5JRDS

E. coli hydrogenase-1 variant p508a
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
264
structure length
264
Chain Sequence
KPRIPVVWIHGLECTCCTESFIRSAHPLAKDVILSLISLDYDDTLMAAAGTQAEEVFEDIITQYNGKYILAVEGNPPLGEQGMFCISSGRPFIEKLKRAAAGASAIIAWGTCASWGCVQAARPNPTQATPIDKVITDKPIIKVPGCPPIPDVMSAIITYMVTFDRLPDVDRMGRPLMFYGQRIHDKCYRRAHFDAGEFVQSWDDDAARKGYCLYKMGCKGPTTYNACSSTRWNDGVSFPIQSGHGCLGCAENGFWDRGSFYSRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Importance of the Active Site "Canopy" Residues in an O2-Tolerant [NiFe]-Hydrogenase.
pubmed doi rcsb
source organism Escherichia coli o6:h1 (strain cft073 / atcc 700928 / upec)
molecule tags Oxidoreductase
molecule keywords Hydrogenase-1 small chain
total genus 78
structure length 264
sequence length 264
chains with identical sequence T
ec nomenclature ec 1.12.99.6: Hydrogenase (acceptor).
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
S PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 5jrdS01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 5jrdS02
5JRDS 4URHA 4C3OB 1CC1S 1UBLS 1UBMS 4IUCS 3USES 5ADUS 1UBTS 4OMFG 1WULS 5D51S 5A4FS 5JSHA 4UQLA 4UE3S 1UBHS 2WPNA 1WUJS 5JSKA 3CUSA 4KO3S 4UCXA 3UQYS 3ZE7A 4UQPA 3ZE8A 1FRVA 1UBJS 1UBUS 2FRVA 3H3XA 3MYRA 1E3DA 4UE2A 4UCQA 1WUKS 1YQWA 3ZE6A 3ZEAA 1FRFS 4TTTS 4UE6A 3RGWS 1YRQA 5A4MS 4KL8S 1UBRS 5JSYA 3USCS 4KO4S 5A4IS 4IUDS 5JT1A 1H2AS 3CURA 4KN9S 4KO2S 4UPEA 4UEQA 4U9HS 3AYXB 4UD6A 4UEWA 1WUHS 1UBKS 1YQ9A 1WUIS 3AYZB 4UCWA 4UPVA 3ZE9A 4GD3Q 1H2RS 4UD2A 4IUBS 4U9IS 4KO1S 1UBOS 4CI0B 5JSUA
chains in the Genus database with same CATH superfamily
3DAYA 4K0RA 2KJQA 3Q3VA 1VRVA 1XVAA 1MD9A 5HBGA 1ZXBA 3W9BA 2GR9A 1MCZA 4G26A 3FW1A 1M0TA 1Y1RA 1CULC 3GOHA 3HUUA 4LVUA 4LC9A 1VHDA 1VE7A 1WVGA 1SZPA 2JZNA 1EB9A 3R3YA 3CBGA 4GXTA 4IYRA 3TD9A 5KU1A 3R75A 3H4MA 5E6RA 4KKXB 1H1TA 1HG0A 5SZHB 4D57A 2G5CA 3A1VA 3IP6A 2DY1A 5JS2A 2LIVA 1NWHA 2UZ0A 3QLVC 4TT3A 2J09A 1C3OA 2ODBA 5EEHA 4CG0A 3EVNA 3P7MA 2GVZC 5DNVA 5EIHA 3RIYA 1HX7A 4NIMA 5C4GB 2WJGA 4D82A 4FYIA 2RGNC 1AN0A 3W8FA 3LC7O 4V02A 1J21A 1S96A 4NP6A 3IIKA 4Z0HO 1EWYA 5B1SA 5BSMA 3SI7A 2Q3MA 5CT6A 1JAZA 5EEGA 4RGBA 2IQ5A 3OX1A 1OTXA 4ERXA 2QRZA 1ZIOA 1T10A 4PBSA 1UPXA 1SKAA 1DVRA 3N6XA 3RC7A 3TOXA 1ZH6A 2DJ5A 4YP5A 2D1FA 1IY8A 4LXUA 4CKBA 2HJHA 4GFDA 4F9FA 5FBZA 1QHIA 1AQIA 1RZVA 1WSAA 2ECQA 2FMUA 2OV8A 2P2CA 3FJOA 2QAIA 3ON5A 4HFMA 5FPQA 4BAUA 4WFIA 1T5BA 3K0AA 4ESOA 5JSZA 2H11A 5HRAA 2W9XA 3ZHRA 2OHJA 2VQSA 3P9XA 4WK6A 3S29A 3VH4A 4D9MA 1L7XA 4NH0A 1TGYA 4KQCA 2X1LA 2X22A 1T8TA 4DR7B 1USVA 2A59A 2MOKA 4MUXA 1C50A 2CXXA 4HL6A 1KYTA 1SUBA 1G16A 4PR0A 2J6HA 5HCUA 4MR8B 3SNHA 1T15A 2CB0A 5H5JA 4X44A 1TCAA 3IDSA 4MH0R 4BQEA 1LDNA 4M60A 4S1VA 2G04A 2X40A 3EFBA 1BE8A 1VPEA 3DAOA 4FFRA 3GBVA 4KRYA 1ACJA 4KWEA 1XQ1A 4ZVSA 2P8SA 4YRDA 2FG7C 2FV8A 1OW3B 3IVGA 2DSNA 2P40A 3TSWA 3TVDA 3AERA 4E88A 3U09A 2H48A 1G5QA 1JSXA 3OEED 2XCSB 1TJPB 4BNHA 1O2DA 1QIMA 2CYCA 3BA6A 4MRSA 2QBYB 4JVNA 1FW8A 2IK8A 4CF5A 5JI3E 1D2HA 3P20A 1AKWA 1H4TA 3N2ZB 1QCZA 1O77A 1LFDB 1RKQA 2JGEA 3OCZA 4FR0A 1QANA 1A2KC 4U7JA 2Y0BA 1Q92A 2XUDA 4ROTA 2KE5A 3RUPA 3ZNPA 3ODPA 1XZDA 2JHGA 2W8ZA 1K8XB 3FFXA 4XB1A 4X8HA 2OV4A 3EOBI 3DM5A 4KNWA 2ZQYA 2A8YA 1JV2B 1KXZA 3W06A 5I45A 4URVR 3KU1A 2EF0A 1OT3A 3WOVA 3ZXIA 2MYTA 1WQ4A 2OVFA 2RGAA 2YV4A 2BV3A 5IC4A 1FRVA 3SQDA 4J0IA 4TOIA 2GUGA 1SVMA 2GEFA 2H1HA 2ZR8A 3GNTA 1GEEA 4IX1A 1II9A 5EZYB 2WJAA 3QPCA 5IULC 2QPTA 1RACA 3S8YA 4TVSA 2C4UA 3ADCA 3PYMA 4RHYA 2C3UA 1ORVA 2J0VA 4GUAA 1P44A 4KO4S 5CBPB 3DKKA 1E98A 1TYBE 1HXHA 2ZSEA 3HA5A 1NOKA 1Q11A 1QAQA 1XO1A 2OWDA 2PRKA 3IAFA 2IV2X 3AVQA 5IEBA 4LC0A 1UC5B 3GJQA 1SXJD 3ZLVA 4DBVO 5IM4A 4RTNA 1DBIA 2ORYA 3A28A 4WEQA 2G9ZA 4L78A 1O95D 4FWBA 4EYKA 3FF1A 1ORTA 4WX2B 1DZIA 4EJSB 3ZZ0A 2AFIB 5JZOA 4BMVA 3FIJA 3IP9A 2R86A 4MB6A 4F5ZA 4C7OB 1DIHA 2G07A 1SVOA 1WM1A 3JRWA 5F12A 1E89A 1Z3IX 1E1LA 2P2ZA 5FNVA 3WGJA 4XWOA 2QAGC 4WOBA 1N25A 3GLFE 3KG2A 3GHHA 2TMGA 2A58A 4YCJA 1JN0A 1WXGA 3FTNA 3KJEA 4FYWA 3RKSA 3RROA 4AD8A 4D9BA 2OE2A 3MWEA 4PXYA 2V0CA 3TOZA 4D02A 5LMCA 1K5DA 1EUZA 3NDBB 1EEHA 4R69A 2BJWA 1FK8A 5LYYA 4DFDA 1JHDA 3PQEA 3EA5A 4AS2A 3UGKA 1JKFA 4NOMA 5TF4A 2NU9B 3R2JA 4ND1A 3G5LA 3UM9A 3CLKA 3WZMA 1XPOA 1DUVG 1SD5A 2W0SA 3DO8A 2LVBA 4W63A 4TKUB 1A7AA 5BV7A 3F5QA 2EZTA 3HKDB 1XKXA 1PVDA 3PP8A 2XZLA 3UK2A 1O94D 3IESA 2J85A 4X1IA 1M2JA 1O3YA 4FEEA 4G84A 1WUTA 1P5ZB 4R7TA 5AKXA 4AT1A 4ZVRA 4X8OA 1NVGA 3HKEB 3UAGA 4Q1VA 2AZTA 1T43A 1DAEA 2AOWA 2KM1A 1L7NA 3P9IA 3QG1A 4J49A 3X2FA 5G02A 2JLWA 2YMMA 3F74A 1M34A 3FWPA 2VNKA 1J99A 3TBHA 1IHOA 1VP9A 3FNBA 5EINA 4B73A 4D9CA 4L6AA 3VNAA 4XB6B 1N4AA 2ZKIA 1WX1A 4KUHA 2ZPAA 1JWBB 4QSHA 1TUBA 4ITUA 4Q9KA 4Y6PA 2UUPA 3N6RA 3WZ2A 1U8AA 4JZKA 1ECPA 2XTNA 1H85A 2YBDA 3OF5A 4D42A 5BWBA 1TC2A 1K7FB 2Y67A 3M6WA 3WLJA 3EX7C 2DFLA 3CUUA 3ZZUA 4LK3A 4O4JB 1E4VA 3EIWA 3ZX5A 1UBCA 4UM8B 3R9IA 4UM7A 1LPBB 2NSLA 3DDCA 4TTTS 5D5HA 1QO0D 3G2MA 2V7TA 3I6QA 5AO9A 2A1UB 2QDXA 5F23A 2WTXA 3VPCA 4LJ4A 4JBIA 3H3JA 3FCXA 1LSJA 3ASYA 3WKDA 5F33A 3A6GA 3MRXA 1W0KA 1Q21A 1F2DA 