1HDRA

The crystallographic structure of a human dihydropteridine reductase nadh binary complex expressed in escherichia coli by a cdna constructed from its rat homologue
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
236
structure length
236
Chain Sequence
b'EARRVLVYGGRGALGSRCVQAFRARNWWVASVDVVENEEASASIIVKMTDSFTEQADQVTAEVGKLLGEEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGKNRPSSGSLIQVVTTEGRTELTPAYF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDROPTERIDINE REDUCTASE
publication title The crystallographic structure of a human dihydropteridine reductase NADH binary complex expressed in Escherichia coli by a cDNA constructed from its rat homologue.
pubmed rcsb
source organism Homo sapiens
molecule tags Oxidoreductase(acting on nadh)
total genus 79
structure length 236
sequence length 236
ec nomenclature ec 1.5.1.34: 6,7-dihydropteridine reductase.
pdb deposition date 1993-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1hdrA00
5C7IO 1WW8A 3PTZA 1C0KA 1IY8A 3U4DA 4D79A 2Y0DA 5A9TA 1GADO 1GTMA 3BMQB 1HTBA 3HFGA 1LBEA 4YB8A 2C0CA 4WGGA 3TZHA 1NPTO 4FFRA 2H5LA 1T25A 3INTA 5JYEA 1R0LA 1LUAA 2PZMA 2EEZA 3CIFA 1V8BA 3F46A 3QE3A 3DMTC 2QW8A 4R5MA 4JN6B 3OSUA 5KVCA 4CM6A 2X23A 1GEGA 4WPGA 1L7EA 4IQ0A 4MKXA 2EG9A 1R4MA 1RM0A 4IXTA 3TNLA 5I9NA 1O94A 2Q2QA 3DBLB 1LRJA 3KVOA 4DLLA 3I4CA 4FOOA 2GGSA 2BI7A 3ANMA 2Y67A 3JQAD 1E1NA 3DOJA 3WYEA 1E7QA 3ZWOA 1HXHA 4R9RA 3NTQA 1B8PA 1UXIA 4U8GA 2JCXA 1A7AA 1O0SA 3DC2A 4RPJA 3PZBA 4P4LA 2JJYA 3GRPA 2D2IA 3DBHA 1U1IA 3DR3A 3F5QA 1KOLA 1A9ZA 1KS9A 3K2BA 4IUYA 3LC1O 1R4NB 4M8SA 3PIIA 4PLPA 2I67A 3E9MA 1PZGA 1VRWA 1XHLA 3HB4X 4N18A 1A9YA 4GX0A 1DC5A 3GNTA 3V2HA 3FWNA 4LN1A 4BO9A 2V6MA 4A5OA 3D3EA 3ANLA 3DMTA 3U49A 4HFJA 3SLKA 4GKBA 2NU8A 2YDXA 1GPDG 1B8VA 4D46A 1LQTA 3JQFC 4IJUA 3WS7A 2GNAA 4QFDA 5DCUA 2Z95A 3H2SA 3ETGA 3H3JA 3JQ9A 4CM9D 3ZWAA 1Y8RB 3MJSA 4KOAA 3Q9UA 1YE3A 1WWKA 4FR5A 3P19A 4BNUA 4Q3BA 3ETDA 2QX7A 3DZJA 4PG5A 3ABIA 5DBGA 5KVVA 1NYTA 3AI1A 4A73A 1R0KA 2FY8A 4MIOA 4QEDA 1YBAA 4WEOA 1O95A 1A4UA 2ZTMA 4XDZA 5A5FA 1YJQA 4I5FA 4PZCA 1AXEA 1XSEA 1EK6A 4Y6RA 4XWYA 1NFRA 2X0NA 2YJZA 3PFWO 4IXWA 4J4HA 4Y6PA 4H16A 4BHTA 4R1SA 3HB5X 3ETEA 1PR9A 4JJIA 4OIMA 1KBZA 2Q3EA 1D3AA 5A04A 1DC4A 4ALIA 3OIGA 4NFYA 2X0JA 2HK9A 2DFDA 3DFUA 4DIBA 1XCBA 3IJRA 4JBGA 5F1PA 3ZNPA 4JGBA 2VUUA 3K5PA 1ENYA 1Y8QB 1BXZA 4XGKA 2AA3A 3AY3A 3JD1A 5BR7A 1E92A 1T1RA 3EUWA 3OJFA 3G79A 3MWDB 3GEGA 2OHXA 3FNGA 2G5CA 2TMDA 3COSA 4FCCA 4O6VA 5C7OO 3OF2A 2VUTA 1EZ4A 3VC7A 2Y05A 3VZSA 5K6AA 2IXBA 2JL1A 9LDTA 3HDQA 4RCVA 3INRA 1DB3A 3JSAA 4MVJI 4J7CA 3EZLA 3D5TA 4RDHA 1DRWA 4M89A 3KSZO 1RPNA 3G1UA 3C85A 5IFLA 2VRCD 3GRKA 3BMQA 5IN5A 5COBA 2Y1CA 3SXPA 4KP7A 4N5MA 4FDAA 5GZ6A 5G0WA 4IY1A 4NJMB 4GL4A 3HADA 3WQQA 3B6ZA 4BIIA 2WM3A 1VKNA 1ZSYA 2FZWA 3WNVA 3M6IA 1F17A 3QSGA 5I9LA 4ALKA 1U5CA 4L4XA 3D64A 4ND2A 2TMGA 5GY7A 1MFZA 1SO8A 4K6CA 3W4JA 3GR6A 4JJFA 1DHRA 5KJFA 3AY6A 2PR2A 5JCJD 2QZ9A 2HMSA 4RZHA 1B14A 3DBLA 1DBVO 4TMFA 4RGBA 1HSOA 2P9EA 2P5UA 2ZYGA 1HE5A 3DHNA 5IF3A 5JXWA 1BDMA 2OORA 1O9BA 2NUAA 3ZGYA 1N1EA 3FBTA 4AJ1A 3QVWA 4FOSA 3G17A 2BKAA 2RCYA 1M67A 1I01A 3NTOA 1U5AA 4YT5A 1YL7A 1PJBA 1ZKMA 4XA8A 4GSKA 3WSWA 4FFMA 5CHEA 4XJSA 1PQPA 4WNCA 1LQUA 2JCVA 3I6QA 3WSVA 3AOEA 1ZJYA 3OQ6A 5I7VA 3I1JA 2DQ4A 2D0IA 2P9GA 5HM8A 1R4NA 3O8QB 3L6EA 4AG3A 5A05A 1RJWA 4Y8VA 4XGNA 2I5PO 3TFQA 3WXBA 3WX0A 1I33A 3T7CA 3WQRA 4I9UA 4E30A 4LVCA 2D1YA 1LDYA 3E48A 3F3SA 5G4LA 4ALJA 3FCOA 3QVTA 3DL2A 4FC6A 2NU9A 3RKUA 3RWBA 1UXGA 3OQ1A 1I8TA 4H3VA 3TWOA 3VH4A 3QIVA 4XCVA 5F1KA 4D3FA 2UDPA 1H94A 1T4BA 3KHUA 3PPIA 2PNFA 3VOSA 5L40A 3NDJA 1DSSG 5DBIA 3NYWA 3PHJA 1E3IA 2WJPA 1Y8RA 1DFGA 3QWHA 3W8DA 4GMGA 3WYCA 3ZWVA 4PLYA 4BNNA 2EKQA 3X2EA 5JY6A 3RCBA 3TPCA 1Z7EA 1NVTA 1VKOA 3TDKA 2I76A 3D0OA 1YS4A 4CLOB 4IS2A 4PLHA 3D4NA 5BQFA 3WWYA 5C37A 3DZBA 4NBRA 4RVDA 1B7GO 1LX6A 4NH4A 3BMNB 4PLVA 4BKUA 2DM6A 3AOGA 1E77A 1LLQA 3G3EA 3HQ4O 2Q2VA 4NBUA 1GD1O 5KOIA 4CMJA 3P7MA 4TKLA 4BNWA 2VTDA 1KEVA 1PGOA 1LDNA 5H81A 4DIFA 3IP1A 1ADCA 1GZ3A 3HDHA 4D42A 1Y8QA 1EVIA 3VH3A 3AJRA 5FWNA 2PKQP 2ZB4A 3ZHYA 2HSDA 3ZU5A 3N74A 3F6YA 5KJ1A 3RD5A 2HU2A 2CNBA 2JD0A 1BXGB 2C29D 2F1KA 3H4VA 1ZSNA 1K6XA 2FR8A 3GEDA 3HHPA 5TJHA 3MZ0A 1LLCA 1X15A 1T2AA 4E13A 4KQWA 4XX0A 2QRJA 3GVXA 4B7XA 1DFHA 1HE2A 2B0JA 1EUCA 1WMAA 4J0FA 4NHEA 2Y1DA 1MC5A 4NJMA 4BO3A 3PQFA 3F5SA 1PU2A 4KUHA 2AQ8A 1VLLA 1LC3A 2ZYAA 3H3FA 4A03A 3OJOA 5HWSA 4FGWA 4W9NC 2OBNA 1ZEJA 1BG6A 1CJCA 1XEAA 2WWRA 3BMCB 5C3MA 4JX8A 4UEJA 4CMGA 3R3JA 2AQKA 2WTBA 4BO1A 4DYVA 3JYQA 4I5EA 5CPFA 1R12A 3CZRA 3PHGA 4BGIA 3VPXA 3O9ZA 2O3QA 2VZ0A 3FPLA 4B4UA 1C0PA 4F46A 3QA9A 2QRKA 3QW2A 2P91A 4WCDA 2G0TA 2D3TA 3GDFA 1KETA 2V7PA 3PYLA 4BO6A 3DHEA 4BGEA 1IUKA 4CLEA 2R00A 4TVBA 1MA0A 2GDZA 2O2SA 4FSHA 2UV8A 3UICA 1ID1A 3F4BA 3LF2A 3IS3A 1KVUA 3U3XA 4Y67A 2ZJ0A 5FFFA 1IHYA 1NHGA 2AMFA 2W2LD 3DOOA 2WD8A 4NZ9A 4BNKA 1ZBQA 2PGLA 3O8QA 4J49A 2HAEA 3L9WA 2DT5A 5JLAA 5A9SB 3EYWA 5KTKA 3I9NA 3SVTA 1JLLA 3VZPA 2IZZA 3NTRA 5L7TA 4DMMA 4YJDA 1BWSA 1DEHA 3A9WA 3OH8A 3HSKA 3QWFA 1QYVA 