1TGVA

Structure of e. coli uridine phosphorylase complexed with 5-fluorouridine and sulfate
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
250
structure length
250
Chain Sequence
SDVFHLGLTKNDLQGATLAIVPGDPDRVEKIAALMDKPVKLASHREFTTWRAELDGKPVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPLEFPAVADFECTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRHFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNAETMKQTESHAVKIVVEAARRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of E. coli Uridine Phosphorylase
rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords uridine phosphorylase
total genus 87
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2004-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1tgvA00
1Z5NA 1ULBA 4OF4A 1A9OA 2IQ5A 1U1FA 3K8QA 5CXSA 1TD1A 4M7WA 4TTAA 2Q7OE 1Z35A 3MMSA 5CCEA 4TXMA 3GGSA 3ODGA 4TXJA 4JP5A 3DJFA 3UAZA 4GKAA 3C74A 4TTIA 5EUBA 2RJ3A 3E0QA 5B7PA 3LBAA 1U1DA 3IOMA 3QPBA 4DANA 1RXCA 3FAZA 5F76A 3D1VA 4WKPA 1Z36A 1PR2A 4WKBA 1PBNA 1V45E 3UAXA 1RXSA 3NBQA 2AC7A 3T94A 4WKCA 4DAOA 2QPLA 3PHCA 4G8JA 5CXQA 3MB8A 4GLJA 4YMLA 1YRYE 5JPCA 1Y1RA 4L0MA 1A9SA 4L5YA 1A9TA 4LKRA 4OGKA 4FFSA 3U40A 2HN9A 4TXNA 3OZDA 4F3CA 4X24A 1V4NA 1Z5PA 3BJEA 1ECPA 1T8RA 2AI1A 1ULAA 1SD2A 4QARA 3K8OE 1Z33A 3OOEA 2QTTA 4BMXA 4QAQA 3BSFA 2P4SA 5CYGA 3E9RA 5B7NA 1K3FA 4D9HA 1NC3A 2I4TA 3PNSA 5FAKA 1ODLA 3DF9A 3NM6B 1NW4A 1XE3A 5CCDA 4OEHA 5C80A 1RSZA 2A0YA 3O6VA 3P0EA 2AI3A 2QTGA 3LA8A 1JDSA 1OTXA 1JYSA 1OTYA 3O4VA 4YNBA 1QE5A 1U1EA 1CB0A 3UAWA 1ZOSA 1YBFA 1PR4A 3DDOA 1TGYA 3OF3A 3F8WA 1SJ9A 1A9QA 3OCCA 2OC9A 3PNPA 5CYFA 1U1GA 1JDUA 4BMZA 2A0WA 1JDZA 1T8YA 4TXLA 5F7ZA 5F73A 4DA7A 1OU4A 4DARA 1RFGE 4D8YA 1YR3A 3OPVA 1RR6A 4LNAA 1ODIA 3GB9A 4M3NA 3OZCA 4L5CA 1PK7A 4TS9A 5DK6A 1TGVA 5IFKA 1T8SA 1V48A 4BN0A 3KVRA 4F2WA 1V41E 2B94A 5B7GA 1Z34A 2A8YA 2GUWA 1K27A 5I3CA 2ISCA 1WTAA 1B8NA 1PK9A 4WKOA 1TCVA 4NS1A 1PW7A 4IP0A 1FXUA 1Q1GA 3NM5A 4I2VA 3EMVA 4TTJA 1SQ6A 4EB8A 3INYA 2I8AA 1VHWA 3EUFA 4QASA 5ETJA 1Z38A 3FWPA 4R2WA 3UT6A 1YQUA 4DA0A 1JE1A 1LV8A 4YJKA 4F2PA 4OY3A 4RJ2A 4MCHA 3BGSA 3IEXA 4P54A 2XRFA 1A9PA 4NSNA 4DAEA 1PF7E 3KUKA 1JDVA 3DPSA 1OV6A 3UAVA 1YQQA 1RT9A 4MCIA 1V3QE 1T0UA 4DA6A 2OC4A 1RXUA 2HSWA 1PR5A 3UAYA 1Z39A 1G2OA 2HRDA 4JWTA 5F7XA 2QDKA 