5JRDS

E. coli hydrogenase-1 variant p508a
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
264
structure length
264
Chain Sequence
KPRIPVVWIHGLECTCCTESFIRSAHPLAKDVILSLISLDYDDTLMAAAGTQAEEVFEDIITQYNGKYILAVEGNPPLGEQGMFCISSGRPFIEKLKRAAAGASAIIAWGTCASWGCVQAARPNPTQATPIDKVITDKPIIKVPGCPPIPDVMSAIITYMVTFDRLPDVDRMGRPLMFYGQRIHDKCYRRAHFDAGEFVQSWDDDAARKGYCLYKMGCKGPTTYNACSSTRWNDGVSFPIQSGHGCLGCAENGFWDRGSFYSRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrogenase-1 small chain
publication title Importance of the Active Site "Canopy" Residues in an O2-Tolerant [NiFe]-Hydrogenase.
pubmed doi rcsb
source organism Escherichia coli o6:h1 (strain cft073 / atcc 700928 / upec)
molecule tags Oxidoreductase
total genus 78
structure length 264
sequence length 264
chains with identical sequence T
ec nomenclature ec 1.12.99.6: Hydrogenase (acceptor).
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
S PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 5jrdS01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 5jrdS02
5A4IS 3MYRA 4GD3Q 3RGWS 3USCS 3AYXB 1UBJS 1WUIS 4KO3S 4URHA 4UE6A 4UPVA 1UBHS 4UEWA 1WUKS 1WULS 4UD2A 2FRVA 1H2AS 5JSHA 1CC1S 1UBUS 1YRQA 1UBRS 4UCWA 4OMFG 3CUSA 1UBTS 4UE3S 1FRVA 3USES 4UQLA 4KO1S 5JRDS 5A4FS 1UBOS 3UQYS 3ZE9A 1YQ9A 4UQPA 5D51S 1WUJS 1UBMS 4IUBS 1FRFS 4CI0B 4UEQA 4IUCS 4U9IS 1WUHS 3AYZB 4KO4S 4UCQA 1E3DA 1H2RS 4KO2S 4C3OB 5ADUS 3ZE7A 3ZE8A 4UPEA 3ZEAA 4UD6A 3H3XA 2WPNA 3CURA 5JSKA 3ZE6A 1UBLS 4IUDS 4KN9S 1YQWA 4KL8S 5JSUA 1UBKS 4UE2A 5JT1A 4U9HS 5JSYA 4TTTS 4UCXA 5A4MS
chains in the Genus database with same CATH superfamily
3X2EA 5FOSA 1EDEA 2QN7A 3C3BA 1T8WA 5FBWB 2YYYA 1YDFA 3GLFE 1CEQA 1TA9A 1G2PA 3HUDA 3SR3A 5BSEA 4ZQCB 2QDXA 1UQTA 2VN8A 5IC5A 4F5EA 1UODA 2E4WA 3DCYA 3B2QA 2ZR8A 1KMNA 3K9NA 1RAFA 2G67A 3WSVA 1P74A 2ECPA 3NGMA 1QTRA 1EJ6A 1V8FA 1ZG3A 4WKBA 5ALPA 1JPJA 4B40A 3MCWA 3E9CA 4C05A 4E03A 4YPOA 4WI1A 1JFVA 1YNOA 3CRQA 3ORQA 4FFRA 3U44B 1M6YA 3P9IA 5EYPA 4OHYA 2WKQA 2A5DA 3SPXA 4TVOA 1Y5RA 3NVDA 1TQ6A 4U7TB 5DDIP 4Q3OA 3RIMA 3CPEA 1EWQA 2IBSA 4WZBA 1QH8B 2GLUA 4D82A 4QVGA 3RBXA 3WGZA 2VQ6A 1IEXA 2VPPA 1Z63A 4IDPA 1BXZA 1FNSA 2IZ6A 1I32A 5BOSA 4PYOA 2J3KA 3FZYA 4ZANA 2ACKA 4K2HA 4HWTA 1NQOA 4DNFA 1RXYA 6PFKA 4PSCA 2C5LA 4I99A 3QM1A 4BUJA 3QEJA 4N40A 2OTCA 4Q03A 3DAHA 3DHVA 1RQNA 1CCWA 1TGYA 2XUJA 1BQEA 1VPLA 4C4XA 3AQIA 4MGIR 1LPMA 4UXIA 2PKYX 3EPKA 2ONJA 4KB5A 4YAKA 3FI9A 4R51A 2C7GA 2XVYA 4GZLA 5T8KC 3UV7A 1MF7A 2W42A 1JTEA 1K5DA 2AZDA 1Q7RA 1YD7A 3C3CA 4CLOB 4JI8B 5EEHA 1E3SA 3CNQS 4R1UA 2HK6A 4S1TA 3LP8A 5JFOA 1A27A 1A5AB 1PYDA 5CPFA 1EXNA 1FRFS 4IZIA 2C3YA 2BH9A 4LF6B 3GLFA 2A94A 2VUUA 4OQPA 3ZW7A 3MVEA 5BUQA 4BLTA 1RRPA 2FN8A 1HDYA 1CK4A 4HMOA 3WP0A 4MUKA 3ZU4A 3NKVA 1QQBA 2ZYGA 3AVUA 1F1JA 4GLLA 4MQLA 1M2JA 3KFVA 2XT6A 2ZJ3A 3DT8A 2R6R1 4K9KA 4L6IA 2WT4A 1AA9A 1I33A 2ZYUX 1IMJA 4D3SA 4G0OA 1QFXA 3T95A 5CITA 5F4BA 3QVSA 5EKTA 5KPDA 4PG6A 3I2YX 4GKKB 3A25A 3EQ9A 3D0KA 3P97A 1FSFA 2VPQA 3CURA 4D9JA 5EKDA 1ATIA 3P0HA 5EJGA 1WXQA 2B99A 2PSHA 3FLMA 4D4IA 2GD2A 5ECYA 2YOGA 4D56A 1MRSA 4YT4A 3A58B 1ACMA 3M5CA 1GY8A 1UF9A 2V74B 3F3YA 4I5EA 3U6KA 3KKMA 4FI3C 3DFZA 4MWBA 1JE1A 2EKZA 2AKAB 3EIHA 3JQ8B 1W6RA 1X2BA 3CNOA 1UDRA 1HYQA 1XKLA 5FJIA 3G7NA 2PUJA 3OKAA 1Z15A 2FV8A 1VG0B 821PA 5ALRA 5TEVA 1RXEA 2J0EA 1PSDA 5CLQA 3D6MA 1AO3A 3KOXA 3DAFA 1H5NA 3OO0A 1T9GR 3OPXA 2TMYA 3Q7RA 2PLAA 1IIBA 3C1OA 3SF0A 3FCAA 1PZHA 4US1R 4K81B 1KMMA 3T4UA 4G36A 4JX9A 3FTFA 5BMVB 3FKQA 3PNLA 4POAA 3KTOA 5HILA 3DZFA 4YRSA 2N75A 3GFFA 3K20A 1P8AA 2IHKA 1ZD1A 4DM3A 1KL7A 2IYYA 4DCVA 8ADHA 3UT6A 2ENWA 1WRBA 4E5VA 2EIXA 1VCOA 3A1SA 3ESDA 2XRFA 5DBHX 1EJ0A 2B61A 3CLVA 3LDAA 5F76A 4Y2XA 2ZJ2A 2YNMA 2BL4A 4QARA 2XIQA 2YOFA 5K4HA 1QOQB 3EUFA 3HPQA 3PLRA 5JAIA 1QFJA 1SG9A 2WNHA 1G17A 1Q0ZA 5IEJA 2PXCA 3ZI7A 3PR1A 4YMSA 2HUNA 1Z4PX 4YN3A 3CINA 2YFQA 1ZH0A 3WLLA 3O8CA 4HGNA 2OCLA 2NGRA 1Z07A 2VJNA 3P2EA 4H31A 4X93A 2XT9A 3V97A 1UT6A 2FQXA 4P7FA 5C81A 3NETA 1GAWA 5CM9C 4IPTA 4BBZA 2WF9A 1VLHA 2WHXA 1P45A 2D7CA 1Z5UA 1LJLA 3ZVLA 4PIVA 3WLKX 1DTEA 3A4MA 1FP4B 4HEA1 5ERYA 2JEOA 3W2TA 4AY2A 4RH0A 1MTZA 5ALXA 4I50A 4O8ZA 1M8KA 4OHWA 5G0TA 3L8CA 4GOOD 1EA7A 2BMVA 1ABFA 1TD1A 2JZNA 2X9NA 4LY0A 4KYVA 5AOCA 4ETNA 4V0NA 2ZTUA 4EYSA 1ISHA 2R60A 2WD7A 3CLHA 4QFCA 4CLRA 3WIBA 5JCZA 4TSFD 5LPNA 4WCFA 5MN4A 2P9GA 4ESEA 1ZRNA 2AW3A 1Q77A 1TQ2A 1DJNA 4QM7A 2NZYA 4CIAA 2NO5A 1CEXA 3RBVA 4W1PA 3B6KA 1JIXA 5I8ZA 1UFVA 2UZ1B 4KXWA 1OX6A 3K0FB 2FFAA 4C3OB 1RJGA 1YF3A 1W4RA 2A5JA 2V4ZA 2YFKA 2DFNA 1ULUA 3TBFA 1J9ZA 2J3DA 2PFGA 4NPCA 4ZICA 3CTPA 1THZA 1GSAA 3EGIA 3PI7A 3T3EA 4JOQA 3G8CA 3OSZA 2RCNA 2WIJA 3DZKA 4TV8F 3W79A 4AJOA 1CQIB 3WLJA 2SCUB 2Q3FA 2GCOB 3D0OA 5A3JA 1Y3IA 5AVVA 2VSFA 3VH1A 5E1BA 2RBKA 3O93A 4W1SA 3IAEA 2AS0A 2NXEA 4IV8A 4LBYA 1CDDA 4XD7D 4LQDA 3DYIA 5AJUA 3SC6A 3LTNC 3E7DA 4B3SB 4BE7B 1W75A 4NXMB 1MBZA 1PR2A 1I2AA 3BTSA 2L19A 3HACA 3LX8A 4Y9RA 3GROA 2BGRA 2AC2A 4WXYB 2VYNA 1BCRB 1VLQA 5EJ8A 5J9FA 2OXIA 1XHEA 5JARA 3V1KA 1GO2A 2XMDA 5I6DA 4DCMA 1NP6A 5ESRA 3K8YA 1VSUA 1KJIA 2J3JA 2VJCA 4G89A 