1HDRA

The crystallographic structure of a human dihydropteridine reductase nadh binary complex expressed in escherichia coli by a cdna constructed from its rat homologue
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
236
structure length
236
Chain Sequence
EARRVLVYGGRGALGSRCVQAFRARNWWVASVDVVENEEASASIIVKMTDSFTEQADQVTAEVGKLLGEEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGKNRPSSGSLIQVVTTEGRTELTPAYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase(acting on nadh)
molecule keywords DIHYDROPTERIDINE REDUCTASE
publication title The crystallographic structure of a human dihydropteridine reductase NADH binary complex expressed in Escherichia coli by a cDNA constructed from its rat homologue.
pubmed rcsb
source organism Homo sapiens
total genus 79
structure length 236
sequence length 236
ec nomenclature ec 1.5.1.34: 6,7-dihydropteridine reductase.
pdb deposition date 1993-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1hdrA00
4EUHA 2I99A 4Q3BA 5TIIA 4J3FA 1FF9A 8ADHA 5L51A 2C59A 4YBZA 1E7YA 5EJ2A 4PLGA 3QSGA 2NU6A 1C0KA 1T2DA 3CXRA 4W4TA 2H9IA 2WD7A 1LXCA 3WBFA 2JFGA 4PVDA 1U5AA 4WOKA 1PSDA 1RYEA 4Z9FA 3NTOA 3ZH2A 3F4LA 5T57A 4MINA 1A71A 3QRWA 4DGSA 1ZMTA 1GADO 2VN8A 5G0TA 5GY7A 4B7UA 3JSAA 4ND2A 4OXNA 4R01A 1AXGA 3UF0A 2P68A 2QW8A 2D2IA 5BSFA 3RUEA 2A9FA 4JLWA 2EKLA 1LLQA 1TI7A 1ZK2A 4Z0HO 3F1KA 3ZU4A 3ZZNA 2QG4A 4RORA 3ZU5A 1ZNQO 3VPHA 4JX8A 3C7CB 1ZFNA 1BRMA 4ND5A 3RFXA 3ROKA 4KWHA 1PQPA 4YWJA 1NXQA 3NYWA 4G5HA 2UYYA 2NVBA 2EF1A 1TXGA 1MFZA 5JC1A 1EDZA 4BGEA 1U3UA 1T1RA 2VWGA 1IULA 2YFHA 3DMTC 1UJMA 2XOXA 2BFMA 5BNIA 4D0RA 3HJAA 4NI5A 5L4LA 1U3VA 2D1YA 1KERA 1BDBA 1DXYA 4GGOA 7ADHA 3OJ0A 3EDMA 4BNGA 2ZJ0A 1PQWA 1VKOA 4NFHA 1IZ0A 3AM4A 1GEGA 2GZ2A 1ZXLA 4OIMA 5F3RA 5HBRA 1RKXA 3GG9A 3R6DA 4HFMA 3C1OA 1HDRA 1N1EA 3F47A 3KB6A 3MWDB 4LMRA 4OHUA 3OMLA 4MP3A 5MGBA 5BNTA 3P19A 3IKVA 4J4BA 4IUYA 4YAGA 1DFGA 1GFSA 1I32A 3PEFA 1KOLA 2NM0A 5GMOA 3JD1A 1DAPA 1ENPA 2EHDA 3Q3CA 1DAOA 4FFLA 4E0BA 5IXYA 4DMLA 1AHIA 3HFSA 4EJ6A 1V3UA 4GLOA 2DUUA 3OQBA 3W8DA 2HMSA 4K6FA 1P0FA 2E37A 4Z3KA 1P1FA 1LQUA 1T24A 3NT2A 4CQLB 5EPOA 3RFVA 3V8BA 1QR6A 1ISHA 1MX3A 1B0AA 1Y8QA 4XJTA 4H3VA 1DC6A 4B4VA 3EYWA 4PLYA 4RDHA 4FN4A 2PTGA 3DOCA 2HJRA 4PZCA 2PH5A 1G0NA 4MJLA 3FSRA 4L9RA 5ENVA 3ZNOA 1U4SA 2ZK7A 1M67A 3QJ5A 5ICMA 3GMDA 3JQFC 1MXFA 1C0LA 1E77A 4FBGA 3ZNNA 1NVGA 5DOVA 2YFQA 4PG6A 4II2A 1KYQA 4LVCA 1BMDA 4EYEA 1ZCJA 3OECA 3M6IA 1XU7A 3I9OA 1X13A 4DPKA 3EVTA 1VKNA 4E2WA 3ZV3A 3DFZA 1IE3A 1QP8A 3BTUA 3DB2A 4NU6A 4WEOA 3WIDA 3O03A 3TSCA 3ABIA 4AJEA 4TQGA 1OBFO 1GYPA 3K30A 5U4QA 1Y9EA 1X0XA 1N9GB 3ADOA 4IIUA 1K3TA 3I6QA 1VSVA 5F5LA 3ZWYA 1ZKMA 1K5HA 1HF3A 4PZEA 1P31A 1U3TA 1WLYA 2PGJA 4YJGA 4ZJUA 1TEHA 1X15A 4B3JA 3ICCA 1R4MB 5JSFA 1PGOA 1LRLA 1JLLA 3U49A 3JQEA 1LLUA 4ALMA 3FF4A 2D4AA 4XZ3A 4PN3A 2HMWA 1R0SA 3HADA 1HL3A 2E82A 2GZ3A 3QWAA 3EUWA 2VQ3A 4B8ZA 4AJ2A 1DLIA 4J90A 4EUFA 5HM8A 1HETA 4DC0A 4N5MA 3U9LA 3E48A 3OQ1A 2Q49A 3RJ9A 4WEQA 5JMPA 4WCFB 5L7YA 1P1RA 3JQ7A 4ROSA 1C1XA 5G2OA 1ZK3A 5JDCC 3I9JA 1ZJYA 1M2WA 3NX4A 3H65A 2CVQA 5FI5A 3WNVA 4DL9A 1UXHA 3UCEA 4J4TA 2GO1A 3UICA 4DTIA 2OOSA 4L4XA 5L95A 3U4IA 5EIOA 5JCJA 2JCVA 1HKUA 2CF5A 4Z6KA 2YY7A 3BMNB 3NT4A 3ONFA 2VZ9A 4XB2A 4YJFA 1M76A 2HJSA 5L9AA 5IN5A 4KZPA 4HV4A 3JQ6A 2O4UX 4RPGA 4EZBA 1KEPA 3CUKA 1IOLA 3ENKA 4RVSA 1NTOA 4PLVA 2FPPA 3EMKA 1RJWA 1H6CA 2WJPA 1NHGA 2X9VA 4U7WA 5F1KA 3ETGA 6ADHA 3WYBA 2VUUA 4Z9XA 3WGHA 1GYQA 2NUAA 5IAAA 2FP4A 4OGWA 1Y5MA 4DLLA 4A0SA 4IDDA 4CL3A 4RPHA 1UP4A 4MVJG 2O3SA 1U8XX 2X0RA 2X9GA 1EE2A 4WGGA 5BR7A 4EEXA 1TT5A 3D3WB 3I23A 1L1FA 1LQTA 2SCUA 2WYWA 3PDUA 3FTNA 3CE6A 3D4OA 1ZEJA 1LLDA 3KYCA 3QHAA 4UAGA 4P4GA 5B4TA 3UXYA 1DIGA 4IMPA 2GYYA 4BV9A 1P3DA 3PFWO 3RUDA 5A9SA 4TZKA 2WM3A 1A9ZA 3AOEA 3KHUA 1H2HA 1H2BA 3H9UA 3JTMA 4K26A 3ZHBA 1B14A 4PG5A 2FR8A 1W0CA 3JD3A 3LT0A 3PQFA 5T67A 1XGKA 3ZU2A 4J1NA 2DKNA 4HWKA 3LDHA 1HLDA 5TNXA 1EBFA 3SC4A 3RC9A 4Q9NA 1PEDA 3O8QA 4DWVA 4R51A 1E6UA 3OEYA 1YH3A 1RPNA 3LU1A 4DREA 3B1KA 1A4UA 2EP5A 5CDUA 3HN7A 1B3BA 2VZ8A 2VUTA 3DHYA 3GVIA 3HDHA 2BD0A 3I52A 3RWBA 3IC5A 1MXHA 1D8AA 2VT3A 4BKUA 1NVMB 5LDHA 4GQAA 4RVFA 4YB8A 1PJSA 3VZSA 4P38A 2IRWA 1ADBA 1MC4A 3CPSA 4ALJA 3GZNB 1IPEA 2DPHA 2OZPA 5C7LO 5ILOA 1XQ6A 1UXIA 3QVOA 3SJ7A 3H9JA 3ZV4A 3W6UA 4PLWA 4LMPA 1HE5A 5KVVA 5KNLA 5CDSA 1BXGB 2Y0DA 3RUAA 3KM0A 2BFPA 2V6BA 4JIGA 5JYDA 4MP6A 2EERA 4CM5A 3C85A 4FIZA 4TSKA 4CLEA 3ITKA 3PHJA 3VPSA 3LSYA 2I76A 4MVJF 1HDOA 4U8GA 4CM8B 3PGXA 4PIVA 1YOVA 2UUPA 1VM6A 1B15A 3VH1A 2X22A 4X54A 4CLRA 2Q3EA 5ER6A 5HS4A 5C37A 4BKQA 4NR0A 4JROA 4PLFA 4MIEA 1R12A 5LC1A 2V6FA 2VCYA 4K28A 3BYZA 5KKAA 1U3WA 5A04A 1JA9A 4GKBA 3K6JA 3L4SO 4JJIA 4BKRA 3GC6A 2YV1A 2V7PA 1P45A 2C5EA 4ILKA 4OOEA 3DONA 4XWYA 3IDSA 4ZRMA 3JQGA 3ZWMA 3OSUA 4BNWA 4HBGA 9LDBA 4XB1A 3TL2A 3PZRA 4BNZA 4Y98A 4K1LA 3DBVO 1F8GA 3GHHA 5C5IA 1BVUA 1SNYA 1C1DB 1DJNA 1JAYA 5KOIA 3U5TA 4IS3A 3UVEA 4ALNA 3PYXA 1K2WA 4HFJA 5ADHA 3ZWBA 2HLPA 4GVLA 2Q4BA 3BIOA 1DIBA 5FWNA 5ICSA 4E5KA 4CM3A 2WE8A 4CR6A 1PZGA 3E9MA 1BWSA 4RPJA 4XGNA 4FC6A 3UKOA 