3WHLA 4RJLA 1PUXA 2OLKA 3L4KA 1L4EA 2YXNA 4Q7JB 1I5RA 2QA5A 4MIOA 4QTTB 5K1ZA 3EY9A 4PO3X 4FS8A 1M2GA 4QC2A 5ECYA 4QOHA 3JQQA 4IDOA 4KQEA 1ADYA 4DQVA 1E61A 1RHUA 4QOFA 4Y6RA 3WQSB 1VKJA 4FR2A 4D8UA 1K88A 1DE0A 2XUJA 3CLSD 3M1LA 2J3DA 5DEIA 5G40A 1KIFA 5IXJA 4JBLA 2VAVA 3PEWA 1MC1A 4F3NA 1AA9A 2GTIA 4PG7A 1X0VA 1K7SN 2G7ZA 4U63A 1NW7A 3OTQA 3NNNA 1EE1A 1MABB 2AKAB 2WWRA 3DXZA 3G2HA 3OTWA 3H5IA 3TQQA 4KO2S 3NVAA 5EIBC 4C0HA 4ZI7F 1ZCFA 4AIRA 2VDJA 4C4SA 1LC0A 5HMMA 4IO1A 5BW8A 3RV3A 1BX0A 4NULA 5A7HA 3PC8C 4P7JA 1LF0A 2FY8A 3C6KA 3STUA 3UWOA 3UJ3X 3JPYA 2P69A 4ENWA 3CX8A 4Z3OA 1A7KA 4C78A 2JC3A 4RNDB 3HZOA 1J2JA 2UYOA 5DNEA 4A3SA 3DONA 3R9WA 1F17A 5C1IA 2WK1A 3A1CA 3DNMA 3NAQA 2MDTA 2ZBGA 5FL3A 4LY6A 1DCKA 2R7LA 3GH3A 3N75A 4BZZA 3CRMA 1KFCB 5CNMA 1TADA 1F6WA 2D0IA 1NLZA 2R0QC 2JLQA 3E53A 3UHPA 2ZM6B 2P30A 2Z0MA 4FCWA 1NTOA 3LVBA 2XGMA 3QJYA 4N0DA 1WZIA 1TMYA 1ECBA 2REBA 3E3OA 2PV0A 1AMNA 2FPLA 5I3ZA 5EXPA 5U4QA 1UBOS 1Z0IA 2ZE6A 5FBVB 4MITA 1RCFA 2NPIA 1D3AA 2H1IA 3OIDA 1B15A 4LNUA 3A31A 3ZE2B 3P0RA 2FFBA 3U44A 3T9FA 3EGIA 1D4OA 4NCIA 2GK6A 5EP2A 3KEMA 3UWDA 1QFMA 1J5EB 2OKGA 4YI3A 2OSBA 1OC2A 1SCJA 1UINA 1V5IA 5TPWB 2BTQA 1OGYA 4E5VA 3BSYA 3OJLA 4G25A 3GLSA 2IP2A 5A7FA 3QLEA 4JEMA 1T6NA 3D7MA 4I1UA 3W8NA 1GPWB 1V43A 2G72A 3ONNA 3WLFA 1V11B 2DFPA 5DCUA 1WVMA 3G8DA 3F49S 3LBFA 3PFNA 1YQXA 2QY6A 3AKEA 1S1MA 2IU6A 2PQMA 1DIOB 3ACCA 3OC0A 4J0QA 4LYYA 3PV0A 5EUBA 2Z4SA 1L4FA 1E6WA 2EW2A 3K9NA 4R3NA 3VR1A 1WULS 3FYUC 3ZLUA 5ADVA 5KEIA 1PR6A 4QUKA 2J3MA 1SCAA 3OZCA 3P9QA 4MQ5A 4EYQA 2UAGA 1G42A 1AS3A 4K9MA 1ZDMA 3V8QA 1JQBA 3A1SA 1DXOA 5ALEA 3QWIA 1FDIA 1YT5A 3C3CA 2JCYA 1E3DA 4Q4CA 4KU4A 3DYBA 4IMIB 1CY2A 1SQ5A 1PFQA 4Z0PA 5FH9A 1JDZA 1X70A 4ZU3A 4CF7A 2VUIB 1C1DA 4G5FA 1HK7A 1P3JA 2FPPB 4TV9B 1W52X 1XCMA 4CHTA 4G4GA 1KH2A 1XD9A 3K70B 3K92A 3MCZA 4PX9A 3SOZA 4RIFA 3UN1A 1KNQA 1TI7A 1U99A 1UJ4A 4RWZA 1XQ6A 4R2JA 2M6SA 4L07A 2BZSA 2C7VA 3UUGA 2IHNA 1OSNA 3QLJA 3CKMA 2LCFA 4QPJC 1JQKA 2OB1A 2Q3JA 3EAQA 3PXAA 5K5EA 2K6GA 1CXZA 1ZM4A 3KC2A 1GTZA 3IUNA 4RIIA 1DCMA 1E3EA 1VLLA 3P26A 3QA3E 2QG9A 4O6VA 4CCYB 2O8DA 3DEYX 3FUUA 2Q5EA 4HB2A 1NW3A 2B99A 4AKHA 4REQA 1LPPA 4JLUA 4CEHA 3FSGD 2X0DA 4AX8A 1M1YA 1QRUA 1WA5A 1X74A 1VIVA 3R5FA 2JLUA 3NB0A 4EY7A 4EX7A 2PZJA 3CZMA 1PN3A 3JWJA 3PYXA 3LPAA 3WDMA 3VR5H 1PGPA 3U3DA 1L6IA 3IA7A 3C70A 3QLVA 3CPEA 2VDQB 3TRIA 1D2AA 3VR5A 1U81A 1ZJJA 4UATA 3MFQA 4C07A 1Q19A 4PAMA 3NHWA 3A3OA 4PN3A 1XJ5A 2OFXA 2WNIA 4JITA 4Z1MA 3DBRA 4RJKA 2Q1TA 2CMKA 5ERXA 4AY5A 5JZMA 2C0CA 5FAXA 3UMYA 4H4DA 2ZUFA 4CUKA 1F60A 2CFOA 2ON6A 1HTWA 1XXHE 3RTGA 2CD9A 2WLTA 2ZB8A 3KOOA 1DQSA 1ZZEA 2J31A 1DUSA 2V58A 5C8YA 3ESCA 4B0OA 4EB0A 2E1PA 2X6TA 5GGXA 3T7DA 3QUTA 1PGJA 1M1YE 1A95A 2C82A 4R8VA 2FOXA 3I2KA 2Q0QA 4KGDA 2HU5A 1MJHA 4EJFA 2SHKA 3GP8A 1EK0A 3O4VA 3OZAA 4BNZA 1RHJA 3NS7A 1T8PA 2ZSIA 3KTOA 5IK2D 3GFOA 1TZKA 1W36C 1W46A 3RVJA 2XHZA 4GC5A 3DP9A 5TY0A 4NWIA 1HQCA 2BFAA 1R16A 2JJYA 1QRTA 4HTFB 2Q2QA 2ZWVA 1QIJA 4B7XA 3OUUA 1DC5A 3EXHA 3ES9A 2FRDC 3PSAA 1RZUA 1SJ9A 4LHEA 4L22A 2XUQA 3IQFA 2DT5A 1XRMA 3CBQA 3UWKA 3G0OA 1IOZA 1EFAA 2DTDA 3AUUA 1IM8A 2ZJFA 5ILOA 4H18A 2YJ5A 1JDPA 5HKBA 5BV1A 1KP3A 2OP0A 2C2WA 2HF2A 2OM6A 2O8BB 3DYIA 2DRIA 4KV9A 5IM5A 2LNDA 2GPBA 1AH2A 1BKSB 3R3VA 3VNSA 4FD3A 4BJ6A 1GNPA 3ZI0A 4HXEB 3S0JA 1EM6A 1NBMA 3TE7A 1V16A 3IQGX 1GRCA 5AHXA 3P0IA 3PUZA 2IZZA 3V4PB 4HAXA 1PV4A 2TRSB 2Q21A 2AJ8A 4YJ2B 2XCUA 1XTQA 4HO1X 4MYCA 4F93B 5IF9A 4D3XA 3VFDA 1R9GA 3TQRA 3F6RA 3ZTYA 3NHUA 3DT6A 1TCBA 4LQLA 1RBMA 5CT9A 1L8XA 1EWVA 1PQ4A 2DAPA 2VYVD 2VZ9A 1X80B 2MSLA 2GPWA 2EOAA 4FEYA 2H85A 2HREA 1GY8A 2HPVA 1VJRA 2BDEA 2PMBA 2O5RA 2FW9A 4AVYA 4H6WA 2J0EA 3BE6A 1JDUA 1YJ8A 4BO9A 4EHLA 4IOLA 2VDWA 2L69A 3M4NA 4RD0A 1JH8A 1DFHA 1YJBA 4OHFA 2WB4A 3X1MA 3FCYA 5B1EA 1VB3A 5KWSA 1VL2A 1B6TA 1MRZA 3C4QA 3LBHA 3EVCA 4HDCA 3S2ZA 3V4SA 4V0OA 3I5YA 4DY4A 3O74A 4Y6LA 4O08A 2O05A 3LPCA 2AHRA 3VPXA 5IAOA 3ER8A 1MT0A 1U8FO 4U6NA 4PX5A 5AHOA 3UHFA 3DM9B 4EVSA 3W5CA 4LSZA 3B6IA 3TLZA 3Q2KA 3SC2B 2BEJA 1UDAA 3KB8A 1ZD8A 2ZETA 3A6EA 5I9IA 2WFLA 2DGDA 3NJ8A 4S35A 1FTYA 1Z8FA 5IXSA 1JFTA 2NUPB 3GJ4A 3IQIX 1C2YA 1HT2E 3TRKA 2WV9A 3EQ6A 4JLMA 5IHXA 3GEIA 4XJXA 1ZK4A 1QHGA 2CZQA 2IRWA 4C7XA 4Z1OA 2B1RA 3UH0A 4EPWA 3LL7A 4YQZA 4CEJA 1URPA 1Y3IA 2V45A 3FLEA 3HRHA 3VGJA 3DOFA 3EZYA 4OLBA 2J0UA 3HB9A 3SZUA 5LQAA 3JPWA 1GTMA 4MIYA 1PVVA 5MFZA 3RVNA 1U1GA 3V1KA 1KZ7B 4PN7A 4PG4A 1GUZA 1J7KA 1G21A 1N9GA 2DUJA 3M2TA 3OG9A 2GGSA 1ANKA 3BAFA 3IMKA 3F3MA 5BW4A 1NM5C 1A76A 4R2IA 4JYAB 1W47A 1YS1X 1Z6GA 3X2SA 1U9CA 5CVUA 1BGWA 3CLVA 3ICWA 1CS0A 1I0IA 1ZITA 3JASB 3L41A 3QF7A 1FYDA 4HH3C 4A7PA 4DA9A 4AX4A 1AJEA 2BKLA 4TVKA 2Q07A 5TNXA 4FLMA 1VE3A 2FQXA 5CDSA 3OJFA 3LXRA 1W73A 1XVTA 1E1DA 1D8AA 1SBNE 2PGJA 2V9CA 3GQBA 4L15A 5F78A 4F21A 4D98A 4W9RA 3CF6R 3EGEA 4MZXA 4DCVA 4DV1B 3LT0A 3D2LA 1POXA 4FT4A 1TCUA 3A06A 3GJYA 3ND8A 1M5TA 3UICA 3VR4A 3I4FA 5JAMA 1GR1A 1MTZA 2R8XA 4O33A 3WZLA 1JAYA 4RZ3A 4CLRB 1MX9A 2HPHA 3LCJA 4CR7A 2IHYA 2QRGA 2QU7A 1Q0RA 1D2GA 1KI8A 2M1XA 3W7BA 4CT5A 1YOVA 4X7PA 2YXDA 1U2ZA 4RPGA 2W8BB 1G20A 