1Z5OA 1K9SA 4WKNA 5F77A 3SCZA 5KB3A 4R31A 1PR0A 1PR6A 5IU6A 3TL6A 3P0FA 4D8XA 1A9RA 4UC0A 3E9ZA 1I80A 1NC1A 1N3IA 1B8OA 5B7QA 4F1WA 1LX7A 4TYMA 3KVVA 1A69A 4KN5A 5F78A 4QFBA 4G41A 1M73E 1PWYE 4GLFA 2HWUA 2H8GA 1SD1A 5K1ZA 1ZL2A 4H1TA 3EEIA 1Y1SA 1RYZA 4E1VA 4R2XA 1JDTA 1JPVA 4JOSA 1PR1A 1U1CA 5EFOA 4TXHA 4QATA 4L5AA 4PNPA 3LGSA 4K6OA 4F3KA 4LNHA 1VMKA 1OVGA 5EPUA 2BSXA 2QSUA 3OOHA 1VFNA 4OJTA 1PKEA 2PGAA 4DA8A 4YO8A 3DP9A 5F7OA 4TS3A 4PR3A 1ODJA 4L6IA 1Y1QA 1Y6QA 4D98A 4M1EA 1RCTE 1TCUA 1V2HE 4GMHA 4MARA 1JP7A 3OZEA 4BMYA 3ONVA 3NM4A 4ECEA 4LDNA 3BL6A 2AI2A 4DABA 3EUEA 1Z37A 1C3XA 1T8WA 1LVUA 1ODKA 3PHBE 2ON6A 4D8VA 4NY1A 4G89A 3OZBA 3FB1A 1VHJA 3FOWA 3KHSA 1JE0A 1RXYA 3ENZA 1Y1TA 1CG6A 3FNQA 4OGLA 4LZWA 1OUMA 3FUCA 2A0XA 4QEZA 4U2KA 2OECA 1Y6RA 3KVYA 2OXFA 4EARA 5F7JA 3KU4A
chains in the Genus database with same CATH superfamily
1EK2A 1D2MA 2GXQA 1P1KA 2C1EA 2GPJA 5KAPA 2LKDA 2BRUC 3UW1A 4A8TA 3EXFB 3LLMA 3IQEA 2OBMA 4EMSA 5TPZD 5ADHA 1NU8A 2QJTA 1DTSA 3EA4A 4INPA 1J0BA 1S2NA 1GNPA 1GZVA 5JC1A 2EP8A 1HKHA 1IN4A 1HE8B 1WG8A 4PVDA 1K97A 3EC7A 4XDHA 3JQAD 3QKSA 2WUEA 2XVZA 1FDUA 3BGOS 4EL5A 1MB4A 3KT0A 5L3QB 1SBCA 3C7CB 1X7XA 1SXGA 4I1RA 2Z9DA 4W8GA 4DR3B 2Q7OE 1YBVA 4MIYA 4O2BA 3BJIC 2E37A 2ZUVA 2D1FA 5LZ9A 4FMDF 2C04A 2HSEA 2N42A 2Q1SA 3OUZA 1PL8A 2NV2B 3QX8A 5KOIA 2G0AA 4GDFA 1EFDN 1CHDA 1MPTA 4UVGA 5F1OA 3HNPA 2ZWVA 1E69A 2XNDD 2UZAA 3LHIA 3RUFA 3KB6A 1YE5A 2XI4A 3DL4A 3H1FA 2ZQ5A 1YI8A 2B1QA 2O54A 2CEAA 3OTHA 2X8AA 5YASA 4CG1A 3JAKB 5THXA 3EH1A 3NDJA 2FX5A 4QTUB 1ODCA 2YJGA 4Q3NA 2JD0A 2G4LA 2NO0A 3PXUA 5AVOA 1DIOB 5AI9A 2JGDB 1WO8A 1H1TA 4ZXFA 2AMJA 4YDSA 1ZYUA 1J24A 1JFFA 3KX2A 4HR7A 3WWYA 1DO8A 2OAGA 4TSRA 3WHPA 3FKQA 2WJPA 4LBVA 3NVAA 3KR1A 4B8WA 3TW0A 3GVCA 4J1TA 3W5VA 4QC2A 3TTVA 4DLRA 2XMRA 4DLZA 5AD1A 5CXQA 2QTCA 1TM4E 1E1CA 1UPUA 1ZITA 2ENUA 4GLJA 1RZ3A 3PFNA 3PFHA 5TF0A 3UMJA 1BEZA 1J33A 1ORIA 4LN1A 4YC7A 3WJAA 5JVDF 1ABBA 1BDHA 4XDZA 4WASA 3MLAA 4X60A 3OECA 1FBTA 1QIKA 4EK9A 1CUJA 4XYEA 3M8KA 3W4IA 4L5YA 3S70A 3T1TA 2XXAA 3QMPA 2X0KA 3EGDB 3OMWA 1GR1A 5C3MA 3SYTA 4C4RA 4MDHA 2JAQA 4LXHA 2HA3A 4CHTA 1IUNA 3H11B 4R5HA 4E14A 1CUHA 1Z5PA 3BJEA 3SLGA 3O8OA 4PONA 1GUDA 2ZS8A 1NM5C 2PLNA 2XWQA 1EK0A 1XROA 1ATIA 4WKGA 5K0LA 3KYJB 3LUFA 4GYYA 1QVWA 1S9HA 2HDOA 4K9KA 4ZVRA 