1QBKC

Structure of the karyopherin beta2-ran gppnhp nuclear transport complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
190
structure length
190
Chain Sequence
b'QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KARYOPHERIN BETA2
publication title Structure of the nuclear transport complex karyopherin-beta2-Ran x GppNHp.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear transport protein complex
total genus 39
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 1999-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1qbkC00
1G3RA 4X8OA 1S0UA 3GPLA 1CJKC 1KK3A 1KO8A 3LWNA 3H4MA 1CLUA 3T5GA 1IHUA 3NH9A 5FL7A 2GZHA 1E0SA 3DHWC 4KFSA 1ELOA 4IRUB 4H1UA 5JS8A 2O8DB 2A5DA 3QQ5A 3U44A 1IQPA 1NVUQ 1YE8A 2GDJA 3DOFA 3K0CC 4V0ME 3CX8A 4D4LA 5M04A 1XPOA 1IXZA 2ZRBA 4DLUA 1NVVQ 1U90A 3IO3A 3PFIA 3ZZ0A 2W6JA 5FBWB 2YZ2A 4LBVA 3HYRA 3BFVA 5G3ZA 2X19A 1RZ3A 2BC9A 3SYNA 2WV9A 2FX3A 5TY0A 2H8KA 5DYIA 1RW4A 2EYQA 1L8QA 3DEFA 5JFGA 2NO9A 1CJTC 4IDHA 3AP1A 1NRJB 1AZSC 2CHVA 2C96A 2EFHB 3TLXA 4OHWA 3HR7A 4ZDJA 4B73A 3U3KA 3K1JA 1F5NA 3I5XA 3B1YA 2IEYA 4S35A 2Q9AA 2FJUA 4DWJA 1UEJA 2F43B 2YV5A 4O0MA 2QP3A 5C4MA 3C41J 1JAHA 4P4SA 1GL7A 1T5LA 4BFZA 1Z28A 3AVXA 3UPUA 4ZDWA 2ZRJA 3EWAA 4EPRA 1NJGA 1KO5A 2JIZD 5IDVA 2FPMA 3K0AB 5GJWC 4QJ4A 1SQ5A 2ZM5A 1QDEA 3UATA 5AUPB 1X1RA 2MMGA 1XB2A 221PA 1KHTA 1W44A 1JI0A 4NCJA 2VRWA 1KMHA 4R7ZA 5KDLA 2W6ID 4FI3C 5FTMA 2VIIA 1JQJC 4IJMA 3JZMA 5BW8A 4MYCA 1LF5A 1D6JA 3CUEF 4A15A 2WIBA 1XXHE 3O8RA 2PBRA 2NIPA 4LYFA 1GWNA 3R20A 3W6PA 4R98A 2IS1A 3Q72A 4NZYA 1R8SA 2REOA 1Q44A 2QSZA 1W5SA 1F60A 5CK5A 4NE2A 3WBJA 2YWGA 3GD7A 3WNCA 1SKYB 4PSAA 4HAWA 1NLFA 4EFMA 4JBYA 4JLDA 2PCJA 1P4SA 1KDRA 2ZI9A 1OXUA 1E2IA 4JSTA 2CCJA 2ZRDA 5K8IA 3HR8A 1RIFA 4AC9A 2JEOA 4LC1A 4B6EA 1Q57A 2ZRGA 4RD4A 4HAUA 1F2UB 1N6HA 1OPXA 2J7PD 3AGQA 4OK6A 5FR2A 3RS5A 3UG7A 2NO7A 4QKQA 5AUQA 2AWNA 1BS1A 1TQ6A 1VG1A 1W4AA 2I4IA 3NBXX 5B2ZA 4RY2A 2BOVA 4ZO4A 4AG5A 5FPKA 1OH7A 2ZANA 1KZGB 721PA 3KQUA 2AFHE 2QPAA 5DI3A 3HWSA 3M0EA 4DLTA 2BMDA 4PSKA 2EFCB 3MUFA 3ZYCA 4B3GA 4O2RA 4Q21A 2LCFA 2WWHA 1KI4A 1R5NA 5FBVB 2IYXA 1TU3A 5L3RA 1UBGA 5LB4A 4B76A 2ZQ5A 4TMWA 4TYWA 1XEXA 2HDNB 2PEYA 2QMEA 1YKSA 2R6GA 1N6OA 1OH5A 2O8BA 3CPEA 2OILA 3BAFA 1WXQA 4FWIB 4QXAA 3NXSA 1CS4C 2CJWB 2YWHA 3D8BA 4NHOA 3GMTA 3SQWA 1P62B 2QA5A 4FCVA 1DAEA 1OFTA 2XSZA 1E9FA 1KJZA 5J4VA 1LFDB 2F3TA 2WOJA 3KXLA 4AG6A 1BMFD 2Q21A 1EFHA 3SHFA 2NO1A 2VO1A 2GWHA 1DG3A 2H16A 4URXR 2QP4A 4ITRC 2J3EA 4ZKEA 4D80A 5L3QB 1G3MA 5F2EA 4KBGA 3P1JA 1K8RA 2PX0A 4MGKR 4CEJB 1ZNWA 2ANBA 2VTKA 2CK3D 2O8DA 1KK1A 2ZIAA 2UZIR 5JECA 5EE5B 1UF9A 1XJCA 1U0HC 3AB3A 2K5UA 4DEYA 2OM2A 1J70A 1UKZA 5P21A 3IO5A 4LX0A 1GDDA 2HCJB 2BBOA 3I3SR 2V1UA 3R8CA 4KFUA 1G8FA 3LLMA 2I3BA 2CEAA 2JCSA 4TWZA 1CP2A 4DLWA 4S2EA 2ZRHA 5JZVA 3W6OA 2IYTA 1Z0IA 2BEJA 4YQFA 1N6RA 4K8OA 1LB1B 3ZIAD 3CNOA 4B71A 5G53C 4BRWA 1AK2A 4L5BA 3NH6A 4AY2A 4TN1A 5EUMA 1JALA 2JASA 2Q9CA 4Q18A 4FD2A 1Q1ZA 1PLJA 1NBMD 4OJKA 1W0JA 1KI7A 4IDOA 4II7A 3ZZTA 4ERNA 1UEIA 3D6TB 3QEJA 1FTNA 3QXHA 4FN5A 2ZEJA 4HDCA 1ESNA 2D74A 1A2BA 1DADA 3K0AA 1XPUA 3C8UA 1U8ZA 4EFLA 2FGKA 2IYWA 5DLQC 4XVUA 4LBYA 3QXSA 2IXFA 4TLAA 1TX4B 4LJ9A 2OFXA 5GJCA 1ZJ6A 4YDHB 1S4QA 4HAVA 1P2UA 1HV8A 2NGRA 3AKEA 3WMEA 4TTRA 3WHLA 1JXOA 4V02A 5HZHA 4R2IA 1SVKA 1YVDA 2GILA 3FOZA 1LW7A 1QRAA 2GTPA 2XXAB 4DC9A 4ON9A 4RVCA 4U00A 3VX4A 1G4AE 1KNXA 4NYIQ 1N6LA 3K53A 3LBNA 2Q0HA 1E2MA 3F5FA 1G7SA 1DS6A 3TAHA 1F2UA 2ZS7A 4FMCB 3B6EA 4A2WA 4X8LA 3FDIA 2ZAOA 1OJLA 3MAAC 2RGBA 3U6KA 2QL6A 4PO8A 1XEWX 1OIVA 3RS7A 1QHYA 4AYWA 4ZIRA 2VSOA 1KJWA 3FGNA 4LHVA 1LTQA 5GJVC 3CKLA 1BO6A 1Z06A 1N0VC 4EUNA 1XPRA 5CYOA 5BN3A 4O25A 3TNFA 4TL7A 4GNKA 1TEVA 3DOEA 1ETUA 2JJ2D 2IS2A 4OQNA 1O87A 4W7SA 1D2NA 2CJWA 3RHFA 3SR0A 4EQ6A 2X8AA 2Y8EA 3RANA 3WP1B 1NKTA 3WY9A 2JIZA 3T1TA 1EWQA 1VIYA 4WAUA 3W8NA 2B6HA 5L3SB 3GJ0A 1MO3A 1R5OA 2NOAA 4G0NA 3SBDA 4WZAE 4MRVA 3VQTA 4OHVA 1XEWY 2W6IA 4PHHA 5L3QA 4FIDA 3ZLJA 1VPLA 4RKFA 3IDQA 4P4TA 3AF1A 1NNEA 1QHHB 4NCHA 4LC0A 4CEJA 3REFA 2W58A 4TLEA 2A5YB 4US2R 3CX7A 2LKCA 2FV8A 2IYSA 1U8YA 2XX3A 1ZW6A 2REXB 2XEXA 3AF0A 4CT5A 1IOZA 4ABYA 3AGPA 4AIIA 1VG9B 3U7FB 5FTLA 2CLDX 2QI9C 4PPFA 1FW6A 1XD8A 2N42A 2A9KA 2D7CA 3K9GA 3LRPA 3VNVA 1IN5A 3THXB 1N6PA 2RGDA 2IHBA 4DKXA 3PIRA 1Z6TA 3RVBA 1P9WA 2ZU0C 4ZCLA 4TL8A 4WZBE 1M74A 2ATVA 5HTKA 5AUOB 3K70C 1VHLA 1WDTA 2CNWD 2J7PA 1EG7A 2ZJBA 3OE7D 4A0RA 4DCVA 2YWFA 4IOMA 1KDTA 1KI8A 1U9IA 4TYQA 4MGIR 3TBKA 4RZ2A 3IEVA 3T34A 1QBKC 1T3HA 3C5CA 3ICQB 2QP9X 4NYMR 2NO0A 3QI2A 3C14C 1H8HD 4R2HA 3GJXC 4Q4JB 1E1QD 1AKEA 1JJ7A 1RYFA 1N5JA 2C03A 2VHJA 1ZNYA 1TPZA 3EG5A 1ZUHA 1X8LA 3RYTC 3FHCB 1Z07A 4KBFA 2RAPA 1GRQA 4GP7A 2FDCA 4M9ZA 1W0KD 1JB1A 4HSEA 3L82B 2OHFA 2D2EA 3BRWD 3Q7QA 4Z51A 2G1KA 2XTZA 3CBQA 1M7GA 3PITA 3PEYA 1UAAA 2CL0X 1ZIOA 3B1VA 4JBXA 4NU0A 5IT5A 1NLZA 5GJBA 2WWXA 1MO6A 2ZJ2A 1KZ7B 1KKMA 1U0JA 4RJLA 1S3SA 3WYGA 3NWJA 4TTPA 3B60A 4YMWA 1BMFA 1P2SA 3KB2A 3GEIA 2D62A 3UMSA 1W5TA 2GVDC 1W4RA 2AHOA 4R9UC 4UNRA 1GP2A 3LLUA 2XXAA 