3D8BA 5K0CA 3K94A 4D5GA 5H3CA 5ELXA 2ZIXB 1T36B 2PUEA 2I66A 4RK1A 3SE7A 1LI4A 1QRSA 5EJ8A 2GK4A 4II3A 3UK6A 1BCSB 5C5DA 2PVCA 1LLCA 4MR7A 4XX0A 2PL9A 1EXVA 4BDTA 4BL5A 2OILA 3I8SA 5K8VA 4Z2AA 1N92A 1NVUQ 3D8RA 3LY5A 1DIAA 2DJIA 4TN5A 1A7UA 1BEUB 1VSQA 3BDIA 4N5LA 4Q16A 1SEVA 4WCFB 1IY1A 3VJLA 3ZGYA 5DU2A 2O5EA 4PYIA 2NVWA 2H57A 2Z95A 3LHIA 2QG6A 1M7HA 1J9GA 1W4AA 2FDRA 2QTTA 2Y68A 4MA5A 1ICEA 3T1NA 4X62B 4X6XA 2DBQA 2GEBA 2O0LA 4DSTA 4DAOA 2X0IA 2Q4BA 5JCPA 3PRYA 1Z88A 3B1YA 3OC6A 1IPFA 1EE2A 1F1JA 4JJ7A 4M36A 3KDSE 2ZSKA 3R5TA 5CLGA 2WU0A 1JFFA 5T64A 1YB4A 5REQB 3FPSA 4DOMA 1DELA 3VR3D 1P77A 1UADA 2HMAA 2HEGA 4S1OA 3N8IA 2BL4A 3L0SA 5E4YA 3GBSA 4D4HA 1MGOA 3B60A 5L9AA 4JNCA 3HYRA 2GT1A 4FHGA 4MGZR 3U7JA 1WZCA 2X76A 1D2NA 1I13A 1PFYA 2BKAA 2ATIA 2QP4A 3G2IA 3MTJA 4HS4A 5GONF 1VA5A 2HIAA 4DCPA 1E5DA 4MS3A 2WDPA 2NYUA 3S3TA 2KS6A 4LOHA 2WZQA 1KO7A 1MOZA 2CFCA 4G3XA 1E5QA 1JB1A 3AHFA 3IP3A 4QODA 1GKLA 3AUTA 3B13B 4A2CA 2JLCA 1UFQA 4QA9A 4X92A 4HQFA 4PYOA 1EX6A 2ZJ6A 4QSMA 2XDAA 1H4VB 3A1TA 3BE5A 1LCIA 1T3HA 3GFRA 4P3NA 4CV3A 5IJ0A 2ZI6A 5JYBA 2HF9A 3ZXSA 5IZCC 1S01A 1T35A 2Q3DA 4M9UA 2WJPA 5ECWA 3T3MB 2XMSA 3MQ4A 4EPTA 3KVOA 4AURA 3GVHA 1POWA 3PJFA 1TLLA 2VQEB 4DV7B 1HM5A 3BSFA 3DMPA 3QMMA 1GTSA 3HBAA 1D2EA 3UAVA 3K9QO 5A3RA 1G20E 2C3PA 3TI9A 3I64A 2FN3A 1GPDG 3HU2A 3BGIA 3CJTA 1VA4A 3ZU5A 1GU7A 3KPJA 3SQOA 3VXKA 4XVUA 2YZ7A 4UE2A 4FC6A 1H4SA 2Y77A 1F7VA 4OQXA 4OHYA 1DRJA 3WY9A 4JFRA 1QGED 3OHSX 4DJTA 4LN1A 1KEVA 1MIHA 1AUVA 1XC7A 2CDAA 4FGSA 1HDIA 1TVMA 4R0VA 5KMGB 1ZEJA 4EKYA 3T0FA 5IRCD 4HLNA 4HXGA 2VAWA 2QN8A 5IH7A 2WIDA 3LKVA 3C5HA 2DBRA 3NRBA 4N9WA 3V8EA 1QDEA 4LXGA 1XVIA 1SK8A 4KQ1A 4KAAA 4BNJA 5BQOA 2RHLA 1R88A 2OZEA 2QQ5A 3ZWVA 3RADC 4GLOA 2ZYWX 1ZC4A 2FSFA 1FUEA 2JGLA 4ZVVA 3ICEA 1UPBA 3Q15C 1U8XX 3PGLA 4Q82A 1V5WA 4RXTA 5HIKA 4FBGA 4COOA 2C7RA 1BVRA 1E9VA 2PWBA 2HK8A 3OSUA 3W1EA 5JEDA 4H3VA 3UJBA 4DLPA 4JI4B 1YQWA 4HN4B 3HQ4O 4FE3A 1RFLA 2QEQA 2G1KA 2VXOA 2XE8A 2ZVDA 1CLEA 5BSEA 3TK1A 5DM2A 2RGNA 1AD2A 2JVIA 2ZRNA 1U94A 5F77A 2YN4A 4IMPA 1FQWA 1E0JA 4BXOB 1U5BB 3BL6A 1EVIA 1GSHA 1AXGA 1XF1A 3JQ7B 1T1EA 1QZZA 1Z8NA 3NTQA 4URZR 2MWMA 3TB4A 3VOBA 4ALKA 3DPIA 1Y5RA 2CL0X 2WPDD 4AXBA 3VDNB 2OHGA 3D7NA 4HS9A 1SAYA 2NO7A 4LMRA 1OKKD 1JG2A 1ZJ5A 2OCPA 4NI5A 2OUIA 2EERA 4FKBA 1E2IA 1P19A 5G3YA 4YRPA 3AJRA 5DX0A 2HK7A 1AVTA 3KZOA 3PEUA 2E6UX 3FHOA 4PYNA 2VHYA 4ZVPA 3U1TA 2ID7A 3EFOA 4D46A 3M70A 3LXMA 2GD6A 2OLJA 4R1NA 1L4GA 2L18A 3IBYA 4CFSA 2AYXA 9ABPA 2O57A 3QWHA 3TQSA 3ZZNA 1HFEL 2QORA 4RKWA 3NWBA 1GG2A 3MRVA 1NXVA 1Q44A 2ZUCA 4CG3A 1GA1A 5JSUA 3PRJA 3LKZA 3VU3A 1OQAA 5FQNA 4FOPA 5AHRA 5BWOA 3KX2A 4ARBA 2WD7B 2C8KA 2FI1A 1XELA 2BR3A 3LT2A 2XUHA 2OBLA 4DILA 1DWOA 4EK9A 1UBUS 3FR8A 4LRQA 1FDUA 4HDSB 3WK6A 1F2UB 3CUEF 2N75A 1QS0B 4LC1A 3F98A 1Q7CA 3ZU3A 5FUYA 4Z4QA 3Q87B 5FYQA 3AJAA 2AW5A 2OBNA 2AC4A 4UU0A 2X0RA 3UV6A 1UPAA 2REXB 3F6YA 2BISA 1XZ8A 1KI7A 3K8YA 4AP9A 2NQTA 1IZ7A 4QZVA 5IEJA 2L42A 3GLIE 2BH2A 4KTVE 2ILVA 2XD4A 4ALLA 4D3ZA 3IIIA 2QTVB 2B4QA 1U4OA 4QUJA 3E82A 3WLAA 4MRRA 2BUAA 1UM8A 2D54A 4IUCS 4P81A 2PKRA 4DC0A 2PUCA 1U0JA 3Q7SA 4G1CA 2IHTA 1YB2A 3ZDQA 3SFTA 4ZPJA 2QP9X 3ORFA 4UHFA 3K9BA 2I2XB 1N0VC 3DO5A 4GO1A 4IIHA 3SIRA 3WVNA 4K03A 4CL0A 2X23A 1UQRA 3HG7A 2W4MA 3M6FA 1R66A 2WNHA 4YQYA 3AG6A 4UCQA 3J81k 1SUCA 4FFNA 4NXMB 1FVOA 4J4BA 2CJFA 2CNBA 1UKBA 1QZ3A 4EYEA 4L85A 4P4TA 5F2NA 4BDSA 2YVLA 2JD2A 4HFJA 2V4ZA 1NLMA 1XXHA 1GT91 2FPXA 1SG0A 1K4MA 2NXEA 4JI2B 3M3HA 1VIDA 2ZS9A 4MW6A 2JJ1D 5DH9A 3QU5A 4ETMA 1NHGA 2HQBA 3I73A 4UTOA 3SZRA 2EF1A 3ZV5A 1QG6A 1SXJB 3ZWMA 2HPAA 2GM5A 4C0LA 2PH1A 4QE3A 4DLWA 4L2IB 3ESAA 2I1VB 1JEEA 3A6KA 2BRUA 5D2CA 2QLLA 1VG1A 5L7YA 1OB2A 2YV5A 1XU4A 2AR7A 2PLWA 2ZJ8A 1SCKA 1YVUA 3AB8A 3KR9A 3NC0C 4QNNA 3V7YA 1TM7E 2BR5A 1ONNA 1SZDA 1XE3A 3CZ5A 3FH0A 4TTSA 3SSNA 2QVGA 4PGAA 4Y2JA 4FZJA 4CLHA 1RKVA 4QG7A 4KYIB 1LDYA 5AJHA 5JXJA 3A1DA 1JIVA 2ZR9A 3I9OA 3LLVA 3CS3A 3BXEA 3LCRA 1B00A 2A5YB 2OOSA 3AI7A 4BO2A 1ODLA 3VJRA 4TKLA 5ESDA 3NJ4A 5M34A 5ILQA 1WXIA 3ZG6A 3OZTA 2H4JA 3WMWA 4TXNA 3IAUA 1U7OA 3MJVA 5TC4A 4GH5A 1LS6A 1Y63A 5CK4A 2PAFA 4WAUA 2WP8J 2E89A 4XGQA 3E5HA 1R4NA 2D0DA 1GQOA 2ZUDA 3E4CA 4RDHA 5C8XA 2CLEB 4A1FA 3D4IA 3QPUA 2RDMA 2QR2A 4XI9A 5EXEA 5KYNA 4DV5B 4V03A 2MSDB 1OAAA 1UF9A 1AXEA 1CVIA 2VAMA 1T4GA 1CVRA 4Z9FA 1DAOA 4BCDA 2H0QA 4J3JA 4J1SA 1CNFA 2GEJA 1UODA 2O0KA 3HVKA 1VLZA 3KYDA 4I6JA 5IBRA 3T7JA 4AMVA 3T5PA 3DFMA 4GBED 1VJTA 4QECA 5FLXA 3FOFC 1ECJA 3D6MA 2E18A 1YDMA 3RI3A 4BATA 2DU8A 2P2NA 2QN6A 4PO1A 4XEUA 3K5HA 4JJFA 1BMTA 4QYTA 2BT4A 3KPVA 5FUQA 1JDBC 3UBTA 5ARBA 3TXXA 4ZYZA 3I01M 2LIPA 4UREA 1Q0SA 3DVAA 2R8PA 4Y8VA 3CN9A 1FUYB 1TA4A 1A5TA 3FGPA 1IFXA 5B7PA 3PVSA 4DCJA 5BSVA 4A23A 3ROEA 3OKPA 2XCOA 4B17A 3PNMA 2VH2A 2XT0A 1XTJA 1XPJA 1U6KA 3SC4A 1KDRA 3UOAB 4P35A 2O2YA 4M8KA 3EXEA 1RLIA 4AQDA 3EIOA 4R05A 4KE6A 4NBVA 2GD1O 1PR2A 4ZO9A 4DYDA 2C04A 3AONB 4JXZA 1BG6A 1B26A 2OAEA 2P4UA 2VBIA 3LT1A 3WAKA 1E94E 1OLSB 5I9SA 3QXGA 5CCEA 5TPWA 3KR1A 3QVLA 2PWAA 5K7SA 1SBHA 3DAPA 3IDQA 3O3CA 4XDGA 1SUAA 3TZLA 1A2QA 1CFZA 3I37X 4B76A 4JBYA 