA 4O29A 4UBKA 5E0OA 3C5VA 4UVHA 1OH6A 4CMAA 4S04A 4WGGA 1QIKA 2VAPA 5EWJB 2WF6A 5L4NA 3H6GA 4TSRA 5BVHA 2Q50A 3IT3A 1WVGA 5EJAA 3WIUA 2AN4A 4UUQA 5B1DA 2IRWA 4A3SA 1ORWA 3CUKA 1JMYA 1SXHA 2PQ2A 4FWTA 2PK3A 5K0SA 1Y5LA 3RC8A 3D6JA 4DNPA 3IP6A 1P9OA 2QRLA 5ALLA 4CKCB 3SR4A 1ISIA 3B51X 5HS6A 1M2VB 1N3IA 2WWFA 2XGGA 2E6UX 3FSGA 4MJLA 1IEVA 2CXOA 3VM6A 3JZAA 2MDTA 2BJWA 3NP9A 3OESA 4BGUA 1K7YA 5HF5A 4UTOA 2PVPA 2Z8XA 4MICA 4WOJA 2DTDA 3FBWA 3JX9A 2ZIAA 1ZITA 4M0EA 5FWXA 3HG7A 1XL1A 3D6TB 3KVVA 3X0DA 3MWDB 2VHCA 4Q12A 5DTJA 4US0R 3FLMA 1HDXA 2IYEA 5IK2A 2SKEA 1HL3A 3N2YA 2ZZNA 1K86A 1IAQA 3IRUA 4DB4A 1O89A 2I3ZA 2CW5A 4MQFA 1M54A 3CFYA 3PDWA 3EWAA 1CUJA 4WUVA 5EXSA 4AULA 4BJ3A 3K94A 2GCOB 4JOBA 1P2BA 2IW1A 3IULA 5K01A 3MYRA 3PUHA 1NV8A 5FWNA 2WA2A 2OVBA 1E7QA 3ODGA 1LTKA 1W5BA 3N7TA 3NBUA 4OI0A 3ITNA 1R8QA 4FQ8A 1BJKA 1XOIA 2J5XA 2PUVA 3A4VA 4JI0B 3GK3A 2R1VA 4WH0A 1MA0A 1VIAA 4U9UA 4QVGA 2O19A 3O4IA 2V9PA 2OO5A 6ABPA 1CRZA 2P2CA 1R0CA 2JK1A 1H2ZA 2VRWA 3G2PA 3I9V6 3O8BA 3PWTA 3VYVA 3WC4A 4HNRA 3WYFA 5AM3A 5ALZA 4R1QA 3FWHA 1BQ3A 3UJHA 3OKFA 5CD9A 3L04A 2A30A 2QN9A 4EF6A 1QO9A 2PZ8A 2AG6A 2OFWA 4LBYA 5FQOA 1HA3A 1M8PA 1NBME 2MYTA 1G8HA 4DA6A 3AM4A 4JYZA 2O8CB 2DR0A 4MKIA 3C7TA 3E22A 4JNKA 4QX6A 3TFOA 2IS4A 1QV9A 2OHJA 2PWPA 1K3FA 2FWNA 5BQ5A 3SKXA 2Q1TA 1U81A 5KINB 3TPFA 3B9PA 1M8JA 3A4LA 3GA0A 4MW6A 3RIYA 3USCS 4YMVA 3KAPA 3UJCA 3IB3A 4NYJR 1LDYA 2X8BA 4HYQA 3ZGNA 1N2CA 1SUEA 3Q7RA 4MNTA 2WTMA 2Z3VA 1OGYA 5GPBA 3KQMA 4RK5A 3VXKA 2FLVA 2A9QA 3O9VA 5JJIA 1C3LA 1P4RA 2DG2A 1L5WA 3CX3A 3HV0A 4G5FA 3PCTA 3HU2A 3Q3EA 3HZRA 1R8JA 4G26A 4N3NA 1NRWA 2QUHA 4QYSA 4XJTA 1J9EA 1KU0A 4NPHA 3GA5A 3I01M 1ZOIA 2FEMA 2JFBA 1KYZA 1Z4QA 3N2GB 3HDYA 5MN6A 3BMCB 5EKUA 4MI9A 2J4DA 2R5FA 2P35A 3EY9A 4M9UA 4XWGA 1SC1A 3V5NA 