5JRDS

E. coli hydrogenase-1 variant p508a
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
264
structure length
264
Chain Sequence
b'KPRIPVVWIHGLECTCCTESFIRSAHPLAKDVILSLISLDYDDTLMAAAGTQAEEVFEDIITQYNGKYILAVEGNPPLGEQGMFCISSGRPFIEKLKRAAAGASAIIAWGTCASWGCVQAARPNPTQATPIDKVITDKPIIKVPGCPPIPDVMSAIITYMVTFDRLPDVDRMGRPLMFYGQRIHDKCYRRAHFDAGEFVQSWDDDAARKGYCLYKMGCKGPTTYNACSSTRWNDGVSFPIQSGHGCLGCAENGFWDRGSFYSRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrogenase-1 small chain
publication title Importance of the Active Site "Canopy" Residues in an O2-Tolerant [NiFe]-Hydrogenase.
pubmed doi rcsb
source organism Escherichia coli o6:h1 (strain cft073 / atcc 700928 / upec)
molecule tags Oxidoreductase
total genus 78
structure length 264
sequence length 264
chains with identical sequence T
ec nomenclature ec 1.12.99.6: Hydrogenase (acceptor).
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
S PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 5jrdS01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 5jrdS02
1UBJS 4UEWA 4UQLA 1UBLS 4KO2S 4KO4S 3USES 3MYRA 2WPNA 1H2RS 2FRVA 5A4MS 3CURA 4KO1S 3RGWS 1UBRS 5JT1A 4IUCS 3ZEAA 4KL8S 4C3OB 4UD2A 4UPVA 1CC1S 1WULS 1WUKS 4IUDS 1E3DA 4UCWA 3ZE8A 4UCQA 4UEQA 4CI0B 1WUIS 4OMFG 3USCS 4UE2A 4URHA 4GD3Q 1UBOS 4U9HS 5ADUS 3H3XA 1YQWA 1UBKS 5JSHA 5A4FS 4UCXA 4UD6A 4UQPA 1FRVA 4KO3S 1UBMS 3ZE9A 1H2AS 1UBTS 3AYXB 1WUHS 3ZE7A 5JSUA 5A4IS 5JSYA 3ZE6A 4IUBS 3CUSA 5JRDS 5JSKA 1UBUS 3UQYS 4UE6A 4UE3S 1UBHS 5D51S 4U9IS 4KN9S 3AYZB 4TTTS 1FRFS 4UPEA 1YRQA 1WUJS 1YQ9A
chains in the Genus database with same CATH superfamily
2RJNA 1LPPA 1JECA 1H94A 2CVFA 2PWAA 2OCXA 4WIAA 3K1ZA 1XMOB 1T9HA 3GN1A 3Q3VA 3K2BA 3LDHA 4LYGA 1U4NA 2GOYA 1R00A 5C80A 4Q02A 1FSSA 5AW0A 3GMIA 3NETA 3B1FA 5TF4A 1Q7EA 2A0UA 3MVEA 4GXNA 4TVSA 4LF6B 3LW8A 1EP9A 4FXOA 4Q12A 1IU9A 3SCZA 2HNAA 1KK3A 4ZT5A 2C5LA 1WCV1 4JUFA 1JQAA 4P54A 4X1OA 4R2XA 4PAMA 2QRZA 4E5PA 2QLBA 4ZOLF 2Y6UA 3TSOA 1E6LA 2VNAA 3H84A 3LXUX 2NSYA 2QRQA 1Y4UA 1QHSA 1UWCA 4MV8A 1B14A 3WL7A 5B1SA 1KARA 4PLVA 3T5TA 4EHJA 4K0KB 2Q99A 4WZAB 1P2UA 1IDN1 4P9NA 5SZJA 4FHCA 4HZGA 1V7CA 4YR7A 4IR7A 1JXOA 2Z4SA 3HGQA 2CZGA 1WCXA 3IPAA 2ZQZA 1RRGA 5AVJA 5F5LA 5BMVF 2P65A 1KY4A 4OQMA 1I2BA 5HZMA 2VHUA 2JAHA 4PCAA 4PYNA 3QFSA 3EIQA 4MLPA 2JLYA 2HA0A 4B0PA 2WHPA 5AHOA 2AYYA 4CM8B 1FP2A 2YC2C 5G1PA 3C43A 4CL3A 1ATZA 2CYAA 3G79A 3EW9A 2EBUA 2W58A 4UE2A 4A36A 1Z47A 1TKCA 2W90A 4N40A 4TKVB 2V7UA 5C3MA 1IZ9A 2NU9A 2GJSA 4EG1A 5HSGA 2H3EA 3Q3GE 1Q0TA 3DMRA 3HEAA 4EFNA 1BROA 5IKXA 5GZ6A 2MTBA 3QV1A 5THXA 3CONA 2HRDA 4TS3A 1ENYA 3WIBA 1C1XB 1FS6A 3RFVA 2CXHA 2YYAA 1AQUA 3U1TA 2CUZA 1C3JA 2GNAA 4PANA 3VA7A 3HV2A 3REOA 3EDRA 5KYKA 1HYQA 3B8HA 4PO3X 2WM3A 1CVIA 3RNOA 1WNFA 1Y9JA 2J0UB 3LPDA 4XWKA 1SZDA 5ITZB 2YUIA 2Z6VA 3HB5X 3IQFA 5HQTA 4N5LA 2V9CA 2PX2A 1E59A 1JAZA 1ZCAA 1SXJE 2OEPA 5IP5A 1E1QD 3KJEA 3U3XA 1PQWA 4M9UA 8GPBA 1KO1A 1PVDA 1KSJA 3F90A 3PUWA 3QBVA 5DBOA 1MRNA 1X7ZB 1NW6A 3JZIA 2EIXA 2AJLI 1ORRA 3A6JA 3ANSA 4Q4HB 5FOQA 3B1KA 2F8TA 3VR1A 2QSJA 5FQNA 1C1DB 3PJEA 2H4ZA 1LEHA 2BFCB 2DHQA 5JSYA 4OA8A 2H5JA 3DO8A 4CL8A 2FSUA 4JUIA 1Z5GA 4OHPA 4REMA 1LW6E 1RI2A 2PYIA 1BNCA 5JRDS 2CLDX 1N1GA 1YRAA 3JYQA 3G68A 2NU7B 2ZIEA 3E48A 5AH0A 1M7HA 4B3DA 2VUTA 1AQLA 3HNPA 3X43A 3W9UA 1E5LA 4URYR 2XTZA 2Z5GA 2I3BA 2MYNA 3C3EA 2D5BA 3TLJA 1QC5B 3VYVA 4D0NA 4PF1A 4V38A 3IUNA 2BHTA 4XOUA 4LG1A 5JCOC 1AKVA 4N82A 3VPXA 1CX9B 3JWIA 3GG2A 3MK31 3GGSA 5DULA 2P6OA 1JDVA 1RXEA 4L0MA 3TM5A 3RUIA 2ZE5A 3OCYA 3AR6A 3OZCA 1GUZA 5DYIA 1JQJC 5HZHA 3PEWA 1M6VB 3FZNA 3HBMA 3GFGA 3KV1A 2OV4A 4QHSA 4KOEC 5IHXA 4P22A 2FR8A 4FFPA 2Z98A 1G1MA 2JLUA 3E22B 2MU1A 1E1KA 1MVOA 3D0RA 3P2OA 4C4RA 1NY5A 4N03A 1OXVA 4HNRA 2JCGA 1NMQA 4QUHA 1IONA 4XLLA 2ISQA 3STWA 4C5CA 2VTDA 4DDMA 1ONSA 2H0RA 2B0JA 4ZQHA 3U56A 1HG1A 2DP4E 4C0JA 1CEQA 4MI6A 1EP2B 2A7QA 5DK4A 2J6IA 4S1NA 4O2AB 3K15A 3WLOA 4R68A 5KSWB 4J2HA 3WQHA 1Y8ZA 4IZHA 2AEMA 1D8TA 4ANFA 5C4MA 4BB5A 3OIWA 4AS2A 2PSFA 1U4OA 3QFTA 2P4EA 4UD2A 4DV1B 2MYUA 2YNMD 3FJOA 4FFBB 3UWSA 1DRUA 4IG4A 2IEGA 3J7TA 4B17A 5JASA 4YK7A 3ZW7A 1LZKA 2XXAA 2C88A 5B1IA 1KORA 5L95A 2FUG1 1XZQA 3D2AA 4E0BA 1CNMA 1GAXA 4OJYA 4II7A 2AIRA 4MWDA 1XFDA 2GN1A 2JLCA 4M49A 1VL1A 3CLSC 2Q3CA 2OMEA 1J5PA 4X95A 4ZU6X 2AMJA 1P2DA 2E4XA 1A50B 1HTTA 4RZSA 4OI1A 1X7XA 1IJFA 4Q18A 3TRDA 3MTGA 4XUEA 2O9JA 2CV0A 4ND8A 5AT1A 4AUEA 1O1YA 1NYRA 3PA8A 5DP2A 4B6SA 4YAGA 4FFDA 2GM5A 1T25A 2Y92A 1XTBA 4WA8A 1GGJA 2H1CA 2I4IA 2OCAA 2XUIA 3HPRA 3LSTA 4RJJA 4F9EA 5FEUA 2EKZA 2EWWA 2WA2A 2GEBA 1K8RA 1UDCA 3QNWA 5U1PA 1IIBA 3OJEA 3IEKA 1TADA 1DTWA 3AVQA 3ZW8A 3HLYA 4KSYA 1NJ5A 1JHQA 3HJUA 1OJLA 2XGSA 1CBUA 3HU3A 2NZ2A 1DAEA 1P19A 2ZB7A 5EHZA 1J07A 3EIEA 3CNEA 1G42A 5EE9A 5IVDA 2P35A 4U7DA 5JJIA 3OPNA 4K9SA 1A9OA 2ONJA 1IXRC 4DPKA 1DWQA 4DNFA 3BC1A 2I1WA 3DLAA 5AVSA 3TX6A 3BRCA 1MX1A 3I8XA 2ZP1A 3BD6A 3O8DA 1EAMA 4BQEA 4JDUA 3LP5A 3ETGA 1Z56C 2BRUA 3IC5A 5E6RB 1NTOA 2OTCA 4ZVMA 4I1SA 2ICAA 1YBVA 4XEUA 1OX5A 4ZQFA 3ESCA 2AQKA 2W6CX 3EIHA 1H2XA 2N47A 3UJ3X 2IH5A 1XRSB 2O2SA 4QTZA 2OD7A 2ZXEA 