5AOVA 5DNUA 2HA0A 4TN1A 2JA2A 1V11A 4AKTA 3S99A 7GPBA 3NEYA 5KC9A 3CZPA 2R6FA 1CR1A 1F5SA 1WCV1 3CUTA 2VNHA 4ZMRA 2ORWA 3OSZA 3WR5A 5I6DA 5KX5F 1NBME 2O5CA 2QOEA 3ESXA 2CDRA 1RD4A 1JA0A 3R7DA 2HJRA 1VQ1A 2Y0EA 4KBFA 4OL0A 2C84A 5FPSA 3RD5A 1X9GA 4PCAA 5I47A 3D8SA 3VHLB 4A15A 2JLRA 1KYWA 2HFKA 5D7NA 1ISMA 4C06A 2FW8A 3E8MA 5JVDB 3VZQA 2C7QA 4I99A 2C9OA 4CG2A 5HXAA 1EA7A 3O9ZA 1DKPA 1ZNXA 1LJLA 3T3PB 5EWLA 4HEA6 3O73A 4HOYA 1U8YA 4YX9A 2TECE 3LQFA 5AVKA 1XA0A 3TX6A 4YUYA 1UJBA 1ZS9A 1H94A 1IJBA 1A69A 2W37A 3H0EA 3R1IA 3RQIA 2C8JA 1MB2A 1JDNA 1AU9A 3GVIA 3B85A 1K9VF 4PLYA 4YEDA 4JZYA 1C9EA 5GOTA 2X14A 1Y9ZA 1NMSA 1UWLA 1ZGGA 2HJ9A 4UEQA 5EPUA 4AF6A 2MJLA 5JARA 3IYLW 4AY4A 1O94A 5FTJA 4RDIA 3ZC3A 2Q0SA 5DCWA 1VYTA 2B4AA 2JAPA 2WKQA 5F9MA 3AW9A 3DE2X 1I6MA 5FWXA 1TNDA 4EB6A 4C6HA 1V9SA 1XK7A 1ZOSA 2XGGA 3KL2A 3OZIA 4XWYA 4NMMA 5F51A 3RVPA 2O8CA 3E9NA 2JLBA 3PJRA 3DV0A 4A10A 4YPOA 4EB8A 4TWBA 4C21A 2OBYA 5EE3A 2WSBA 4B6FA 3PC6A 3U7IA 3WWPA 4D44A 4KFRA 3INGA 2EKDA 1QJ4A 3OWOA 3BB1A 2FPGA 3PI6A 1ZCZA 4IR7A 3S81A 4QYSA 4RH3A 2ADOA 5CLLA 3ZWPA 2IZ5A 1F38A 1G55A 2YR0A 1T2CA 4Y6OA 2JFYA 4JI3B 4ALMA 5CURA 2ONZA 3SXJA 4FDLA 4MJ7A 2WJYA 3TXAA 3HABA 5KNBA 2BY4A 1VJDA 3BWCA 1T0PA 4Q12A 2WD8A 1YMUA 3T1QA 2ZSFA 2I3ZA 4MS4A 5E3HA 3P96A 1DV2A 1OASA 3BL8A 1H8HD 2Y1WA 3G5TA 4ZYYA 3OTOB 4N8EA 3ZZMA 1JW9B 4D96A 2QRVB 3JZAA 3U3JA 3VUFA 2ZYIA 1DO0A 3DBVO 5EE0A 1TGVA 3AZPA 1U31A 2FMFA 5H3HA 2Z5GA 1WXQA 3RVOA 4IG4A 4K2AA 4L9RA 3BCHA 2C58A 3UMVA 1CYEA 1VE9A 3GT4A 2AE2A 1XMQB 1WEHA 3EXG2 1H66A 1LKZA 4MWDA 1QIEA 2XNJA 1XU9A 1YU6A 2L82A 1ZK0A 3U9TA 2FVXA 3LIPA 1LK0A 3PXCX 2H9YA 4R41A 1FL9A 1YR6A 4ZALA 3GPLA 3HUDA 2H16A 4EPYA 1U0BB 2FN4A 1V3UA 2FPKA 1NVAA 1DJNA 1NVTA 2I71A 4Z4GA 3K9CA 5IBCA 3O83A 1XIVA 1QTNA 3DFFA 3LUCA 4KO1S 4P08A 3NI2A 4HKTA 1Q17A 4PC2A 2B4YA 1N6PA 1E1CB 1I30A 1E3MA 3RTEA 4FCCA 4RVSA 1HUQA 4BECA 2P1DA 2XBLA 1YJAA 3CSUA 2KSQA 4KRGA 4LWPA 2O0MA 2XBUA 1NUPA 1X0XA 1HKHA 4XIFA 4D9KA 2FKAA 3MGAA 1P18A 2CMGA 5AVVA 2RIRA 1PSZA 3ORYA 4FP9A 3KAPA 4IBOA 4LVOA 1K8YB 1OFUA 4CMJA 2NO4A 4ZRNA 3GHYA 2GASA 1E18A 4EY4A 2AJLI 3E2PA 4KWIA 4YT5A 4LPKA 3MA0A 4Y2PA 4WZBA 2WVGA 1J09A 2AX3A 4NFYA 4ZI2A 4YJ2A 1KU6A 3D3WA 2DMRA 2C94A 1K8QA 2PBZA 2W6JA 3GUHA 4HWSA 4IIJF 4LRWA 2QTFA 4N6NA 1IZ9A 1Y6ZA 4F3TA 5AW6A 5TQ0A 2COEA 4RZIA 1AUOA 4KLRA 1SU4A 1DWPA 1WP9A 4H59A 4ZU6X 1X80A 2O8VA 3OZDA 1QPGA 5B6IA 3HCOA 1D9XA 4KDCA 4BNWA 3R4CA 1VL8A 4C4RA 3AUAA 2IP1A 3NV7A 1JDSA 3S1LA 3VKUA 2VTBA 5FUVA 3NQ41 1GUAA 3KOYA 3QVMA 4L6CA 3UKOA 3UT5A 4R98A 1WTCA 2ODAA 1RWPA 3B6EA 4RDCA 5IKEA 3PRHA 1NT2A 5E7QA 5K3AA 2CV0A 2JEYA 3RASA 5CD1A 4HEHA 2J3IA 3C1TA 1XTTA 4JC5A 1GKYA 3NT4A 3FLBA 4FJ2A 1IWOA 3E2MA 3TKAA 1IB0A 2O2IA 2PZ8A 2Q4DA 1PGNA 3UJAA 4BC1A 4UNRA 3VNQA 1RMTA 4HI0E 5IN5A 5K8CA 4BNDA 4CL2A 2G4CA 1J1IA 4BBAA 4NU0A 2BZ1A 3WGNA 5TPZD 3ZXUB 1UWVA 4I4TF 4LE1A 3DCIA 1TEZA 2Y99A 2QZ4A 1A1SA 5BQ3A 5C1DA 2R751 5K03A 3AFIA 1P1BA 4RYLA 1XQWA 2HADA 4R3WA 4XPIB 2Z98A 2NUPA 3TL2A 5CB8A 3LGSA 2XJ9A 3MN1A 5BUSA 4RJIA 4I1IA 4QGAA 2WJWA 4RZXA 2VR1A 5LD2C 2HLDA 2YMPA 1NMYA 4BMZA 3H19A 2GZAA 5AH0A 1CUHA 5C7IO 1WV0A 3JVVA 6CHYA 4UFPA 2GYWA 3NM4A 3ZD7A 2DFTA 3FYUB 4OMFG 4RK7A 5AW2A 4GF5A 3RTAA 1MJ5A 2FFHA 3RVRA 4ZTUB 2R11A 4H17A 3EAFA 4XYMA 4IOKA 2W2KA 1AF7A 8AT1A 1MUUA 4PAGA 1IY2A 1QG0A 2QM8A 5D86A 2JIDA 1T6ZA 2HTFA 4U7TB 2X15A 1YO6A 5KOYA 4B4OA 2Q5OA 5FWDA 1NV8A 3MUFA 1B8NA 1P7YA 1SHKA 4HUQA 4KXXA 4HATA 4NZYA 3L6RA 2FSVC 4NPCA 5KNCD 2DR3A 4QXOA 4A82A 4CTOA 1PWZA 4TRMA 1GXSB 4EMBA 4CDNA 1J1ZA 2LKDA 4PV7A 5ALTA 2BMEA 3UHOA 3RVLA 2NTNA 1E6LA 4JJ8A 2VWGA 4MRNA 3T3OA 5EXSA 1QUEA 2B35A 1PTKA 2INGX 3BXFA 3V4FA 2P6NA 4LF8B 3PGVA 5FBHA 3BHNA 3FE2A 1T8SA 2F9MA 3D6JA 3PX3A 5HFJA 3RU7A 4E32A 1C8VB 3H2IA 3WJ2A 4MGEA 3EVEA 2JIMA 4N7RA 4B3CA 2ZIXA 4DIDA 3Q0IA 2BMVA 4F5YA 5JG7A 2BN4A 1QG2A 3LHSA 4BQPA 1M1ZA 4RY9A 3CLSC 4AMUA 3PZRA 2PZLA 3VSBA 4B2YA 4XXHA 1VLQA 4TWIA 3UGQA 3PNQA 4CLOB 4ED9A 1HTBA 3GDOA 4XKJA 4XGIA 4PO9A 3S68A 1TRKA 3P9RA 4AZ3A 3GN1A 3LTNC 2IYZA 3GLHE 4ND7A 1YAHA 3Q7EA 5E1MA 4BNKA 2QGNA 3IVRA 1H5NA 2AKYA 2IA5A 3O1LA 1N75A 2N3ZA 4LRYA 4M9SA 4MVJP 4RIEA 1P72A 2XA9A 2W4IA 2RCNA 4TVOA 3F96A 1ZLYA 3BIJA 4J7CA 2IBMA 1GV1A 4IOMA 5C7OO 1AHHA 2ZAMA 7AT1A 1P5HA 1FLDA 1YU9A 3GDHA 3KE9A 3B51X 3IEUA 1DIRA 4DR4B 4DMFA 1XNJA 3R6DA 3RS5A 1DOAA 1R0KA 3D43A 4O4JF 3QV1A 3NUGA 4DA0A 4YY3B 3A9CA 3BBPA 1HC7A 1YZQA 5GP1A 1AN9A 1E2EA 3EIUA 5FTKA 4GYWA 3L07A 3GVCA 3HACA 4E70A 1R4MB 3PNKA 5C9ZA 4LF9B 3FIUA 1A9SA 2HNAA 4RLFA 1P0MA 1XCBA 2JH9A 3I9V1 2QM3A 3I92A 4OHXA 2QGZA 3TEJA 4IIBA 4Q9LA 4RJTA 1RLMA 2I7VA 2P5SA 2PD6A 3QA9A 1G63A 2E82A 1N9ZA 5EMMA 4Z9BA 5IDVA 1ISRA 3VPGA 4AK9A 1DT3A 5CFPA 3CLUC 3CCBA 4XD7A 2OLEA 4HNAB 3OCVA 1KJNA 5EMJA 3HA2A 4EPRA 4DUPA 2Q5FA 3W0LB 1UKEA 2XVYA 2HRQA 1H8HA 2YJ3A 3DH0A 3VR0A 3TD2A 4OGWA 5SY4A 1FP4A 2CZCA 5A05A 3DQZA 3E5NA 3TZEA 4E22A 4J0GA 2CHQA 1DGQA 5LZ4A 1CZHA 2IEAA 4QVKA 1XFDA 2B69A 3CU5A 2XQKA 3E23A 1N7HA 1IPEA 1NNI1 3LO5A 2WPNA 1EE9A 1FBNA 2D4HA 3T15A 4BASA 1ZNYA 5JS7A 1IXRC 2N1MA 4RL6A 4RY8A 4DIUA 5CDHA 2ZIVB 4Q37A 2PKYX 4LGVA 1B8VA 3RSZA 4KSYA 