5G2OA 4W9NA 2J8ZA 4YYZA 2EJVA 1EDZA 4W4TA 3RUHA 1HL3A 1KY5A 3OFSA 4GLOA 4J1NA 2FSVA 3HN2A 4E4YA 4IGFA 5AOVA 4EEXA 4QSMA 4A26A 3L4BA 5IXSA 2YV1A 3AM3A 3MTJA 3GAFA 4XJTA 1XGKA 4CMIB 2UAGA 1HZZA 4WLVA 1JA9A 2CD9A 2GZ3A 1ONPA 1T2FA 3I9LA 3I9MA 3EDMA 1P31A 1PGNA 2PGDA 3PEFA 2AQHA 4BO0A 1E1MA 1KC3A 4G65A 3JQAB 3GG2A 4CLOA 2WSBA 3E18A 4AVYA 3RFTA 4XYLA 4FD3A 3STHA 3WJAA 5TX7A 3BMNA 3I9JA 4CL8A 4RDIA 4D3SA 4PGFA 4D45A 1JWAB 5T5QA 4ONEA 4HFMA 1BRMA 4EJ0A 3WDSA 4CM5A 1KERA 2C20A 2JAPA 1GZ4A 4J1TA 3Q6IA 3RFXA 1JAYA 1OC2A 1AXGA 3LZ6A 2CY0A 3EZYA 2JD1A 1DIBA 4BV9A 1UAGA 3FNFA 2Q1UA 4PLTA 3UCXA 5ILOA 1U3TA 4PG6A 4LMRA 2DPHA 1BXGA 2X5JO 4CLDA 4XQ9A 4AJIA 4D0SA 4HXYA 1TT5B 2CF6A 1UJMA 2FRDA 4Z0TA 4MVJP 4DWVA 1E3SA 2OGUA 3WBBA 1AUPA 3FBGA 1U8XX 1ISMA 3KBOA 3QWAA 3VKVA 2I65A 4YT4A 4R54A 4MO2A 1WMBA 1AE1A 4DPKA 4ZJUA 4AL4A 4BB6A 4IDEA 1HE4A 3NAQA 1F8GA 1KVQA 4WASA 5F5LA 4Z9FA 1EFKA 3WGZA 2D8AA 4BNYA 5I8ZA 1P44A 5A1TA 1I2ZA 1K6IA 2HLPA 2JCYA 5IXYA 1DIAA 4EYEA 2GO1A 1J6UA 5L3ZA 4U6QA 3ADOA 3BMCA 4NMHA 4HBGA 4Z6KA 3UOGA 3KYBA 1X0XA 5DP2A 1K5HA 4ZQBA 1LNQA 3PYMA 4IINA 4S3MA 5JDCA 4BNXA 3MJ4A 1WXDA 3OM9A 3BZUA 1HF3A 4W7HA 5COAA 1ENZA 5T67A 4AJKA 3QVXA 4HKTA 4RVSA 2EP7A 4WOKA 1GQ2A 4BNMA 1GCUA 1YL6A 1V9LA 2CSUA 4O59O 2ZQZA 4XRGA 1I32A 2F00A 1QKIA 1XQ6A 2NSDA 2B4QA 3AM5A 3LU1A 4P38A 4DQXA 1QLJA 2PLAA 4IDCA 3AWDA 3JCZA 4BGUA 1PR3A 4RF3A 5A03A 5T57A 3RC9A 2OP0A 5EQFA 3ZH2A 2O2YA 5A9SA 1C3VA 1SOWA 5DOZA 2YFQA 2PWZA 3KM0A 1CERA 3ZV5A 1E1LA 4MKRA 4BO5A 3R0IA 5G0TA 4YWJA 2FSSA 4R3NA 3KZVA 4WEQA 3K96A 1MFPA 1NM5A 1QRRA 1VJ0A 3GFGA 4QQRA 3AU8A 4I9HA 3VVBA 4MVJF 5CP8A 3I23A 1P9LA 3K30A 4JIGA 4FN4A 1SBYA 3AY7A 3ONDA 5THQA 3TSCA 4CMHA 2YUTA 3ZWPA 5K9ZA 2DBQA 1E6UA 4CR8A 1Y6JA 5AXDA 1TXGA 1GUZA 2ZB8A 5DNAA 4LCJA 2C82A 2G82A 1HYGA 5FI3A 4CMIA 5A5EA 1XQ1A 4L75A 3CE6A 4XQCA 3UF0A 3FWZA 3QHAA 2C7GA 2VWGA 3WTCA 4ALNA 2IEDA 2NQTA 1YRLA 1O6ZA 2P5YA 4B8WA 2FPGA 3PWSA 1RYDA 4LSMA 3NGXA 4BS9A 3JQAA 1P1RA 4YAKA 2NV6A 2WE7A 1ZK1A 1T24A 1UP6A 3BTOA 3LVFO 3OETA 2PD6A 2Q46A 1XG5A 3CKYA 3LK7A 1ZMOA 3PXXA 2DC1A 4I9NA 3WIDA 1YONA 4GX2A 3S55A 1P74A 1YOVB 2DBVO 1PL8A 1LLDA 1SOVA 4RVUA 4FGSA 1N1GA 1MLDA 1ISIA 3WWZA 5AQ1A 1E3WB 4O1MA 4YCAA 2B5VA 3M2PA 4NK5A 4CMAA 1LTHR 3L9XA 4WJZA 1EK5A 2HMWA 2EP5A 2R2GA 4QO7A 4WOJA 4DQUA 5L4NA 4DTIA 1Y9EA 1ZK0A 2PFGA 3AI3A 3H9EO 5CG1A 3QWIA 4JQCA 2FZEA 1HRDA 3VPHA 2W98A 4I1IA 4OOFA 4IIVA 2EWMA 4J16A 3GN1A 1K89A 1PX0A 1EDOA 1JKIA 1TT5A 1OI7A 4ZQFA 3WQSB 3HZZA 1D8AA 3D4PA 2A35A 1Q7CA 1A7KA 1EUDA 4J43A 4R41A 4CM9A 2ZYDA 3H8VA 1P1IA 3DQPA 4X54A 4BB5A 1GYRA 1RKXA 3H9QA 2IEBA 1AHIA 1D4FA 2OO5A 3GDOA 4MP3A 1E1KA 1FJHA 1E6EA 3GGOA 3GZNB 3A06A 4YTEA 4HUJA 3E03A 1DLJA 3RC7A 3ITDA 3JQBA 2HKIA 3Q0EA 4Q3AA 1I5RA 4PRLA 5TIIA 1NBOA 2DTEA 2W4QA 4BO4A 1S7CA 4GGPA 1KIFA 4KWHA 1YDEA 2NACA 1LC0A 3E9QA 3OEYA 4S1VA 5TSDA 1Z6ZA 3P5SA 3OEWA 4JP3A 4XDYA 1N2SA 1IPFA 1FMCA 1LI4A 3CMCO 3GC6A 2IYOA 3IQDB 5H83A 1IULA 3ZWMA 1HYEA 5TT1A 3GUYA 3RAJA 4E5NA 1CQIA 1GQYA 4OL9A 4OSPA 3P2YA 2X7HA 1P77A 3ZN2A 5BSGA 3LT0A 4BNIA 4YAJA 1PS9A 3I9KA 2CDCA 3DWFA 3I83A 2IRWA 2JD2A 2VRCA 3L6DA 4GPD1 5CDTA 4AJNA 4NU5A 4JXKA 4GQAA 3RUFA 4RJTA 3O38A 2PKQO 3D5QA 1LRKA 5HBRA 2E6UX 1FK8A 1GZ6A 1QORA 5L51A 2OL4A 4N5NA 1E7RA 3H9JA 2BGLA 5EPOA 3DFZA 4E2WA 1B0AA 3ROKA 3FSRA 4GLLA 5JCJA 4OKIA 1ZNQO 4QO8A 5L95A 3VPSA 2D5CA 2DBRA 1I3LA 2DFVA 3KLPX 3T4XA 2DKNA 2E37A 3AUTA 3NRCA 4RORA 5B4TA 2NQ8A 1WZIA 4OXKA 4WLNA 2QIOA 1G0NA 1I36A 2ZJ1A 4L73A 3SEFA 4XQGA 1ISJA 4MOWA 4XRRA 4B8ZA 1QP8A 2VTEA 1ISHA 3JQ8B 3K6JA 2QG4A 4CMEC 3K92A 2HK8A 4ZD6A 4FQ8A 4AJHA 2O3UA 1YOVA 3UHAA 2IZ1A 2NVUB 2Q99A 5C7LO 1E3WA 3OIDA 1Z74A 3A14A 5A3JA 1RYEA 1QLHA 1ULUA 3AU9A 1DIGA 5DOVA 4CM4B 3JQGB 4FB5A 1G6KA 1B8UA 2X5OA 4OXNA 2BD0A 3MOGA 4BO7A 3RI3A 9LDBA 4TWRA 4H15A 3KV3O 4RL6A 2HO5A 4N54A 2AG5A 1ZK2A 2WYUA 4WCFC 5EL0A 4XIYA 2DPGA 1X1EA 1SMKA 4OOEA 4CR6A 2AXQA 4ZQGA 3HE3A 2DLDA 1KVSA 3JQFA 1A4IA 4NFHA 1EFLA 2XXJA 3IC5A 4ZN6A 4RV9A 4A2CA 2QZZA 4YAEA 5HRUA 3T7EA 3GZNA 2EKLA 4CMEA 4RPHA 5HA5A 5LDHA 3HDJA 3DMYA 4WLOA 1D7OA 1EVZA 1HETA 2OUIA 4D44A 3PDJA 4OAQA 1I24A 4ESOA 4AJ2A 3VDQA 1NHWA 2BFPA 4MVJM 1KVTA 2PA3A 1WZEA 1CQJA 4EJMA 5JC8A 2VYVD 4LRTB 3U09A 3PDUA 3RSHA 2B4TO 4RZIA 3PVZA 3RUCA 4YRBA 1DC3A 1VJTA 4RVGA 5JFOA 3AK4A 3RBZA 2VYNA 4J3FA 4QT0A 3PFFA 4CQMD 1VM6A 2VT2A 1R6DA 3IKTA 5ER6A 5GMOA 1XIVA 2BGMA 2JHFA 2X0IA 3NT5A 1UZNA 3RKRA 4OHUA 1BXKA 1ARZA 2SCUA 4MP6A 1UP7A 4BQRA 4PLZA 3OQBA 5JY1A 4TRNA 3TZKA 2FMUA 3CPSA 4PG7A 1HDYA 2VHZA 1QYXA 4J7XA 3V5NA 4TROA 2VRBA 5CDYA 1PJQA 4CM8B 1E7YA 1TVEA 1IOLA 1U2DA 4AFNA 4UEKA 1UAYA 4FS3A 2X5KO 4FFNA 3QWBA 5EMHA 4GX1A 4J1SA 1JN0A 1GCOA 3DZHA 4GX5A 4ZQEA 5EQDA 3ROPA 3DEYX 3JYNA 1ZFNA 1PJ4A 2YZ7A 5JO9A 1YVEI 4CMKA 1ZMTA 1C14A 1T2DA 1ISFA 1T26A 2NTVA 3ON5A 1Q0LA 4GKVA 3VHRA 3KSDO 4Q3DA 4QTZA 4NU6A 5JS6A 4UVIA 1SAYA 1H2BA 2CVZA 4DLAA 1A72A 4KUGA 1K2WA 3M1AA 4HY3A 1JQBA 2NADA 4PN3A 2GRAA 1V35A 3CZMA 1C0LA 5KJ6A 1ZXBA 2RH8A 3S1LA 1HDGO 1XR3A 5BNIA 3CXRA 1TLTA 4E5YA 1X7GA 3WGTA 4A0SA 4CR7A 2OOSA 3PJGA 4IDBA 5JBIA 2DU8A 1UDAA 3B70A 1NAHA 3EGOA 3JQ8A 4BO2A 1I3MA 5IDXA 