1FJHA 4D3SA 4GVXA 4O0LA 1VE9A 2P91A 3A4VA 5G0VA 5DOZA 5KJ1A 1ISGA 1Y81A 1T1SA 2O2YA 4DUPA 4XQGA 3AWDA 4HNGA 1T25A 2GASA 4CV3A 1WZEA 4UVHA 4YQZA 5EINA 3AI3A 3BAZA 3JD4A 4IDGA 3H2ZA 2Q45A 2PKQO 4TWRA 4R1TA 4XYBA 4D3DA 4CMKA 3G1TA 4J49A 1E3IA 5HA5A 1F12A 3D5TA 2G76A 1GEEA 3GRPA 1NASA 4OOFA 2DBZA 4IXTA 4CLOA 4ALKA 1XKQA 3JQCA 3PWZA 3VKUA 3WGZA 4BO3A 3PJEA 2BLLA 5JLAA 4CM9A 4F6LA 2B35A 1A7AA 1J6UA 1DFIA 1ENOA 4F6CA 4WASA 1DC3A 2Q2VA 5DBGA 5A5EA 3OA0A 1TA4A 2P5YA 2FR1A 3HDYA 2FOIA 3GR6A 3RBZA 1EFLA 3DZJA 3R3SA 2Q1UA 4E2YA 1SB8A 1X1TA 1PJTA 3TRIA 3KLPX 2WSBA 4WPGA 4DIFA 4GX1A 2BI8A 1DHRA 2GDZA 4TRRA 4LRSB 3C1TA 4A7PA 1UXKA 1NAIA 3PDJA 2HRZA 1PJ2A 2PKQP 4Q3DA 4MVJH 4DQUA 3OJFA 2E48A 2OP0A 1V3TA 4ZICA 4JP3A 2VHWA 3TQHA 2CF6A 2GNAA 3MJEA 1GL3A 1N7GA 3VVBA 4OL9A 1P1KA 1Z75A 4NPCA 3EC7A 4CL8A 3KSUA 1MFPA 4EDFA 4CODB 3S1LA 1MGOA 1EMDA 2VOEA 2XXJA 3I9NA 2NU8A 2C7GA 2J5RA 2EJWA 4UEJA 1HZJA 3QVTA 4XRRA 1B16A 1E3EA 3RFTA 3WWYA 1TT7A 2I5PO 2RCYA 1F0YA 1T2FA 2EKQA 1AUPA 3DBLA 4DBZA 4Q3AA 2IYOA 1U9JA 3HHPA 1T2AA 4FFOA 2GF2A 3F1LA 3V1YA 1X7DA 4PRLA 4IJUA 4XX0A 3BHIA 1XHLA 1GAEO 4UULA 4XEHA 3AW9A 1IPFA 3F3SA 2QX7A 1Z74A 1Y1PA 3RU7A 4XQ9A 4JNKA 2J3KA 2PZKA 3FPCA 2VHZA 3L9XA 4JBIA 1GPJA 3RCBA 1YJ8A 3VH4A 4BO1A 3IMFA 3DHEA 2PGDA 3FPLA 3GMSA 3VH3A 4BNMA 3DBHB 2B4RO 1YL5A 1VPDA 3BMCA 3PYLA 4CV0A 2A92A 4O63O 3TOXA 3WJ7A 3G0OA 2X0JA 2EW8A 2B5WA 3MZ0A 4Y6PA 5G0WA 4FQ8A 1ZMOA 3MJTA 5DN9A 1VI2A 4CMEA 2Y0CA 2YHIB 4QT0A 1ISMA 1JDJA 1Q7GA 3MTJA 1U4OA 5AVOA 4L0QA 4E5YA 2WDZA 3GFBA 3ZWNA 2IZ0A 1YWGO 4BGVA 3QWHA 2BH9A 4XYGA 3GGPA 4AICA 4AL4A 2B37A 3JQDA 1HYHA 1EK6A 3W1VA 1XELA 1A5ZA 3KBOA 3V2GA 5K6AA 3DFUA 3FRJA 1ZO8A 4OO3A 4PLTA 2LDBA 4RPLA 4GLLA 3DQPA 4WCFC 3PPIA 2XPCA 1SMKA 4TRMA 1I8TA 3TFOA 3JQAD 4KMSA 1X7GA 3AUTA 3QWBA 4FDAA 1Z7BA 3L4BA 4CR8A 2HAEA 5ER9A 2OUIA 1LDYA 4R41A 5JY6A 3JCZA 5CAEA 1YE3A 1R66A 2PKRA 5DBIA 3VOSA 4AVYA 4CUZA 1PGNA 4XGKA 2FY8A 3I5MA 4J2OA 4YR9A 1I33A 3EGOA 3TDKA 3JQAB 3VAZA 1QSGA 2YHUA 1IHYA 1PJCA 4MVJI 5CEEA 5L40A 2W98A 5T8KA 2E6UX 3AUSA 3JYNA 3IKTA 2RHCA 1GD1O 3KOUA 4Y8VA 3PZBA 5JYEA 4OMUA 2C82A 5L4NA 3ASVA 2YYYA 4LSWA 4ZQEA 3WQRA 4WLUA 3IQDB 3GNQA 4E30A 1FDVA 5B1YA 4KUGA 7MDHA 1Q1NA 3KEQA 1DO8A 3A06A 4ZQHA 4XCVA 4JGBA 5AXCA 1GUYA 1N9GA 5HTOA 4KQWA 5GZ3A 3MJVA 4UUNA 3ZWOA 4A5OA 4KWIA 5KJ6A 5IZ4A 4L4SA 3PHHA 4KP7A 2IEDA 3OF2A 4ESOA 4MVJP 4XA8A 4G2NA 1KEUA 4P22A 1E7SA 3FI9A 1LDEA 2WTBA 4IXWA 1R4MA 2R2GA 3ITDA 3SXPA 2QRLA 3PVZA 3R0IA 5K0ZA 3DZGA 4JJGA 4XQEA 2CNBA 4XQCA 3ZHZA 3UGKA 4M86A 1Z7EA 3PQDA 1JWAB 2QYTA 1HDCA 4OKIA 4E6PA 4BGUA 4DA9A 2PNFA 2HO5A 2QZ9A 3NGXA 3BHMA 4DQVA 4W82A 1ZUD1 1NQAO 4U6SA 3SEFA 3VPFA 5JO0A 3QVXA 5I7SA 2VYND 5I7FA 5IDXA 1JKIA 2EGGA 3Q0EA 4G65A 5EQDA 3W8EA 4YT2A 3PIDA 3RC1A 3KSZO 3K73O 1VL8A 2O7QA 4QSMA 5BNFA 1E3WB 2EKPA 1WMBA 2Z1MA 2HCTA 4R9SA 2C29D 2E4AA 4DXHA 1OC4A 1NBOA 1V9LA 3C1AA 3ON5A 4XIYA 2NNLD 4CM1A 4I9HA 5L53A 4A73A 4IDEA 4J1TA 3WQQA 4YRAA 4D41A 4CMIB 1KY5A 3JQBA 4CQMD 1K6IA 3SLKA 1ZSYA 2FPGA 4C4OA 1OFGA 1ZVMA 2EV9A 1YS4A 1P77A 1KVUA 2X58A 2Y1DA 3GVXA 5U1PA 4AJ1A 1E0DA 1GV1A 4R1NA 3GQVA 3LZ6A 3GVPA 4E13A 1R37A 3UOGA 3JQ9A 2DBQA 4CMAA 5MDHA 1O89A 2QZZA 4J1SA 2CY0A 3DEYX 3S2GA 5I9NA 3RUIA 3E9NA 2I65A 3D7LA 2VZ0A 1PIWA 1E3LA 3ZI0A 4BMSA 4BGIA 2D59A 3GAZA 1WAMA 1RWBA 1FDTA 2B5VA 2Y1EA 1ULUA 4L8VA 3MOIA 3S2EA 8LDHA 4YQYA 2NQTA 4D3FA 1PJBA 1NFFA 4CM6A 4XJSA 1I36A 2JD2A 4E2XA 5JAIA 3JD2A 4OQZA 2Q46A 2YUTA 4ZA2A 1CQIA 2WE7A 4CLDA 1NWCA 2GZ1A 4MOWA 1JWBB 2O48X 4Y9DA 1F8FA 1E1MA 4AJNA 1MG5A 2HK9A 3OICA 4JP2A 2R00A 3TOZA 1M6HA 3UH1A 4NJMA 4A27A 1EBUA 3BXXA 1WVGA 5A06A 2ET6A 3WLEA 1VSUA 3PWKA 3KYDB 2JCYA 1SPXA 4IINA 5TJHA 2GCGA 3TNLA 4BO2A 3H3JA 4ONEA 4BNJA 4OKNA 3K92A 3L9WA 1A4IA 2FMUA 1T26A 4WCDA 4FPXA 3QE3A 3DOOA 1IUKA 3R3JA 1KY4A 2ZTLA 2R6JA 1LRKA 3MTGA 3OEWA 2AEFA 2YQ4A 4YVFA 4WE3A 1YBVA 2G1UA 1LC0A 3ICPA 2W2KB 1L7EA 3WGYA 3I3OA 1JVSA 2JHGA 3IL2A 1T4BA 3PRJA 5EN4A 2G5CA 3BMQB 5F1PA 4GX2A 2VHXA 3D5QA 3G49A 3PHGA 4IGEA 4J9VA 1ID1A 1ONPA 3CINA 4FJ2A 9LDTA 3GDGA 1A9YA 4LISA 2DFDA 1QYWA 3OP4A 2G0TA 2H5LA 4QFDA 4WECA 4BOYA 2I67A 3HUDA 4FOOA 4Q3EA 2GR9A 4BNXA 4GWGA 1HZZA 4QEDA 4Z9YA 3L07A 4PG4A 3K8ZA 3I4CA 4TKLA 3DMTA 4J1QA 5H83A 2W2LA 1CETA 3VZQA 5JBIA 2EEZA 2D8AA 2EW2A 4BO5A 3FBGA 3GUYA 2X8LA 4RVGA 1YVEI 2Y1CA 4CM4A 3CMMA 1HE2A 1XQ1A 2DFVA 3GZ4A 3PJFA 4J4HA 3JD0A 1GZ3A 4MPDA 4NZ9A 4BNHA 4XD2A 1Z82A 1UAGA 5T6BA 3ROQA 2EIHA 4RF5A 5ITVA 2GN9A 3IP1A 5L7TA 3GNTA 2BRUA 2I66A 1C1DA 4H16A 4AFNA 5A3JA 1ISIA 4ND1A 2X9NA 2VTDA 4CM7A 2AEMA 1UAYA 2AG8A 2Q1WA 3G3EA 1DDOA 4NMHA 3EW7A 3BTSA 4IGFA 4MKXA 1XYGA 1YL7A 3TJRA 3PJDA 3ZGYA 2VRCA 4GI2A 3A1NA 4IS2A 4HFRA 1Q7CA 4AJIA 3HDJA 1ADFA 1EQUA 5DNAA 3PGJA 5CPBA 2PA3A 4L76A 1AXEA 1G0OA 1EFKA 1Q2XA 2DTXA 2NVUB 4Q3NA 1TVEA 5TS3A 5G4KB 4D79A 3GPDG 3RU9A 3DMYA 1DLJA 5GZ1A 1LUAA 3C24A 1E3JA 3D4PA 4Z0PA 4R1UA 3INTA 3K9QO 4UVIA 1WXDA 4DPMA 1C0IA 3BHJA 4MVJA 5JDIC 3FD8A 3JQFA 5HS6A 2AQ8A 3OJEA 3CEAA 3IUSA 4EITA 1IZ9A 2O3UA 4OSPA 4PVCA 4R3WA 3K2EA 1H5QA 4ALIA 3H8VA 1H94A 1V6AA 2AE1A 1JVBA 2ZB3A 3O38A 2FWMX 4UUPA 2CD9A 3WYEA 3TN7A 4YJHB 4D44A 3S2FA 