5JRDS

E. coli hydrogenase-1 variant p508a
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
264
structure length
264
Chain Sequence
KPRIPVVWIHGLECTCCTESFIRSAHPLAKDVILSLISLDYDDTLMAAAGTQAEEVFEDIITQYNGKYILAVEGNPPLGEQGMFCISSGRPFIEKLKRAAAGASAIIAWGTCASWGCVQAARPNPTQATPIDKVITDKPIIKVPGCPPIPDVMSAIITYMVTFDRLPDVDRMGRPLMFYGQRIHDKCYRRAHFDAGEFVQSWDDDAARKGYCLYKMGCKGPTTYNACSSTRWNDGVSFPIQSGHGCLGCAENGFWDRGSFYSRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrogenase-1 small chain
publication title Importance of the Active Site "Canopy" Residues in an O2-Tolerant [NiFe]-Hydrogenase.
pubmed doi rcsb
source organism Escherichia coli o6:h1 (strain cft073 / atcc 700928 / upec)
molecule tags Oxidoreductase
total genus 78
structure length 264
sequence length 264
chains with identical sequence T
ec nomenclature ec 1.12.99.6: Hydrogenase (acceptor).
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
S PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 5jrdS01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 5jrdS02
3USES 4KO4S 3ZE7A 5A4MS 1WUKS 1WUJS 1UBKS 3AYZB 3ZE9A 4IUDS 4KO2S 1UBTS 4URHA 3UQYS 1UBLS 1YQ9A 1UBOS 3MYRA 1H2AS 5JSKA 1UBMS 4UCWA 5JRDS 4UQLA 1FRFS 4OMFG 3ZE6A 4UPVA 1FRVA 3AYXB 5D51S 1UBJS 1UBRS 1UBHS 3RGWS 2WPNA 1WUIS 5A4FS 4TTTS 4UCQA 4KO1S 5JSUA 1WULS 3CURA 4UE6A 1H2RS 4IUCS 4IUBS 3ZE8A 3USCS 4UD6A 1YQWA 4U9HS 1WUHS 4UEQA 3CUSA 1YRQA 1CC1S 4C3OB 4UQPA 5ADUS 4UE3S 5JSYA 4KN9S 1UBUS 4UCXA 4U9IS 5JSHA 3H3XA 5JT1A 4UEWA 4UE2A 4UPEA 3ZEAA 2FRVA 4UD2A 4KO3S 4CI0B 5A4IS 4KL8S 1E3DA 4GD3Q
chains in the Genus database with same CATH superfamily
1GPAA 1ZL2A 1T1JA 4EH1A 1RVV1 3IQFA 4NTZA 1LVGA 3N74A 2QUZA 5F7ZA 2DHEA 3WISA 1DAKA 5A06A 4MUKA 2P2GA 3E7XA 4KMMA 4PG5A 4C6RA 2FW9A 5FUBA 4O8CA 3L82B 3RS9A 4Y2SA 1C0LA 4D4HA 2BE7A 2RKWA 2HAEA 3FUXA 5LKAA 1MIHA 1F2TA 1QZZA 2C1EA 4ZZ2A 3NPMA 3K9LA 4A0HA 2RHTA 2ZULA 2XA1A 1HYHA 2KW5A 1OMOA 2B83A 2Q62A 2AFHE 3AUUA 2XYPA 3FHCB 3P2MA 3W4KA 3CZ9A 1GPBA 2QN7A 1LF0A 4IKEA 1J9ZA 5DMHA 3LP5A 1MOQA 4WLUA 4B0PA 1NSFA 1ZKMA 5E38A 1UJ2A 3V1NA 1TRKA 1ZD8A 2FR8C 4NMLA 1D04A 3LOPA 4TUYA 4AO7A 4F6CA 2ZZKA 1L5NA 4C7OA 1RJDA 2QTVA 3IIIA 3TLYA 5LDGA 4H3KB 1ML4A 1Z13A 5FD8A 4FMDF 1G3QA 2C5FA 4CF6A 1OXTA 1U7XA 3EGXA 3QE0A 1SOUA 1VE1A 1BU5A 3A2LA 2WJ3A 4K81B 2HF9A 3VMFA 3AI3A 5C3UA 1YDMA 2A58A 4F60A 3VKUA 1YAJA 4M7WA 3IBSA 3UGQA 2X3YA 3IKJA 1L1QA 1QMGA 3ADPA 5CR9A 1TLLA 3EIWA 5JNLA 4J49A 4HJRA 5L51A 5KJFA 2Z8XA 1G5RA 3T7KA 3CY6A 1J0AA 3KYDA 4HLUC 2FPPA 3T9AA 2VH1A 4JFRA 3PT9A 1NSYA 4KQGA 3U13A 5M2QA 4JT9A 1E8NA 1Z4MA 3ZWAA 3ER8A 4WY8A 3N8KA 2XECA 1DBWA 1RJEA 2DVMA 2NYRA 3N05A 4XIFA 1Q84A 5IJ9A 2OCYC 1DOZA 2BFOA 3TWOA 1XU9A 1I1NA 3DONA 3W78A 4R0MA 3U2QA 4YREA 3ZLUA 2W6OA 1Q6YA 3HUDA 1FFXA 1L5YA 2FFAA 2R44A 4MVJH 4RHYA 1DAGA 1Z17A 4BQOA 2WFLA 1IBKB 2B4QA 4C5AA 2HWWA 3LFUA 4V02A 5IYZB 5ALHA 3ZHTA 4TWIA 1X7YA 4QFCA 3TL3A 3WWOA 2FWAA 3TOXA 1E8MA 4ER5A 5A6SA 2AI3A 2CXRA 3E9RA 2H1CA 1NWCA 3AUAA 5G4KA 1RKVA 4HZUA 1KARA 3M9LA 1QRUA 1WZIA 3KKPA 1E5DA 4ZDWA 5JH7B 5DVZA 3GLIE 4WASA 2KWIA 2VYND 3LZ6A 5BQPA 3SG0A 2P9YA 4KPEC 1S4MA 4NV1A 4LOAA 3SBOA 3NANA 1MABB 2YQ4A 3WA7A 3HLYA 2NXCA 2EW1A 1V1JA 5A5DA 4PWZA 4R9RA 1VCOA 1LCIA 2YRXA 4D6PA 4QPZA 3LAWA 1YS7A 1C7IA 1P9NA 2BFFA 2SKEA 4RSGA 2HLDA 5E4FA 1T8TA 2AN4A 1Z07A 5NLLA 3RIHA 4MW2A 1XL1A 3UW3A 2LUOA 3B9RA 2Y0DA 1NLZA 4PU0A 1QQ6A 3SQDA 1UADA 4C89A 5J4YA 4H4DA 1MB9A 3T1VA 4L0MA 2QV7A 4ZU6X 3S3TA 8ABPA 5ALKA 3HCNA 1MJFA 1TYDE 2OXEA 4JA0A 2HO4A 3U3MA 1GCAA 1DQSA 2MOKA 4QU5A 3WQHA 1GN8A 4L22A 1L4LA 3ZHSA 4XB6B 3EW9A 2OYRA 1M2OA 1A88A 3G6WA 1AN0A 1U8UA 2EFCB 3IJEB 4MVJM 2WUEA 3LP6A 3V80A 1NXVA 3GFRA 5DBGA 1UAAA 5D3KA 3GNTA 4HG2A 4Q9KA 3FD8A 4GPZA 5HF6A 2YXPX 2XSZD 4QU8A 5LBTA 3ZIAA 4ACBA 5B58C 3BF8A 3DP9A 4RJKA 3T6KA 3QVTA 2BYTA 1ISFA 2C92A 4QFMA 3I45A 3D0OA 3INYA 2HNKA 4Z3DA 4B32A 4NJMA 3NFRA 5ITSA 3RBZA 4RD4A 4I50B 3SX2A 3KKQA 1IBLB 2F17A 4I1PA 5ITZB 1BWRA 1GPH1 1J8MF 2EXXA 2FVYA 3PDUA 4GC5A 4JP2A 2IGBA 2F67A 4QTYA 5AW7A 1TA0A 3WK5A 2OOKA 4L74A 3GLKA 4B84A 2I2WA 1X9GA 1XIVA 1O7JA 2RC6A 2OWDA 4NMWA 4WHMA 5K20A 3U44A 4GZMA 4G0WA 4MYSA 4O4IB 1PGQA 1PG0A 1HH4A 4EF5A 5BOVA 1M1NA 5MFZA 1YRHA 4KGVA 4Z8YA 1RMTA 2NSLA 3F4KA 3NXSA 3HVUA 4FILA 2ZCJA 4G5XA 4W1PA 4BXOB 2XE6A 3BCSA 3X44A 1V48A 2QQGA 3VPFA 3C5WP 3SVTA 3DEJA 3KOUA 3QH4A 1ADCA 4FCCA 3JRNA 4Z9YA 1FEZA 2R86A 4MEBA 1M72A 3CEPB 2IPXA 3II6X 3PUZA 1Y9ZA 3X2SA 5F2NA 3CKLA 1TCBA 2QVGA 4HGYA 4RDCA 3SIWA 1NBMA 2C9BA 2FV8A 5AK5A 4UUNA 4C2UA 3PGVA 4HPXB 1B74A 3E05A 1CRQA 1TJ4A 4FFWA 4DQVA 5L4NA 4MWBA 2O0KA 3MT8A 2ZR8A 5CJ2A 4EI7A 5IS2A 2Q5FA 3HDYA 1SHKA 5KQSA 2AMJA 4XB1A 4BAGA 5KEIA 4OOEA 2PXCA 1DKRA 3H84A 1C2TA 1XLTC 2ONJA 2LDBA 4Z9AA 4DV1B 1DEOA 4PGHA 5BO5A 1IM2A 5EWMB 5HGXA 2OFFA 5LB2A 3T3IA 1QNLA 4C3VA 3ET4A 3E8XA 3JVIA 2O3QA 5EE3A 1V2HE 3NAMA 5DCLA 3W5SA 1UR5A 2A30A 1CB7A 1RWWA 3CJTA 4Z49A 2LIPA 2OZLB 3C1UA 3VR4A 3V9PA 1MG5A 1CUXA 1LBSA 1L7AA 1QYRA 1NRIA 2X2OA 3WL3A 3WRYC 3MBIA 3TCXB 4DVJA 3BYZA 3LUPA 3PZRA 3AEQA 3PC6A 2OILA 3GLSA 3QYJA 4QUGA 2J5KA 1CG6A 1JWAB 3AU8A 3BE4A 4G0PA 1SXJB 1EGVB 