5AVKA 4ENTA 5DF1A 2IV7A 3PQ6A 3GI1A 1N8SA 4M1TA 4MS3A 4ZI7A 5L3RA 4HN2A 3RS7A 3ILVA 2J4DA 4G4IA 5JMOA 2IEYA 2UVPB 3KQTA 2CY0A 2QUHA 1ZX1A 4B1FA 3MINB 4GSKA 4OB7A 4DKJA 2B99A 3O1HB 2EFJA 2YIMA 2Q4DA 3OQ6A 1JEOA 3O2QB 3E8XA 3QVUA 1MRSA 4QOFA 2W43A 4BRUA 4ZK6A 1MNAA 4YT8A 1N5DA 2FFRA 3JQ7B 1FBNA 3WRXC 1UDAA 2ODBA 4IKPA 3SDZA 4BO2A 3E5HA 2HK6A 2GN0A 1VJ0A 1ENOA 2NZYA 4G86A 5SV2A 3OIGA 4ZAVA 3LOUA 3PWSA 1NI4B 3ILSA 3HRHA 2BJHA 4IHKA 4NE7A 5DYYA 1PQYA 3EFBA 5EUCA 1Q1AA 2GAIA 2ZRAA 5C31A 4EFLA 4M8IA 1EGMB 5BQ5A 4JT8A 1FNBA 2BFMA 1MPXA 3BRWA 4NBVA 1KPIA 2W98A 5CPBA 3SF8A 3C8DA 3QKWA 3FWZA 3LLSA 2WD7B 1EX6A 3G82C 1PNOA 3IR5A 2ZSJA 4X1YA 2ADFA 4QUBA 2MCFA 3O03A 4UU8A 3EZXA 3EF3A 5G0SA 1TEHA 2PBFA 2H48A 4O3FA 1TRHA 3V2HA 3V4LA 5LQKA 1N7IA 1SIOA 3O1JC 4LNHA 4R9NA 3W7VA 2R8ZA 2HRZA 3G2NA 3F2IA 4WHMA 2W2XA 3FYCA 1ZLXA 4PRZA 4EPXA 2ZKLA 5M04A 1JTFA 2M6SA 2GERA 4CKWB 4PBRA 1QYVA 3T4PA 1ACLA 3RS0A 2P7IA 1Z4NA 3O95A 1AUVA 2IIVA 3O31A 5JLAA 3SEAA 4KX3A 3ZXUB 4BKUA 1OFHA 2BGMA 4ASUD 4PLFA 2VP9A 1G4AE 1A5AB 5HFNA 3BD8A 3NWPA 4CM6A 4ZJYA 5KVCA 1M34A 3HO8A 4H0CA 4QXMA 4CI0B 1T6YA 1E89A 4EFKA 3L6OO 1AUOA 3R8FA 4CMIA 3EZLA 2FWMX 1KDZA 3R8CA 2Q5CA 4QUJA 2XVAA 1LC0A 3A4IA 3R1IA 4NEQA 4OD0A 4XB6B 1PVOA 3DHEA 3LUBA 4G85A 5AVOA 3ROPA 2FMTA 1KDYA 5CLHA 2VR1A 2PT9A 4NE2A 1ZN9A 4EUHA 2C94A 4A0HA 4K40A 4DWJA 4Q66C 1L8LA 3TNYA 3E3MA 5BOSB 4RZXA 3PTLA 4XQEA 2NM0A 5HJ7A 5EMKA 3TDKA 1AMOA 1QV6A 3ELUA 2PZ8A 3D4IA 3R5XA 2ZANA 5T6BA 1KDVA 3KJNA 2GK7A 4RHUA 3ONDA 4GOXA 3UG6A 3JARA 1X7HA 3HU5A 2W37A 5T5QA 5BYKA 4BRSA 1EYZA 3VPGA 4CNBA 4YCCA 1A9XB 3IEPA 4CM9D 3L9XA 3M8KA 4JB3A 4QPZA 4MQMA 2KX7A 5EUMA 1A7JA 1TJYA 2BISA 2CNWD 3BSSA 5E6SA 5IDQA 5KSYA 5KS2A 4MV1A 4F4DA 2H59A 3BJMA 3HKBA 5T8KA 5KB3A 3SZUA 1Z62A 1N77A 1RXYA 2HSGA 4WCFC 3RTBA 1Z4OA 3D8BA 3ZOZA 1AKEA 1T9ZA 1TZ2A 3I3OA 4AF8A 4CIDA 3AM5A 3JALA 4HLUC 1Z3CA 4CETA 2FVXA 4FYJA 4PHTA 1H5UA 4W9MC 4Y2VA 1YH3A 3HRIA 3FVRA 2JZNA 4IQ8A 2P6PA 2YIVX 1DX6A 3FTNA 3HP7A 1XKTA 4WW0A 5JMPA 3RVRA 4JI8B 2O3QA 4CE6A 3G88A 4Q24A 3UWPA 4DRZA 5TIIA 4DCGA 4ER5A 5IAEA 4KKVA 1R9NA 4EKGA 3T12A 1DEOA 1GZ4A 2IU3A 3MB5A 1R4MB 5BV7A 2XE7A 3MFYA 4CR7A 2RAUA 4FI3F 3EQ2A 2WF7A 5K99A 3LHDA 1E98A 2XNDD 1UWVA 4GQIA 3BIJA 2XZDA 2FK8A 4YJ3A 3SQOA 3VNSA 4TQUS 3D5EA 1AHPA 1N2EA 5ALHA 4Z3OA 4YMSA 2FVYA 1DCMA 2O8FA 3MLBA 2WPDA 1H0KA 3D6TB 3UICA 2D1RA 1W87A 3AJ9A 1YIAA 4L6AA 4D0LB 4DV7B 2E37A 5DCYA 1OAKA 4EMBA 1PUJA 1RHQA 3KG2A 3CWCA 3R0IA 3TXYA 4CKCB 1TM7E 1PZFA 2R1TA 1YE8A 3ZJYA 3H5OA 5K8IA 1G3MA 2FPSA 4HK4A 3D8NA 3HVHA 4FDLA 2GUWA 2ZSHA 2ZYSA 5AUOB 4MUKA 1LJLA 1TYAE 4R41A 3KQKA 1I30A 1Z4JA 2GBGA 3TKYA 5CP8A 4PFSA 1NG9A 3S3TA 3D02A 2X5JO 1ZEMA 3HCOA 1K7EB 1YQQA 2IEAA 2OUKA 2YINC 3JQGB 2GZ2A 3MGGA 3DZKA 1GCIA 4GXQA 1LTKA 4KXQA 2R6FA 2COEA 2AX3A 2Q4EA 3VHXB 1O57A 1ZK3A 3AIIA 4RJKA 4CM4B 4CUJA 4E21A 5L8VA 3CM0A 2FUEA 5TQJA 5CRIA 5FOXA 3EGCA 1U2ZA 3S8YA 3H5IA 5B37A 2VT3A 4TLCA 1QFXA 3SNHA 4DHWA 1IUPA 3C5HA 4IDFA 3FWYA 5T64A 1H42A 2RGAA 5TMPA 1FJGB 221PA 3A58B 2YDXA 3KT8A 5DO9A 3S6JA 4LE1A 5KJ6A 2EJBA 4HGYA 1BXRB 3QYJA 4MMXB 5EGNA 3M4NA 4OQZA 1F60A 5DM60 3E2MA 1WRBA 1W4AA 4M53A 4A03A 3HO1A 1J8YF 1E6UA 1E79A 3GZ4A 1SKQA 3SEQA 4NHEA 4OXRA 3MA0A 3VZDA 3W9SA 2ZBRA 4FFLA 1N1DA 2I3GA 1R5BA 1ZBQA 4F46A 1XD2B 2IHYA 3AHGA 2Y1FA 1HDZA 1UC5B 1L4UA 5DEOA 3AUYA 3EXAA 4B4KA 1YTUA 1IEWA 3M9LA 2I2XB 3MMSA 5BN4B 1OZHA 1W5TA 4F56A 5M2QA 5HRCA 1Y8QB 1V0JA 2VPYA 3HVJA 1ID1A 3OFJA 4HDAA 4J7CA 1ZM3A 4Q7JB 4CCAA 5EJ9A 4M6WA 4UUAA 5LCXA 3JRXA 4CRWB 2VP0A 3MJSA 1XMXA 1ODFA 2GEDA 1VFPA 1R0XA 2W22A 4QUKA 5IDYA 2WF5A 1JFFB 5F7XA 2ZITA 1FDSA 2Y2UA 2ZOSA 2GZAA 1QVAA 3OPMA 4UBOA 4EW1A 1Z63A 1VMIA 5CITA 1SHKA 1EQAA 3ICQB 2AWNA 4B40A 1N2SA 3ADDA 1SXJB 3PHIA 3HCRA 3PRJA 4D96A 3W5BA 3SQWA 1QOQB 3TR0A 2QT9A 1LLUA 4B9EA 1LNSA 3BFPA 1BX1A 5JVDF 3KKNA 3ZDDA 3MTDA 5F2OA 1BFKA 3EVCA 5KSZA 3QNMA 3DW3X 1CUAA 4RVGA 1TZMA 4RANA 2X0EA 2A9FA 1A9YA 4MUEA 1ZH8A 4WNIA 1X6VA 4OSPA 1YR8A 2BPOA 3NKVA 5JC8A 3GUYA 4LC9A 3W6OA 5CVJA 4OX9B 4BLTA 2WINI 4IEIA 5JD5A 2G08A 4HAOA 2XJ9A 3NM5A 3WWDA 1AH2A 4RPKA 3EUAA 1E9AA 1H5QA 2XIJA 3HGMA 3H6KA 1OE0A 3MSCA 2L2QA 1UEXC 2GZHA 5DSTA 3P4UA 1D0IA 3LBAA 3PPXA 4WPGA 4WKNA 4ZQCB 1MC4A 1KAOA 3RVLA 4C01A 4EHDA 5CFZA 1RZRA 3GQBB 1N0IA 1VL2A 1WG8A 5K0FA 1VSBA 2YWBA 1HDYA 3HN7A 4MQEB 2J1LA 3TOVA 3TMYA 3T7EA 4F4JA 3KOOA 1ZJ5A 1J0CA 1U04A 4RHTA 4ZODA 2OPBA 5F5XA 1FU4A 2FN3A 3RC3A 3UOWA 1T5IA 3ZKAA 4EF6A 2G67A 3PNVA 4RH3A 4BOYA 2ZXFA 4JVSB 1YF3A 4R5HA 1K5DA 3QMMA 1DQNA 2FWJA 4BKMA 1GD1O 4PN7A 3T5AA 4LCEA 4QRHA 2W2VA 4I1YA 4EP1A 1JEAA 3HMKA 4IHJF 3Q98A 16PKA 5FOSA 3ABSB 2OZKA 4RMIA 1O5OA 5IT0A 1ODSA 1P33A 4Q00A 1VBKA 2JPDA 5A1TA 4J49A 3GUVA 2W6MA 4TKLA 4CM3A 3HJGA 3CVUA 3V4RA 4ZHQB 3FXAA 1NF2A 3WK6A 1YDHA 1WVMA 1PYGA 1OZGA 3EAFA 3GUZA 3K0AA 3MB8A 2RGNA 3LYAA 1M3SA 1L5NA 3KTFA 4GRDA 3EA5A 3R6LA 1KPGA 4X61A 1ACJA 2ORED 2EX1A 4BNDB 3QEMB 5C7OO 1IXZA 2B78A 2X6RA 4FYHA 1G63A 4DCUA 1S7GA 3C6ZA 1CP3A 3VVMA 1EDOA 1H6AA 1GPBA 3LY7A 3OICA 3RUEA 3AY0A 1LS1A 3ZVRA 4XXHA 3V8PA 2Z56A 3FDZB 3KPWA 3VU3A 2E0IA 4HPXB 4OJMX 3IAS1 2EGHA 1XKLA 4QECA 4TRMA 