1PGPA 1WZIA 1KVTA 2OGUA 2WD8A 5CHEA 5IXSA 3BA1A 1I2ZA 4ZQFA 3RKUA 1I5RA 1BW9B 1GQQA 3W8FA 2V6MA 5AYVA 2GN4A 2DU8A 3ULKA 3V1UA 1DC4A 3DXFA 4W9NC 2VHYA 3FBTA 3DTTA 1CWUA 4CV1A 2VWPA 2X86A 4HKTA 1Y6JA 4U0JA 1HDGO 4BV8A 2WMDA 4BO6A 4IJKA 1EVJA 2IE0A 2VYVA 2JCXA 1SO8A 3KRTA 2GLXA 3VVCA 5COAA 3U4HA 2DAPA 3B70A 3VHRA 1DHTA 3QIVA 4GSLA 4II3A 3M1AA 1OAAA 2C2XA 5AXDA 3IIEA 4R5HA 3JYLA 1EK5A 3LT4A 2AQHA 5JDCA 3EVNA 3IJPA 5T5QA 4YAIA 2Z1NA 3FN4A 4UUOA 1LTHR 2PZJA 4M49A 4B4WA 3AM5A 1HDZA 1B3RA 4ZHSA 3GN2A 4RLSA 4BO8A 5JAMA 1OMOA 4P8RA 2NWQA 3LK7A 4GX5A 5AXBA 3JYQA 5A3VA 1AGNA 4RF2A 2IXBA 1SEVA 4ALLA 4O59O 1YBAA 4EGFA 1UZLA 3L0DA 4CMHA 6LDHA 2ILTA 4RQUA 3E9QA 3ZNQA 2LDXA 3I9MA 3QV1A 4FCCA 1ZBQA 2Y1FA 1K89A 1U7HA 2HK8A 1LDMA 4O1MA 2J3JA 3KZVA 3RD5A 2UVDA 2YHIA 2GSDA 2CVZA 2Q2QA 1DSSG 3PFFA 3FCOA 5B4UA 1V8BA 3WGGA 4ZVVA 3PWSA 1E7WA 3F5SA 4E31A 3OJLA 2O7SA 4WLFA 3MJ4A 4JN6B 3AFMA 2W90A 5DULA 4N18A 3HDQA 4TROA 2DTEA 3U3XA 2Y93A 2P4HX 4FS3A 1E5LA 1P1HA 1W73A 2IDZA 3H6KA 4EW6A 4G81A 4O5OA 1LRJA 3OQ6A 4AJHA 1QV6A 2E49A 4RV9A 3PIIA 1BXKA 1QMGA 2NVWA 4DC1A 1YRLA 3GHYA 1RM4A 3W4KA 4I5GA 4Q39A 3DL2A 1N5DA 4DIOA 4R1SA 1HT0A 1HXHA 2DC1A 1XSEA 1X7HA 2Q99A 5F21A 3C8MA 1ZXBA 1AN9A 2P5UA 3HFGA 3NEPX 5JW6A 4TKMA 2P4QA 4R69A 1EDOA 1BGVA 2OXIA 4OJNA 4UEOA 4BVAA 5BT9A 3QW2A 2G82A 2P9EA 2X5KO 3I1JA 1PGQA 5ILGA 4PG7A 3E6AA 3GN1A 3TZHA 1VRWA 3AUUA 3VZPA 4AJLA 2QRKA 4BL5A 4WLNA 3GK3A 1YO6A 1CYDA 1LJ8A 2W2LD 3VDQA 1HYEA 3MOGA 4MKZA 4D45A 1LSUA 3JQ8A 2O50A 2NLOA 5B12A 5HWSA 3RSHA 1Y8RA 4RJTA 1GU7A 1JTVA 2AXQA 1V0JA 1NAHA 2PZLA 4N54A 1W8DA 2Q2WA 2Y1OA 4ND4A 3WYCA 4P4NA 3Q1LA 1P1JA 1D7OA 1WDLA 3NUGA 4R4JA 1XR3A 2PK3A 3Q11A 3F6YA 4I9NA 3PXXA 1DPGA 4CMGA 1CRWG 4W6ZA 3U4CA 4BUCA 3WGIA 3M1LA 4KTTE 5FEUA 1B8UA 4PZDA 1PZHA 2H1SA 3UCXA 2I3GA 4ZN6A 1YQGA 5C7OO 3NDJA 3IOYA 4XKJA 1V35A 2GERA 3O4RA 1AE1A 1WWKA 3H5AA 4I5DA 4BKOA 1B26A 2IYPA 2B4TO 1CERA 2B4QA 3WSVA 2J3HA 4KQXA 2EG9A 2YDXA 3DHNA 4IDFA 1D4FA 4YJGB 5CP8A 5GZ6A 2BFOA 3QWFA 5DCWA 3GEDA 4M54A 1SCUA 4DRYA 1PR3A 3C7DB 1FDSA 3Q2IA 4E2ZA 3AJRA 2PZMA 2FZEA 3K5PA 4FGSA 4IZHA 1V3VA 4LSMA 2C20A 1HTBA 2JJYA 2XAAA 3FR8A 5I9MA 3RVDA 2G17A 4BNUA 1WW8A 4FFPA 3W4JA 3DAPA 5LDGA 4AJJA 2O3TA 5ENDA 5JCJD 3HNPA 4NBWA 5G0UA 1NQOA 3NV9A 1E3WA 3ORFA 1H6BA 1EVZA 4NU5A 4R16A 3U62A 3V5NA 1MC5A 1RM5A 2HMVA 1QLJA 3FNEA 2W4QA 3PYMA 5T64A 4PFJA 2ZYAA 1E7QA 1MA0A 3NDRA 4IMRA 5TGDA 4FB5A 4YJFB 3GT0A 4RL6A 3FNFA 4W7HA 4QQRA 3QY9A 1HSOA 1SB9A 3QP9A 3RC2A 1KC3A 4NBRA 1WPQA 2CDCA 3ANNA 1GPDG 2X5OA 1O95A 1Y5RA 3AU8A 2J8ZA 3DDNA 4IQGA 4HUJA 5TT0A 2VNSA 4XDYA 1PQUA 2RAFA 3H3FA 4M8SA 4Y67A 4BO9A 4AJ4A 2B0JA 3TPCA 2JFFA 2Z95A 2YDYA 2VRBA 1D3AA 4UVEA 1QKIA 4B4UA 3KV3O 1WNTA 1E1LA 2QRJA 4NQZA 2VYVD 1QXSA 5TF4A 1DRWA 1YB5A 3WR5A 3LYLA 2HSDA 1TT5B 2ZB7A 1DC5A 3LC2O 4FJ1A 4ZRNA 4RVDA 5EESA 4IIVA 3E5MA 3PLRA 1BHSA 1LDGA 2BHLA 3DC2A 2FZWA 2WEKA 3WMWA 4BNLA 2CVOA 2B69A 3H7AA 4MP8A 5DP1A 4YCAA 1ZIDA 5A9SB 2DTDA 2CDAA 4I8XA 3PJGA 5L3ZA 5CDTA 3GA0A 3AI2A 2J3IA 3DOJA 3CZMA 1QYCA 3HSKA 2AA3A 4BNTA 2C7VA 4GX0A 2AEJA 3D3EA 1HLPA 2JL1A 2V65A 3WIEA 2BGMA 2PD3A 4BNFA 3GG2A 2EP7A 1X0VA 3H2SA 3OJOA 1ISFA 1VL0A 1NQTA 3VH2A 3PI7A 4WLVA 2GPTA 1P74A 1PX0A 3RIHA 3QVSA 5THKA 3I4FA 4ZQBA 2CUKA 1D1TA 3KYDA 4IDCA 4ZU3A 3KEOA 3NJ8A 4CUKA 1DEHA 1UXGA 2CMDA 4I5FA 1GYRA 5A5FA 4DMMA 4BMVA 4O6VA 1UZNA 3E82A 1ZZEA 3BZUA 3E18A 2X0IA 1I01A 1ZK4A 4JCOA 3F5QA 1EUCA 1JU9A 4EI2A 1NM5A 3GUCA 3NGLA 3TZ6A 1BTOA 4N7RA 4YRDA 2ZATA 3OH8A 3AK4A 1ENYA 4MVJE 3TFQA 3EZYA 1ZSVA 4FFRA 3GRKA 5DDIP 5I7EA 4LK3A 3NKLA 4FR5A 5BSGA 1PJ3A 3NTQA 3ZDFA 2CSUA 4C7JA 4PRKA 5EL0A 4CQLA 5IZCC 1F17A 5F1OA 1GQ2A 3QA9A 3OETA 4WLEA 2AQKA 2PV7A 1I0ZA 4YPOA 1NPTO 1JAXA 4EJMA 4FFNA 1TB4A 3LF1A 1RM3A 1LDBA 1NPDA 2HU2A 2HK7A 1YOVB 4GL4A 5CEJA 2ZB4A 2NADA 3ZNPA 4R68A 4CLRB 3GOHA 1BG6A 2HDHA 3A28A 1OZAA 1N2SA 4I5EA 3CTMA 1LI4A 5IG2A 2VUSA 2YQ5A 2BGLA 2Y1GA 4RLHA 5A9RA 3TZQA 1NNUA 1MP0A 2PR2A 2D5CA 5EQFA 1O6ZA 3DR3A 1DRUA 3ANMA 4CLHA 1U8FO 5TQVA 2UAGA 4BQPA 3WTCA 2Q1SA 2IZZA 4YA6A 1U7TA 4J0FA 4DIBA 3P2OA 4PCVA 1LNQA 1E6WA 1XG5A 3DBRB 2FR0A 2A4KA 4URFA 4KUHA 4R3NA 4LCEA 1E7RA 4K9DA 1N92A 1O94A 3QQPA 3U09A 3G1UA 4EUEA 3D1LA 3VTFA 3WB9A 4F45A 2OMEA 5CPFA 2ZKLA 5A4DA 1IL0A 4KUEA 5B4VA 4B7CA 3JYOA 2VWHA 4A2CA 2NTNA 2OL4A 3WMXA 4WCFA 4ITUA 3CZRA 5JE8A 1NWHA 4HX5A 4U0KA 3RROA 5A02A 1GTMA 1SOVA 1ONNA 4OSOA 4B7XA 1FK8A 1U1IA 3RBXA 4KDEA 1KVQA 2OORA 3FR7A 5COBA 1CEQA 2OFPA 3ZCXA 5KVQA 3TZKA 1PL8A 2J6IA 3E5RA 1GQYA 3OHSX 4CM9D 5IFLA 4CJXA 4D42A 1KC1A 1LC3A 1X1EA 3BMNA 3WTBA 1A72A 4CLOB 4J91A 3U0BA 1IYZA 1Y9AA 2RH4A 1RM0A 3GFGA 3CIFA 1UH5A 1DB3A 4HP8A 5JAQA 1C14A 4B79A 3Q2KA 1U2DA 3AU9A 4HADA 1MG0A 4INAA 4IZIA 3OIFA 3TF5A 2ZIZA 1KBZA 1ZW1A 3KVOA 4QO7A 5CEFA 1M66A 3L6EA 2FSSA 4YJHA 4Z0TA 2C07A 3OIDA 4JJFA 4CPDA 1HE4A 5KJEA 1E3SA 2BMAA 3RI3A 2DM6A 5BQFA 1SAYA 3H5RA 4IDAA 1H0KA 2AG5A 1BW9A 4XRGA 3ZWPA 2BKAA 1OC2A 1NP3A 4CQMB 4A10A 1UR5A 3D3WA 1H9AA 3N58A 5FF9A 3LLVA 5H81A 5K9ZA 2Q50A 4LVUA 4XIJA 5KVCA 3H4VA 2QHXA 3C3XA 3CH6A 4TRJA 1U2GA 1CJCA 3Q6IA 3KSDO 4BS9A 3VZRA 3PQEA 4BO4A 2TMGA 1J4AA 4RF3A 2VHVA 