3GMDA 3M1LA 3I9OA 3U62A 1H6CA 1K0UA 1YB5A 3ANNA 4YPOA 2W2LA 2GYYA 2AEFA 1LEHA 1YH3A 2NVUA 3CTMA 4CUJA 2ZQYA 4XIJA 4IDAA 5L9AA 4ZHSA 3EW7A 5IDYA 1A5ZA 3BMOB 3Q3CA 4DVJA 1NPDA 1PWXA 3H6KA 1EQUA 2D5AA 2YHUA 1E6WA 5IAAA 1B3BA 1ZK4A 3A1NA 4UVEA 4YA6A 3V8BA 4ILKA 1TEHA 1DJNA 1YQXA 3PK0A 3ZZNA 4CM4A 4YXFA 3JQGA 1Z73A 4L0QA 5CDUA 4M87A 2P68A 1RWBA 3GNSA 3HG7A 3DZIA 2FP4A 3ICPA 5T6BA 4YJFB 2DTDA 1IE3A 3KETA 3LT4A 4C7JA 1JTVA 4AJOA 1U3UA 1D1TA 3OJ0A 4LK3A 3G49A 3DHYA 4J2HA 3FRJA 3RASA 3JYLA 2Q45A 4L9RA 5FI5A 4E32A 3NT2A 3PGJA 4R01A 2GZ2A 3I6IA 1HWYA 4KWIA 5F1OA 3OP4A 4OKNA 4DPLA 3ASUA 4Q3EA 5FEUA 2V6BA 1E5LA 3ZU3A 1T2EA 4BMVA 1NWHA 1IL0A 3ORFA 5BNFA 2RHCA 4UVHA 2W8ZA 3IUPA 2GUGA 2WYWA 5THKA 4MJLA 1R66A 1EQ2A 2HRBA 4NPCA 6LDHA 3UGKA 2ZTVA 1JVBA 2WEKA 2CUKA 4EEZA 1X7HA 3PRJA 4YAIA 1YXMA 1I2CA 2VNSA 1N9GB 3W6UA 1BW9B 4LRSB 3U4HA 2EIHA 3RU7A 3A28A 3JQDA 1NR7A 5F3RA 2EXXA 2I9PA 2GZ1A 4QX6A 3FPCA 3ZW9A 4XB2A 4B4OA 3R1IA 2GLXA 1EVJA 4PZEA 1IHXA 1YQDA 1Q0HA 5JE8A 1NFFA 1P1KA 1Q2XA 1FDTA 5MDHA 5CPBA 3ROQA 4YBZA 1GL3A 4TRJA 4E2YA 3GNQA 4IJWA 4CV2A 2PH3A 1AGNA 4CM8A 3OJLA 3TZCA 1PJ2A 3AFNA 3KOUA 4KUEA 4IM7A 3OA0A 1SPXA 1ZEMA 2CVQA 2QYSA 4PZDA 1SCUA 2AQIA 3IAHA 2YW9A 2I3AA 3FR8A 3IIEA 4R51A 3GG9A 2GN4A 3PQEA 1MC4A 1DHTA 4HFRA 2CDBA 1ZJZA 4NBVA 3TL3A 1PJ3A 3ZWCA 4RVHA 2RAFA 5B12A 3H65A 3RC2A 4OQZA 1E7SA 3BXXA 2DUUA 3PWKA 4I08A 1J0XO 5DN9A 3WB9A 4BKRA 4CLHA 1K3TA 3TZ6A 3U4IA 1R16A 4DL9A 3LYLA 4D0RA 1UDCA 1L7DA 4MVJE 1UP4A 2ILTA 3S8MA 3WGOA 5CEEA 3UH1A 3TQHA 3QRWA 2P2SA 2IZ0A 1ZSVA 4YJGB 3VKUA 3PJFA 4CM3A 3H5RA 4MVJD 4YT8A 1WP4A 2C59A 4O5OA 1LU9A 3ZDFA 3N58A 4FFOA 3ZV3A 3TRIA 4XD2A 1NASA 3GQVA 4JJGA 8LDHA 3HNPA 3NJ8A 3EK2A 4HP8A 1LRLA 5HS4A 2ZCVA 1PQWA 4HFNA 3IKVA 5DT9A 1JW9B 1T1SA 3DTYA 1NFQA 1QXSA 2EW2A 3CSDA 1X0VA 3BMOA 4IIUA 4IS3A 3DZFA 3BHJA 1HDXA 3RJ5A 2IE0A 3DDNA 1JWBB 3NKLA 2G1UA 3HJAA 2X6TA 2IODA 3ZWWA 3UVEA 4Z0HO 1JKFA 2H9IA 3AM4A 1C0IA 5FYDA 3UN1A 1IPEA 2LDXA 2NU7A 1B3RA 1C1XB 2BRUA 2W2KB 2WE8A 3EAGA 1PJTA 1H9BA 2AHRA 3KLMX 1H2HA 3KO8A 4GH5A 3WMWA 4ROSA 1MP0A 1M2WA 3UKOA 2DUWA 2Q1TA 3SBOA 4K26A 1T4DA 2HQ1A 4MVJG 5I7EA 3FN4A 3FHLA 5JDIC 2ZIZA 2E48A 5CEJA 4JK3A 2C54A 2PY6A 5IJZA 1PSDA 3VTFA 4D7AA 3QLJA 1MGOA 3LC7O 5ILGA 2OP1A 5JCXA 3TJRA 3S2GA 4E12A 3WFIA 1ENPA 4ID9A 4R1TA 4XYMA 2Q1SA 2C5EA 1X1TA 4MIYA 5KNLA 4BO8A 3WOHA 4P22A 1B26A 4OGWA 3RBXA 3V1YA 1PIWA 4L8VA 2P9CA 1WVGA 3WNQA 2BELA 1SNYA 4OJNA 3IOYA 3DB2A 1VI2A 3B1KA 3BTVA 2B4RO 1I3KA 1ADBA 2E4AA 5TLSA 1JDJA 4WLFA 3BHMA 3GVIA 2OBYA 3GDGA 3W8EA 4KZPA 1I10A 1WAMA 4RO0A 3S2FA 1E7MA 3PJEA 4C7KA 1N9GA 2PGJA 4UUNA 1BW9A 2VOEA 1ZZEA 1LDGA 1VPDA 2XXBA 1IB6A 2YY7A 1BVUA 3NX4A 3IL2A 4CPDA 4NQZA 1ULSA 4M55A 4NNJA 2CF5A 1GYQA 1LDEA 2FWMX 3FNHA 1U28A 5BSFA 5KCZA 1GAEO 4CLRB 3B1JA 1PZFA 1VE9A 2BMAA 4YDRA 5JDIA 1Q7GA 1BDBA 5AYVA 2YHIB 5MGBA 1D1SA 4H7PA 8ADHA 1Z82A 1V3UA 5U1PA 2OFPA 4OO3A 3PQDA 3GOHA 5G4KB 4W7IA 4FC7A 4BV8A 3GFBA 1PZEA 2OZPA 3WGIA 3CH6A 4I8XA 5IDWA 1E3JA 3C1TA 4FFLA 4IJVA 2UYYA 2O7SA 1P0CA 5A4DA 4BQPA 4NBWA 4BVAA 1P1JA 1QYCA 1SC6A 1ENOA 1YO6A 4CV3A 2HK7A 4OXYA 1PZHA 3Q1LA 2AEMA 3VH2A 5A9RA 1A71A 1SEPA 1NTOA 4JROA 5DCWA 1GQQA 3ITKA 4BOYA 4K9DA 4XYGA 2B36A 2RBEA 3E5RA 1F0YA 5IG2A 4RQUA 1I30A 3QVOA 4B7CA 5GZ3A 3GLQA 2NVBA 2Y0EA 2HUNA 4Z3KA 3K31A 3WFJA 3OJEA 2VOJA 4YJGA 1QV6A 3KYCB 1MG0A 2VHYA 4CQMB 3JQ7B 5HTOA 1AHHA 3FI9A 3K9QO 4DYDA 3I3OA 4URFA 4E5KA 5BNTA 1WNTA 1QMGA 3H5AA 3DBHB 1UXKA 1TB4A 4B79A 1GV0A 4NDNE 3ZWBA 1Y7TA 4R1UA 1SEVA 2B69A 3AUAA 1J5PA 2PV7A 4XZ3A 2FN7A 3MOIA 4OH1A 1GUFA 1E0DA 4OMUA 4DC1A 4QUKA 3M2TA 2D4AA 1XLTA 3L0DA 3WGYA 4F6CA 3DAGA 3RFVA 3BA1A 2W2KA 1C1XA 1F8FA 4XKJA 1UZMA 3VPGA 4IQGA 2X9VA 2D59A 4J4BA 3P2OA 3GVCA 2J3HA 4PLWA 3PGXA 4HNGA 4DLBA 3V1UA 2BH9A 1QR6A 2VT3A 5K0ZA 4IDGA 4UEOA 1VSVA 3JQEA 4J91A 1M76A 5BT9A 3ZW8A 1CIVA 3T4EA 2BFMA 1P3DA 1RM5A 2DAPA 1N5DA 4A27A 3SJUA 1N7HA 3DOCA 3U4CA 4WE3A 1YB4A 3C7AA 4XQEA 4R4JA 3EHEA 4XR4A 5JW6A 2X0RA 3GA0A 2J3IA 5EJ2A 3RUIA 3PLRA 3WGQA 2GPTA 1YL5A 2JAHA 1U4OA 3HUDA 3IMFA 4NK4A 3E8XA 1ORRA 1MXFA 5EINA 2ET6A 5L53A 4M1QA 2BFOA 4Q3CA 1FDVA 4Q3NA 4PRKA 5DZSA 4WKGA 2CMDA 4GBJA 3TN7A 4CUZA 2HRZA 4RPGA 3SLGA 4II3A 1OOEA 3GGPA 4CJXA 5KIAA 3L77A 2J3JA 2WMDA 3L4SO 4HX5A 3K2EA 3MTGA 2QRLA 2X9GA 4A10A 5TNXA 2UVDA 3ZV6A 4PCVA 2JKVA 4U0JA 4E2XA 4R1NA 2YYYA 4J1QA 1LSUA 5G0VA 1TT7A 4KTVE 4ZA2A 1P0FA 4AJPA 1Q0QA 4CLRA 2B35A 4I5DA 3X2FA 3O03A 2GN6A 1U4SA 1U7TA 2YHIA 1R0SA 5TF4A 4GI2A 1NQOA 2NNLD 5H82A 3O26A 1HLPA 2LDBA 4GWKA 1Z75A 4IPTA 4K28A 5G4KA 5BSHA 4NIMA 4B3IA 2HCTA 4ZICA 4E31A 4B7UA 2C2XA 2C5AA 4WCFB 1CETA 4XR9A 4CLXA 5CFZA 2GR9A 4BNTA 1NR1A 1LDBA 3ZNOA 3ROMA 3OBBA 3TF5A 2A92A 5B37A 2J5QA 4GWGA 2X1HA 2ZK7A 2VWPA 4Z3DA 1G1AA 4FJ1A 4XYBA 4JCOA 2NTNA 4NG5A 5DDIP 4CMCA 1W8DA 2O50A 1QSGA 3N7UA 4Z0PA 4D43A 1NAIA 4YAGA 1ZH8A 1W73A 4AICA 1N92A 4RLHA 1XU7A 2Y1FA 2VYVA 3FTNA 3JQ9C 4ND3A 1UUFA 2NU6A 3I4FA 5A02A 4Q39A 4DC0A 4TQGA 1Y9AA 1KEPA 1B15A 1U3WA 3A4VA 2PK3A 4ALLA 3OECA 5J23A 3S2EA 1PQUA 3KYCA 4CQMA 4PLFA 1F06A 3JQ7A 3WLEA 2PKRA 2AG8A 1IZ9A 1HEUA 2NWQA 1I0ZA 4P4GA 3WGGA 5L4SA 1BVRA 1GPJA 4RPKA 2YV2A 