3RAEC 3KUKA 3W5IA 4M38A 4LYGA 1H9AA 1UPCA 1JQAA 4EY8A 3KVYA 1VBNA 2HXYA 3WQBA 1JHAA 3RM3A 4D8TA 3HO1A 2B8TA 4RPJA 3GQVA 2H7YA 4DB2A 1QK5A 2C29D 4I5FA 2H0RA 1PR1A 3HVJA 2V3CC 1CZLA 4I4TA 1E3QA 2RG7A 2BAGA 4UAUA 4A8JB 3RTCA 3L82B 3A4YA 1UJ5A 2ZAOA 2W6ID 3QENA 4IGKA 2BFOA 3TUJC 3ITKA 1C7IA 4NJEB 3ZNQA 1YQUA 3KJFA 5F5NA 3D9QX 5IKOA 1HRKA 3F7TA 4QU8A 3QLUA 4KE9A 4S0ZA 3GIDA 3SIPA 1EG7A 5L51A 3VJMA 1ADCA 2NAFA 4U2CA 4ZICA 5KOHA 2ZTMA 3HEBA 3R7WB 4F92B 2XF8A 1IEQA 3CJQA 2RI0A 3L6CA 4R7ZA 2IUFA 1TA0A 2C5AA 3QHPA 3QKIA 2BLLA 3BEDA 3L1HA 4DEYA 1W36D 4EG3A 3CGWA 5J4HA 1GRQA 3RYCB 3KLNA 1RAHA 2I33A 3TSYA 3I0NA 4HZIA 1NSTA 2R60A 4YLGA 4RD6A 5THQA 3G8CA 2YRFA 2JK1A 1M6VA 2SCUB 3AEQA 5LQRA 1I0ZA 2G06A 2IYFA 1PWYE 1Z5ZA 1ZSNA 4ZVOA 3K4HA 1KJJA 4IDAA 5A5EA 5I4KA 3U4MA 3TLCA 1MBZA 2BFWA 3E35A 4A2QA 4ZKDA 4CQJA 3KR0A 1IH8A 4FXOA 4FFBA 2OYRA 5LKAA 5COAA 3T41A 2HRZA 4FFDA 3F5SA 3A1EA 3PQ3A 1H2XA 3AF6A 3Q4GA 2XVZA 3M1AA 1I36A 2X77A 1XEAA 2BHNA 2X2OA 4QBKA 2DY0A 1NUUA 2XNSA 4X7MA 2Q6TA 4HAOA 3VNBA 1P2GA 1RAFA 5FORA 5KHLB 2C4MA 5DXJA 1WDKA 3C6YA 1L5RA 1JSLA 3JQAB 5CLFA 2A14A 1P73A 2BELA 2BVNA 3MG9A 3EVTA 1BIFA 1R0XA 3WYAA 2CVQA 1PS0A 1NDHA 1KAGA 2GCEA 2IYSA 2P65A 3GLRA 3CM0A 4N8SA 5EXTA 3T9BA 5I7FA 1YWGO 1ULBA 1CD5A 1GU0A 4A6EA 3LPLA 1WBJB 1UT5A 2C1XA 1TCVA 4YRBA 5KREA 3GEEA 3ZU4A 3IOEA 2LDXA 1XVUA 4V1CB 3KKEA 4X6YA 1AURA 2OAGA 3GLHA 5CM8B 2XCTB 1R0YA 4ZREA 4MGHA 2G1JA 4OVKA 1KMHB 4GZLA 3GBPA 4KPUA 4AJ9A 1FRZA 1L8OA 2ZRKA 2IHBA 1DJPA 3P9NA 4IGEA 2JKYA 4D9JA 1ZONA 1JLLB 1GZDA 2GTHA 3IELA 3X1ZA 1SCIA 3GNQA 4MCJA 2P9JA 4JELA 3KV1A 3NASA 3SX0A 5JD4A 1OFIA 4DTIA 4DLSA 1LBEA 2VUSA 4NY1A 1UANA 3PWTA 3Q2OA 2CEKA 5IKMA 1NXTA 3L6BA 1XRJA 4BRWA 2G9QA 4EJSC 1BS9A 3BHMA 4R68A 2XNKA 3R3UA 2BUCA 4NNPA 2B1GA 2YXLA 2CMFA 1GA4A 3KYCB 3C24A 4XM1A 2G9VA 1T9CA 2ZUUA 1EZ1A 2GDJA 1FDSA 1WXWA 3QU7A 1KS9A 5EMNA 5FWYA 1AQYA 2EJTA 4P22A 1L5KA 2GM4A 4EQ6A 5KNCA 1AF4A 3UC9A 4KQGA 3TL3A 2HUPA 4RVOA 2DPMA 1T5TA 3MMSA 3O6VA 2J9FA 3RSOA 1CY6A 3ZKWB 2PTHA 3D6TB 1CRWG 1LWNA 4NCNA 1EUDA 2AF4C 2XRZA 5HSGA 4I5IA 3HKCB 3RABA 3AU9A 2EJCA 1XLWA 3CB2A 3QWBA 3WIVA 4HDMA 1JA9A 4R1MA 3C87A 4BE4A 5JFOA 3V80A 1NA5A 1N6NA 1X15A 3ELYA 1F8FA 2F4VB 3FUCA 1YRYE 2LRHA 4OI0A 1PV1A 4JOSA 1NF2A 1M76A 1XP8A 2W7TA 3Q9NA 4DANA 5CDFA 5LMUB 1X3LA 1XWWA 1Z5OA 1IRIA 2QR5A 3QVWA 3MS7A 4Q5IA 4GWKA 3AVUA 3OCYA 3VHXA 1E79D 4O2BB 3W2GA 1DKLA 1MJNA 1CCWA 2VF8A 4B5KA 5I8PA 4HDRA 5I9MA 4N0MA 3AR2A 5LIPA 3OF2A 4FN4A 3STVA 4Q0MA 2P0EA 4U9HS 5BSGA 4YP0A 4J8PA 4EPXA 3B1WA 2NN3C 4GLBA 4I5GA 5L7WA 4S1NA 5JLJA 4ZT4A 3WRYC 5JRDS 3DOIA 4HWRA 4MP3A 4AMYA 5BN5A 2Y1FA 5BOVA 3KRTA 3CVOA 1FYWA 1YCDA 4PG8A 4C2UA 1FW6A 5I7UA 1G2QA 1U11A 4DCNA 1SIWA 1FOEB 3D0RA 4N47A 1L5WA 5ALSA 2QPOA 4CKYA 1W1IA 1JLKA 1GPAA 3GCGA 1UFRA 4PFJA 3MLAA 4EHNA 4BJ5A 1FNCA 2JF0A 3D1LA 3K32A 5EMHA 4EUEA 5FEUA 5CEEA 3FHTA 1SZCA 1J2UA 1CUBA 1GLVA 1QHFA 3PUHA 4W8HA 1VJ5A 1UUFA 4A0FA 1TAHA 3H2HA 4GMFA 4NEQA 3L7YA 4RH1A 2ZREA 3H5OA 2G08A 4AC9A 4XUGB 2P3QA 3E6AA 3E61A 1DJLA 2VEOA 4PPYA 3P2YA 3OO1A 4M0CA 5M2QA 3EDQA 4BNLA 1S8OA 2REQA 1CDDA 4ZHQF 2H8KA 4Y0VA 4F4DA 2RHCA 3O4IA 4LRSB 3UGJA 2OCKA 3OPQA 2VHQA 3H5TA 3MAAC 4RUKA 3CRW1 1WDMA 2AZ4A 4KQ6A 2C8LA 4HH4A 5EWMB 3HADA 3N0TA 4LF4B 1H3EA 1NRJB 1MRNA 2ERCA 4AI6A 4D6PA 3VHRA 4C4PA 3U4HA 3B1ZA 1CFJA 2Q29A 3LLCA 1U1DA 4TSFD 4BV3A 2R3SA 2YCBA 1YR2A 3V7UA 2HQRA 3KVRA 5CTJA 4BX9A 4CTMA 2LWIA 5B58T 1BJTA 3GJTA 3JQ8A 1NUHA 3WA6A 3FLAA 3M6MD 3U4CA 1P60A 3K9LA 1N1GA 3PA6A 1YHYA 4FSDA 1SIOA 1TQ6A 4UAGA 2ZBDA 4XR4A 3UPTA 1R6XA 2WF6A 3QSGA 1VL5A 3A37A 5FI5A 1DKOA 3ESYA 3IPLA 3JQPA 1NN5A 3L6OO 5K4GA 4MDHA 4PRYA 4HWGA 1GWNA 3ZYZA 5L3SA 3W6NA 4KKVA 1H3NA 3CPJB 3N39C 1I51A 1YI8A 3R24A 3UNXA 1PNOA 3NEPX 2HF7A 1W9MA 1V41E 3INTA 2TYSB 3H6HA 4B0PA 1PK7A 1IATA 1WXDA 1ZMBA 3FPLA 4EG0A 1ACLA 3BIFA 4ZEVA 1GNRA 4IIEA 4CW7A 4OXYA 5KSZA 1Q0LA 3OEEA 3HLYA 3W6ZA 2FUG1 3E3MA 4IQ0A 3UJNA 3MWYW 4ZANA 4W9NA 3RH0A 1PNTA 2WFMA 1UOOA 3L4BA 5CT8A 2ST1A 1YR3A 4LDNA 3C3MA 1DJMA 4QPCA 2C7BA 3ONEA 2JFWA 2X1VA 3NALA 2GF2A 1UMDB 4B8YA 1FPQA 5TS3A 4KQHA 3W5DA 3KETA 1GPJA 1WPRA 1ODJA 2I5PO 2QIOA 4FIZA 5E8RA 2I29A 3FYDA 3I1IA 4AKSA 3Q3EA 5MGBA 1QWSA 4QDKA 3WLNA 2VHWA 4OHMA 1BVUA 5JHHB 4KZKA 2Z5FA 4DUZB 3U4GA 1JFVA 1T8YA 2C78A 1LRJA 1Q16A 3AGPA 2RBKA 3TDMA 4MVJI 4BFUA 4EUHA 4C2TA 3OM1A 1TW3A 4INPA 3IMFA 3DV0B 2AN4A 3W5JA 1CZRA 1E69A 4FOSA 3DD1A 1D5WA 1U9JA 2C2OA 2DPLA 4RVCA 1F5NA 3ZV4A 2I65A 3KSMA 5F64A 2FPGB 1QE5A 3TXYA 4RA9B 2IBSA 3FMGA 2DQZA 1X7YB 3OLQA 4LHYA 1JKMA 2XEXA 2QMUA 4PYKA 4CGZA 4WLEA 3IPXA 1D04A 3EVZA 1CR2A 2Y93A 4DQUA 1EYZA 5EIXA 1GZVA 4HZUB 4MQMA 5A4MS 4LKRA 1CEXA 1NVKA 1Z16A 4FX5A 1P9OA 2HO5A 4K9PA 1RAEA 4DLLA 5BNZA 4M89A 1FUKA 2ECPA 1NX6A 1EK5A 3FB4A 5AT1A 1E8MA 3V8NA 4BQQA 3WL6A 4ZQHA 4E5SA 1YKGA 3ZE9A 1WDLA 2FZ4A 1X8JA 3U1BA 2FETA 4YCCA 4KR6A 5E6UA 4A6PA 4WY8A 3LPMA 2Y2UA 4M4SA 1RYHA 4WNAB 5CAEB 4E14A 1UPUA 2COKA 4F6RB 1BGVA 4R9RA 4L95C 5CVTA 3N5CA 1P7VA 3TF5A 1GVNB 3HO8A 1O5OA 4IDDA 5AW7A 3BCSA 1NXXA 2DTXA 3IIJA 4KUGA 4MYDA 3R7BA 2D5AA 4N01A 4YONB 5HKKA 3PD0A 3K5IA 1SVNA 4JT8A 3TLGA 5JDIA 3W4KA 1YDHA 