2DVMA 1R6DA 2ZQZA 3WDSA 4OXKA 2P9GA 5ITWA 1M6WA 4E5NA 5KVSA 3RUFA 3F9IA 2NSDA 3FHLA 4IBOA 1KVRA 5IDQA 2EWMA 1E7MA 1E6EA 1DIAA 1N8KA 3EY4A 3OBBA 2ZCVA 3IS3A 4QECA 3H9GA 1W6UA 1ZJZA 1R0LA 3JYPA 5JCXA 4RPKA 2BI7A 2GD1O 2ZYGA 3DBLB 3BMOB 3ETEA 4HNHA 4UEKA 1Z45A 3EK2A 4FC7A 5KKCA 1B8PA 2O3JA 1DIRA 2X7HA 1WP4A 2X6TA 5JFOA 1DJQA 2C54A 1GZ6A 3ONEA 4BO0A 4J43A 1JN0A 1LU9A 2D3TA 3B6ZA 4HFNA 5CFZA 2QIOA 4BIIA 2Q4EA 2GUGA 2RBEA 1MLDA 5TT1A 4N5LA 3T4XA 3ROMA 4EBFA 1ADGA 5EMHA 4W99A 4BNNA 1Q0QA 4YEDA 4RDIA 3G79A 1KEWA 4I1IA 1GCOA 1PJ4A 1YQDA 3GZNA 3ZN2A 2J5QA 3S55A 3BMCB 5IDWA 1ULSA 2FN7A 4OXYA 3GF4A 5L45A 3MJCA 3GGOA 3GEGA 1I10A 3A9WA 1R16A 5DT9A 4BQRA 3KXDA 3ADPA 4OH1A 2IODA 1BXGA 2VWQA 3HE3A 4J0EA 2DLDA 3T4EA 5THQA 1C0PA 1R4NB 1Z6ZA 2B36A 3H5NA 1P0CA 3ENNA 1HRDA 2PD6A 4ND3A 3RBVA 1PS8A 4CM8A 5LCXA 3B20A 3V1TC 3KYBA 5KTKA 3KLMX 3I83A 5CG1A 2NU9A 1GZ4A 4GGPA 4ZQGA 4MVJM 1S6YA 4WNIA 5CDGA 1HE3A 3BTVA 4L73A 2YV3A 1YONA 2H6EA 4MKRA 4H15A 3M2TA 1PS0A 1XIVA 1WMAA 3DZIA 3UFXA 3NJ4A 3DAFA 5IF3A 5J23A 4AG3A 5C7IO 1ARZA 1I3NA 2Z5LA 5U9CA 2PD4A 1FDUA 5TLSA 3WWZA 3P5SA 1W4ZA 1K0UA 1BSVA 1U5CA 2DQ4A 2O3QA 4AJKA 2JD1A 2RH8A 5F5NA 4Q3CA 1HSZA 5BSEA 3FTPA 1G1AA 1NX6A 3P2YA 4GMFA 4XYMA 1LSJA 4CLXA 1I3KA 5H82A 4E5PA 1UDCA 1BDMA 4FW8A 1MB4A 2GGSA 1EEHA 2QYSA 3HZZA 3WFJA 3FWZA 1LA2A 4BB6A 1IB6A 1E5QA 4BNYA 3LVFO 5AXAA 1F06A 4KDFA 3DZBA 1PJLA 3JV7A 1C3VA 1VJTA 1N1GA 2YJZA 3WGOA 3SBOA 1ZSNA 1QLHA 4TVOA 5TC4A 4NG5A 3I6IA 4D43A 3OFSA 1Q0LA 4CMCA 4FFMA 4LN1A 3S8MA 3QVWA 3N7UA 4IDBA 3DAGA 2ZTMA 1T2EA 4UVDA 1PL6A 1I2BA 3ZWXA 1YJQA 4DYDA 1XLTA 4E4YA 1EE9A 1QYDA 1O9BA 2Y66A 3AOEC 1P9LA 5CDYA 2CFCA 4C7KA 2GN8A 5JMWA 1PS9A 1CQJA 3W4IA 4JQCA 3WFIA 4WNCA 3ZWAA 2O23A 3AUAA 3ZHYA 4K6CA 1PWXA 1I2CA 2X5JO 5JO9A 2X23A 1XA0A 2UV8A 4CR7A 1GY8A 1PZEA 3E1KA 3E8XA 2UUOA 1LEHA 1YB1A 4YT8A 3HB4X 3ZWCA 3LT1A 1H6AA 4HXYA 1NFQA 5A9TA 4MO2A 4P4LA 3NRCA 5L4SA 4NHEA 4D0SA 3TL3A 4M87A 2ZB8A 3RASA 4EJ0A 5IJZA 3IJRA 1HWYA 1VLLA 5TX7A 2C0CA 4N5NA 4YXFA 1SC6A 4RVUA 3C7AA 2RHRA 1T4DA 3HN2A 3ONDA 1FDWA 2WD7B 3FNGA 3GVHA 4FGWA 3FWNA 3NT5A 3RKRA 3GVCA 1QRRA 4GMGA 3T7CA 4YACA 4GSKA 4PG8A 1BVRA 1CDOA 2YV2A 4IM7A 2RIRA 5IDYA 2A35A 3GH3A 4BKPA 3H9QA 2ZYDA 4NNJA 4ZD6A 1O0SA 4MDHA 2PFGA 2NV6A 3SLGA 4FOSA 4RQTA 4AJOA 4DVJA 3ZV6A 1DFHA 5JDIA 4E32A 1OOEA 2Y05A 4J7XA 4YAJA 4RZIA 4LCJA 4ZGWA 1UXJA 5JS6A 5JY1A 3PLNA 5I7VA 3DBHA 2WYVA 4GH5A 5KJFA 4OQYA 3U4DA 3WX0A 4F3YA 3WLFA 2VTEA 1HYGA 3DZFA 4GKVA 4QXMA 3SVTA 1LSOA 2JAPA 4I08A 4LGVA 4PLCA 3WSWA 2JFHA 3ROPA 1U28A 3MCVA 3B1JA 1UZMA 2I9PA 1NPYA 4CMBA 3ANLA 1ADCA 1OI7A 3VDRA 3AOGA 2IZ1A 4JBHA 1VL6A 1FMCA 4NK5A 5KJCA 2NACA 2AQIA 4BHTA 1GR0A 1H6DA 3EAGA 4NJMB 4W9NA 4WLOA 2PY6A 3AY6A 3GNSA 5G4LA 5DCUA 1YDWA 2XF8A 4Y6SA 2FPIA 3ZHXA 3BTOA 4YT4A 1UDAA 2C2YA 3KTDA 5CG2A 1XDWA 4OAQA 3WNQA 1A7KA 3LF2A 1QYXA 4TZTA 1CIVA 2B83A 4JK3A 2O2SA 4Y6RA 2FHSA 1ZK0A 2DBRA 1SEPA 2C5AA 4YYZA 1DRVA 3DZHA 2ZJ1A 1P1IA 3L6DA 3Q9UA 3ZW9A 5DCYA 1K6JA 3INRA 4S1VA 3GDOA 4JXKA 3V2HA 3S2IA 1TLTA 1GCUA 4GAEA 4L75A 3EHEA 2AMFA 1BXZA 4YAEA 5A05A 4A26A 4CMJA 1Y8QB 2I3AA 3ZWVA 3X2EA 2GRAA 5FYDA 4WJZA 2OO5A 5TRTA 4BNIA 1UDBA 5IN4A 2Y0EA 3JQAA 4E5MA 4UVGA 3EZLA 5COQA 1JW9B 2QQ5A 4PLZA 5KIAA 2D0IA 3IAHA 4E33A 3WBBA 1ZH8A 3GGGA 1R0KA 3CMCO 3P7MA 4FJ0A 1DBVO 1B8VA 1UP6A 1E92A 1EZ4A 4JBGA 3GLQA 2I6TA 1NFRA 3UHAA 4RF4A 4R5MA 2WYUA 4EEZA 3ZWWA 3GEMA 5JXWA 4J2HA 4CM4B 3PK0A 1NQ5A 1JKJA 3DBRA 3AY7A 1B7GO 3F46A 3PHIA 1N7HA 3Q9NA 3UAGA 4F46A 3TWOA 1ML3A 3K31A 1LLCA 5JPIA 1R15A 2PWZA 4KOAA 1I3MA 1HDYA 3WOHA 2VRCD 3I9KA 4GBJA 1SZJG 5G0SA 1FXSA 1YXMA 4HY3A 2EJVA 2JD0A 3WXBA 3RUHA 1GUFA 2BF7A 3G17A 1E1KA 1NR1A 3AI1A 3QLJA 3QWIA 4NK4A 4TMFA 4YTEA 3WG9A 3LC7O 5A1TA 2HMUA 2BELA 4ID9A 2Y99A 4NH4A 3D64A 2CDBA 5AOVA 5I8ZA 2CZCA 5B37A 3WICA 3JQ7B 1IY8A 1VJ0A 1C1XB 2NTVA 3X2FA 4MVJD 4RVHA 2Y67A 4UUMA 4PGFA 3ETDA 4D7AA 1UP7A 3HG7A 1KS9A 4RO0A 4CV2A 4AJPA 4S3MA 3B1FA 2VYNA 1ISJA 3GY0A 3INGA 4J7CA 3COSA 2YW9A 3LC1O 3NTRA 3DWFA 4NIMA 5EERA 2X1HA 4IJWA 2PGLA 4DPLA 5KWEA 4NBTA 5JNLA 3HWRA 4DQXA 3NAQA 3OA2A 4CMIA 4L4RA 1A27A 2YZ7A 4I9UA 1J49A 1GDHA 1PR9A 3MEQA 4YAKA 3AY3A 3VKVA 1M75A 3LLSA 4J7UA 4LRTB 3D0OA 4NBVA 2BFAA 1XEAA 1F14A 3SJUA 4NDNE 2DUWA 4CQMA 4CUJA 1LBEA 3ZU3A 1QG6A 3GAFA 2OBYA 1PL7A 3O9ZA 3VPXA 4B3HA 4CMEC 2VNAA 2TMDA 1HEUA 3LT2A 4FSHA 1PTJA 2NTJA 2WWRA 4MIOA 4Z3DA 4IJVA 1VC2A 1XWFA 1EVYA 3H9EO 2ZTUA 1I24A 5DF1A 1IHXA 2FRDA 1KIFA 4IQ8A 1KVSA 2GN6A 4QUKA 4R9RA 3KYCB 1SBYA 3CSDA 4DBVO 2XXBA 1JQBA 3MJSA 1EQ2A 4NFYA 3SC6A 5K6AC 4BB5A 4B4OA 1QORA 4PLHA 2IXAA 1UUFA 3K2BA 1EVIA 3UW3A 1Z73A 3BMOA 3TZCA 1YB4A 4U6QA 4M89A 3PTZA 1RYDA 5KCZA 2DT5A 3IP3A 5A03A 2OP1A 4E3ZA 3O8QB 4BO7A 1WDMA 3I9LA 3L4BC 1GUZA 2DBVO 5I9LA 4W7IA 3RJ5A 4GPD1 4BNKA 1T2CA 2V6GA 2OBNA 1WDKA 3UN1A 4E21A 3AFNA 3M2PA 2HRBA 2ZTVA 3GDFA 4FD3A 5T8KC 1O8CA 2PH3A 4UREA 2O4CA 4NFSA 4OYRA 4TRNA 1ENZA 3HB5X 3KETA 2HQ1A 1NYTA 3R1IA 1PJQA 1QV7A 4QX6A 2F1KA 3FNHA 4QO8A 3IUPA 2W2KA 3RUCA 1YQXA 2BGKA 1I30A 4RZHA 1H9BA 4L74A 4D46A 1R4NA 5ES3A 3VTZA 1DIHA 1XU9A 4J9UE 3BMQA 3T7EA 1X14A 4A03A 3WQSB 4B3IA 2P9CA 2HKIA 1YBMA 3VPGA 