1GSIA 3WRYC 1P5ZB 1M1YE 2Q3FA 3PR1A 4HUTA 1E2JA 2IEZA 4DUGD 2X1VA 4HB3A 2FEMA 4YXWD 2GEUA 2WSMA 2CK3A 3RNLA 4MKGA 1E9RA 3RSOA 3BC1A 2MMCA 4UJ5A 3VR4A 2HT1A 3MGCA 1T5IA 2DFNA 1I4DD 1Q1EA 1G5TA 4L9SA 4IVPA 4LYAA 2OG2A 3X1ZA 2QN6A 4B48A 4ZKDA 2WJVA 3EASA 3P20A 1DAKA 3A1UA 3RS3A 3THYB 1YZUA 4TL6A 4IKEA 1FMJA 2B8WA 3MLEA 4PAOA 2C98A 5IK2D 1SXJC 2IYUA 5B57C 3SBEA 1U2RA 3KJIA 1G19A 1II8B 4LYHA 1QF9A 1VCNA 2P2LA 2V54A 3ZIAA 4BLQA 1S96A 3RWMB 2XGJA 4ZDKA 2FH5B 1FQKA 3N2IA 5FH9A 3ZS8A 5TARA 5JI3E 4BFWA 2P67A 2WJJA 1UJ2A 1XXHB 3SFZA 1T0HB 1NY5A 3U3OA 2OBMA 4KJZA 3WHKA 3MWYW 3TUZC 4CGZA 2C5LA 2J46A 3WMFA 2YKGA 2HF8A 2P6RA 1MH1A 4GDFA 3AV0B 3A6PC 2F9LA 5BYJA 4OYHA 2AFIE 2OUKA 4JLAA 3UMRA 1OH8A 1G8PA 3RRNA 2IYLD 3E5HA 5EZ5A 5KPJA 2IYYA 3EC2A 1QHHA 4DB4A 1N25A 5AJZA 1NMXA 1VIAA 1IN7A 2ZR0A 1Y3AA 1ZU5A 1ZVQA 1KSGA 5JJKA 3ZVLA 1KAGA 3VR5A 3SZRA 3BH7A 4QGHA 3CF0A 4YONB 5JS7A 2FPLA 3KJEA 4Q4HB 2J0QA 3L2OB 3TSZA 4KCGA 4Q1FA 3PEUA 2GAAA 3LXRA 2EU8A 2W2XA 5CLQA 3VTKA 1E98A 1W4CA 4OQMA 1U0LA 2XZPA 3THXA 1Z0JA 2DR3A 5J4LA 2ONJA 2PH1A 2PT7A 2WJIA 4MUAA 1US8B 3Q3JB 1N3BA 1W4BA 1XD2B 4M1SA 4JL8A 3LX8A 5FBLB 3KZ1E 2PJRA 2GCNA 4DDVA 2FSIA 1S2MA 1ZM3A 1YR6A 2W0MA 4AKIA 1V43A 1PV4A 2ZR7A 3U7HB 1AM4D 3LQQA 4B3BA 3AEZA 4KO8A 4Q4JA 4JJKA 3F8TA 4QGGA 5H70A 2A5FA 3T61A 3KX2A 2OFOA 3Q7PA 4JZKA 1A5TA 3K9NA 5AK0A 2QRZA 2JDID 1UKYA 2P6UA 2FE4A 4F38A 5FPYA 3EC1A 3B13B 4LHZA 1E1RD 1Q3TA 2VP2A 2DYKA 2AL7A 1E96A 1KSHA 2JJ2A 3KXIA 2J1LA 3PV0A 4P32A 4NH0A 5J4HA 1RVDA 1N6KA 2OBLA 5J5CA 3RS2A 2IXEA 3I8SA 4V03A 1RFLA 1Q20A 3KKOA 3SYLA 2D7DA 3EXAA 1ZNXA 3B1ZA 4XTCS 1MRSA 1TL7C 3NHAA 1UBEA 1NN5A 4KLZA 4A6XA 3PUYA 4LSGA 2ORWA 3HU2A 1Z22A 4PR0A 3A1VA 2ZJ8A 4IXNA 1U8AA 2ZSAA 2XSZD 3VX3A 2WWFA 5EXSA 2PMDA 3BH0A 3PQCA 1GZSA 4PPGA 1L4YA 2Z43A 2JGNA 1P6XA 4RCYA 4MKIA 2FNAA 1TQ4A 3ND8A 2QENA 5HE8A 1E2GA 2ZRAA 2G88A 2WIAA 2F7SA 2BIFA 1U9IC 5B64A 3X2SA 1ONBA 2GXAA 1J99A 1G6OA 2J9RA 3KL4A 3THYA 4TT3D 1E2HA 3RDPA 1N5KA 1ZRHA 4F91B 3EPJA 4M9QA 5KO2A 2DWOA 3L8YA 3NC0C 2ODWA 4QGAA 4Q47A 1G3IA 3OE7A 2ZI6A 4F92B 5IRCD 1XMIA 1II8A 5KOYA 2P5SA 3I8XA 2ZSEA 3PVSA 1K5DA 1ZM9A 4HZUB 3U60B 1H8HA 1P3JA 2WPDD 2ZVQX 3BJIC 1QHNA 2F1HA 1E1QA 4C0AC 4ZI2A 4ZCIA 5FR1A 5CJPA 1OHHD 1XCPA 1XBTA 1TF7A 3OIUA 2Z6VA 4JYCA 4LJ4A 4M1WA 1RRGA 4Q4AB 5DI3B 1W0JD 1W0KA 4UXIA 1AA9A 1XD9A 3K09A 1M6NA 3KKNA 5E7IA 1JBKA 2VEDA 2JLWA 4ASUA 1XCGB 3Q5DA 2WJHA 2IS6A 2AKAB 2RGNA 2OLKA 2IWHA 3A37A 2OBNA 4B75A 1NI3A 4EJSC 3C7KA 1W48A 2D3WA 2QAGB 4NTZA 2O8BB 1DPFA 2ZI7A 4D0NA 1A7JA 1E99A 1WF3A 1ZU4A 4XOIA 1JECA 1Z5ZA 1Z8FA 3A4MA 4Q4HA 3FTQA 2O52A 1D5CA 3D7MA 4ARZA 4ZPXA 5BYKA 2GJSA 4B3XA 2H5EA 2W83A 3IPXA 1I2DA 2HF9A 1EGAA 2ZTSA 3CR7A 1NIJA 1A1VA 1ZAKA 4MGYR 4FCWA 1HTWA 1KY2A 4DUGA 3H2YA 2BBWA 2CCKA 3ECCA 4YXWA 1JPJA 3I32A 4XH9B 1US8A 3ZDQA 5FPTA 3U5ZB 1XD2A 1AJEA 2FFQA 3TQFA 2HUPA 3D31A 4M9SA 4A6PA 2C99A 1PLLA 1D9XA 2XZOA 1P2TA 4FXPA 5JWHA 4BE7B 4B33A 2XZLA 1QG4A 2J7KA 5EXPA 1OV4A 4LY6A 5AJXA 2SHKA 1P75A 4JBWA 4YLGA 1ZMXA 1S3GA 2D2FA 3AP2A 5FTNA 4G5GA 4QNMA 1X8JA 5IK2A 2PCLA 3WXMA 3Q9LA 4DIDA 4G01B 4EPWA 1XTSA 5CIWA 3FE2A 2FFBA 1JXMA 2ORIA 5AJWA 1NIPA 2WAXA 1QG2A 4AYXA 1G6HA 3KTAB 2J0SA 4I4LA 1KO4A 3A1TA 4DRZA 5A5GA 4LHXA 4URUR 3AKCA 5G41A 3ADDA 2V1XA 1NSFA 5FFMA 2CL6X 2HV8A 5J4YA 2WSSA 1WQ1R 2XOKA 1FX0B 1NLYA 2QY9A 4AURA 2ZYUX 5CK4A 2YOFA 4Q7JB 3DMDA 3MWJA 4N1AA 4GL2A 1E2LA 3LAWA 3GQBA 4PXAA 3QBTA 1OSNA 1VCMA 2KE5A 1G64A 1E9BA 2GEDA 3HP1A 4UXHA 1EWRA 421PA 5DI9A 4YC7A 5EE1A 4MA4A 1GUAA 4C3ZA 3F0TA 2OZEA 1AZTA 1EFUA 4QL3A 3R8FA 5JSZB 2BJVA 3B5JA 5KTYA 1BKDR 2CVHA 4M21A 5JRZA 4A8JC 4B2LA 4O2LA 4FMBB 1MO5A 3VKGA 2NMVA 3ZQJA 4OK3A 2GHIA 3NTUA 4JMPA 3WNBA 5BWMA 2F9MA 2FFAA 4QBHA 5B58C 3VNUA 5CDFA 1Z6XA 1Z6AA 2J59A 2XJ9A 3TH5A 2R6DA 1FL9A 2C9CA 4WZ6A 1G7RA 2AN9A 1W2HA 1DE0A 4B44A 1KOFA 2ZRPA 5FUVA 1Z6GA 2O0HA 2WWGA 1E2DA 1HT1E 3KJHA 1DEKA 1FFHA 4TQ9A 3NEYA 1KI9A 1HUQA 4TQAA 4BQSA 1XTQA 5E7JA 4ZDIA 4F4CA 3CO5A 4Q7LA 5CIQA 1ZD8A 3SYKA 4A2PA 2G3YA 4HZUA 2YOGA 5FOTA 2ZRFA 3ZZUA 2ZROA 1ZCBA 3BFXA 3IQXA 4IW3B 1JAIA 3BB1A 3EARA 4DLVA 3CNLA 1OXTA 2IYRA 2P6NA 4LDJA 2ZE5A 2JDIA 2FWRA 1G41A 1RRPA 2J5XA 4Q4AA 3B9QA 2EWWA 3OIYA 4ZIRB 1E1RA 3DDCA 3RWOA 4MKFA 3WBKA 3BB4A 5CLLA 1E4YA 1W7AA 1MR3F 2NG1A 4JLJA 4CDGA 4IVRA 1V5WA 3B78A 2ZYTX 4KFTA 2QAGA 1YZKA 4PO1A 5TB5A 1U98A 2R8RA 1NG1A 1W46A 4LI0A 3SFVA 2ZS9A 4I99A 4M1MA 3OIVA 4URWR 4M1YA 4DSTA 4EQ6B 2DB3A 1PVOA 4KSBA 3ZJYA 4PSVA 1KTVA 4DSNA 3IEUA 4JVNA 1T8TA 2BWJA 4Q5IA 5GADl 1RC8A 2BMFA 2CL7X 4HLUA 2KWIA 1X1SA 2BMEA 1NVVR 5DHAA 4P3YA 1DTSA 3C16C 3MD0A 5FOSA 1XZQA 3E2IA 2BKUA 3KJGA 5AWFC 5KNCA 1AS2A 4BFTA 5HKKD 2ERXA 4KI0A 3IILA 2UKDA 1M8PA 3UXMA 1G21E 2F6RA 2PLRA 1GNQA 2QU8A 2OXRA 4Q7KA 3L0IB 3PEVA 4TT3A 1FP6A 1KK0A 2GA8A 3HU3A 5L8VA 4PC3A 5AR1A 1Z6YA 2GF9A 4XWKA 3T1VA 1NJFA 2OFWA 4HLCA 3GEHA 2RGAA 3TUIC 3TVDA 3MJHA 5KSOA 1AIPA 2QNRA 3DZ8A 5FOXA 3TW8B 1YR8A 3KTAA 1E3MA 1Z2AA 2ZRIA 1LV7A 5AJYA 2IUUA 1DAMA 4IDPA 4W5HA 5EP2A 1FUKA 821PA 4L8GA 2V55B 1R10A 2IF0A 4BFYA 2WPDA 1XFAA 2JLSA 4E09A 5LD2B 3QOFA 4UNSA 1SHZA 