3EOAI 4OQPA 4JYCA 4BB5A 3C8HA 1V3QE 2CUNA 3VBEA 3LOUA 3VKHA 1RI1A 5LFAA 3CH6A 4CR8A 1G4HA 4JT2A 4OCZA 4UHBA 5H80A 4M55A 4KN9S 5SY9A 3JATB 2CKMA 1MFPA 5JW6A 2VHEA 4R6WA 1KVSA 2ATEA 2QHXA 2PIAA 2WIFA 3F2IA 2FMIA 4TMXA 5EMLA 4QJ3A 1Q1GA 4TMVA 5KOJB 4FILA 5KNLA 1KQNA 2NU8B 4B6OA 4Z7OB 1U7WA 1Z62A 4KUEA 4M7WA 5BP7A 3TN7A 3RE1A 1MU0A 4P82A 1I0LA 4Q7LA 3JD4A 4GXRA 4B47A 4BO1A 3TRFA 2CUZA 2VRBA 4DDKA 1GYQA 4ZIRB 2XUKA 1CEQA 4IHAA 4D5EA 4FZ3A 3OQHA 2PGXA 5TDHA 4FGWA 1EGHA 3EQ8A 1O5TA 1Z38A 3FUWA 3QEMA 4QWMA 3BQ9A 2P75A 1J2EA 1RXCA 2RGGA 2VF7A 3K0HA 1L4NA 3EH2A 5ALZA 3NDIA 2E37A 4GC9A 4RK5A 3TCXB 2GVDC 3TD6A 3L18A 4N3NA 2NU6A 2W42A 4DC9A 1KEWA 2FWRA 1ECGA 1JF8A 2R5FA 3L7DA 3B82A 4G89A 3G02A 4H15A 3KO8A 1BYIA 1S2DA 2OHFA 3DZDA 1RE1A 1U28C 2YS6A 3FB1A 4CYMA 4MRMB 5LNK6 2R00C 3BH6A 3TTXA 3RNOA 5JCOC 3EVGA 3QSYA 2H4XA 4M0EA 2VVTA 5EVJA 5BURA 1W49A 3RB8A 3VNUA 3V1NA 4B3JA 4K9RA 3IEMA 3ABQB 3HUEA 4Y2VA 1B0PA 4C3VA 2CY0A 4EEKA 4MDYA 5CH3A 4MO2A 5G0WA 1JAXA 2R6R1 4B3XA 3HSKA 4P7GA 4CIYA 3PNYA 2OV2A 1LSOA 4K9OA 2D5BA 3T34A 3C8ZA 1PX2A 1V25A 2FUG6 4UVGA 5G1PA 4NV1A 3WGQA 3CURA 3JTEA 1G7TA 5CLQA 2KLHA 2D4AA 4PBRA 4BNMA 2ZTLA 1QHHB 1B23P 2PH5A 4CZ2A 1RKXA 1O57A 1YQEA 1RNLA 4C7BA 4BLQA 1K2WA 3B7WA 4EX6A 3Q12A 4KN8A 4LJ5A 3COJA 1QORA 2FPMA 4ZT2A 1HE1C 3K0EA 1KEPA 1A3CA 1PHRA 1XLTC 3B6JA 3BE4A 4KNYA 1KPGA 1HL3A 2FR8C 4MOWA 4FYHA 3M4ZA 1Z33A 5TGZA 1G5RA 3UAYA 1OYYA 4MJLA 1JYFA 3BL5A 2XQGA 4MULA 3FPHA 1IPHA 1KO5A 9ATCA 3UFXB 1SXQA 3DLHA 2JI8A 1DS6A 1DC7A 1PUIA 2QXUA 3K09C 3KCNA 3M49A 3P0HA 4NMXB 4TGLA 1VL6A 3N8GA 4IRUB 4BWYA 1MFZA 1TLFA 2BEVB 2IJGX 4M1SA 1C7EA 1E62A 1W59A 3KZ1E 3IFSA 4INZA 3ZBQA 3DKRA 2CXQA 3LP8A 3QWAA 1QIHA 4XYLA 5K0SA 4WOCA 1Y7IA 5M7EA 2YVQA 2VN8A 4KHZA 1ZUIA 1C7JA 4DJDC 3BCRA 1S4QA 3HXOA 5FAKA 4R5MA 3USES 4LZPA 2NUAA 5ARCA 2Q9CA 2VDNB 1ZEMA 3OZ7A 4YMSA 1RJ9A 2LBPA 3CVVA 1MORA 4P5PA 2V1XA 3ZNOA 4BX3A 3O8RA 2BP7A 4NECA 1IHPA 1ONBA 3SF8A 1KSHA 2QQGA 3GWZA 5J43A 3T5GA 4MX8A 1RBQA 4YP6A 5DTMA 2IS6A 1AA6A 2I2FA 2PRZA 4DJAA 3BJEA 4G37A 2H54A 1E2QA 1QMPA 1LLUA 2EC5A 3B2EA 4N18A 4N5HX 5JDCC 3SR3A 3MQ2A 2QENA 4IJMA 4Y18A 4BY9E 4Q3NA 2QRPA 4F8JA 4OHCA 1SXJE 4GIBA 2AR9A 1SO8A 3PNBA 4QTZA 3TNDA 4X3OA 4B34A 4BP3A 2CLHB 1RR6A 4HHEA 1I1HA 3PLRA 4JASB 4PFQA 4DG5A 3G0HA 4P3PA 2OWEA 3AR7A 4ICIA 4KYUA 1PBNA 3S1SA 3O7WA 3G2JA 1EX7A 5CW2A 1SHLA 3GRCA 4BQRA 1HDRA 2CJPA 3JXEA 5B5SA 1IVNA 2O1XA 5FNZA 4N3AA 4H6VA 3ENKA 5GQSA 3OE1A 4DLAA 4D0SA 1W19A 2NZ8A 1B43A 3MGKA 4PC6A 3KQUA 1J4AA 1KL7A 1UJ6A 4QBTA 5LLTA 2HSWA 5KTRA 3JYOA 3RRJA 4Z4FA 5JD5A 4RVFA 4JVOA 4EGJA 1UBKS 2I6FA 1HDOA 2QMZA 5AQEA 4DSZA 4DA8A 3NUZA 1PJLA 2VPQA 5KHOC 1NBMD 5DJ5A 3PVCA 5HUQA 1U02A 4JS0A 4JEIA 2OGZA 3PNPA 1JH9A 3SP1A 5AI6A 3DHWC 3BH0A 3OT1B 1K6JA 1IU9A 2ONCA 1H2YA 3EGXA 3O8OB 4QRDA 3LQ4A 1SKBA 1GZUA 3OQIA 3UAWA 3WGZA 1NT4A 4H0CA 4NJMB 1IBKB 1EDEA 1W5BA 3R5SA 4LRUA 3QLUC 3IB3A 1Q2UA 1N2CB 4CL3A 2EVWX 2IEDA 3Q40A 4Z4HA 1MAWA 5K8LA 4HRXA 2ZRGA 3EZNA 2X42A 5FL7D 4IF6A 3G0IA 3NAMA 3CW2A 5TQ2B 5EY5B 4TRRA 1XYGA 1N5OX 5KJ1A 2G0AA 2QJFA 4QU9A 5FOWA 5T67A 3TTYA 4DIMA 1OFVA 1NRIA 2ZFUA 3KKZA 1QC5B 3P9ZA 4L4YA 4RJ2A 3WLIA 4YECA 1RCTE 1RWBA 3E81A 1BCRB 1RXEA 1YBHA 3L8EA 3V48A 2Z8XA 5IT5A 1V7PC 3B38A 4RLHA 2D5CA 3GLFB 1Y80A 1XYVA 3MBOA 1QF7A 3KB6A 1GSAA 4J6EA 4TMTA 2HHLA 2VNIA 2VUHB 3CIFA 3L7MA 1PYOA 4ZCTA 4RULA 4TXHA 2GKSA 5J1SB 4MI6A 1B0ZA 3NEJA 2X9VA 2O54A 2CBGA 3D3NA 4HSGA 3WKBA 2YS7A 3AVOA 5GONA 3T3GA 1ZD1A 2NYRA 5T4BA 1UEIA 2HU2A 2CFSA 2ZDGA 2DPXA 2ZQZA 3I34X 4JLPA 3EMVA 1U0FA 5HK9A 1FP4B 1SKQA 3G59A 5JWHA 5DLDA 4HB3A 5JEEA 5AUQA 1AQJA 3H9GA 5DCLA 1K27A 3ERCA 1W25A 3JWPA 1DKRA 3Q6NA 4RF3A 4JEUA 3L02A 2X4DA 1F2TA 1U98A 2I6XA 2EBUA 1JBKA 1KI9A 1TU4A 2J9XB 1S7CA 2Y0DA 4R01A 4LG1A 1JHPA 4MWSA 1UOQA 4UXJA 4JL6A 2ZJ0A 5JMPA 1CYDA 1U90A 5LXTA 3JQGA 4I4IA 5LUBA 3A05A 3GK3A 1XRSB 3ELDA 4FK8A 4RS4A 1MVLA 2OCGA 4V24A 5AKGA 3GAMA 4ZVLA 1L7AA 3ZXXA 2V6IA 4YJHB 1P0FA 3D0KA 3WYDA 2I6UA 1YE3A 2FWAA 1RZRA 3HK2A 3OIYA 1KY2A 2ILTA 4Q4HA 1N7IA 1U5AA 2HBQA 4O59O 5KNCH 1Z08A 1O6GA 4Q4AB 4P4SA 5GAJA 1WDWB 1VJ1A 1Z4KA 5D7BA 1EVZA 1YZTA 1T5LA 4IIFA 5ICEA 1PEDA 2RONA 4IUDS 1OWNA 1KR5A 4R81A 5D6NA 4DY6A 2X5XA 4RH0A 3WNQA 4LMAA 4AF7A 3TAXA 3G49A 5FTMA 1ONPA 1CUZA 2WWIA 3ADOA 1CS4C 1EFCA 4HADA 3PA8A 4KYTA 4PICA 4IV8A 3M4YA 5E0OA 3SWWA 4YRGA 3PFFA 1LRKA 1E4OA 1NATA 1CZKA 2VLIA 1CVLA 3BGDA 3CT6A 3EIFA 1ZVKA 3VO8A 4C05A 4KQFA 3BMCA 2Q4TA 1KSGA 2HF8A 1IUOA 1QIGA 2ZRHA 3DDWA 3HH8A 2XWQA 4YH1A 5IUJC 3OIUA 4E30A 3LE8A 1TAUA 1ENOA 1FYVA 2OCAA 3QU4A 3V3KA 2JATA 4IIUA 3HB0A 2O2GA 1N3LA 2AFIA 2QJWA 3OQ1A 3Q9LA 1ZKMA 3GXOA 1MP0A 1XHEA 4FMBB 4OK3A 1FLAA 4NYMR 1IY9A 1GUYA 2PBLA 1T5DX 5FNVB 3DTVA 4KQJA 1RYZA 3UHJA 4AJOA 4DUGD 1WE2A 3RRXA 5FD8A 5EYPB 4BKMA 3FKQA 3I72A 1RJWA 4G5RA 4KOEC 4RE6A 3M9WA 1RI3A 3JX9A 4GZ5A 3WWOA 4AW9A 1CEYA 5JNLA 1TVEA 2YWDA 1VMAA 4A8PA 4BKQA 5JMWA 3DHNA 1QSGA 3C4VA 4II7A 1E99A 3EMKA 3UWSA 4HRYA 4NENA 5KYXA 3U4AA 4Q6WA 5D5QA 6YASA 1M2FA 3QE3A 1RRCA 1J06A 1VSTA 2J6CA 3DE6X 3OLCX 3BS4A 3HKDA 2YJZA 1QLHA 4FYYA 4OBWA 3IOBA 3JVUA 1YIDA 3OP1A 1BEZA 3QJGA 4ZZ2A 4NZNA 4A6XA 