4ESHA 3DBRA 4UM9B 1DEXA 2WTAA 3F6RA 4CL2A 5JAPA 3BKWA 3LSYA 4PPYA 5LP6F 1JIUA 1U7HA 2NQTA 1UBOS 3LUDA 4LSMA 4MIYA 4RPHA 2PMKA 3QFRA 2Q7DA 1G18A 4R9VA 5TR9A 3RT1A 3SFVA 3I62A 2JHFA 5HOQA 3JQ8B 1FFEA 1DE0A 1JZSA 1LLDA 1X86B 2D4AA 4OHFA 4OUDA 3UG7A 5FBVB 1HFJA 1XCPA 3I2IA 3EQ7A 1ECCA 2CUTA 5CJPA 2VWGA 3FMGA 1C9JA 1AZTA 2GUGA 2XDQA 5UKDA 1GQYA 5J47A 1UEIA 3I45A 1WU7A 3JAWB 1N34B 4R0VA 5TPWA 3Q10A 1Z82A 3CW8X 3EASA 5FIUA 2WJJA 1ZKMA 1JMVA 4W1SA 4OHRA 1OXUA 1SUAA 4NBUA 3RYHB 2XUZA 4R1PA 9GPBA 1SQFA 4QSMA 3R0XA 1OX4A 3ZV3A 1YI8A 3G1WA 3JCZA 1YIOA 1PRYA 1YWGO 1XG5A 1Z29A 2YJZA 3ZE0B 4X6YA 3WWEA 3DHNA 2HJHA 4EYQA 1U8AA 3GCXA 2QDXA 2ZZMA 4CLOA 3HXPA 1F2TB 4RK5A 2W00A 1JILA 1S2OA 2QMUA 4HMPA 3PNQA 3TI9A 3Q8LA 5K8VA 5ADVA 3THYB 3K32A 3R4CA 2EWMA 2VP4A 3D8HA 4HLNA 2W6NA 4X3PA 1KEVA 4D8WA 5ENVA 2NIPA 3ZXYA 2RKWA 4XX1A 3BE6A 4TWAA 4AF6A 2K2WA 3UCXA 1JEJA 1JHXA 1FFDA 3PQFA 1F20A 4HDNA 5HEKA 3WAKA 5HZGA 4CTOA 3H4TA 4GM4A 4EG7A 2OZPA 4DN6A 2I3AA 3AETA 1VI6A 3DCNA 4TYWA 1DKLA 2DUJA 4X3CA 1CW2B 1HK7A 2AXEA 3W6UA 5KYXA 2C3OA 4HKTA 1J8FA 5C1OA 3MQFA 4WNYA 3KQUA 2E4ZA 4MPDA 1N5IA 1DEKA 1F48A 5LU9A 3DO5A 2Z43A 2P2DA 1KE1A 1TYZA 1NR7A 3B1WA 3LUHA 1VKRA 1F17A 2NZJA 4ZFNA 5ITWA 4BBJA 3F6YA 1BQ3A 1JJIA 4DIEA 1FRZA 1KAMA 1YZVA 2CMKA 2ZT8A 1DHRA 4M9SA 2KM1A 1XZLA 3RC1A 2R751 1WMFA 2F2TA 2QT1A 2VNIA 3F5DA 3L07A 4YUAA 3JVIA 1GARA 1YVUA 4BMSA 1OW3B 2WYWA 3NHAA 3A7DA 2BW0A 1PE0A 3IP8A 3PGMA 1CUXA 1R5JA 3E35A 1E7RA 4OM7A 4TXMA 5FUQA 4P0PB 4TT3A 1J9GA 4HC4A 1ZGZA 2VJKA 3TD2A 4U2DA 5JFTA 1U6JA 2QRHA 2VPIA 2R3SA 1KYQA 5GAJA 4GX0A 5EAIA 4E4RA 4B4UA 5DI3A 2A35A 2QTTA 3IR6A 2NZ8A 2O14A 1D04A 1G8KA 3L6EA 3QK7A 4JFRA 5TJ9A 4ABTA 2MJLA 2FG6C 1V5GA 2ZJ8A 2Q2NA 3SBXA 3V1TC 4B7ZA 3MTQA 4CDNA 2GZDA 4UTNA 1U5AA 4QYTA 3AEUA 5AI5A 2ZETA 4GT1A 3UWOA 3I9KA 1PLKA 1G5HA 1ZYUA 2XVXA 4LJSA 1PJ3A 3CZMA 1Z6TA 4UEQA 1XPUA 1DCFA 1N3BA 1U0TA 1E6KA 3TXAA 3QXGA 5CNMA 2R96A 3EMKA 3PI7A 1DXOA 5A4JA 5B6PA 1Z0SA 4I99A 5ALWA 2QOEA 3IBCA 2G76A 3QLEA 4MGYR 4PG7A 2JFQA 2PGOA 4IH4A 5TV2A 3BS4A 3PXCX 3WLRA 1G8SA 2Y9MB 2BKUA 5EPOA 1XJ5A 2XVYA 3AEKA 3CRW1 5FTWA 1JIQA 4LZJA 3EAQA 5A7HA 4BFLA 1CZHA 1Q57A 4LE2A 3GLHE 4QGHA 3NP9A 3VISA 4GE0A 5EYPA 1N9GA 1XKQA 5A6VA 1AMNA 4BNYA 4XTCS 5IAKA 2WIGA 5EWLB 2CBGA 4K0RA 3UT5A 3UHJA 1MHTA 2O0JA 3ZS8A 1M2VA 4W7IA 2RKOA 2X41A 4Q34A 4RDIA 2YHIA 3T99A 4DMRA 1B7GO 3VBEA 5BNWA 1QJCA 3ZBTA 2UZ4A 2FQXA 2RGCA 4KSBA 1WUHS 1XRNA 1EGAA 4X1KB 5I7UA 1NG1A 3HXKA 4KLAA 1UJMA 3K9FC 4OJQA 3E9ZA 2C84A 2OCBA 3OHSX 2YHUA 4MQUA 3KDSE 3TRJA 4F2HA 5BVGA 3DPUA 5K1ZA 1AT1A 1OFUX 5JAMA 3NPAA 2GHIA 4RD2A 3PLAE 3HP1A 2OQIA 2XIQA 2W48A 3AUTA 2Y1CA 3ZZUA 2FP3A 2Q4TA 4CEJA 5IHPA 1N5OX 2P68A 2C7RA 3H2HA 4TXJA 1UPTA 5EXEA 2P40A 3DOEA 4KUEA 5EP4A 3Q9UA 1EX7A 4F9TA 3EPRA 3DUWA 1N25A 3LKBA 4MW0A 2H54A 2IODA 3DUFA 4DZRA 1ZMTA 2J09A 4RS4A 2W4IA 2XADA 1WKVA 2ZSDA 2WVAA 3KT0A 4BPRA 5EMJA 2B6HA 4V1CB 5J58A 1GXSB 1T3HA 4K87A 3RWOA 4YJ2A 3I52A 3VNUA 3ZHYA 3WK4A 5HFAA 1TD1A 3H65A 4EW6A 1GSOA 3EXG1 4JHLA 3ABOB 2X40A 1KY3A 5CB4B 5A0FA 1KERA 5DRYA 1OMOA 1PJ2A 4OFWA 1D09A 1JHOA 2CNDA 2XEXA 5K0NA 5KVSA 3CVWA 1T36A 5ALDA 1T2DA 3ESRA 1O96A 3ENNA 5AQEA 3HSKA 2IUUA 4JI6B 1QP8A 4CMKA 4CF3A 4NYMR 1ZK2A 5KINB 3V48A 3K1TA 3S7ZA 1OH8A 2FYTA 3OPYA 2FZ4A 2EFEB 2IE0A 2Z58A 4I8DA 1JWLA 1Z6AA 1EVJA 1M76A 4OBWA 4HH4A 1OIXA 1QGDA 2V4UA 3EVBA 5F12A 2DGDA 3L5OA 2I2AA 4O5OA 4W5NA 1EBBA 1QPGA 3L6DA 4QNMA 3UPUA 1KIMA 3KIPA 4RZHA 5FA8A 4DIKA 2XECA 2HK9A 2LKDA 4XGQA 5D5QA 1DU4A 3SS9X 3T1NA 3TI7A 5A4FS 5FL7A 4C1NA 2OK8A 1KH1A 2I1VB 3H9EO 3AESB 3I9V6 4Y1RA 2DM6A 3G8DA 3JQBC 3DS8A 3IJEB 3R3ZA 1RKXA 1M67A 3GP5A 2P91A 3JTEA 1Y1RA 4HUJA 2FE1A 3KTDA 1ZR2A 1SB9A 4DADA 1XX6A 2ZM5A 1YS9A 2JFFA 3VR2A 2P5SA 2O6HA 3RSHA 4RKRA 3RU2A 3T3HA 2W0MA 1W1WA 1WDLA 4GZ5A 1I4EB 1JG6A 1J1ZA 2JF0A 1XPJA 3A1FA 4BUZA 4JK3A 4OAOA 3EW7A 4WBNF 2DJIA 1SXJD 3F3SA 3A4VA 2NSHA 2R8OA 5B5SA 1OB5A 4F6RB 4DIFA 2BFPA 1IN8A 2YS7A 3ECAA 3H5WA 5J59A 4GQBA 4P08A 3E1SA 3KR9A 5K3FB 3MCVA 4N9QA 1JA9A 2CGEA 4R98A 4DL9A 1J97A 4ME6A 4JEUA 3TLBA 5LM3A 4G0NA 5FPHA 4RA9B 5FOUA 3TVTA 1JPJA 3HYTA 4MI9A 3FNHA 4DUPA 3ZLJA 2NTVA 3NBFA 2WUGA 3FMFA 5CNIA 1LX6A 2JKYA 3KYCA 4I7EA 5SICE 1JEEA 5CHEA 1RXCA 1UMCB 5IKPA 1UKVY 3SX2A 4HZIA 5KTSA 4M7WA 1T91A 2H57A 3MXTA 5KBYA 1UP4A 4RGYA 4WL0A 4F6CA 1ZBDA 1EGHA 2FQYA 1MJGM 4MHSA 4Q4DA 2C61A 3FCEA 4ZOLA 2ZJYA 3CEMA 3PHJA 1U7WA 2Q7OE 1IVYA 3CWZA 3QQ5A 4FLMA 3AFOA 4LWPA 1X7WA 3JPWA 1ZD9A 3DKKA 1UQUA 4RVSA 3R7WB 4FOLA 1G0OA 1IY0A 2R11A 2ZB2A 3DWGA 5AK4A 3OE5A 3RVKA 3R3VA 7GPBA 2ID9A 3FSEA 4EL5A 2DECA 2HPZA 5BYJA 5KMGB 5E1MA 1PR2A 3RAEC 3W5HA 3W8DA 2P4UA 1UMKA 1MD9A 5BMVA 3A4LA 2RJ3A 4R2WA 4MUJA 2KLBA 4CQNA 4U7HA 4REQA 4MQ4A 2Q29A 2RHRA 4ALNA 1PDWA 1DELA 4LS3A 4R51A 4L51A 5D51S 2IZ6A 4RA6A 2ZT5A 3ZPXA 4TMZA 3JASB 3TLCA 4CT0A 3IIIA 4OK5A 3OZVA 3VGJA 1I9GA 1OREA 1ZVMA 2G1PA 2XUOA 4Z4CA 5AHRA 3R0VA 2JVIA 4L9WA 4MP3A 4O29A 4CFSA 1EKXA 2EBWA 4KE8A 4OHUA 3RH0A 1G291 3H3JA 1L8XA 1U2GC 4J0KA 1Z08A 2WZBA 1XLVA 1Z35A 2YWEA 2EP7A 3DE6X 3IT3A 5DTJA 3BZBA 4F5DA 4ZYWA 5E1BA 1TK9A 4X84A 2QL6A 5DYTA 1NJ2A 4MDFA 2X5XA 2N42A 4C6RA 