1PD0A 4RTPA 6Q21A 3NO4A 1B00A 3KYDA 4PSKA 3W9YA 5LL6P 3GUYA 1FX0B 3ODPA 1CJTC 3L1HA 3ABIA 1XCJA 4P2BA 4F96A 2C7RA 2NSJA 3CWZA 3DGFC 3QPVA 1OTXA 1NDUA 2P11A 4RQBA 4XQEA 4E13A 5HQTA 3HB1A 1AQYA 4WNAA 4BMCA 1QQTA 2AZXA 4UM7A 1K3TA 2OXEA 3IMGA 1FNMA 5FD8A 4HRYA 1OH6A 1BH6A 4MWSA 1Z5ZA 5EWJA 1QGDA 4WBNA 3AKYA 1TQ8A 2BBWA 1V71A 1ZI8A 4YH1A 1HE5A 1QHHB 5LYYA 4C7OA 3OQPA 1YVUA 1SUFA 1Q12A 2C4UA 4Y2VA 3ON5A 3O8LA 5D8DA 1QR2A 2EFEB 2VXOA 1OU0A 1JA1A 4JUAA 1KSJA 1ICEA 5BQ3A 1K3FA 3VBEA 3VDMA 1GA6A 2QJWA 1W94A 3MT0A 3RVLA 3RVOA 1HQCA 3LQFA 5DP1A 3S29A 3FYHA 4LJ8A 5L3QA 4YRRA 3H1BA 8ABPA 2ID9A 3L7KA 3NTUA 4LNHA 2XF8A 4OBWA 2M6KA 2JGDA 3SICE 4WK2B 4JB8A 4ALNA 4QYMA 1SMKA 2N0SA 3I30X 4XGRA 3R76A 4UNSA 2L82A 4L9AA 2ZGVA 4EITA 1D2AA 1N2JA 1P62B 2FUG1 3K7EA 3EH2A 4GVXA 4N3GA 4EO9A 4QO8A 1PV1A 4NMWA 3M3DA 1VB3A 5D5PA 4JYPA 1IEQA 4J0FA 3IIIA 4LISA 2AFRA 2PO5A 3ZTYA 4AT1A 1EAMA 3UOWA 1PJBA 2PWZA 1ODIA 3C2QA 2FJPA 2WIDA 4IIJA 1A9OA 3CE6A 2BCJQ 1X9GA 2AG0A 2VNSA 3UM9A 1WMDA 3IDSA 4PEVA 3RG2A 2DGDA 2PSFA 4RKFA 1NWHA 4BECA 1XMJA 3QPDA 3N2IA 3HO1A 2X1LA 1DQYA 3LRXA 3HR8A 2IPNA 3M89A 3U7EB 4X97A 2V7VA 4ZI3A 4RMJA 1AGYA 4RTOA 4I3FA 1FL9A 2IXGA 3VOBA 1ZGCA 3WRYA 1BYIA 2NP6A 3STXA 1AQIA 2GCPA 2ZUTA 3STWA 3WHKA 3OHPA 4U9UA 3TTVA 1AB6A 2R1TA 5HS4A 4NE2A 5DHFA 1NR5A 5A05A 4XB2A 2Z58A 2HTFA 2QN3A 1RAGA 5IG2A 1U7HA 2AVNA 1ZYUA 2MWMA 4I3GA 4KAXA 1YZKA 3KUXA 4DM7A 4JYAB 2PAAA 4R2JA 1QOZA 1EVZA 4IO1A 3AQ4A 1AE1A 2F6RA 2IEYA 3SHVA 1CJCA 4B35A 2HF2A 3E61A 1P1KA 1NN5A 1T36B 3ZWOA 4B79A 3EQ7A 3FI0A 2Y93A 3R75A 3VAAA 3GLQA 2PJRA 5A4DA 4I46A 5I47A 4IQ8A 2AMYA 1K92A 3HU5A 1Q3KA 1KOFA 4URFA 4PS0A 2QRNA 4WZAB 5CNJA 3U17A 2QMUA 4XARA 2G9ZA 4JFAA 5GJBA 1JAZA 1V0JA 3DNPA 2W71A 3QEKA 1CZKA 4PWYA 2YV4A 1H4SA 2BR3A 1ODFA 4RD2A 1VBMA 3T9AA 4NFHA 3W3AD 1I2CA 5ILQA 3WLIA 4BTVA 3G5UA 5FUBA 4H7HA 2ZVDA 2H2AA 3L7OA 2CJYA 3BBLA 3L49A 4KQWA 2WHPA 1CNMA 2OP0A 4PLYA 5ED4A 1TIPA 2E1PA 4CWAA 3R5XA 2GBGA 2F17A 3ESXA 3FD8A 3N8NA 2BEWB 5BOVA 1OB5A 2IKQA 4W5WA 3OIYA 1UPCA 3FM9A 4XLLA 1ORDA 3GYGA 5K5EA 2I6TA 2NV0A 3N0RA 1BOOA 4YXWD 1ZSNA 1VGQA 2HK9A 3FGNA 4S12A 3FUUA 5I3ZA 2GN4A 1N8NA 1HLDA 2OEPA 1E0AA 4DSNA 3WR5A 5EQTA 2F67A 4RL6A 2ZJ1A 1ECLA 4QJIA 4U2BA 3TKLA 3VTZA 4A4DA 4B3JA 2QUJA 4UUPA 2AG8A 4MZDA 1EFVB 1WKBA 4WNCA 1UBFA 2W90A 3JZMA 3H13A 4NENB 3AR3A 5BWOA 4MB0A 1OW3B 1U63A 2YFYA 4PBTA 1PTJC 2IBTA 3K09A 4FTWA 1ZUHA 3OLQA 4N6OA 2W93A 4R41A 2C29D 1EVQA 1F2TB 3D2BA 3GDWA 2HWWA 1MOSA 4W5QA 3DV0A 4MKXA 1SVNA 3D3QA 4FDVA 3HDTA 5IM4F 3PWZA 1D9ZA 1MZPA 1N4AA 5CCBA 2Q1UA 4U2GA 1Z7GA 1CS0B 1R0WA 3VU9B 1YS6A 1HLGA 2IYFA 5ICCA 1ELOA 3C8HA 4NL4H 2D3WA 4RFSB 3A1WA 4J2HA 1JQDA 3EVCA 4XUCA 1IN5A 2QU8A 2YN4A 3PPXA 3K31A 3CG0A 3A06A 4ZI7B 4BKOA 4Y18A 4FGZA 2ZSDA 1IXKA 2ZIZA 1ZSVA 1P2UA 3A9TA 5AW1A 2C2WA 4EA8A 1G55A 4JASB 3BE4A 3RTGA 1RM3A 3CR7A 4H0NA 3RNLA 4IYJA 3O1HB 4EFMA 1KFBB 1LQTA 1S01A 4BV2A 4N5HX 4Q1VA 4MW2A 1TC2A 4CG1A 2IDZA 2PZLA 3LBFA 1GR0A 5GONA 4JLWA 4BO6A 2AR7A 5JU6A 1WETA 3EARA 1QIEA 1RI3A 3OETA 5JSZB 1XZNA 4XJTA 3KB1A 3BS4A 5K51A 2PKWA 1U0EA 3FTNA 1R0BA 4PBRA 2X5OA 2DFLA 3GJXC 3D7MA 4M8LA 3A3NA 4YRQA 4B6SA 3IOEA 1EGAA 2Q5CA 3EGCA 4NYMR 2G5CA 1QHGA 1ULAA 1X7YB 1XXLA 2C1EA 2CHUA 2HA0A 3I52A 3NVKI 1IONA 1QYRA 1OMOA 2ZSUA 1HL7A 4LSWA 4K6MA 3PXBA 4JNCA 4WY2A 2ZZMA 3D4LA 3C14C 4JT9A 4DWWA 5ICSA 1LBQA 5BR8B 1GTZA 4QAQA 5IJAA 4PZYA 3PUWA 4UD6A 1NASA 1Y4DE 3QHPA 4HDKB 4IXMA 4OPMA 3TRKA 2O2JA 3UV6A 5HZHA 4NG5A 1A71A 3QUCA 1VL0A 4X7PA 3JZIA 1FXWA 1W46A 2A8YA 1X0XA 2DR0A 3ZQJA 2QM7A 2RONA 1PR1A 2WVJA 3O47A 3ST7A 1AK9A 1XRPA 4ZA2A 4MRVA 3TAXA 3R74A 3SJ7A 1E7MA 2P1DA 5AT1A 2CSXA 2QMEA 4PQGA 3PEFA 2GMWA 4DC0A 4EABA 3BCSA 5K99A 3ZY6A 2X1HA 3OA2A 4IIYA 2E0IA 2GJAA 3BIWA 2ENUA 3ET5A 3FOAA 2R2AA 1US8A 3HV0A 1FF9A 3MWYW 3FPBA 2JFZA 1CU1A 4P92A 5HMMA 3ZDXB 10MHA 4OREX 1C30B 1DDIA 3BGOS 4F91B 2ZRMA 1GZ7A 2ZQ5A 3HXMA 5GM2A 5CFRA 4BMSA 3B9PA 2BM9A 3AXTA 1F3LA 2HLDD 3MQ2A 4UUMA 3GBPA 4AZ0B 2Q6LA 1UIRA 4PC6A 5L7YA 4BOYA 3GWZA 1A2QA 3HUUA 3PNYA 4GF5A 1QG0A 1AKYA 2BSXA 3L7DA 2GAOA 1FP6A 5JAQA 4QG3A 5DXFA 1XCBA 2B5WA 5IAOA 2P9YA 2JI9A 1YK0A 2GH1A 2YIJA 4Q01A 4JQYA 4DC9A 3ONVA 4XDYA 4Z4HA 5CLFA 5ADHA 5GTDA 2E4UA 3KQKA 1F17A 4YAIA 4QPCA 5ITVA 4Z4IA 3V8VA 3HNRA 2BRUA 4YTEA 5M7EA 3AVVA 4RTMA 2OZLB 4EHFA 3IS3A 3DMGA 3PNKA 1LC3A 1E64A 1OT5A 1G98A 1TE2A 2IDJA 4OA5A 1I2BA 1QS0B 3TIVA 4JBNA 3RRNA 3VNUA 1B43A 3TX2A 4EF6A 4Z9XA 4BZXA 1BXKA 1U28C 2CB9A 1GQQA 1Z6XA 1JA0A 2JLBA 3QQ5A 3A1EA 5LU9A 3NRBA 2C88A 3SF8B 1EFRA 1E3IA 2RH9B 2W83A 4XJSA 3N28A 2CLMB 2PBRA 721PA 2QT0A 3HBAA 5KOYA 4KHPB 2QK4A 2UAGA 2ZWPA 4MQEB 1OXMA 2AN1A 2CD9A 4H0FA 1CNFA 2AZ4A 1ZUIA 2WMNB 4NJMB 4ND7A 4Z9FA 4H35A 4KGZA 1I7LA 3TXXA 2ZI6A 1T5HX 4F2PA 1GPWB 2W2NA 4Q4DA 1GL6A 1X13A 2GXAA 3PGKA 2X4GA 3OPYA 4BX0A 1X14A 2X22A 1C1XA 3I9KA 1E1MA 1RC0A 2XNCA 1XDWA 3LI2A 1G5PA 3L7JA 4QBGB 4IG4A 4EPXA 4LE0A 4ZDKA 1YJQA 2V5AA 1VJGA 2AA3A 4M7RA 3VR2D 3V7WA 4FFNA 4Z3DA 1YIDA 4D99A 1AA6A 1KJNA 5DLPA 1PW7A 1X92A 4AW9A 1YS2X 2QM3A 5E6SA 1JGTA 2CJWA 2Z09A 3I0ZA 1NJ5A 4PV7A 4TVKA 5AVZA 1CEYA 3KVRA 4PZAA 1HRDA 3IAUA 2PX8A 1YRHA 3CIOA 4DRXB 