5AIAA 1EJ6A 1IM2A 1P3DA 1RE0A 1VI2A 1HMYA 2PANA 3G0OA 3EGXA 2Z5FA 3GT0A 4XYMA 1YUBA 3K0FB 4IUYA 2RGWA 3OZFA 3HEMA 4KGZA 1O2DA 1XF9A 1XBTA 4IS3A 2FN8A 3W2GA 1KU0A 2DZDA 3OPYI 4UTOA 4B7XA 2Z9CA 5EHQA 3DEYX 2X7XA 4GQIA 4GOXA 1VL0A 3OZRA 4XPIA 5KNDD 2GWRA 2WZDA 1EHYA 3AG5A 4OI2A 5CBKA 4J0EA 4NZOA 4LFCB 4DM4A 1TIPA 2QMQA 3NYWA 1IYZA 4BQEA 4RTKA 3BFXA 1AQUA 1X42A 5G4LA 2PX3A 2QGNA 5HRAA 3SE0A 3ZZMA 3VUEA 1LF5A 3DM9B 3MG9A 4GLOA 4MXDA 2KYRA 4Y6LA 4R8SA 1W19A 4B44A 1K98A 1RSZA 2Z04A 4BNFA 1GQ2A 3H1TA 3LDFA 4M7RA 3HPRA 2JGEA 1K5DA 2G67A 1U9CA 4UDYX 1EUYA 2X1HA 5FYDA 3AKYA 2YDXA 1YS6A 5CA0A 1YRBA 2QMUA 1OB2A 4MP6A 1ODSA 4ND5A 3RREA 4BC1A 3E2PA 3HABA 3NIBA 2P68A 1YZHA 3UAWA 3OJLA 4A6PA 2AG8A 4A1FA 1D4OA 3RJ5A 4DLNA 4MHOA 2AJDA 2YWJA 3C8DA 2I9PA 2QRGA 1V5EA 4BV3A 1PTKA 4R84A 5DASA 5DNAA 4DKXA 3I5YA 4RMNA 4LYYA 1D5WA 2JEOA 3TG2A 3Q6IA 4EGQA 1XRRA 1TT7A 3HY6A 2WEKA 4MQ5A 1XXHB 3SJZA 2YN0A 3ND9A 5KKNB 4P53A 1ZUNA 4I36A 4ID3A 5CYFA 3V4FA 2WHPB 3KFXA 2O2IA 1PU2A 2OHHA 2OVBA 2C4VA 3COSA 3WK5A 3O7WA 4S24A 3ZE7A 3GJ4A 3T7CA 2JGFA 4RVGA 3ZU5A 1JDZA 1XD2B 3H3XA 1A9XA 2JBWA 1TUGA 4LJ9A 2YXPX 4L3VA 4UCQA 3RYFB 4AUEA 3WGIA 4OLAA 1HH4A 2Q9AA 3AHEA 2P8SA 1JEAA 3FHCB 3RYHB 4QT4A 3T5GA 1PWXA 2C2XA 3HFSA 4FIZA 5ER6A 5TY0A 1DBQA 1YK1A 1SVWA 1Z82A 4LJSA 4TZTA 3KSAC 1AKUA 2BUBA 4AJ1A 3CUSA 2G0NA 2B7BA 3NBMA 4Z4FA 1Q20A 1J4AA 4NAVA 2DPMA 4KWCA 3TE7A 3V7WA 5KNDA 3BXPA 4Y2RA 1W94A 4K0KB 4IG4A 3ASUA 5B1YA 1OFHA 3I53A 3NBFA 1ZNQO 1DZIA 2CXHA 2JLZA 3PNMA 3DCJA 1X86B 4O2RA 3PX3A 1RRGA 1G21B 1T1JA 1U8UA 5ALGA 3F49S 3MJRA 2H31A 1O5OA 4R05A 4MV7A 1GNTA 5JWRA 2JHCA 3BEDA 3EBPA 2QIOA 2GD2A 2NSLA 1K89A 2XAUA 1PP4A 4NV3A 2XCTB 4Q9IA 1VCHA 3KFLA 3TCXB 4YPOA 3JW8A 1UBMS 3MSXA 4MMZB 3R9IA 4MP3A 4ZI7A 4TQGA 2YS6A 3INGA 5FBLB 5FTLA 3VTFA 5KOJB 3O93A 3D6JA 5LIPA 3B1JA 1DTWB 2MSWA 3Q12A 4HFNA 4IM7A 4LVUA 2QQFA 4XVUA 2OO7A 5KVVA 1YQGA 4GU5A 1YA6A 3IHLA 2J0SA 1NQUA 4QPJC 4XWOA 4FXPA 3QQPA 4NIMA 1C41A 3ABQB 5EE9A 821PA 3U3MA 1OREA 1SEVA 2AUTA 5IARA 5LC1A 1P2UA 4A8JC 5KTOA 1L5FA 4NHOA 1XMOB 3TLGA 4NS1A 4WACA 1TU3A 3RH0A 5M7EA 3JQCA 5FPQA 2QD4A 1B4DA 2R7MA 3B6IA 2QMZA 3N6RA 1Q11A 1PHRA 4AKEA 4EHFA 4RGYA 2Z3WA 5A4AA 1LY1A 2Q6IA 2J0VA 1NKTA 2X0FA 4QQFA 2ZB8A 1WZ2A 5C4IA 1NI3A 2VZEA 5KTPA 2DJIA 3T3OA 5DBHX 2RGYA 5ITSA 2FZEA 2GUGA 1Z9BA 