4E12A 5JC8A 2X4GA 4PLPA 4OM8A 4YJDA 4WKGA 3RAJA 3GPIA 3WJAA 4DLAA 1DOHA 2POQX 4RCVA 4GWKA 4TVBA 4YDRA 4WUVA 4YRBA 1LDNA 5JAZA 4J16A 1CF2O 5DZSA 4XYLA 2P2SA 1VJ1A 3UCFA 4BMNA 5L7WA 3VC7A 3SX2A 1L7DA 1MUUA 1ONOA 2HUNA 4NJOA 4MIYA 3WS7A 3PHLA 2VT2A 4YT5A 1J0XO 1ZEMA 1H93A 2EXXA 1E1NA 1K6XA 3RC7A 3AM3A 5AQ1A 3JQGB 3OIGA 4J6FA 2A94A 3V2UA 3O26A 1LSSA 4B8WA 2FSVA 4WOJA 1Y7TA 2JHFA 2Y68A 1O5IA 5FI3A 4IQ0A 1PWZA 4RGBA 3WGQA 3JQ8B 3KUXA 3RQSA 1AHHA 1PU2A 2OHXA 4BNVA 2NU7A 1Y8RB 5TJ9A 3CKYA 2J5KA 2X0NA 4XR4A 1Q0HA 2O3RA 2D5AA 1PGJA 2EGHA 1ZK1A 3JQBC 1P44A 2JKVA 3DZKA 3KO8A 5BSHA 3L77A 3UUWA 1KEVA 1YDEA 2ZQYA 4DLBA 4IY1A 4XYEA 1EUDA 4XDZA 3ZW8A 4R54A 2AHRA 5IZCA 3JQ9C 1D1SA 1EUZA 1GV0A 2NVUA 4IPTA 1G6KA 1YL6A 3D4NA 4M55A 5G4KA 1JKFA 3ST7A 2JAHA 1B2LA 5DBFA 5I8WA 2DPGA 5HRUA 4M1QA 3W6ZA 1P33A 2NQ8A 3MWEB 1Q7BA 5C3MA 3OM9A 2HMTA 3NDIA 1I3LA 1NHWA 4XGIA 3LQFA 1S7CA 1KETA 2AE2A 3PP8A 4WK6A 1YGYA 4KTVE 1J5PA 1HDXA 4H7PA 3ZV5A 4QFCA 1PZFA 3L6OO 3DTYA 3K96A 3N74A 4U5QA 1QYVA 3A14A 5FFFA 1NR7A 1SOWA 2H63A 4QTZA 1LX6A 2F00A 3ASUA 3DO5A 2Q1TA 3WGTA 4DYVA 2PLAA 2ZCUA 1ORRA 4LW8A 4NBUA 4XR9A 3HQ4O 2IEBA 3E03A 1YKFA 5TSDA 2VOJA 1NVTA 2R00C 1MV8A 2W8ZA 3STHA 2AW5A 5DP2A 2UDPA 3F4BA 1XCBA
chains in the Genus database with same CATH superfamily
1XTTA 1K88A 1YT5A 5TIIA 4ECAA 4QGGA 1QGZA 8ADHA 2C59A 3RAGA 4YBZA 5ADWA 5L51A 3MWGA 2O2HA 5EJ2A 4MB6A 4L08A 1J8MF 3QUAA 3QSGA 1AB5A 1E63A 1T2DA 2QRNA 1CQWA 2HD4A 2H57A 2PMWB 2VHUA 1IHOA 1UM9A 2WD7A 4DQLA 1E66A 3S5UA 4HDMB 2E89A 3ZZUA 2XB4A 3QU5A 1F7VA 1TF5A 4MQLA 4C9BA 1UOPA 2VN8A 3KBBA 1TPYA 5IBPA 4JQOA 3JSAA 4ND2A 2IV3A 4PFKA 4JMPA 1U3GA 2QW8A 5DHRA 4QOHA 5LA6A 5BSFA 3RUEA 2HI0A 2Q4OA 5HDBB 2VF5X 2W6ZA 2A9FA 2AFHB 3I58A 3OTHA 4OQDA 3P26A 5KX5F 5CR9A 4NU8X 3F1KA 3PUZA 2HGZA 1F2TA 2ZJ5A 3GJQA 4ND7A 3ZU4A 3ZZNA 1O6CA 3OLXA 3OZRA 1E2PA 2CMFA 2Z2JA 3PFCA 3VPHA 3ZU5A 4ZO6A 5TEWA 1JIQA 1CF9A 3EG5A 4ND5A 3C41J 4ZT7A 3IP7A 4ITRC 2X8BA 3GLUA 3IT0A 4KWHA 1ORIA 1G38A 2XVXA 3FKQA 4GC5A 1KIMA 3EAFA 5AVJA 4ROTA 3THYB 3OZIA 4N7BA 4OL0A 5KU1A 5HUQA 3O47A 4OV6B 4W5QA 1Z6XA 1A2QA 1OR8A 2JH9A 2FLVA 5A0FA 1X19A 4LOHA 1EDZA 3M5CA 1U3UA 4EPTA 4AO7A 2VWGA 1T1GA 5CA1B 4ZO7A 3DG9A 3TYXA 1B6SA 5I45A 4H18A 3QBDA 1R8QA 2QRZA 3VNQA 2VZLA 1GSOA 1UJMA 3DMTC 3D1VA 4MR9B 5BNIA 1ZGZA 4IYJA 2ZSKA 4NI5A 3MTBA 4H6XA 2F43B 2BZGA 4GGOA 2WSSD 3OJ0A 2JLVA 4E88A 3PNYA 1WKBA 3OOWA 4H4DA 2C2OA 1VKOA 2E1PA 4WXRA 2VHJA 1GEGA 1F6BA 2FWRA 2GZ2A 1ILWA 5F3RA 3TKAA 5HBRA 1RKXA 2XEDA 1G60A 4U9HS 2WFZA 5F78A 1HDRA 1BEUB 2YJ4A 3F47A 3W5UA 2G8NA 3KB6A 4FFWA 4PGAA 1Q1QA 2BRUC 4LMRA 5CM9C 4B6OA 1QR2A 2B8JA 2VPTA 3CF4A 1L4FA 2XNCA 3P19A 1M2FA 4H6VA 4X20A 4C6TB 2Z4SA 1VBMA 4J4BA 1AUQA 3F49S 3F7OA 1TO2E 3N39C 4KMRA 4F38A 1PHRA 3Q7SA 3FJ1A 1AOXA 4MEJA 2EZ9A 5PGMA 5HMLA 2NM0A 4N3AA 2EHDA 5DYTA 3HFSA 1D03A 1NE2A 3LL7A 1V3UA 1VIDA 3MSCA 1F7UA 3HYRA 4KLAA 4F7WA 1I3OA 1WUTA 5BXQC 1BEZA 4FMDF 2FK7A 1UJ5A 5LZ8A 1C4OA 3K0BA 4JLMA 1PNRA 1JBQA 1LQUA 3HVHA 3NT2A 2Z98A 4UJ3A 5EPOA 4C21A 4DA8A 4DQ0A 2CNKA 4WW0A 3EDQA 1PD1A 3NC4A 1MC8A 1HYQA 2YRXA 2PS1A 1G42A 2PYIA 2WWYA 3U4MA 4B4VA 4A8TA 1PF7E 2OCYC 2Q1XA 1J97A 3ZKAA 3ZCRA 1EX1A 5AHXA 5EJ9A 3UPTA 2XMCA 5B1HA 5NULA 1IXKA 1JEDA 4INJA 3EWIA 5LR6A 3CLVA 3P9ZA 4PXAA 1U1DA 2CVFA 3QKSB 2YIJA 4ZYZA 4KIFA 1N2EA 2WAMA 1W88A 2FE4A 4L9RA 1PD0A 3ZNOA 5IT5A 2OENG 4A82A 2EG5A 2V4MA 2ONKA 5D86A 5ICMA 1E77A 3DE5X 5BW4A 5I7UA 5DH9A 4OUKX 1GKLA 4II2A 1BMDA 1ZCJA 3F7NA 1CD5A 1BXRA 2J0UB 5HKOA 4JI7B 3I9OA 4FYKA 5C81A 1T34A 2C92A 4TLAA 4UUBA 3WGNA 1OH5A 2ZJBA 4BEBA 4M21A 5CB8A 5JSKA 4G23A 4DHWA 1S7GA 3AHIA 4UAVA 1UK6A 2H1VA 4WEOA 2NXEA 3O03A 4FSXA 3ZY5A 1X1AA 4MV4A 1CY8A 2AD5A 2FMKA 3H6GA 3M82A 3VAZA 3Q7QA 1X0XA 3L0IB 2IP2A 3K6SB 3BFXA 3SXUA 3FTCA 1XD2B 3D4BA 5F5LA 2YMQA 1NL3A 1DAGA 1ZUIA 2GESA 2WA2A 1JA1A 1IH8A 2OFWA 1HF3A 2C8KA 4LGCA 2ZDGA 1V6SA 1U3TA 1CZUA 4YJGA 3GPLA 1IMJA 4MUFA 4ZK6A 5IBCA 2LCQA 2FPOA 5JSFA 3KAJA 4M0UA 1GPKA 2B4YA 3SKYA 2GXQA 1JLLA 3EXHB 3V7UA 1NN3A 3FF4A 4IX9A 2C1XA 4HQ0A 3UWOA 6AT1A 3VJRA 1P7PA 3D2CA 4CFSA 3X1DA 2E82A 3QWAA 2QX4A 4GZLA 4B8ZA 4DV2B 1CLEA 4N9WA 1DLIA 4J90A 4UCXA 4MRMA 3DMNA 2IZ5A 4DC0A 5E38A 2BEKA 2Q49A 2ZDQA 1XTJA 3UWSA 2HA4A 1PUIA 1NQUA 3FSJX 4OM7A 4RA9A 1RAEA 3LE8A 4ROSA 2BGRA 2TS1A 4UQOA 3ZWKA 2VJOA 1ZK3A 3TSWA 3AYXB 2VC2B 1CUFA 1ZJYA 3ESAA 3L82B 3NX4A 3H65A 2AB0A 1ULBA 3KOYA 3O95A 4M6WA 4TVKA 5FI5A 3WNVA 2XMRA 3I42A 2H1HA 5HZGA 1RE0A 1WCV1 3KHSA 3ETNA 5TY0A 3WV5A 5EIOA 3LHFA 5JCJA 3A58B 2WSYB 1IAQA 4MCJA 4OHBA 4FHCA 4D9MA 3NT4A 4XB2A 3L7NA 3MWFA 2ISSD 4YJFA 1RAIA 5B1IA 5IT4A 4KZPA 1AU9A 2KW5A 3JQ6A 5BNWA 2O4UX 1U7WA 5ALIA 1HNWB 1W25A 1NTOA 1QC5B 1L5LA 3GP5A 4URVR 2PX6A 4KR6A 1L7VC 2ZWIA 5J2UB 1NHGA 5CM2Z 1Y4SA 5JT1A 3ETGA 2WAOA 4B8YA 2IV2X 4ZAWA 1JPVA 3G9TA 5JYBA 2QB5A 2Z8YM 2FPGB 4MB2A 5IAAA 1O57A 4WX2B 5AO9A 2Q6TA 1Y5MA 2B8NA 1YA4A 4CL3A 1JR2A 3C3EA 3HCRA 3RTDA 4L95C 1UP4A 1OXTA 2GLTA 2IUFA 2O3SA 1DINA 5E0OA 3I04A 3DDCA 4DXAA 4MS3B 2P8JA 1N5JA 3AKDA 3EZ9A 4TSFA 4EELA 1EE2A 2R68A 4I4IA 3MRSA 4QA9A 2XTJA 3ESBA 2Y27A 4P4SA 5BR7A 2OQRA 1P8JA 3GP3A 3ZYCA 2O19A 3I23A 1OPXA 