4X66B 4D9GA 1GD1O 2H4FA 3GEBA 4Z9XA 1AX9A 1ZAKA 1RM3A 1EU1A 4PYMA 3U4QB 2H65A 1FEZA 3UB4A 2RK6A 3BILA 4UARA 1Y6GA 3L8ZA 1PKXA 2EX4A 3U3MA 1AKNA 3CWZA 1KS2A 2N47A 2VZ8A 1FNSA 1PV2A 3LAWA 1I4DD 2XB8A 2VC2B 3NGXA 5F73A 1P8JA 4GZ6A 5GPBA 4DCTA 4ZXFA 1GVHA 2XOXA 3GYGA 3O0DA 1K4KA 3A9TA 3DEKA 2FWMX 3CVUA 4P4GA 4AYTA 5FKJA 1IM2A 3C14C 2FE1A 2PY6A 4Q93A 1QO7A 4Y2SA 2PVPA 2BFNA 3V7WA 4EUSA 4M1OA 2M6RA 1CRPA 1WPXA 1ZU5A 4WFQA 3SD7A 2WYIA 3QVTA 1UJMA 2DTEA 2QLNA 2ZE5A 3P4UA 1MHPA 3IULA 4G0ZA 1KJ8A 4U9IS 2RBEA 5AVUA 3X1XA 1A5AB 2EKQA 2ZWIA 1B3BA 3ENZA 2FGKA 4MYHA 3RFCA 3SKVA 4AJIA 4BBZA 2NVUB 2ZBRA 3DTNA 3Q11A 1E59A 1XLTA 1UQTA 2Y9PB 2Z2IA 4NOLA 2QI9F 3IXLA 1X87A 2DUMA 3OPYI 4EKGA 5B2ZA 3ZWQA 2GPNA 3RC3A 2GBIA 3CLRD 1ZYUA 2V74B 4W5QA 2V4UA 2QLBA 1U9ZA 2WZBA 2C9ZA 4A0SA 3HPRA 3FCOA 4JXKA 4EDHA 5C3MA 5ITVA 2WIBA 3AEKA 2IWHA 3UQZA 2Z4TA 3AM3A 5EFZA 1KEUA 1WPQA 2D3TA 2VA8A 4G1UC 3DBOB 4FTWA 4UD6A 5JNRA 1QLJA 1AHPA 3SNKA 3SQXA 1BFKA 1JDVA 2NU7A 1CDZA 5BQXA 3GRRA 4PHFA 3NHMA 1CUWA 3PQ5A 2UDPA 4BFXA 1Q5PA 3AMVA 4LXQA 2WMDA 3T1TA 1W5EA 4IJ5A 1ZQ1A 5EKSA 3R7FA 3JQAD 1ZM9A 1BC5A 3FRJA 3WADA 1GQQA 4GVXA 2B7BA 3QVUA 4R8SA 1S2NA 3BMOA 5G0VA 3WYEA 2YKGA 4Q4LA 2C2MA 4OA5A 4UTPA 3LS2A 2EWVA 1ENYA 2FQYA 2VOEA 1V7ZA 4P58A 4U1RA 1BJRE 5DBOA 4RTKA 1IWBB 3WRVA 4B3TB 1ISGA 2IGBA 2Q3CA 3I1JA 5KKCA 4P36A 2CL7X 4UZSA 2IWRA 1ZHFA 3W9SA 3SYLA 2IYLD 3JAKB 4RIGA 4YI5A 3KNZA 3SC6A 3KSZO 4EBFA 3KB2A 2CD7A 4CN9A 2QQFA 2WKWA 4HX9A 3WNBA 3ZW8A 1CEEA 1H05A 1XA3A 1XKQA 3RIEA 1R15A 4RS3A 1L5NA 1M10A 5L3RA 1I14A 2OP1A 5E0KB 2FZGA 2R87A 3D4LA 1JHXA 2JVKA 1GCIA 3HO6A 2R48A 5AW5A 4C9BA 1H2WA 1GGNA 2VYVA 3L49A 1LBIA 3UMGA 3DC2A 2PRSA 3N7TA 1K7EB 4U8HA 4EJ6A 5LLDA 2VTEA 1K4YA 3LKDA 3MJHA 3S5JA 2E9SA 2VXCA 1J9EA 4OUDB 3PNLA 3TJMA 3BWMA 1BXZA 3O93A 4KK3A 2W2QA 3QXSA 3GA7A 3PDCA 3E05A 4K88A 3IUBA 2A1TS 3PXXA 3VKGA 3O1HB 1DKQA 2QM7A 2R6JA 4MJXA 5EJ2A 3O5AA 4X1OA 2W70A 1TYZA 4OEHA 1O97D 1JRLA 1I2MA 1XLVA 2IPNA 2MMGA 3KEGA 3QOWA 1N1EA 1Y8QA 1B8OA 1E2DA 2RHWA 3GJ5A 4JBWA 1VPTA 4E11A 4IQGA 2ETXA 5JLAA 2M6LA 1W88B 4QYWA 4GDFA 1P2FA 1VJGA 5ALOA 1OILA 3U9SA 2VJAA 1SZJG 4MV3A 1L4UA 2B2XA 2HIMA 4HQLA 1PNVA 4PRLA 3WXMA 5E1DA 5BUZA 3W5AA 4HGYA 4P93A 3L0BA 4RACA 3UA4A 3HNRA 3KQOA 4IXNA 4LRTB 3NGMA 2ODQA 3C3YA 1Y34E 1YIAA 4N7MA 4PS0A 3T9CA 1KZ4A 1L4YA 3WLRA 4DV2B 2ZXEA 2HZBA 3L1VA 3WHIA 2GZ3A 5EJ9A 4FZRA 3RFVA 1FXSA 2I6TA 1YS2X 2HJVA 3AU8A 3HJBA 4RC9A 3QMVA 3SG0A 4DLYA 4HNTA 1R10A 4ND2A 4DLZA 2OOKA 1EAYA 1PR4A 1X94A 3MWGA 3VYWA 2VS1A 3ZCUA 2C4HA 2C9MA 3C3WA 3GJXC 2Q1XA 3RC2A 4B48A 5EJEA 1P9RA 1MXFA 2ORED 4O5OA 2XF2A 3TS1A 1PEYA 4QHTA 3RHSA 3S2EA 4B6EA 2YMLA 3DL4A 4BVGA 1GQ2A 4KAJA 4C5AA 4NCJA 2HI0A 4LXXA 5C37A 3U3OA 3I0MA 3V42A 3COZA 1T4CA 4WBSA 5THXA 1HQYE 4QBHA 1QCCA 2HHCA 2R8YA 3P9KA 3ZTWA 4BMXA 4BNYA 4UOEA 3ZWYA 5LJIA 4P0PB 1RQXA 3E58A 4HQ0A 4INAA 4C22A 1HE3A 4OATA 2Q8PA 3VR5D 4IKPA 3TQHA 3PUJA 3HXMA 2AI1A 3O4FA 2MSCB 3FDFA 1MQ9A 3F4LA 1ZIXA 4BJHB 5EJIA 4HCJA 1X6VA 2A9QA 4LCJA 3IVMA 3CNHA 5DOVA 4ARCA 2DLCX 4KIJA 3DZCA 3EWNA 2QTMA 3BFJA 1FRNA 1QVAA 4RCVA 1A82A 3CR8A 3STHA 4AG5A 2GAJA 4CEIA 4NH4A 2A2ZA 2JBHA 5DHRA 3ANSA 1BFDA 3STWA 4RW0A 1QP4A 3THYB 3VU0A 3AESB 1CJTC 1VIYA 3AVPA 1V1RA 5B57C 3JRNA 1AKTA 1SUFA 3THSA 3H9QA 1JU9A 5HIJA 3WSWA 1O6BA 3P32A 3NNSA 2Y6VA 5B58C 1QV9A 3G68A 3PUKA 1Y1QA 2GCGA 3A4NA 1QTRA 5EUQB 1T1RA 4U2EA 3EZ6A 4U6QA 1BW9A 3WO1A 4RQUA 3THWA 1X8LA 3COPA 3G5AA 4DPKA 2CLCX 2WIJA 4A8TA 3QFFA 2Z8YM 1OC4A 1MC8A 1IM5A 4NFHA 2JIZD 4EJ0A 3BXPA 5IJZA 3WL8A 5E6UB 2RKWA 5K8TA 2UXCB 5B55A 1WCWA 3I3OA 3NJRA 5G3ZA 4EP1A 2Q3EA 4M1KA 2HAEA 1NYQA 2P2SA 3OJEA 4RVUA 3A9SA 3BHIA 1EUYA 2J6BA 2PKQP 8MHTA 3PUWA 5EHQA 2YNMC 1KBZA 1JPJA 2AS0A 4Z0NA 3VPDA 2VTKA 3KWMA 4D80A 4G56A 2ZPUA 2GPYA 3AP2A 3WGKA 1L3IA 4TWRA 2NQ2C 2W58A 4MI1A 5ITWA 2NGRA 5K99A 2R7MA 4JT4A 4OIMA 1FJGB 5M04A 5EZ6B 2J87A 3S40A 5DI9A 3FKJA 2ZRPA 4JYMA 4RV5A 1SEPA 1Z5VA 4LGYA 4EMUA 1KXJA 2ZRAA 3OCXA 3I9MA 1F4VA 3UBMA 2NU8A 3MVEA 4EHFA 2GN8A 2R4UA 3K7EA 4UEWA 2H1LA 4OI1A 3WC4A 3CEMA 5DM0A 2CLMB 2AUTA 4U2KA 3OM0A 2J41A 3T1YB 3H17A 5A5VA 3PFWO 2AI3A 1M3SA 1KKLA 1KY5A 3AOEA 4HDAA 4WOKA 1V8ZA 3MJEA 1FSPA 1BKYA 2HSDA 2Y1LA 1C5KA 4JQOA 2PN1A 4KMMA 2JA1A 1KEEA 3GZNA 5CDGA 3BX1A 1E2JA 1SULA 2FK8A 4L9WA 1EK2A 2CE2X 3LV8A 3E3LA 4GS5A 2MYNA 4L9AA 4G0QA 4XQEA 2GAOA 2FQQA 1E3TA 4I14A 1WP4A 3DBHA 1XV5A 2ZRLA 3EA0A 3EUFA 4JKIA 1IONA 4DADA 1QIFA 3RHZA 1SVLA 2HKIA 5K0NA 4B33A 5HM6A 1P1FA 3BG5A 4ESHA 3DMTA 3LF2A 4TTPA 3FUVA 3SE0A 5DBEX 2YZNA 1GDTA 1T4DA 2XMBA 4G01B 4CFZA 2VRCD 2YQZA 3K8ZA 3ED1A 4IHKA 5JTUA 3TIVA 5JHGB 1GCOA 4KBYA 4WFJA 4YP7A 5G4KA 4OGFA 2Y0CA 4GLLA 2XOEA 3NHBA 3ANTA 5TT1A 4JI7B 2OKCA 1G7CA 4BNFA 4U5QA 3VYRB 5J2TB 2HSGA 1DEKA 4DLRA 1A2OA 1QHHA 1ORRA 5LU8A 1VM6A 2O52A 2BE9A 1RBYA 1IHYA 3HCFA 1XTUA 1DFGA 4P83A 4PTYA 4QUAA 1LPAB 3TB6A 2ZB4A 1I3MA 1RT9A 3FNHA 2CLSA 4QG3A 2ANCA 4ODIA 4MKIA 1IY0A 2BJVA 5TARA 1DLJA 1MH9A 1O89A 5DKFA 1IN7A 5LBUA 4KRXA 2FEOA 2FFQA 3TL6A 5LU9A 4MKZA 2YY5A 1HDZA 4BNXA 3OZWA 1UMCB 1KTIA 4B32A 3WLEA 1P39A 1X1DA 2EZUA 2P2DA 1HEYA 4XVCA 3LQRA 2AG1A 2A0YA 3EYWA 3FZNA 1X8XA 