1FX0A 1ANKA 3Q8XB 4Q7MB 1OHHA 2GVZC 3ZD7A 3EPHA 4BRUA 1WE2A 3FPAA 5CDFE 5EQTA 3U2QA 2J41A 3A36A 2BCJQ 4TZ0A 2YJTD 1N0UA 4IHQA 4HB0A 3K0EA 2B7BA 3DVLA 3RLFA 2XTNA 3BD9A 5JWRA 3ICEA 1TUIA 2YVUA 1R2QA 5JEEA 5JSZA 4LGMA 4B32A 1NVWQ 3VHXA 2VHQA 3H1TA 3OAAD 1HT2E 3EZ6A 4IOKA 5UKDA 1T8UA 2H17A 3FVQA 4TLBA 5AUNB 621PA 1DVRA 2W2TA 3LXXA 4QRHA 2IWRA 2QG6A 3QKTA 4YDSA 5LDDC 4Q02A 4KU4A 3TJZA 3QXXA 3K9HA 1A2KC 1DARA 4GZLA 3NVAA 5EXXA 2G0TA 4HLQB 1L2TA 1NN1A 1B23P 1NMZA 5SZHB 1T91A 5ANRB 5EJEA 1QHGA 2H92A 3MWLA 1U81A 1NN3A 2BM0A 4JLVA 3NDBB 1G8YA 1MOZA 1II0A 2ODBA 4HB4A 2BKEA 2AK3A 2A7QA 4BEJA 1Q0UA 1VHTA 2JJ1D 2Z83A 3LA6A 3QKSB 1T0JB 3M4YA 3W3ZB 1S9HA 2C95A 1OKKA 2ZJYA 2ZJAA 4OBEA 3MWKA 3RC3A 1CTQA 4B2PA 5FOUA 2AK2A 2WTUA 4WW0A 4MRNA 1IM2A 1R4AA 3QE0A 2FZ4A 3B82A 5TVKA 5H1YA 5BXQC 1DAIA 5DN6D 3AM1A 2B8TA 2BVNA 1H8ED 4GP6A 3GP8A 2A78A 4PPNA 2KSQA 3CF6R 4D4KA 4EIWA 1S9DA 1G17A 4GMDA 4M8NE 4LPKA 4PZYA 4XD7D 3U3RA 1IJFA 3FKSD 4DSUA 5F9HA 1OIXA 3DMNA 4V0LA 4PFSA 4LOAA 2WWIA 1LS6A 4C9BA 3K9LA 4KXFB 2AD5A 2RHMA 3LV8A 1WP9A 4QBIA 2VF8A 1YR7A 3KQKA 1D2EA 1PUIA 2WKPA 1XTKA 2P3SA 2PLFA 1IONA 4FW9A 4EFNA 4BFSA 3QKRA 2IA5A 3OEED 4HB2A 3ADBA 3OESA 2VLIA 5IF9A 2Z4SA 2E9SA 3EW9A 2QSYA 2DFKB 3BS4A 3I73A 3T15A 5JCPA 5CM9C 4DCTA 1P73A 2IHYA 2C77A 5JBQA 3VU9B 2ZRLA 5C18A 1JQLB 2XAUA 2ZR9A 3QBVA 1KMQA 2C9OA 3NKVA 4U7DA 4CF7A 4F4JA 4HEJA 2XTMA 1WB9A 4DB2A 2PL3A 3TIFA 2V6JA 2LKDA 2QROA 3LW7A 4RSGA 3RS0A 4UNPA 4B43A 3Q5EA 1TF2A 1Z47A 3RABA 1ZM2A 1U99A 1S8FA 3L0SA 4KAXA 3T35A 1W47A 1Q1BA 4KV9A 1R0YA 3GLHB 4NCNA 4NYJQ 1HURA 2BCGY 3ZVMA 4DDUA 4CYMA 2QE7A 1XMVA 4PX9A 1TTTA 1OB2A 3O8DA 1AQUA 5A4JA 4Q9IA 5LPNA 3THWA 3QG1A 2ASEA 4A82A 3SU8A 3W34A 3IKJA 2BDTA 2QAGC 4TYNA 1G3QA 1SXJE 3IHWA 3GCGA 3AKYA 4D25A 3OFND 1FNNA 1EFTA 2HJGA 4TSFD 4BZPA 1GKIA 3Q85A 2FSGA 2IUTA 4PHFA 3A1SA 1Z0KA 1VG0B 2QT0A 4HLUC 4JSYA 1GITA 3PEWA 5KUTA 4BASA 1EX6A 4CRWB 3EZ9A 2CE7A 1OXVA 2EYUA 3GLIB 3ETLA 2IC5A 3ADKA 4ASUD 4DLRA 3HJNA 3AUYA 2VH5R 4FCTA 1TF5A 3EZ2A 2AX4A 4KVAA 4NYIR 4UQOA 1CEEA 4OI0A 1KO1A 2P65A 4W5WA 2OLJA 1ZC4A 2QZ4A 4WXPA 2HXSA 2W0SA 5JCZA 6Q21A 3H84A 2A30A 2A5GA 3KQLA 3L0OA 1E32A 2VP6A 1KI3A 1VECA 2XNDD 1E4VA 3CF2A 3NEJA 5HKKA 1IY1A 1JR6A 5FPSA 1D8TA 1IBRA 3THOA 5JJIA 3PXGA 2GZAA 4M0LA 1Q12A 4D82A 1AQYA 2WHXA 4IVQA 8OHMA 1GRNA 1UDWA 2FF7A 3ZQ6A 3BORA 4LJ6A 3ONWA 4JT4A 1C9KA 3AQ4A 1DAHA 1UPTA 1SVMA 3QKSA 2OT3B 3GJ8A 2ZSBA 5F9FA 1N6IA 3TSOA 4A0HA 4DCNA 3FMIA 2JLQA 3RRYA 4QHSA 5CYPA 5TXGA 4JT2A 4QHYA 1GTVA 4Q9HA 1EFCA 3U4QA 1F2TB 3AVOA 4CZ2A 2GK7A 4HATA 5LBIA 1OF1A 1QHIA 4XIGS 5C46F 2JA1A 2VHCA 4RFVA 2PZEA 1G8HA 3FHOA 3H86A 3ZGXA 1DAFA 1OT3A 1Q3HA 3CPHA 5KHOC 2H57A 2GJAA 2WSSD 2XOKD 2J0VA 1II9A 1XCMA 4J0QA 1CULC 3OAAA 3WNDA 5EP1A 1XTIA 1QZXA 4UJ3A 1G7CA 4L16A 4IXMA 3I1FA 3QENA 3VR3A 1DG1G 2DCUA 4DCSA 3VU9A 4LUCA 2J87A 3K0CA 2X2EA 4OI1A 4DLZA 2EVWX 3CR8A 1NMYA 2FPKA 2GJ9A 4G5RA 3TK1A 4WOPA 4Q1DA 5KNBA 1VMAA 3GJ6A 1JEDA 2R65A 2R6FA 2VSFA 3LH5A 4MDEA 1XEFA 2IXGA 4E07A 4DT1A 4LWZA 3NBZC 4HUQB 4PQFA 3TRFA 4ARZB 2JATA 4D6PA 5TDHA 3VKHA 1GKUB 3S1AB 3AVTA 3VFDA 2G0NA 5EP4A 4D0GA 4UXJA 5J40A 2NZJA 3GLHA 3G82C 1COWD 5FI0B 3UMFA 3VR2A 5KSYA 4XWAA 5C4GB 5DSZA 2VPPA 2JJ1A 2DWQA 4C0QC 2GK6A 4I1OA 3CIOA 4Q9LA 4YMSA 5HPYB 4PPQA 2NTYC 2JLXA 3BH6A 1Z0FA 1QVRA 3B1XA 4OQFA 1E0AA 4A0GA 1T4GA 4U02A 2PZFA 2ZYWX 1FUUA 1HE1C 1YRBA 1GM5A 2BJWA 5DN6A 2WVJA 1JNYA 1H8EA 5EE0A 4E5UA 5KPDA 3WYAA 4XD7A 4OQXA 3AVVA 4HI0E 4LJ8A 3FKSA 5KNDA 5J4KA 1AKYA 4QNRA 1E9AA 5KDOA 2JLUA 3GLIA 3EZ7A 3RRMA 4JKYA 4IDNA 5JWOA 1N6NA 4DDWA 2CCGA 4RZUA 1E0KA 2OAP1 2P5TB 3W9YA 4URVR 1YZGA 2AXNA 2XITA 4UKDA 5EE3A 2WKQA 3OEEA 3JVVA 2QQEA 1G9XA 3CWQA 1QHSA 4NL4H 4QM7A 3A58B 3LBHA 4PQRA 4RFSB 2ZRNA 3U61B 3V4FA 5SZIA 2ZYVX 4R71A 1E69A 4DSOA 3QEOA 4B6FA 3K70D 2V7QD 3LDAA 2GJKA 1OYWA 1N0WA 1PUJA 2O0JA 5DHFA 1NSTA 1ZCAA 1G5PA 4I81A 4TMTA 2ATXA 3MMPA 1TMKA 3OEHD 4Q9JA 1WCV1 2ZXUA 3SOPA 1BIFA 4LZZA 4L9WA 4ACBA 1E0JA 5H8WA 5GVSA 3ZS9A 3QVUA 3JZAA 1IN6A 1JPNA 2ANCA 5IHPA 5FUYA 3PENA 1FNMA 5FUXA 1C4OA 1R0ZA 4I1SA 2EFEB 4PQYA 4C0KA 1J8MF 4G3XA 4HDQB 1IN4A 3QF4B 1KI1A 5TV2A 3K0FB 4ZI3A 3A4LA 2OO7A 3M1IA 1F2TA 3EAQA 2GBLA 1MKYA 3AF2A 3AUXA 5FTJA 4A1FA 2YC4C 1X8KA 1DAGA 4POAA 1S1MA 1CRQA 5D3MB 4JLKA 4OHZA 4JKIA 4MRSA 1SGWA 1ESMA 2ZPTX 2QTFA 521PA 3X1YA 5FI1B 3P26A 4Q1EA 4EKDA 2GF0A 3U7EB 1NL3A 4LJ7A 2OCBA 1W36D 2GKSA 3OFNA 4BGDA 4OK5A 4TSFA 1BYUA 4KFRA 1JR3D 4XSHA 1CRPA 4LV6A 2QUZA 1UM8A 4CIDA 3G5UA 2ODNA 3QJYA 2BBTA 2JLZA 2FFHA 2DBYA 3DZDA 2Z4RA 1E2EA 4BWYA 3GLHE 3RAPR 4HAXA 4URZR 3TE6A 2QBYB 2ZE6A 1E9SA 2B92A 3QF7A 3CWZA 1NG9A 1KKLA 3WMGA 2GXUA 2O8FA 2ZUBA 1ZD9A 2FU5C 4HUQA 3W8RA 1LF0A 2DHRA 1CBUA 3SI7A 4EAQA 1SXJD 2QEQA 3A4NA 2CE2X 2IBMA 3S1AA 1P61B 2XNDA 5SZKB 1IY2A 4Q66C 3K70B 2WOOA 1ZC3A 4IFBA 4QBGB 3CH5A 4MITA 3GFOA 4RD2A 5DISB 3RSLA 4C0BA 4OQLA 3GLIE 2UZ3A 1RJ9A 4JLPA 1KI6B 4BLSA 4TTQA 2RHDA 4EPVA 2L0XA 2RB4A 3TR0A 1RRCA 3CM0A 1AS3A 3AKDA 2CLSA 4MRRA 4U5XA 3TVTA 4C4PA 4Q4LA 2NPFA 4IEEA 3TAUA 4D4JA 1CKEA 3KDSE 2RMKA 3EPLA 1OKKD 4YMVA 1WMSA 2UVQA 