1L4MA 3FW1A 1X1SA 2VAMA 3NHKA 2UZAA 4DLUA 3MNFA 1WCWA 2ZSIA 4UM9D 3GBPA 2KLHA 3FSJX 1FFGA 2XT6A 1TCVA 4K28A 3MPOA 5HQ3A 4C6TB 2CEAA 5CXUA 1J8DA 5J4VA 1ESDA 1NYQA 2PLAA 4Q3AA 3UK1A 5JZOA 4B9AA 3V7WA 1INLA 1JAIA 1ZRHA 4MRVA 4EX6A 2B36A 4F8YA 3R6WA 3IT2A 5BSUA 3OHPA 3SS7X 1YTLA 3KB6A 1XR3A 4A10A 1KA9H 1V8FA 4UHCA 2VQEB 4ND3A 1IMJA 1ZC4A 4MRRA 1YB5A 4C2TA 1LBIA 4EBFA 3O2JA 3AP1A 2PV7A 2PGLA 2WZQA 3EA4A 2C9MA 2QM0A 3KVNA 4IM7A 3LI2A 3OU7A 4LK2A 5TC4A 3RSCA 1XP5A 1W25A 3UO8B 4DLYA 4JNCA 4Q9AA 5CFMA 3O8CA 3LK7A 2JRCA 1TM2A 1WB4A 2LIVA 4P3XA 3KVOA 1U0BB 1U7ZA 3IP7A 3IAM6 2HCJB 3JAKB 1PFGA 2AOXA 4BQNA 4YRAA 3ADKA 1W8DA 1TX4B 4TWIA 2C97A 1E1QA 2P30A 2PRIA 3H0CA 1B2RA 1C4OA 5CUQA 5AK3A 1J7KA 1KJWA 1TAQA 1MGOA 3EMBA 3K94A 1IOLA 2PO5A 4XVQA 2A5JA 2JLRA 1M5TA 4IOLA 3GW8A 4NI5A 4ESEA 5AVYA 3HLTA 2VDUE 1XMSA 4RTQA 3MRTA 2C2GA 2QE6A 5JXJA 2IF2A 3BE8A 3E9EA 3RIYA 1DKOA 2Q9BA 1P7PA 4K46A 3LQRA 3UGTA 4YV7A 4Y2YA 4G1UC 4PQGA 2ROQA 1I1HA 1LDMA 3K9WA 1GPNA 3QI2A 3UWKA 5JYCA 3C2QA 3H75A 2ENWA 2JBAA 2YIDA 2HIAA 1XL0A 2IHJA 1W36B 4QTXA 1GPDG 3DCYA 2HGZA 1OZAA 3M4JA 2VF5X 4K03A 1KJ8A 3QELA 5INTA 5BRAA 4C0WA 1GNSA 3L93A 1T0UA 3L7KA 2AK3A 1E2JA 4ARAA 1UOQA 4JJGA 1C9NA 3IHLA 3LOPA 4QJ4A 4RY0A 2UUPA 3B7PA 3BCRA 1GLGA 3PA6A 421PA 1ONPA 1JWBB 3JD3A 3DE0X 2QP3A 1UBUS 3A6KA 3QVKA 4G2TA 4G5HA 4KZPA 3EXHA 4DT1A 4BO7A 2PUCA 1ZD4A 2OXFA 2UUCB 3GP3A 1Y89A 3IELA 2BF4A 3L6RA 1A8HA 3N5KA 1TNDA 2GPTA 2VXBA 5C2JB 4EVQA 1V43A 2OECA 3K0CC 1TFRA 3L46A 2R5FA 3DAPA 4ZZIA 1O3YA 5LQCA 3W3AD 2Z5LA 3NVAA 5I3CA 1LLQA 3U7EB 5REQB 4ZZ1A 5FD8A 1MORA 1WL8A 3WYCA 1ZMXA 3VPSA 4A8JA 1BKYA 3RVJA 5BSHA 4M8SA 2FF7A 4JP3A 1N2OA 3WIDA 1SCUB 5T4EA 1C30B 1N2BA 3RFFA 3SJZA 2GVZC 5B2EA 1Z16A 1R2QA 2PKQP 2P9YA 3RYTC 3SX4A 1B1CA 1X92A 2A4MA 5HK9A 4BV2A 3R0QA 4MX8A 4PLTA 2RAVA 2GLTA 4TLAA 2CE7A 2Z2ZA 4BNXA 5K0CA 3H2GA 3AG6A 4HH0A 3AF4A 1PEAA 2H1SA 4GPBA 3ZDYB 1Y81A 1MOZA 1FQWA 3CURA 4IHQA 1VPLA 2CFOA 2IHVA 1K97A 2VHXA 1A69A 5FLKA 1P4SA 3UYKA 4A0FA 4BQOA 3W3AH 3C7AA 1QZXA 2EJCA 4GOKA 1GTMA 4YC7A 2OV2A 1E1DA 4CMCA 2Q2OA 3MTAA 2FE4A 3A1EA 4YGXB 4M87A 4RQBA 4UBJA 4P4GA 5DHTA 2JIRA 2QTLA 1ZOOA 2RCNA 3GUUA 4R6WA 2DUWA 4KAXA 4MUBA 2FN8A 3NVDA 2ODNA 1QH8A 1U2PA 2XBUA 4XARA 1J2EA 3RTCA 4M22A 4C0AC 2OOSA 1UXIA 1YOVB 2V4ZA 5BV8A 1ULUA 4CXMA 3CNOA 3JQDA 3K0EA 4URXR 5TNXA 5HKOA 2JEZA 1PJBA 1JQKA 2C0CA 3PFHA 1S0UA 3UK7A 1FLNA 4PRLA 1DJNA 2O50A 2HL6A 3IVGA 2XCQA 5K0ZA 2AYXA 4D98A 1IB6A 5CD1A 2VDPB 4LXGA 3F1KA 2IZZA 4UU0A 3JQ9A 1QV9A 4R1LA 2D3TA 4U3JB 2BYTA 2X0IA 1ZRMA 5EIFA 3FKSD 3D1LA 3RYIA 2ZE7A 5ICSA 3KZXA 5KVVA 3CXUA 1F8GA 1SVNA 2GXUA 3IDOA 3M5CA 4B84A 3T5BA 2HBQA 5EWJA 4JUCA 2Q5FA 1SFRA 2D2VA 5TRTA 1UT8A 1NSTA 2AI1A 1TMGE 2QRMA 2VDNB 2GHRA 1JQEA 3DXZA 4KR0A 1U1EA 5ITSA 3GLHB 2D0OB 1PZXA 4UD6A 3BYZA 3Q85A 9ATCA 1L3CA 1T8RA 3S2UA 4R3UC 3IULA 4L15A 3L0YA 4WXPA 5KNCA 3RJMA 3D9QX 4RWZA 1FTYA 2H2HA 2PH3A 2ISCA 4GP9A 3I2YX 1YJ5A 3TX2A 1CFJA 4ZT7A 2IPLA 1Z6GA 2BGLA 3BKXA 3D1JA 4IDOA 3ZVKA 3A4MA 1RWQA 3AJEA 1GRNA 1RM3A 1GGMA 5JSUA 4HGPA 4HDSB 1BO6A 1U8FO 1D6SA 3NT5A 3HJHA 1WTCA 4NPAA 1LK0A 1PLJA 4D4HA 4ZTUB 2AC2A 4XVRA 4BNGA 5J1SB 3UMSA 2CZCA 3KAQA 1Q91A 4FWBA 1O2DA 3OQVA 4EUKA 3EDQA 3VFDA 2F43B 2FRDC 5IU6A 3GXOA 5BUQA 3OM9A 1U0SY 5ERYA 4RIIA 5E0OA 1I2AA 4QGAA 3EEOA 3AY3A 4D26A 3NPMA 3M70A 2NZUG 2QRLA 1EINA 4I1PA 1DXQA 2GTIA 2GCPA 4KE6A 1SCBA 5B3JA 1Z8DA 2R4QA 1RLIA 4OJNA 2OBNA 1VRWA 2OLKA 1Z2NX 2I2DA 5CTAA 2JJ8A 2KI5A 2OFWA 1LPBB 2VBCA 3DF7A 3IOYA 2BSQA 2QTWB 2A5FA 3IHWA 1M54A 1YRWA 3ABZA 2HRBA 3GL9A 4LWOA 1GR0A 1Z18A 1PSZA 1PR5A 4D8YA 2JW5A 2IYVA 2OVFA 2Y1XA 4ZOQI 5JNLA 2H63A 4D74A 1BX0A 4BMXA 1T24A 4M98A 5ICMA 1G9TA 4L22A 1KZ1A 4UE6A 1XPOA 4XDHA 1ONOA 3G0CA 4J1NA 4Z4GA 1J42A 2P2LA 4N01A 3PEVA 1JV2B 3QLVA 2GBLC 4L78A 1ZOIA 4K2AA 1T3GA 3DEKA 4Y7CA 5L3ZA 2EX0A 1ECFA 1MB2A 3HBFA 3STTA 3Q9NA 4GMDA 1SUWA 4NQZA 2IP4A 3WYGA 4KOAA 5D1HA 4Z4FA 2BUCA 4FOTA 3G5UA 3I64A 3MOGA 5L3SA 1C9YA 5AKXA 2EZTA 1XDGA 1C8LA 3R5FA 1QF9A 3OMXA 4YT4A 6NULA 3K1JA 3FPBA 5DB4A 3URMA 3C4JA 3B6IA 5HE8A 3IKJA 1WZUA 4UCWA 3RVBA 2GBFA 3CVVA 3FOCA 1YL5A 3EEIA 3KEGA 3ZWOA 5J4HA 3AF3A 2JH8A 3PQ2A 1E9SA 4ND2A 3KCNA 4OHVA 3F6PA 1QVZA 1Z6PA 3AM4A 1LSOA 1I5EA 3K70B 4DABA 2RGWA 3ZHOA 2ZBEA 1DWOA 4Z9FA 3V42A 2OORA 1B8PA 3KUXA 1YXMA 2ZGVA 3GBSA 4MIKA 1FEZA 4CM9A 4QG3A 5L51A 3QG1A 1PG5A 3BZUA 5L53A 4KQMA 2ZIAA 5CIQA 4KQIA 1GZ7A 1JZQA 1ULHA 3WYNA 4P83A 2OO5C 2RIPA 3KOUA 5ECDA 4ZHSA 4B3JA 2FQQA 5B1DA 4F3NA 1AURA 2EU8A 4M8LA 4S1TA 2IFTA 2OVBA 4W6ZA 4E07A 3ZJVA 4RIEA 3VTFA 1NV9A 1Y3AA 2O8EB 1V3TA 1AZSC 2WB4A 1PJRA 2J48A 3CGGA 1MW9X 4Q9NA 4QASA 3CH5A 2DKOA 2VHTA 1Z74A 3IDAA 1FPMA 3KQVA 4MRMB 4P4UA 2PKCA 2N0SA 4OL9A 1KOJA 3WLKX 2X4LA 5F98A 2Q7XA 3EFEA 1GADO 4RTPA 2I67A 2ZUUA 1RAIA 1SQ5A 1YR6A 2WIBA 2WTEA 4IRXA 3WWOA 4K9RA 4N1AA 3CPHA 4WZAA 3SHFA 4E1BA 3AVXA 1C1HA 5HK8A 2DWUA 4CEIB 3EG9A 2WM9B 2B7BA 3PFIA 2MINA 2LV8A 2XNDA 3NHWA 4R3WA 5HCIA 4TWZA 4J75A 1NN5A 3FSGD 4O1MA 4GS5A 4XUCA 1ACMA 1ZONA 2XDAA 2YMMA 3Q5DA 5I8WA 2YY6A 1QCDA 4R2HA 4BO8A 2ESRA 4Q05A 3ZIAA 4AYXA 2O2EA 5LIPA 4OF4A 5LXTF 4UZSA 4DCTA 5JCJD 3H5TA 1CJMA 5F1KA 