3FN4A 4YAOA 3BRSA 3CNNA 3O4HA 1D4AA 5UKDA 3VO2A 1FNBA 2KW5A 2H1RA 1W0KD 1U9YA 1ZH4A 1SG6A 4RSGA 4R7GA 4ZOLF 2WJJA 5AJXA 1OB5A 7MHTA 4ZJUA 1VE1A 2ACEA 2QZJA 3L8FA 3ZW9A 3R7SA 5F3RA 3DFIA 3T3NA 3S6JA 2VYQA 1QO0A 3ND9A 2B9EA 1RJ9B 3D81A 2K4MA 4YJGA 5TVKA 4I19A 1ZK3A 2JI4A 2E4WA 5AUOB 3UWPA 3WNCA 4YMIA 4WCVA 1BXGA 1K0UA 1L7EA 1YR9A 4V0KA 5BR7A 3Q8WA 3ILYA 2G80A 1Q3HA 2K2QB 5LZ9A 1U0EA 2PU7A 5I7SA 2BFDA 1LZLA 1LY1A 1V96A 3KPWA 2C4WA 2R1TB 3NWOA 3WAGA 3H97A 1NVVR 3UY4A 1D2RA 1KOGA 3O26A 2JZCA 5HF6A 4QO8A 4RMGA 1UIMA 3SS8A 3A8TA 1OFUX 4BVLA 5HZKA 1J20A 1XTBA 4JUCA 4YRQA 3VOTA 3ADBA 4MWOA 4TS3A 2VP2A 5DWDA 3N5KA 3GXBA 3LBYA 1IXYA 3JY6A 3RC1A 5TXGA 3RSLA 3WWYA 4BN5A 4I50B 5AJZA 5KYGA 2QVBA 2N0SA 2XDQB 4B82A 4YV2A 2HY7A 3VH3A 3H2SA 4XWTA 1US8A 3BMQB 3RS4A 2OQ2A 4AAYA 1YZLA 4JC0A 5BSKA 1B8UA 1RMQA 4ZD6A 4WXRA 2G8NA 2BEKA 2QUHA 2IX3A 2GJ9A 3G9QA 1L1EA 3KLOA 4KXNA 2WUVA 1ZMRA 1N77A 3EFEA 1C1HA 1OXXK 3HC7A 4LECA 1QVWA 4FN5A 3EPJA 1XAHA 2Q6OA 1YVRA 3K1JA 4RKQA 3F97A 3JD1A 4DBLE 5GWXA 1CS0B 2ENUA 4RTRA 1Y1PA 4X41A 3AYXB 4IKOA 4U3JA 1WETA 4X24A 1Y48E 3EGXB 5IHPA 3MHTA 2NPOA 2PX5A 4AWBA 4I9UA 2ODPA 3H6GA 4KAFA 4DIBA 4AP5A 3GRUA 4FGUA 2PZAA 1XZHA 5JXGA 3IRUA 5TS2A 2FJUA 1K3TA 2X0NA 2G28A 2G17A 3FCSB 3KXPA 2JI9A 3LQ1A 2SNIE 1QO9A 2ACKA 2NAPA 1NOJA 3R20A 4I36A 1VSVA 1M2WA 4BFCA 4QJIA 1F9EA 4TL6A 2P9EA 1THZA 2X6QA 3DTYA 3RAPR 4BUCA 3NVMB 5AWFC 3X3HA 1A8PA 4YAEA 1WQ3A 1W30A 3GFGA 2XUOA 2F3TA 4R40A 2V65A 1ZINA 2WMYA 3DE1X 1VKHA 3F1LA 4TKZA 2ZWAA 3VV2A 3DO6A 3D02A 3L0YA 3MC1A 4D7AA 2ZUTA 5KTKA 1RQ7A 3H2BA 1Y6JA 1WS6A 3M4XA 3HR7A 2RJOA 4GBMA 2I6QA 2IEIA 5J4VA 3NIDB 1ZGHA 3MXOA 2EBFX 4XX0B 3TW4A 4F72A 4N41A 2CKDA 4URWR 2O50A 2ZJ5A 5KYYA 5BRAA 4FFSA 4KMOA 1ZD5A 1YJ5A 3D5TA 5JQGB 3U3XA 1UMBA 3ER9A 1MPXA 3D6HA 2B37A 5GONB 5L8VA 1N2BA 4US1R 3R09A 2H29A 2CNLA 4G8JA 4DPMA 2C5FA 5DTQA 1QKKA 5TSDA 2B83A 1U0GA 1ZVVA 2QX6A 1EDOA 1TO2E 3PQ8A 4GRAA 1Z15A 2V1UA 5KQMA 1WHTA 2I34A 4PHHA 3SHVA 2H1OA 4Y1RB 2ZDHA 2HCJB 4WSOA 1C1XA 3AJEA 5REQA 3U6BA 4HDKB 1E6CA 1FFWA 4CMIB 1TXGA 1UM9A 4IDBA 4PIVA 4WKBA 2EIXA 3JQGB 1RXIA 3BRWA 4Q21A 2V6FA 1E1RA 4NS1A 3HR4A 2WVAA 2DPYA 3I45A 1BOFA 3L8YA 1G291 3PVZA 5EA2A 1E7WA 1RPNA 1AK2A 4HLUA 3QX9A 4QFBA 4JA0A 5E2IA 3W7VA 5KDOA 5CLIA 1USGA 4F5EA 4J2TA 4P4SB 2JLAA 2Z2YA 1QFXA 4LGMA 2GXUA 2PCJA 3L8GA 4RCYA 3K16A 4EFMA 2RI6A 1N2GA 4F1KA 1OTYA 2XKAA 2C9CA 1Y5IA 2F1HA 3M7IA 1GGVA 1PP4A 1FYXA 5FYDA 1XOIA 2JVJA 2OR3A 2P67A 4CM9D 2VZEA 2BFCB 4IIGA 1GZ3A 3OJXA 5AOBA 3IMGA 2PH7A 1OU4A 3TUIC 3L0OA 3RSGA 2BMAA 1Z06A 3HCWA 2HTEA 3UT0A 1NW5A 5HPYB 2P1RA 1QJCA 4WADA 5HFNA 3EFHA 1T6XA 1HQKA 3LW7A 1MKYA 2W6PA 3BFVA 2DECA 3RTDA 4AZSA 2RHDA 4DDUA 4RORA 4IHJF 4GPTA 2G1UA 3R7NA 1DIBA 5B36A 2QD1A 1P9WA 2EGHA 5KMGA 5J59A 3DDZX 5JAZA 2V7UA 2AJCA 3TCNA 4RZUA 1L7RA 1YNSA 2O8FB 4H0NA 3RS7A 2PUAA 3ZV3A 1FBTA 5MN5A 5F1PA 4MUGA 5E9WA 5LD2B 1NPDA 3TMYA 4LYAA 4D92A 3K30A 2AOXA 3QI2A 1GGEA 4RQTA 5IC6A 1J97A 3HR8A 1M6WA 4NENB 3OLYA 3AHCA 3OKCA 3TE6A 1THTA 4DXAA 4CNQA 5KYKA 2J8ZA 4AJLA 3QELB 4TLMB 3PK0A 3W2IA 5PNTA 2ZBEA 4IOJA 3U0BA 3SJUA 2I8LA 4K28A 4BIIA 4EF6A 5KJ6A 2O2JA 2HA5A 1YS7A 4M46A 4Y1EA 3H11A 4ASUD 4TZKA 1GFWA 3C4JA 2Q6IA 4HDNA 5EJAA 5F76A 4G4JA 4E4TA 3I5XA 2GCNA 3EDRA 1ISSA 2VDVE 4PIPA 4W5HA 1IBSA 4YYZA 4W5TA 4QEZA 5FHRA 1RRGA 2GK3A 2NT4A 4EGSA 4Q3OA 1ZK2A 2R7NA 3NO4A 2W2TA 4LXTA 2HSEA 2JKVA 3K4QA 4R8LA 2VK1A 2I9PA 4J7AA 1OBFO 3TQIA 1QQ6A 3CH4B 3A1WA 3HE3A 4JSTA 4UHDA 1KDVA 3HEAA 2OV3A 3S2YA 3VR3A 2JS7A 4UMDA 1NVMB 3OOJA 3ZGNA 2EW8A 1L5HB 2HV8A 2POQX 3D0OA 4JKYA 4RKRA 1WD5A 4WK0B 2JASA 1ZD9A 5J4YA 3LOQA 4LF7B 1Z5NA 5JRZA 2KQUA 3VAYA 3MMXA 4FBLA 1NIJA 4D4JA 3OFSA 4DKXA 4OMUA 4I1YA 4C4YA 4L2IA 1KH1A 1J9ZA 3G79A 1IMJA 2XE6A 2V7EA 4R9VA 3S55A 2WUGA 1PLLA 1G3IA 2PKEA 3E3NA 2QUIA 5I7EA 2XUGA 2QTBA 4WE3A 1D7AA 1M33A 3ZY4A 2CCGA 3NFYA 2JBWA 3OJWA 4BU0A 2A9VA 4BMYA 3C98A 1I4LD 4UTZA 1YS6A 3IP7A 3SMVA 3NBXX 4D8XA 2XYQA 4DSUA 2GYUA 2ZRFA 1O9BA 3RVDA 3URMA 2IYVA 4JP3A 4MV4A 3BGVA 1AGNA 4YRMA 1SM4A 5K4AA 3H3XA 2PYDA 3FTDA 2PCLA 2JD1A 2FNAA 4Q9IA 1FUUA 3RC9A 2F1JA 1W4LA 3PHLA 1ZCAA 2HN9A 4UBIA 3UV3A 2FSVA 2W6MA 1VYVA 3H83A 2OO7A 4MB0A 2ISCA 1RAAA 3HDQA 1ZRSA 3RWMB 3QEAZ 1WDTA 5KSWB 4JBGA 3U48A 4JGIA 2H4ZA 4GD3Q 4M7RA 3NIWA 1FYFA 4G1BA 4M8LA 2VYCA 5CUQA 1JU3A 4WXHA 4DRXA 1HZZA 4DSAA 4RETA 1L7DA 5K6AA 1T2DA 1X2EA 2VCHA 5IWAB 4B46A 4PGFA 3EPHA 5IT0A 1BU5A 1F4PA 2X5NA 1JG4A 3N86A 2QT9A 4OOEA 3TRHA 2PSDA 3DCJA 1T2UA 3ZDZB 4DLKA 2PMFA 5DTRA 1DFIA 2VSQA 5LMNB 1Z45A 1W4BA 4WCFC 3RYFB 4PZ0A 1GA6A 1M1NB 3JWIA 4MI3A 1EFRD 3B6MA 3V55A 3VPSA 3ZIUA 2GFIA 4MWGA 4EOGA 2AFHB 5MN6A 3IKTA 2ZJYA 4ZCLA 3ZWWA 3TPCA 2QRHA 4QHYA 4JROA 1DQYA 5LL6P 4HP8A 3N8HA 5ADHA 1V8FA 1N8KA 3EEBA 3ISTA 4O1HA 1XDGA 1CW2B 3QE9Y 4IXWA 4M9RA 3D4OA 1T34A 4M9CA 1EZ4A 3AIKA 4KYVA 5EP1A 2I7TA 2QRJA 4GSYA 1M1XB 1WXXA 2PD3A 3L9WA 3T5AA 1KGDA 1F1BA 4HVAA 1W581 1NU8A 1VP3A 4MROA 4A73A 4DLVA 1BN6A 1I7NA 3B7PA 4CQMA 4HGQA 1VHQA 1U0TA 4AS3A 3JQBC 4OJQA 5LA6B 1SQGA 3KSBC 1MC5A 2IXDA 3AK4A 3JAWB 1V3TA 1OLSA 1T0IA 1IZ8A 1W4RA 2AYZA 3CKKA 3IVCA 5FOVA 4NFSA 4CN8A 4ND3A 5I48A 4KCGA 2ZRBA