1P7CA 1GKYA 1M34E 1W2GA 2ZI3A 2PEZA 4EDHA 2C2HA 4A36A 4LBZA 1M7HA 4JJZA 3W5JA 3FB4A 4Q1BA 1YQTA 1NVXQ 4A4DA 4AKHA 5F3WB 1IJEA 4NCKA 5L3VA 2KBEA 1W36B 2ONKA 2XB2A 1CR1A 4LJ5A 2FOLA 3W5IA 3X1WA 4DCUA 4ESHA 5D3QA 2GESA 3N2EA 5K8LA 4TYYA 2O8EB 1N2CE 4PAMA 1HE8B 3WP0A 4ZV4A 2IF2A 3DPUA 4C2UA 4K46A 4AKGA 3GLFE 2G77B 3LO5A 3QUSA 3B2EA 3K8YA 4RFSA 3B9PA 1IXSB 3DM5A 5AJVB 1E9EA 2GAOA 4TMXA 3QXJA 5DO9A 1M7BA 4JVSB 5FL3A 3PUXA 4BECA 3FWYA 3NBFA 1MO4A 1NN0A 1XDBA 4LRWA 3UKDA 1E2NA 3TKLA 4OL0A 4CEIA 2CXXA 2LWIA 2V9PA 4BEBA 1P9RA 1XX6A 2IW3A 2TMKA 2NZ8A 3C5HA 3HPQA 2DWPA 2QMHA 2EFDB 1Z0DA 2VP5A 4OHXA 1BYIA 1JJVA 5FPHA 1AN0A 1Z83A 5C1BA 2N1BA 5ELXA 4CEHA 1SXJB 2O5VA 4GOKA 3EX7C 2QMUA 5DNYB 4BUJA 1G18A 5BN4A 5KYKA 3QF4A 3FMPB 1MABA 1J8YF 3K0FA 1COWA 4JVLA 1SHKA 1WA5A 3SC3A 4MYHA 5HCNA 2V8OA 4DXAA 1OH6A 2OSBA 1K5GA 2KI5A 4AD8A 2ZITA 2FG5A 5D3MA 1RE0A 1T6NA 4HDOB 3CZPA 1BOFA 3B1WA 4TYPA 1SVWA 3ZD6A 4TQUS 2RGEA 2EWVA 3NBYC 2QE7D 3BFKA 1D2MA 4G5OA 1S1CA 5LB2A 5JLJA 3WRXC 2H7VA 2JLYA 2V4ZA 2R62A 1KNQA 1U94A 2ZI4A 4JS0A 4BZQA 3SHWA 2BHRA 4NONA 2VP9A 4LHWA 4PO9A 1SVOA 3AF3A 1G3UA 4Q9KA 1CF4A 1X3SA 3EPKA 1GG2A 2C78A 5E7MA 2YC2C 4M9XA 2Z5FA 1I2MA 1TADA 3GJ7A 3IGFA 3TMKA 4LV8B 5GVRA 2E87A 2WBLC 3ASZA 2QBYA 2H18A 3O47A 4RZ3A 1P60A 4MUBA 2IYZA 4Q00A 3X1XA 5FOWA 1XJQA 3I5YA 2VA8A 1WBBA 3BWDD 3GLGE 2B7CA 1XU4A 5DIFA 4KITB 3G0HA 1LY1A 4BZXA 2HEIA 2ZETA 1G4UR 1G291 4DEXA 4DHEA 1CXZA 2IYQA 4NDZA 1OLOA 4JLBA 1LVGA 4RD3A 2FMXA 3L0PA 5CB8A 4GOXA 3LD9A 3MFYA 1W49A 3QKRB 2WJGA 1G20E 2V7QA 1HY3A 1XZPA 4PANA 4RD0A 4BLOA 2ZREA 4IDQA 3JVUA 1GOTA 3OEHA 4GSYA 1R0WA 2GBLC 3KB1A 4KYUA 3FFBA 3PCRB 3QG5A 4ACAA 1KI6A 1X86B 4WIAA 1Z29A 4G1UC 2IL1A 4I1UA 4B3DA 3AVUA 1HA3A 5HCIA 2PT5A 3OZXA 1GVNB 1EFRD 2OE2A 1OE0A 1AS0A 5FOVA 1VCIA 3NC1C 3I62A 2HT6A 2F55A 4Z8YA 1SULA 3HPRA 1GNPA 2FA9A 1YZNA 4D81A 4OKSA 1Q22A 4G5QA 3ZH9B 4LCBA 2XNSA 3VHLB 5H68A 2ZSDA 2MSEB 5CM8B 2WMOB 1G1MA 1MRNA 4MYTA 3K09C 2QM8A 1HQYE 2BM1A 3UG6A 3W90A 1YRAA 3LQRA 4GMXA 4PC6A 4M2LA 1CJVC 5FUWA 3AH8A 4TLDA 2GCOB 2GXSA 5J47A 2VQSA 3SEAA 1VTKA 1JR3A 2OCYC 3THWB 2X77A 3T1QA 2RGNC 2WAYA 1QVAA 3GJ4A 1I4LD 2O8EA 4YMUA 5CITA 2GZDA 2OCPA 1RPZA 2Q3HA 4M53A 5EP3A 3T06B 3CRMA 3KFXA 4DIEA 2VSXA 3IQWA 2CHQA 1CJMA 3A8TA 4HZIA 1G5RA 2W00A 2DFLA 1F6BA 3EWSA 3OIWA 1EESA 3VAAA 2O0KA 3QSYA 3RC8A 4Q48A 3ADCA 2D4HA 1K6MA 3AVPA 5JHGB 1GL6A 1YJ5A 3B85A 5HR5A 2F43A 3V4RA 1UFQA 2F3RA 3R7WB 3FMFA 2ZVPX 3MRSA 4H1VA 1SXJA 5HE9A 1OXSC 2ZRKA 1YZTA 4TMZA 2VBCA 4V0KA 2X2FA 1GIAA 2CDNA 4FMCF 3V00A 4PHGA 4QOSA 1N5IA 4BFXA 3E70C 4A92A 3QVVA 1VDZA 3BGWA 4Q1AA 4MDFA 4NYMQ 2RKOA 4RCZA 5DH9A 2QMOA 5FBQB 2CVFA 3DO6A 3BE4A 2VHUA 3EIHA 4KHZA 1XMSA 4A2QA 2DFTA 4MGZR 4XVQA 3RRZA 4Q19A 4EPXA 1SZPA 2DPXA 2AD1A 3R9IA 1TQ2A 3CX6A 4DLXA 1EX7A 1KDPA 2C8VA 1GRRA 3DKVA 5DYGA 4GI7A 3REGA 4BLRA 3I61A 1J90A 3UK6A 4CT4B 1IY0A 1XWIA 2ZJ5A 3U4QB 1VYUA 3I72A 3CNNA 4EJSB 3LFUA 3TGPA 3SQXA 2J45A 2WM9B 3A1WA 4TLCA 4B74A 1ZP6A 1KAOA 3DM9B 2R6AA 3X1DA 2JAQA 1PZNA 4Q03A 3UWOA 3GFTA 5JEDA 4Z8XA 4JVMA 2DY1A 2I1VB 2YWEA 2O8CB 1IXRC 2Q9BA 4NKRA 1TEXA 3U3MA 1ZINA 3AP3A 1Z08A 1E2FA 4IOJA 4HLDA 2ZE7A 1OFUX 3FMOB 1WBDA 3P4YA 4GBMA 3I92A 4NMMA 4Z1MD 1GAJA 4OHYA 1KK2A 3SJCA 4C0SA 1OW3B 3DL0A 2Q3MA 4EPTA 1ZM7A 4I1VA 3FYHA 3B7GA 3IIKA 3NDPA 3QNUA 1NP6A 2FSFA 1E9CA 1R7RA 1Z63A 2VL7A 1ZIPA 3V9PA 2R9VA 2EW1A 1W1WA 4QBFA 4DLYA 1R5BA 4PHTA 1JR3E 1DO2A 2YOHA 4URYR 3SJAA 2HXYA 2CLCX 5KSZA 2QQ0A 3CH4B 4Y0AA 4DT1B 1Y63A 1E79D 1KSFX 3L8ZA 2ZJOA 3U3JA 2PX3A 5K8TA 1H65A 2VYFA 3BOSA 2D06A 1GFIA 1P72A 1FTSA 2C04A 4TZ6A 1QHXA 4D0LB 2VP0A 3LBIA 4N3NA 5FBRB 3CRW1 5KSPA 3FFAA 3KKPA 5KDDA 1R0XA 4Q01A 2G6BA 2WZQA 3OHMA 3KQHA 1AGRA 4JLMA 2GCOA 1DBSA 4C7OB 1XRJA 4GFDA 2ZUCA 2IK8A 1XP8A 4C0JA 3W6NA 1G7TA 1AGPA 4GRAA 4OI2A 1OIWA 3TUJC 4C30A 5JJLA 4B2IA 4PAQA 4KODA 3KUDA 4UNNA 3SE0A 1G8GA 4A8JB 4JLOA 3J81k 3GFPA 1CIPA 5CB6A 1CR0A 1KO7A 1SKQA 1SVLA 3F3YA 1PLKA 1Q1QA 4H9GA 3PUZA 2HYDA 4NPHA 4F7WA 1TUEA 3CLVA 3UIEA 3RS4A 3R7WA 4LV5B 3EZFA 3VMFA 1R6BX 4DVGA 1J7KA 3U6BA 5JI2E 2GETA 3LW8A 3IBGA 1L4UA 1VCOA 3C4JA 2JLRA 4X8HA 1ZUIA 1MT0A 1FZQA 2WMNB 1GL9B 1P2VA 2BEKA 4D2IA 4XJXA 3IIMA 2IYVA 2HLDD 2RCNA 3L43A 3MSXA 5EE9A 4KYIB 1VYVA 1E2PA 1SKYE 2WICA 4P31A 2R6CA 4P4UA 2JLVA 1G16A 1EXMA 2ZSFA 3HDTA 1Z3IX 3SJBA 1TAGA 3KKMA 2EQBA 4HYYA 1C1YA 3SNHA 1KIMA 2GRJA 2YINC 3P27A 1EFRA 3QKUA 4JLNA 4PC7A 4PZZA 4LYJA 4OJQA 3TW4A 3KUCA 4DJTA 1W36C 5DE3A 1ZUNB 3QXCA 3P4XA 1KYIA 2QTHA 4MYUA 5G3YA 3GLFB 3EA0A 4MQBA 4P33A 2RH5A 1UKVY 2KBFA 1KI2A 2REBA 3WYFA 5HZKA 4JYBA 4JL6A 1XJ0A 4AYTA 3H0KA 4EJSA 3LX5A 1R8QA 2ZS8A 3KXKA 2BV3A 2QPOA 3MCAA 5EZ6B 3EIEA 1RKBA 3EA5A 4B3CA 5DGXA 3ASYA 2EFGA 4BFUA 3VR6A 4FINA 4PZLA 3GEEA 2V3CC 2O8CA 1L7VC 1BH2A 1ODFA 2VP4A 5FL7D 4DBLC 4AK9A 4TMKA 4AKEA 3UWKA 1HEIA 4EPYA 3GJ5A 3ND9A 4LBWA 3PJRA 1NY6A 4TMVA 1VKJA 1E94E 2W6JD 1SVIA 3D3QA 5BQ5A 4DLSA 2GXQA 2PMKA 2OV2A 1FMLA 3DKPA 4OI4A 3ZVNA 3LNCA 4KVGA 2OCAA 4HAYA 1VG8A 1GILA 3GJ3A 4V0NA 1B0UA 5EUQB 3E1SA 2J0UB 3CPJB 5KU1A 1ZBDA 2YYZA 2MSCB 1DOAA 2QGNA 3TQCA 4NYJR 2FZLA 