4AX8A 4HB0A 3H86A 1NVMB 3FH0A 3ANMA 2AE1A 4FW9A 5EXEA 3RDPA 1IRIA 2IHJA 3W04A 4BLOA 1BZYA 3GDGA 1VIAA 4HJXA 3RT1A 3ABRB 2HRBA 1PX2A 4CKEB 3WYGA 5G2OA 1EK5A 3DDOA 1OREA 5JEDA 2WNSA 1VXRA 3ETHA 2B0CA 2OBBA 2VSOA 5C8YB 3SQXA 2O8BB 4N8SA 4GRAA 1B0ZA 2GARA 2R1ZA 3VR6D 3AU8A 2H2WA 4NAUA 3QXHA 4KFRA 1E9RA 1QF7A 1TEZA 4X00A 3GB9A 2IYNA 3N2ZB 3IEXA 3H8JA 4ZV9A 2UVDA 5KO2A 4C9BA 3O75A 2VTKA 5JSKA 4D9GA 2H1LA 2QJOA 5HA5A 1NKTA 4HV4A 1KFCB 1OWOA 3E03A 2CUTA 1QPBA 1ZDMA 1TF2A 5JHGB 4EO4A 5H80A 2WT9A 4HFJA 4IIGA 5K4AA 1HDCA 3PDWA 3BL8A 4DANA 2CCGA 2ZIXA 4FYMA 1GEGA 3OTHA 3ZDCA 3BYZA 4V24A 3A6EA 3B60A 3ZLBA 4KQHA 1WX1A 2J9GA 1T24A 1LXCA 3E70C 1PVDA 2A35A 3NWOA 4A0SA 4QHYA 3R5HA 1LRKA 3E27A 4HGQA 1F2UB 5JAHA 3NIWA 1M2GA 4LRWA 2RI6A 1IZ8A 4BQIA 3WJ7A 3AJEA 2PQMA 4YJGA 4MDEA 2OECA 5B12A 4J1TA 2GTPA 4R69A 2C5GA 2V96A 1PL8A 1J5PA 1DQZA 1I1NA 4HL6A 3DTVD 3EMVA 2XUFA 5CRIA 2AK2A 1WDTA 2XQIA 1KZ1A 1MC1A 2WIBA 4R2KA 3COYA 1CY4A 2QXYA 3DZHA 4ODIA 5CH8A 4RAQA 2ZBFA 2YZMA 4C5AA 1NBME 3DBHB 1C7RA 1TJ3A 4LXQA 1E2JA 2IZ7A 1U4OA 3PGMA 5DI3B 5DNUA 2UKDA 3W6UA 2Y77A 3G0BA 1Y34E 2DKFA 3GEIA 4MPTA 3V46A 3SSAA 3OTWA 5KNDD 1VBNA 1A5BB 3ENKA 1A98A 1L9KA 1HT1E 4KTTE 13PKA 1Q1EA 5F3DA 1UM9B 3R3JA 3ZV4A 2HQOA 2QJTA 2AOTA 3LXRA 3I39X 1O7JA 3LQYA 4W7SA 2WIAA 5HFJA 4BFXA 3HVHA 1OB2A 5A3QA 2VRCA 3MTQA 4KPGA 1YSCA 5JH7F 4EOGA 4Y6LA 4GI2A 4UUAA 5DFAA 5TPWA 4E1AA 1EUDA 5INTA 4W9MC 3M9XA 3L1UA 2F3RA 1NVWQ 5D6OA 4G1MB 2FDCA 4GGOA 7ABPA 2QR5A 1C2YA 4DUGA 3BREA 1GGFA 2X0DA 2OESA 4LI3X 2O48X 4MW5A 3PGLA 2I2CA 2V9CA 1SC1A 2O1XA 4H3HB 4CTMA 3AF1A 2CBXA 3O21A 4BB0A 4PYKA 3NNNA 3OT1A 4BEWA 1AGPA 4MVJE 4ECEA 1CERA 3Q7EA 5CCEA 3N0WA 1M54A 4CG3A 1U80A 3QVLA 2IFTA 4YO7A 1GPKA 4IIBA 3PJFA 4TX1A 4MIYA 5GP1A 1KAHA 4RQTA 3LT4A 5KYYB 3SZUA 5F5LA 1OX4B 4NEQA 4HDOB 4O4IA 1V8PA 4A3SA 5KX5F 4U7GA 1BWQA 1JF8A 4G8DA 5I4KA 1XNGA 4JZYA 2V7BA 1LRJA 1Q7CA 5T41A 1NBMA 1Q6ZA 2XCOA 2XNSA 3K15A 4HZUA 2QVYX 4DV6B 4E2ZA 1Z56C 2PVCA 3LVFO 2FCAA 3G2PA 4RENA 4XOUA 4I8IA 4OFXA 1KK2A 2LKDA 2JKVA 5CP8A 5ECWA 1BN7A 4ANFA 1W1IA 5F2NA 1LBIA 1OFUX 4AKEA 3MCVA 2OV1A 3LT0A 4X1KA 2VBCA 4G86A 4XQ0A 2IE8A 2QHXA 4DEYA 1WCWA 3MT9A 4DLSA 1F12A 2ERCA 2FPWA 2HV9A 4P82A 1PW5A 3F4LA 4OM7A 3L1KA 1BXGA 1NP3A 1SA0A 1CTQA 1NMZA 1U9YA 1XXHB 3IESA 1MB9A 3UH0A 1ESCA 1FFWA 3Q3CA 3E53A 4BU0A 4F84A 5HSGA 1FU8A 1OZHA 1TQHA 2X9VA 3ZZUA 4OHCA 1M6HA 1D8AA 5JAMA 2B35A 1CUXA 3HJGA 1XCOA 4FFLA 2C3UA 2QX6A 3BG5A 4Q0MA 5J2UA 5ALOA 1YV9A 1GG5A 4LRUA 4JWKA 4LFCB 3PZBA 5LZ4A 2VRWA 3HKBA 2VAMA 4U0JA 3SSNA 4MVJA 2D06A 4QOEA 5TNXA 3T3IA 5PNTA 5LZ2A 2DJIA 3G1TA 4ZFNA 2OMKA 2ZYDA 3AB7A 1T26A 2WHEA 1QG4A 3M5WA 1GQOA 3E1GA 3PC2A 3SLRA 2BFNA 4RD1A 3P5BA 3DJYA 1ZOIA 3B89A 2ZUDA 1W9HA 2G40A 1MRZA 1IU9A 3BN3A 3RBZA 1SVUA 4B3RB 1KZ7B 3CFYA 2B36A 2J7KA 1WY7A 4C6SA 2QW8A 1Q3HA 3EMBA 3U7QA 5K01A 4ZTBA 1OY1A 3GUZA 1X1AA 2FN4A 4X20B 3U4GA 1HNNA 4TQ9A 5FBRB 3HCPA 1CULC 1RZUA 2EIHA 1UKVY 3DHNA 3EIQA 1W19A 4W5JA 5DYTA 4AN0A 1KSHA 2EKPA 3TS1A 2UYGA 3TTXA 1RQRA 3WFZA 5KJCA 4HMPA 3R23A 3E4CA 1IHPA 2OFXA 2FZEA 4PHHA 3DVAB 2W43A 1RQPA 2O0HA 3AY6A 4BKQA 3R8CA 3CF0A 2C42A 1L8QA 4ITUA 1YJXA 3IIJA 4DIKA 4JP8A 4R8SA 3NIGB 2EL9A 4WGFA 1XJWA 3LMKA 3TLYA 3R3ZA 4TYPA 4RK0A 4MJXA 2GVNA 3LNCA 1DQRA 5TF0A 2HQBA 5IDQA 4HUQB 2HLNA 3JZDA 1PO7A 4BTEA 2AZMA 1M2FA 1UANA 4F5DA 5JQGB 3OUZA 4O5AA 3SD7A 3Q10A 3T7IA 2M1XA 4OCZA 4P93A 4PG7A 2CLFB 3TIFA 4Z7JA 4IV5A 5TMDA 5EJ5A 1KP2A 1H42A 4JI0B 4KO1S 1IG0A 3A28A 3NP9A 1HV8A 2WJWA 3L8MA 4MKRA 3UYLA 2ZJYA 3OU7A 3A2MA 4M22A 1L4KA 1PFGA 1TO2E 3KEGA 2FJ0A 4RETA 1RE1A 3O3OB 2VPTA 1Z74A 3NIBA 3TVTA 3GLIE 3KPYA 1AO0A 2OHHA 4KQ2A 2OR3A 4DV5B 1EVLA 1W8DA 3L5KA 2C2XA 3FOFC 2XQVA 4Q4AB 5FTNA 4OJKA 4QC2A 2XYGA 3MERA 4MQMA 3EBPA 5E8JA 1DJMA 4OH1A 5JRJA 5ABPA 1MEJA 1SVIA 2ZYRA 4GZ3A 1JDBC 4B8WA 2WKSA 4IIEA 2I6XA 4RHEA 3IQXA 2XCTB 1VG9B 5CB4A 4GICA 4JB2A 4OUDA 3WKDA 5JQGF 1Y5LA 3WYCA 3VOAA 2VA8A 1LEHA 1JZQA 1QV7A 2O1WA 5FWXA 2M98A 1OLUA 2H2DA 3QVGB 4PONA 1FQWA 2JKYA 4RVHA 1KHTA 5GQSA 3WG9A 4BFWA 3FVRA 1OUMA 4GI3A 4JLAA 5FWAA 3TAUA 1YMVA 2G06A 2VJMB 4YUAA 5FPQA 2WJIA 4PC3A 3V32A 3HSYA 2FR8A 3QVKA 3QOXA 1ZGGA 3EPRA 1SOWA 3CPJB 4QXQA 3LKBA 2RGNA 4WMLA 2EKBA 3VC3A 3GR6A 4H6WA 5TX7A 2GEJA 4II2A 3FIUA 1JEQB 3KLNA 2A58A 1C7FA 1L3BA 4XEUA 5HK8A 5IWCA 2ZCJA 2VDPB 1ZA1A 3HGMA 4BNMA 5BV1A 3DLHA 5F21A 3K5HA 2RC6A 1TYBE 4JYZA 5JXHA 1ZAYA 3GFVA 3I42A 2B8TA 5JNWA 2OHOA 3F3MA 2EHDA 3GLIA 1QH1A 1U02A 1Y7IA 2FN9A 3DNMA 3GJ4A 4FLEA 1P2TA 3C3WA 4UATA 1Z4NA 3QMVA 1RM4A 5JROA 3PITA 1PS9A 2WBLC 2XPCA 2XJ4A 3ETGA 3H83A 5AJWA 1OILA 1CUJA 2R68A 4D4JA 3VZQA 1O6BA 1UJ2A 1DHTA 1YQQA 3GT3A 3UA4A 5KMGB 1NPYA 2WUWE 3ICQB 2A2ZA 4KDFA 4D4GA 2A0YA 3ITEA 3C5WP 3ELYA 2Q4RA 4N5IX 1PJLA 3SC3A 1CQJA 2HEGA 4PM4A 5U4QA 3ZOKA 3ZDYB 2C83A 3H97A 4HTFB 3MGGA 4XWYA 2JCSA 4IRUB 4RGQA 3GQBB 1QVAA 2PXHA 1N9GA 1HH4A 2GR9A 2CVHA 3CNHA 3NASA 3CIFA 2A0WA 2VLIA 4AO8A 1WULS 2P0YA 2C4WA 3QLJA 3JAKB 3BD7A 2C4NA 4H4CA 4NZPA 1NZFA 5IKOA 4URVR 1X7XA 4KQ6A 1PQWA 1Z6YA 2FHPA 3CN7A 3DE2X 4RA9A 4S0XA 1HNZB 2DFDA 4FDAA 1NR7A 4DXDA 2ZS8A 1F8UA 4H1UA 1QWSA 1EQ2A 3OX3A 1UBUS 1R6VA 4KRXA 