4DMCA 2B34A 2SCUA 1KKMA 1XZIA 3FTNA 3CE6A 3K8YA 1BE0A 4HCJA 4NEHB 5ALSA 4DANA 2QRUA 4X1YB 5I01A 1EWQA 1X86B 2BKLA 1U0NA 3FUVA 1U8ZA 3FTDA 4P4GA 4ZVRA 3CRRA 4GXNA 5M3BA 2C4TA 2QRGA 4BV9A 1P3DA 3PFWO 5DHSA 2FPRA 1BN7A 4QXPA 2JDIA 4TZKA 3WE7A 1GSHA 3KHUA 1PT7A 3Q3EA 1EINA 2AZDA 1PVOA 3LPMA 1D0IA 2HIAA 2I33A 3H9UA 4IWYA 4AJ9A 3RB8A 2FPLA 2PZGA 4JLKA 2IWHA 4AU1A 1QFYA 3TUJC 2FR8A 1V5GA 3AVWA 3CLKA 3CW8X 1K66A 1BMQA 1Z37A 2B1JA 2BR5A 3MINB 2DKNA 3IT2A 1WO8A 1HLDA 1OLXB 3FWYA 1EBFA 3LDHA 3SC4A 2VDPB 1C3OA 1PEDA 1RXCA 1KJ8A 4AY3A 4DWVA 2NXJA 5A6SA 3HB9A 1REQB 2CCKA 2G3YA 1YH3A 2I6GA 3EULA 3OEYA 2O2DA 5IC5A 9MHTA 3OPVA 4FKMA 3S2YA 1LZKA 1N5IA 2OV6A 1A4UA 5C3UA 1RKBA 2P9TA 1B3BA 4MUBA 3Q8XB 2BD0A 3RWBA 4IIHA 1KRXA 1JJFA 1E9VA 2FW9A 3GLHA 2EQBA 1A1SA 2WIAA 1DO0A 3OF3A 4FI3C 3LRPA 5FLYA 3F6EX 1EK0A 2ZRDA 1CVLA 4YB8A 1L8XA 2R5NA 4KQEA 1M34B 4P38A 2IRWA 2V9CA 4MQ6A 4ALJA 4KNYA 4RX1A 4Y1RA 4C89A 2OZPA 1MEEA 1ZDMA 4DV0B 3ABQB 2PUBA 3GAMA 3NYRA 3I30X 1XEXA 2ESRA 2QPLA 1DIOB 1GLVA 1RC0A 1YZFA 3FPHA 3FZEA 2H5EA 3GOQA 3H9JA 3IOEA 1FNBA 4IDHA 4OAPA 4Y2JA 5LB2A 1USIA 2N42A 5AQEA 1HE5A 2VJPA 5KVVA 3LUCA 5KNLA 1XDGA 2BFEA 2PV0A 3D8RA 1BXGB 5DLYA 4TT8A 5C1OA 2GA9A 4JIGA 4CM5A 4JQYA 4FIZA 2ORIA 4LYGA 4TSKA 1G8YA 2AF3C 4CLEA 4F91B 3VPSA 1FVOA 4F5EA 3DHVA 5DX8A 1J8DA 1O8BA 5DYYA 5AW0A 4DILA 1NONA 5K3DA 3TOSA 1GRRA 5CNJA 1JJ7A 4U00A 1Z5NA 4ZZ3A 1J8QA 1L4BA 1QQ7A 3VH1A 1V1JA 4CLRA 4X54A 4DR6B 5A0TA 2NU9B 4GZMA 5HS4A 1YCHA 4RIHA 4N3GA 3PFBA 4FT4A 4F2HA 1HFEL 2DFPA 5LC1A 2PSFA 1FU4A 4UPDA 3BD9A 4I4TA 3T1OA 2P6UA 2DLNA 1YZHA 4LSZA 4DEXA 3E9CA 5K3SA 3NKVA 4YMSA 1ZCZA 3VR1A 3PCTA 4BKRA 1DNPA 1EWTA 2OZVA 3TIVA 2YV1A 4IIXA 2V7PA 1P45A 1WLSA 3BJZA 4GR5A 1PLJA 1QFMA 3ESZA 3EXAA 3IDSA 2I78A 3A1EA 5JAOA 3G5UA 3CN7A 4RNCA 3ZE7A 2EL9A 2VAPA 2VBIA 4G0UA 4K6HA 4BNWA 9LDBA 4LC9A 4XB1A 3FA2A 4Z4IA 2K5UA 1UBMS 1R27A 4DKXA 2F8SA 4EHFA 2RONA 4Y98A 1KAHA 1TFUA 1F8GA 4MX8A 5C5IA 1JUDA 2WB2A 1W75A 4QQFA 4EG7A 3B38A 1L6IA 5AVWA 5KOIA 1YB6A 1CR2A 2FWJA 1IY2A 3PYXA 1CUVA 1NVKA 1JDTA 2VK2A 2QD4A 1VIAA 1MTOA 2FX5A 2I1QA 2ZROA 5CGZA 3PDIA 1NG1A 4MR7B 1CR4A 3BIOA 5FBHA 3UXMA 3AVUA 3AGPA 2ZUSA 3G8BA 1XDDA 3L6CA 3G0HA 1PZGA 3PVCA 2W6IA 4FC6A 1Z2DA 2OE2A 5FTKA 4MAAA 2G4CA 1FLAA 2FJPA 2DERA 1Y81A 5E6UB 4FE3A 4CIWA 2O2YA 2PPLA 1VSTA 4MPTA 3AWDA 3GLIB 4XIIA 3NP9A 4P3PA 1QOQB 4HNGA 1A2OA 1I4WA 1NUQA 1T25A 1Q16A 3OQIA 3UJ7A 3VSEA 4YLYA 3M7IA 4BLOA 3BAZA 5E9QA 2EZ4A 1ZVQA 2FG5A 3EJ6A 2PKQO 2VKTA 3MWEA 2XI4A 3SHOA 2ZAMA 3OG9A 3G1TA 3PC3A 4J49A 2Y92A 5JZMA 4HVTA 5CT6A 5K20A 3Q7TA 3CO0S 2PUAA 1SKYB 1QAMA 3D2BA 1BWRA 2G76A 3WRYC 1GEEA 4EMUA 3G5TA 1NASA 4OOFA 3U4QA 2DBZA 4CLOA 4Q9HA 4ALKA 1XKQA 3JQCA 2JBAA 2AOVA 4CTMA 2BLLA 2FDXA 2P78A 4NCHA 4BGDA 1KTIA 3O4GA 2R4TA 4PRZA 1J6UA 1DFIA 1ENOA 2JLZA 3AB8A 4NJEB 4WASA 5DBGA 5EMKA 1NVUQ 3UJ3X 1TA4A 4B0OA 2P5YA 1S9DA 2FR1A 1NR5A 4H7JA 4Q1AA 5GOZA 3DEHA 2QRMA 3GR6A 1SOAA 3DTVA 3JWEA 2GZAA 3GFOA 3KQTA 4BZXA 4J2TA 4CKXA 4P7KA 5LYJB 1GGMA 3UAVA 3TRIA 5HF5A 2G25A 1H8EA 2D62A 1OFHA 5C32A 2C88A 3PUJA 2GDZA 4QPPA 2QMUA 3C1TA 3SVZA 2AJTA 3IUJA 4A7PA 1IRIA 2C3UA 3WRXC 2JBHA 3SQNA 1ZITA 2BJVA 5EJFA 1RAHA 3ORSA 4MROA 1OPRA 5JVDF 4GDMA 4XVUA 1MNQA 3OEED 2CD7A 2OP0A 3QVUA 4RCYA 4WINA 5GGYA 3NIWA 4W5NA 2NZXA 3GRUA 4RJJA 4XAQA 5CH5A 5K0GA 2CYCA 3LQ1A 4KK4A 4R9NA 4E46A 1W1UA 4YRKA 4NPCA 2AG0A 1AK9A 1NDUA 3KQVA 2YJGA 4HDMA 5LQAA 5JAHA 2ADOA 1URPA 3FROA 1B00A 1CZOA 1CIJA 2A6PA 3L1JA 4S1NA 1NM5C 1MT3A 4DADA 4TSFD 2FWNA 3DE7X 3V1KA 1L1QA 2R8PA 3HWWA 1HZJA 1G5RA 4GOOD 2QLJA 3JY6A 2FUCA 4RZUA 3VPAA 4X1KB 4P3OA 2I5PO 3KTOA 4KYVA 2JGMA 1T2FA 1MQAA 3AEQA 2FWIA 2K2QB 3DBLA 3EIQA 3FHTA 2IYOA 4C7MA 1I1NA 4KIGA 3FTFA 2AYXA 2NAPA 3F1LA 3V1YA 3WGKA 1YQ9A 2H4WA 4KO3S 2WOOA 3IQIX 2CEAA 4ECEA 1XHLA 2PEZA 3SX4A 1GAEO 3I61A 4ERNA 3BN3A 1Z2CA 4UBKA 3THYA 1IPFA 2C4VA 4NCIA 4DMKA 2P4SA 2ZJOA 2DUMA 3OIWA 1KZ6A 1ADJA 5J4VA 1CUSA 2J3KA 4RY9A 4XDHA 3L9XA 4JBIA 2BEVA 1GPJA 2J6CA 3GRAA 4H17A 1YJ8A 4IVQA 4PCAA 3VH4A 4M7WA 4BO1A 3AJ9A 3HABA 2ODNA 3FPLA 3W6OA 4Z7NB 5JAZA 3O21A 2AN5A 2RK3A 3DBHB 2ZE5A 3L7MA 4MR9A 4BJ1A 5JXIA 1YR7A 4O63O 2F43A 3PX2A 1NLYA 4IR7A 5HMMA 3TPFA 3GJ3A 3FUUA 1CB7A 4U02A 5WRFA 3VBEA 4LOAA 3ML1A 4IWXA 3U48A 3MZ0A 3UQZA 4ER0A 1FFAA 5G0WA 1P0QA 1ZMOA 3GL9A 1B23P 1XRSB 1QZTA 2Y0CA 3E9YA 2RK4A 1JDJA 3UJDA 2P2LA 3LUPA 5AVOA 4L0QA 2QMOA 3ZWNA 1PR0A 4F8JA 1PAUA 1FCJA 1LKZA 1K6MA 4BE9A 4HAYA 1RRKA 3SKXA 1YS1X 2FHPA 5FBWB 1ZI8A 2Y9PB 4QNRA 1Q21A 3UJPA 4LY9A 2CLDX 2OLEA 1HYHA 3JQDA 3W1VA 1FY2A 4IZOA 4CHGA 4ZMRA 3SSMA 2YZNA 3QYPA 3PL1A 3U3OA 2JFXA 2HRDA 4K9OA 3B8HA 3DFUA 2ZSHA 4MQ4A 1QG4A 1SUPA 4EX6A 2XAUA 1FPQA 1IJFA 3TAHA 4I5IA 2JAOA 4JOSA 4UM5A 2V96A 2FQ1A 4BWGA 5EKTA 2LDBA 2UZ1A 3R9WA 2JH3A 4EHJA 4GLLA 2B1IA 1AF4A 3PPIA 1T4CB 4C2BA 1NI5A 2F4VB 1U0BB 2XT9A 3KXIA 5BURA 4TTSA 3JZMA 1O7JA 2B99A 1SMKA 4TRMA 1I8TA 5C80A 2BGIA 4Q7QA 2EJCA 1X7GA 3AUTA 3D7MA 3L7YA 4AQDA 4C4AA 1MAVA 3QKSA 2IHTA 4QICA 5JNVA 2PKRA 3JWGA 1CY2A 5DNWA 4CETA 3DFKA 3PGA1 3HYLA 4CUZA 1LPPA 2FY8A 1XTSA 1DC8A 3ESXA 1P3Y1 1OWLA 2DWQA 1ODSA 3JQAB 4HN4B 1QSGA 2YHUA 1ODJA 1PJCA 