4LVUA 3ENKA 4RF5A 3D3WB 2X9NA 1R37A 3QJ5A 5A06A 1ADGA 3KB6A 4LISA 1RM3A 4GVXA 3R6DA 5I9MA 4WLUA 5T8KC 5ICMA 1O5IA 3FNEA 1XDWA 4PIVA 2EV9A 3MJVA 4CL3A 1HT0A 2JFGA 4PLCA 1BMDA 1BSVA 2O48X 4W82A 1DO8A 1PWZA 2GN8A 5ENVA 3D7LA 3K8ZA 3V1TC 1Q1NA 3RU9A 1PEDA 2G76A 3RROA 1Z45A 1M6HA 1UR5A 3WR5A 2EGGA 3GGGA 3RVDA 4A7PA 1GY8A 4AJJA 4AJ4A 1L1FA 2YFHA 3PLNA 3IJPA 3QP9A 4YVFA 5K6AC 4Y6SA 1NXQA 1XELA 3UFXA 2FPPA 5DF1A 3V2UA 4AJEA 4EUEA 4ZGWA 4YJHB 3W8FA 3OMLA 3LC2O 5EIOA 2HMTA 3BTSA 3DTTA 3PWZA 3DONA 4F45A 1MV8A 5JAIA 2DTXA 5B4VA 3OIFA 3B1FA 3BIOA 1P1FA 3G0OA 2Q1WA 5CAEA 3C1AA 1MB4A 2RH4A 4GMFA 4CV0A 4HV4A 5ITWA 4L4RA 3ZWNA 2B37A 5LDGA 2X4GA 1GDHA 1JU9A 2O3RA 5ENDA 3UCEA 5T8KA 5G0SA 4RQTA 2I66A 4EDFA 3I5MA 3AW9A 4UUMA 4ZRNA 3VZQA 1H6DA 3RC1A 2RHRA 4MPDA 1JVSA 3BTUA 3W4KA 4E6PA 2X58A 3E9NA 1M6WA 1HDCA 3ICCA 3LT2A 5LC1A 7MDHA 4L74A 5JMWA 4FBGA 2EW8A 3TL2A 1ML3A 3HN7A 2VWHA 3EVNA 4TRRA 5T64A 1DXYA 4J9VA 5L45A 2JHGA 4RVFA 1EBFA 1M66A 4CV1A 4DMLA 4YQZA 3EVTA 3GH3A 2GD1O 3WIEA 1PTJA 3VPFA 3ONFA 1FDSA 1ONNA 2NLOA 3JV7A 3AOEC 3VTZA 4YT2A 5AXAA 4YACA 3UAGA 4BMSA 2I3GA 5AVOA 3H2ZA 4N5LA 1MXHA 4BL5A 4WCFA 2Z5LA 3OHSX 5KVQA 3U0BA 5TRTA 3K73O 2Y1OA 1V6AA 1HDZA 4IDFA 2CDAA 4WUVA 1KY4A 4B3HA 3O4RA 2Q2WA 3ENNA 1MX3A 3H9GA 3LSYA 4II2A 3ZV4A 5CDSA 1XU9A 3R3SA 4IQ8A 4BNHA 2VUSA 1KYQA 2ZKLA 1Y1PA 4J90A 3UXYA 4P4NA 1UZLA 3ULKA 2UUOA 4R69A 2VHXA 4EI2A 1GYPA 4KDEA 2C07A 5GZ1A 1SB9A 3W4IA 4E5PA 2E82A 3ONEA 5C5IA 5DULA 5ICSA 2XAAA 3ASVA 4PG4A 4JP2A 1B2LA 4L4SA 1WPQA 1H6AA 2PTGA 4YRDA 2DBZA 1YKFA 1KC1A 2PZJA 3IUSA 4UAGA 2GN9A 1N8KA 4ALMA 1WDMA 4TVOA 1BTOA 1BHSA 5EN4A 3IDSA 1ISGA 5HS6A 1O89A 3H9UA 3RJ9A 2W90A 3CUKA 1PL7A 2HJRA 3FTPA 2VQ3A 4E0BA 4FFPA 4R68A 1K6JA 2QHXA 3DZKA 5AXBA 4CMBA 3D3WA 4XEHA 5TC4A 4PFJA 3KXDA 4DPMA 1N7GA 3HFSA 4J4TA 1NPYA 3HDYA 1DLIA 1PL6A 3C24A 3NDRA 2EJWA 5L7WA 2BLLA 3JTMA 1NP3A 4RPLA 1S6YA 5U9CA 2FPIA 4QXMA 4BGVA 5KKCA 2QQ5A 5IN4A 5KWEA 1NNUA 1PJSA 4UVDA 5JC1A 3NGLA 3AFMA 4CM7A 3PP8A 1CRWG 3BAZA 1MG5A 3E1KA 2HDHA 3GVHA 5I8WA 2O4UX 3PIDA 1FF9A 3IP3A 4QECA 5TT0A 4KDFA 4WK6A 3LLVA 1E7WA 1DRUA 3QQPA 5EESA 1I2BA 1VC2A 5DP1A 1PGQA 3MJTA 5I7SA 2EERA 5JAQA 2ZCUA 3DBRB 3LLSA 3RIHA 4XYEA 3GEMA 4DGSA 4YJHA 1LLUA 1EE9A 1SZJG 5A3VA 3LQFA 4EUFA 1DIRA 1EUZA 3ZI0A 1CF2O 2BGKA 3MJEA 4MVJA 4CQLB 2HJSA 2J6IA 2VHVA 3H7AA 3ADPA 3PHHA 4BKQA 2Z1NA 1PS8A 2P4QA 3VAZA 3PJDA 1PGPA 3C7DB 2POQX 2O23A 2PD4A 3OA2A 1DOHA 2XF8A 5BSEA 4ZU3A 2B5WA 2CFCA 2XPCA 2I99A 3NEPX 1DC6A 2VYND 2HMUA 1GFSA 1RM4A 4GVLA 4BNLA 1J49A 1U2GA 2VN8A 2H1SA 3SC4A 3KEQA 4D3DA 3F4LA 5KJEA 4LW8A 3TZQA 2YQ5A 2PZKA 4XB1A 2R00C 3GMSA 3GT0A 3U9LA 3WMXA 1NWCA 5ADHA 1FDWA 1LXCA 1P33A 1EBUA 4PG8A 2Y99A 2VZ8A 5F21A 1KEUA 2Z1MA 2AE1A 2ZATA 3C8MA 4Z9XA 4ZVVA 2Y93A 1NX6A 2UUPA 3Q2KA 3AI2A 4IBOA 3KRTA 3AUSA 3QY9A 1NVMB 2GSDA 2RIRA 4IMPA 2FR0A 3GAZA 4U5QA 5ER9A 1M75A 4CODB 1QYWA 1U3VA 1LSSA 1U9JA 2Y68A 4P8RA 4OQYA 2OXIA 2IDZA 4DBZA 1ZUD1 5TS3A 3V2GA 1E5QA 3MCVA 4M49A 1E3EA 3DO5A 4E33A 2GF2A 1OBFO 4TZTA 2G17A 4TZKA 4R3WA 1KVRA 1UXHA 3D1LA 3L07A 1LSOA 2BF7A 3E82A 3WBFA 4EGFA 1V3TA 1VL0A 2Q4EA 1OZAA 2ZTUA 3L4BC 4FJ2A 3RUAA 4IZHA 4NFSA 1UDBA 3SX2A 4L76A 2VWQA 2O3TA 4UULA 1YQGA 5IZCC 3JD2A 2O3SA 4XGIA 1P1HA 5L7YA 1U7HA 2WD7B 3VDRA 2Y1EA 1AN9A 2XOXA 2O7QA 4OM8A 3WLFA 3ZNNA 2Y66A 3C7CB 4U6SA 1V3VA 3DAFA 3WTBA 2PH5A 3E6AA 3LF1A 4INAA 4KTTE 4TKMA 5G0UA 2AW5A 1ZCJA 5KJCA 3I52A 1HKUA 2YV3A 1LA2A 5KVSA 3KEOA 1VL6A 1HYHA 2B83A 4Q9NA 4YEDA 4B3JA 5B4UA 5JYDA 4LGVA 1YBMA 2DVMA 3UCFA 2AEJA 2Y0CA 2IYPA 3F9IA 4EJ6A 1Y81A 1ZXLA 5JAZA 1Z7BA 2QYTA 1PJCA 3AUUA 3F47A 1OFGA 4EUHA 4DREA 2EGHA 5FF9A 1FXSA 2NVWA 4ND4A 3NT4A 1DAPA 4JLWA 1EVYA 1Q7BA 2AE2A 3U5TA 3ZHBA 4DUPA 1YB1A 1GUYA 2GASA 1WLYA 3ST7A 3VZRA 4DA9A 4EW6A 4BNVA 1GU7A 3GN2A 5U4QA 4BNJA 1O8CA 3VH1A 4MKZA 3UUWA 3DBRA 3W1VA 3E5MA 4DBVO 5B1YA 5IZCA 4FJ0A 4HADA 4AJLA 3PHIA 3SC6A 5AXCA 5JMPA 4FIZA 3BHIA 4YJFA 2EKPA 1LDMA 3S2IA 3DAPA 1PJLA 2EHDA 2OMEA 3PI7A 3TOXA 1EMDA 2C7VA 4CQLA 3KSUA 1R15A 4U7WA 1TA4A 4YR9A 3LT1A 5TGDA 3RQSA 4RF2A 4EZBA 1P45A 1C1DB 4OSOA 3G1TA 4UREA 3RUDA 4CUKA 4NI5A 4J0EA 5JDCC 3C1OA 1KEWA 1YWGO 4RF4A 4ZQHA 3KUXA 1JAXA 1B16A 3OICA 3GHHA 4NR0A 1UH5A 1NQAO 3PZRA 3EMKA 3UW3A 3WGHA 3WG9A 4DQVA 5CDGA 2FHSA 2E49A 4HNHA 4FPXA 1Y5RA 4NJOA 4Z9YA 1HSZA 3DXFA 4PVDA 1XYGA 3L6OO 4U0KA 1ZO8A 2PD3A 3JYPA 3GVPA 2A4KA 4E5MA 3HWRA 1HDRA 2A9FA 4NBTA 5F5NA 5TQVA 4ND5A 3CINA 3SJ7A 3QVSA 2V6GA 4G5HA 4MP8A 4R5HA 4F6LA 1PGJA 1GR0A 1DAOA 2GCGA 2JFFA 2IXAA 1CWUA 2WDZA 3Q2IA 1T2CA 1QYDA 1YBVA 1DPGA 1YDWA 4CM1A 1IYZA 4GGOA 4FW8A 3H5NA 2V6FA 1ADFA 1E3LA 2V65A 3KYDB 3EC7A 4O0LA 4IJKA 4BMNA 3BYZA 1OMOA 4QFCA 5JPIA 3GF4A 3D4OA 4WLEA 5L4LA 5EERA 4KQXA 2JFHA 3DZGA 1CEQA 3MWEB 1BGVA 3ZU4A 5I7FA 5IZ4A 4UUOA 2A94A 5TJ9A 1HZJA 4PLGA 2X86A 3W6ZA 4M86A 4K6FA 3LDHA 1DIHA 3B20A 2VNAA 5DBFA 2WYVA 3Q11A 7ADHA 4BKOA 4W6ZA 3VVCA 2J5KA 3GY0A 2FR1A 4YQYA 1F14A 2H6EA 1CYDA 3NDIA 1X13A 2WD7A 3FR7A 3KTDA 1R4MB 4IMRA 5IDQA 1ZVMA 4E21A 1X14A 3ZHXA 1I3NA 4B4WA 1OAAA 2GERA 2J3KA 1H6BA 1MUUA 2Y1GA 3JD4A 3F1KA 1JKJA 1PS0A 1F12A 2CVOA 2PZLA 1Y5MA 4LSWA 4MINA 4IDDA 5KKAA 2ZB7A 