2W2XA 4QHTA 1KAGA 2K2QB 3VHQA 1UZMA 1XF1A 3K6JA 3OCUA 5FNZA 4Z9BA 4ZYWA 3HMQA 4KR3A 5A62A 5LP6F 2CFSA 2GCNA 3RS7A 3C4VA 2VRNA 3SZ3A 2KI5A 1AM4D 2VOEA 4DR3B 4UAGA 4BUCA 3CJTA 5GJWC 3L4KA 1E1QA 1TK9A 1K6EA 2QT1A 1EUYA 3QELA 5E95A 4LZWA 2G09A 3R5SA 4YAJA 3UICA 1VDZA 4BATA 3BEOA 4KX3A 5ALUA 3THOA 1RSZA 1Z25A 3KQYA 5B1DA 3JAWB 1TD9A 1LQUA 5IMBA 2H65A 3QY0A 4KXNA 3CUUA 3ZNOA 4LVCA 2ONYA 2KW5A 1XELA 2O7SA 2IC5A 3HYTA 3PCXA 4UU1A 1O89A 3GIDA 3GRAA 2PZMA 4CMEA 1D2GA 1SIOA 5AW7A 2VYQA 5ESDA 1VJCA 2UUBB 1DEAA 1ZHFA 1Q84A 4ZTUB 3GP5A 4PGMA 4PCLA 3CH7A 4XEHA 5GY7A 1WNFA 3IVRA 2O57A 1A5SB 1C0PA 2DZDA 2F3QA 3PQ4A 5H1YA 3P4UA 5LB2A 3QYPA 4B80A 4D9BA 3CVUA 2QMHA 3UQZA 4EBFA 3DAPA 5B1HA 5A3VA 1JDVA 1RHQA 3FF4A 4CKYA 4CM8A 1WP4A 4JVLA 2GYYA 4MVWA 3UK0A 2GOYA 3JY6A 5AW8A 1D2HA 2C03A 1D1SA 5EE0A 1RC8A 2YRWA 3GDHA 4ZVTA 1W36D 1R9MA 4GYWA 4LMAA 4DIOA 3HVKA 3IO3A 4BLVA 2GYWA 2MMCA 1W29A 2HU8A 4EJ2A 5AVYA 1TKAA 4JT8A 3WGJA 2G1AA 4I55B 1TKBA 2NVWA 4Y30A 1AN9A 1SUPA 3FMGA 2H2FA 4FGKA 4LWQA 5DV9A 4E3WA 5BORA 3NALA 2A9JA 4Q7EA 2G4CA 4MX8A 4O1MA 4V39A 4M0MA 2DBYA 2QI9C 1E2QA 1RLTA 4EL0A 4B9AA 2EQ5A 2FMIA 3FRJA 1AVTA 1VECA 2NM0A 4K0RA 5EAIA 3ZIDA 3DH0A 3ZDRA 4F3RA 1PDWA 3C45A 3FYUA 1K0FA 3NAZA 2CV1A 1KI8A 1LSUA 3K9QO 3OCVA 2C58A 2FUCA 2G36A 1KR2A 2CKMA 3TB6A 2I3AA 4RK6A 5EIWA 1EBBA 1XA3A 1AQJA 3KZCA 1CDOA 4I9HA 1WJGA 2XCUA 2VWHA 1MT0A 3KETA 4N6GA 1NL3A 2YV2A 3IE0A 2HJVA 4O8CA 3SFZA 4MS1A 5KSPA 5D2CA 2ZAIA 1SVWA 4DIFA 5KNLA 1P39A 1KI1A 4UE6A 4UPVA 4EUHA 3VJKA 2V8BA 1H4VB 2IOQA 2K4MA 3DBIA 3ZLUA 4BASA 2VTVA 4ENWA 2BGWA 4P86A 1AS2A 3NBMA 3A36A 2YASA 3GEHA 1PHPA 4I0WB 4Y0AA 2IU4A 3DHWC 5KYVA 2I99A 1A04A 1MQ9A 2JJ2A 4DG8A 3W2IA 2X7HA 1CETA 5BVGA 4LK2A 4BMXA 2WTMA 2FP4B 3HBLA 4UU8A 4CW7A 1BDIA 3OC6A 1XZMA 1TZBA 3DFFA 3SIXA 5EP3A 4Q1BA 2FP3A 2K6GA 3UAGA 1JR3D 2Y6UA 3H2YA 3EEIA 4XI9A 3AEUA 3IHKA 5MF6A 1YK1A 1PGNA 1U7PA 1II0A 1UJ6A 2X6RA 2G6BA 1NYTA 3B52X 4A1FA 1T4MA 2DU8A 2V0NA 4LMPA 1XVVA 4ZHQF 1PR0A 5JHHB 1FY2A 2ACEA 4DMKA 2R6HA 4JEIA 5KOIA 1GFZA 4DLBA 5IXSA 5IRCD 1ZL0A 1MTOA 4EY7A 2EP5A 2X6TA 4OHUA 2DF8A 3T7JA 5HF5A 1CWUA 2W9XA 2AKEA 2JJ2D 3KYBA 3BMOA 3ZE9A 1G6KA 1ZJ6A 5I9MA 5C0OE 4BFVA 5K3CA 2VEDA 1CR2A 3FCYA 4J0DA 4M7WA 5FAXA 3IEMA 1E60A 4CL2A 1FDTA 1U7WA 4FEEA 4LOIA 3M7IA 4XPZA 5EIEA 1K8ZB 4JB3A 4Z1OA 4N5DA 5GPBA 3O84A 4A2QA 1XCPA 3WGGA 2ZYVX 5AXBA 3HXOA 4AM8A 2HRRA 1IZ7A 1ESZA 4N3AA 4KQKA 2JLUA 1NLZA 2A1UA 2JBAB 2QQ0A 4WLOA 4ZVLA 1RP7A 1LCIA 2AEEA 1CJMA 2EERA 2HQRA 4RK1A 4RX1A 4B87A 3FWPA 3U26A 3WL8A 1GGVA 1GTG1 5C9ZA 2D2FA 1G20E 1KMCA 3SJAA 1C0IA 1C0LA 1OXTA 3QENA 4CL3A 5I7OA 2N47A 3GRFA 4ID3A 1T0IA 1CJVC 4BP1A 1O0SA 3L4SO 5CXXA 3BSWA 2VHYA 2R00C 5E9AA 1UKAA 3GWGA 4J2TA 4N4AA 1SXQA 1KYTA 2B92A 2PQ2A 5DE3A 1P9WA 3KWFA 4O4HF 4L8FA 2FU5C 1PBTA 2Q1YA 4A36A 2P30A 2BKLA 1I51A 3FCOA 3OQIA 1Z2CA 3O8OA 3V1NA 5I7RA 4EUFA 4ZIRB 7MHTA 4NEHB 4O2BA 1T5TA 1C3LA 3EGXB 5EZSA 5KTYA 2C3PA 4FUQA 2PR2A 4LXYA 3ENZA 5TQ2A 2ONKA 4IXTA 3KHKA 4U9HS 4WACA 3RS3A 2BW0A 5EXXA 1OF1A 5CT5A 1W2WB 3MINB 2G0TA 4OHOA 3M83A 1N3IA 1K89A 1R9GA 3WKEA 1WL8A 5DYWA 4EVRA 4W6QA 3WLHA 1E6LA 2CWDA 4RY0A 4B46A 2ATEA 3IURA 5A4IS 2LIPA 2O07A 3BXGA 2VZ8A 4NS4A 4BGEA 1SHZA 1UADA 1KJYA 3SHTA 3TKYA 4LF4B 2MMGA 5AOBA 3UAVA 3GMTA 4U2CA 5KI6A 4TL8A 4UDOA 3MPUA 1I94B 1JS1X 4ENRA 2ZRDA 2XTMA 1NA5A 3PNBA 4OJTA 1M6NA 4XGQA 1OVGA 4JLJA 4TVBA 3E9RA 1DUIA 2ZVPX 3AY3A 1FJ2A 4ZT5A 4GMGA 3ZCXA 4BDSA 4DKXA 1R0LA 1N6HA 1XRSB 2JHGA 2ZT6A 3AR9A 3JQCA 1G20A 1T5OA 4IVNA 2WJHA 3GJ3A 3LW8A 1FTWA 4L8GA 5EMJA 4PRZA 3FDZB 4PQEA 4YDSA 5C37A 3LOPA 2Q5HA 3I6BA 4QUBA 3UCFA 1CUFA 1S3GA 2NTVA 1H8ED 5FJJA 1YBMA 1P9NA 3VPGA 3PFWO 4ZREA 1WW3A 3G23A 1FIUA 4TYQA 3H5AA 3NWBA 3O92A 1VPDA 2QYSA 1K98A 4NC9A 4R1LA 4REQA 5AVUA 4DKJA 5KJFA 1O95D 5LA6A 1QANA 2KSQA 3D6FA 4Q7QA 4QUGA 1IB6A 3IDOA 3GLHE 4GUDA 3RVJA 4IHJB 4R1OA 3GJSA 4ND5A 3DO6A 3KIPA 4PZLA 1EHIA 4MB2A 1ZM9A 2FLVA 3LKDA 1LNZA 2NTEA 1AG9A 2DQZA 2NZVG 2R96A 2R44A 5CR9A 2G9NA 3LT2A 3QFRA 4LK3A 2PAFA 4XASA 1P7YA 4TL9A 5JJKA 4XOIA 1R37A 2Q6OA 4AYWA 4G0XA 4OBXA 1K08A 1J8MF 2FQ1A 2F8SA 4Y2YA 5DEOA 1KMIY 5FO1A 3FKSD 4A5SA 2QLTA 4PGHA 1VYVA 1OI7A 2ZSBA 3ITKA 1XNRB 1R5JA 3GPDG 4CHTA 1ZGBA 3TINA 3EXAA 2AFHA 2QYTA 3D4BA 4AXBA 3K70D 1Q91A 2CXRA 4KAJA 4HNHA 4EPWA 4ZI2A 1M10A 5SYAA 5AKZA 1CKEA 4D43A 1UC4B 5JPCA 4HADA 3I6QA 1QP7A 3NH9A 4FDTA 3RYFB 1A9SA 4RU1A 2DLCX 2DMRA 4BNTA 4LHSA 3VJRA 3QTBA 4ZO9A 5E3IA 1NNI1 2RSLA 1Z6TA 2XOKA 1XWFA 2GBLA 1SCBA 5IUNC 3HDYA 4GL4A 4LG1A 3UY4A 1VOTA 1KZ9A 4D8TA 3O26A 2LCFA 3B1ZA 1LPNA 5DGCA 5DJ5A 5CHYA 4QQKA 5D7NA 3GLHA 3LGXA 3NTOA 4FCVA 4YDRA 3WGUA 4IS2A 3K1ZA 5AESA 3WIVA 3WOHA 4Z4FA 4US0R 5ALVA 1P1RA 3F1KA 4TV8B 1XJ5A 4L4YA 5FLKA 4TT3A 1ZJWA 5DM70 1E2BA 3IP7A 5CM8B 4W8HA 4Q15A 1S8NA 4HG2A 2DUWA 4ZVPA 5KNCA 1KH1A 4F0JA 3WC4A 3JWPA 4HVAA 2EU8A 5CEJA 2HH9A 2CFTA 2IYOA 2YY5A 4PPQA 4X1OA 3MGBA 1ES9A 3A6DA 2OFOA 5BNTA 3GGPA 2Z98A 3EWAA 2OG1A 4A2CA 2VSXA 3ZJ5A 3AINA 1FMJA 2OM2A 2IPOA 5EUCA 1Z4KA 4L9WA 5A71A 3ZDQA 3NWJA 1BE0A 5BSMA 3QPWA 4FHEA 2GZDA 3QPUA 3ZDAA 4C2BA 4NS1A 2PGLA 1A8UA 2MTBA 3HVUA 2BDEA 1H9CA 1I7NA 4I4TB 2CJPA 