2QUJA 3B89A 3QVKA 5K0NA 2P41A 1GUAA 2I33A 4Z49A 1R0XA 2DWCA 3M6LA 3RTAA 3BICA 5C5IA 1U8CB 2HJWA 2NADA 5G0VA 3I6ZA 3KYCA 4RQTA 4PC1A 5JO9A 4H1WA 2Q4BA 4AULA 3LS2A 2EFDB 3I30X 4OMDA 4PQGA 4GWKA 4QUDA 1LEHA 3JR7A 4TLMB 2PBZA 2DVMA 2EKPA 3AKCA 4EHAA 3R3HA 2R87A 1FDVA 2EFYA 3GMDA 3OETA 3AUXA 1J9EA 1AKTA 5CJPA 1RNLA 1XVAA 2DR0A 3Q7EA 1F0PA 1FYDA 1Y0BA 2VUTA 1JSLA 1VLMA 1Q3HA 2ZDHA 1NBAA 2PXAA 4TRNA 4TSKA 5F9MA 1I8TA 2FP4B 3N9IA 3AM1A 2YFYA 4CKEB 4FDTA 2Q2WA 2ZBVA 1IZ9A 5EJFA 2PUGA 1H0KA 2PUWA 3COZA 3EZ6A 3IUNA 1PR9A 1LTQA 1YB6A 1XZPA 2ZRKA 3NDPA 5UKDA 3OT1A 4H77A 1KORA 1ORWA 4RF3A 4TX1A 2AN3A 4X45A 4UD2A 3TSYA 4C7JA 2HEGA 1UOPA 1PFGA 1OBOA 2O0JA 1L7PA 1JG3A 4D96A 3G82C 3QLVC 3BHMA 3C39A 3WB0A 4LYDA 2O8FB 1PD0A 3B6KA 2EATA 4ZT3A 1E4EA 1KVQA 2GX6A 1KAQA 2DWQA 4MW1A 1SHTX 2HNBA 3IUBA 4N0QA 3AJAA 2D8MA 1DC8A 4ZVLA 121PA 4ENPA 1W5AA 2HRDA 3LQYA 4KGVA 4MW7A 1RTKA 1P6UA 3HDGA 3HCOA 3LPDA 3M6MD 3QU5A 4PY2A 4AG5A 2C5EA 1IMOA 1S2DA 1VJCA 4HAOA 5ALDA 4IXNA 2YICA 5CK5A 3ZXXA 2O2HA 4QFMA 3NHMA 1SCUB 1NMEA 4LRXA 5FBKA 4JNKA 4AJJA 1XL0A 2EARA 1TKBA 2W2OA 2YTZA 4R31A 5KZMB 2OK7A 4MVJG 3KZ1E 4KSCA 3DGEC 1X7YB 1PR0A 1NQOA 2R6GA 4I4IA 3NCHA 1N1EA 3SVTA 1XCMA 4AM8A 2QYSA 3UT5A 4B3XA 1A9RA 1RRPA 2C8VA 2EDAA 1AQNA 3FTEA 2IYTA 3QXJA 4NU5A 4M0KA 1LFAA 4UC0A 3GNLA 4CM4B 1P2DA 3R9XB 4PYNA 4M1WA 4AX8A 4DMMA 1C1HA 3NIWA 4DRZA 3TR0A 5JQGF 2GJ8A 1XCOA 1YQXA 1QIDA 1YZLA 3UMFA 3JX9A 2WB2A 3GLKA 1N75A 2GBIA 4LSMA 4QE3A 4KN8A 3UWSA 1XQVA 1ZXBA 2EX4A 3SX0A 4AJ4A 3EGIA 5JADA 2O8EB 3ENNA 1OROA 1V6CA 3N8DA 4OXIA 2ZYSA 1BROA 2I34A 2OQVA 2ZUUA 3RUIA 2ZPAA 4BVAA 1PDOA 2EIHA 3FH0A 4OFBA 5JZBA 4UBKA 1MRSA 1PWYE 1MD9A 5L8VA 4P4SB 3RD5A 3BRWA 4AURA 4M54A 1VYHA 5LMNB 3QSYA 2HHHB 1KDOA 1K3TA 1QFYA 4R4JA 4E21A 4DBZA 1UDCA 5DGCA 1X9GA 5C8YB 4MKRA 4YGYA 4V0LA 2HFKA 3O1JC 4IZOA 4OKNA 3GI1A 1Z6AA 5AW8A 5JS1A 1QTQA 1I7DA 1FMTA 4IILA 5IHXA 5K3EA 2VRWA 1MABB 5BWCA 2Q1TA 2MINA 4ZAZA 3VPSA 1T2AA 3H6HA 3HLYA 1RPJA 1MC1A 3TRKA 1W49A 3AM4A 2XYRA 2A9JA 1EU1A 3IDFA 2ZYAA 4UVDA 4XEHA 2KJQA 3KQHA 3G7NA 3O73A 4JI2B 4CIXA 5JZSA 1AM4D 4IOLA 4RZXA 3UJPA 4BEBA 3NS7A 2DH5A 1S0UA 4KKVA 4YP9A 1X0VA 1ANKA 1SVUA 3A4TA 1CBUA 2FX2A 3DE6X 1WW3A 4UNNA 1OGJA 1A5SB 1Z2EA 3LFTA 1AGYA 1RP7A 4WOBA 3TL2A 2QE7D 4I6GA 5AM5A 2FG6C 2Z8YA 3FLBA 2ZB3A 4CVNA 3WQQA 5BQFA 