4HWKA 5ES3A 3F1LA 4BKPA 1H5QA 3JQCA 2Q4BA 1ONOA 5JNLA 4O63O 3CEAA 2ZB3A 3NJ4A 4DXHA 4WECA 3ZNQA 1H9AA 4E3ZA 1ZW1A 4J2OA 2Q50A 5LCXA 5CG2A 1XKQA 2VZ9A 1EEHA 3NUGA 4IGEA 4UUPA 3INGA 1HE3A 4JBHA 2YDYA 2HMVA 4J7UA 4R9SA 4Y98A 3WJ7A 2YQ4A 3PHLA 1FDUA 1H93A 4M54A 4PVCA 3RBVA 1YGYA 1WDKA 1DFIA 1LSJA 2X22A 5DCYA 1IZ0A 3FD8A 4IZIA 4TSKA 3GHYA 5COQA 1DRVA 6ADHA 4GSLA 1ZK3A 5JAMA 4DIOA 3C3XA 3GUCA 1VSUA 3GPIA 4J6FA 4N7RA 1UXJA 3ZWXA 4EITA 4RLSA 1VL8A 4MVJH 1X7DA 2ZTLA 3GZ4A 4MIEA 4G2NA 1H0KA 4LCEA 1HDOA 1DDOA 2R6JA 4J9UE 4E2ZA 5JSFA 1NQ5A 4I5GA 4WNIA 4GAEA 1NVGA 4K1LA 4JBIA 4UVGA 5CEFA 3JD0A 4G81A 1DJQA 4D41A 4ZRMA 4W99A 3JQBC 1C1DA 4ND1A 2C2YA 1QV7A 3TFOA 2EF1A 4Y9DA 1OC4A 1G0OA 4ITUA 4R16A 1NQTA 1XA0A 3MEQA 3JQ6A 4BUCA 4OYRA 4C4OA 3FF4A 1A27A 3ZHZA 1YJ8A 3TOZA 1W4ZA 4YRAA 3WICA 1WDLA 1CDOA 2VCYA 2O4CA 2J5RA 3QV1A 4TRMA 4DRYA 4F3YA 5JO0A 1VJ1A 3JD3A 4LMPA 1HLDA 2NTJA 1TI7A 2BHLA 2O3JA 1GEEA 2Q49A 3Q9NA 1W6UA 2H63A 1QG6A 3WYBA 3MJCA 3ZCXA 1SB8A 2NM0A 1LJ8A 2BI8A 1EE2A 1W0CA 3ZU2A 4EBFA 3CMMA 2P4HX 3GPDG 1XWFA 3NV9A 1ZIDA 4JNKA 2CZCA 4BNZA 4BNFA 2BFAA 2VHWA 1GV1A 2FOIA 1V0JA 3DBVO 2I6TA 3PYXA 4BNGA 1U8FO 1J4AA 3ZWYA 3EY4A 4B4VA 3JYOA 3KYDA 3GK3A 4KMSA 4MDHA 2X8LA 5ITVA 3RUEA
chains in the Genus database with same CATH superfamily
5FR2A 4AECA 1WM1A 1OJLA 1CNFA 2RK3A 2XNJA 2JJQA 3U4DA 4D79A 4ZK2A 1YZLA 3BMQB 1GTMA 3PEUA 5KDOA 4ARAA 2ZXUA 4YUVA 2DX7A 2I4NA 1CB0A 4WBXC 4FFRA 4MGZR 4UDNA 2CLCX 3INYA 5BQ3A 4X8OA 1VCHA 4AROA 3OKAA 3BD9A 1T3HA 1V8ZA 2B8TA 2VNKA 5ERYA 3O3CA 1V8BA 3EBPA 1P4GA 4ZJYA 3DMTC 2QW8A 4R5MA 4JN6B 3ZBQA 4P2GA 5DNYB 1H8HA 5JJLA 5KVCA 3BIXA 3PICA 2FFJA 1ZZGA 1L7EA 2J0VA 2VJAA 3I2KA 4IQ0A 2KS6A 4IXTA 4BVBA 3IQXA 2VC2B 2Q2QA 4OHCA 4E3WA 3CJRA 1PDVA 3KVOA 3BK2A 4WXRA 2HRQA 3B78A 4FOOA 4F4HA 3R4VA 2BI7A 4JKOA 4Q4HA 3PNPA 3ROEA 3PDHA 4KBYA 3ZQ6A 4BU1A 1ZJ5A 3SQWA 2Y67A 2PPLA 2NUAB 4YCBA 4C3OB 4KCGA 1QF6A 2I2CA 4D5EA 1QH8B 3OPXA 2BFDB 4G4JA 4I1OA 1GPNA 4Q1FA 3UV3A 1D03A 4JXXA 4HDRA 3EIOA 1B8PA 4ER6A 1B8NA 2PZAA 1KJJA 1MB3A 2JCXA 2R6HA 3IP6A 4X8MA 1T1GA 1HRKA 1S89A 4HCJA 4W1PA 3IEMA 5CM9C 3VR4D 1O0SA 2RHJA 3DC2A 1VG8A 3OAAD 3K70C 5DGDA 1GLGA 1QJ4A 1EAYA 1HTTA 1EI9A 3FF1A 2KJQA 3N3AC 2PUBA 3DR3A 1U1IA 3F5QA 1KOLA 3NHWA 4CKEB 1KS9A 1RKUA 3IURA 4M8SA 3HCOA 3HXKA 1T8PA 3GYGA 4OQQA 4PLPA 4Z3OA 1ZOIA 4F4IA 2I67A 1XROA 2C9CA 2Q28A 4IKOA 1YI1A 1S3GA 4XH9B 5CXSA 5AJWA 1A9YA 1I4LD 1BU5A 1DC5A 2E0IA 3QITA 1U0GA 1XOIA 1I5EA 1WVIA 3IRVA 1TVKB 2RCNA 3EC1A 1P81A 2GAFA 4HEA1 2CUTA 2JB9A 3AJ8A 3DMTA 3U49A 3FVTA 2RHHA 4KODA 3UA3A 3SLKA 1V2HE 3BXEA 1M7BA 2XUFA 3C3YA 2YDXA 5ECGC 3U7JA 2PT6A 4D46A 3IAEA 1OXBB 5CIQA 1ZAYA 2GNAA 2JH8A 2NO5A 1QKKA 1EXNA 2YASA 4TUYF 5IJWA 1GT91 3I45A 4XUGB 3CIOA 1J5XA 3H3XA 3JQ9A 4RQAA 4LJYA 3TZEA 3FGPA 1Y8RB 1XD8A 2HA6A 3EGEA 2IS1A 3YASA 4GM4A 1S5PA 2HHCA 3QUTA 1EFRD 3P19A 4FR5A 4KIJA 3KQHA 1U8UA 2QX7A 3DZJA 1E94E 5I8PA 1NYTA 3AF3A 2H2WA 4HDKB 2FY8A 2J33A 3EARA 1YBAA 2X8BA 4WEOA 5L6LB 1G6OA 1XTVA 3UGJA 1M2GA 4FDMA 4D0GA 4LHYA 1H2ZA 4Y6RA 1EK6A 1SHUX 3WDSA 4Z54A 4YECA 3RSLA 2D62A 3Q7RA 4WXMA 2J9FB 2WUGA 4H16A 1I51A 4RY2A 4IOMA 4L7QA 1DC4A 3TTYA 3OIGA 4Z0NA 4HL6A 4ZGBA 1U98A 4NZNA 2ZAIA 5CFOA 1YJ5A 1QRTA 3R7WB 3QI2A 3FKSD 1PDOA 3B6MA 4DA0A 4EA6A 3K5PA 1ENYA 1T9DA 3VHXB 1F0NA 1BXZA 4ZOBA 1KBQA 4XGKA 3AY3A 3VYSB 1X9GA 5J43A 5LSAA 5DK4A 3L01A 3W5UA 4D9JA 2QXUA 3PC7A 2IXEA 2P7HA 3IQWA 3GEGA 1NDUA 3CKKA 2XMGA 4FCCA 2YVQA 3Q88A 4P3OA 4XFJA 5C2JB 1EZ4A 2Q6IA 3PUZA 1DUSA 2G1JA 1BHO1 2V03A 1QG2A 2JL1A 2ROQA 1I6LA 9LDTA 1WEHA 1SXJC 4RCVA 3G59A 5D7NA 3JSAA 3IBSA 1QNLA 1KOGA 3CX4A 1EG2A 2CXOA 4ZANA 2Q5LA 4DR5B 1IJBA 4FMCF 4EUSA 1FUEA 2C95A 3GJYA 3C85A 5T4BA 4EG1A 2AYXA 1FS4A 3G9QA 2JCGA 4FHFA 4YIKA 1CUJA 4N5MA 5T7BA 5SY4A 4F8YA 3KAKA 4FEEA 1J90A 2H1RA 1DTWB 1OFUA 1PWEA 2J32A 4IY1A 4REMA 1SUSA 5EGNA 5I7HA 4IDPA 2OWDA 3B6ZA 3ZTYA 3P2KA 1WU7A 2Z98A 3IV9A 2CE2X 3A6ZA 4TLAA 2J0EA 2CFSA 3M6AA 4QDKA 5AKGA 5ALQA 4QTXA 1CY7A 3ISVA 1Z2EA 3F6BX 3HWWA 1E96A 2OWEA 3LO8A 1LVGA 4KBGA 1KA9H 2WP8J 1OJ7A 3R0VA 1ELOA 2FSIA 2RGEA 1KJ8A 4K6CA 3A25A 3AF5A 5TEVA 4EMBA 1KO8A 2B98A 3CNOA 2PR2A 3IPRA 3ZHRA 2QZ9A 5IJ0A 5JCJD 1TKBA 3B5IA 3DBLA 1DBVO 3JX9A 3WLNA 2ZYGA 2MSKA 2P5UA 4OKSA 1HOXA 2W6ZA 3EH1A 4RFSB 4C4SA 3RU2A 1BDMA 3GJ6A 1IEVA 3I6BA 3QEMA 1D6MA 4YJ3A 3GGJA 3ZY3A 3BE8A 3FVVA 5BW5A 2ZUBA 3QU7A 4PXYA 5AJZA 2D74A 3FDIA 4FOSA 1FFSA 4YMLA 3GCZA 2RCYA 4IJMA 2B1QA 3NTOA 3BBLA 1SVOA 1YZKA 3IDZA 1YL7A 4YT5A 1GPAA 4BLRA 4BYGA 5K01A 2C4NA 4GSKA 2YOHA 3VNRA 2NO1A 3WSWA 2G80A 4CTKA 3OZTA 4KFCA 3AESA 5KQPA 4ZV7A 1OF1A 2PR7A 1MV5A 3OIWA 4H1VA 1PQPA 1USWA 4WNCA 2JCVA 3FKQA 5B58T 2I3ZA 3OQ6A 2LRHA 2D0IA 5HM8A 4EK9A 1QJCA 4QQ8A 4FBLA 4OMFG 5AKIA 3SWWA 1M2VB 2FHPA 5J4VA 3L6EA 3HJGA 4GR4A 1O6GA 5LZ8A 4AG3A 3T54A 4MV6A 4RADA 1KAHA 3B1VA 3MWJA 3OQIA 4Y8VA 1JLLB 5FOXA 3TFQA 3KXLA 2IPOA 2F90A 2YWJA 3K0KA 3PD1A 1RJ9A 5JFOA 3EXIA 5KOHB 3DWEX 4DUGD 4ENTA 2F2TA 3LXMA 5IARA 3E48A 4G3XA 1EAMA 3KPWA 1T2UA 2V55B 2WFZA 5G4LA 4LF5B 2J0UA 2QXYA 4FC6A 2NU9A 3D2LA 3RKUA 3RWBA 1N2GA 1UXGA 3BILA 5AVKA 1JFSA 4H3VA 2BJHA 3JVDA 4KH1A 1RXEA 2VPZA 