2PT9A 3PUHA 4MAMA 2RGCA 4RY2A 3V3KA 1R15A 3NHSA 1HLPA 1SFRA 4V0KA 2BKEA 1G9TA 3ABQB 4YRTA 4FB5A 2OD2A 3C6MA 4YPFA 3HM2A 5CYOA 4QGBA 2C57A 1H2AS 2GFIA 2QD2A 4ON9A 2Q5QA 1BU8A 3T0GA 3A6LA 5EJAA 3UMCA 1TFUA 8LDHA 4MHTA 1PR6A 4FYWA 4YS6A 4AYXA 3WNCA 4C78A 1CR4A 1N7IA 2H7YA 1G21E 1F6DA 3PV0A 1DRWA 4FCWA 3UHAA 4BNDB 3NTLA 2IP2A 5LLDA 1UBEA 1HDOA 2FHSA 2HMYB 2TYSB 2A9RA 1U99A 2GGSA 2WWRA 2YVAA 3OZGA 2FOXA 4KE6A 1J42A 4HNAA 4PY2A 4DY4A 2YRXA 3TQQA 3GGGA 3NI2A 3D3EA 4P8RA 2G9VA 3GAAA 1WQ3A 1TZKA 3L0CA 3M5DA 2OVFA 3U3JA 4NF2A 4FKMA 3UK2A 2RKWA 3FZGA 1WUJS 1OIXA 1OWPA 4XRRA 1GG9A 2ACWA 3RU3A 2C61A 2FH5B 4R05A 4BGIA 3HK2A 1OI2A 3L6DA 1FFSA 1JZSA 5BUSA 1DT5A 3MJDA 5JVDA 5AVRA 4EKGA 2YOHA 2K2WA 3EZYA 3T1QA 4B3FX 5DSZA 4BBPA 4RANA 4AQDA 5A4KA 4QHSA 3CG4A 1BJRE 3IB3A 1WHSA 4YRPA 1ND5A 5I7HA 1V9SA 4LY9A 2F64A 3KTFA 3PCTA 1GA4A 3RC9A 1YMQA 5IC6A 4JXZA 1I80A 3KBBA 4PXAA 2PH5A 1C3OB 3OJWA 4OGGA 1YU6A 4IWXA 4N0EA 1N1GA 4CMJA 2CYBA 1OH8A 1EA5A 1M2VB 3PUVA 1T35A 1NMXA 4Y1EA 5JJCA 2P6OA 3DLAA 2C7OA 4PTZA 4GC5A 2EEZA 1SEVA 1MJHA 1T5DX 3WGHA 3S1SA 4M8SA 1W0JD 4Z8XA 5DIZA 2OXFA 2C9MA 5KAPA 2NU8B 4GMKA 4OX9B 1EP1B 1RXUA 3FWHA 3O95A 3GNTA 1F6WA 2NZXA 1G21A 1T0BA 3IP1A 3NP7A 4TLCA 2QGZA 3KXKA 1E7QA 3CR3C 1MO2A 2XWBF 4JLSA 2CDAA 4MEJA 2AJLI 2QLJA 3C7TA 3UJ8A 3RODA 2PMFA 3N2KB 3PF9A 1RAIA 1W52X 1PGJA 2ZYTX 1ZN9A 2PKQO 3CF6R 3X1KA 3I58A 2JZCA 4WOBA 1LDNA 1WA5A 1L5ZA 5CT4A 3T12A 4D4LA 5EL0A 2IYWA 1C9EA 1J5EB 1K3UB 3E3MA 3EW7A 4H18A 1QONA 4OY3A 5FPHA 4GXQA 1CZRA 3Q85A 4ZRNA 5EE5B 3FYSA 4G81A 3THXA 1KPIA 1HTTA 1F5NA 2XGJA 3AETB 2VCHA 4L6AA 5A4JA 1S9HA 5CB6A 5KPJA 3L8FA 3TQFA 2RHBA 1AKMA 1T8PA 3P5SA 3QLEA 1I2MA 4C01A 2OBFA 1SKYE 4HDRB 1QPGA 2JJ1A 2PJDA 3PDCA 5K09A 1G4UR 1N6KA 5LSAA 3S0JA 1U0BB 1ZKMA 1NW7A 4OI1A 3NAGA 4QDUA 4ZOAA 2J5RA 4AVYA 2A5LA 4Q82A 4F1WA 2CKDA 1V1JA 4H17A 4F9FA 3CVYA 5DW0A 4O29A 4YPVA 4MUYA 4AJEA 3UAYA 4C08A 3C3EA 3PQ7A 1C7EA 1NW4A 3VNVA 3UJPA 3SN6A 1WB5A 3EGOA 4F1JA 1X1SA 4HDSA 5AUPB 2O0KA 1NI4A 1RPNA 2I4LA 2BMFA 3NDJA 4EAQA 4YJHA 5JTUA 1QKJA 4L2IB 3NV9A 4MQFB 4QT0A 2XCIA 3DKRA 2BEVA 1KA9H 1QUFA 1Z16A 1TF7A 1BRMA 1E8DA 1FYFA 2WDZA 3ER6A 5IM5A 5KTKA 4EZBA 2ALJA 1E8MA 1J09A 2QKYA 4GYKA 2MCFA 3ZE1B 4ZQHA 3AXSA 1UOPA 2BMEA 4O6VA 2DG2A 3ZE0B 4WRRA 3G7UA 3QYFA 4HGOA 4YDQA 4RCVA 4RVCA 4LGVA 2OV8A 2CNLA 4UBMA 1XMOB 3DL2A 4MRPA 4B32A 1Z2NX 2V98A 4H59A 1ZH4A 5FWYB 4N18A 3UOAB 1DC3A 3FPKA 1RWMA 2MT9A 4OYRA 5JY1A 2BSAA 1H3NA 2I5PO 5HQJA 2YWBA 4M1OA 3VR4H 4EHIA 4X6YA 1TAUA 2IHVA 5LR6A 3C4JA 3D5TA 3IUMA 3AI3A 2XDQB 3AVXA 1Y4AE 1UOQA 2QEQA 2QD5A 3AGQA 4QELA 1DWPA 1WZNA 2Q1SA 3P9XA 3WV4A 3UKDA 3F98A 4C4RA 3GT7A 4CIYA 5C7IO 4P34A 3L4BA 1I3OA 3AWDA 1Z0KA 2E4XA 4A0GA 5AHWA 2DR3A 3MGAA 3DL7A 4XFKA 2NADA 3O83A 2BZSA 4DVGA 5H8WA 3R3UA 1UEXC 1IAQA 3UHOA 2P62A 5SYMA 2HSWA 2QXTA 4PNPA 2JH9A 4FC6A 1JFRA 1SBHA 4CQMB 3GDFA 3D7KA 4L72A 3LF1A 3DMFA 5JJBA 3E3AA 1O1YA 221PA 1Z33A 4U8HA 5ICFA 3KOZA 3N7UA 4KR0A 3SQOA 3LWDA 4K1XA 3MBKA 2V7QA 3B1WA 5IC4A 3OOYA 4QPNA 5BNIA 1XPOA 4D79A 5IS2A 2ZXFA 2W2MA 3CKMA 1AV7A 5IYZF 4CG0A 3QPCA 3EEOA 1XL1A 2WJJA 4MV9A 4DNPA 3QLUC 1PKEA 3DVQX 3R6WA 1YA6A 5J4HA 2V4UA 3V4FA 5E6UB 3WLNA 4HNSA 2GZHA 1YBFA 2Q2VA 2VJLA 2QBYA 4G4SO 4TMKA 2X7XA 3NM4A 3WGKA 1K5PA 1X3LA 1SXJB 2XD9A 1XZIA 5C46F 4Z0HO 2MJLA 2PL5A 1ZIOA 4NV3A 5DLYA 4DCPA 1SXPA 5JZVA 4RTRA 5H3LA 1FDOA 3AEQA 1BXRA 1SQ0A 3AR7A 3QXGA 5TGDA 2NG1A 2JGAA 3T9BA 1NHWA 2E6UX 2PBFA 3Q72A 3SI7A 3UW1A 2XT0A 1L7MA 1K6XA 1R0YA 2HK7A 3D0RA 3I8XA 3PDIB 4JU9A 1JH9A 4QO7A 3F4KA 4ENQA 3NHMA 4B3TB 3OY7A 4OHZA 1N32B 3P9CA 1LZKA 3FGOA 4GR9A 2OYSA 4I5DA 4N12A 4Q4JB 2GFQA 2PMWB 5F51A 1UMBB 1TM4E 2R65A 4LRQA 4RK4A 3P0EA 5LCXA 4EW1A 1S02A 5EJMA 2IDMA 2X7JA 2YY6A 1NLUA 2BBTA 2F3PA 1RP1A 2UDPA 1MHPA 2B9EA 2PA0A 5F7ZA 5CDUA 4JA0A 2M6LA 2Z2KA 3JPYA 3ZD9A 2G7ZA 1V4VA 1AHIA 4I6JA 1EXWA 5IP5A 5C51B 2FSVC 4XX1A 1WUKS 2FLKA 4PX2A 1PK7A 5JI2E 1TEXA 4D9EA 3U0BA 3DFMA 4C03A 3UJDA 2VWPA 1SM4A 1E77A 1QYWA 1Z73A 2ASVA 3WMFA 3O6VA 1ZVMA 2DWUA 3FNRA 3PENA 1TYCA 2NZWA 3OCZA 3ETDA 3AX6A 4JOBA 1T1SA 5FO0A 1DCFA 2QX7A 3NTRA 5AJZA 3SJUA 1H2HA 3L41A 4WJKB 2VSQA 2CYAA 1TOAA 1VJ5A 2FF5A 3AEKB 2EYQA 2RK6A 3REFA 4PAWA 3PFFA 3MS2A 5F7JA 3T5TA 1KYIA 2QAGB 3HDGA 1YRLA 4LMRA 4M7OA 4WK4B 3JD3A 4C5BA 1XPUA 5HKKD 3TE7A 2F8LA 4D9HA 4YRBA 3VR3A 3GLSA 1NNEA 4RHYA 5EJ9A 4ES6A 3LK7A 4CV0A 4G9EA 2H1RA 3P9SA 4FWBA 5B7PA 1O97C 1CDZA 1KWKA 3ER9A 3IBFA 3RCBA 5F98A 5TF4A 1XQXA 2XUGA 2EJTA 1AKEA 4HQ0A 4NONA 3TQIA 1WTCA 1N6LA 1QYIA 1VP3A 1F2VA 1KXJA 1TTQB 3L0DA 3H2GA 4N6NA 1EB9A 3TSWA 3DCIA 3UAWA 4CR8A 1PZEA 2IVZA 3GH1A 3HCBA 4RVGA 4M9XA 2V55B 4IUCS 2FWBA 2JK0A 3TK1A 4HX5A 4KR7A 4K8RB 4YJFA 2CZGA 4JI3B 3L7LA 3UFBA 2IS4A 2TMGA 3W5IA 3DR5A 2HF9A 2BEUA 4ZP1A 2FPPB 3ZUPA 4LGYA 1RCFA 3AUXA 1R8SA 4KGVA 4CKWA 2ORVA 2GHRA 1QCZA 5ALQA 2NUBA 5HHTA 1E79A 4J0IA 3JWJA 2QTCA 1BS2A 1FVXA 2P6NA 2CNWA 3EVGA 2OV6A 1THTA 3EIWA 4MS4B 4B3HA 2PJZA 4HAWA 1WV1A 4TSKA 4FFSA 2WUDA 1IQRA 2FEXA 3GF4A 4L3VA 3RC7A 2IIQA 2ZROA 3OCCA 4A0RA 2GSDA 2Q9CA 1UPBA 1NNLA 4E5SA 1Y3AA 2DETA 2PUCA 4JT4A 3HKEA 1TMOA 1DG1G 1L4UA 2QA5A 4ZEMA 4ND4A 2ZI5A 4PZ0A 