3B8HA 1NBMA 2B21A 2IT1A 2A5JA 3AF4A 4GT1A 2IUSA 1YU9A 3SS8A 2O8FB 3CW2A 5SZJA 1E2KA 1TU4A 2F1JA 4GPTA 5L3SA 4UNQA 4M1OA 3BBPA 3M6AA 3PG5A 4MKHA 4W9MC 1CU1A 4GZMA 4BLTA 2BBSA 3QPVA 4QC2A 4D4MA 5FTKA 1LNZA 4WXRA 2NQ2C 4YMTA 5TMPA 3AVQA 4DDTA 1YZLA 1YR9A 4P0TA 4MRPA 1Q21A 3P32A 1Z2CA 2WWYA 1E9DA 1RJ9B 1OXXK 4PC1A 3CRQA 4AWXA 2HYIC 2ORVA 4C7OA 3GLGB 4G5SA 4WVFA 3VKWA 5G40A 1HYQA 2KB0A 1XF9A 3SDZA 3VR1A 2ODEA 4GOJA 2ZE8A 3N5CA 2ZRMA 3KQNA 4FWTA 5JMTA 3SJZA 2XB4A 4RD1A 2F1RA 1ZD1A 3FHTA 4A8JA 1RYHA 3MJRA 3CRRA 2IX3A 1CJUC 5K8UA 4M4SA 3T12A 4IEIA 1DELA 2QGZA 1FP7A 1OYYA 3IUYA 1IAQA 1O3YA 4LK2A 2ZJZA 4MH0R 5E3HA 2ZAMA 4RD6A 2FEOA 4E03A 1M2OB 3SN6A 2AXPA 4C2TA 3UANA 4JL5A 3BB3A 4Q1CA 2QORA 2Z0MA 3U44B 5EXTA 2WKRA 4Z1MA 2V6IA 3HYTA 4WA7A 4XVRA 4IOLA 2QPTA 1MV5A 1XMJA 3QY0A 2GNOA 3IHLA 4RKEA 4D26A 3BERA 1OFIA 4ZCMA 2IS4A 1FQJA 2WWWA 4C0HA 4NCIA 3PUWA 1EK0A 1WRBA 4AI6A 1D9ZA 5JHHB 1SVSA 2CHGA 3LVRE 4QFMA 3TR5A 2OESA 4CEIB 1ZYUA 1I4TD 1F3OA 1OB5A 3QPUA 4M22A 1A4RA 1F48A 2I1QA 2MSDB 4NP6A 4V0MA 4XTRA 4QJ3A 4Y0VA 3TSWA 2YHSA 4P4SB 5LD2C 1JEEA 1E79A 2A3RA 2XJ4A 4N0EA 5BN5A 1YHNA 1E6CA 2N46A 1HH4A 1Z0AA 4F4IA 2GEVA 2RGGA 4IFEA 3GLFA 4CEHB 2BMJA 2A2ZA 4X8MA 1T3LA 1MABB 3AVWA 2ZI5A 2E1RA 1YZQA 2OAQ1 1ZNZA 4QJ5A 5CJ2A 4QG7A 1FPMA 1UDXA 2P0EA 1CR4A 4RZXA 5C2JB 2YNMA 2R2AA 4B3FX 1A82A 4B35A 1KGDA 4K81B 1KMHB 2AKYA 4M1TA 2RGXA 4XSGA 3R9WA 1UADA 2CMKA 5E4FA 3LY5A 1E2QA 1GNRA 3CONA 4LJAA 4TL9A 4A0FA 1NBME 3U7GA 2OXCA 2PJZA 3T1OA 2QRNA 2QM7A 2HCBA 1T9HA 3R9XA 3BK7A 2AR7A 2WJYA 3IBYA 4LHYA 4LPSA 1ZM4A 2FGJA 4FMDF 4QGFA 2JJ8A 4WBSA 2HJVA 1KY3A 4CVNA 5A0FA 4KLNA 4XWOA 1J2JA 2ECKA 2AWOA 2CNWA 2G9NA 1NF3A 4QHTA 4PTLA 2OEPA 2FSHA 3ZVRA 3AVYA 4JIMA 2J0UA 4Z54A 4ESVA 2W2VA 3CRVA 3HU1A 2QT1A 1N5LA 3QIAA 4E22A 1HQCA 1OFHA 3FKQA 3I4LA 1PJRA 1VYTA 3CB4A 3EIQA 1TNDA 1NKSA 2G83A 5B30A 2C9YA 4M1KA 4L15A 1LS1A 4V0OA 5F98A 2QTVB 1XXHA 2ZUDA 5E95A 3KFVA 4PC2A 2NO6A 2GCPA 1TQDA 2GJ8A 1IN8A 4ILEA 3BIFA 4B47A 3NIBA 3QPWA 4C0LA 2HLDA 3IPYA 4W5JA 4BPBA 2H1LA 4LJYA 3NG1A 3IIJA 3O8BA 1RRFA 3O8CA 4BLPA 4CW7A 2ZRCA 2QAJA 2G1JA 2F1IA 4HAZA 1UBCA 1FOEB 3KKQA 2NPIA 3N70A 3T5DA 3K0SA 3W3AA 2VF7A 4O3MA 2CBZA 2KJQA 4FMDB 1X6VA 1XEXB 1XNJA 4KSCA 2FN4A 3LVQE 2ERYA 3NHBA 4BFVA 3GLGA 1UBFA 4N0DA 1KSJA 4A9AA 1XTRA 2R44A 3BXZA 1P9NA 4NBSA 1UKEA 4US1R 4DZZA 2Q6TA 1KJYA 2PZGA 5JRJA 3PUVA 2ZU6A 121PA 1DO0A 4B34A 2RGCA 1XTJA 4QM6A 3C15C 1KDOA 4L4UA 3OF5A 4F93B 3CZQA 3MG9A 1T3SA 1CR2A 2VHTA 4US0R
chains in the Genus database with same CATH superfamily
1KH3A 3MMNA 1KVTA 3O1IC 3GPLA 1CJKC 1CE8A 1KK3A 1UZNA 1Z0SA 3LWNA 1L4FA 3H4MA 4TTAA 5KYUA 3TXYA 3V1YA 4YV2A 1IHUA 4GD3Q 3NH9A 5FL7A 2GZHA 3DHWC 3G85A 1I1QB 4MVWA 5JS8A 1QM5A 4DUPA 3QQ5A 4C87A 3U44A 3K0CC 3CX8A 5DZSA 1XPOA 3DP9A 1NVVQ 1U90A 4HJRA 3IO3A 2WIJA 3PFIA 4NJEB 3R74A 4AU1A 2PUAA 3CUVA 4PNZA 3DLTA 3HCEA 5K8JB 3P0JA 3U4IA 3HO6A 4W1RA 5SYAA 3TTUA 1D6MA 1NT4A 3CVOA 3SYNA 2FX3A 4N0MA 4E2ZA 5C1DA 1JFSA 2WNSA 3H17A 4L4ZA 4IMPA 1FNBA 1YR2A 2OXIA 1SU8A 4GGMX 2NO9A 2VDRB 3EOBI 3ZWWA 1NRJB 1PVVA 5FJIA 2EJUA 3M9WA 4HTFB 2CHVA 2RFLA 4JEHA 3I04M 3OIFA 3CUUA 1OBCA 3I5XA 1ULHA 2IEYA 2O14A 3GDFA 4L3WA 4S35A 1WPQA 3LPCA 2FJUA 4DWJA 1UEJA 5C4MA 8LDHA 2GR9A 1JAHA 3S44A 5IN4A 2PWZA 3UAXA 1IL0A 1SPXA 3G0GA 1M5UA 5LUBA 3RK0A 3D5EA 1C41A 3UPUA 4N47A 3AVXA 1FMFA 1SUDA 4N76A 1NJGA 3ZE0B 2O1XA 4DTCA 3BL5A 3CMCO 1RC1A 1AKNA 2JIZD 3GN2A 1UJ4A 1EAYA 2Y1DA 3PC7A 3TQSA 3C3KA 3M2PA 1FMCA 3UJ6A 2WVHA 4HEHA 4WZBB 1IYZA 4RS4A 1XB2A 3T1NA 5KCMA 5D6NA 1KHTA 3IEPA 4CG3A 2ZUVA 3F1KA 4DIBA 3MQFA 1UQTA 4D9FA 4G37A 5BW8A 2Y99A 1OFUA 2DY0A 2WT9A 1BGWA 3AHEA 3CUEF 2H5IA 3UQYS 2PBRA 2NIPA 2X22A 1FDOA 1OI7A 1CB7A 1Y4DE 4OHRA 1KDYA 4EGQA 4KQIA 4ECEA 3W6PA 3ESBA 4RHXA 4AT1A 4ZGGA 5CCXA 1Y8ZA 1LKZA 4NZYA 2DQ4A 3AETA 5HFNA 5BQFA 2PKYX 4YX9A 2QSZA 1F60A 1TRHA 1L6RA 3MTQA 5HP4A 4KRYA 5C8YB 2X86A 1SKYB 2BUCA 5FAXA 4W5NA 4HAWA 1FFDA 1NLFA 3WOHA 3HTXA 2BFWA 4Z9BA 2PTHA 4JBYA 5D86A 2QLJA 2I1LA 1P4SA 1M54A 1SHTX 1HPLA 2CCJA 2Y1GA 3HR8A 1TD9A 4IX1A 1RIFA 2E48A 1XDGA 2JEOA 3JAWB 3K32A 4KXQA 2ZRGA 2NO4A 1H69A 1F2UB 3OLYA 2J7PD 3AGQA 4HAUA 4IGFA 4OK6A 1XTTA 4LTMA 2WV7A 3S2YA 1P5HA 5AUQA 1E3TA 2WYHA 3AC0A 1I24A 5B2ZA 2I4IA 3HM2A 4LEIA 4RK0A 2PNJA 2BOVA 4WXYB 1E6WA 2IDKA 2TYSB 4YRLA 1L5HA 2ZJFA 5I8PA 5LQJA 4Q05A 721PA 1E3WB 2QVYX 4HGRA 3OLXA 2FW7A 1K7FB 3GRCA 1ZHHA 2IHUA 5DSTA 2AZTA 4C76A 3B3JA 4DLTA 2HPHA 2VZLA 3PL1A 2X1LA 1SCDA 5THKA 5IFKA 2C7OA 3B6IA 3ZYCA 4ZO9A 1UWKA 1XRMA 4Q21A 1KJJA 2WWHA 3O4JA 4WKNA 2CDCA 1J2EA 4GI5A 4GWKA 1XZLA 2X3YA 4LVOA 4LE2A 3RJ5A 4B76A 4TYWA 3PNOA 1TUBB 3GHHA 4OHFA 5KTTA 3BAFA 1WXQA 3L5OA 4RVSA 2CJWB 4ZQIA 1I13A 3HY3A 3GMTA 3C70A 3KJZA 3SQWA 2NTNA 2X1HA 2QA5A 4OBWA 4PLGA 4D9HA 4C08A 4UEKA 1GHTA 1YFLA 2FKAA 5K09A 1H3EA 3IT1A 2XSZA 2DERA 1KJZA 1IRIA 3EUAA 3HDHA 1VBNA 1TAUA 2NO1A 2VO1A 1T9BA 1GGNA 3NAZA 2ACKA 1YS9A 2FEXA 4EYOA 2H16A 4C06A 4ITRC 2J3EA 2G4VA 4KBGA 4NK4A 3M70A 2PAAA 4OFXA 1E3DA 2RHTA 3KJQA 1XCOA 3K6RA 4G0OA 1RCFA 1Y42X 3ND5A 4MGKR 4ZQEA 5DNUA 1EFLA 3KXPA 1PNOA 3LPNA 