2EJBA 2NPFA 3AY6A 4GX1A 4M0EA 1GITA 4NABA 4RV5A 3TTYA 5KCZA 3D7RA 1T5BA 1XT6A 1H65A 1VMIA 3WTBA 4HGPA 1TADA 3JPYA 3C8HA 4QUJA 3C45A 2BT4A 5EY5B 4BFZA 3ELWA 4KLZA 1ZVVA 3P5SA 3X2SA 7ADHA 4E12A 5IANA 1GUYA 1XJ0A 2GTHA 4OQPA 4PYQA 5IAGA 2D8AA 3M5CA 5HNKA 4D6XA 2VF7A 3CKLA 4NH4A 4Z9XA 1T8UA 3P0IA 2CFSA 2Y1GA 3QKTA 4IZHA 4RELA 1E2BA 2PM8A 4LHWA 1U63A 3DDSA 1GT6A 4Y18A 3R3WA 3LCVB 3C1UA 1RBYA 3TTXA 5AICA 1OAAA 4NG5A 3E2MA 3JTEA 4BO3A 1JIJA 5EHGA 2YYSA 3TJMA 2QTMA 1DKUA 3LX5A 3RFUA 3SKVA 2WINI 4WZAE 2DEUA 1ZN9A 4KLCA 4PN7A 5J4YA 1O1YA 5JZVA 3TZ6A 4EJMA 3VYWA 4F4FA 4QTYA 2FI1A 3JU3A 1GVNB 3RR2A 4RQBA 2C5SA 1JG4A 1KDTA 5EINA 4BVJA 2V9CA 1TPZA 1Y8RB 4JJGA 2XB4A 1XC7A 3WB9A 3L0SA 4EW3A 3DWIA 3H5LA 1T3LA 3AMVA 1YJCA 1ZGZA 4PC3A 4OP3A 1N2HA 3LKBA 5KAMA 5ADUS 1X19A 4PG4A 2V03A 1TK3A 2WIJA 3THWB 1DWOA 1Q0QA 2ZI9A 2ZI4A 4AZWA 3WKDA 4WLFA 3OZGA 3GCZA 4MQLA 2QRVB 3LNTA 5B4TA 4Q4AA 2YUIA 1AHNA 4YAOA 3IQZA 2PX0A 3NV7A 1C7QA 3TOSA 5CB4A 2FG7C 1G4HA 3R3SA 3OZBA 2E87A 3IBSA 4JLBA 2B3DA 1U0SY 4Q02A 1PVDA 1KOGA 1VHJA 4DGQA 2ATXA 1C8BA 4NMHA 3J81A 3MCVA 4X90A 3S7ZA 1N34B 1KO4A 2RGBA 1KAMA 2OFWA 5E4YA 1W5FA 1WCV1 4GPEA 3WXBA 3DW1X 3IALA 1DRUA 2PV0A 1DDGA 3MTDA 1RHJA 1ST3A 4ZTUB 2QBYA 2GO7A 4IH9A 4ZT5A 2JFQA 5SY4A 3HDYA 4EYOA 1KZ1A 2YYAA 2X8JB 3JXEA 2BJHA 3PJEA 1HDYA 4MVYA 4OFXA 3QLEA 3R7BA 3GJ6A 1TF2A 1N5LA 1Y6RA 3HG7A 1T34A 3QENA 3DPUA 1W52X 3GRRA 5EE3A 1KVSA 3ZX4A 2ZAYA 3U4GA 1ISRA 2P65A 3HMKA 1H6DA 1YQWA 2EL9A 3GT7A 4MI6A 4N1AA 2GAIA 1Z0IA 2YVAA 3FNHA 4DTCA 3D3WB 5K0BA 3AFOA 4YRQA 5LR6A 3NTOA 2Y77A 4R1UA 3SQDA 3HR4A 5LP6B 3C6KA 5EJ7A 5BR4A 5U4QA 1JB9A 3FUWA 1CS0B 2WLTA 3IKVA 3QZUA 4PYKA 4A73A 1A1SA 1NYQA 3AY0A 3EXEA 1YVUA 2HBYA 2GKOA 2OV4A 2YQZA 4F91B 1KEVA 2BUAA 1SCKA 4TV9F 1CJCA 1JIVA 2F62A 5C46F 1CR1A 2GEBA 3AZOA 2OXCA 4TWBA 4OL0A 4Q34A 3T9CA 2Z8YM 3LQ1A 1F7UA 3KAQA 1RMTA 1KKLA 4RY0A 2QM3A 4ZYLA 2CV0A 5HQTA 3QEMB 4I55B 3I1YA 3UK6A 3WHIA 4PC7A 3W7VA 2ZJFA 2QUKA 3JQDA 4OJMX 4E2XA 5KTTA 1GCUA 1QUEA 2GEDA 3BXXA 1YRWA 3H17A 2H2DA 2NACA 1VKRA 4CM8A 1HEYA 3DS8A 1QVRA 3DO6A 2W2NA 4GVLA 1IPFA 1MAUA 4J03A 1R6AA 3SC3A 3BSWA 3H16A 3K9HA 3ZLVA 4UNIA 4J4BA 4D44A 3EOZA 3AKZA 2UXCB 4RF2A 3AHJA 2J9FA 3MRSA 5T4BA 1ESDA 1G2QA 1JEYB 2IZ6A 3WK4A 4RHCA 1I9CA 1UH5A 3DGFC 2ZUDA 4ZJYA 1ZM9A 4D9NA 2CDNA 1NXSA 4DV3B 4FEGA 