2BHLA 1FU8A 4OQQA 5TMPA 3FPAA 1Z73A 2C1ZA 1L7BA 3ENWA 4DQUA 1ISHA 3D4IA 1A4RA 3UH0A 3C3JA 4F11A 5ALXA 4Z9BA 2XQKA 3LY8A 1A69A 3I3SR 2RBGA 1GAJA 2PR2A 1D0SA 3CCBA 4HO1X 4M53A 4RUKA 4ENTA 5FWNA 3HBFA 3C7DB 1O0CA 2AG0A 2VI5A 4H4CA 1RHRA 3PGMA 4I8XA 1OH7A 3C3CA 1UK9A 1UPBA 5H82A 3A11A 5A4MS 4GMKA 3QHPA 5DCWA 5B3JC 3AYZB 1PDVA 4RIEA 3STWA 1IN4A 2V4UA 3FUCA 1OQAA 3LUKA 2WUVA 2F59A 3BMCA 3BN3A 3EAFA 3MQ4A 2OXFA 1V41E 4GYKA 2YW2A 3JVUA 4RMIA 1T5DX 3DMTA 5AK0A 4M1WA 4N5IX 5K3BA 4YRIA 1U94A 1WCIA 3GPLA 2ZJZA 4ZAWA 4PZYA 4EKYA 1L4EA 4MDHA 1VLHA 2XADA 3U7HB 3DXZA 3TNJA 2OR3A 3GVIA 2FSHA 2NO1A 3D3QA 3QIVA 3T7IA 4DMLA 3C4VA 1BS2A 2J0UB 1KMCA 2RAFA 2AJLI 3G7SA 4RS4A 1WHTA 3RSZA 4J29A 1J8YF 5DLDA 1W5TA 2W6JD 1N2OA 2E2WA 5ALVA 1C4WA 2VR1A 1XZAA 1KI6B 2AZ4A 5IP5A 3RHSA 2JLYA 4BZZA 2F64A 4A4DA 1O5OA 3THYA 3KPJA 4FOOA 1ISRA 3W2HA 6AT1A 5JS8A 1E0AA 1H93A 2VUUA 3I28A 4UZEA 3K9CA 1UMKA 3FFBA 4RD0A 2J9YB 2RI6A 4HDSA 5CFRA 1DO8A 5T4BA 1QOQB 1E3IA 1E5XA 3HVHA 2VPPA 4O0MA 4DIBA 1VXRA 3WK7A 3I8SA 4N18A 4DBLC 3ZDCA 5BW5A 2ZWIA 3IFSA 4QULA 3G7NA 2CV0A 1H5QA 1ODSA 3EIOA 3A4LA 1PL0A 4IZIA 4BGUA 5TEVA 2LD4A 3K4HA 1G0OA 4YX9A 4Y6LA 3ONDA 1CUAA 3FYUB 3ILHA 3QEKA 1QHIA 3U0BA 4LQLA 1I2BA 1Q7TA 4KRFA 4BFYA 5HKKD 3C1OA 4Y2VA 1KYYA 3QX8A 4DHWA 3B89A 5B1IA 2Q5OA 1AF7A 2WINI 4ZVUA 3CLHA 5KC9A 5K4AA 3TJZA 2W0MA 5IVDA 2P69A 4NLLA 1TEZA 3DF7A 1HOXA 3MA0A 1US8B 1RLTA 2HBYA 4MUIA 4AROA 3SJCA 1P33A 3A28A 4GGMX 1GA4A 4FMDB 3FB1A 4CMEC 3CWZA 3HFGA 4L0DA 2MSDB 2ZI5A 1SC9A 1SZJG 1A1SA 3OZSA 4G8JA 4H3HB 4YDRA 3AFIA 2ATVA 4YMUA 1FSSA 2NZJA 3DE2X 4DLLA 1NJ1A 3IAFA 4QRDA 4E1VA 3PFBA 3FWHA 3VR2A 4BEWA 4GGOA 1JHAA 4JXKA 1CT9A 4CT5A 1KZ7B 3H1GA 3JVVA 4KR3A 2J87A 3JYPA 1DAFA 1WXHA 4LF5B 2IP1A 4HDAA 3WGUA 2RARA 3TFOA 1XD2B 3HDQA 1UP6A 2O0LA 1ECJA 3GFTA 4Z0NA 2ZB2A 1Z7EA 1GPWB 4H7DA 5C1IA 1Z5PA 3MJEA 4U7GA 2PFKA 4INAA 4M87A 1DZ3A 2R751 4CIYA 2LE0A 4BO9A 4COKA 4CDNA 3BB1A 3V4ZA 3PDJA 4PZCA 2I80A 2A0YA 4IS2A 4P4LA 2WTEA 4DREA 4QXMA 4DJTA 3EF0A 2H2WA 4MR9B 1XN1A 3NIBA 5H8WA 2C8LA 3KUXA 3ROPA 2DQ4A 3RS3A 3DBOB 4Y9TA 4BNWA 2ZJ0A 3U81A 4LG1A 4LYDA 4DSNA 3KR0A 3RRNA 2WWIA 3WTBA 3L06A 1JQLB 4C2BA 3ZY2A 4AC9A 3TUIC 4DRYA 2GF2A 1XYYA 2HO5A 3KT6A 2C1XA 4A0RA 3EAGA 3HNOA 3AJRA 3BTSA 2AF4C 2FEWB 1U80A 1Z6AA 3BMNA 1QQBA 1WZEA 3N2GB 4G5YA 4MWGA 3ADBA 5EKDA 4MIKA 4MI9A 4D9GA 1Y7IA 2KX7A 2PLFA 1OA1A 4N5LA 2BP7B 2H16A 4C4PA 4CL8A 4KAFA 1Q1GA 3S5JA 1UXJA 1V4VA 4DYDA 2P9ZA 5AICA 3GIWA 4DIEA 4HSEA 1NOKA 1CY6A 1OV6A 2VJMA 1BQEA 1U2TA 3ZTWA 1FX0A 3HSYA 4DC0A 3PRKE 3TQRA 3QKUA 1KSJA 1RDFA 3EA4A 5J4LA 4ERXA 3AUFA 1QYWA 2IXAA 4OHOA 5DISB 4PQYA 3WWCA 1GPUA 5CVCA 2Q7XA 4AUNA 4NCJA 1FXWF 5M7EA 1YZNA 1OAKA 2NVUA 5CEEA 1BFUA 4RXTA 5B58T 2GHTA 2CXSA 1Y1TA 4O4HF 3ZVKA 3W6PA 1XTPA 4WCVA 1H9CA 1TRHA 2W11A 3QBEA 1J5XA 2CNBA 4J2TA 1N2CB 4Y1FA 1MR3F 1GSOA 3HCAA 1WRBA 2ZB8A 3E70C 1AK2A 4I9GA 5AESA 1HKUA 2AJCA 2P8JA 1XJ5A 3KJIA 1P4HA 3RUHA 3WC4A 3WMRA 5B1YA 3HTXA 1ESEA 1RQPA 3T5GA 3IBCA 5IJ0A 1Q7RA 3AEZA 5KTYA 4DV2B 3B12A 1VHTA 5GZ6A 3HWRA 3L46A 3BC1A 3RC7A 3I6YA 3PJRA 3KVNA 3VGPA 3ZWPA 2P1DA 4FGKA 4RZSA 2AJBA 4Z9XA 4F7DA 3OVMA 3GJ7A 4BWVA 3KZXA 4PY2A 2RGAA 3U7EB 3TLMA 2B8JA 2CJWB 2F1JA 3IP7A 3KQSA 3PE4A 3DD5A 4ZKDA 4AIIA 4C4ZA 1IK4A 1Z4KA 3QV1A 2VTBB 1Y5MA 3FGPA 1NY5A 3C70A 3MFQA 2OAEA 4PX5A 1QFZA 3ND7A 1XGKA 4X61A 3DTVA 4F9FA 1XEWY 4WZBB 2NTNA 2IEYA 3D5QA 3LY9A 4P22A 4PLZA 1CR0A 4R2IA 1YRAA 5GJBA 2DQSA 3ZZNA 3H5VA 2IHBA 3KFVA 4WZZA 4I81A 5P8WA 3R7WB 4QJ3A 2F4NA 2YBEA 5JYEA 2QAJA 4C3UA 2GA9A 2VQ3A 3K9BA 2Z1DA 3GGGA 2CKMA 3NBUA 5IF9A 1JVNA 5GGXA 3N6XA 3ICOA 4PGMA 2BELA 3OESA 4UTXA 4WXEA 3GDGA 5SZJA 4C4TA 3HA7A 1U2DA 1BHQ1 5KQPA 1F7UA 4HS9A 3B1ZA 1IXSB 3BK1A 1SEVA 2CDBA 3EIQA 1U63A 4JSRA 1P1CA 2ZYHA 5JC8A 4BNUA 2BHNA 5FYQA 2TMGA 1EVLA 2CKDA 1AKWA 3ZDRA 4PYJA 1TQ6A 3T5AA 1H94A 4IKPA 3JVEA 2ZS9A 4I46A 2X19A 4LK2A 5AKLA 5A7GA 2IBMA 4JLMA 2D06A 3L02A 3ZD7A 4EQ6A 1QGZA 2E55A 3LCJA 5ALLA 4DNPA 4EVSA 2Z09A 3U7JA 4CTMA 5CW2A 4C9BA 3ZHRA 1QFXA 3AF1A 3R3HA 4F9TA 2ZI9A 5IPFA 3WL5A 1W34A 5JCZA 2DSNA 2WYWA 5DWQA 1JN0A 1UFKA 2B7BA 4R3NA 2B36A 2CB9A 1YQUA 3L6BA 4II2A 4BVKA 1JXOA 5KMGB 3DGFC 4OBWA 3A1WA 1C1DB 1ZD2P 1MJNA 3DT9A 2XYQA 1X9HA 2O8FA 3HDGA 3PC8A 2YZNA 1CY7A 1EE1A 3G0BA 3JPWA 4L8GA 1QFMA 2E89A 1ZNWA 3KJQA 2Z8YA 4NE9A 2REBA 1XN4A 1VE3A 3KQMA 1N4AA 3RGGA 1USIA 2OD2A 4HAVA 4EHIA 4MHOA 2XNDD 2IY7A 3E82A 2I3BA 2CL6X 4H15A 5AVKA 1VLMA 2J0QA 2A4MA 4EI9A 3RFFA 2VHYA 1ZH2A 5DNAA 3RS4A 5J2TA 4B3TB 3M1LA 4PHGA 1P29A 4D3XA 4F3TA 5E9JA 5EFZA 4AZ0A 1C2YA 2WNHA 3KZ1E 4M4SA 3NAQA 2P30A 1I01A 3G2JA 4KITB 4JY7A 4PR0A 1QKJA 2JHPA 4PLTA 5IVIA 1LEHA 4FFBA 5FWDA 1NJ6A 1XA3A 9LDTA 1XO1A 4IDFA 1J7KA 1P31A 2P6MA 2QORA 3BDAA 2X0DA 5ESWA 5BXYA 2JCVA 3ND5A 1QX4A 4RACA 4UATA 3UT5B 3RKUA 1OJ7A 2EZTA 1JNYA 2D8MA 2YDXA 3SCZA 4OHFA 3B48A 4TTIA 1VLQA 4QODA 4ZT6A 3DVQX 5CIYA 3QEAZ 2QU8A 1Z2NX 3BL6A 4KLAA 3PGA1 4X8LA 4Y3UA 3U40A 1A8SA 1TZCA 4MQMA 3H1AA 3KXDA 1CRLA 3N8IA 4YUWA 4LXGA 4XUDA 4A8JB 1DPGA 1EVYA 4NJEB 3L0SA 2VRBA 4J7CA 1X14A 1U7PA 3TQOA 2AXNA 3P0HA 2K2QB 1X1DA 2W00A 5KTTA 1N5IA 3U6KA 4MS3A 3ONWA 1ANKA 3ZU5A 3N6RA 