1R8XA 3H6KA 1YHYA 2D3TA 3KYCA 2EZUA 2PWPA 2PRJA 4KP7A 1C1DB 4REOA 5KVVA 1JHAA 2ATVA 2JGJA 3JRWA 4KQGA 5T5QA 1XOIA 5TMBA 1SBYA 1ARZA 2Q7DA 3X0DA 4BXOB 3ZZTA 1Q6YA 3M3HA 1RRVA 3OMLA 5DGHA 4C0KA 1SD1A 4KL8S 4URXR 1QO9A 4NTZA 1WPGA 3KZ1E 3H8VA 5TQVA 5KVCA 2AOUB 4DHEA 1MX5A 1NI3A 2JGNA 3E3LA 1NW5A 1MT3A 3BTOA 3IR7A 4NRDA 4GNRA 2W6NA 3U3XA 2FZ4A 1RADA 3FFWA 1MOQA 1P19A 4IKOA 4RJ2A 1P17A 4FEGA 3C70A 1FUUA 3R3XA 3AHIA 4TMZA 4L75A 5F3RA 4V03A 2J0QA 5WRFA 2O2CA 2K7ZA 3WL4A 1JDSA 3EVNA 4PG8A 1NQUA 1QHSA 2C9DA 4CM6A 1WDMA 4CMCA 4NATA 4WXMA 4X1IB 1E5LA 1JYEA 1S2MA 4GDFA 2N42A 3A4VA 3FZNA 4X3CA 3OC0A 1USVA 3EPPA 2I6UA 4HNUA 2BELA 1YACA 2HR1A 4TXJA 1A8QA 3TR5A 3OPYI 4MR9A 1RXVA 2E4YA 2C94A 3UJ6A 1FFHA 1SVLA 3BXFA 2FFBA 1GNLA 3FUWA 3GEPA 4U3JB 3TLXA 3R0XA 1VIVA 2B82A 5BPFA 4ATNA 1E1DA 4R7TA 4RDCA 1P5ZB 3E22A 3G1UA 4O4LF 1YNSA 4BNFA 1P0FA 1SK8A 3TOZA 2P1RA 5K1ZA 3PUXA 1JHUA 1GRVA 1J2JA 1UKCA 3ZH9B 5LXTA 2VZ9A 4IIVA 4XVHA 2ISQA 4EGSA 2IODA 4ZYTA 5BNWA 5CBPB 3ETEA 1FP1D 3KJFA 4I8XA 5CNMA 1YE5A 3FG9A 5E6RB 3R7WA 1OFIA 4LDQA 4K5QA 3II6X 4UQLA 4BGUA 2VP6A 4M2LA 1W5SA 2F4NA 1YR7A 2F7SA 3CEJA 5IVDA 1UBOS 5TARA 2C0PA 3QYJA 1EJ2A 1IRXA 4MS3B 3Q9NA 2YQZA 1T8SA 3OQBA 4BZQA 3FLEA 2FWNA 5TGZA 5FCDA 3RRFA 3H5OA 2ZE7A 4LCEA 4Q4CA 4AF6A 1A4RA 1EE2A 5JH7B 3VYVA 3H9GA 1GDHA 4JL5A 2C3OA 5CFZA 3DZBA 5FOVA 3TAHA 5EHQA 1DC4A 4TTPA 1KTVA 1OFVA 1DG3A 1RC1A 3F46A 4C7MA 3FMPB 5FADA 3TOVA 5IDXA 1H3EA 3AJAA 1AKWA 3JWIA 3K4HA 3JTEA 4X9XA 3EOZA 3QV2A 4DF3A 3H2KA 1XZPA 4NBNA 4MQUA 2ZLBA 1G5HA 4XGNA 1E5VA 1QMPA 1LDEA 2NUPA 5AJTA 3GI1A 1R4MB 4BLPA 2QRVB 2WF6A 3DE0X 5FOXA 3ZHVA 3ZWKA 5AIAA 3A2NA 3DE3X 4KNYA 1QGUA 3L92A 4BNUA 1GLGA 3N76A 1CR6A 3BGWA 4ZC8A 4WOCA 4AP6A 3TIGA 1YFZA 5B7GA 5IT0A 5IJ9B 1KYVA 3EVBA 2ZBUA 1EFPA 1P1FA 1T2NA 2XNJA 3I2IA 5JXIA 1YUBA 3WSTA 1JR4A 4CCAA 1OE0A 1MPTA 1ONOA 3RSZA 3JZFA 3ASZA 1JFTA 4IJ6A 3T4XA 3HI4A 3KXPA 3WLOA 2J0UB 3S3TA 3FMVA 3V7UA 4F4JA 2WFLA 1IHOA 2Q8NA 3CA8A 4FP9A 4PQRA 5E2IA 1OYWA 4EJFA 4M7PA 2G1UA 3KQUA 4R16A 5ISMA 4YMLA 3PF8A 5FTMA 4HN9A 2ZJBA 3QKRB 3THYA 4XIIA 1WCV1 1RYDA 1YWGO 2GO7A 3CKKA 3MXOA 4FYIA 2CK3A 3TM4A 3MXTA 4JJ7A 5F52A 2RJNA 3QE9Y 1BCSB 4PFJA 4XGIA 2H6EA 2CHVA 2V7WA 2W8ZA 2XUPA 3JQEA 5CGZA 5THQA 4ND8A 4EL5A 2RH4A 2C2KA 3H6GA 2GYVA 3LVBA 1WW2A 4OYHA 5A0FA 5JMWA 1D4OA 1H6BA 4G8BA 2H0RA 2XKKA 4DFDA 5IZ4A 4KI7A 1I6MA 2F1HA 2OO3A 3NUGA 4GX5A 4OFZA 4U2EA 5KEIA 1PJQA 2YHSA 4FFBA 1E3TA 1T15A 2FWRA 1E5TA 1YQDA 1NFFA 3GCGA 4P35A 5LNK1 1TVMA 1NW9B 1Z08A 4W6ZA 3KJIA 4PRKA 3R7BA 2H63A 4YRFA 1LDYA 3UMRA 4K9OA 1OH5A 5JDIA 3Q2IA 4FFOA 2JASA 3IQFA 3NDPA 5CDHA 4MYDA 2RHGB 1JQJC 1GCAA 3HVIA 2QTAA 3LH5A 3RH0A 2WG0A 4RLSA 4ZYYA 2V0GA 3FFAA 1X0VA 3LBIA 4UOQA 2YZKA 3D1LA 1X9HA 1IBCA 2X4LA 4RSGA 3V42A 4BMOB 4BVAA 2ORIA 3AOEC 3SIRA 2OCKA 1YRQA 3WKCA 5JBNA 4YP0A 3S1AB 3HXLA 4M60A 1MC5A 1Q14A 3U4CA 3L6UA 4J9UE 5DHUA 1D9XA 1FU4A 1LC0A 4D5EA 1T34A 3D4OA 1RRFA 3RWMB 2D5CA 1VXOA 5BVHA 1IN7A 1BHJA 3ZYZA 3UTDA 2Q0HA 4QXMA 4ZCMA 4FE7A 3KQPA 5DT9A 5B7NA 5D1NA 4JQZA 4XVRA 2VJPA 1GUAA 2AXEA 2RK4A 4N48A 2CXXA 2DPYA 2ZZNA 2Z1NA 1TF5A 1KEPA 1ZWKA 3GRVA 3Q0EA 1SCUA 5EOVA 1DXQA 1NF3A 3O4JA 4NYJR 3RUCA 2CDCA 3MRVA 2A1TR 3DE7X 4PYMA 4UFOA 2H1FA 5TC4A 2WWYA 2QVXX 4Z1MA 1KZGB 4WLFA 5JXGA 3CS3A 1VFNA 3NYRA 2XKJE 1Y6ZA 4I4NA 2ODEA 2P3OA 3UG6A 1QAOA 1XDZA 1E4EB 3PRYA 2YXEA 3ZYCA 1CE8A 1V8BA 3B9QA 2DLNA 1ONSA 2O8VA 3A1VA 3DLPX 3LUJA 1C3XA 4D8XA 4GOJA 2H29A 4J49A 2NXNA 2EGGA 2G76A 2P4HX 1SY7A 4H27A 4NOJA 4AX4A 3SQWA 3JSAA 4J7XA 4R2IA 4S35A 3W5UA 4ESHA 1NU8A 1FDRA 3DB1A 3K0EA 3GL9A 1S1CA 3MRSA 3SXUA 5K7SA 1CF2O 4KOEC 2DP4E 4M53A 3ZHBA 2XXAA 5EGNA 3N7TA 1XSEA 4FMDF 4PGGA 1IJEA 1YR2A 3M4ZA 5BT9A 1O0BA 3R3WA 1DKUA 3V4ZA 1XAHA 3AKDA 1AB5A 2W00A 3WRYC 3T5AA 2J46A 3I12A 3KB8A 3IELA 1FOEB 3FYCA 4OH7A 5AI9A 1HDIA 4MI1A 5E9JA 1WCIB 2YV3A 3PGJA 4J75A 3PE3A 4P9NA 4X5OA 2V6BA 3LQQA 2YVUA 4J43A 5ER6A 3HO8A 3C7KA 1ZOSA 3QH4A 5F73A 3FBGA 5BW8A 5CA0A 3P45A 2QMYA 4NR0A 2I1LA 4MVJI 4N01A 1DARA 3UIEA 3OU2A 5DHSA 4ZARA 3NHAA 4GPZA 2ILVA 5CEEA 1SVSA 3ZXUB 5JD5A 2HEIA 2IUTA 1J99A 2ZWOA 2ZB2A 2QL9A 4S04A 5AXAA 1R12A 4XWTA 4U1RA 3Q6MA 4XD2A 1QRUA 1HE2A 1UWCA 3LDUA 3L0YA 1ZMTA 2HFKA 1BFKA 2JLSA 4NV0A 5DZSA 3W9BA 4BRWA 1N3LA 4UQOA 4CBVA 4F4HA 2X3YA 3ADBA 1AZTA 3CN9A 1L6IA 4XWOA 4LZLA 4EEKA 3CZAA 4HCJA 2R6GA 1YJCA 4WT7A 4MH0R 3GLGB 4LOAA 5T8KA 4L9SA 4KQ1A 1XAIA 4KIJA 1TRKA 3KB6A 4R3UC 4G6ZA 2BGMA 1RWBA 4M0LA 1R6BX 4DN6A 4G0ZA 4MWEA 2WPDA 5C1DA 2JHPA 3AEZA 4OJYA 4RVDA 4WA7A 5EJ2A 4E08A 4DJFC 3NFRA 2YHIA 4WN9B 1G60A 2A30A 4TLAA 2EF0A 2OQ2A 3JQAD 1P77A 4F6CA 1Z0ZA 4GBJA 4B6OA 1Y9EA 1AGXA 1GRRA 5SICE 5TT1A 1CYEA 4PX9A 1USGA 3VR1A 1ZCAA 1C7IA 3DTNA 1XTUA 2J4CA 1J0XO 4MVYA 1DOHA 2Q6VA 4RWZA 1DRUA 4DIUA 1KZ6A 4NDZA 4UMVA 1UP4A 1X38A 4IHKA 3IQWA 1TMKA 3PTLA 2Q62A 1H22A 3PNOA 2AC7A 4KZPA 2G9RA 4QM6A 2ZRFA 4EF4A 5MFZA 1G7TA 1GNTA 1R6UA 5LN1A 5E0KB 3I6YA 2BFWA 1FVHA 3N6VA 4G0VA 2BHRA 2KX7A 1TM2A 1FFGA 2YTZA 3ZCVA 3ZUGA 1I0ZA 1TPYA 1DV2A 3DWFA 1JWAB 2CMDA 2OBMA 2YN2A 3AI2A 3BWXA 3GJ6A 3V8PA 4JMLA 3X1JA 3EBOA 4AJJA 4NMHA 3OLZA 3IVXA 2WV9A 4RLHA 4D8VA 1F0PA 4A2PA 2QTHA 