3T3HA 3CYFA 5L3RA 5JAIA 5FBWB 3EGCA 4RPLA 4EZIA 1E2NA 4OM8A 3WLMA 4AD8A 1YIDA 1BKSB 1Z75A 4OM7A 2FPIA 5GGYA 3RUHA 1TAQA 3SZMA 3ULKA 1EFTA 3B82A 3LYAA 2G06A 4GO1A 1ENYA 3IVMA 1C9KA 3W2EA 1FFDA 3WWDA 3AFHA 4YUAA 4AY3A 4UBNA 3OE5A 1HDOA 4TSFA 2PHZA 2XV1A 1ZK1A 3KOUA 5ESXA 1NDHA 4HS4A 1X38A 3H2JA 3PX2A 2OBLA 4II3A 5ARCA 1DB3A 3HM9A 1G8SA 1N2BA 1WVMA 2DC1A 3ZCQA 3IS3A 5IJXA 4GT1A 4MVJD 4NPHA 3LPAA 5HKLA 4EG0A 1ZXXA 4LKRA 1W59A 3B1YA 4WK6A 1W4CA 3CKKA 3VSBA 3CLRD 3GLQA 3OZDA 2QP3A 5I48A 4JKIA 3RK0A 1E79D 3TK1A 4E15A 3HBMA 5DI9A 4FMPA 3TEMA 3W6OA 5AM0A 2CW5A 4WNIA 1QRTA 4HTAA 1ISSA 4RGVA 4ZOEA 5JSKA 1ORRA 4G3XA 2REBA 5BR1A 3MT8A 4M89A 4RH0A 1UQTA 3R77A 5CURA 2AD1A 2W22A 4KZKA 3O4FA 2NPIA 3CGWA 4EY6A 4ER0A 1SULA 3WJ1A 1L0BA 2V74B 1DARA 1MVNA 4HWOA 2BCJQ 1N25A 2WHEA 3UV3A 1AT1A 5D84A 2GNOA 2VJPA 2NUBA 5CIYA 3U4QB 2NV0A 2R8OA 1WUTA 2ZCUA 3PXAA 4S35A 4EGSA 2FP3A 3HQ4O 2ZI5A 2Z08A 3LYUA 4OFZA 5CDSA 3GYBA 2CLDX 4LI3X 5IXJA 4FCWA 4YX9A 2AB0A 2VNSA 2YWCA 4LDAA 5BQ5A 4INAA 1J5PA 2OD2A 1G3UA 3QEAZ 5CCDA 5E95A 1UQRA 2AFIE 5J2UF 1G5TA 2OCDA 3ZDBA 1PJZA 1UC5B 2DYKA 5ICEA 4Q4HB 2V7WA 4KE7A 4PEVA 4Z4IA 2W2KB 4LKOA 2AI3A 1JDSA 2AQKA 1QV9A 1Z5VA 2DE0X 3KE8A 4JJZA 1OZGA 2V3VA 1JECA 4ZAVA 2P4EA 3WGYA 4L4XA 3S2SA 1T4BA 4BIMA 1R16A 3AR4A 3RJ9A 2R65A 4MUFA 4CV1A 1CB0A 4INOA 5JXWA 1TYBE 2NTEA 4KXYA 4MKGA 4F11A 2P4HX 1WDMA 3LXXA 5ENVA 3WIVA 2G72A 4FHFA 4HQRA 1G20E 2PD3A 1SJ9A 3OQIA 3ZNOA 1G1MA 3PRJA 1XPUA 2D5IA 1RMYA 3OCCA 5FQOA 1KTVA 4D4GA 1YU9A 5AYVA 1HQDA 4E11A 1ZI8A 4RA6A 4Z0TA 4IR7A 4KITB 2AQ8A 1YHYA 4W6ZA 3PNPA 5AK4A 4EPWA 1P19A 1FNCA 2BAGA 3R1IA 1JDUA 1GNRA 2XNJA 3CVXA 4NICA 3DZJA 2PSEA 4NV0A 1HDRA 4W5HA 1XNJA 3D1JA 4M8LA 4NCJA 1SC1A 2J5BA 5EKUA 3FTDA 1II9A 3DB1A 1JAYA 5CVVA 4IHKA 5F73A 3WSTA 4DCGA 1ZISA 3WGHA 4HADA 2VNHA 3KL4A 2XECA 4YJHB 3M1YA 4I4LA 1I7SB 1JUDA 1XZIA 1MJ5A 2HK9A 1JPNA 2WIKA 3A6HA 3E3OA 3P45A 2Z9BA 4WA7A 3VJKA 2LWIA 3OFJA 5EMHA 2P35A 3EG5A 5JOQA 3VR3A 2TMGA 4KO8A 4KQJA 2VP2A 1JI3A 2EZ8A 1TE2A 5FUYA 3PC2A 2DJ5A 4EVIA 3IERA 5BNFA 1Z26A 1OD6A 2B78A 3C85A 2LXNA 5DWQA 2RHJA 3K30A 4B6EA 4V1CB 5J4VA 2I80A 1MP0A 5E7MA 5BSUA 2I2WA 4LNAA 3GFSA 2VT7A 5BRJA 1ZU5A 3DG9A 1DCFA 3F78A 3QUSA 4I50F 3T12A 1A96A 2IUFA 3RO7A 3MCAA 4UKDA 1G21E 1G9XA 1YULA 5LUAA 1OH8A 3KALA 1JHYA 3FF4A 5DJ5A 2FN9A 1NXQA 