3QIVA 3L1HA 1A8SA 4NH0A 5ALGA 1CVIA 1PYOA 3AR6A 2H85A 1O57A 2GK6A 3PPIA 2OESA 1PFVA 2NZUG 3H16A 2P2CA 3QWHA 5FAXA 3W8DA 3REOA 3NOQA 2EW1A 3KZ1E 1MPXA 4FSDA 4GMGA 4EHHA 4MUFA 4HK4A 3PC8C 2B4YA 1JDSA 4Q66C 1B6GA 3TPCA 4E5UA 4MYHA 2QDXA 3IOBA 3ZCQA 1CVRA 2I76A 4ICIA 1MEJA 1DQYA 3OZBA 3QEKA 1ABBA 4QREA 4ZOLB 5HX7A 4RVDA 1B7GO 3A6DA 4QUHA 2WVAA 4EEKA 4YXWD 1XTRA 3AOGA 5DISB 5EA2A 5AHOA 4Q9AA 5LYJA 3SMQA 1E64A 1UMBB 2UZ3A 4XPIA 1ODCA 4P58A 3ZIDA 4ZO6A 3O47A 1PVVA 2V45A 1BAPA 4KSYA 1PGOA 1LX7A 4DIFA 4CN8A 4W5RA 5E7JA 1JHMA 3QX3A 1ADCA 3R3WA 3HDHA 5EJMA 3PT5A 4G0VA 2FPMA 2ADFA 1AF4A 2ARKA 3TLGB 4CGZA 4G37A 3B1ZA 2AUTA 3A1VA 3U37A 3IVRA 3AZOA 4UE3S 4CDRA 2G9RA 4CG3A 2ZB4A 1FSFA 2ZWVA 4MIKA 3T8YA 4TT3A 1GKLA 2Q2NA 3K9LA 3RD5A 4LF6B 1J9ZA 2DB3A 1BN7A 4H7DA 4LV6A 3ZVLA 1QS0B 5GIOE 1L3BA 3SC2B 3SYTA 1IK4A 5K0TA 1CP3A 1BX3A 1ODJA 3OM1A 4D25A 3WLJA 4YRGA 3GEDA 1RAHA 2YH2A 2FG7C 2E5FA 5FRDA 5BV8A 3ZDAA 1VLHA 5A6SA 5T4FA 3UMSA 1NN0A 1P4HA 3VC1A 4AO8A 4FFBB 4MV0A 3VYRB 1NMZA 1XN4A 2YIVX 1DT5A 3G6KA 4KQWA 1XHEA 4Q6BA 2QRJA 2I8LA 4LYFA 3RW9A 2XXAB 1DFHA 1Z6XA 3DP9A 3HYTA 4BMPB 4K0KB 1GUBA 2QSYA 3NWJA 4KO1S 3TOSA 2HU7A 3RREA 2H4FA 3K6SA 2UZIR 4J0FA 4NHEA 4UPVA 1WF6A 2I7VA 1MC5A 2HEGA 4BO3A 3PQFA 2DH5A 4I1SA 2AQ8A 4KUHA 1VLLA 1LC3A 5C5DA 4ZT7A 4PAGA 1R18A 2ZYAA 2AZTA 3H3FA 3LM8A 4C14A 5HWSA 1QYIA 5LMUB 3GT4A 5GWXA 1ZEJA 1PF7E 1RQNA 2AC4A 2CCJA 2I7DA 2FXIA 2Q6OA 3QKIA 5JFGA 1XEAA 1ECJA 5F3DA 5C3MA 4M0MA 4UEJA 2GPWA 2AQKA 2CCKA 2CJFA 3N07A 4BO1A 4D6YA 4I5EA 2OK7A 1R12A 3SM9A 3WLOA 4UE2A 2GZMA 1J22A 3D8TA 5INTA 1L1RA 2C9MA 3O9ZA 5EJFA 1C0PA 3AZQA 4R6WA 1U2QA 1JPNA 1X1SA 2XDWA 4LJRA 5F7OA 1RFLA 5F78A 4CEJB 1KETA 3N7TA 4CQJA 4BO6A 1I0LA 2GRUA 1S2MA 2FZVA 1Q95A 2QVBA 4BGEA 4K6OA 4IIFA 3E3OA 4W1SA 2R00A 2FU5C 1BNCA 1KMHA 3MSCA 3FOZA 5I48A 1PKXA 2OZEA 3HC7A 4CQMD 3MGAA 1FNMA 4QU0A 1UPUA 1M8KA 3IS3A 3U3XA 2WFAA 5FFFA 1ZP6A 2HSZA 2W2LD 5H8WA 4MGEA 1BN6A 1FRVA 2OA0A 4AS1A 4AKGA 4Z4HA 2ZI3A 5CT4A 3LA8A 3DULA 5K2OA 1KSHA 3FMGA 5CMLA 5L3QA 1SC3A 1JAIA 2X2EA 4MRMB 5HM6A 1DBPA 5GQSA 1UAAA 4N12A 4GM1A 1MOQA 4OGGA 1RDFA 3VZPA 1P62B 2YMPA 1Z5NA 2XTAA 1XMQB 2PSEA 5L7TA 1J70A 1PW5A 3A9WA 3DXXA 3JU3A 5G2OA 3QWFA 1CEEA 1GXSB 3JRWA 3WGUA 4NX2A 4IX9A 5KUTA 3WAKA 4YYZA 3C3DA 5CT6A 4AWBA 3WKEA 1EDZA 5FX2A 1EWKA 3OU6A 4CTNA 4DCNA 1HL3A 1ZJJA 3IB6A 3OFSA 3D2AA 4K9LA 1FFEA 4ZCSA 2A58A 2Z09A 1ZLYA 3KVVA 2RI6A 1TF7A 4IH4A 2V4MA 4QAJA 5DIZA 5AOVA 3S27A 4EEXA 2YFYA 3AM3A 2DKOA 4KFUA 3GAFA 4YJKA 3NLLA 3QVGA 5TB5A 4AP6A 3F7OA 1NE2A 4YMWA 3JR7A 4KQ2A 2UAGA 4U5XA 4WLVA 2VPXA 4RK6A 3ANYB 2LKDA 3GZJA 1YB7A 2N46A 3PEFA 4BO0A 1CR2A 1HT3A 2AQHA 3DNPA 4AZ3A 4CNQA 1UKVY 2FPGB 1JR3E 1YFJA 5EZYA 1KC3A 3ETCA 4G65A 1YS2X 4JUAA 5E4FA 2WTXA 3GG2A 4BP3A 3E18A 4LV5B 3W9YA 4AVYA 3SQXA 4XYLA 1VHDA 1LPSA 1NF8A 1JHAA 4D8UA 2V7TA 3Q3GE 2R86A 3UAXA 3L02A 1IBRA 5CIWA 3UXHA 1NQXA 4JY7A 4NZOA 4D3SA 1NW9B 4PM4A 3RT7A 2JFXA 3CSSA 2MWMA 4AQDA 3U39A 4A0HA 1BRMA 1U0FA 2Z5GA 4EJ0A 3ESZA 1OV6A 4WTOA 4FKBA 2DT8A 4JEUA 2A7XA 4AUNA 2JAPA 3GRZA 1CUXA 4HBZA 1F4PA 1P72A 2BUCA 3EW9A 3IPLA 4Q3LA 2PGXA 4P3NA 4AKTA 1CR6A 3KG2A 4XGQA 4F97A 2BMEA 1JAYA 2P6NA 4IVNA 5AW1A 2JH3A 1AXGA 2PS0A 3LZ6A 2AUMA 1RE1A 2CY0A 2GN1A 2VJDA 2JD1A 2JKYA 3MMSA 1DQPA 2JHCA 1TMYA 4M88A 1Y1QA 4NY1A 3OFVA 4BV9A 4JEHA 5ILOA 1KU6A 3UCXA 3EIEA 1U0RA 1P4AA 2D3WA 1W2GA 1YJAA 2XUZA 4MPRA 3UHJA 1STOA 2G9NA 3COJA 4CLDA 1P17A 4FYVA 3R3ZA 4PRYA 2IDJA 2GYWA 1OH8A 3OU7A 4ITVA 3G2JA 3LUCA 2B3TA 3HDGA 1O96A 3LG2A 5D1HA 3VSDA 1E3SA 5IK2A 3WBBA 4B2IA 3FBGA 3QWAA 1U0BB 1RYHA 3QLVC 5H1YA 5IANA 4A15A 3DA8A 1XRPA 3KVNA 4DDUA 2HLNA 3F6RA 4FDUA 4HDNA 3FVQA 4LXHA 3RVOA 4IDEA 3MVEA 4GS5A 2BFEB 1F8GA 4EMTA 4ERXA 4HVLA 3NM6B 2ZSFA 5LDDC 3GARA 3WGZA 2HFKA 1I1NA 2ALJA 2WMOB 1XJ0A 3HCCA 3VOAA 4ZYWA 2VQDA 1ML4A 4G5FA 3FB4A 1C4WA 4PWZA 2HLPA 4BKMA 2VPQA 1J8FA 2A5FA 1U7ZA 2A1TR 1S2GA 2BHNA 3AKYA 3H11B 4JB0A 3BWYA 1TK2A 2ZRNA 3BMCA 3LUFA 4LE2A 1L7BA 3P0HA 3U4QB 4HS4A 4MRRA 5KYWB 4BLOA 3OCJA 1K5HA 3UAVA 4I7EA 3NTVA 2WSMA 2AH5A 4H4CA 1CZRA 2JFYA 3QLTA 2OLJA 3HYLA 1N0WA 4BNXA 4FS8A 3OM9A 1YCDA 4IIHA 4A6PA 5T67A 3AX6A 1Z0KA 2ATCA 1I6WA 1KS2A 4HKTA 3R7DA 2EP7A 4HX2A 2Z58A 4C76A 3AKDA 1BYUA 1NV9A 2QZSA 5LQSA 3A4MA 3HKEA 5FI1B 2WMYA 1V9LA 2PQMA 3K53A 2ZQZA 4UBOA 4ENUA 2ODNA 2PUCA 1I32A 2ZVQX 2DQYA 1QKIA 4C03A 2NSDA 4PYQA 1J07A 1ZICA 4P2BA 4DV4B 1NBWB 2Y6VA 1KJYA 4X41A 2IU3A 3TD9A 3TQCA 1UEXC 3K8QA 4D9FA 1KO7A 3RC9A 4KZKA 1YVDA 2ATIA 3ZH2A 3Q3HA 4DVGA 2O2YA 1ITZA 4DXAA 3E3NA 2PWZA 2CLFB 3ZV5A 3ESXA 3R0IA 1WBJB 5KBYA 1NL3A 3I62A 4M0CA 3S2YA 4AF8A 2WJAA 2NP6A 2AOTB 3KZVA 3B5EA 3JSXA 4G0ZA 1SUBA 2W6IA 1VP3A 3GFGA 3OQOA 3FNBA 5CP8A 3BCSA 5ALPA 4U9UA 5EMLA 1P9LA 3GLVA 1ZWKA 4YI3A 1ICIA 5THQA 4OHMA 3TSCA 5K9ZA 2YUTA 4G8BA 4MRAA 5HZHA 3FYTA 1KP3A 1XBTA 4CR8A 4D9EA 5BW4A 4L5BA 1PWYE 3LHFA 1GUZA 4J16C 3H2JA 4YO7A 5DNAA 5HP4A 2VP9A 1J0EA 1QTRA 5F2EA 1C7ZA 1F3OA 3AYZB 4CMIA 2ZJBA 1XQ1A 2JAUA 3VTAA 2AX3A 4XQCA 2QMHA 3JALB 4GLFA 2DE0X 4AUKA 2BMDA 3O8DA 4KNWA 3MUFA 5D3MB 5FWXA 3O83A 1R1DA 3RHFA 2NQTA 4BWGA 3ZQ4A 4X60A 1SBIA 1CS0A 1XMSA 2JBHA 2OENG 2QTTA 3G2QA 