3X1YA 3PWTA 2RH8A 1OYYA 3GZNB 3K1AB 3GGSA 2Y6UA 4KE6A 4IH4A 1DC3A 3SIXA 1Z83A 1V3VA 1SFRA 3R41A 2Q5IA 1XZDA 3B3AA 3BIOA 4PHFA 4XSHA 2E5WA 1UDCA 1HEUA 5EJFA 3EODA 4OGWA 4PLFA 2D1YA 1OLUA 3ZBUA 4D97A 4UBJA 2HH9A 1XCMA 2FN8A 4FUQA 3GHYA 5BMVA 4GEKA 2XA2A 4Y7DA 3O2QB 5D01A 4MQFB 3ZD9A 5EQTA 3MFYA 2DRIA 2EC5A 2JKYA 2QPAA 3HWSA 3JYNA 3KJFA 4PCAA 1FTGA 5EESA 3NYIA 4KIWA 5JZBA 2IUYA 1EDZA 1Q1BA 2WMYA 4UULA 1Q0LA 3BRWD 3NHSA 3SSAA 5C8YA 5CPBA 3T1OA 1IBCA 1KJZA 2L18A 2DHQA 1FYWA 4TWBA 4TWZA 2YZKA 1QMPA 5AKHA 4QTUB 1RAHA 5EZSA 3P20A 3DV9A 1AS3A 1VKZA 2ZRQA 3ZI0A 1WVGA 3CH7A 3ZCRA 1V7CA 2VJOA 1QKIA 2XOKA 4L57A 5A7FA 4I4TB 1W2HA 2O8CB 4AMVA 1MAHA 1SUSA 1DPFA 2C97A 2VATA 4HB0A 5BP7A 1LS1A 1YUNA 3BTUA 3JQFA 4PFJA 2PX4A 4EUEA 4B6EA 4Z7OB 1QZXA 4E11A 3D8NA 3SF0A 3HWX1 4QT4A 2GCOA 1JR2A 2GJ4A 3FPHA 4LE2A 3HN6A 1V3QE 3A9TA 1YU6A 3W7BA 3WKEA 4DM7A 1WKBA 5JYDA 1WMBA 1QUFA 4M99A 4RD3A 4FSHA 1SXJE 5G53C 5EE0A 3N5CA 3W2TA 3ZKWA 2B7CA 2VNSA 5FR1A 2VDNB 5KYKA 3R09A 2X0KA 1LGYA 3NGMA 1N7HA 1N57A 3DMDA 3VHLB 3GT0A 5D3MB 4AIRA 2YV1A 4Y6GB 3THSA 1PW7A 4HRVA 4RK7A 2DFPA 4INOA 1BN6A 1K4YA 2VZ9A 5F3WB 2P90A 3LQYA 1XHLA 3FLBA 3IAUA 5CURA 1XDDA 4YAFA 1ESDA 4PZLA 1RXEA 1V1MB 3E9MA 3COJA 5JWOA 3U3XA 4EFDA 2JFYA 3K8QA 2GEFA 2Z2JA 5JRDS 4CU5A 3LPAA 5LQSA 1W46A 2EATA 2VSOA 1H0HA 1WBJB 1G21E 1DJOA 3RWMB 1R7RA 2YVUA 3EX7C 5JAQA 2D59A 1K75A 4B7CA 1C0KA 4U7HA 1Q17A 1LLCA 2ROQA 3V46A 2XF8A 1KS2A 2RGDA 4L0CA 2C7OA 4S24A 3GLGA 4RKRA 3KOOA 1XZNA 1IY2A 3AM4A 4ND6A 4FS3A 4KYUA 4R6WA 5F2EA 3GB9A 4Z1OA 5B53A 3IPXA 2O2GA 4M7OA 2PX2A 3OPQA 4L5YA 1JL3A 2V54A 3DG9A 3PUIA 4N4AA 4X60A 3UKOA 4MRVA 4PYIA 4XM1A 5HS6A 3TLBA 1TO1E 3DOOA 2AN3A 5A7HA 5I4IA 4GPIB 4URWR 3TZEA 4XJSA 3V1LA 4EB6A 5IN4A 1Q11A 4D0NA 1CIPA 3EXG2 3CSSA 4PPGA 3SJBA 5KNDH 2CYBA 1Q1AA 2LP4Y 3A3YA 5CT8A 4EMBA 2QRZA 3FNBA 1DJQA 3RV4A 1CR4A 1HETA 4ARBA 1B6GA 1C3OA 3X1KA 3IAM6 3MRTA 3WGKA 1IJFA 4CKWA 1JMYA 1JLKA 2O2EA 4ZHQA 1O0BA 4MW1A 3QFCA 4PZUA 3GFFA 1HX7A 1BS1A 1N5LA 3PFNA 3IIMA 3W3AA 4X20B 2PQMA 5IAAA 1JEAA 2WAYA 3PUXA 3W4IA 4YQFA 1CUYA 1PFVA 3TCKA 1L4KA 1RZRD 1RLJA 5FBHA 1TMOA 5ECDA 3BGSA 2YZGA 1AF4A 2DFDA 3ETCA 4D9HA 4YALA 1QK4A 3OP4A 4YWJA 5TT0A 3RVRA 3A32A 5FPQA 4ONEA 1P91A 2ZGVA 4C08A 2X0JA 1NXTA 2IIQA 2HK9A 4WUTA 3ITEA 4PX2A 5KJEA 2QUJA 4IJWA 2GPNA 4NBSA 2IYOA 2IOYA 3KU4A 4MKXA 2ZAYA 2I55A 1PZNA 1VRVA 2QJRA 3K9QO 4K28A 4QUHA 4LJ7A 1XA4A 2OA0A 5GTDA 3TB6A 4NCHA 2NYVA 4YCCA 1U7OA 4LBZA 2ADOA 1E1YA 1SWVA 1MAAA 2MYPA 3H2SA 4CLRA 3BWVA 2N9UA 1AB6A 3K0AA 3HGQA 4JKYA 4P3YA 5AXAA 1KO5A 4V0KA 1DO0A 2FRVA 3RD5A 3V7FA 3KZOA 3OY7A 1CQZA 3AESB 2QJTA 1U8FO 1V5FA 2OEPA 4UHBA 4BQFA 3G0DA 4PZAA 4TL9A 3EZXA 1SCAA 1BEEA 2CN1A 2OP1A 3R6WA 1K27A 1UXOA 1E9VA 1Y7PA 2NSDA 5L3QB 2JB9A 3S70A 1ZH8A 4BJ6A 4DDWA 1G7TA 2VBIA 1X7XB 4W5JA 4CHGA 4U8GA 4LXYA 4Y30A 2R7LA 5EG5A 5F2KA 4CF4A 2E3JA 3LUCA 5EYPA 1J1UA 3LHIA 3R9XA 1NVKA 1T0PA 1TKRA 1Y89A 2CCGA 2QYHA 3D8HA 3EMKA 4AWXA 4G4SO 2O05A 2IYXA 3FFXA 5CT5A 1EIZA 1LW6E 3RYCA 2IT1A 2ZATA 4G5HA 3NWJA 4O1MA 3T52A 4BVGA 5IYZA 4Z4QA 1ODLA 2H4XA 1K08A 3IUYA 4KDFA 3MSXA 1TVKB 2ASEA 3BRSA 4ZAVA 2ZYVX 2FX3A 2H1IA 3MUOA 4L72A 1UQUA 1WD5A 4G0XA 4UTOA 3EPKA 4DC9A 2IL1A 4E5KA 1H0KA 4WOCA 5L9AA 4C4AA 1R00A 2QT0A 3FNQA 3VSAA 1JAHA 3AFGA 3AUYA 4RNDB 2C4HA 5BWBA 1EQ2A 3OLXA 5DHRA 3H16A 3V6LA 5DN6D 2UUAB 1KXZA 4C4OA 4XJXA 4ILEA 5H3HA 1E6WA 1L4NA 4HEQA 3SHWA 1AXEA 1FRVA 3C6QA 3DQZA 3TZKA 1V4BA 3HBAA 5DYGA 3DAPA 3UJ8A 3L1UA 4Q9LA 4EQZA 4CIBA 4FKZA 3FTFA 1E69A 4LY6A 1G20E 2EFJA 3OICA 4G1BA 1H2WA 4NE7A 1C4OA 4V3CA 4QO7A 1IUNA 2YWDA 1R8QA 3CRMA 3GQBA 4FC7A 2C5BA 4OEHA 1NIJA 4LJLA 2UXDB 1HLGA 3RIEA 2HA3A 4M0PA 2XOXA 4FEAA 5KQRA 1HE8B 3LC0A 1J0DA 4MQUA 3AJ8A 3VOTA 2C96A 1BOFA 1XJWA 2EJCA 1VJ5A 1TGYA 2G09A 3NT2A 5HCUA 2J6IA 1KDTA 2AOUA 3LOUA 3PD0A 4IWXA 1KFKB 5AIBA 3WYEA 3HS3A 3I0ZA 3W8FA 4YR7A 4PE5B 2FW6A 3SOPA 1N2CE 3KVYA 3FPCA 2C2OA 1SQGA 5F52A 1YZTA 4NNOA 4P4SB 2B92A 3UHFA 5CDHA 5L8VA 1QOZA 4KGXA 4NOMA 3OFVA 2FMKA 3MWEB 3AUXA 3LOQA 5IANA 4EHHA 4Z54A 3EEYA 4HQOA 3EIUA 4ZK6A 1OXVA 3GA7A 4AJNA 1JAZA 1V9SA 1P2SA 2RGGA 1QHHB 1QIEA 4HNQA 4JZKA 5DOZA 3FX2A 1Y6FA 1SA0B 2ZBEA 5HSGA 4MJLA 3JXEA 4EEKA 3I9FA 1P0PA 1GZ3A 1M8KA 1F6DA 4J2OA 2XRZA 2NIPA 3JYQA 3IHTA 4BEVA 1GR1A 3KEQA 2ID7A 3H9JA 3IERA 3OCWA 3W5HA 2CEKA 3GRYA 5TQJA 1VZ3A 2ZQYA 1O95D 4EI2A 1Y4UA 3RUEA 4E2ZA 621PA 3NHFA 4MVJI 5DGCA 2QKYA 5E2AA 3GUCA 1G59A 4W6ZA 5BXQC 1JDSA 4UE2A 1OYWA 3L4BA 3LCRA 1EWVA 2AW3A 4N54A 2TMKA 1ZMOA 1EZ4A 3C24A 4Y1RA 4HAIA 4OUDA 4UPEA 5K03A 4X65B 1EXNA 2JA1A 4UBNA 1IHPA 4DCCA 4KNWA 1P5HA 1M6HA 2O7NA 4W5RA 2ZIXA 4MVJA 4YB8A 4C30A 3WRXA 4ALMA 5ES3A 5K0ZA 4M1QA 1C30B 5B1EA 1W48A 4GMHA 2XQIA 4CGZA 1A5TA 4UVDA 2FUNB 4FSXA 2RMKA 5LB4A 4OGGA 1ADYA 4F6LA 2W6ZA 3UVEA 1H2EA 2NYAA 1ADFA 2O0HA 5BMOA 4N8EA 1CY0A 3OTIA 4B3HA 2EARA 2OO5C 4AFNA 2FX5A 4MWZA 3JATB 5CVUA 3U4HA 2KJQA 3J7AC 4Y1EA 3GAAA 2QTGA 1U1IA 4QECA 1ZMBA 2HMWA 2ODQA 4WN9A 1Q0UA 4E2WA 4DR4B 1FP6A 3URMA 5CXXA 3M81A 1R4ZA 1Z2OX 4AUMA 2W2LA 4IJQA 2G9RA 2WABA 3GJ4A 3UMVA 4D0LB 5LL6P 2IH5A 5FI5A 3VPSA 4QFDA 2OY0A 5JSZB 3LGAA 2AQIA 4XPZA 5JYBA 1KYZA 3ZOKA 