1JIJA 2VYVA 4EB8A 4Z4QA 1BVHA 4F8JA 1UMCA 4PQYA 3ICWA 2RH8A 5M3BA 2NT4A 3NANA 3WKAA 3TUZC 4Q19A 4UMFA 3OIUA 2IX9A 4UHJA 4V0RA 3UUEA 4JBXA 1ZVVA 4HOYA 2NUTB 2RHOA 4PNHA 2G82A 3NR2A 4DA8A 1SXJC 1Y1LA 2FQYA 3QUBA 4K9LA 5F2EA 2O0LA 3QLVA 2ZBEA 2P3QA 4RA6B 5HF8A 4TVSA 1R6TA 1TLFA 5ITSA 5LP6B 5E4JA 3F4BA 2PGOA 4BN4A 3OESA 4ARSA 3LA8A 1CY8A 1AZLA 2IZ0A 1GN9A 1IMOA 1ISSA 3R2JA 6REQB 2C82A 2VDVE 2VDWA 2XRMA 3IUEA 4ID9A 4PSDA 4GH5A 4U5QA 3KKEA 1XRNA 4HAIA 2VDKB 2XJ9A 3NJ8A 5G0UA 5LJIA 4BPBA 4UPEA 4QUAA 2WQZA 1YKGA 4NCKA 1RYYA 5CU7A 4EQ6A 2LBPA 3PVSA 2C78A 4A0FA 2W98A 3Q3JB 1T2AA 2I6SA 1QMGA 1NBWB 1OWLA 1HZZC 1SQSA 2X9QA 3KKNA 3MG9A 4CT0A 1NM5A 1ZBQA 2Z2YA 1S7GA 3WAGA 4B45A 4UOEA 3Q3EA 4ZALA 3TDNA 2XUHA 3R6TA 4Z3OA 5HBRA 3EQZA 3EEFA 1E7RA 2LV8A 1KIFA 3I5XA 1X7ZA 2DOKA 5C5CA 3WB1A 1GCGA 1H9AA 4BO0A 1RDFA 1KEKA 3FVVA 3GA5A 3B7GA 3JWHA 3KD3A 5DM4A 3TNDA 2BFBB 2O2SA 1YZYA 3IB6A 4DSZA 2P6MA 5B58T 3UANA 5JE8A 2O8DA 2YHBA 4J1QA 1UFRA 5BSVA 1P81A 1DE0A 5JT1A 4OFWA 4Q9JA 5AW5A 4BVJA 3A70A 4V3BA 1J23A 4GX1A 1A9YA 4KXQA 4EUKA 4PYLA 2XA2A 5A5GA 4BIMA 4OJNA 3IHTA 4MUMA 1U7DA 3WZ2A 2XB2A 2JD1A 5EWLB 1BS9A 3G0CA 5I9NA 2FTKE 1Y7HA 4Q9HA 2PFSA 3JV7A 4UFPA 1SU6A 3OFND 2BFCA 2HNKA 3EXG2 4QLBA 5EXSA 2HOQA 3AHCA 3K1TA 1QH0A 3F67A 3ZCSA 1TA4A 5CA1F 1IPFA 2GHIA 3E23A 1TEHA 4MITA 4OOEA 5HOEA 4M8IA 5REQB 3E1KA 4X61A 4ZDJA 1XQ6A 4BVHA 2ZZKA 3T35A 2XKAA 2YHAA 3I2FA 4YMTA 1U3TA 5IFKA 4P31A 5IJ0A 2Q1TA 1PTKA 4HY3A 4LDZA 1LV8A 5JAZA 5F1PA 1NT2A 2BIFA 1SUWA 3KT8A 4RVOA 1XU9A 3PXGA 3ZY4A 2GWHA 3LUFA 3U3DA 2OAP1 3NYIA 2BRUC 3JQQA 3B9BA 4OB8A 5FORA 3A6FA 5EJ4A 3EOAI 3RB8A 4BIIA 1Q7EA 2A9KA 1EEHA 2X0IA 2RAUA 3GRUA 2BFAA 3DOEA 4LN1A 2GN0A 3BF7A 4Q7KA 4Y1RB 2F1KA 4Y2QA 4DQDA 1ZU5A 2FAXA 1Z9BA 3BMNB 4E12A 2ET6A 1WBDA 1EFKA 1GAQA 3ZZMA 4GMXA 1BA2A 2WTBA 3ESQA 2I2AA 2NSYA 4HN4B 5IDYA 1MJGA 1TLTA 1Z3IX 3ZXIA 3TLGB 2QD3A 2OLEA 4N7JA 1WD5A 5GZ6A 1WB9A 3DMDA 2PUAA 1H1TA 3OM0A 2GJ4A 1PZFA 4BEVA 3KBOA 1T4DA 3QBEA 3DPIA 4HH3C 1P2BA 3CMMA 2R751 4BV9A 1G5IA 2V5UA 4EK9A 4GBED 1E9DA 1PI3A 2BV3A 1VJTA 5SY6A 2NO6A 4ZHQB 5IVIA 3ISTA 3DMRA 3KZOA 1ZU4A 4MNTA 3K6SA 3V2UA 3C3DA 3ZJYA 5DYYA 1G18A 1QO7A 3WBJA 3JVUA 1UINA 3G5MA 3WYBA 2Z43A 1M3SA 1V35A 4WESA 3RWBA 2BGGA 3OZRA 4CDNA 3A3OA 4JDUA 1LI5A 1QG6A 1UR5A 3EAGA 4RKEA 1RBQA 2H11A 1BFUA 1CVLA 1G66A 1X86B 2AJBA 4JT2A 2FW1A 1IK6A 5KOJB 1PCXA 3FOEC 3NBQA 5H16A 3BKWA 3N70A 3UGKA 5BN3B 2R11A 1KK0A 2DBRA 2HCBA 3G8DA 1B0AA 3QU4A 3UWOA 1I7QB 1U2TA 5TB5A 4MIOA 2PX0A 2R6FA 1P3Y1 4CNQA 4N3BA 2R6DA 4ENVA 5DN6D 1SELA 1IB0A 2UVPA 1UP6A 5GWXA 2EW2A 2Q5LA 2WAOA 1AY0A 3PT5A 4FINA 1G7CA 1FZTA 1BG6A 1BU5A 1EK2A 3PK0A 5EIXA 4BNJA 4YREA 5KSYA 3E8MA 2YR0A 3FN4A 2JDIA 3D8HA 3OPNA 4KQMA 4MWZA 1E99A 4GP6A 4GBGA 5E2BA 1VKNA 3WQSB 3F2VA 5EGSA 3IX7A 3QE0A 2YXPX 4EQZA 1IXZA 5EUMA 4J3FA 4JBGA 1UPAA 4I1SA 3PJDA 1XEXA 2GKGA 1BEEA 3WNDA 5HIAA 3V1YA 1W5AA 3FROA 4O4HB 2H9AA 3UVEA 3H2JA 3T1YB 3KRTA 5F4ZA 1OZ0A 3DCJA 1CP2A 2QRUA 1POXA 3KFXA 1J49A 4XPIA 4ZYZA 3M1YA 1KI4A 3HP4A 3E9ZA 4MVJG 4HATA 2R2GA 2R7LA 4CKCB 4JOCA 4M1TA 1JU4A 3S2UA 3SOZA 1HDXA 5A5DA 2MSNA 1HTBA 1MIOB 3ADOA 2H51A 2AMJA 5AH0A 1CR0A 3EBLA 2OB1A 3H1FA 3HO6A 4D98A 2XZOA 1VSQA 3P9YA 4J1TC 1EUQA 3I9MA 3NJ4A 4JU8A 3TSCA 1YI1A 5CM2Z 3NVMB 3KPWA 1EJBA 4B2YA 3OZCA 5CMLA 4D45A 3NORA 3IUSA 4WERA 3KP1A 3UK1A 4UCWA 1U9ZA 2OOSA 4OJQA 3WK9A 1D6JA 5ICGA 1DAOA 1RKQA 4E5PA 3AIMA 1ORVA 4RYDA 1S4QA 3C6QA 4KPEC 3R5JA 1K0UA 4KIWA 2OV2A 1BEZA 1KU6A 4Q6WA 1ZL2A 3Q8MA 2DLDA 2ZSAA 4B2IA 2ZYIA 1XKQA 4XFJA 4N3CA 1GZVA 1XL0A 2AG5A 4JJ6A 5M29A 1A9XB 2IS6A 4TS4A 4G0UA 4RDHA 1ODSA 1BMQA 2GLXA 2HSGA 3KSUA 4B4VA 3DZIA 1Y9DA 1QP4A 3SKXA 5JRDS 5FEMA 3CNEA 3WAKA 3GNQA 3FA2A 1SD5A 4HK4A 5HIJA 3RT9A 1DNPA 5EZYA 4QGHA 1M7HA 2FDRA 3CGWA 4KN8A 3SK0A 3GFPA 2Q2OA 3GQVA 1XZCA 3OE1A 3KSAC 4G5GA 1Y7TA 3ABZA 4YWHA 2V6FA 5C31A 3UHJA 2AG6A 3OEHD 3DMPA 1O5OA 2CC2A 3FTEA 3NTXA 4CCYA 2ROQA 4JK3A 4YJKA 2F1IA 1ORWA 3OQNA 5IN4A 4BO2A 4GOLD 4LMBA 3FCXA 1I5RA 5BQXA 3P0RA 3UH1A 3SZMA 4MP6A 3DMNA 4YK7A 3LXXA 2G6TA 3IUJA 1OZAA 4IDBA 4LYAA 3OZAA 1KR5A 1DOAA 2J45A 1C0KA 3BHMA 3PC8A 4R8LA 4BNHA 2BI4A 3GHYA 2NVUA 4BQSA 3M34A 5J40A 1V7QA 2IY7A 2FQWA 2V3WA 1E1RD 3LCUA 1RJWA 3MD0A 3QW2A 2DVMA 5FFNA 2QN1A 4MULA 5BSTA 4BQFA 3PX7A 1YZGA 1W8IA 5HRUA 3OCJA 4MYHA 1CUIA 4EGJA 3H5TA 1FBNA 4R9SA 5ECDA 4GG1A 2HQSA 4JH0A 1FYWA 3LPLA 2WWTA 3CLRD 2JATA 4LHEA 1H5UA 4ZZ2A 2EGHA 3H4TA 1QV6A 2FOLA 3IULA 2JGMA 4OK6A 2Z9DA 4FSDA 2X77A 3REOA 4EMUA 3C0KA 3AVYA 5ALHA 3PNMA 3HUEA 1KI3A 3CRZA 3D54D 1E61A 1BE1A 5JATA 1YGPA 2QSJA 4G8JA 3H2IA 4QATA 1MAUA 3DG9A 1QO0D 2P4QA 2B25A 1GR1A 4DCCA 1YBHA 2ADFA 2XB4A 3V8MA 3IJRA 2Y1LA 3MAGA 1Z4MA 3QKSA 4R5MA 2POCA 3GK3A 2WY2D 1TVCA 1VCNA 3GFOA 3TRJA 4CIWA 1EHCA 3IERA 1GZHB 1XALA 2XV1A 3H5WA 3M6MD 3N5CA 4E22A 1YVRA 5JW6A 2V54A 1AURA 1GQFA 5FBVB 1XLTA 3DDUA 3WYNA 3U3OA 3VOSA 3PE6A 4S05A 1PK9A 1WEKA 2ORWA 1PLJA 3MHTA 3HXQA 1O6GA 1OQAA 3JYNA 2ZIFA 4LJ7A 3CVVA 4M87A 3CKLA 2J0VA 2WD9A 1Z5WA 4MV3A 4ND3A 4Z0TA 3I23A 4Q9NA 3BE5A 1JAYA 1KP3A 4HWPA 5MFPA 1D2CA 4U6QA 4BQQA 1MQ8B 1P0PA 3RAPR 3E81A 1ATZA 1U4NA 3W5DA 3BGSA 1JJBA 3PTAA 