1ZGJA 3P5BA 1O95A 4OLBA 2BGMA 1SURA 2CVPA 1RACA 3QGMA 4NJEA 1PZGA 1J70A 3AI2A 3KAKA 4GC9A 5K3EA 1ZGCA 2WKWA 2Q3CA 4FJ1A 4REOA 2FEWB 2HCJB 2BBOA 3Q41A 4P83A 1O77A 3BCUA 4XFKA 1HNXB 3R8CA 2VWQA 4O29A 1G8FA 4BB0A 5IJAA 3ZWBA 2I3BA 2X9VA 2IITA 4HTFA 4HKTA 4X6LA 4IMIB 1G0NA 2J0EA 1CP2A 3T7EA 3ITNA 4QQNA 2QTAA 3T3MB 2AN1A 2QD4A 4P08A 1JZSA 2AB0A 4WK2B 5ALMA 3FOWA 4HFJA 4BRWA 1MO2A 1Y9ZA 1AK2A 2RJNA 1TYDE 3QFHA 5U4XA 1XQ9A 5EUMA 1JALA 4Q18A 4MQUA 2E4VA 1Q1ZA 4OJKA 1MW8X 1W0JA 2SKCA 4IDOA 4J76A 1R12A 1RAHA 2AS0A 1UEIA 4G1FA 2VHWA 3QEJA 3ZZTA 1IBCA 1OZFA 3C7TA 2BUAA 1BW9B 1EB8A 2D74A 2VTEA 1A2BA 3CSDA 1R0RE 4HDCA 5DULA 1MQAA 2AFRA 3OPXA 4Q0MA 1M8GA 3E7DA 3C6KA 1A8UA 4A8HA 3C8UA 1DEXA 1U8ZA 4WZBA 4EFLA 2D5CA 2I91A 2IYWA 3AHGA 1CQIB 2IXFA 3G9ZA 1X1DA 4UMVA 5I5GA 3GGDA 4TLAA 1TX4B 3PK0A 4WESB 3GT4A 4UCQA 1MP0A 4KXXA 3TL2A 2I4NA 4F56A 1IULA 2FSVC 3FWKA 3AUFA 3T7CA 5A5FA 3DVQX 4HAVA 3S2EA 6PFKA 1GEEA 1UOEA 1N2GA 5JNUA 2MCFA 1TU0A 2Z3VA 5IBQA 2BM8A 4QQRA 3R4CA 3AKEA 3N8NA 4ZCSA 4WOKA 2XCRB 3SYMA 4GDMA 3WHLA 3M81A 3M9LA 4EHNA 1JQKA 2QD1A 5JZMA 1SVKA 2E6KA 5HX7A 4IBOA 3TZLA 3RUHA 3T9AA 3IODA 1OGIA 1CNEA 3KAJA 4TS9A 2GRUA 1GPLA 2UYGA 4XARA 4DC9A 1YZ3A 4WY2A 1E1CB 1ZX1A 2I2FA 2W4QA 1S2NA 2HDWA 2NTEA 3DZKA 4CM5A 6NULA 3GLVA 2XQJA 2X5KO 3F5FA 4BY9E 1O9HA 1U6JA 1IZZA 2H6EA 1G7SA 1OZHA 1DS6A 1QV9A 2H85A 3JAWA 4J16A 2WRZA 3TAHA 1F2UA 3HV0A 4II2A 3HUTA 4CG1A 3PF9A 1QORA 4FMCB 5DHRA 1OJLA 2B1GA 2VNKA 3MAAC 3RIEA 3UBTA 1RLJA 4LQCA 5EUCA 2M9MA 1Y6JA 1KDVA 3DCJA 4AJEA 1XK7A 5TR9A 1E3WA 4TRMA 2AG6A 1Y6QA 2V9CA 3EFOB 1N2SA 4HX5A 1RAGA 1BVUA 1I5OA 2VSOA 3AFMA 2BLLA 3L5KA 4FFRA 5EKDA 1F2VA 1ZIXA 1U04A 4LHVA 3ZXYA 5CFNA 1BO6A 4QYSA 4IIXA 1JU9A 4EUNA 1Z2DA 4S2UA 1MLDA 2X4LA 3MMZA 2W98A 3LL7A 3QMPA 4FGSA 1B74A 1YNOA 2WHYA 4JLWA 2XQVA 3LK7A 4GNKA 5AO9A 5THXA 1D4OA 1ILWA 1TUBA 2QNBA 1ETUA 2VJAA 4UATA 4OQNA 3VKUA 1V9CA 4OHOA 4MP3A 1JFTA 3ASVA 4KDCA 2CJWA 5SY9A 1TOAA 3DDWA 4YRFA 1XCLA 4BNXA 4PRZA 2Y8EA 2YQZA 3M4NA 1NKTA 2EKQA 4EARA 1ZN2A 4J1QA 4MIOA 4PZDA 3V4VB 4IMJB 5DLYA 2WWVD 5FV4A 1VIYA 2JIQA 4RPLA 3UV7A 1MVOA 3UJBA 3GJ0A 3HHPA 1N78A 4K03A 4G0NA 3SBDA 2RBGA 4IWNA 3VZQA 2A1UB 1Z7BA 2EZ8A 4R1QA 4OHVA 4ZAZA 2X6RA 2W6IA 2CKMA 3CY6A 3OJ0A 4QICA 1Y0BA 4FIDA 4RTOA 2Q5CA 2RBKA 2JFGA 1G8MA 3N7UA 2ZBQA 4JDPA 1KJNA 4N8EA 1QHHB 1NNEA 1SUWA 2QLMA 4MVXA 2ZZNA 3O4HA 2AW5A 2IYSA 2XX3A 1XL1A 1TUGA 1B42A 2PRZA 2REXB 2XEXA 2JGKA 3AWDA 5DBIA 3FOBA 4JGBA 3VH2A 1VG9B 3IT2A 4MR9B 2CXTA 2Y67A 3TTYA 2IZZA 1RP1A 5BMVB 2L69A 5CU7A 4XOUA 2NQ8A 1U65A 4YK7A 4OIFA 1J56A 2D7CA 3LRPA 4H27A 4B3IA 3VNVA 3THXB 1K8ZB 2YWBA 3TW8A 4YHHB 1SC1A 3NAQA 4K9MA 3PIRA 4PG8A 3RVBA 1X77A 3I2GA 3EGWA 4ZCLA 2KW5A 1U7HA 2ATVA 1HE2A 1QRDA 4EA7A 2YRWA 3D3WB 3K70C 1EG7A 3OE7D 3BXFA 4JI7B 2GPWA 3R5SA 4QA9A 4RK5A 5EJGA 2IU0A 1HYEA 3ZJVA 1KDTA 2Y0DA 2KPOA 4HF7A 3TBKA 1QJ4A 2IBTA 3GFGA 2RJOA 3ICQB 5JCOC 2NO0A 4PSCA 2IE8A 1YL5A 5ICSA 4V0QA 4Q4JB 5B6IA 1H2BA 2QN7A 1ONPA 2C03A 2VHJA 2CLHB 4RU1A 4M9RA 2XDAA 4UAUA 5LOVF 1KJIA 1SXGA 4KBFA 4XR9A 4H6PA 4DYDA 2RGUA 2UUCB 3H8SA 1GRQA 2QR2A 3FWHA 3RODA 4JROA 5AK3A 2UXCB 1CPYA 3L82B 2HWXA 4Z51A 1CQIA 3LYUA 5A05A 4B3TB 4NZZA 3OQJA 2C5AA 1BDJA 4TV8B 1M7GA 2UZ0A 5I7RA 2DG2A 2YZNA 4HL6A 1ZIOA 5FF9A 2UZAA 3HJUA 3JQ9C 4WCVA 3TDKA 5IT5A 1Y3HA 1C4KA 5DLDA 5GJBA 4COOA 1ITZA 3TQOA 5LZ8A 3NWJA 2QRJA 5B3JA 2ACEA 4IZOA 3B60A 3W6ZA 5IEBA 1P2FA 1ISIA 3WVNA 3OF2A 1W5TA 1M2GA 1UBLS 1AMUA 4G63A 5FWNA 1GPDG 2B37A 4G89A 1J9ZA 1GP2A 4HCJA 4GQBA 5GONB 2GNPA 4LSMA 4GQIA 1E7QA 5AXAA 4ZCQA 1NONA 1E1CA 1P5ZB 2Q3FA 3ES9A 2VHEA 1NW9B 3BRQA 1GTRA 1SHUX 1I7DA 4DUGD 1UEXC 4HFRA 1QP0A 5JMWA 2WVAA 3LK6A 3RSOA 4DQ0A 3G5MA 1JYFA 4DPMA 1LC0A 2DFNA 2GPJA 3LC0A 4I7EA 4OGWA 2RGRA 1I4DD 2IYPA 1Z35A 3KTDA 5ITVA 4BNUA 3KJFA 4IVPA 4MW6A 1ZXXA 2FR8C 3ELDA 4RV9A 5E6SB 4O4LF 2ATIA 4ZKDA 4Y9RA 5C3UA 3TF5A 3DL2A 3HBFA 4AMZA 2DLCX 3MWDB 2FETA 2XW6A 3CNBA 4B4VA 3EASA 2D1YA 3EFOA 3A1UA 4CQJA 1JDJA 2P2SA 1C8VB 2VKTA 4UTVA 1QPZA 1SXJC 3FD8A 4M0FA 3TEJA 5C51B 2G82A 2JD0A 2E5LB 1II8B 2P2LA 3UK0A 1N57A 1VI2A 2V54A 3OA0A 4BLQA 1S96A 1O57A 5J3JA 2WB2A 1M8KA 2XLCA 3MBKA 3SC4A 2WMDA 4FS8A 4R69A 3N2IA 4HDAA 4WLVA 5JI3E 2HREA 5F4BA 3K15A 1IE3A 1T0HB 7REQB 4L27A 3NCTA 4QPPA 4NOMA 3WHKA 3C8DA 1R9GA 3N2ZB 3HGTA 1V41E 2J46A 3RT7A 3TZKA 4Y1GA 1NYRA 3D0RA 4JI2B 2O57A 3AV0B 3NRBA 1H42A 2A1UA 2QE6A 3SS7X 3VR0A 5GY7A 1COZA 4BVJA 4ZU6X 4EZEA 2CSXA 4NU5A 3UMRA 2ZULA 2GI4A 2QN9A 5KPJA 5EZ5A 1AT1A 2IYYA 1PHPA 5GZ3A 1QHHA 4DCJA 1Z15A 3LPMA 4UUBA 4WH0A 2H31A 5BYAA 1IN7A 1FVFA 1KIFA 4FW8A 4MPDA 2ZR0A 3V46A 1Y3AA 3IP5A 3VR5A 4L72A 3B2NA 2HA0A 1VM6A 4I9UA 3V4PB 4PNEA 1MJHA 3KJEA 3V4ZA 4AKSA 4LYEA 2A14A 4WFIA 3L2OB 3PGLA 2HD4A 5F1YA 4MR9A 3Q3CA 1MJGA 2AMLA 4KCGA 4Q1FA 3TSZA 2EP8A 3BWVA 5BMVA 5HZGA 2GAAA 2RI0A 4LRYA 4JQYA 1GU0A 1E98A 2EFJA 4DQLA 2DETA 2HK7A 2QUJA 4ETNA 3THXA 3SOZA 1PYOA 3GELA 5EIFA 3UT0A 4D43A 1AC5A 4ETWA 1IEXA 4DC0A 5HJ5A 4ZHSA 3BM5A 4QEDA 3D3WA 4BTEA 3LX8A 3WK9A 5JQGF 1V8PA 3AFIA 3ETNA 3V55A 3L49A 1XZGA 3OP4A 4MVCA 1H6AA 3HKBB 5LYJB 4AKIA 1V8ZA 3JPYA 