3B3AA 5IC6A 2IH4A 4UBLA 3OD1A 4UDOA 4ZHQF 2BH2A 1R7RA 4MQ6A 1WF3A 4X9XA 4IGEA 1EFPA 2RI1A 4EKNB 4TKLA 5AHOA 4HZIA 4TWZA 4DCMA 3JQQA 2Q6OA 4HNRA 1D09A 4PFQA 5EESA 4CL8A 5KHLB 1XSEA 2HQSA 1QFSA 5LOVB 1JPUA 1NQTA 1NE7A 1PL7A 4R1LA 3RIMA 4OIFA 1Z8FA 4AZ0B 3OD5A 1JJAA 3CPEA 1AK2A 3AUYA 1C1XB 3OHMA 4HRXA 4YY3B 1A7JA 1NF8A 2RGNC 2HY7A 3TQTA 3BTUA 3QVGA 3A6PC 2WZBA 3LFUA 2FLWA 1UJ2A 2EZUA 2AYYA 2G80A 3IULA 4GUDA 1B26A 1GTVA 3VTZA 2Z4SA 4M9CA 3S55A 4P4TA 5JVDB 1TDJA 4IIGA 1SXJA 1WZNA 1HYEA 2E4VA 2JLAA 3JYLA 3RKRA 3TOCA 3QWAA 2ZIVB 2NZXA 5EERA 2JVJA 2W8BA 2R8RA 3RODA 1BQ3A 2F1RA 3UT5B 1MR3F 1E1QA 1Z0JA 4JLDA 5FFNA 2EL7A 5EKDA 4GPTA 4WZZA 1NJFA 1OI3A 2GK4A 3ZV5A 2CL5A 5JBNA 1W0JA 3IXQA 3A0RB 2ZBDA 4ES6A 2ZRAA 3FUTA 3ZHVA 1BZYA 1GJRA 1KA9H 2WD9A 4BMPB 1A4UA 1NSYA 1PW5A 4ZQIA 4DJ5X 3OIGA 2FPXA 2OHGA 3F98A 2AUMA 4A0RA 1BQEA 1YDWA 4YMUA 2IYNA 2QL9A 4WVLA 3TM4A 3M81A 5G0UA 1FUKA 3FPAA 3QQ5A 3CUWA 4EG1A 1QO9A 1UQUA 4MCHA 3MAGA 3QTBA 4Y7CA 5FTWA 4I9UA 5ENZA 2PKQO 2IV7A 4YJHA 5E1BA 2YX1A 4JK3A 2QY9A 4I1YA 4O4LA 4QJ5A 1N5DA 1E99A 4CLOB 4B3RB 1M7BA 1W8IA 3ESCA 4PX5A 4KRXA 3SIWA 4RTNA 1XWIA 3FPFA 4HZGA 2QVCA 2B7CA 4M99A 1SB9A 4PLVA 4YR9A 5KO2A 3KK0A 3KSDO 5CH8A 2EBWA 5C8XA 1Y6ZA 3I1JA 5JS2A 2WTAA 3WA6A 4DA6A 1LBEA 4Z0HO 3ZE1B 1UM8A 4CIAA 5DH9A 3DBOB 1GAEO 1MB2A 1ZUHA 1EM8B 2WTBA 4L8LA 4XD7D 5EXEA 5AVUA 4U9HS 1FXSA 1B0PA 3PLAE 5LLDA 4L57A 3E8SA 3PC7A 1Q84A 3EODA 3TIXB 1VGRA 5FTNA 3VM6A 3JWHA 3FHOA 1EE9A 1SC9A 1UMBB 3IAS1 5KTSA 2Y1FA 4C06A 4PTYA 4DMGA 3JCZA 3QI2A 1TA4A 2PYZA 2YRWA 4L8FA 1XNHA 3HB1A 3SEQA 5D3KA 1PUXA 5A5DA 1P6XA 1QU2A 1YIOA 2JJ8A 1L4YA 1TQHA 2BI8A 4E3ZA 3K0SA 2HRBA 1MAVA 3HU1A 1GPDG 2D5AA 2EHDA 4RZHA 2PSSA 3EWIA 1XCBA 3MRVA 3N2GB 2QGFA 4QFDA 3LD9A 1P2GA 1HURA 2FEKA 5BNWA 1GT91 5EJIA 3EG9A 3CVYA 1O96A 3IP1A 4MZXA 4PSAA 5CLLA 3VYUB 3I04A 3A3OA 1W76A 4OB7A 2QJOA 3TNYA 4BCCA 3QW2A 2HWKA 1CUZA 1WQ1R 2VDUE 2Q2VA 4MINA 5IC4A 2V59A 2V1XA 5HPYB 4LYFA 1C3EA 3BWYA 4KTTE 2RK4A 2J67A 2Z83A 3GRKA 4ZOQI 3STYA 5L95A 5TLSA 3O21A 4IIJB 5IJWA 4B87A 4RCZA 2FV8A 5JMOA 2A3RA 3SSAA 1XDSA 4YMWA 1K6MA 2BBOA 4D3YA 1FCJA 1F5NA 2JAPA 3ANMA 3G1WA 1KOFA 4HDMB 1CDOA 1SM4A 3LVRE 3CR7A 3TZCA 4C0KA 1DJQA 4FEYA 3N2YA 1SIBE 2ZRCA 1UZAA 4DG8A 2ZWIA 4V24A 3V55A 1BIFA 1OLOA 5CVEA 2XUZA 4KZPA 5CLGA 4UUOA 2VDKB 2OFPA 5DGTA 1O54A 