1ZUNB 2ERYA 4KR6A 2QLMA 3JALB 5TSDA 4X1YA 1CZUA 4D3FA 1HEUA 4EJSB 2IUEA 1AUOA 1D0SA 2COUA 3IOCA 3DO8A 3NT5A 3OZTA 4XB1A 4I08A 2XZPA 5CYPA 5G41A 5EFOA 2HV8A 2FGJA 1ID1A 5DTIA 2PL1A 1KQGA 4EHHA 3ECAA 5HJ7A 3KEOA 2XEXA 3B6MA 1U9JA 1LLDA 1NQVA 5KYUB 4L5BA 4OLHA 2VNKA 3GUCA 3EMDA 1U7ZA 4ZD6A 2G5TA 3L04A 4MCHA 1QH8A 1V25A 3I0MA 4RQUA 1CRLA 3HCDA 1FDUA 1LU9A 1SZJG 3FTCA 5K0ZA 4E6PA 1SRQA 1YQ9A 2WYUA 1K63A 4A92A 2BD0A 2PM8A 2WNIA 2OO5A 4B0OA 2I4NA 3JVDA 5KYTA 3OJLA 1JKFA 4P7BA 2MSWA 3B5IA 4PRLA 4H7EA 5ALYA 4RH1A 2VJOA 2QGFA 2FMTA 5BP7A 3L0IB 2DTDA 2WAXA 4JEHA 1FJHA 1U8AA 1G3MA 1ZIDA 4Y1GA 4CF5A 3ZEIA 3AFOA 1JECA 2E6KA 3K35A 1JEJA 2GBIA 3UN1A 4AJLA 5IT9A 3ZI0A 1CBUA 3A6JA 2PLRA 2LR0A 3RSFA 3EXHC 1DT3A 1TUEA 3VH4A 4AZ3B 1M5RA 3FBTA 3RSGA 1EX9A 2C7VA 3SLGA 2JI6A 2GAAA 3BSYA 4D74A 3DE4X 1X1EA 1GNQA 4UUQA 2O2ZA 1YL6A 2P4EA 3AWIA 3DEKA 2FNAA 1Z5GA 1TYZA 3IP9A 1DELA 1GITA 1U28A 1JN0A 1UQRA 1XN4A 3C3KA 3LW7A 1G1AA 4ZODA 4W9RA 5K8CA 4U7DA 2R8OA 1N8TA 3DT6A 1CUEA 3RRJA 1QE3A 3K1AB 1RJ9B 3RREA 3DULA 3DOJA 5FR2A 5IBCA 1ZHOA 3GUUA 1WSAA 4OJMX 1FTYA 1Z2AA 3P4YA 1X8XA 2GZ3A 4ZC1A 2GHTA 5FPKA 1BW9B 4YC7A 1SRRA 4TWZA 3SM9A 3NT2A 1QLJA 1CQXA 3C87A 3TO5A 1USWA 3B6JA 4RGBA 3OY2A 4YCCA 4NZMA 3OE7D 4L8YA 4OLFA 4P4UA 4US2R 2GBFA 1NQWA 3W9SA 3F96A 4QX6A 4X65B 4YJ3B 2UUPA 3QEMB 4U2KA 2P67A 1II8A 1JSXA 2FG6C 2XYQA 4LWPA 4C1BA 5K0CA 5HG0A 1FA9A 5F23A 3ZGVA 5IK2D 5JZOA 3L1VA 5ICMA 3CU5A 3R7DA 3V8RA 3ED5A 4BAZA 4DWVA 1QU3A 2RC5A 1D7OA 1MX1A 2ZRIA 2YZGA 3JQ8A 2IXAA 5IDVA 5IJZA 4IKPA 3BBPA 4WQMA 1C9MA 1N2CB 5LQUA 1N78A 3S27A 1YMUA 3SLKA 2X8LA 5HFAA 2EW8A 2JIMA 3MEQA 1A4IA 1V95A 3W7BA 3Q87B 3VZCA 3ETNA 1JFLA 4LSMA 1L7OA 4YMWA 2QUKA 2JVIA 3U1VA 4G37A 4BNLA 2EFCB 1YZLA 2QLLA 3ROKA 2P5SA 4BLSA 4KR2A 3E5MA 3ZNNA 3EJWA 5GM1A 3GX1A 1RMQA 4R84A 1CUSA 5LB4A 3RUAA 4OTZA 1A72A 1GPLA 4BB6A 5FI0B 1Q0LA 2YWJA 2WJ6A 4EA9A 4LOLA 2PPVA 1K8QA 1T0HB 3GMIA 5EYPB 3ZOZA 1WDLA 1XMQB 3H7AA 2P68A 5EMLA 3HWWA 4RORA 1RR6A 4ZK2A 1Z82A 1ML3A 4PF1A 3GD5A 4N0QA 5JALA 3L2OB 1VMEA 4RO0A 4XJVA 5L45A 3R4CA 3TMYA 3AZOA 1AQNA 2JLXA 4LWZA 5DBGA 2JA1A 3CB2A 1G8JA 4K87A 3F71A 4A7PA 4C7VA 5DTMA 4EENA 1QAQA 4HT3B 4L4RA 5TJHA 1XYGA 1DB3A 1YT5A 4KNVA 3SDSA 1ZX1A 3IHWA 3NDBB 3UMSA 1IUNA 2P1ZA 2R0QC 3AR6A 4LEIA 4CGZA 2AOVA 2WLTA 4EB6B 3E48A 4NBVA 4C0BA 1Q1QA 3EVTA 3ZLVA 3MWDB 4DA6A 4UQPA 2QRKA 4NCIA 1IJKA 2J7PA 5IFLA 1QC5B 3AW9A 4CQMD 1E0DA 4OAOA 4JJGA 3JD0A 1B6RA 2GD6A 2NZ8A 2FMKA 4FHCA 4UUNA 3P8ZA 4KQXA 3PJRA 4I5IA 5BMVF 2NZJA 4QG7A 3PR3A 3VPSA 5K6TA 2ZIWB 3H2BA 4N39A 4BPRA 2ZRJA 5EERA 3CJRA 5KJ6A 1T1RA 4KEAA 4KO2S 4O2AA 3F97A 3ZBTA 4DCSA 4DUPA 3HCEA 5EMKA 3VR5D 1IM2A 1JFFB 1I1OA 1WMBA 2HT6A 1X8LA 3VSAA 3EG5A 4HS9A 3ZWMA 1V11A 2B7LA 3K6RA 3LUHA 1I7PA 1HYEA 2CVZA 3QJYA 5ILOA 2C77A 1MCZA 2Y1OA 2PKRA 4CMEC 4ABYA 3BE6A 2X42A 5ECGC 3WMWA 2WPNA 1J2RA 4DIBA 2ZUFA 2PMKA 3BWMA 3STYA 2WU3A 2FFJA 3W2FA 4HKTA 2UZ1A 3KV1A 2GBCA 4IJKA 3R20A 1TDJA 1DIOB 3QUAA 2EC5A 2XQGA 5HR5A 4G3XA 4ZAGA 1NX9A 4DLNA 5HWSA 2CZCA 2C92A 4R1NA 3PXAA 4D25A 1UXHA 3DDWA 2FJUA 2GBPA 3TOXA 4Y2GA 2M32A 1JIIA 2PTGA 1J8YF 3HCAA 4E14A 1TAQA 4FOLA 1NIJA 2AEMA 4MAFA 2Z4TA 1N5LA 3LF2A 5EIFA 1DKLA 1EZZA 1SG0A 5IYZB 1TC1A 4L7VA 4FD2A 1JLMA 2MSKA 5JO0A 3Q1LA 2A0XA 3LRPA 5G4LA 1SUBA 2H8KA 3H5IA 4WUTA 1RYNA 2YYZA 5I45A 1BCRA 3CC8A 4P84A 2X2OA 4UU0A 1Z6ZA 4ED9A 2A57A 2WKWA 4IF6A 4A03A 2YV5A 5NULA 3PX3A 1E6KA 5JBQA 2NVOA 1VE9A 2J9FA 2EATA 3LLUA 4RELA 5IAEA 4OIFA 1YL5A 5FL7A 1ZOPA 4JHLA 1JAIA 1FX0A 1CZHA 4J9VA 4L8VA 1I9GA 1U3VA 3ELUA 4Q66C 2QR2A 4URHA 3ZDZB 3OD5A 5KTTA 4WNYA 1JI3A 1QXSA 1XTKA 3I1IA 2P2DA 5CVUA 1SUIA 1M33A 2ZB4A 3PA6A 1GGMA 1L5YA 4R3WA 2BUCA 2VDNB 3TDKA 5JPDA 1DS6A 2FWJA 2C5SA 3Q5GA 5B3LA 3KPUA 3P0JA 2C2HA 1G8PA 1YKSA 2YXNA 4PX3A 1CHDA 2PHZA 4QU5A 5BPHA 5E0OA 1W5EA 2QOEA 4XUDA 5KOHB 1W25A 1ADGA 3OF5A 4ND6A 1QHHA 4OHKA 5B55A 4YUZA 2XMSA 4U5XA 3FPHA 5CDGA 2YS6A 2H7XA 2VAXA 1U6JA 1RRMA 2IPLA 1QR6A 4M9ZA 1P7PA 3PWKA 5DGDA 2XW6A 2ZE6A 3DWEX 3Q7SA 5CFPA 3UJ9A 3ZWDA 4OG2A 3ANLA 7ADHA 4MO9A 2E4ZA 4CTNA 4IJWA 5A3SA 2O1EA 5K9ZA 5E38A 4EMBA 1LSOA 3TDMA 5U4XA 3T4EA 1K4YA 1P0MA 2IGTA 2PX3A 1J9GA 1G6HA 1X7WA 3OPVA 2PRKA 3EXIA 4I50B 4NZ9A 2IW1A 5GADl 3ZHCA 1A97A 4RM3A 1RKVA 3NEYA 4UREA 3WHIA 4WZAE 5K8IA 5D7BA 5D3MB 2AX3A 3RF6A 1X7DA 1V5FA 4BFSA 2I7DA 2HBQA 2E55A 1V8ZA 3L43A 3FHJA 1FLAA 4AROA 3NT4A 4WCFB 4EH1A 3EIEA 4X6UA 1LJUA 3BWBA 3GY0A 2GEFA 2ICAA 1L5GB 5DNWA 2PV0A 3ZCQA 2O05A 2J48A 2WSSD 3FSEA 4GGPA 3WO0A 2YJ3A 1O96B 1ABEA 2OCYC 2Z5GA 4MVJM 5G1PA 3SX0A 2J0SA 3UCXA 3UJHA 1JNYA 2FR0A 2WU0A 3G82C 2AW5A 3GJ5A 3LUPA 5EI5A 4C30A 1EP9A 4PGFA 3EFBA 1Y4ZA 1JKIA 5IW8A 5JS7A 4HQ6A 4DPKA 3O4VA 2CV2A 1J2UA 1NQ5A 5K8JB 2BFDA 1TEVA 3MTJA 3CTMA 4TSRA 1N6RA 1NNSA 4RZIA 4RAOA 1L4FA 2XLCA 1OHHD 4JKOA 1MB2A 4QDTA 4WZZA 4F38A 1BHQ1 1WMSA 1E1LA 3O03A 4TWIA 1PJ4A 2I3ZA 3H9BA 5CTJA 4I2NA 4IEFB 2CBGA 3AI1A 2ZRGA 4V1CA 2JIZD 1G3QA 3FSGA 2H4WA 3C3YA 3W2HA 1E7WA 5DBOA 5AVJA 4B4OA 1U5AA 2ZUCA 1AGRA 4TKLA 3LYAA 1P7CA 1SQFA 1MABB 2Z1DA 4JLNA 4WEQA 3GJ8A 1YZUA 4AFNA 3LGAA 4YY3B 1GPH1 4BX8A 2CCKA 4D0GA 4MEAA 2ZT5A 5K20A 3WL7A 4QYWA 2RHHA 1VGVA