1D2AA 4DLNA 4X44A 3HUUA 3CO5A 3OWHA 3HHEA 2YVQA 5AJXA 5AESA 4YI3A 3QHAA 3T95A 1OX6A 4BV9A 5TLSA 3E03A 3L8YA 3I4LA 4NCHA 4DSOA 4I1RA 1CE8B 3MWGA 5CDHA 3MMPA 3EDOA 2AFIE 2CKDA 5GJWC 1KZ9A 4IS2A 4BLRA 1DLJA 2ZIUB 3MWDB 3K20A 4OLJA 1JDJA 5ADHA 3K0SA 3AF6A 1DFHA 4GVXA 4PLYA 4HLQB 1WDWB 1P0QA 2NXWA 2FAXA 4Q1EA 3WLNA 1MNQA 1NQOA 2QNIA 1N0HA 4J03A 13PKA 2GN8A 2Y2VA 3E70C 3O75A 1K7CA 2WKPA 3NO4A 1B8OA 2YWDA 2BMWA 2JDID 3RGGA 1K6EA 2B2NA 4NBWA 5ITZA 4KN6A 3TSWA 5DTIA 4L3VA 2I65A 4BWYA 2GM3A 1QXSA 3AHHA 2IYEA 3BSFA 3SFZA 1EFPA 2C0QA 4GXTA 4JJEA 4YP6A 2OC4A 2PLFA 2X7HA 2WYUA 3D3JA 4DQKA 3FPGA 1CPYA 1JT9A 1X7ZA 2YZ2A 1YAHA 1N8KA 3GVXA 3N8HA 4Q4HA 5CDSA 2V7XA 4CLHA 2XCTB 4G01B 2GS9A 4G5FA 4ETIA 4HVLA 3B36A 3H99A 1IOZA 4DLBA 2ODAA 2ZCJA 1G16A 1JLRA 2QI9C 2C2WA 3HGTA 4IOKA 4N18A 4UEKA 4UDYX 3RKRA 4DWVA 5LQJA 4XASA 2VWQA 1GGFA 2NU7A 3M7IA 3R40A 4CUKA 3O8RA 1AU9A 4JLNA 4IS3A 3PQ4A 1ZI6A 4C7BA 4XI9A 1DIBA 1KQFA 3UJHA 2MYTA 2ZRNA 1J2JA 2DWOA 3HHPA 3IO3A 3LGAA 3PS9A 4OYYA 4QOSA 1YJXA 4EYOA 3FUVA 3ISTA 4D81A 4EJ6A 5LJLA 5LIRA 1YZLA 1W36D 3ZY5A 3U7JA 4AG5A 3WGTA 1QMGA 1SA0B 4JOSA 2JKZA 4MVWA 3KSAC 5LL6P 2ZBVA 5ED4A 2ZREA 2WLSA 4F7WA 2HI0A 3GLIA 4X8OA 1LK5A 1URPA 1ZIYA 1M6VA 1AZLA 4D8XA 1Y3CE 3E7DA 4O2LA 5AHWA 4MYRA 5CBPB 2ZIFA 4V0MA 4HYEA 3L4BA 2QRGA 3QLUA 3E22A 1RFLA 1B8NA 4HATA 4CHGA 2F8MA 2JGMA 1O9GA 3CRQA 4IGAA 6ABPA 3WGGA 4II2A 2IOQA 3O7WA 3BMOB 5C34B 4LMAA 1T5SA 2JLAA 3DVAB 1VHDA 4TSKA 1BSVA 4FDMA 5AOBA 1ZITA 4M2LA 4XGRA 5IBRA 1VHJA 2CXPA 2PPLA 3WLHA 1JHVA 3UMJA 2DT5A 1KVRA 2WAYA 3TLGA 1XTUA 1SC6A 3VAZA 3BGWA 1NW5A 3TG2A 3NLLA 3I0MA 4BPBA 3ZK8A 4IHJA 4IO0A 1J1IA 1II9A 3WL6A 5B4VA 1XHLA 1N6OA 2J7PD 2FUCA 1GPMA 2VHZA 1EDEA 1PWZA 3O9MA 5K7SA 3KQLA 1BIFA 1SG9A 2VCEA 3EPHA 5EMLA 2NSDA 4JBIA 4BP1A 1QRTA 1Y1QA 2X1VA 4B2IA 2D0IA 1EK1A 4FSDA 2GD1O 3QFFA 3KS9A 4ALLA 1IYZA 2REXB 1D4FA 3GPDG 3IERA 4H17A 2I3DA 3UZUA 3VJLA 3WGKA 3OF2A 1UINA 4FEYA 4NSNA 1F2VA 1DVRA 3AHDA 4UUBA 5DNVA 4DR5B 1L7EA 3MWJA 4FFNA 5IYZB 1IY2A 3PFWO 1OPRA 4W99A 2AZMA 3PPIA 4IDGA 4LXHA 3PYMA 4MGIR 5LNK1 2JHPA 4MYHA 5JHGB 4DLKA 4PM4A 4GPIB 1EFRA 3OUUA 3GN2A 4GU5A 2AN4A 3GYBA 5D3MB 3AB7A 4WQMA 4B82A 3ESQA 4NK5A 3SLKA 2FPKA 1FYVA 3O3OB 4DC1A 5LP6A 2ENUA 5JNWA 5EG5A 4QOEA 5LC1A 2CZQA 3EZ9A 3KKOA 2SHKA 5IKOA 4FC6A 3NDPA 3T0GA 3EJWA 3BRQA 2B20A 4WLOA 5AKYA 5B58T 2NU8B 1DJLA 4TMYA 4KQ6A 4MWCA 5EJIA 5C37A 4PC2A 4ND1A 3KE8A 3UJBA 2F1RA 5TS2A 2V7EA 1X1CA 1HE1C 2XKAA 3T3NA 2C8KA 4FEEA 2Q8PA 4ZEVA 4EGSA 2IYUA 3PSHA 4L07A 4Q37A 2ZXUA 3BXPA 3U61B 4XJSA 5I48A 2PWZA 2HFJA 5LZ7A 1UWLA 2R47A 4I55F 2DHCA 4INJA 4WCDA 5E1OA 2R7NA 3TKAA 3MGKA 3ZGLA 3I5YA 5GJBA 6GPBA 1X80B 3DOHA 3Q3EA 1F4PA 2D8MA 2FETA 4MRSA 1M2KA 2XNCA 3I6MA 3P5BA 4GG1A 4OB8A 4HEHA 4HXEB 5CNJA 3H86A 4HH3C 1RACA 9MHTA 4GYKA 1DFIA 2W7TA 1YSCA 3GZNA 1W85A 4YBZA 3QENA 7REQB 2BFNA 3QQPA 3GJ4A 3S44A 3TLEA 3BREA 3MINA 2EQ5A 5JALA 3ZHVA 3RF6A 1SRQA 3FNIA 5A7GA 5HJEA 5U4XA 2PBZA 1SOUA 4LJLA 1ABBA 4N76A 1G7CA 3R7FA 3SVTA 3ZY3A 4O5AA 1P4GA 1D2NA 1G6Q1 4ARVA 3JR3A 4FR0A 4KIGA 2BV3A 3JQ7A 4FZVA 4HPJB 1HDCA 5A05A 3FRHA 4BX0A 3B13B 1JR3E 5I7VA 1Z2OX 2WUWE 3VBCA 3VO2A 1K0FA 2H65A 1PU2A 2VRWA 3F4BA 1NI4A 1BU8A 1YZTA 3EY4A 1MF7A 2E6KA 3HFSA 2UXDB 3T41A 1F4LA 4GL2A 1JXMA 4JX9A 1X13A 3CLVA 3I76A 1T8YA 4O2BF 4PXYA 4YAFA 4ZVOA 3E7XA 3UUFA 4AZ0B 3JSAA 4CG0A 3HU1A 2B4KA 2PMDA 5AR1A 4IDNA 4Z7OB 3QNUA 1CRWG 3IYLW 3O4IA 4ENRA 3NIFB 4L8VA 4KFTA 3UHOA 4LZPA 4KHPB 2C2YA 5DCLA 1KI8A 3QM1A 5FL3A 3U7QB 1ML4A 1I8TA 5LQSA 3A0RB 2ZR9A 4WBSA 5JS6A 5IC5A 2JASA 1SC4A 5IF3A 3F8TA 3H1BA 4RSMA 1L9KA 1I6MA 1JG7A 3ZY4A 1FQKA 2D4HA 4TTSA 2GN9A 2B82A 4QLAA 3WJ7A 4DSNA 1JX6A 2YNMC 1EU1A 5COAA 4OPMA 1EB8A 2H9AA 1JQ5A 1Z4MA 4MO9A 5C7YA 1HFWA 4ZALA 5DBEX 2OCGA 2O8DA 4NJEB 1RWMA 1W2WB 2VWHA 3PIIA 4DIUA 2AMVA 4GGPA 1AGNA 2IEBA 3Q6MA 1YD7A 2QSUA 1MV5A 3UF0A 3QEBZ 4DMMA 1XGKA 3MRXA 1FFYA 5K05A 2PNJA 2A3RA 4N0EA 2BTOA 3SLRA 3BMXA 4TV8B 3WGOA 2IDKA 1A5TA 4BKQA 4MGZR 3NG1A 2PEYA 1GCOA 3ZQUA 5CJ2A 5J3JA 2WKSA 1GQQA 1VB3A 2DBVO 2QLTA 3IV6A 1Y5NA 1D0SA 3PX3A 4H7JA 4EMTA 4K9KA 3IT0A 3EUWA 5BW4A 4HJRA 3DV0A 5BOSA 3W5DA 4RHCA 3C7TA 1Q6ZA 4ZYLA 3RU9A 2DERA 2ID8A 3IIJA 2B5OA 4I50F 1T9DA 4KP7A 5ERXA 1V5EA 3WL8A 4HN9A 2XZLA 1NBHA 4KK3A 2GXSA 4MW6A 4JXKA 2RHMA 2XMBA 4BMVA 4DQVA 3KEOA 3OCWA 4L4SA 3K70D 2HU8A 5BUZA 1EMDA 1AF4A 2VJLA 1BWPA 1DDOA 5A4MS 1BA2A 3OZTA 4QXQA 1A9XA 1ZCBA 4FHZA 4C6HA 3O0TA 5E9AA 5LZ2A 3OKCA 1BH2A 1KKUA 4YRIA 2UYQA 2BEWA 4C05A 4B87A 5HGJA 5ALVA 3LVFO 3PHLA 2H1RA 4O2RA 3WIVA 1MAAA 4MVYA 1GT91 3IVAA 4GHWA 5FUBA 3N1UA 3I72A 2ETXA 3O8BA 4WX2B 3SSOA 3WK7A 1SUSA 1NYTA 1ILWA 1GR1A 3H1GA 1T3TA 4EB8A 5KTKA 1U9IC 3BB3A 3Q7TA 4JEMA 3KPYA 2UYYA 4NL4H 4HT3B 3C6XA 5GMOA 5AO9A 2PR2A 3DEYX 3P9ZA 4BLWA 4IGFA 5AJVB 2VUUA 5JLJA 2OR3A 1QCYA 2EOAA 3A27A 1R4MA 3OD1A 1DEHA 4JV5B 3WRYC 3IESA 4RPCA 2C5SA 4YRKA 2XQGA 1M5RA 5K3AA 4X85A 4DG9A 2BGGA 4G9BA 1YS7A 2I7VA 3GD5A 5B30A 2R4UA 1I94B 1FRQA 1T5TA 1H5NA 4UBNA 2C4MA 1SKAA 3VR5D 1JU4A 3PC3A 3P5SA 3WHPA 2GYWA 2ZYAA 5FO0A 1V26A 1HLPA 3UAWA 4JT9A 2VDJA 3SYTA 3VSAA 1OFTA 1TCUA 3CZPA 1XROA 2BMJA 1FFHA 2WMDA 4PHCA 5DTQA 