1ZOOA 3CJQA 2I7TA 2PKWA 2BBSA 3LBIA 2V7QD 3MWDB 4HNAA 2BR3A 2PPLA 2ZRCA 4H0FA 4IXNA 5GIPE 1AE1A 4U2GA 1G8FA 4R9NA 5EZYA 2ENWA 4F2WA 4NYJR 4N76A 5LZ7A 4Y2QA 2PDAA 4E7OA 4YCLA 4NBUA 4OQEA 2OBLA 2PIDA 2D0OB 4P5PA 4EZBA 1E96A 1YL6A 4Q6WA 4L9RA 2ZSFA 3P1JA 4HWSA 4PBTA 4OXIA 1XE3A 5ALNA 5CP8A 4K6OA 2N0SA 5KO2A 1OILA 1TMGE 5GONF 4FN5A 3OEYA 1TTTA 2Z5FA 2H4JA 2J8ZA 1MZPA 2C29D 2X2FA 1KH3A 1T8WA 1RC1A 2I4NA 4BECA 1EAYA 3KIPA 4B3FX 1AG9A 2VPWA 4UEKA 3IAM1 3O3MB 3S2ZA 1JB9A 4ATNA 4Q19A 3I2FA 3ENZA 1XUOA 4GI3A 4QUIA 1T1RA 2WVGA 5KCZA 1T2EA 3TLGB 3VI3B 3E5MA 1MFPA 1G2QA 2A67A 1X2BA 3M6AA 4ZYZA 1Y4AE 4KN6A 3CR3C 5LXTF 4AJEA 5IC4A 4PSVA 2HIMA 4Y0AA 3J81A 3LECA 4G1VA 2E4VA 4INZA 4GPD1 4RQAA 1Q7BA 4TMVA 1C1YA 3T7EA 2IPNA 1ZUNA 1NKTA 1KMIY 1U28C 2A5JA 3KWLA 1EVQA 3C6BA 1N5RA 3FWYA 3QQ5A 2WJVA 4Z2AA 3LBYA 3OU6A 5U4QA 4K86A 5AKEA 3F2IA 1R9MA 1MGOA 1U2RA 1ZDMA 3A1TA 3QRWA 3O4HA 4LXUA 3RC1A 1I1QB 3CRW1 1VJRA 2RG7A 4FGWA 4M88A 2XCRB 4YJFB 1Y3BE 1ECBA 2QDXA 3CUSA 3DOJA 2FETA 1KHTA 4G6ZA 3IRUA 1D6JA 5DGIA 1NM5A 2PU5A 4JB8A 1U4NA 4EVQA 2PNJA 5K7SA 1JS1X 1ZJ5A 4G8CA 3BX1A 4WUVA 1DJPA 1EE9A 3BFVA 3QOXA 4J94A 3IULA 3V4RA 1SVOA 2C07A 3A7DA 2GESA 2HQOA 1YKSA 4CEHB 1BA2A 3WDSA 3PEUA 3PENA 2NVWA 1RAFA 3DT6A 1D9ZA 1VI2A 2QX7A 2TECE 4B2LA 4YMLA 3BHMA 1FLVA 3IDOA 4LCJA 5JFOA 4PRYA 2HJHA 3KYCB 4L9SA 5FUQA 4DC1A 4JJ7A 2RK6A 4GECA 1GT6A 4OHMA 1AKUA 3KKLA 4RPHA 4Q1AA 1ZEMA 2Q1YA 4YGXB 2BFAA 2AX4A 3ANSA 5DN9A 3RYIB 2PMWB 3AEUA 1TM3E 1Z68A 2V7PA 1Y1LA 3UJPA 3V2HA 2VUIB 4Q4DA 3F49S 5DNEA 5HTOA 3U9LA 5KYUB 5FA5A 2A84A 1DC4A 1NZDA 1STOA 3GJ5A 2WK1A 3ON5A 4QSHA 1P1BA 3KAPA 4H2DA 4IG9A 1QYXA 2PH3A 3HDHA 3U3KA 3UJBA 2D0PB 2ZYWX 1IBMB 2Z6VA 2QVBA 4MMXB 4DAOA 4ZC8A 2W4IA 2QQ0A 2HPHA 3CNNA 1E89A 2GEJA 3I64A 3A58B 5JAHA 2GAAA 1U7TA 2RJNA 2GZSA 4RKFA 5E1BA 4BO2A 4CCSA 2EJBA 1E7MA 4JSYA 4AKHA 4YY3B 2AW5A 1BXZA 4KX5A 5FUVA 1SBHA 4HPJB 3UHAA 2IEIA 2NW6A 4RVFA 5JD6A 3CUTA 1C7RA 4HNVA 1U1FA 3KKNA 2BE9A 2ZUSA 3S55A 2V6BA 4Q5IA 2IBSA 3Q0IA 5BSWA 4UQLA 5CUQA 3Q8WA 1DAEA 3USZA 4KW7A 1NXWA 1DKQA 1EBFA 2JC3A 1Q7GA 4D02A 4DG8A 5HZHA 3B60A 2GHIA 5JHHB 2FZKA 3F3SA 2XMSA 2GKSA 1FUUA 1U0OC 1XF1A 3EXEA 3GUHA 1M66A 4TPKA 3WQBA 4PO9A 1JILA 2VKQA 2XMDA 3LL4A 4KOEC 2OV4A 1NNUA 3TQSA 3RUAA 4TSFD 1DIRA 1KPIA 4DWWA 1GTVA 4L85A 1OH6A 3E6AA 4LRQA 2GBLC 2JFHA 3S27A 2Y2VA 4E12A 4CT0A 4QXOA 1J0CA 4U1RA 4B2YA 1GNSA 2WM9B 1Y33E 1XRPA 2HSJA 3RQSA 4H7FA 1ADJA 3GNQA 4OVKA 1GR0A 3KAJA 1Z6TA 2ATCA 1VIDA 2NYUA 2J32A 3JR3A 4D5GA 3ABQB 4F71A 1II0A 4WWHA 3OO0A 5KYGA 3S1AA 4G5OA 2BKXA 2JJ2D 3Q7QA 3QG1A 3OF5A 2WD7A 2XDQB 3C1TA 4IJMA 3OUZA 3G59A 3OZFA 5K99A 1KFEB 5AHWA 2VAPA 4EEZA 5E6UB 1BMFA 1YDHA 2VJPA 4YCDA 2POQX 1LRKA 3I37X 3HV0A 2MT9A 3NWPA 1CK4A 4QATA 1U5BB 2VHTA 2HF7A 1ONBA 3QU7A 4OJQA 4PC7A 3GW8A 4K9DA 3IE0A 2FMHA 5ALIA 3SOZA 1HT2E 4LK3A 4RQBA 2QE7A 3HFSA 1Y7HA 5FTKA 4D0GA 4ENUA 2B1JA 1A5SB 4JJ4A 2ZWPA 4G2TA 1Q92A 1U04A 2QRVA 3R0IA 4LCEA 2NP7A 4JVSB 1PX2A 4BMVA 2Z9BA 3A1NA 3KALA 3HN7A 3W6ZA 4WBNA 5ADUS 4UE3S 3L1JA 1JFFB 3A14A 5J9FA 4MYHA 2GAJA 4PFQA 3R5XA 5EXPA 2HA4A 2J3JA 3IOEA 3NTXA 2GCNA 1YHZA 4BNDA 4V0RA 2BRUA 1YOVA 1N5JA 3DKRA 4NBKA 3U4AA 1GFWA 4MJXA 4DLKA 3CPSA 4KIGA 4JH0A 5HK9A 3ZWWA 3ETEA 3KVRA 4WX2B 1S2NA 4EAQA 2HI0A 4J7AA 1L1FA 5CDFE 3WGHA 4RJIA 2RGNA 4E2FA 2ZVPX 3H4IA 3RSOA 1OFVA 3PR2B 4MUHA 4ER6A 4YN3A 1GEGA 2QROA 4RO0A 5TQVA 2AMFA 4JLBA 3UMRA 2O1EA 1O6CA 5B7PA 2UYCA 3FUWA 4FLEA 4C43A 3R7LA 3ABOB 4M0EA 1XAJA 3MZ0A 4OM7A 2WZDA 5ALGA 4OQMA 5C35A 1KYTA 2D5CA 4X5OA 5EE5B 1ETUA 1GILA 4ZVVA 1C3XA 4PHHA 3ZDYB 4WGGA 3PU6A 1A7AA 1GPYA 3O4VA 5CFQA 1AGNA 3EOBI 3ZHYA 5KVSA 4PX3A 3T7JA 3LY5A 4W1QA 2NU9B 2XZPA 2FOXA 1GKUB 4C14A 3D1VA 2CLCX 3LF2A 4Q00A 2OQVA 3TSCA 1T2NA 3L8MA 2GF0A 2ZBDA 1Z5VA 1SVIA 1V5WA 3JQQA 4L5IA 4RU1A 1HQCA 3N2NA 4DBLE 2ZKIA 3JSAA 2CT8A 5LZ8A 1BVYF 4FDVA 1CX9B 2YFQA 4Q4JB 4TT3A 5MHTA 2QRUA 5DM4A 4E94A 3RSCA 4BNKA 4DWVA 5JISA 5TIIA 1JE1A 1SKBA 2L69A 1Q12A 1CETA 1GRNA 3OIWA 4M1ZA 3UOAB 1XWIA 4OHXA 1O08A 3PNBA 4BKRA 4GI2A 4E09A 1GNLA 1BGWA 1X39A 3OHMA 3QKRB 4R81A 4D44A 4HAWA 4DZZA 3KXLA 5EIFA 1RMYA 1W19A 1YGYA 3TBKA 3U7RA 4AW9A 5FH9A 3L4JA 3MGKA 1K98A 1QS0B 1ESZA 1FUYB 3ZH9B 4TLAA 1HL7A 4MHSA 4F6RB 1W4CA 1PO7A 1HI9A 2V5VA 3AWIA 5EMKA 1FL9A 4IO0A 1PYOA 1P0CA 4GXTA 4IVNA 3K3PA 4EHAA 1KO1A 2ZRDA 3PXEA 4V2IA 3ZWXA 2H63A 5CA0F 5A71A 4NAVA 3ZE0B 3D7SA 4PN3A 5AVYA 2XTJA 3UXEA 5FHQA 4AG5A 3LC1O 1DHTA 4HQNA 1E0JA 1TCUA 2GASA 1YZUA 4R2XA 3RH0A 3VYRB 3SLKA 4FONA 5CB4B 2NU7B 3C74A 2DU8A 1ZN9A 4GI1A 4AP6A 5A1JA 2GZ3A 3FMIA 1ZU4A 3KLBA 4QHYA 1YJQA 1FVFA 1JVSA 4RK1A 1OF1A 1YB2A 2C84A 1C9JA 2R1UA 3AI7A 3CH5A 3KEOA 4OJKA 3VU0A 5FWXB 4B81A 2OV1A 3ZOZA 3FDIA 5REQA 1I5RA 1ZBQA 3GL9A 1N6RA 3N2IA 5FAKA 1ILEA 4Y6SA 1T25A 1NMXA 1M1YE 2F6RA 4PZEA 3F6EX 5B37A 1OLSB 2P4UA 3PUWA 1NU6A 4RFSA 4HDQB 1Y81A 4HN4B 4ZOLB 2BEWA 2G5PA 2JEYA 3MLAA 3W5JA 4DGQA 2PUFA 1P0IA 2OCGA 4OI0A 3VR3A 1N5KA 1OFHA 2H2GA 5CT6A 4KUEA 5T8KA 3K0BA 5IW8A 2K7ZA 1QE3A 5TVGA 3COVA 4TV9F 4HLQB 4AQ7A 4JI4B 3NKVA 4JT2A 4RYDA 3JVDA 2Q2NA 5I7RA 2HDNB 4IDPA 2X8WA 5LXTB 1GOTA 3RC2A 4RD1A 1EX6A 4H1VA 5J5VA 4WNCA 