3NGXA 4HZIA 1UOOA 4R7ZA 3X44A 1XPJA 2WE7A 4DCGA 1T24A 3T5AA 1UP6A 3GJRA 5M04A 4H2DA 5KTOA 3NTLA 1P2FA 2PD6A 2IP2A 3ZHQA 2O7RA 1XG5A 2E3JA 4GT1A 5JYBA 3W3AA 1BA2A 3RSCA 1NMEA 2PX5A 4Q1EA 4TV9F 3U7IA 1YONA 1VE5A 2C3UA 4HZGA 3S55A 1QVWA 3OESA 2QX9A 5DRTA 3RK1A 5ALDA 1YOVB 2DBVO 4LKOA 4GDMA 4LDJA 4QZVA 2UZ0A 1P2DA 3WWZA 5AQ1A 1SBNE 1Z12A 1Q16A 4IHAA 1EWVA 3PKIA 4LX8A 4O1MA 5GV8A 3ZTTA 3D43A 4MLPA 3A1WA 3B7GA 4CMAA 4R2JA 2Q0XA 1O6FA 4NEGA 2KQUA 2Z08A 3H84A 2HHLA 4ZT3A 4UOEA 1W36C 1SUEA 1N78A 4QO7A 1YNSA 4WOJA 4RD4A 4DTIA 3NOXA 2KYRA 2FX5A 2PFGA 2IYLD 2QMZA 3QWIA 2AN3A 4IHQA 1UJ2A 5KIAA 1Y8AA 3H5TA 1POWA 2VF5X 2FZEA 3MTIA 1HRDA 3OLWA 2IYAA 5E3IA 4WFKA 4BQOA 1UT8A 2DHRA 1YTUA 3IPYA 4J16A 4MW7A 3GN1A 3RVLA 3JYHA 4QATA 5TMEA 4TMTA 5HVNA 2R1ZA 1GAXA 4ZQFA 1NVEA 3FTDA 1D8AA 3ZCVA 4C7OA 2OFXA 1HNNA 1CQZA 1SVUA 3CX8A 4FGJA 4KPUB 2DFPA 3R40A 1P1IA 4MGKR 4RMJA 5EZ5A 3O73A 5DW0A 2C9YA 4PBSA 1Z68A 4OJYA 1T9HA 4JQSA 5BYBA 4U02A 1GCIA 1UFVA 3H9QA 4F11A 1U9YA 3AVPA 2GZRA 3DE5X 3LBAA 1GDTA 2H1OA 2GDJA 2AKEA 4DYHA 1E6EA 1VI5A 1O6BA 3GGOA 4R81A 2WWXA 4QGFA 1DBQA 1JZQA 1PJ8A 4QD3A 4YTEA 2X0FA 3TNJA 1DLJA 1BX0A 3RC7A 3MBKA 1E2FA 4BU0A 1LS1A 1UJNA 3JQBA 4IHJB 4K81B 2HKIA 1P39A 4PIMA 3SFVA 5CB4F 4Y2VA 1E2HA 4C5AA 4PRLA 1H8ED 3DV2A 4DSNA 1Q6YA 3DSRA 2C2GA 1SXIA 4P7JA 4ZAGA 2YVAA 3L41A 3P97A 1YDEA 1Z4KA 2RB4A 2W8BB 1BU8A 1H65A 4JVLA 3OEYA 1TF5A 4HZUB 2HMAA 3H18A 4S1VA 3TSOA 5I9IA 2HQOA 2D0DA 4TMYA 3UJ6A 2H92A 4LBYA 4X91A 4JP3A 4KX5A 3D0QA 3IULA 1IPFA 1FMCA 1LI4A 2IYOA 3ZD8A 1RCTE 1XEWX 1EFDN 1DOZA 3HCBA 4Q12A 3ZWMA 4J8PA 3AL0C 1Q2UA 2E1RA 3QFSA 2WG1A 3MCWA 5LLTA 5BWOA 4OHVA 5AI6A 5AICA 3RAJA 3V8MA 3WWPA 4E5NA 3QF4B 5CW1A 4D99A 1GQYA 2OQIA 4DBLE 1HNXB 5J1TB 3R7BA 4RK0A 4C0XA 4EYSA 4DR6B 3P2YA 5AVZA 2X7HA 2JBWA 1MH9A 4QGSA 1N2IA 5BSGA 1RJDA 5KNDA 1OFTA 1MO6A 2CDCA 3ZKWB 3L6DA 2LIPA 1I1OA 1XQVA 1XVLA 2VRCA 2YWFA 2Z3ZA 2ACWA 4R2MA 5CDTA 3KZMA 4MJXA 221PA 2VH1A 3GJ4A 4XI9A 1CYEA 1NW8A 2PKQO 4E5SA 3BGWA 2QQ0A 5F3WB 4KQ9A 4CBVA 5KZMB 4FMDB 5BXYA 2HCFA 1FK8A 1GZ6A 4I19A 2XCRB 3ZDBA 1NJSA 3ES9A 2DF8A 2G8LA 4JJ4A 1V16A 3F2IA 3UFBA 4CIYA 5BXQC 3DCNA 4MEAA 1WSAA 4B4DA 1KZGB 3DFZA 5FNVF 1B0AA 3T06B 3KQPA 1ECBA 2WV9A 4QJ5A 1IQUA 1EP3B 1KDRA 1XTSA 4OTZA 3PJRA 1X42A 1SG9A 2AWNA 2D5CA 3GFQA 4DY4A 1WBBA 3KLPX 3HCRA 3E23A 2E37A 2I2WA 4B9AA 3GX1A 4RORA 4C0QC 5A4JA 4OXKA 5I9SA 2Z5FA 3WMRA 1C9KA 2AWOA 5TS2A 1PFQA 1G0NA 2JBAB 3DEAA 4XLTA 4L73A 1KI3A 3RVKA 3SEFA 4RTQA 5IJ9A 2C00A 2I03A 5IABA 5F51A 3TMKA 3U3OA 1TEZA 2QG4A 3LYUA 3K92A 5FTNA 3L7CA 4ZD6A 2FYTA 1ZN2A 2XMPA 1QRUA 3RJTA 3HUUA 5CGQB 2O9JA 4MUEA 3AB8A 4B5KA 2ZJ2A 4A3SA 2RK4A 2WC1A 1J9EA 5C7LO 1B1CA 1QF9A 4GYYA 1E3WA 4DR7B 5K4HA 3AWIA 3SY8A 4F9FA 3TIIA 5BWCA 1IY2A 2PU7A 4RW0A 1G4HA 1K3UB 1L8XA 2GT1A 2JLUA 4BB9A 4KXUA 3ZDDA 1V95A 3QH4A 4X90A 1LVUA 1LW7A 5TMPA 1NIJA 4EM6A 4H15A 5GM1A 2GHQA 1KJIA 4RL6A 3F4KA 1AA6A 4N41A 1A96A 1DPFA 4QYXA 5CA0B 2HZBA 2H17A 5IH7A 2HCBA 1AUVA 4WCFC 4XIYA 5L3SA 3B85A 1X1EA 1SIUA 1JH9A 1SMKA 3PNQA 1CE8A 1Z6TA 4LK2A 4S1OA 1QZUA 4CR6A 5LP1A 2YXLA 1YFKA 4V24A 4ZV4A 2ZSBA 1N7JA 1SFRA 3NB0A 1VHJA 4RKYA 4C3UA 1G3MA 4ENRA 3F73A 4JC0A 1JALA 3NIWA 3BIJA 4HMQA 1DKPA 4JBNA 2I1WA 1JQEA 2VDQB 4C87A 2VJBA 3FPBA 4MV8A 2QZZA 3J81A 3NH6A 1MRZA 2PX2A 4AYTA 4GI5A 1LPPA 2ZSKA 1LI7A 4RPHA 2J30A 3RNOA 4YRSA 5LDHA 3HDJA 3I0NA 3PNOA 3QMMA 4WLOA 2HYIC 2RGWA 4F38A 3WLAA 4IH9A 4YAUA 3FTFA 2NT3A 4F7DA 1KI2A 1ZPDA 2OUIA 3BSYA 3E7PA 3PDJA 4OAQA 4I55A 1SZDA 3GI1A 1ORHA 2P62A 4C5BA 2BFPA 5D5PA 4F56A 1PZXA 5C5CA 1OLUB 3IA7A 2PA3A 1Z5PA 3N3BC 1WZEA 4WX2B 1LW6E 2GEKA 4K6HA 2JHAA 4QHSA 3PEYA 4ZMBA 4H1WA 3JARA 4V39A 4RZIA 4O08A 5LZ7A 3L6CA 4AD8A 4YRBA 1WTAA 2J3QA 3D7RA 4LZJA 2C5HA 3AK4A 2I1VB 2HSJA 3QMVA 1HL7A 2Z4RA 3SG0A 2IKSA 4QT0A 5FB3A 1LZKA 3V1LA 1YOBA 5ER6A 4PR0A 5GMOA 4KO4S 1BMFD 5EFZA 4B6FA 4BLVA 1RD4A 4QUJA 1UZNA 2VPWA 4OHUA 4AMUA 1BXKA 1A7JA 1A4RA 1ARZA 2FUG6 3D2BA 3L0BA 5CDFE 4GXTA 2VA9A 3KQOA 1YU9A 3NWBA 5JY1A 2MHCA 2OXCA 4ZMSA 3TW6A 5LFAA 4RIIA 1GGHA 3AHCA 3ADBA 5JROA 3CPSA 4HUQB 4PG7A 4XOUA 1HDYA 1QPBA 3V5NA 2ZSIA 2FZ5A 1U31A 1PJQA 3MWLA 1H3FA 4ND6A 1U2PA 1NF3A 1OXXK 3IEVA 4AG5A 1Q84A 4FFNA 3WXMA 2ZLBA 2CMFA 4MYRA 3T7SA 1OKKD 1FQJA 2XVYA 4P86A 4ZQEA 2JVKA 1JLSA 3EGIA 1L0BA 2LV8A 3DEYX 1HK7A 2D06A 3PNKA 1J00A 2YZ7A 3HKBB 3M4JA 3GJ0A 2MMGA 3SAJA 5JXJA 2FKAA 2NTVA 3KBBA 2F8MA 5F2KA 4MV4A 2O1EA 4S1NA 4RLFA 5TQ2B 3VHRA 1H2YA 1H2EA 4FZJA 2PS9A 2I6GA 3QU9A 4UVIA 3QX8A 1SAYA 3T3EA 2QUIA 2XQJA 2DPYA 3A0RB 1A72A 3Q87B 3ELUA 1K2WA 5BWNA 4Z4GA 1TTPB 3LX6A 2ZS8A 3M1AA 4DR4B 3URKA 2VZEA 1JIVA 1JQBA 2J46A 1XK6A 2XMRA 1R5NA 3R7SA 2HLDD 5B7NA 3L4KA 1V35A 1IOWA 1W9HA 3NYIA 5KJ6A 2RH8A 1CX9B 1GJRA 2XT0A 1A9QA 3VC2A 4DJAA 2E89A 1RWMA 1PNTA 3TIVA 1TLTA 4BWVA 4CR7A 3HXQA 3BWMA 4LIPD 1A9SA 1BFUA 3T52A 1EVEA 1EGMB 2DU8A 3PXAA 5K51A 3VR4H 4AF7A 1NJ2A 4A2WA 1AD2A 1C2YA 3JQ8A 3L0ZA 1ZGHA 4XTRA 4BUJA 5IDXA 4Y6LA 3COZA 3TKLA 3VR5A 3WHPA 4KGXA 1GUAA 4ZK6A 4YV7A 3A4LA 1ST2A 3E9RA 3OT1A 5JSHA 2I6FA 1EJBA 5ALTA 3K20A 1DV1A 1XZGA 1SU6A 4GZLA 2H57A 1YH3A 3ROXA 3MBOA 3SU8A 3CTMA 3M3HA 3GH1A 1U2GC 1WR8A 2ZQYA 