1UMDA 2ZE6A 2QM3A 4HZGA 4D0NA 3OTIA 1QVVA 4DXDA 4KEAA 1T4CB 1VGVA 5AFSA 4P6VF 2JRLA 5AK0A 2BRUA 1PP4A 2C0CA 2WYIA 4ZU3A 3L0CA 3U5TA 4UM9D 2OV6A 1VKNA 2O2EA 4U3JA 4XJXA 5DXJA 3OPXA 4JBGA 3IPLA 2PUWA 2VDWB 1AK1A 1S2GA 2GILA 2H4WA 5ERXA 2VSYA 3AR6A 4RTNA 4WOCA 3BT7A 3MB5A 2H2FA 2PSFA 5JJCA 1MPXA 1QTNA 3MLBA 4IR7A 1AM4D 1WZIA 2GO7A 3DHYA 1WNTA 3F6RA 1F2DA 3INYA 3Q9NA 2ENUA 1QP0A 4GI5A 3W6PA 2NZ8A 4DCSA 1J2RA 3U4IA 3GRCA 1UM9A 4KUGA 4KMMA 5CD1A 4S2UA 1ESCA 1XVUA 1DHRA 1I1QB 1T1IA 2IXDA 5D87A 1T8TA 5LC1A 3S55A 4AUNA 5EJ8A 3LUJA 2G25A 4G84A 4JROA 4AZVA 3LNTA 2YJ3A 2NAFA 2RK4A 3H4VA 3QLJA 1IEWA 3OUZA 3JQGB 4QFCA 4EP1A 1DCTA 2GWRA 2O2JA 4JELA 3UWKA 5JD4A 2B6NA 4TM8A 4DLVA 3EZGA 4QGGA 3T34A 1ZIYA 4LX0A 1DVRA 1VKHA 4GWGA 4JGIA 2D74A 4AN1A 4YROA 1MIOB 1O8BA 1ZINA 2BFCA 1V2GA 3A2LA 3A1DA 2G9VA 5ECWA 5DHUA 3E9QA 2IUYA 5CT5A 1ECPA 2P8SA 2XHEA 3IHTA 3NT2A 2XCQA 4G0VA 3GRKA 1OZ0A 3IQZA 4C3ZA 1MFZA 1U2DC 3SFVA 1QRSA 1H8ED 4AJHA 4WESA 4KMRA 2GZMA 3DTVD 3NP7A 1NJ1A 2WM2A 4EVRA 1RTKA 4I5DA 4KIFA 1OH8A 5C1DA 3V8VA 4XI9A 3CEJA 5LP6C 2IDMA 1SC4A 5TNXA 4X7MA 5KOHB 4EFKA 1AS2A 4HB0A 3D6VA 3DAYA 5BR1A 4OSEA 3UT5B 1HH4A 1BVHA 3KO8A 1WVMA 3ECCA 2A84A 1ZN8A 3GPIA 1ZICA 2CFSA 1PX0A 1PR6A 4PV7A 4ZVMA 4ZK2A 2PLNA 5C7LO 4YAUA 2YJ5A 5HJ7A 3NHFA 2WJZB 2IIPA 3EMBA 3B3QA 2A78A 5KTNA 1JH9A 4M9SA 5E38A 3BE4A 3SX4A 5ERGB 4IJMA 1VTKA 4JB0A 2JD1A 3MTGA 4GL4A 1S7GA 2Y68A 5TJ9A 5JNLA 1U6IA 2HA2A 4YXWD 1T9GR 1FU8A 1ILEA 1N8KA 4UJ3A 1O96B 3S4YA 5DH9A 1GL3A 2XCIA 3GAMA 4INPA 4Q1AA 4GVLA 5AUQA 1J7KA 1HEYA 3SBOA 4N5IX 1IE3A 2FOXA 3BSWA 3FOAA 2C57A 4Y67A 4FFPA 5ENZA 2BTQB 2LBPA 4YAWA 1AKRA 3KZVA 1WOYA 3HBNA 1Q77A 3KLNA 1VZ3A 1RXCA 2IKQA 3I76A 2FMUA 2J9ZB 1ZGJA 2YJGA 4FUTA 4DQUA 5L4SA 3KETA 2FG6C 3NONA 5CM8B 1FBTA 4FYJA 4BJHB 3KQUA 2DPMA 2J3EA 4RF4A 