1G41A 4MNTA 2HPZA 1RXWA 2CLHB 4GDFA 1DV1A 4Q3CA 4FCTA 1LI4A 1PLLA 3WHKA 1HDCA 4JEUA 4UHHA 4MW4A 4OU4A 4MVWA 1A95A 1RWBA 2WF7A 2JCSA 3K6SA 3MXTA 4PAWA 1JIQA 1KEKA 3A6PC 2P11A 3LPMA 4O3FA 4NOKA 2VHQA 4HVAA 3IQDB 4IHAA 4ZEVA 5EJ8A 2PS1A 4EPRA 1YGPA 2P40A 4BNVA 5C18A 3HKCA 4KZKA 2GRAA 2Q1WA 4LW8A 1QIGA 2WFZA 3NZEA 1N0IA 3VNUA 3NOOA 2VK8A 1QAMA 2WJJA 4A8PA 1XPRA 3O90A 3VKGA 2H5LA 1WY5A 5JDCC 4GQIA 4CM8A 3BH6A 3W8NA 1KZHA 1NJSA 3A6GA 3NBYC 5FNVA 4LX8A 4YGYA 1GTSA 4KOAA 3ZV5A 4FU0A 3SKXA 4BV9A 1BYUA 4TLDA 2G9NA 3B36A 1C3JA 1HDEA 1MEEA 1T3ZA 3FUUA 3AKYA 3HGTA 1WXQA 2BLLA 3WHLA 2O8NA 3THXA 3L7OA 1YV9A 5E1OA 2CE7A 1NZFA 2O59A 5IVPA 2AE1A 1EUYA 3OO1A 3ZWVA 2B0CA 2IELA 3HPQA 1HDXA 3IVXA 1ARZA 3AYXB 4KMOA 3SZMA 3EUAA 2EBWA 4YRPA 2QTNA 1V26A 2C31A 4ECAA 1K6EA 1RLOA 3KBOA 3QLVA 1JXQA 3W34A 1YL7A 4B4VA 2ZRGA 2QTWB 4IDNA 2Q5EA 4A03A 1YNOA 1A2KC 4GKBA 2DWOA 3FOCA 2SCUA 4JN6B 3S6JA 4DB4A 4IIJA 3I9LA 1T36B 1DIGA 5LA6F 3N39C 1TM7E 2OHJA 1G16A 1DV2A 2QENA 2VUTA 2GH1A 2P2YA 2UYOA 4EUKA 5K0JA 1LX6A 3Q6NA 1CJBA 3AHIA 3FDZA 2XA9A 4KO1S 3GLFA 3LXXA 1DMSA 1E1CA 2Y0BA 3TQTA 1JKIA 1RRVA 8ATCA 1JLSA 2K7FA 4NHOA 1JDNA 1D6SA 3NHPA 1T24A 2BCEA 4IINA 4M6WA 5CYFA 2H48A 4A0QA 1R0SA 2G5TA 2I6TA 4HRAA 4MWDA 3JWPA 2QSZA 4R98A 4BMXA 3M83A 1AGPA 4NICA 5DP2A 4HWOA 1PWEA 4YJ2A 1P8JA 3P5SA 3RVLA 4W5NA 1YHNA 1Z6ZA 1M76A 1YR9A 2HT6A 4Q3EA 2P1RA 4O0LA 4PBSA 4WZAB 3UT0A 1P39A 4QXRA 4Y2GA 2VJLA 4ODIA 4AS1A 2IXEA 4ZAZA 1Z7YA 4BL5A 2XTZA 4UAVA 2Z9CA 3U5ZB 3PGLA 3T0IA 1HWYA 1P2UA 3RAJA 1U1DA 3UCXA 1LUAA 2CEAA 3VR6H 1GU0A 3ASUA 1LQTA 1QVVA 1SC6A 3FYCA 1L7PA 2ORED 1EX1A 3HCCA 2CUZA 3N8NA 2FGJA 4LDAA 4ZVNA 2HN9A 2HIAA 3J7TA 2O50A 4YS6A 5AMXA 4A1FA 1YZHA 5FOWA 3H3XA 2GZHA 2F8LA 2J3EA 3NM6B 4EATA 4EHDA 4N49A 4U2EA 3H42B 3GNSA 1UWKA 2EKBA 5TE9A 2Q5CA 1QH8B 2F90A 3GLVA 1TIKA 2PR7A 4IQ0A 4EYOA 1DAPA 2WA1A 2JG3A 1E18A 1ZJ6A 3CRVA 2HM7A 2X0RA 3Q5GA 4F72A 3IL2A 3GZTB 1PJ8A 3K09C 4NCXA 1VE7A 2ZSBA 1TC2A 4G0ZA 4KXQA 2YDYA 4S04A 5IJZA 2HA7A 3AERA 3N3BC 4HUJA 4OU5A 3UC5A 3FJ1A 5E95A 4NFSA 2XMBA 1TW2A 1UUFA 4TTVA 5A4FS 3RKRA 2WJYA 4RV9A 4X92A 3LHSA 1E1QD 4QVIA 1SUDA 2X8JB 2CSXA 1FDOA 1FDWA 1XQYA 3IVCA 3PIDA 3IEUA 2J4DA 1UP7A 3UAYA 4U39A 4LNUB 2FW1A 2H5IA 3U09A 1ZHOA 2C5LA 2G72A 3JQ8B 1EWYA 3TXXA 4UW9A 4KTTE 5DHTA 3OECA 3ZHZA 2R84A 1BN7A 3PPVA 2BW0A 3FVQA 2HV9A 2O2JA 2JIPA 3QVJA 2QMHA 1S89A 2R85A 3UICA 3M4YA 3ZCSA 1NNI1 1R4MA 3AEXA 2ZB4A 4OI4A 3RS7A 3DJFA 3PQ2A 2XIJA 4GIBA 4GU5A 1FQWA 3QPAA 1MAUA 1Y6RA 1CRZA 2KM1A 4LWQA 1WU8A 4CR8A 4MLDA 1KI7A 2IVFA 1ZESA 1RJFA 1ZJZA 2NACA 2QTMA 4K0RA 3LQ2A 3WR5A 2MMCA 2PRIA 5A62A 4RVHA 1ZY2A 2BMEA 3EVAA 3IP6A 4MR7A 4E1AA 2P9HA 1QZTA 2BMVA 2I1QA 1W0KD 2OCLA 2W58A 1GXSB 3O47A 3Q3HA 4IVQA 3I01A 3B3JA 1XMVA 4ABYA 4AJ4A 2I4LA 1YZ3A 5BVGA 1EUDA 4XRRA 4BQSA 2HA2A 2CWWA 3UGJA 2P0AA 2DQKA 2GHRA 2HMSA 2VJBA 3AU9A 3L7KA 4BCBA 5DLYA 1WCXA 1G8KA 3UMMA 1TXGA 4CEIB 2BI8A 4WE3A 1ZH6A 5AM5A 2KBFA 2YW9A 2RGUA 5DYIA 2Z8ZA 1OPXA 1BSVA 5FLKA 3GLHA 2BZSA 4ZDIA 3IUMA 4DA6A 2ZUEA 4D3DA 1UZUA 2R6GA 5AP9A 4B6OA 2IHKA 4YRSA 5HQ3B 5CD9A 2AUNA 3R20A 5AVRA 3L7DA 4LGMA 4B4OA 4IXMA 3SP1A 2R4UA 3H7IA 3ICVA 3QOYA 4MV4A 3VNAA 3COPA 3HUFA 2P2SA 3SKYA 3A6KA 3K8YA 5LN1A 5H3CA 1HFEL 4HUQA 4F3KA 1QHXA 3D7RA 4YXWD 1PCXA 1MD9A 1H2HA 5I8ZA 1PE0A 1E2PA 4LDZA 4M3NA 1M67A 3VVBA 3FN4A 4L3VA 4DUZB 1E3WA 5J4KA 4JUDX 5AVZA 1DDGA 1K3FA 4UCFA 4YT5A 4D41A 4FYKA 2V7EA 5IC6A 3OBIA 2QTZA 1KP3A 4K9NA 4ME6A 3RG8A 4UTPA 1I2MA 1P7PA 4F8YA 5B6IA 5KVVA 4ZPJA 5HBRA 2XXAA 4MRRA 1NYRA 2ZWMA 3AM3A 4O8ZA 4KIUA 3W5IA 1UXGA 3K16A 4MWSA 4BO5A 5FA6A 5KNDA 1PZXA 5MN6A 4NH4A 1AQ6A 1MG0A 3KM0A 3FAKA 2O1WA 2EF1A 4WV3A 2M2IA 3H5TA 1U9IA 4R3WA 5LNK6 3PHCA 4NOLA 2QZ9A 3E5NA 4XLTA 3RB8A 3WBFA 2GD2A 1DGQA 1L5GB 4MW9A 1T4BA 2RGRA 1NI5A 3KFXA 3LYLA 4HNGA 1DOHA 2E0IA 2SECE 4BKOA 1WABA 4Y9RA 4C1BA 2CLIB 3NB0A 4DLTA 3FBGA 3CWCA 3L7BA 4G8BA 3AILA 2VFAA 4CLOB 1SK8A 4MDYA 2CVZA 4CL0A 4G9BA 1U7WA 2KB0A 2J30A 2HHAA 1P61B 4YCSA 2BMAA 1E9BA 1T3GA 5CHYA 2JJ1A 1Z62A 4MMZB 5LP6C 1OU4A 3W5DA 4BX8A 4MRMB 4G4JA 4RK0A 4B7AA 2QUHA 4KEAA 3QGMA 2H2FA 3A1EA 3FPLA 3A37A 4J0DA 2J9FB 4LJ6A 4OIFA 4EO4A 1NF8A 1UPXA 1MPXA 1UM9B 1B3BA 2GETA 2WIKA 5GZ3A 3CE6A 1D2EA 1NPYA 2CK3D 2P0YA 4OF4A 3UFXA 3GA5A 1XTZA 4R1SA 3EG9B 3UWPA 3VNRA 1HEIA 3W7VA 7REQA 1VBMA 3LKZA 2COEA 3BGDA 5HIAA 2Z2ZA 5KMGA 1D07A 3IP1A 2WSMA 1GZVA 1RYFA 3FA2A 3L8DA 2O8BA 2VA9A 2ZJAA 2FZ5A 3FMFA 2ZI7A 4KH1A 3RKSA 5DEOA 1GFIA 4YXFA 2W8ZA 1RVDA 3MYRA 1PR2A 3BCRA 2XHZA 1TAQA 2VQDA 2Y67A 5HOQA 2WAMA 1UQTA 2PQ6A 3AFMA 3RK4A 3GN1A 4DNOA 3Q98A 3D54D 4L2IB 1I10A 3VDQA 2C2KA 3DHYA 3CCFA 3H3JA 2Q2VA 1TT7A 1RWMA 1H2BA 1WWKA 2H9AA 5IK2D 2A9VA 3PEWA 3K5IA 1OIXA 2J7PA 1PSZA 5LYJF 2IDZA 4R1PA 2Y1GA 3O3CA 4FMCF 5K6AA 2X22A 1B41A 3X0DA 4NI5A 3RK0A 4I2NA 1R6DA 3SFTA 3GFVA 1YONA 2P2NA 3ZUGA 5F5XA 1OC2A 3IIKA 4G1EB 4EO7A 1IZ8A 5KHLB 2DERA 3CIOA 4JKIA 4NL4H 4O25A 1FVHA 2H1WA 4DG9A 4YMGA 3VR5D 4B31A 3U16A 3GA0A 2ZBFA 4O5OA 1GGJA 1SXPA 5ERYA 4YMWA 5EIBD 2V7GA 2V3VA 2JARA 1QXSA 1HTWA 1O96B 1XAHA 1PHPA 1O77A 1PK9A 3G3EA 3NV9A 4PSUA 3NAGA 3VSCA 5JTTA 1WTCA 3RHFA 4EW1A 1SUWA 3WICA 4DDTA 