2Y1KA 4RH3A 3KQHA 1XDZA 4NOLA 2IHVA 2ZI3A 3AUSA 3EEIA 3JYNA 5EYPB 3IKTA 4OX9Y 1SD5A 1GD1O 5HKBA 3V4PB 2CL0X 3HKCA 4AC9A 3J81k 1U2DC 4K1XA 2O8DB 3ODGA 2YYYA 2A5GA 2RGEA 4RD4A 5AI9A 4XIGS 3D31A 4LDJA 4N03A 4WLUA 2CJFA 2MT9A 3IQDB 3LDFA 1E9RA 2WKQA 3GNQA 4O4IF 5B1YA 5IUNC 3X3HA 7MDHA 1Q1NA 5EIBD 3NWOA 3KXKA 4XCVA 2O8CA 3BB3A 2YZGA 3QTTA 3KJIA 3NHSA 4A5OA 1E79A 5IZ4A 3MJRA 3O8NA 2IEDA 3OLVA 4K86A 4XA8A 2BUBA 1LDEA 3LVRE 2WTBA 2DT8A 2R2GA 3UK6A 5CCEA 2QG6A 3ITDA 4C7OA 2WKPA 2MOKA 2QRLA 2XKJE 3U3RA 4X0EA 3FGNA 2UU9B 4M2LA 2I54A 4K2HA 3TLKA 4FNAA 1GU1A 3QVJA 4XQEA 2FZLA 2XCUA 3WK9A 5DRYA 1LFAA 4DAOA 4FDVA 6CHYA 1UMDA 1SRRA 2JLXA 2WJIA 2CBXA 4PO3X 1DAEA 1WABA 1ZRSA 4L16A 4QDOA 5BYJA 1DBSA 4D9NA 4X6XA 1YK0A 1TJNA 2PNFA 1Z39A 3FMPB 3NGXA 1ECPA 3BHMA 4UMEA 4URHA 4W82A 4RANA 3ZE0B 4DQVA 3PEYA 2C57A 1WXXA 2P3LA 2X6QA 5KYVA 3SZRA 5IDXA 2EGGA 3Q0EA 4DV3B 1V11B 5LMCA 4H7DA 1M8GA 3K73O 3BKXA 2NTEA 1KPGA 4Q6WA 4JI6B 2WQ6A 3JATB 4KGXA 1G41A 9ABPA 4QSMA 1XA4A 2XQGA 3GRYA 4HB0A 4F3RA 4OI4A 3Q0TA 1WMBA 3FY4A 1ACMA 2Z1MA 4R9SA 2P40A 2C29D 1OJ7A 4DXHA 1NBOA 1V9LA 1QC5A 3DCIA 3ON5A 1FQWA 5C5CA 4JP8A 4XLZA 2KPOA 1SVIA 1J09A 1I51A 2AR7A 1P4RA 4CM1A 1QGDA 3WQQA 1WQ1R 1UZUA 4D41A 2OYSA 4GYJA 3K94A 4IXMA 5K6RA 1ZSYA 2FPGA 2HW8A 2FFJA 2NIPA 4EKGA 4JVSB 2EV9A 2YS6A 1KVUA 3MBKA 1XB2A 3IE2A 4R1NA 4F7DA 1DKPA 2JGAA 2PKCA 3GFSA 1U9ZA 2QE6A 4MS3A 5UKDA 5MDHA 4CRWB 1L5QA 4UTPA 3P32A 1H42A 1E8MA 4GRIA 1DBPA 1NYQA 2KM1A 3HCOA 2Q3LA 1T8PA 4L4ZA 1Z0AA 3CA8A 1CDZA 4P58A 5I9NA 1P91A 3AKZA 1SCDA 4DB2A 1QGUB 1IBRA 3OCJA 3WB0A 4OKSA 4DDVA 1Y8AA 1PIWA 1TJ4A 2J7KA 3M33A 4IX1A 3ZI0A 2CHVA 3QVMA 4BGIA 4BMSA 1JI0A 2D59A 4JT8A 1RWBA 1GNVA 4M76B 4ZCLA 1ULUA 2DPXA 3IODA 3S2EA 4A1FA 1Z56C 5DXJA 1AMOA 2J0QA 1E3TA 1QIIA 2NQTA 3C39A 1INLA 4WQMA 1UKBA 2QGNA 5KINB 5GJCA 2DY0A 5ABPA 1I36A 1EGMB 2FVXA 2CKDA 1S2LA 1UZAA 2ZRFA 4P08A 3U3DA 3ECAA 3GV0A 3I6YA 3JD2A 3MINA 5CT8A 2A58A 2YUTA 1OLXA 2F2TA 1USGA 2WE7A 2NSJA 5FJJA 2QM3A 2O05A 3FXAA 1O58A 4A16A 5M04A 1MZPA 2IX3A 1SK8A 2ZAGA 3Q88A 1XALA 1F8FA 4IDOA 4ZO4A 4CW7A 2RG7A 2FZCA 1SY7A 1VGQA 1W5FA 3OICA 2R00A 4RFSB 3RSZA 3O84A 1IBSA 3TOZA 4TYNA 2IELA 4PYMA 4M1SA 1X2BA 2M1ZA 5HILA 3K71B 4BLWA 3NB0A 3UB2A 1NUSA 1UDXA 3O9VA 2NYVA 2O8VA 4L5CA 3BJRA 3R3VA 4NFLA 4EG6A 5GIOE 5EMMA 3KQMA 3TSAA 2ACWA 3BGOS 4CTJA 4S2UA 1QUEA 2WPNA 3FJYA 5IBRA 1T8YA 1QTNA 1DUSA 2P5SA 4OKNA 4UW9A 3TL6A 5BUSA 1YZVA 3SYKA 4BFXA 1K86A 3UEOA 3P9YA 4NAVA 3DOOA 2CXQA 2ANCA 2AMYA 2PYZA 1KY4A 3EXG1 5F3WB 1C1HA 1CZNA 1Q44A 1QFJA 2ZTLA 3CW2A 5BNZA 2QTWB 1TAHA 4K9QA 5IJAA 3ZX4A 5JCPA 4WE3A 4DCUA 2G1UA 4D8WA 3EZ2A 5SY9A 1Z12A 4F9EA 1TQ4A 2W2KB 1H2FA 1BE1A 1M1XB 4KI0A 4K6MA 4Q37A 1XWWA 3EVBA 3O4HA 1E5VA 2PUHA 4P4TA 3H19A 1II8B 2P11A 4IIDA 1T4BA 3PRJA 4OHRA 5KKNB 1X7ZB 4GX2A 3D5QA 3G49A 2I2BA 4J9VA 4LK2A 3JVVA 3CINA 1UBLS 3R2JA 4ZVQA 9LDTA 4AM8A 4RS4A 5A6VA 5JXGA 4ZDKA 2GD6A 3B2QA 2FW8A 4G0YA 1U0LA 3UJCA 3K0EA 1FNMA 5EWMA 1FS5A 1OV6A 3DUWA 4LYJA 5J4KA 2W2PA 2ZAYA 3OCCA 3L79A 4Z9YA 1DTWA 1M3SA 2XHEA 3VR2D 2ZKIA 5IH3A 3K8ZA 5AM3A 2IT1A 3JRXA 5H83A 3RTBA 4D5GA 3U81A 1SC3A 3AB3A 2WYOA 1VA5A 3PD7A 3QU9A 4GG1A 4QBTA 4M60A 3FBGA 2CLSA 1US8B 3ZHTA 1RXSA 1B6RA 4RVGA 4MAMA 2K7ZA 3CMMA 4MPDA 4UE3S 2JGRA 3AHGA 5ALQA 2QXYA 3VV3A 1GZ3A 4PYJA 2J9GA 2JLQA 1SUDA 3BC1A 3F5FA 1KJ9A 3H5VA 1H4TA 4JDUA 3L7KA 2WWGA 5ITVA 1JYSA 3R76A 4AXBA 3IIKA 2ZRLA 4AZ3B 4BFCA 4YASA 3IAXA 3MMSA 2B2XA 2QY6A 1CCWA 2VQ6A 1QGYA 1R0YA 1J7JA 1WQ3A 1YUBA 2VTDA 3OLYA 1UAYA 3U17A 3WV4A 4MR7A 4JODA 1QTRA 3ZDYB 1JR4A 4GLFA 3Q8WA 1KRWA 3H1BA 1HFKA 2LKCA 3C5CA 2PMBA 1XJWA 2H5JA 5M34A 4UAJA 5BYKA 2PWYA 5AKZA 3BTSA 1IHDA 1E1QD 4EI7A 1XYGA 1YL7A 3ZGYA 1OFUA 5E6UA 2W42A 1C9MA 2QGZA 3N8GA 1AKUA 4II7A 3OJWA 5JJCA 1LTQA 2QVYX 1NI4B 4C1NA 2OD9A 2FF5A 3HDJA 1AS0A 4FGJA 5JH7F 2E4ZA 4ZCSA 2JBWA 1XL0A 1UFVA 1N3IA 4OHFA 1SHTX 4L76A 5E1BA 2OR3A 3CF6R 1E2QA 4ZYUA 2O9JA 1Q2XA 1MPTA 2D7JA 4R83A 4DMGA 3SHVA 2V3CC 4MNTA 4I6JA 2WZBA 3FVRA 1B8OA 3RU9A 1U2ZA 3ADDA 3VO2A 2NP7A 1G3UA 3UWDA 3PNSA 1O4VA 5I9SA 4R1UA 4BQEA 2QORA 4NYJR 2JG3A 1C0IA 2JJMA 1UJ4A 2QTAA 1D9XA 4GUAA 3L4KA 3VKGA 4QOSA 4EITA 2I03A 1NW6A 2LKDA 1OU4A 3IUSA 2O3UA 3NHLA 2HWWA 3Q7EA 4L8FA 4JLSA 4PVCA 5FQNA 1Z06A 4N7MA 4WL0A 4L3VA 5LYJA 4O4JA 5F4ZA 3U26A 1ZD5A 1LNSA 1K3FA 2ADMA 1V6AA 2C2MA 2I7XA 3P8ZA 5AJXA 1G5IA 3KTFA 1UC8A 4YJ3B 1JXQA 2UUBB 1II9A 3WYEA 3TN7A 4YJHB 2Y6UA 4KH0A 2ZRCA 1U28C 4G5SA 4YMGA 2ZWAA 4D6XA 4LF5B 3RNLA 5MFPA 2HPZA 1V6CA 1XMXA 5FADA 5IM4A 4HATA 2WIJA 1B41A 1MQ8B 3AGQA 3C6QA 4ZQFA 1IUNA 4O4LA 5FUVA 3HDVA 1BW9B 1GQQA 4OGKA 1XE3A 3ROFA 4BP3A 2DU8A 3K6RA 4EA8A 1A9XA 3ULKA 2VYQA 5DNDA 3DXFA 3MLAA 4LYHA 4TWIA 5LJIA 5LQUA 3KALA 4P5PA 1N6NA 5FD8A 4D6PA 1DO2A 4D6YA 2HO4A 1YQUA 4OUDB 3VJLA 3IDFA 5JHHB 1EVJA 2M6SA 3OO0A 4LNHA 4RUKA 3LBNA 1XRMA 4UZSA 5GPBA 2LWIA 2JCXA 3EC1A 2GMWA 3VVCA 1C5KA 3ZPXA 5JXJA 1N2CA 2RHTA 1XZDA 3WMEA 2UUAB 2CFTA 1FBNA 1SD2A 1DAHA 2OCKA 1ZJWA 1VJGA 5AXDA 4R5HA 3ZDZB 1EK5A 5CB6A 3X1KA 3EMBA 3PUYA 3WQBA 3FN4A 3LNTA 3WJ1A 4ZK2A 3Q8LA 4UUOA 2PZJA 4M49A 3WA6A 2COEA 1HDZA 1B3RA 1IHPA 2WQZA 2ZAOA 1TK2A 3GN2A 4ISCA 2HU8A 