4XB6B 3IBCA 2OKCA 3U7HB 2C4UA 1QO0D 2B5WA 2QUKA 1NWHA 4TMYA 4Q4JA 4JJKA 4QGGA 4BPRA 1KP9A 5C31A 2WJ4A 2OFOA 4MEBA 4AULA 5ER9A 4ZV9A 1QQ7A 1WETA 1FJGB 4BRSA 3WGYA 1RWXA 1TCBA 1TM5E 2V5VA 2UVPB 3QVTA 3Q2KA 1XP5A 5AK0A 2XB9A 5EJ7A 2EW8A 2EG9A 2F1OA 2HPAA 4YALA 5FPYA 2FW9A 1SAYA 4D9MA 1WXGA 3IOMA 1B15A 1GQ2A 2G9ZA 2JJ2A 1KSHA 4TV8A 5E0OA 4XGQA 4P32A 4UFNA 3KELA 1Z7GA 4FP9A 4J94A 1RD4A 1YB6A 2H51A 1N6KA 2R4QA 3D2BA 4YUXA 2GD2A 1MPXA 3W05A 4GICA 4GR9A 5J5CA 3SEZA 2IXEA 2QJRA 3CNHA 3ORQA 5BVGB 1NUQA 2IVZA 3DL7A 4IM7A 2B78A 3EXAA 3UHOA 1E8NA 1ZNXA 2F00A 2JKZA 3ED1A 4KPUB 4XTCS 3RTEA 4QVKA 3UMGA 3WHIA 4HV4A 4M1QA 1U7TA 4YRKA 2PGLA 1TGVA 2ORWA 4I4TF 1Z22A 2GFHA 3LL4A 2DTXA 2ZJ8A 3SHOA 2PUCA 1PJQA 1QYWA 4YCMA 4N6NA 5JARA 2X14A 1Q83A 2YFYA 3MJSA 4XIJA 4CT0A 1AB5A 3UXYA 3T3IA 3BH0A 2GKGA 5BSVA 2Q3LA 2DQKA 3OU7A 2PX4A 4QOFA 1P6XA 2XVZA 4XGKA 1PFVA 3DDUA 3DMRA 1TQ4A 4QD3A 5CXXA 4L4SA 3TM5A 4MKXA 1YA8A 4XD2A 2ZRAA 3L6CA 3NV9A 4LNUB 2F7SA 1MX5A 4LXUA 3FZGA 3RIYA 2VWPA 4EZIA 5KVVA 1QRSA 1E3SA 4ER3A 3E3AA 3HDYA 2J9RA 4IGIA 1QJCA 1KYYA 4QZVA 5HUHA 3RDPA 1YI1A 2IW1A 2ILVA 3DMTC 4F91B 3EPJA 3UTDA 2ZOSA 4M9QA 1NXPA 5KO2A 2EBHX 3UC5A 4XM0A 2DUWA 4QGAA 2IYNA 4S1VA 5D7BA 1YB1A 4B1FA 1THZA 2B8JA 1E5LA 1G3IA 3NDJA 2PT6A 4XEUA 5TEVA 1ZO8A 4F92B 1II8A 3FB1A 5IRCD 3HY4A 4N41A 2B4QA 5HW0A 4LF7B 5JXGA 2ZSEA 3VR6H 1OA0A 7AT1A 2ZQZA 4M60A 3MNFA 5NULA 4EYEA 4PCAA 3U60B 1KYWA 1H8HA 1XAGA 2HSJA 3FUUA 1I8TA 3U4AA 2F1HA 1E1QA 4NMWA 1ORDA 3ZE7A 1NFRA 1KBOA 2VYCA 3E81A 2R1UA 3X2EA 1QIGA 2EIHA 4U2KA 4D8TA 4ZVOA 2Z95A 4F71A 5IWAB 4DGSA 2GD1O 5IDXA 4JYCA 3HG7A 5B3JC 4Q4AB 5HZMA 1W0KA 4RULA 3LHIA 1XD9A 3K09A 5GGXA 4OHPA 2G0AA 4FEGA 5E7IA 4MCJA 1ACLA 6YASA 2VBFA 1B7GO 2P3QA 5K9ZA 4F7DA 1ZOOA 4D97A 1T9KA 1TA4A 2A1TS 4KGZA 3WGMA 1NI3A 4JBHA 4J0DA 3C7KA 4MV0A 4YROA 2QAGB 5A4FS 3T7DA 5I8ZA 2ECPA 2XY4A 1NW7A 1V8FA 3PNLA 4RZQA 4YACA 4FYJA 3WBFA 3DAPA 4YRTA 1HYHA 4XWWA 2J5BA 4OXRA 3A4MA 4KP7A 4G65A 2VYQA 1D5CA 4ARZA 3MT0A 3TLBA 2R4UA 1Y81A 5AMXA 3IPXA 2W83A 1UXOA 3QU4A 2L18A 4BU1A 1I2DA 4AN0A 3WO0A 3R24A 3L79A 1C9DB 5B7GA 2A9QA 2YQ5A 3K6JA 1U5BB 5EJ6A 1QB8A 3H2YA 4YXWA 4XH9B 1F06A 1IZ8A 3W4IA 1DEOA 3V1KA 1V0JA 1KA9H 3H5LA 5F7JA 1U8FO 1PKEA 1XZKA 4NH4A 4ND8B 1D9XA 2ECQA 3HKBA 2Q5EA 1IIRA 5E1BA 3LQ2A 5LYJA 3D4PA 4B33A 4BE7B 2XZLA 5EXPA 2OORC 3GRRA 5F64A 1JX6A 3FAKA 5DCWA 2MYUA 1ZMXA 1S3GA 2IU3A 3AP2A 3IA7A 4MTCA 1MVNA 2JK1A 1X8JA 5IK2A 2WM2A 2B83A 1HTBA 1Q7TA 2XZDA 4FNOA 4G01B 5AVVA 1FRNA 2UVPA 4CG2A 1XTSA 3QOXA 1X39A 2COEA 3I28A 1N34B 1JXMA 1H5NA 3R75A 1M72A 3N87A 3E8XA 2C0QA 1BFDA 5IZ4A 1P4GA 4C88A 3U9TA 3UFXB 2CUNA 1CX9B 4ZQBA 4BHTA 3CLRD 4IZHA 5A5GA 3PGXA 3BXXA 1K8QA 3AKCA 4LXGA 5G41A 1KFKB 2I7CA 2ILTA 2NV2B 1P0FA 1UPBA 2EERA 5J4YA 2ADFA 1WQ1R 3BMCB 1GVHA 1Z4OA 3HN2A 3COWA 1HLGA 4YTEA 3MWJA 4GL2A 3LAWA 1EP1B 2KE5A 2O6HA 3GFQA 4KPUA 2JGLA 3BXPA 3HP1A 4H3VA 4Z1OA 2I6TA 1ZESA 1VL6A 2NT3A 4YC7A 4ZV7A 1GUAA 2GERA 5HJ7A 2RCYA 2OZEA 1AZTA 3PLAE 4DIMA 3PX7A 2NYVA 5DTRA 4FGJA 2DTDA 1JMYA 5B1IA 3LQ1A 5I4KA 4FDLA 5JSZB 5LM3A 4C7BA 1C0PA 1NXOA 1P2DA 5I4IA 1VFPA 2GFQA 1U7OA 4HP8A 1QO9A 5DBFA 4YBZA 4R8SA 2CVHA 2OSVA 2Q2NA 3KZMA 4Y18A 4AS2A 3VPCA 4FMBB 4BKOA 4KN8A 3WGTA 1MO5A 2YVKA 3FYTA 3DWIA 3R76A 1U8UA 2XLBA 5EIAA 1XTVA 3WNBA 3DDZX 2XVYA 2F9MA 3DOUA 2FFAA 3HYLA 4WADA 5LKAA 4PLTA 2IFTA 3V3KA 1ODCA 5LBTA 1Z6XA 2DVMA 2GYVA 2YXDA 5ILQA 4UOZA 1USIA 2RC5A 3QPBA 1EA7A 3ND7A 2IGBA 4M37A 1GXSB 1G7RA 4HXGA 1W2HA 3DSRA 4WZ6A 4D6XA 3VNSA 3F74A 4PLPA 3QEKA 3WFIA 4QXPA 1F0KA 4WEOA 4QYXA 3FIUA 1S01A 3HSKA 2ZVJA 1J39A 3WQBA 3NEYA 1HUQA 3OHPA 4DG5A 4F2DA 2ZBPA 3MGKA 2G67A 1CUZA 2BFAA 3ZK9A 4E13A 1RKUA 1TZCA 3OMXA 5CIQA 1ZD8A 2P3LA 3I83A 5J59A 2NACA 4A2PA 3ZLVA 4MQMA 4YXFA 1Z2EA 4CTMA 1LWOA 1LA2A 2ZKLA 2ZRFA 5BV0A 2HC9A 3GMIA 3IQXA 4IW3B 1JHVA 2YZGA 3CUSA 3BB1A 3DVSX 2CXNA 2J3IA 3P2EA 4JCOA 5LXTB 3EARA 4Q3DA 4DLVA 3GDOA 3W6UA 4IDAA 5ERYA 1OXTA 3VAYA 4MQ6A 1BE0A 1G41A 1KC1A 1XHEA 3K0KA 4Q4AA 3B9QA 4I3FA 1XDUA 3KOZA 4DV3B 1A3CA 2HF2A 1GKKA 4XM1A 3R4VA 1M1YB 2BW0A 2GN6A 3DTVD 2F4NA 3OZ7A 4MKFA 2JRLA 3TGWA 1IWBB 5MGNA 4BNFA 3A14A 3A2NA 1G8SA 4ZVMA 1V5WA 3ENQA 3B78A 4AROA 2IPNA 2VPZA 1LRKA 2QAGA 4R51A 3X0DA 5TB5A 2ZXFA 5JH7B 3OZCA 1PGPA 3WL4A 1MAAA 5B7QA 1GUDA 3WK5A 1VOTA 4L1KA 3SFVA 4M1MA 1VSQA 3UJHA 4EQ6B 3HP4A 5DN9A 5CDTA 1VKOA 3J81A 1QS0B 5HJ2A 2BEVB 1I6MA 3RH0A 4DSNA 1T8TA 2BWJA 2JI9A 3R5KA 4FNMA 1A8QA 1MB3A 1OFGA 4IIUA 5A4MS 1W5AA 2PZLA 3P5SA 4HLUA 4MCAA 5TC4A 3WK6A 4BYMA 4CDNA 1CZUA 1NVVR 5DHAA 1U5BA 4P3YA 1U6IA 1L1FA 2CLIB 2WF7A 1HBJA 2EBUA 1QVZA 4M7OA 4TV9F 1W9HA 3W3AH 1RZRA 3KJGA 1GGKA 3RU2A 2IV3A 3ROFA 5JPIA 2Q6VA 4BFTA 1GNSA 2UKDA 1YR1A 3UWSA 1XZIA 4NBKA 4IILA 3UXMA 2F6RA 3E3NA 2B4AA 2AT1A 2O2CA 4IDGA 4JXKA 4BATA 4BNNA 5DXAA 5IYZB 2IDJA 3NWEA 3U13A 2XQIA 5C7OO 4J4BA 2YASA 4F2GA 4PQGA 3VGPA 1PL8A 1QVWA 2C7RA 1KK0A 2ACWA 1A1SA 2BT4A 4PC3A 2HHCA 1Z6YA 5AVUA 3NYRA 1Z5GA 4GKVA 4HLCA 4ZQGA 1I3LA 1EJ0A 1ZH4A 1KE1A 3TFOA 5C52B 3MJHA 1DEHA 3A4YA 1LNSA 4LSWA 3I3OA 3UFXA 2I66A 3HZHA 4LDRA 4WA8A 2YDYA 2ZRIA 3DO5A 