1BA3A 1FNMA 1ODIA 1L8XA 1NUHA 1OXUA 1X7HA 2GBGA 2O1XA 4RPIA 4EPXA 1Y8QA 2QN3A 8OHMA 1FLDA 1LV8A 3DVLA 4ITUA 1KVSA 1UXHA 1Y4ZA 4HXFB 1UKAA 2HCJB 2PUJA 5KNCH 1CU1A 1DT5A 1FRQA 3A9SA 3DO5A 3Q2OA 4QQRA 2RJOA 2HY7A 4PNHA 4CT4B 4DDMA 5GVRA 1R0CA 1XP8A 2WF5A 1WCYA 4BVBA 4Z8XA 5KYWA 1E92A 5ILQA 2HJVA 2ZJ2A 1H22A 2QF7A 2RJ3A 1E2MA 4GMFA 3DWFA 2FF7A 3GVPA 4QIHA 5C1BA 1AB5A 1C41A 1KEPA 4OA5A 1JQKA 1Z4JA 4LAFA 4NCIA 4S0XA 2JGEA 3NUQA 2W98A 2YQ5A 4N3CA 4Z4GA 3GX1A 3HY4A 3LWBA 1ZIPA 5DGHA 3MCWA 3LYHA 1YVRA 3I9KA 2C3MA 4GXRA 1HG1A 1Y3AA 3FPFA 2OWEA 1KO7A 1USGA 1VCMA 1XFDA 5JC1A 4QBKA 4FOTA 5HUJA 3GMDA 1K7SN 3CA8A 5DBIA 1JTVA 3TRIA 2D2VA 4P31A 1PDWA 2QE6A 2BFMA 1LI5A 2ID9A 4DAEA 1J5PA 3V97A 5F7XA 3AFOA 1HYBA 4NHEA 2ODTX 5T6MA 3HYNA 3H2BA 3OZRA 4FX2A 3SWWA 1OOEA 2VDQB 1T1IA 3BUSA 3IKMB 5FNZA 4DUGA 1W0JA 4GUAA 3KQUA 1W36B 1ABEA 2WG1A 3M6FA 2YWFA 1XEWX 4X7RA 5EZ5A 1GHTA 4CDGA 4AF8A 3FNIA 4YRLA 1YK1A 3K4QA 3D59A 4AJKA 2V6IA 4YPFA 1HYEA 5AT1A 3L01A 4B46A 2ZIGA 4W9NC 3IDAA 3SK0A 5FO0A 1RAIA 4AKEA 4F2PA 1J7JA 3QU9A 5KBYA 4LDJA 5DTMA 5KYXA 2HRBA 3HB7A 3MCTA 3TD2A 1ZW1A 1SCBA 1D6NA 4TTPA 5KHAA 3G1TA 2XMRA 2P9BA 3WB1A 4M49A 2VSYA 3WJ7A 1TNDA 3FHLA 1XLUA 1Z2CA 5GJVC 3FTEA 4NJOA 4YV1A 2QP3A 1E9CA 3FCEA 1W93A 3GXBA 4J16A 2DR0A 5E2BA 5BWCA 2JI4A 4OP2A 2YVKA 1T5HX 3CG4A 1D4AA 5HKBA 5AVTA 4F04A 1NDUA 3ACCA 4UFNA 3SZ3A 3W9SA 3BIXA 5LP6F 3FW1A 5K0CA 3QPWA 3C3MA 1RZUA 1JIUA 1RQLA 3UJHA 2Q6VA 3KQWA 3ZDXB 3O9MA 5JNRA 4WGFA 2BTOA 4YRMA 5I3CA 2ACEA 3OFSA 1KORA 2ZT5A 4DKJA 2OBMA 4ZJPA 5CK4A 2G17A 5L95A 1XBTA 4BFLA 3H4MA 3LQRA 3O74A 2NUTB 4R05A 3O21A 3ZK9A 3ZLJA 3H8SA 1M2HA 1W52X 3OWOA 2BISA 3QEJA 3U6BA 1Y37A 2FPGB 2J5XA 4WLFA 2HQ1A 1VFNA 3AHEA 2I3DA 4IH1A 1ZRNA 3GBSA 4EJSC 2V96A 1TA4A 4PO3X 4ALNA 4R8SA 1R18A 3LRTA 4CMKA 3DVSX 2GBIA 2OCIA 3TTWA 1N25A 2JGKA 3OSUA 4FTWA 3U4CA 4IMPA 1P72A 1FMCA 1M2EA 1QK5A 3EDRA 5SV2A 3C3AA 1CJTC 5LCXA 4BLUA 1EFLA 2ZI3A 2UAGA 4HMQA 4MITA 2NQ2C 5T67A 3H9EO 2FUEA 2PZBA 4BNZA 1PVVA 1NVMB 1XJCA 1NXXA 1LTKA 3K0SA 3HJUA 1V1RA 2BSXA 4OMDA 4Y9SA 1H05A 5A9SA 1NSTA 3QYFA 2R8ZA 1ZOIA 3ORQA 3GEEA 3PJFA 3V4OA 3KD3A 4XSVA 5I9SA 5LNK1 2N42A 2IOQA 1KI1A 3R44A 3MUEA 1WOYA 4EITA 5IKPA 2JFWA 1PEYA 4S1OA 4B3CA 2NZYA 1QZ3A 3AF3A 1KRXA 3S2IA 2JZCA 1FMLA 2AOWA 2WWWA 2BHTA 5AW5A 4RKEA 3E9ZA 4WKCA 4FK8A 1YE8A 4I3FA 1AGXA 2XUHA 1Y1RA 1KO4A 2P5YA 4OL0A 2ECKA 3V7NA 3VR0A 2EL9A 4ZZ0A 1QC5A 4R16A 2ZR7A 5CDUA 2B98A 4XM2A 1DRJA 1JB1A 3PLRA 4BJHB 4I55F 1O97C 4R6XA 4Z3OA 4MIOA 5IABA 1G2OA 2PWPA 2WSBA 1Z6QA 2PZEA 3Q7SA 4IRMA 1QE5A 4US1R 2INGX 2JH9A 1THGA 3OJOA 1IMOA 4MA5A 1CJKC 5BW6B 3SDZA 3P27A 3L5KA 4ZQFA 4ZO6A 2AXEA 4WA7A 1GKIA 2O3JA 2IU3A 2L17A 2XB9A 3E84A 3MTDA 4AP5A 4DTCA 3GRKA 1B73A 4BGEA 3VYUB 2NPOA 2ZJOA 1JTEA 4P2BA 1O97D 3UAVA 2ZAIA 3MCUA 4NQZA 1IN6A 4MYCA 2QRMA 3NHUA 8ADHA 4MYTA 1L7MA 4QT0A 4DA4A 5IT5A 1E2KA 4WADA 5KX5B 4X00A 3M4ZA 3H0KA 4GH5A 4DADA 3C15C 2Z0MA 3RNOA 4JZYA 1NWHA 2HHJA 5J5AA 4ZCPA 1Q14A 3UB2A 3VC2A 5JI3E 2MSCB 5B4UA 3ESXA 1MA3A 5A3SA 1DX4A 1PN3A 3HVIA 4S1NA 1CDZA 3HMKA 3NOQA 3ZDAA 2GPYA 1RE0A 4OGLA 4IF4A 2A9OA 3MJ4A 3L5OA 3S7ZA 5IAOA 4PLWA 3N8DA 2QN2A 3WKBA 3KYJB 2CXPA 1P1HA 4CL3A 1AUQA 2IF2A 3FHTA 3R76A 3BJRA 3MOIA 1JT2A 3QVXA 2WWFA 1T9ZA 3W06A 1Y1KE 1XU4A 4KXWA 2I2BA 4LX0A 4NV0A 1QZUA 4K9RA 1WE2A 3CW9A 2K5UA 3PWKA 3ASYA 2X5JO 5JADA 5DE3A 2FDXA 2XF2A 1PW5A 2C04A 4MVJP 3H8WA 1DJNA 1YS6A 3PPYA 4DXDA 4JL8A 1Y63A 5ITWA 2EV9A 2P5UA 4NBNA 1O9HA 4EK9A 2CXOA 4ARSA 1ZK4A 1L7VC 1Y48E 1PYDA 3BJZA 2O14A 3A2KA 3NETA 4DMMA 4DCOA 2Y1CA 1JHZA 1FYDA 1UPUA 1KI4A 1KEWA 3CM0A 3DGEC 4TV8F 2RHRA 2WWVD 1V8ZA 2NMVA 3WOHA 2O23A 5D86A 3JQAA 2Q8NA 3EPPA 2YWBA 1VL1A 4HEJA 1K1EA 4OHCA 2DY1A 4M37A 5C8ZA 4UEJA 1GKLA 1AKRA 4MV7A 5LYJB 1E0DA 2CHFA 1MO5A 1KGDA 4EFLA 1WUTA 3PVCA 4RVSA 2Y1FA 1WPGA 4RKWA 1DL5A 1JEEA 3LDHA 3PL5A 3M2PA 4MCIA 5GM1A 3GUZA 3S4YA 2ZM6B 2QZ4A 3HFRA 4OFBA 3CVUA 2AC2A 4QUJA 1ZFNA 2IYUA 4MTCA 4C06A 2YNMA 5GJWC 5AKIA 4DRZA 1ZAYA 3V34A 5K8UA 1XQ6A 1Y6QA 1YMUA 2QZSA 4B87A 1NN1A 1NW4A 3C87A 3IR6A 4KP7A 6NULA 5HM8A 5A05A 2VF5X 1WP9A 3DAYA 3M5CA 2DCUA 2NTJA 2ES4A 4UEWA 3CVJA 1A8HA 4A2WA 3P9XA 4FYWA 1CERA 2WB4A 4HKTA 3LFTA 4DR1B 2XGSA 1PGOA 3OQMA 2BR5A 2Q4OA 3ZCVA 2XVMA 4FD2A 2RGWA 1NC3A 3PA6A 4LSMA 3KZKA 5AR1A 3TTUA 2F1KA 1NBIA 3C6MA 1GL9B 5K8IA 1DT3A 3NEAA 3PNOA 2IV2X 1AUXA 3STHA 1A9XA 4EABA 3OPXA 2DX7A 3H2IA 3LT4A 1UOQA 5HUHA 3A8TA 4GMXA 3KO8A 3MG9A 2P91A 1HZZC 3MD0A 4WOKA 4F5ZA 2IHZA 1GQYA 3HL0A 4D9CA 2QMQA 4KO4S 1JG1A 2R2AA 1RBQA 2V4ZA 4H18A 3A4NA 1IJKA 3OG9A 2RIPA 3QWHA 2DBYA 1OHHA 3V8VA 3OKPA 1UBCA 1S7GA 1U0SY 3PFCA 2ZRIA 5JH7A 2EL7A 1USKA 2JZNA 1VL6A 2V45A 4OQXA 4D56A 1OBFO 2E9SA 3THWB 3OCUA 1F12A 3PDCA 1R4NA 4BEJA 1MABA 5BSTA 2A7QA 1ZSVA 4DLVA 3S81A 2PE5A 4HDMB 3BGOS 4Z4IA 4MRAA 4QFBA 5FPPA 1N0UA 3DBHB 1HE3A 3FZYA 2ISSD 4MGYR 2A0WA 2FPIA 4QYMA 1QCDA 2WP0A 4LPSA 4MUYA 1LB1B 4PG8A 4RLSA 4AJ1A 1CQJB 2W6MA 5I9IA 1Y5NA 3TMAA 4DHEA 2Y9MB 3RDPA 4YRJA 4OH7A 4MB6A 4X8MA 1NT2A 3IS3A 5AYVA 1Z8FA 2R60A 1Y8RB 2BVNA 1UBHS 5IVKA 3RVDA 4X66B 3JD2A 3WWEA 3KOYA 1TJPB 1LJLA 3K0EA 4J91A 1A4XA 4LZOA 3PKZA 1UPAA 3KR1A 3OT5A 3CISA 