4CKCA 4QZVA 1NQWA 3W2HA 1USVA 2WUFA 4KV7A 1E92A 1O95D 2OBBA 3RQSA 2ATEA 1M1YA 4LV8B 5F3RA 3E82A 1NKVA 2G07A 4RXTA 1JHZA 3W04A 2ORWA 1F1BA 4XPIB 4JI5B 2P4QA 1K0UA 1PZNA 4QRIA 1Q3KA 1V7PC 1H65A 1QUFA 1E9VA 1NUAA 2DFLA 4H6PA 3P4XA 4D8UA 1E8MA 1Z4LA 5CA1B 3CE9A 2IITA 3JQGA 3VHXA 1VBNA 1PL6A 2TMYA 3FVTA 1RMQA 2C92A 3IKVA 3KXLA 3VH2A 3VR5H 4CV0A 4D6PA 4CM4A 4NONA 2CUNA 1U8XX 3ZE6A 3PIDA 5GJVC 5T41A 4GPAA 2H4XA 2HUPA 2IBMA 3BA1A 1GGHA 1C0EA 2HQOA 2QE7D 3IPXA 3OT1A 4FHFA 2QGFA 4MW9A 2NSLA 2ZRQA 2PUAA 4UAGA 5AI6A 2CJWB 3BFVA 1N6LA 3FI9A 2P5TB 1HYGA 1XNRB 3N0RA 1SKUA 3EFHA 4PIPA 2IYZA 3DT6A 4LCBA 3SI7A 4XDYA 1KAQA 4LV5B 1QPZA 5EIHA 2FZGA 2P2YA 3T1QA 3UW1A 4AN4A 1ETUA 1RXWA 2PQ0A 1PAUA 2QWXA 1NONA 4JBNA 4ZVLA 5JI2E 2E7ZA 2DPGA 3CW2A 3DLTA 3WMFA 1II8A 3OZBA 1RXIA 2IYNA 4UNIA 3TW4A 1W1UA 2AFIB 2CHUA 1MEOA 3GZTB 2HV9A 3M6IA 4U0KA 1SHZA 3AX6A 5DYWA 1RLUA 4OQYA 4US1R 4XR9A 3SK0A 1Z06A 5DM70 4AY6A 1G6KA 3GOHA 2WG2A 2BGNA 3EJ6A 1V8DA 3C7DB 4FT2A 4MYUA 4BEBA 1SM4A 3FIUA 2ID4A 1XRQA 3C85A 5CFRA 2Z2JA 1DG1G 3DYBA 1XQVA 3DMDA 1NZDA 1K8YB 3FCSB 3NOOA 1Y7HA 2RGXA 3I0ZA 2F3SA 1VJ5A 2DPLA 3CXRA 2SECE 1EWQA 2Y0PA 1J39A 4AB1A 2DFKB 1OB2A 4ZT2A 3RU3A 4EI2A 1SH7A 1XYVA 3LC1O 1SKYE 2ZAMA 3EE6A 1CS4C 3A10A 2OBXA 2OE2A 1JE1A 3GLSA 3GELA 4RHEA 1BW9B 4DOMA 2HB6A 2W6PA 4X6UA 2Y1WA 4AKHA 1I4LD 2H0AA 1V9LA 4OOFA 3S2FA 5ISMA 2JAPA 4O63O 1E3EA 1NMZA 4TTAA 1VSUA 2VF4X 1YQGA 2WUVA 2WV7A 3H7AA 3IQXA 3L02A 5FO1A 2ZJFA 3IP3A 5CA0F 2V54A 1D07A 4PVDA 3I28A 1EUDA 3AFMA 1W30A 3AINA 3Q6IA 3AV0B 2WFAA 5K5EA 1RQ2A 1I14A 3GLQA 3KKZA 5K8UA 2XV1A 5LKRA 5IRCD 2PMFA 3GJ5A 4LDQA 2VYVA 4D02A 1SU4A 3LXMA 4MQLA 4RTKA 1U63A 1ND6A 2ABWA 5BSRA 1XEWX 1UBKS 2E2WA 5LZ4A 3WHLA 3S1SA 4M8NE 2VS1A 4K8RB 1NVAA 1Z83A 3I9OA 2PUFA 3RADC 3BTOA 5CDTA 3C6KA 1WSBA 2ZIVB 1P0IA 1KQ3A 1U7XA 3H6HA 1G98A 3CUTA 1EA5A 2OGUA 5TDHA 2ZI6A 4IRUB 5CB0A 4DCNA 2NO0A 1PR3A 1PZMA 2PXCA 2HF7A 2G72A 3WLMA 2IXDA 3WO1A 4LF4B 2WD8A 4BMDA 1YZHA 1NQAO 5DM4A 3ZHSA 4DUYB 3KAPA 1WXWA 4V0KA 3E5MA 3TB4A 1VPTA 3K3PA 4EEKA 2OB2A 3FDJA 2ES4A 1DC8A 1LUAA 3KSZO 3NHPA 4YJFA 4YHBA 4HGZA 2J8ZA 4DDUA 3WNBA 3G2MA 4R16A 2NO9A 3HP4A 4K6HA 3KAKA 3QEMA 2CJXA 4Y30A 1PX0A 3E9QA 3ZC3A 3EA0A 1O54A 1XEFA 3MSXA 3M1IA 2V65A 4FQ8A 4OGWA 4D6XA 4KPGA 3Q3IA 4KLNA 1ADJA 1ZGCA 2P6RA 1R6TA 1LRLA 3AEQB 4PZEA 3SHTA 1NKTA 1GNTA 1MB9A 3FFTA 5ALSA 1OC4A 5LOVF 2WIAA 5BN1A 3EF0A 1HDIA 3I12A 1HWYA 3BXHA 1VL5A 1CNFA 2O2IA 5DGHA 3UNXA 1VB5A 3PUHA 3PFFA 2OSVA 4P4SB 3V55A 3G49A 3V8EA 4FZRA 2HXGA 2W2QA 1WB5A 5IFLA 2EGUA 5GP1A 3OT5A 1US8A 4NNOA 4D0GA 2FLWA 1QZTA 3CIFA 4FDVA 4H0NA 4LUCA 3TL3A 3M6FA 3X0DA 2P90A 4PN3A 4G5OA 1D3AA 2PS9A 3COWA 5JD3A 1YVPA 4IMJB 3R0JA 3JAWA 2D06A 4QVGA 3MOSA 1ZW1A 4EA9A 1RQXA 4V03A 2FR0A 3LRXA 1PL8A 1XXHE 1MABB 1KI6A 3V8RA 4J43A 3O92A 4RORA 2IYYA 4X20B 3RYHA 1NJ6A 2HDHA 1OAOA 3ORYA 4UFNA 2RC6A 4PR3A 3KETA 2C98A 3BIOA 3SM3A 2CXUA 3VPAA 2O8CB 2WSSD 5F3WB 1W4CA 4YS6A 4GRAA 4NV1A 2QN9A 2N46A 1NMXA 3IB6A 4FE4A 3SICE 1IPFA 4PSKA 4RZIA 4KHZA 2GN4A 5DNYB 1RCFA 4K8OA 2J3IA 3EOZA 3GRZA 3DCIA 4XSGA 4BKRA 1E20A 1G3QA 2IK8A 4EUNA 5IH7A 1PEDA 2SKDA 2W5UA 3F5MA 3QF4B 3THYA 2X86A 4N5DA 4JQCA 1U81A 1C8KA 5FTLA 4OP1A 1MB0A 1IULA 2EL9A 1V96A 1XJQA 5CCDA 3V1YA 2DR2A 2RIRA 3DV2A 3LRPA 2PNFA 5CTJA 1FYEA 1SPBS 2V6MA 2VBGA 2YTZA 4FKZA 4RXMA 2NO5A 4M36A 1X19A 4EENA 2BDTA 1UOEA 2NOAA 4ENQA 3MW8A 4HAWA 4AVYA 5HPYB 4WY8A 5DHRA 1ODCA 3QEOA 4Y2RA 5FPPA 1Q1BA 4L0QA 3WMWA 1EUYA 1Z7YA 2GESA 1T1JA 4OHXA 4G5SA 1GGNA 1SD2A 1BA3A 4AJIA 2AG6A 2Q6IA 1KJYA 3MHPA 2J4CA 3LNTA 1AM4D 1YB1A 4RE6A 4BWGA 3CUUA 4KTVE 4EW2A 1G8JA 4RQAA 3U9TA 1MX5A 3T8YA 4B3RB 5TMEA 1WOYA 4X7BA 4U2BA 2IYFA 2QMZA 4E3ZA 2GQ0A 4TXLA 1FUEA 3RJ9A 1DJPA 4COKA 3RUHA 3HABA 3L6BA 1K86A 5T4BA 4KI7A 3FFBA 4H1WA 2O0LA 1VHTA 2OC9A 2R0QC 4ILKA 3QVOA 3TMAA 3QA3E 3DBVO 2PFSA 3C3XA 4IRMA 4JQSA 4L8WB 5H8WA 2VWPA 4FTWA 4TQ9A 4OSOA 4TL9A 2OFPA 3AWIA 3DVLA 2YN2A 2P2SA 3IHTA 4HV4A 2YBEA 1X1BA 3HA7A 3L8CA 3HWSA 3W3AA 1HR0B 4WNAA 1ZA2A 3H5VA 1W5EA 4DR6B 2PMCA 1MH1A 1V1JA 2PD6A 1EVQA 4NWIA 4GWKA 3ZZNA 3RUCA 4YMLA 4PZYA 2WJGA 2NACA 1CVRA 4ZGBA 5BYBA 4NABA 4RF2A 3UPDA 2UUOA 1JLSA 2H00A 1GL3A 5TB5A 3C6YA 1YC2A 4X41A 1BX3A 3PP8A 3Q88A 1H8HA 4Q7KA 5JWHA 1N6PA 3SMVA 2J87A 4KQCA 5MN5A 3PC7A 1LX7A 2GYYA 2MHCA 3ITDA 5K0LA 2ZVJA 4TV8F 1QH1B 3ZQKA 1T4GA 2ZUVA 4LNUA 1R8QA 3AEYA 1VCMA 3E7WA 2F9LA 2A9RA 5C0OE 3HACA 2DE0X 2J9RA 1V7ZA 1S02A 1NUPA 2Z57A 4TZKA 3G0GA 4BAZA 3R8XA 3W5VA 3LE8A 3ZHRA 1KOFA 4NCIA 2FG7C 4PTZA 1VP3A 1QGOA 4S1OA 5D7NA 3THXB 1E1LA 2IGTA 1GNRA 4X7PA 4RTLA 3K6KA 4J16C 1CEXA 3ZH2A 3FTDA 2HV8A 4I5DA 3QLJA 2D5IA 1IHOA 2VXOA 1COWD 2EKDA 2YVUA 4LQLA 4NOLA 5EWLA 4RK4A 1GDTA 1YRBA 2R1UA 1G1AA 2QTVB 1DOZA 1YDWA 1KEWA 2NVWA 3HA3A 3JSXA 4NECA 1YRYE 1MQ9A 4QWWA 3II6X 4RGQA 3O3MB 4HVAA 5I4IA 1CSEE 1Z2CA 3LFUA 3PNBA 5FUYA 4AWXA 5AVTA 4EK9A 1UAYA 1QVRA 2YJ4A 1SOMA 2B92A 4RK7A 4IXDA 3TIIA 3NYRA 4AECA 4B3CA 1JLLB 2NO4A 4R0MA 1O6BA 3AH8A 3MBKA 2YS6A 4I46A 3PXEA 5C8VA 3HK2A 1QTNA 3MILA 1RYZA 3BWBA 3L43A 4QWMA 4JJIA 4MKHA 2XA9A 3D6AA 4W5JA 3INTA 1HQDA 2AG1A 4ID3A 4YAJA 3IKMB 2DHEA 3CX3A 4EMUA 1F8XA 1E69A 