5I9IA 3IBSA 4BO8A 3RAFC 4LF6B 1A3CA 5JATA 4P8RA 2UZ4A 3B1XA 2CGEA 3GDWA 2C7PA 5EJ4A 1MB3A 4QXQA 4DC9A 4P31A 1AGNA 1II0A 4M7RA 5G1PA 1S2IA 1PQYA 1ZBDA 2HDNB 2OO5C 1FMTA 1O9GA 4MRSA 1NSYA 4ALLA 5JJIA 3COZA 2J4CA 4EGFA 3HU1A 2R3SA 2DH5A 5AKXA 1F4PA 4NOMA 2QUIA 4UASA 5LKRA 1SHJA 3ZNQA 5EFZA 4MW0A 4U7DA 4G5OA 4H1VA 3C8DA 1U7HA 5JSZB 1A1VA 1LDMA 1HQYE 5C4GB 3FF1A 4O1MA 3WYAA 3BMXA 3KZVA 3RD5A 4ND8B 3AR4A 2UVDA 4MS1A 3IVRA 1NN0A 4LC0A 4G1MB 1JSXA 1UPBA 5LIPA 3GYGA 1RYYA 4D1YA 5B4UA 4B82A 2VTBA 5TMDA 4ZVVA 1NGSA 3PWSA 3IEVA 3NNDA 1L3BA 4FUQA 4H7EA 3PQ6A 2VA9A 3MUFA 1VHDA 1AZWA 3LBFA 3NWPA 4JN6B 3OX4A 3PUVA 4TROA 5EIBC 1V25A 1E5LA 3ZD9A 1FW6A 3U3KA 2WU4A 4XUDA 4MW6A 4EW6A 4DA4A 3CVOA 1DBWA 3JS5A 4ZVSA 3VZCA 2JRCA 2XZLA 1D8TA 1J22A 2VHTA 3PIIA 3Q85A 4HS9A 2NVWA 4DC1A 2AXNA 4DABA 3CVUA 2UZ3A 4Y3UA 2X2PA 4I50A 4C29A 2DHDA 3DL2A 1N5DA 1UFQA 3E3OA 4R1SA 1HT0A 2JIZD 1T4CA 2XCIA 4U6NA 3ZDAA 1X7HA 3AQIA 1ZXBA 1LBQA 2QE7A 4LXIA 1VLMA 4ARVA 2W8BB 3KKLA 2J3EA 3KJEA 4EF4A 1YCFA 1BGVA 3MVEA 1UFKA 4RSRA 1P6QA 1G3RA 2BISA 5KNDA 3FIUA 4UEOA 4AZ0B 3T94A 1U0HC 2VZEA 1PGQA 1DBIA 3GN1A 2VPZA 1VRWA 3G2NA 4AJLA 1WIWA 2H59A 2V7UA 3LG2A 3P9CA 1MDFA 2GAFA 3GK3A 4I6EA 4QGBA 4OQEA 4AP9A 4RA6A 4Z9BA 2YFKA 2GHIA 2A9PA 3MOGA 5HZMA 3CY6A 3JQ8A 2L42A 5B12A 1GAXA 2XECA 1OFIA 3R9IA 3ZE1B 1Y5IA 1EM8B 3C5WP 4DV4B 1GU7A 2AXQA 4GP9A 2ZBFA 1TYBE 1I2DA 1QO0A 4BFWA 4A0FA 1ZC4A 3STTA 3R3UA 5KDLA 2X4DA 1XO1A 3QLUC 5F5XA 3Q87B 1T5IA 1Y8ZA 1P1JA 1D7OA 4FT2A 3ANTA 1XR3A 2BP7B 1ZOOA 2FMXA 3DGEC 5LXTF 1N3BA 1YU6A 2WKSA 3ZLTA 2B82A 2EFGA 3V42A 4A91A 2XUAA 4KPEC 1M0TA 3L0PA 4BUCA 3QOFA 3WGIA 1JLHA 1GGFA 1KPHA 1P2FA 2M2IA 3LKBA 4KTTE 1TM4E 2VK4A 4WKNA 1IFXA 1PZHA 2I3GA 4NH0A 2MSNA 1YQGA 3INNA 3FG9A 3X1ZA 5KOHB 1W1WA 1QTQA 2HBRA 3EASA 2Q21A 1FSGA 1AE1A 1JHPA 1WWKA 2YRFA 4I5DA 1S3IA 1B26A 3NQ41 2B4TO 2B4QA 2QR5A 3QM1A 2J3HA 3QVLA 2YDXA 4IDFA 4RZSA 4UEQA 1N0VC 5CP8A 1PR6A 4H9GA 1MN6A 5GZ6A 1EVKA 3NVKI 4RK4A 1OZ0A 1AKVA 2JGEA 1U3CA 3C1UA 1LD3A 2QRPA 4TMTA 4UOZA 3B85A 2RAVA 1G8JA 4JY7A 4XWGA 4TLLB 1YHNA 2JCSA 2E5FA 3GMTA 2JJYA 3FR8A 2VR1A 3DDZX 4RQBA 3TO5A 5JBNA 2HRQA 2WWWA 1M72A 2ZYWX 1PFWA 4RZQA 3RVDA 1WW8A 3CPJB 4KR9A 2G9ZA 3W4JA 3A2KA 3BERA 2O3TA 5TQJA 3W3AD 1Q3TA 4P82A 3O7WA 2FAXA 2VDKB 5G0UA 5LUAA 3MS7A 3A6LA 4QTUB 5CLLA 3I0ZA 3JATA 4GOXA 4ML3A 1UC4B 2DCMA 4Z49A 3OTOB 4OHYA 1TZJA 1VLJA 4KPFC 4C0SA 1EVZA 3QX8A 2H0AA 1RMQA 2IUTA 4NU5A 1DXQA 3HJRA 2FMFA 4ZCQA 4DT1A 1NLZA 4FEYA 3BRSA 2IBMA 3VHXB 1P29A 2CYAA 2JFPA 2GEKA 2ZYAA 1L4NA 2AX4A 3I8OA 4I9GA 4QPJC 3BXPA 1GZDA 3CBGA 3GCGA 3GT0A 2WJ4A 4OIFA 4RL6A 2HA2A 4QQRA 3QY9A 4A8JB 3TTSA 2VFAA 3SBEA 5KTOA 4QZVA 2ZJ7A 2Y71A 1GKUB 1T0BA 2GZMA 2OCDA 1NXSA 2EC5A 2X5OA 3TLYA 5BN4A 2KQUA 4N0EA 1Y5RA 3K1TA 2WF7A 2J8ZA 3N8IA 3LWNA 4IQGA 5FOUA 1XTKA 2LRHA 4TT3D 5GJVC 4RK6A 4Y2QA 4K9MA 4XDYA 5HPYB 1HTWA 1PQUA 4X45A 4CKWB 4AY6A 4BO9A 4Y67A 2PSHA 2IEAA 5CCBA 1NF2A 4JI2B 5EZ5A 3FIJA 4DLSA 4JYBA 2D1RA 3EA4A 1DPFA 4FFDA 2WMYA 2YDYA 2FMIA 4HGYA 1D3AA 2ZI5A 1WW3A 1ZRMA 2IHYA 4I6GA 3L46A 3KV3O 5DK4A 1Q95A 2MJLA 1E1LA 4ZREA 4MEAA 4NQZA 5DISB 1YB5A 1Y3HA 3IHWA 5H3CA 3LYLA 2RMKA 1DC5A 2PA0A 4FJ1A 2FLWA 4RVDA 5B3AA 3LQ2A 3EYAA 5EESA 2BM0A 4IIVA 3PLRA 1BHSA 1E2NA 3UAYA 3TXYA 3A1CA 3NALA 2W2MA 2ZZKA 3NOXA 1KI2A 3DC2A 4G36A 3DF7A 1UPFA 2P7IA 3B5JA 2FZWA 4WXMA 4G8BA 3WMWA 4BNLA 3EWAA 3IUQA 3WWCA 1V4VA 4HHEA 4KAFA 5DNVA 4ESHA 2F67A 3EWSA 1YBHA 4Z4CA 1BAPA 4J16C 4CI0B 5BSMA 3A6EA 1E89A 1EI9A 2ZE8A 3BXZA 1QYCA 3L18A 4JBWA 2AA3A 4KWCA 4LYAA 1XYVA 5DWVA 2F8TA 2R1VA 4KVGA 4MCHA 1PUJA 5DX1A 5KMGA 3NG1A 4XWWA 5CFMA 4KODA 1QONA 3UH0A 6YASA 4RSMA 1SU8A 3UV3A 4FEEA 3D54D 3U7IA 1X0VA 2G5GX 2P1DA 3SBDA 4L15A 2F64A 4ENWA 1NQTA 3COYA 1E2EA 3RIHA 2GPTA 3V4LA 4ZHQB 1F9AA 3SQXA 3CRNA 4YRLA 1F5SA 3E81A 1RHMA 4XM0A 2BCJQ 3T9BA 1L5HA 4YRQA 5KTMA 5B5SA 3PXAA 3KG2A 1HKHA 4RFLA 1NYRA 1UZNA 2WHQA 3TLGA 3OZWA 3CUYA 2YCBA 1A77A 3EZXA 2PWPA 3EVDA 3ZY3A 2WSMA 4WCVA 3EGEA 4JCOA 1T3LA 2Z56A 3PQ4A 2ZUFA 1UT6A 4P34A 1J1IA 4HGNA 1FRFS 1Z6GA 4B81A 4DR5B 1A95A 3U40A 3ZHSA 1EEXB 1Y7PA 5F7ZA 3AK4A 1ENYA 3TFQA 5LZ2A 3EZYA 1EXWA 1ZSVA 4D56A 1E0SA 2K2WA 2XDYA 2CXUA 5HTKA 1U5BA 4LK3A 4NENA 2WIFA 3FB1A 5BSGA 4RWZA 1II8A 1JE0A 2G0NA 3NTQA 4PRKA 5EL0A 2EFYA 1NZDA 1X7ZA 2J7PD 3EUEA 3QA9A 5F1OA 5IYZA 5JWRA 2H7YA 3ZZ1A 2BKVA 1BFKA 1I0ZA 2A9KA 4OHMA 5EAIA 2HQRA 2DEUA 4R1MA 1F8YA 2X14A 4EJMA 1WD5A 3LF1A 2Y3IA 4RENA 1PYOA 2VO1A 3MHPA 4D02A 2X2OA 1C3LA 3TAXA 1RLUA 1C7EA 4TQUS 4YUXA 1NPDA 3FLAA 5EWJA 1ND6A 4G41A 4R1QA 4WGFA 4BKMA 2NADA 4QE3A 4ZZ1A 3JVEA 3DQZA 2BFDA 3WLLA 1BG6A 3HYCA 3V7FA 4AMVA 2HDHA 2HH9A 1PWEA 2WV7A 4BFSA 1FTNA 2P9HA 3AHCA 3EAQA 3W2EA 5LSAA 1LI4A 4MPRA 1EHYA 4NXMB 3C3AA 2PMEA 4WFIA 1QG0A 1VBNA 1SVLA 3EOAI 3LECA 5F4BA 3TZQA 1MP0A 1PDVA 2PR2A 3AETA 5SY4A 1O6ZA 4NS4A 3DR3A 4KQ1A 5DGDA 4KO1S 5BRNA 4EMBA 5T4EA 2CJWB 2HBZA 2B8WA 3SLRA 1A0OA 4R6XA 2AUTA 1U7TA 3I34X 5MN6A 2FLKA 4MV0A 4QYIA 1LNQA 1ABEA 2FR0A 3DOUA 4KQCA 1TEXA 3HCAA 3GRFA 4HDKB 1RXIA 4P2GA 4KUHA 4NMLA 3OC0A 1CYEA 1E7RA 1T9GS 1N92A 1P2BA 1TMYA 2FQXA 2GZRA 2H00A 2ISQA 3AFIA 3PCRB 1OXUA 3FWHA 2QAGC 4BBJA