4S2EA 3SIPA 4CUJA 5SY9A 4YRIA 2JJ2A 2AMYA 1E62A 2II6A 3H6KA 1EQUA 2YHUA 3AUYA 3RVNA 3ZBTA 3LPAA 4BE7B 1Q92A 4H7EA 4O4IB 4UVEA 1JF8A 2RGAA 4YA6A 4ILKA 3OZGA 4G25A 1DJNA 1T3ZA 3ZZNA 2MR5A 1QQ7A 4PQEA 1G8GA 4L0QA 5JSKA 5CDUA 1DI0A 4JQZA 3AERB 2WOOA 3T5CA 3KB1A 3X1MA 3ICPA 4NENA 3FW1A 2JK1A 5TY0A 3LUHA 3N6XA 1Z0SA 2VUHB 4MHTA 5LA6A 1OYWA 4QYIA 4XASA 2BZ1A 4EI8A 1MNQA 1T6ZA 3OJ0A 4LK3A 5HXAA 1WBDA 2D13A 3RASA 4L9RA 2Q45A 4EF4A 1JAHA 3NHFA 2ZOSA 4GC5A 4YP1A 5HKLA 4E32A 1GRVA 1GKYA 3FJOA 2GXUA 4YUAA 1QANA 3LBIA 5AVQA 5IYZF 1HWYA 4RE5A 5F1OA 2Q6LA 3ASUA 2CLIB 4ZYTA 2HA4A 4JJ7A 2I62A 1W75A 2V6BA 4V0QA 1N9KA 1WPGA 5FQOA 4CDGA 4GC9A 4ESEA 1IL0A 3A04A 1MVOA 4RHYA 1DWPA 4O4LA 2Z8YA 2FAXA 5BNFA 2RHCA 4N9QA 4UVHA 3GL9A 1UPXA 4RD3A 2FRVA 3B8EA 4Q05A 5EXDA 4EF5A 1G98A 3IUPA 4EB3A 1HYBA 3GZTB 4D2IA 5JADA 1JDBB 4KO8A 4MJLA 2NQ2C 1P7WA 2ZE7A 1FDRA 2HRBA 3HP1A 2EFCB 3KP1A 2A2ZA 2ZWMA 2EJUA 1JVBA 2WEKA 4EEZA 2EX1A 5DLDA 2CK3A 5L6MB 1I2CA 3CRZA 3KJHA 3ZCTA 4EFLA 4FFSA 2N3ZA 4XDHA 4DV5B 3OEEA 4LRSB 2EIHA 3RU7A 3SDSA 3U3JA 4ZT4A 5C31A 2E5WA 2GZDA 3MRSA 1QM5A 1SCDA 1W49A 2EXXA 3JAKB 1VHTA 3EC2A 3TQIA 1HE1C 2ZW9A 3FPCA 2A9PA 1ABFA 3O4FA 1EVJA 4IP0A 2D54A 1J9GA 4L95C 4L2IB 5JE8A 3P2JA 1P1KA 5FV4A 4GYJA 1BD4A 2XRYA 2XQFA 2QAJA 4M99A 4TRJA 2RHLA 2PH3A 1PJ2A 4KUEA 4M9SA 4O1IA 5D87A 2QYSA 3UGQA 1TZMA 1RBYA 2XWSA 2GCPA 4KQ1A 4CL0A 3CCBA 3K7EA 1GT6A 4QBIA 2ZXEA 5L3VA 2R6DA 3OHPA 1MC4A 4E1AA 2ERXA 3IR5A 3A4YA 5KYUA 3UEOA 4DJ5X 3ZWCA 4RVHA 3J80A 2J9XB 3VU0A 1TCBA 4KFSA 4E46A 5B12A 1THTA 3C70A 4MUAA 5HIAA 3BXXA 2DUUA 1CTQA 3PWKA 4OK3A 5C8YA 4HYYA 4I08A 3RRYA 2Y77A 3KT3A 4D8YA 1LKZA 1K3TA 5LNK6 3AEQB 1N5LA 5H80A 1GRQA 3TM4A 2PHZA 4N49A 1P0IA 3DZ8A 1UP4A 3F9CA 3FRHA 4ZHQB 3L7BA 1GFZA 1EJ6A 3E0XA 3UH1A 2VT7A 3TQHA 5DYYA 4J0KA 2P2SA 1WSBA 2IOQA 2A86A 4YJGB 2WZCA 4YT8A 3PJFA 4CM3A 3H5RA 4MVJD 3HM9A 1DQNA 2C59A 3H8WA 4O5OA 5H3LA 4F86A 3N58A 3IVMA 1GSAA 2GQ0A 3TRIA 3IAFA 3I8XA 4Q7KA 3GRVA 4IIJF 4JJGA 5IM4A 3EVBA 3CT4A 2WYHA 3CQ9A 3EK2A 3HNPA 2B1IA 3O2NA 3OLCX 4H0CA 5HGJA 3GWGA 4GDFA 4U2KA 1J33A 3IKVA 3O8OA 4HFNA 1L5LA 2O1SA 1T1SA 1BQ3A 4DV6B 2QN2A 4HQ6A 2EW2A 2QTBA 3TI7A 3BMOA 3IAAA 2OGSA 4AYWA 4G24A 4IS3A 4O1HA 5GVRA 3HB7A 2IE0A 2FP3A 3BRWD 4GSYA 2GCOA 3U7QA 3HJAA 1O5OA 4V03A 5AM4A 2Z6QA 1T8YA 2XMZA 4RGQA 3AIKA 5FYDA 4RYLA 1IPEA 2W2KB 1NYLA 1C1XB 3EAGA 2AHRA 4P3XA 2O54A 1UKCA 2YIMA 2PZ8A 5F64A 4HWPA 1F1JA 5EHZA 3WMWA 2O5CA 1R0CA 3FDZB 4I55F 4Z8YA 3GWZA 3NC0C 2Z2KA 4PGHA 3LY5A 3PQ2A 2XTJA 1R8YA 5AM5A 4TVSA 2FUEA 3E2IA 1T6NA 1MORA 3FHLA 4MVXA 4LOAA 2IOYA 3G6WA 4PWYA 4FU0A 4WHMA 4WN9B 8MHTA 3TX2A 2E4WA 2XA9A 3GFOA 4A0RA 3LOUA 1W85A 2G77B 4YCSA 2ZBPA 4L27A 3CLUC 4FB4A 5J2UA 1NN1A 3LC7O 5B64A 4YRTA 2OP1A 4NDZA 5JCXA 1XC7A 4GP6A 3S2GA 1ENPA 4C5CA 3ONVA 1BJKA 1IH8A 2XUJA 4M46A 1X1TA 5HF9A 4NKRA 5KNLA 4BO8A 4BEJA 4DS3A 3WOHA 2FSHA 1TM7E 1SJ9A 1GDDA 2P11A 4TTTS 3EN0A 4KR0A 1UIMA 1HBJA 3EWNA 1Z34A 4L8VA 1MW8X 2P9CA 2BELA 1T3TA 4HVTA 2O0LA 4OJNA 1E3MA 1YR9A 3BTVA 2E4AA 3HN6A 4MUXA 2ORWA 1XZJA 3BHMA 2HTEA 4DARA 5EJGA 2XHEA 1WAMA 1TJ3A 4BLPA 3F7MA 1I0IA 4P7GA 2C3MA 2EQBA 2V7BA 3ILXA 1FVXA 1BW9A 2R66A 1G3UA 2QTCA 1ISSA 5LYYA 2B30A 1IB6A 3ZI4A 2RHBA 2XLCA 4IOLA 4LE1A 4NQZA 1ULSA 4TLMB 5LMNB 2WT9A 4NNJA 3P45A 2Z6AA 1LDEA 1UBNA 4MS1A 3RNLA 3WYAA 4GNRA 1QH1B 3OCVA 3AUJB 3PI6A 5BSFA 5KHLB 4JI1B 1RI5A 1THZA 4PGMA 3TRJA 3O8LA 4G0UA 1VE9A 2GESA 2HLHA 3LNTA 5MGBA 8ADHA 4H7PA 4WH0A 5DGXA 5U1PA 3RHTA 5D6OA 3JWIA 5EPEA 4J3NA 2WZDA 3GOHA 1VIYA 4EHDA 2K5UA 5JTUA 1U0TA 1U8TA 2JDIA 3RIGA 2Y6UA 3GFBA 1J25A 2OZPA 4IGIA 4E7PA 3O3NB 1X1CA 3CH6A 4J7AA 4PC2A 5IDWA 3C1TA 1JU3A 3FGNA 2IUSA 4EA8A 1E3DA 4N5IX 1MTOA 1P0CA 3GIDA 3RFFA 4BVAA 2PV0A 2Q5QA 3LDGA 4EATA 5E6UB 1S2DA 2JRLA 2IIBA 3A7DA 3ER6A 1SC6A 1ENOA 3AVTA 4WBNF 4CV3A 1Y8ZA 1IVYA 1Z8HA 2HK7A 2P27A 3BUSA 4YQEA 121PA 1PZHA 2AOXA 2B6NA 2XQVA 3N39C 3Q1LA 4O2BA 4UBKA 4YP5A 5A9RA 3G5TA 3KQQA 4JROA 4CKCB 4K9DA 4LGYA 2Z0MA 3M81A 2B36A 5A3SA 2RBEA 3E5RA 5IG2A 1ZOSA 3AEKA 2HWUA 3LSTA 3PCRB 4L50A 3SN6A 1XEFA 2NU6B 2UZ1A 3QFCA 2Y0EA 3RTCA 1MAUA 3K31A 3S99A 1N6NA 1QHGA 4F60A 4NV3A 3B3QA 1YSCA 4BVJA 1FFWA 4KR2A 3HK2A 1T4CA 4QAQA 3KT0A 4AB1A 4QM6A 1Y63A 2R0QC 3KYCB 4ARIA 3EH2A 1SD2A 4GKAA 4YAWA 2ESRA 4X95A 1KK0A 5FV7A 2QX6A 1AHNA 1ST3A 4P31A 3QENA 4UJ5A 4CVNA 4BX3A 1Z5ZA 5LA6F 4E5KA 3UOWA 4ZQCB 2BR5A 3K8YA 1QMGA 1RYFA 3BORA 1XEXA 3EB9A 3M7IA 3U4AA 2ZJ5A 3G7UA 4Z99A 4OQNA 3LFHA 2IYWA 2RGGA 5GONB 1SEVA 1C2TA 2B69A 3AVOA 3NBMA 4ATNA 5I3CA 1JE1A 1GZUA 1IXKA 2IHJA 2PV7A 3GYBA 3O8BA 1J56A 3PFNA 4UEWA 2R5WA 2MDTA 3MOIA 3K2QA 3NHRA 2W00A 4QUKA 2R8EA 3OVMA 4UTOA 3L0DA 1ZESA 2QS9A 1OFHA 3G9XA 3KALA 4L5CA 1T2NA 4OLFA 3RJMA 2V7QD 1O5TA 2AZ4A 1L5WA 3BA1A 1XAJA 3FYUA 1Z4MA 2CMHA 2F3QA 4IQGA 2XF2A 2D1FA 1CF9A 4TWIA 1UBOS 1XJ5A 4N3GA 2ZROA 1F0PA 2AYYA 2QD2A 4UMEA 3V34A 1A77A 1Z26A 2FSFA 2ZGVA 1VYVA 3C6QA 3O9MA 4IW3B 4QDTA 2BH9A 1QR6A 1VMDA 2JF0A 2P67A 4LZOA 4IDGA 3V1UA 4UEOA 3D8NA 4X1KB 1M76A 5BT9A 4EGCB 3VO8A 3ZW8A 1RWVA 4I14A 5D5QA 2AX4A 2HU5A 2AB0A 1DU4A 3EDRA 1M1YE 2B8JA 3G2PA 3AFIA 1ZHFA 1ZJWA 1NUTA 4BQQA 1NVKA 2YWRA 1JKXA 4R4JA