1EXNA 4M0PA 4IXTA 2MSNA 4FFOA 1DKMA 4H27A 3V1LA 1GQOA 3PJGA 1DBWA 1KSFX 2Q1UA 1L8OA 2Q1XA 3I5UA 1SBIA 4DRXB 1L6RA 2EFYA 3BEOA 1B8VA 3O94A 4MKIA 4N5IX 3RBAA 5JRZA 2G9RA 5E8RA 4FX2A 2JFNA 4H35A 2NV6A 1LK7A 4W5TA 3Q4GA 2WWRA 2MR6A 2ZR8A 1GFZA 3ASYA 3B6MA 2PJUA 3HDJA 1QDEA 3AV3A 2J7KA 1T4CA 3EMVA 4B6JA 4V1CA 2ZJ2A 5AVUA 1GXSA 3Q3HA 4YMGA 4RHXA 4A15A 3PJFA 4AW9A 1YZKA 3QXXA 1PSWA 2JLXA 4OHYA 3A05A 5ADUS 1Q7GA 3AHFA 5EA2A 4Y67A 3O4GA 2G4CA 5KYGA 2V7QD 3RG8A 4UVIA 3R5TA 1A9ZA 4ZIRB 5HQJA 3TGLA 3PK0A 1RP1A 3M6VA 1CG6A 2O5RA 3D8RA 4QEKA 2AE1A 1U7DA 5ICCA 1M2JA 1Q7RA 2FPMA 2SICE 1C29B 2GPAA 2RFLA 1OWNA 3FUWA 5IJ9B 2YV3A 2VRCD 4B75A 1DGQA 2VP6A 4MUYA 2YQ5A 3H5AA 1Z0UA 4JLAA 4D45A 5CA1F 2AN5A 1Q0ZA 3B9PA 3NWBA 4G4SP 1P7WA 4IDBA 1IN1A 2GBIA 2QTZA 1P1IA 1QFMA 4I14A 3AF1A 3OA2A 5BORA 5CB8A 3H97A 5KVAA 4NU5A 1Z5UA 4PXSA 2W2LA 4D1YA 1GUBA 1MJFA 4DMKA 3N74A 3WJAA 3CPSA 3DOIA 1HMPA 1MO2A 3AESA 3LX8A 1ZOLA 4N6NA 3E9RA 3B70A 3T7DA 5IPFA 5EWMA 5FDFA 4MR8B 5B1HA 4FUTA 4I4TF 4DLWA 3ENWA 4D8VA 4OHCA 5JY6A 2C78A 1ZD5A 1IHYA 1ZNZA 4CU2A 1MOSA 2XZTA 3ZK7A 5SZHB 4F38A 4J4TA 2J3JA 1KJ9A 1Y98A 2O3SA 3EGEA 3JATA 3PGJA 2NADA 4ABYA 4AUMA 3GK3A 1CQWA 3N0XA 1ZC3A 4G23A 2B35A 5ARBA 3GRCA 2R8YA 3STVA 3EEYA 4EHKA 2O07A 5KYWB 4F6RA 1XWIA 4C7OA 2PIDA 4IIFA 1I6KA 2E4WA 1EFHA 4UEWA 5G0WA 4UQLA 5DE3A 1ZCFA 1UCFA 3PPVA 5DX8A 3OCXA 6CHYA 4RA9A 2OZLA 3TJRA 2AN1A 3NIGB 4QODA 5I4CA 2J59A 2AYZA 3I01A 3KAJA 3MJFA 5FI0B 3V9AA 1FL9A 5LD2B 3EZ7A 1VE5A 3LX6A 2N1MA 3O9VA 3PXDA 4D9HA 2C58A 2PXAA 2WAAA 2C9ZA 3AZPA 4I19A 4F5ZA 5GOZA 4Y6SA 3ZCSA 5DGXA 4N49A 1Y7LA 4OG2A 1RSZA 3PEUA 3FPLA 3A6PC 1JJVA 2B3TA 4NAVA 3F47A 3FPJA 4EB6A 3F73A 1OWPA 4B83A 1GCAA 3IUQA 3QHPA 2RHBA 2EKPA 3GFOA 5K20A 3K9QO 2HU5A 4PO9A 3C1UA 4KL8S 2J3QA 4MR9B 4YV1A 3X1MA 3GEBA 1WXQA 2W2KA 5DN9A 4HXYA 5ETJA 4RBNA 1ECGA 1IUNA 2RC5A 5KMGA 2QV7A 1A82A 4LDRA 1X70A 2FPRA 4E08A 4DQXA 1HE8B 1SKYB 2GI4A 4JEHA 4TOIA 4L16A 3M89A 4WKCA 3D4PA 4UU1A 3IXMA 3D2LA 1YZNA 4KH1A 4FCCA 1TEXA 5KYUA 1H0SA 3F6EX 4YALA 3SZRA 1VJTA 4YCMA 4E14A 5IUJC 5LXTA 1IHUA 2XRZA 3CJRA 1E9DA 1F8UA 4QUEA 1I3OA 4GAEA 1N2GA 2CDRA 2WI8A 4C0HA 3FN4A 1TYDE 2ZBPA 3DBOB 2OSBA 1TA4A 2VHYA 1KGSA 4YP0A 2BI4A 4HQ0A 4BFXA 2GTHA 1USGA 1D6NA 2OB1A 1RI1A 1DIRA 1U8UA 1EUZA 3TOXA 4DHEA 1BHO1 1ZAYA 2HQBA 4FW9A 4S35A 4B2LA 1M10A 1SOWA 3FSGA 1SIUA 5BNFA 1C80A 4W9NA 5BV0A 3SEFA 2IV2X 3KT6A 1CFZA 1XMPA 4ZGGA 3GQVA 3F3KA 4CCWA 3PXUA 2JATA 3F7OA 3GT7A 5CIWA 4ZRMA 3U37A 4CKEA 1CD5A 2RAFA 1O97C 2G77B 1QZUA 1Z7EA 2DUNA 3EBLA 2Q5QA 4HDRB 4C6TA 3AB3A 2XYHA 1KNXA 3PGXA 1TB4A 4P38A 4ARBA 2LIPA 3IP5A 4CLRB 3QPUA 3PSAA 3P2IA 5JBNA 4V3CA 3W5IA 3KZ1E 4X71A 3Q72A 1GL7A 4M1EA 1CZOA 1L5KA 3IBGA 2EGGA 5LDDC 4EUEA 4P32A 4U7FA 3WWCA 3HCAA 3L18A 4HWTA 5A4IS 1IZ8A 1RBQA 1E7MA 4Z2YA 3EPKA 1AXGA 4B3TB 1N92A 1F6BA 4IPTA 3VAAA 4D3XA 5F9FA 3W5SA 5BVHA 1SUPA 1VRVA 1KI9A 5HMMA 1WXHA 1T6NA 3VKUA 3MMXA 4ZPJA 3R7DA 3OOEA 5AM3A 4MUXA 4CFZA 4RU1A 3E8SA 1Y63A 1R6VA 4Z4EA 2IW3A 3V4VB 1KK2A 2VJQA 1FE8A 3CEPB 3KZKA 4RKEA 1C9MA 2PV0A 3AI2A 5H80A 3WTBA 5FUMA 1QX3A 1UOPA 1PFKA 3NHFA 4ZU1X 1WZEA 2AG8A 5IULC 5HUHA 1CEEA 3I92A 3EWSA 3VXKA 5EE5B 3H18A 5H9WA 2F9FA 1B26A 1K7FB 1SXJC 2ZRLA 1ZN8A 2ZJOA 3PFCA 4E2YA 1WMEA 3QVJA 5IJAA 4AO6A 2EQBA 2VF8A 2Z3ZA 4JLPA 2WP0A 4DTIA 2ZDHA 4ZMRA 4GI7A 5JI3E 5I9SA 4Q1FA 2YXPX 4XQGA 2ECKA 2FPGB 4NESA 2JFWA 3F5SA 1JAYA 3BCUA 1UMBB 2YY7A 4GPEA 5IM5A 3N2GA 2O05A 5J23A 4X60A 1FLAA 5U4QA 2NP7A 3ZDQA 1ZVKA 4HB3A 1TIKA 2QP9X 2FRVA 1YIDA 2A1TS 2XE8A 4NAUA 5BN5A 2RGBA 5CT6A 4N6OA 5TEVA 4JQOA 4GZMA 3WFJA 3B7GA 5IABA 3A06A 1XXHB 3PFBA 3GHYA 4W1QA 3S27A 4ZQGA 2WVGA 3PVZA 2QU8A 3EODA 3X1YA 1T8SA 1Y8RB 1P5JA 2IP2A 3M6WA 1FC0A 1WSAA 5IG2A 5ADWA 5EP2A 4FOPA 2R6CA 3EGXB 3VU1A 1KEKA 3C45A 1JR3D 1P1KA 4M0MA 2YYYA 3SG0A 5CU7A 4TYMA 3UBTA 5G3ZA 3EVEA 2WHEA 4KQEA 1ENPA 3OLCX 4C88A 2QZPA 1P75A 4KAAA 5DXFA 3AFIA 3ZIDA 2J5KA 5I7RA 5IAJA 1MU0A 4C3VA 1NC1A 3FAKA 1W1IA 4HLCA 1NXOA 2OCLA 1XZBA 2QTMA 3PU6A 5K3DA 1DBVO 4M9RA 1KO8A 5IS2A 2CXQA 4I0WB 3L1VA 2I54A 5DT9A 2Y71A 3EARA 4JUAA 4MV4A 4IVNA 2OLEA 1C30A 2W83A 3Q5EA 5JCPA 3NDBB 3S55A 3TEFA 5FR2A 3U16A 2J33A 4IQ0A 2VLBA 1FU7A 1NW7A 2PX5A 5F4BA 4PU0A 5KTMA 4G37A 1UIMA 1DHTA 4UDXX 4OIFA 5LDHA 2V3VA 3CVXA 1ZPDA 1RWBA 1CRQA 2GJKA 4A0GA 1EM8B 1M5UA 2JS7A 2OM6A 3OU6A 1VLVA 2P78A 1ETHA 3AWDA 1VJCA 1Y4AE 2GEKA 3GMTA 3CLSD 2QG4A 1WZNA 5CGZA 3UIEA 5FPKA 4QT4A 4UFPA 3CLRC 2W6JD 3PE4A 1SC9A 1V39A 1NVWQ 4U02A 1BN7A 2GB4A 1U3VA 1XTIA 3PL5A 5F1YA 2V9ZA 3TLAA 3TQCA 1OXTA 1GQ2A 3HE3A 3KM0A 5LQRA 2WK1A 2BMAA 1M1NB 2REOA 1MV8A 4X7MA 1UK9A 2R6ZA 2ZAYA 4LDPA 4WEQA 2Y27A 4QFMA 4ZI3A 2EZ4A 3IUYA 5THQA 5KC9A 1TO6A 2FPXA 1ZH0A 1WABA 4F5YA 3P0IA 3NEPX 4MVCA 2MYPA 4YMIA 2REQA 3KPJA 3OF3A 3FYHA 4I55A 5IT5A 4G0OA 3TGWA 5LZ9A 3IDZA 3GLGA 4LF7B 5JFOA 5GVSA 5FNVB 1YOVA 4XQCA 5F7OA 4D9KA 1KHTA 1VIDA 3ZG6A 3H42B 2NTJA 1VE7A 2QUAA 3X1XA 1XHFA 2H06A 3QE2A 1QHGA 2B1RA 3PFNA 2H2FA 2LCIA 2QQ5A 1N7HA 3QBDA 1XT6A 3UJ6A 2VPTA 1VKOA 2PLNA 4ETNA 2J3DA 2NO7A 3TEMA 1LFAA 1X3LA 3RC8A 4AI6A 1E5XA 1FTNA 1V7QA 1SCIA 4U3JA 5E2BA 5ALIA 2B61A 1IY1A 1SR8A 1R4NB 3FUTA 4QICA 