1YJ5A 3GRAA 2P4SA 1K7CA 2ZPAA 1B2LA 3BSFA 2X9LA 4R41A 5HE8A 5DGTA 3LYAA 4QU0A 4EGFA 2IYRA 4I4NA 5AO9A 5KNCD 1C0PA 2OUKA 2V7WA 5JNWA 3ICEA 3FCUB 4I50A 4G5RA 4YECA 3E0XA 3NAZA 1E5VA 1IVSA 3GP3A 1E64A 7MHTA 1T15A 5KKAA 2QGFA 2Q2QA 3DZBA 2GD0A 4V0OA 4D8YA 1O5IA 2GSDA 5L4SA 1FFEA 3O75A 3PQ7A 2VWPA 3NKLA 4IZOA 3BE6A 2QY9A 3LRXA 3D7KA 3OQJA 4ROTA 3DPSA 4PPQA 1M2KA 5CEJA 4YUXA 3L9WA 1X1CA 1G5PA 2FZEA 2OHVA 2FI1A 2ZJ4A 4TL8A 1NNSA 3CX6A 3RQIA 4YASA 4BYMA 4RA6A 2FEXA 5E3IA 3WFZA 5BQ3A 1XR3A 4BXOA 1PV1A 2P62A 3O8DA 3IA2A 2H7YA 1DXOA 1I7DA 5B30A 3LDAA 3F5QA 4H7EA 4GYWA 2J9XB 2ZJ6A 3ICPA 4YP7A 1MQ8B 1JEOA 5MFPA 4BV2A 4GKVA 3G1UA 4OP1A 3SS9X 1GNQA 3LXUX 2BD0A 2YV4A 1RRGA 3NC4A 5CB0A 1QIIA 5HJ2A 4L6IA 4RHFA 5DO9A 5C31A 2COKA 2XKBA 4TMZA 3NHRA 1P3JA 3QIAA 2VLBA 4TVSA 1PIWA 2X4DA 1AKEA 3FCAA 3K05A 1PNTA 3C3EA 3QENA 4TSKA 3V2UA 4Q0MA 3KZVA 1J06A 1NVTA 1AIPA 1CUCA 2YINC 1J8QA 3VXKA 5DX1A 4F4UA 1U2GA 4EJ2A 2DHDA 3EC7A 2RC5A 1UANA 4PSCA 1Y6ZA 2FQXA 2Z2XA 4ZCLA 3W05A 4D0SA 4G07A 2HZ7A 2YC2C 2IS1A 4OM8A 3PP8A 1HNZB 2OV8A 2A1IA 3B2QA 2PHZA 2XZOA 2Z6QA 5F7JA 4HDNB 2FHSA 4GICA 2XNJA 4BV3A 2OZLA 4OYLA 5CXSA 2QPTA 5KCMA 1M2NA 1HMYA 3ZWNA 2J0EA 4PC2A 1AVTA 4XCQA 4DLAA 4AYTA 1KI3A 2BUAA 3WYDA 5SZKB 4JNCA 1SD2A 4BRUA 3FKQA 3FPJA 1VHWA 2D5BA 2EGUA 5HKAA 1XZMA 1SU8A 5AM2A 2WQZA 3LU1A 2VPTA 5CGQB 3RAFC 2YKGA 1G9XA 2XUKA 2WA2A 3HJCA 3ROFA 4RFVA 4C07A 4QQKA 3ZDQA 3FKJA 4CKEB 5J2UF 1LSJA 1D5WA 5IJXA 2M6KA 3TKAA 1U2ZA 2L0XA 2IZ0A 5HFNA 1HTBA 3S8EA 1KKLA 5MN4A 1RM3A 3Q4GA 1X70A 4UNSA 5HIJA 4P08A 2HW8A 3FOBA 1EFRD 3A9UA 4DV4B 2AG6A 4F3YA 1PL7A 4IIBA 5JPIA 2PSSA 1Z4QA 4L16A 3B8EA 4BB6A 1KMHB 1TZMA 4BMCA 2UXCB 2G9ZA 5C7IO 5BSRA 1U0TA 3QXJA 1UBSB 1NUUA 4QXAA 1XEFA 4RPJA 1HDZA 4N3GA 5DU2A 5EVCA 4RM3A 2V8BA 5I9MA 1DUVG 2CLEB 1IZ7A 1CJMA 2P68A 3F73A 2GTPA 4K6MA 4EOGA 4BPBA 4QUDA 4PLVA 1GG8A 1Y6JA 3S2GA 3H3FA 3NVDA 4ER0A 4F9GA 5F4ZA 5A04A 4XUEA 3WX0A 4LA4A 1KU6A 4H0NA 1PVDA 2QRHA 3U7QA 1E9SA 7GPBA 5LZ2A 1VSVA 2CHVA 1KJ8A 2J0UA 3TD6A 4MH0R 2VT6A 3SEAA 3NNNA 4HZIA 4IIYA 5I48A 3EVDA 2G70A 4ANFA 4CQLB 5C8VA 1SUFA 1A1VA 2A9FA 3WGTA 2WJAA 4H7PA 3X1WA 3LUGA 5FX2A 1KI6A 1XD9A 3TZ6A 1QH9A 3A6DA 3H5WA 4DSTA 3RAPR 1UDXA 3OOSA 5F1PA 3SEFA 3EVFA 5JEEA 2FZVA 5TQ0B 4B47A 2B4RO 5GVSA 3BH7A 4NSNA 5TPWA 3BRQA 4PS1A 2GJ8A 4B0OA 5EPUA 4NS1A 1EP3B 1KA9H 4E70A 1R5OA 1VECA 1JJFA 1XDGA 1X94A 3R1IA 2IYWA 1VJ1A 2AN5A 2JD2A 3ORRA 4MCJA 4MWOA 5HIKA 4V1CI 6ADHA 1E2QA 2F8SA 1MB0A 3M0EA 5DMXA 3SQMA 2O5VA 1UBUS 3PQEA 3FSGD 3TD9A 2V6FA 3I42A 1MZVA 3WIOA 1R74A 3FYUA 3GEDA 1YZQA 4YDHB 4TV8B 1ESMA 4ZMBA 1W47A 2GAFA 4KBGA 3FE2A 3I4FA 3EFHA 5BRNA 4POOA 3AVTA 2NP6A 1L5LA 1JQEA 2RAUA 4GMGA 2GM4A 4MK4A 4YRBA 3DHWC 1FLNA 4JBYA 4V1CA 1P4SA 1QIFA 3HEAA 4L5CA 4P0QB 2HCRA 2ZSDA 2PYDA 3PTZA 5B3AA 4UOQA 3X1ZA 4ZICA 1F0KA 2DLCX 3HBJA 3I12A 2IIBA 1US8A 3PB3A 1JX6A 4NCBA 1CY8A 3C3YA 5GQSA 3VR6A 2XUPA 1SK9A 1AKYA 4NZYA 1YK0A 4PGAA 5JFGA 4OQZA 5FYDA 2PGLA 4X1YB 4GOJA 3HBLA 3VU8A 3DOFA 4DR6B 5TPZA 1M34B 4IRXA 1IPHA 1KEVA 3EOAI 4Y2HA 1M33A 3TAUA 3SGLA 3RTBA 1G0NA 2CXUA 4HNHA 4NKRA 4RY8A 2X0FA 1XXHE 3FNGA 4JOQA 2EWWA 3DZCA 3AX6A 3QNWA 3KKMA 3MMZA 1DTSA 3EZ6A 3OHPA 4JOBA 1QCZA 1XDZA 1VCIA 2F62A 3F78A 1XD2A 4M9UA 4XYEA 4LDQA 1EUQA 2P65A 5HTKA 1HGXA 2K87A 1ORHA 3F4BA 3O94A 5E6RB 5E9WA 1NT4A 1GPDG 2QG9A 4INJA 5L53A 3TECE 1JR3E 1D6MA 4Z86A 2WMNB 3VHXA 2O6LA 3PPXA 3LDFA 5ILGA 3ZCQA 4BB9A 3OKFA 3NALA 5F78A 1IEQA 1NR7A 3SYKA 3E7DA 5KTOA 2H59A 4MR9A 4ZDKA 2YWJA 3RUPA 2PKXA 3PUYA 2Q1TA 4K5QA 1PBTA 4U3JB 1WMAA 2AT1A 2G4LA 3ZWCA 3NDJA 3VAZA 3GGDA 3LX5A 1EP2B 4A0FA 5AUOB 2DGDA 2FYTA 2O3TA 3KOZA 3KYIB 3QF7A 2UXBB 1WW3A 3CXRA 1XNHA 4K6CA 5M34A 4BWGA 1FQKA 3SFVA 1ZK0A 4U6QA 1X1SA 4RBNA 5G1OA 1GD1O 1OWMA 1CULC 2CHEA 5H59A 1KR2A 3FI0A 2P3LA 2Q0XA 5HQTA 421PA 1BW9B 3F3YA 4LMPA 1DC8A 2HDHA 3LUJA 1KK3A 1GUAA 3CEJA 3MM4A 3S29A 3AR8A 2NVOA 1ZUIA 3DEAA 3KPYA 4C22A 2TYSB 3N2GA 4DJDC 2GYWA 2GCGA 2A57A 3STVA 1YTLA 1RM5A 2BP7A 3ZBPA 1UINA 2C83A 1BCSB 1ES9A 1JPJA 3ENVA 3Q7TA 4EYQA 6PFKA 5C1PA 1ZU5A 4YMSA 5ECGC 5KWSA 3OE5A 3EQ2A 3QPUA 3FOWA 3SF8B 3NBKA 3T0GA 1PGJA 3KJHA 4KN8A 4AG6A 2D5AA 2ZSKA 3KKOA 3ILSA 2CXQA 4Q7JB 2O2DA 3ESRA 2VDPB 1EB9A 2BGMA 3HRHA 1KJIA 3UK1A 3WLHA 2FDRA 4Q9IA 5GV8A 2WM8A 2HL6A 4K9QA 2PGAA 2ZDHA 4LN1A 4REMA 4UDNA 3AETB 3UGTA 4E08A 3I9JA 2O06A 2VHZA 2QP9X 1I14A 3FFWA 4UBMA 3RF7A 2FU5C 2P0EA 5AK6A 4RVCA 1S8OA 2J6HA 3QBDA 4AS3A 5EP4A 2XLBA 4YAOA 1RYEA 3FM9A 1SAYA 1L4YA 4PRLA 4B7UA 5IDWA 3NBZC 3R0QA 3L8GA 3B5IA 4KK3A 1QHNA 1AXRA 1V9CA 4TXMA 1RXYA 3NNDA 4JLWA 4E03A 2ZS7A 1D0IA 1C4XA 1GGFA 2X7JA 1IAVA 2XVAA 4P32A 4REQB 5IJWA 1GM5A 4C4YA 3GUUA 2JASA 2HHHB 4IIDA 1I3OA 4TL6A 3RAEC 1EESA 1L7EA 2B1RA 3HUTA 3FNHA 2D7DA 2JGLA 3CBQA 2GERA 2Q3LA 5KI6A 3LW7A 3ACDA 3EWIA 4GR5A 1OASA 3S8MA 5C2JB 3MBKA 2VTBA 4OLFA 2QXYA 4OQ4A 1PAUA 3HJTA 2GEBA 1K66A 2I7DA 3IELA 1QG4A 3ND6A 3OIDA 1T8UA 3DAGA 1JFRA 4LVNA 4WZBA 5HMLA 4QEDA 2ZVDA 2OMEA 5TXGA 2PBZA 3VNQA 1GN9A 3VZRA 2GLTA 4QASA 1MTZA 3SYNA 3WIVA 2JGIA 2QZPA 4MVCA 4WPGA 4KPGA 3PE6A 1RWQA 3EGIA 4MJ3A 3R7WA 3T5PA 4S3MA 2D2XA 2ZEJA 3CNHA 3PDWA 4M0CA 4XIIA 4BBJA 4IOLA 