5AJYA 5HHTA 1ADJA 3KR0A 5EP2A 1FUKA 1UOPA 4IFIA 4HVTA 2I7DA 3LC7O 4NNPA 3VSAA 3SIRA 1QNLA 5LD2B 2C4TA 2CFTA 3BMCA 2XZTA 1JLSA 4RPJA 4TSKA 1SIOA 1ANKA 3H0EA 5LUAA 5KJEA 1OHHA 3GGGA 3T94A 3D81A 2DFDA 2FK8A 4U63A 2C0PA 1J1ZA 2DPGA 3PXXA 3NX4A 3FPAA 4FHCA 4FHGA 4HD8A 4M54A 4RKRA 3QUBA 4LSZA 5T41A 3D7RA 3ZNPA 3A36A 3EHDA 1U6KA 4TZ0A 1GQQA 1S2LA 3AEXA 1N0UA 4FBLA 4M1EA 2B7BA 1ONSA 3HBAA 1EK2A 2XTNA 1MD9A 2ROQA 3AXTA 3D6AA 3NVDA 4G0QA 3RLFA 4AP9A 5JWRA 4FSDA 4YHBA 1I0LA 4XYGA 5JSZA 4IJKA 1ZG3A 2Y4OA 2QN1A 2ZM6B 3LP6A 1HT2E 4PQEA 3STVA 3RSFA 4A0SA 1EG2A 3AR5A 2I3GA 4TKUB 4B0OA 2DQZA 4NG4A 3MUNA 1JDBC 3IE0A 1DVRA 3DBLB 3TIXB 5AQ1A 2O54A 2FLWA 4GHWA 4JGGA 4MV8A 2QRUA 3G2HA 1TQ8A 4O8ZA 1PZEA 3QKTA 5GOZA 4RIHA 4EBFA 5KNBD 4KU4A 3TJZA 4KQJA 2DKOA 1GXSA 2R8BA 3TTTA 1LLCA 1W25A 1NN1A 3AFOA 4QXQA 1IHYA 3GZJA 3OTIA 2AI2A 2H92A 3KKEA 5BVHB 4PN7A 1NN3A 3U1VA 2OHVA 3U7RA 2X5JO 3ORSA 4H7HA 3ACCA 4K0RA 4WLNA 4HB4A 2Q7XA 1CHNA 1QZ3A 1RJDA 4B09A 1EM8B 2A7QA 4O0LA 4AUMA 3GUVA 1KZ9A 3SYRA 1VHTA 3LXMA 3QLTA 2NU6A 3BDAA 1S9HA 2XADA 2FWJA 3HZZA 3RC7A 3TPCA 1FE8A 1I0ZA 5H3CA 4PYJA 1NP7A 2PKXA 4N01A 1BH6A 3RUFA 5AW0A 1NJ8A 5LXTA 5EUBA 1IM2A 4LY9A 5IKOA 3DLBA 4JBGA 1NJ1A 4RETA 2WNIA 2H1SA 4KIFA 5TVKA 5CVCA 3P2IA 5K6AC 1QAOA 2V7XA 2EOAA 4C1NA 1KOLA 1C3VA 5EPOA 4CMCA 1M1YA 1PFWA 1G17A 4M8NE 2IHJA 3AY6A 4KO2S 1T2CA 4PAGA 5HK9A 1OLXB 3B52X 3KLNA 5CT5A 3DMNA 2FF5A 2JGFA 3E7WA 2AW3A 4V0LA 3BA6A 3IAXA 5EWJB 4AY3A 5JH7A 1C8KA 2AD5A 2A6PA 2WM8A 3WHPA 2TS1A 3ZU6A 5B3LA 1CS0B 1YBHA 1XZMA 2VF8A 1V6CA 2CWWA 1MJGM 2QW0X 4DR3B 1QS0A 2BEVA 4LX8A 1XTKA 2P3SA 1JHUA 1PFQA 4FW9A 5KQPA 1BVHA 3QKRA 3L46A 3H18A 5HIKA 1TK2A 1ILEA 4HB2A 3ADBA 3OESA 3DYBA 2YXPX 4MUGA 1NDUA 1QR6A 1HFKA 2Z56A 3GBSA 2E9SA 3B36A 3I73A 1I32A 1RU3A 4WK4B 4MICA 3R3JA 3T15A 3W04A 1V45E 3JYNA 1NMEA 3C6YA 4LXQA 4JR1A 3H6KA 4Y6GB 5HS6A 5ECYA 1YL7A 1ZMOA 4I5FA 1RXWA 2CVOA 3V4LA 1I94B 4MTLA 1I9GA 1VFNA 4HEJA 2A92A 1WB9A 1HDZA 1YS4A 2PL3A 3TIFA 5FLXA 2LKDA 3EVZA 3ZCUA 4UNPA 4ZJUA 1CZKA 2HMVA 4RNCA 1Z16A 2GUGA 2YHIB 3L84A 1N8KA 1U99A 1W8DA 1X9GA 1S8FA 3ETDA 3L0SA 2INGX 3OZFA 3X1KA 4KACA 2V4UA 4C6TB 4RS3A 2A94A 3LHFA 3L7AA 2DHCA 3UMVA 3TMAA 4ZK6A 3FSGA 3FRHA 2BCGY 1J97A 1E3LA 1GUFA 3T3DA 1PW7A 4CYMA 3RYCB 3S3TA 3QRWA 4PX9A 5JRDS 2ZTUA 1LK7A 3TNLA 4TX1A 4A73A 2Y05A 3AFHA 1EFDN 1G98A 2VJQA 4X7MA 4EVRA 2YS7A 1YKFA 5F1KA 5CFLA 2OB2A 1OAKA 4TS1A 1QNFA 1AQ6A 2CGEA 2BGUA 3Q11A 4L5IA 4MGHA 5ALOA 4IPTA 4WX2B 2C82A 5TMBA 2D7JA 4IUYA 3WTBA 3UGKA 2QAGC 3K9FC 1NBEA 4EW1A 4DAOA 3IHWA 3GCGA 5B6PA 3I53A 3OFND 4HO1X 5FIUA 2PHZA 1EFTA 3GNQA 3TVYA 4C0XA 3MRVA 1GKIA 3EY4A 1K8YB 4BZPA 2IUTA 1CETA 1I0IA 3OCCA 4PHFA 2HZBA 2W2KB 2PMEA 4D74A 1VG0B 3F6YA 3TLCA 4HLUC 4JSYA 2BDEA 3RLIA 2D0IA 1GITA 4GSLA 5D3ZA 4ZHQB 1CC1S 4BASA 4TKUA 4X00A 4L8YA 5C5CA 4EMTA 3GLIB 2OK8A 2ZIFA 3BWEA 3ETLA 4R8KA 4ATNA 1PWZA 3F90A 1FYXA 4R68A 2HN9A 3TRIA 1HKUA 1T2FA 4FCTA 1M83A 4OHCA 1XEAA 3SK0A 3EZ2A 3KUUA 1EJ6A 1VJ1A 2V0GA 2XBLA 2VG8A 2KYRA 2P65A 3EW7A 2QZ4A 4MV4A 4WXPA 2FWAA 3QUAA 4L8FA 1FPQA 3DNPA 4MOWA 2QRQA 3CH6A 5CW1A 2W0SA 3MZ0A 5DWDA 1THTA 2DCMA 2A5GA 4UBLA 4UNIA 3KQLA 2X0FA 1DEAA 1AQJA 5BVHA 4F12A 2Q5JA 1DWOA 3VPDA 1E4VA 3G23A 1Z8DA 4YQEA 1T9AA 1D8TA 1IBRA 1NV8A 2QIOA 4YRCA 4YN3A 5JJIA 1EM8A 1Q12A 3PQ7A 2GLUA 5GV7A 4FKBA 1GRNA 1UDWA 3ZX4A 8OHMA 1HR0B 5DEIA 5BOSB 1TE2A 2R8PA 1T3TA 2D1QA 4JT4A 5IUKC 1SZCA 4TLMB 2HSEA 2I8AA 1YS7A 5JBNA 2RKBA 3GL9A 5HRCA 1W76A 3GJ8A 1SB8A 1N6IA 3MWGA 4A0HA 4P3OA 1ZJWA 1EFKA 3FMIA 3FLBA 3JQCA 5THQA 3AILA 2F1KA 2Y1KA 2CZQA 4UULA 1SD1A 5TXGA 1RXYA 2AMVA 4FN4A 5BWLA 4QHYA 5ITZB 1PQPA 5BNTA 2Y0PA 1GTZA 1UC8A 4G5YA 4K6GA 3AVOA 4ARCA 3NT2A 1ZRSA 3ETCA 4K5QA 2GFIA 3NM4A 4HATA 4UAVA 5L9AA 1OF1A 1ECLA 8MHTA 4B4DA 3M6IA 4XIGS 1OLXA 3DMYA 5EWJA 4H1HA 5F9FA 2JFWA 2H63A 4CKCA 1EVZA 4DIFA 1NPYA 1QIMA 2QX4A 3CZCA 4B81A 1CS0A 5FBKA 4WCFB 2JIRA 3NGMA 1XVLA 4OOEA 1FJXA 4TSRA 3A4IA 4KC0A 4HZGA 4BVEA 3KQYA 3RF6A 4Z4HA 1WJGA 2GYWA 3WNDA 1P1KA 5AK4A 5IKEA 4DCCA 1QZXA 5ETJA 1Y4UA 4J7AA 1CJBA 4J91A 4WQMA 2F62A 3B8EA 2CNKA 4YJ3F 4KLRA 2J87A 1DKMA 1ZK3A 3RSZA 3CR8A 3SQMA 2P62A 4DANA 1BXKA 2WLSA 1GZ5A 4G5RA 4Q1DA 2COKA 1R27A 4LKRA 1HFEL 1HT3A 5B7NA 2C07A 3F7NA 4G8JA 3VOBA 2R47A 3AF5A 3NBZC 1P29A 2UYOA 3H5WA 2YHIA 4PQFA 5KKCA 3MERA 4X1YA 1KE2A 3K1ZA 3M6WA 3O0DA 4IIHA 2O3JA 2XBMA 3S1AB 3AVTA 4CQMB 2GAJA 2AXEA 4UXJA 4C6TA 2ST1A 4DR1B 2NZJA 3ID6C 5A4KA 4PLVA 3UMFA 2O06A 4HQ6A 1N7JA 2GLXA 5F3DA 5DSZA 2VPPA 2HSZA 3RYCA 3EOZA 1KORA 4Q9LA 5DTJA 4CFZA 1CY6A 3ZV7A 4NAUA 5CXQA 4LOJA 4PPQA 1EEXB 4WACA 3HCDA 3JRWA 5G0WA 3QVXA 5AM5A 3WLRA 2XE6A 2YJZA 2C7BA 1GA6A 3U0VA 2H2DA 2Y0EA 1HE1C 4K9RA 5A06A 1YRBA 2CT8A 4OG2A 5DN6A 2WVJA 5K03A 4G1EB 2Z2JA 5MF6A 4F96A 1H8EA 1H2YA 2F9FA 3AZQA 3LDGA 2PL1A 3E61A 4N9WA 4RXUA 3ZW9A 1ZQ9A 5ALJA 1JVBA 2ODQA 1G20B 1VSVA 1PD0A 2BGJA 2FN9A 4GW3A 4XD7A 5K6TA 4HI0E 3AVVA 3FKSA 5KNDA 1EXWA 4J2OA 4H3SA 4BIMA 4BYGA 4ZHQA 1Z5PA 3HYCA 4X7RA 1E9AA 5DWQA 4CCYB 1M2FA 2VUIB 3UWPA 1F8YA 5F76A 3EZ7A 3SXUB 1UZUA 3GLIA 3RRMA 1BZYA 1L7AA 3DDHA 4JKYA 3EG9A 4RK1A