5ALEA 1DKUA 1AN0A 2QXYA 3HG7A 1J56A 5AXBA 5ESRA 3HCDA 2CNNA 4NDAA 1SVIA 1V41E 4UHJA 1CV2A 1P3DA 2ZBUA 3DOOA 2HQSA 1KZGB 1O58A 1PJSA 1QE0A 3A1SA 1RRFA 3CCBA 3NWJA 4PGFA 1FFCA 4Q7LA 5AVWA 3DEHA 4XIIA 2QIPA 1XCJA 3RRBA 1OU0A 4OI2A 5CYOA 1J23A 1X7GA 4GEGA 1GHTA 4R2IA 3JV7A 5SYNA 4WACA 4YMVA 1RC8A 1IG0A 2G1UA 2Z8XA 2WU0A 1NZJA 4PLZA 2GLUA 4RQUA 4JI3B 1Q7TA 2ZJAA 5JRJA 3H6GA 2VSQA 4YJHB 1QLJA 1WO8A 4HQNA 2OAP1 1O9HA 1EP3B 1EDBA 3BWMA 4HAXA 4A4DA 1S96A 3OZ7A 4IW3B 3THOA 4F3TA 2VDWB 3WSTA 4X1IB 5G0TA 1DC6A 1SK9A 4FYVA 1Z2DA 1UF9A 2X19A 3ZBPA 4P35A 1UR5A 4I36A 1ZQ9A 4URFA 4L2IB 3UHPA 4F8EA 2XOEA 5JANA 2VN8A 3LZCA 5EP1A 1C8VB 5FYDA 4GM0A 1LZLA 2QMYA 3R41A 2GARA 1EXVA 3WSWA 1KETA 2NT3A 3KJIA 1D1SA 2ALJA 3PEFA 3CA8A 4K6FA 4D9FA 1K6MA 1KKMA 3SP1A 1OYWA 4QGGA 5D01A 1XZIA 1IHDA 3AOGA 3AJ8A 3DVSX 5JBIA 4PCVA 1HE4A 1P4RA 3FMIA 2ZCVA 3AR7A 3CPJB 5KPJA 4HFMA 4M89A 3P27A 2VYQA 3BK2A 4PNHA 3UKJA 5BO5A 5KJFA 4DV3B 3AEZA 4KLZA 3ADBA 2V1UA 1ECJA 1TU3A 5EXTA 4EECA 4RADA 1S01A 4PZZA 3I04A 3K8ZA 4EG5A 1KQPA 3OBIA 3QJGA 4EJSB 4EHBA 1DZ3A 1NQ5A 3TW8A 4JB2A 3VYSB 4LMBA 1GRQA 1UZMA 1Y6QA 2QYSA 1JNXX 4JC4A 4R31A 3NI2A 1TT5B 1IWOA 2BFOA 3MTBA 4I1IA 1W5AA 2WWHA 1B42A 3ZDXB 1IZ0A 4I50A 3TNJA 3F74A 1XLTA 2RH9B 3KUDA 3V8NA 2PX4A 3A04A 3N86A 2FWAA 1Z7GA 2ACVA 1IJEA 2ORYA 1Y9EA 2IY7A 3C4VA 1Y8CA 4LRXA 1CF2O 2UZ0A 2ZYGA 4OHWA 4ZCLA 5HZKA 1TM3E 1VE3A 2C8VA 2X13A 1DC5A 4GI5A 4WKPA 2NYAA 3KWMA 4XKJA 5K6RA 3ZD6A 3JU3A 3J80A 4QOGA 1F38A 4QEDA 3Q9LA 2HWWA 3PJDA 3ORQA 3LBNA 4WN9B 5J2TF 1OTXA 4R7TA 3GLFE 3AIMA 2VSXA 4BE7B 3WB1A 4O25A 1PUIA 2F3QA 3T5CA 4A92A 1AXEA 3B5JA 2HO4A 1E1CB 2WMNB 4ZXPA 1E3IA 3AVTA 2NXNA 3R7AA 5J2UB 3D0QA 1B0PA 1J24A 4TSFA 4U7PB 3QKTA 3VU8A 1M8JA 4Z7QB 3LKZA 3AF0A 1AJEA 1ZZEA 1W0CA 4B74A 3D6JA 4HJXA 4FS8A 2HMVA 4PPNA 3S1AB 4X62B 4AFNA 2FSVC 2I4MA 1VG9B 2WVHA 5EHGA 2Y93A 4NZOA 3DFZA 1GFWA 2FKAA 4ISCA 3KK0A 1F2DA 2FP4B 1AGPA 1GNVA 4UBMA 4DAEA 3E15A 1MXHA 1YRQA 1FNCA 3EDYA 2B5VA 2P8SA 3NGMA 3OX1A 5IVHA 1U3DA 2G09A 1YZYA 2R86A 5JD6A 2QLMA 2YCLA 1NBMA 2WG1A 4AYTA 2XBMA 4DXAA 3K0FB 1L6IA 4QQFA 1NJFA 5FI3A 1M66A 3TLXA 2Z1DA 4XM0A 2DETA 3KOMA 1GJRA 1LV8A 4WK4B 3TLKA 2O8EA 2GFIA 4UARA 5EXPA 1B43A 4KITB 3AOEA 3A9VA 5EMMA 5TGTA 4CG1A 1KI1A 5JPIA 1UFQA 4MULA 4HWSA 1WVGA 3IUSA 2JBHA 2VH2A 4FQ7A 5H1YA 4YJKA 4F97A 5B3LA 4QO7A 5HBRA 4J0EA 1LRJA 2HQRA 4M1WA 4C4XA 1K6IA 1PEKE 3L77A 1DKQA 2G83A 3BH7A 4JLUA 2WKWA 3SJ7A 2HW8A 5BR8B 4I1VA 1DRJA 3G9QA 1FNNA 3TINA 2FWBA 3VOSA 4KKXB 3C6BA 3ZV4A 2QR5A 3DHWC 4OQPA 1GAWA 2C77A 4I9FA 2X4GA 4HFRA 1CY2A 1T3ZA 2J3KA 2QTBA 3I4FA 3VR5A 3W0LB 1H0RA 4R05A 3ZWPA 1V45E 3KO8A 1E0AA 2V59A 4I5IA 1WE2A 5K8TA 5AJUA 4ZANA 2YOFA 1XLUA 2PA0A 1HRDA 4RMNA 3OE7D 5HW0A 1W96A 5CYGA 4R1QA 1YVRA 1Z26A 3PNOA 4JIGA 3UUGA 4YAIA 2EFGA 2ZIGA 2IQIA 4FYPA 3I9V1 4MV9A 4C0BA 2IWHA 5ELXA 1FK8A 3IT1A 1CE8A 1E3WB 4IZIA 4PSVA 1ZO8A 2FSSA 1S6YA 3SN6A 4CIWA 5MDHA 2DUMA 5E3JA 2QK4A 3ZH9B 2UXCB 3MWDA 3NHYA 5A06A 3ESXA 1DQSA 3H11A 3O8LA 4OV6B 4ZCQA 1YS6A 3V3TA 3OZUA 2GEFA 4GVLA 4PSAA 3E9DA 3A3OA 2IXAA 4DCVA 4DLPA 4O4IF 3DGFC 3KKEA 4CM5A 1AQIA 4FGLA 1L7XA 1WXFA 3ZWCA 1BN6A 3VDRA 3N87A 1LVUA 1R8YA 2J3HA 3HC7A 2FUNB 3S2SA 1N33B 4LBYA 4MKZA 1H2EA 2J0QA 5ES3A 3OOWA 5L4SA 1OGJA 3G85A 2QE7A 1RAHA 3UMCA 4LJKA 4P1ZA 3QKSB 5AXDA 1CUCA 2TS1A 3L8HA 2EKBA 1P8JA 1Z07A 1ZSNA 2XYGA 4BGUA 3O7MA 1C7EA 3GAMA 2Y1KA 1IY9A 1UMDB 2Q9UA 3DMGA 4BUCA 3NWEA 1Q5PA 1LPAB 1U6KA 4R1MA 5KX5B 4TXNA 5CXSA 5JZBA 3W2GA 1A88A 2L82A 5LLSA 2EZ8A 1MFPA 1RD4A 4MPTA 4X63A 4KMRA 5A4KA 2ZSFA 3ICOA 2QAJA 5H02A 2BONA 3KTOA 4N0PA 4TTQA 3TD9A 4C7VA 1Y34E 3PNLA 2V96A 1JR4A 5E1DA 4XTRA 3VC2A 3HN2A 3BL5A 2DQKA 3WQQA 1UPUA 3K72B 2O5VA 4RNDB 5FUVA 1L5OA 1J5EB 1JU3A 2PCJA 3DAYA 1NWCA 5AOVA 3TFOA 4S1VA 1Y1SA 1CS0B 3V2IA 3QOYA 1FX0B 4MCAA 1JFVA 2W2PA 3K2EA 5IJWA 1VFNA 2G1JA 4PPFA 4DUGD 3RRFA 4ACAA 4D4LA 4JUBA 1YC5A 4TX1A 2GJ4A 4AMZA 4PX9A 5CBPA 4KH0A 3LIIA 1L5ZA 1GA6A 4UMVA 3QU7A 1Z9BA 2H1VA 1TTHA 3T4UA 1CKEA 3TH5A 2WQ7A 1HLDA 2LD4A 3S7TA 5B2ZA 4E31A 1I3NA 1T2CA 4FLFA 4KFSA 1XK7A 3BMOA 2NUAA 2CCKA 2FPLA 3OO0A 1HBJA 3PD1A 4K9PA 3DVAA 1WMAA 3W90A 4D46A 3H7IA 3C3DA 2XX3A 3ED5A 3WICA 1U3TA 1WLSA 2WHXA 1D2CA 3G8YA 3G2HA 5T67A 1K8XB 1Z5WA 3DVQX 1AX9A 4MV5A 1GKLA 4NHOA 1LH0A 5CIYA 3FWKA 2FDCA 1L7VC 2JIOA 4YVFA 4B43A 2FJ0A 4DVGA 1F1JA 4NCKA 5CYPA 4XWWA 4LGYA 4MKGA 2GK4A 2UUAB 4ZVRA 5F9HA 1Q3TA 1PL0A 2CK3D 2BEVA 4Q0MA 4G8BA 4E6EA 2R48A 3CB4A 3VJMA 4XOIA 5IZCC 3QE9Y 1NLUA 4E4TA 3L41A 4OJTA 5DW3A 4Z1MD 1R0WA 1C0IA 1AQ6A 2I62A 4XB2A 1WD7A 3MM4A 1NNLA 4HTAA 4IDAA 4JHXA 5EJ5A 1K92A 1XZDA 2JH9A 4JLBA 3WGJA 4E2ZA 2GA8A 5LMUB 1AUPA 1KDOA 1OTHA 4UDNA 4TYQA 3X2EA 1RYEA 4IWXA 4YRCA 3RS8A 3WXMA 1PIWA 2HO5A 1EBFA 3T9BA 4DM7A 3TJZA 4U39A 1KEEB 1KBOA 1KDRA 3K9LA 4HYTA 3SXUA 5FWNA 4LDNA 2JFHA 3E2IA 3IAM1 3PENA 4TLBA 4A16A 1JKJA 2FGJA 1QM5A 5HIAA 5BQOA 2OFXA 2PSSA 1GUDA 2Q0HA 2K2QB 4PWZA 1PJQA 3QRWA 1WSDA 2AT1A 3E0QA 3QE4A 3O47A 4HWRA 4ER6A 5KNBD 2NU6B 4HVCA 4YLEA 3EY9A 3VVLA 1R4ZA 3LIPA 3CMMA 2XGOA 2VKQA 5C4IA 4LYDA 3FUCA 2DLCX 1FDRA 1PW7A 2ZLBA 3U4MA 5AK0A 3OEEA 4HQLA 4WE3A 4Z8XA 5B3AA 3W1WA 5ITVA 1HZZC