5FJJA 1IULA 1YT5A 4RIFA 3TSWA 3BZUA 3C43A 3HZHA 1ZD4A 5AKYA 4Q1EA 3STXA 2CL0X 4MI1A 4AUKA 5AM3A 2ZAMA 2RD2A 4P33A 3ELYA 3G8CA 2PS9A 4I5GA 4KDRA 4U5QA 2DQYA 1PSWA 3I9OA 2A5LA 1ECCA 1ONOA 4BLPA 4XX0B 1QDEA 1YQ9A 5JNTA 2DWPA 5ESXA 1S3FA 4CVNA 7YASA 5AOCA 2J4CA 2PKRA 4BQQA 3TSAA 4R5MA 1UK8A 1ZM2A 2ATXA 5EKTA 2ID4A 4YWHA 2Z5VA 4ENSA 4HF7A 4FJ1A 4OMFG 3WMXA 3C7CB 3O26A 2NO4A 1U0EA 3CN9A 4GKAA 2WC1A 3BFJA 4WK4B 1GDHA 2ODEA 4QBGB 5K0NA 1XCOA 3GJ3A 1E1NA 3IBYA 2WU1A 1DOAA 2TRSB 3DA8A 4KKXB 4LHVA 1C1DA 4Q9DA 2Q29A 4FBMA 4XXHA 4AO6A 4B1FA 2VZLA 2HSEA 4MKFA 2JCYA 2GPTA 3DLIA 1NN5A 4XUGB 4AXXA 3OP1A 3VYSB 4Z1MD 3ZWKA 1YQEA 2P6PA 3DBLB 2DY0A 3CINA 2HJGA 4FFSA 4YR9A 3V32A 1E2EA 3O95A 5JRJA 1PYGA 2P9GA 1TYCA 3A6HA 2E5LB 4MJ7A 1NR1A 2WVHA 3TOZA 2GMWA 3R23A 2AV6A 1NP6A 2DP4E 1N75A 4XCVA 5B1HA 2J5QA 4EMSA 2G9UA 1QHEA 4J6EA 2H54A 3DCIA 5AJVB 3R6TA 4TGLA 4XUCA 5CIWA 1QGYA 3GOQA 4EUSA 4I14A 1A8PA 4BUCA 5C80A 2GN1A 2YYAA 4ESEA 3PSAA 3D3KA 1OYVA 1ORVA 2IZOA 2JFXA 5CHEA 5J2UB 1ZNQO 1G7CA 4RTLA 2Q28A 3T1NA 2YHIB 5AVQA 2GWHA 1HC7A 5A9RA 1TVMA 2VUHB 2WYHA 2VYNA 4HHEA 1UZLA 2CNLA 1EP9A 3NOXA 3CLVA 3ZKAA 5FPHA 3CG0A 3NM4A 4XX1A 1K2WA 1DEHA 1RLMA 1IY8A 3FVWA 2ODWA 3UT5A 2XUIA 4F3NA 4U8HA 2Y1DA 3R5KA 4FMPA 2ORWA 3UK6A 4D9MA 1YR6A 5A0TA 1D0VA 3V8PA 3N75A 1DE0A 2QW8A 5B12A 1WIWA 3AR6A 1ECLA 1GV0A 1EB8A 2JRCA 2KQUA 2C98A 4KQXA 5EKSA 3IEPA 4A8JA 5G02A 4G65A 3INTA 4BNXA 3GVHA 5F5NA 3TCNA 3WGGA 2LDXA 3G5MA 1V37A 5JALA 1EJ6A 1TYAE 1C5KA 5D5HA 3SYRA 1CQIB 1Z7BA 2Q2WA 3CZ5A 4OAOA 1HF3A 1PTJC 1EK6A 3ENKA 3HM2A 5JPCA 1KFCB 3GZNA 3K1AA 5JUWA 4WRRA 2JIMA 1R5NA 3X3HA 3BREA 5CNIA 1FJ2A 2OCDA 1M6WA 3GFGA 4L51A 1EM8B 5E6SB 4ZAXA 2R4TA 3OFJA 4KR2A 2B3TA 1M9NA 3EUWA 4LI3X 5G0WA 5IKEA 2XSZA 2O5CA 2H6EA 2JLBA 3M34A 6YASA 1WW2A 4RGQA 3ZH2A 3IUQA 3K9GA 3F7TA 4I8IA 4IEIA 5CH5A 1LBIA 4MQFA 4CQMD 4LQCA 2BHSA 2WD8A 3I6BA 5L3VA 4A36A 4G0MA 2EEPA 4BYGA 4N41A 4Q3BA 2JRLA 3Q15C 1UOPA 4R3UC 1BNCA 5KKNB 1ZGJA 4CM9D 3OZVA 2ZSIA 2DQZA 3DYVA 5DXFA 4U7TB 3IAEA 3ZNQA 4CETA 1GSIA 2ESRA 3KKZA 4JOCA 3SSNA 1UKVY 5TJHA 3I5XA 1XTSA 2I2CA 4LOKA 4WZ6A 3SN6A 3GEPA 2XT9A 4ZMSA 3VHRA 1LRJA 3FTDA 3GROA 1JGTA 1FOEB 3L4SO 4LC0A 2D6FA 1FZQA 2Y1EA 3H65A 3KNZA 1W4ZA 4Z2YA 3T5DA 2PMDA 2IYLD 1W8DA 1YI8A 3JZMA 4I4TA 4RVOA 4C5CA 2C7PA 4UMDA 2O8CA 4QOIA 2J46A 2V4MA 3CLSC 2UVPB 3DZKA 1ENYA 4MVYA 3ZCPA 2CUNA 1A9OA 3JRXA 5CX1B 1JBEA 4YEDA 5B5SA 5A4DA 2G0TA 2YOHA 2ZB3A 3ET5A 4Q3AA 1Z8HA 1GU7A 3FRJA 3AV3A 1Z6YA 4QARA 5ALWA 1MC1A 1H8EA 4EARA 5D2CA 4WLNA 3G5AA 3OIVA 3WY9A 1W73A 3HL4A 1RTTA 1UJBA 4CGYA 4CTNA 2R25B 2C7VA 3DAHA 4Y67A 3L0YA 4EBBA 2IU4A 1O94D 5D3MA 1UOEA 3TGLA 1QANA 1EFVA 4AMYA 4ZD6A 2ZAGA 4OQDA 1NF9A 2ZYSA 1W29A 4U4AA 5TMBA 4PVDA 1EFAA 1AD2A 1B8VA 1I13A 3O73A 4BBAA 3ERCA 2A9JA 3M89A 4IGFA 2OPHA 1P74A 1Q15A 2A1TR 2H5JA 3WLJA 2VF2A 1XRSB 2GN8A 1V1MA 2AG5A 4LBVA 4R1UA 4V38A 5DRTA 4BN0A 3P5BA 4PYRA 5H4HA 2CLDX 3SR4A 1BKDR 3G85A 1WBBA 2I3GA 4KIFA 3I9NA 5EFOA 5GWXA 2BTQB 3JCZA 5EJ2A 2BEVB 2GUGA 3ZBQA 1Y42X 4DNQA 3RFCA 1Z3CA 3A4MA 3DL0A 1C9YA 1NKSA 4C78A 2AS0A 2C58A 1AX9A 1RYBA 5LSAA 3H1FA 4O2AF 3PQ5A 1T4GA 4KRGA 2H0RA 3RVSA 3T3GA 3TRFA 1V6AA 2NQ8A 3GFPA 2AC4A 3QF4B 4N7JA 3UJNA 4S05A 3WSVA 3CHYA 1UP4A 1C7QA 4HSGA 1ABFA 1Y1SA 5DPMA 4BJ5A 2PD6A 4C7VA 3V2GA 2PBRA 2QYSA 3BSWA 5HDBB 9LDBA 5JD5A 4YLEA 3E7WA 4B3XA 2H08A 3QTTA 5BSHA 5TC4A 4C6HA 3F5DA 3IXQA 3Q8XB 1XLVA 3WRYA 3D3EA 4IIFA 2C88A 4CWAA 1Z8DA 4EAAA 2QMZA 4RHXA 1VDMA 2IYZA 3WLEA 1HNWB 1ILWA 5AJUA 1Q83A 4EMUA 3T5CA 2ZIUB 1NVGA 1K6JA 4MUGA 1NATA 4JJ8A 2J0SA 1DAMA 3FKSA 2ZUUA 4FP9A 4AURA 1WCV1 3ZGZA 2AJDA 4DM4A 5BWLA 1NLFA 4IAOA 1V11B 2VK2A 4LS3A 3HE3A 1FYEA 4X20A 1PT6A 2WPDD 4XD2A 2V0GA 1J9EA 2OBXA 1UK7A 1VPDA 3ZHQA 2J9ZB 3WADA 3R5HA 5EP2A 2AE2A 3TVDA 3T3DA 3GD5A 1LRLA 4FZ3A 4A9AA 3B78A 3FG9A 4L4XA 3ZXSA 3I6ZA 4UM9D 1L7QA 1VBKA 2FQWA 3ADKA 5B3JA 1ABBA 1U2QA 2NO0A 5F33A 1G8HA 2QM3A 3OTWA 5BSMA 3P9CA 3UNXA 1J09A 3UBTA 2QMUA 2W6JA 4N5HX 4O08A 3JSXA 3KOMA 4J0QA 4PAQA 1LXCA 1PWHA 3OTGA 2H18A 2YN2A 3O2SB 1XJQA 2I9KA 4D7AA 1TOAA 2PNFA 4FS8A 1A96A 1J2EA 1F8UA 1RMQA 4L4ZA 2YXEA 4UUQA 3NTUA 3WSWA 2MYUA 3IVGA 4XPIB 3AESA 3DNMA 4AVYA 2FFQA 4F85A 4QLAA 3MGGA 3K70C 4ID3A 1NUPA 2Z2YA 2WUFA 5U4XA 2VNIA 3G0IA 2CBXA 1AHIA 1FJHA 1THZA 1SD1A 4KRXA 5BRJA 4HFMA 2OKGA 1NPDA 1O89A 4IDHA 1E5QA 2Z5GA 1X7XA 4H3SA 3U7FB 4JI7B 4NU5A 4PHCA 2XKJE 4YIKA 1LD3A 2YXBA 2ZRAA 4P9NA 2VPXA 2QW0X 3MGAA 3K70D 2R7NA 3KPVA 2ODBA 1FUEA 2WHPB 3PT5A 4UUMA 4TXNA 3ZGNA 3NCTA 4B17A 1Z28A 3IQEA 2HLDD 4GM0A 1TYEB 3QUSA 1TVKA 2XCIA 3CUUA 2YY6A 4IGAA 1ADGA 4MW7A 4EPYA 1GQOA 1H85A 1A0OA 1NUTA 2B94A 2PWYA 2V97A 3JPYA 3Q8MA 1T2FA 4HAUA 3O84A 4A10A 3AR3A 2FG5A 3E4DA 5A5EA 3QNMA 3RW9A 3WGYA 3D7MA 4Q9NA 4L0QA 3KV1A 4IUCS 1Z63A 3PNLA 5M04A 3IPYA 1CR2A 2BGUA 1O58A 2QMEA 4ZVQA 2ALJA 2NZWA 3QVUA 1IWBB 4CMEA 2QB5A 3W6OA 1KE2A 4BLVA 1Q91A 4LYEA 4KFCA 2I5PO 5ER9A 4WW0A 3K4PA 4AKSA 3ISVA 4IXWA 2LGJA 5IC5A 4CR7A 5BV1A 3ZIAD 2OSVA 4RVNA 2Y0PA 1RCTE 4QGGA 1FYVA 3OA0A 3RTDA 4BBPA 2B5WA 3ITKA 2OORA 3IPCA 1JQDA 4OY3A 1A2BA 1J8DA 1RI1A 4GVLA 4KE8A 2QTFA 2HOQA 2XXJA 3RABA 4YCAA 4RTQA 1XZ8A 2ST1A