4ZQGA 5F2OA 3B1KA 3HUFA 4W5QA 3AVOA 3MXOA 4I9FA 3G2QA 4ER3A 1GEGA 2YJ4A 1GQFA 4K9LA 4URZR 2PJUA 4QXRA 3TOXA 1TYEB 4QNNA 2K7ZA 3WRYC 5F5XA 4BJ1A 4DWWA 2C8LA 4MQFB 1WZUA 5LQNA 3AK4A 1G8MA 2OHVA 3BXZA 3C15C 1KEWA 1LRKA 1TZJA 1SUBA 1UZUA 3R9XA 4KFSA 3B60A 1YR8A 3HUTA 4QBKA 1X19A 1IK6A 2YZ2A 4R69A 4BEJA 3FOZA 3IJEB 4CR6A 1M1YB 5BY2A 2IH5A 2BLLA 1TQ2A 2B0JA 2GHQA 1RWKA 2ONYA 3I92A 4FS3A 4O4HF 2FPPA 2BI7A 4O63O 1ORDA 2A92A 2P9GA 3V4LA 2WJ3A 4S24A 1II0A 1GZHB 1E7WA 1Z0JA 3UWPA 3ITDA 1JHUA 2OSBA 3N1UA 4H4CA 4F8EA 1D2MA 4ARZB 5KX5A 1FNBA 1J9GA 1DRUA 3PHIA 3KP1A 5K0LA 5B2EA 1LC0A 1PFGA 1ODSA 2YYZA 2UVPA 3ROTA 3WLAA 4BVKA 1D1TA 4NKRA 1CS4C 3Q5GA 3ANLA 3COYA 5GJBA 2XBMA 1XA0A 3V7NA 2COKA 5LDDC 2ANBA 3DMTA 1E5LA 2G5GX 2VJDA 1T8UA 5DV9A 3STYA 4DEXA 1JDVA 1UKYA 1EWRA 2SNIE 3V8EA 1M1YE 5ALOA 1GCGA 1GGNA 1G8PA 4CGYA 5J4VA 2GEKA 3OLCX 4WACA 3DLCA 2NSHA 3EZNA 3B6IA 5TVGA 5U4QA 2AK3A 3L0PA 5BNIA 4FEGA 2D7DA 2QRGA 2DR3A 5K0CA 4F93B 2VT7A 1G9XA 3KPJA 1PNQA 1Q50A 5EMJA 1NG9A 1KZYC 1X9GA 1C3JA 2QJWA 1H8HD 5TARA 5HEKA 5M5BA 1LRJA 3ZOKA 2WRZA 3BB3A 3QPDA 2BFEA 4CIVA 1T4BA 2YY7A 3JWEA 2FMKA 1R88A 3DLTA 2C0QA 2EWVA 5TQJA 3F6CA 4KFCA 2GZ2A 1XHEA 1AXEA 2M6KA 3FLBA 1GA1A 3MCVA 1CYEA 4B31A 3UC5A 4C3VA 5D3ZA 4DJJA 3U3ZA 4TT3A 5FHQA 3ACDA 4IIBA 3TBKA 1KR5A 3WK9A 3O2NA 4D42A 1HT3A 3R0IA 3HCWA 1XT6A 2VNSA 2V3WA 1S5PA 1YBHA 2VDLB 3H9UA 3P9NA 3IBSA 4ZRDA 2VO1A 5E0KB 3F5QA 3WLMA 4YCLA 2ZRCA 1QZUA 2IYQA 4P83A 4E0BA 4PYMA 4BLTA 2CDAA 4R1UA 1FNDA 1E6KA 1E9VA 3KR0A 4GG1A 3N6XA 1TZ2A 3BMOA 3L3BA 3CVVA 4UU8A 4NR0A 2XLBA 1UPUA 1VE6A 2F67A 4ZI7F 1UQTA 1XAGA 4NYMR 5J4YA 5LMCA 3DJYA 3PUVA 1CP3A 1CF9A 3H1AA 1W73A 4WCFB 2GK3A 5BW6B 1YSCA 2VYVD 1C30B 5FI5A 3KAQA 3N07A 3VR3D 1W2HA 4CFYA 3QPBA 3A0UA 3W5IA 5G0UA 1Y1KE 4F7DA 4IDPA 4HMPA 5DGXA 3KOYA 1SVOA