4EYKA 4IV0A 4R9RA 4HNQA 1OBVA 1M73E 2Q29A 2IYZA 4OOFA 1NWCA 4GLFA 2PXXA 1NRXA 4PZ0A 1RE1A 2RAPA 5J1TB 2JDID 4MAFA 2Q3CA 1DBPA 1SD1A 2H00A 3KEOA 5FADA 1US8B 1Z7BA 2WK1A 3I37X 3D8SA 3KR0A 2XA9A 1PFYA 2QDXA 3AF0A 4JENA 4N54A 3ZNPA 1Q0PA 3I3SR 4BGIA 1OXSC 1T91A 4ERNA 1MX1A 2EQ5A 4IO0A 4NATA 4XWTA 1KI4A 2ZI7A 3FZGA 1QONA 3NUGA 1L7EA 3RF6A 4Z54A 1N3BA 2PZLA 1IOLA 2DQSA 1XTKA 4H7EA 4D26A 2GQ0A 1HG1A 4QELA 2P6MA 3E03A 2NGRA 4ZANA 2PJUA 4QXPA 4J0CA 5EFOA 2NXCA 3FOEC 4MYHA 2IU6A 1L7AA 4L5AA 3VMMA 2H11A 5K8JB 2C88A 5C5DA 1L7VC 3C3KA 1IY8A 1P3Y1 1LPNA 1GKLA 1K7EB 1FUUA 2QMHA 4NK5A 1XU4A 1H8HD 3RSCA 5KWIA 5DM60 1XDWA 1ZD8A 1L4HA 4QRIA 1GRCA 1KSHA 2W71A 3U37A 5LYJB 3LDUA 4MVJI 1FNDA 2C7GA 1OVGA 5AJZA 1DX4A 3L8GA 4IDPA 4YCLA 2P6NA 4JX9A 5CVDA 3I12A 3CLHA 3GH1A 2X7HA 3ORRA 2P2CA 1OE0A 3MVEA 1AQJA 1PKEA 2FY8A 3FPJA 4DIBA 5FOVA 3GG2A 1T4GA 5T6MA 1ECGA 3PP8A 3QH4A 3AXSA 4UNSA 5EYPB 5K4GA 3CKMA 1RC1A 3SC4A 2CLMB 2IPLA 1E2GA 2B5WA 2H9IA 5DIZA 5CFZA 2QB5A 2FW1A 3ZV3A 2YN2A 5B1SA 1WEKA 1J2YA 3H05A 3LP6A 4IYJA 3K1YA 5IUNC 4P3PA 1W29A 2YOGA 3WGKA 3V7FA 2X1VA 2ZSAA 4Y1GA 1IN7A 1FL9A 3RYCB 3ZGOA 4W8HA 1V1MB 1NVFA 1T10A 2OLKA 1OF1A 4I66A 4RKQA 3SFZA 4F46A 1Y1QA 2LD4A 2A88A 1DAIA 2D2XA 1GYRA 3WLQA 3V00A 4UW9A 2GEKA 1EG2A 3F4LA 1QHHA 5IJ9B 3THXB 3WLTA 2RGRA 2QLLA 1DEOA 3SR3A 5ADWA 1O97C 3TMAA 2ZAGA 3QI7A 3IVXA 4CKCB 1GY8A 3REQA 5IP5A 1DHRA 5CFLA 4RTPA 1G2PA 3HA3A 1IMJA 1RQRA 1O87A 2BMFA 5TRTA 1X9HA 1X3SA 2CT8A 4QGGA 3TGPA 3JARB 3T7EA 4LDNA 5AJYA 4UU0A 3FXAA 3UJ6A 2X0NA 2XB9A 3ZHBA 2VDOB 5JZMA 1B6RA 1I1HA 2NOAA 4RXUA 4M9UA 3PYLA 1VP3A 4EA7A 4D8VA 3E2IA 4FGZA 1E7MA 4Y1RB 4QDKA 3UYKA 4JJAA 4NY1A 5K3SA 1UKYA 4I5IA 2G9RA 3T7TA 1PDVA 3ZJ4A 3M1IA 1S4QA 3KOWA 1SCUA 3GDOA 4HDSA 3TZLA 3VH3A 1EWRA 2CBXA 3OA2A 1OIWA 2X4IA 4P5PA 3ITKA 3QELA 3WY9A 1ND5A 4GLLA 4NG4A 4O2LA 5DHRA 2QW8A 4QNMA 3VQTA 4B8ZA 4R9SA 3H9QA 4PWYA 1D4ZA 2VWQA 4X1IB 1JI0A 1CVLA 1OUMA 1EVJA 3EIQA 5TS2A 2AJCA 3A1FA 3L0DA 1V43A 3I72A 3GRPA 4MULA 3AR5A 3TSWA 4DNFA 2G1JA 2DT8A 2YCLA 4NTZA 5A3QA 5CPBA 3FUUA 3MTEA 2P90A 1JF8A 2R6CA 3JAWA 3OOWA 2AXQA 1ZVKA 2WC1A 2JFYA 4YUYA 1DC4A 3BXGA 4NX2A 5LZ7A 3WL4A 4F04A 1J5EB 1M2EA 1H2RS 3GVIA 3CWQA 5A3RA 3NOQA 1AO3A 1PG0A 1Z5NA 1RMQA 2WSMA 4J0HA 2ZRJA 3PQ7A 4Z3OA 1ZUD1 3TFQA 1JU9A 1HDCA 4M46A 4D6PA 1LDMA 2Q5LA 1U0HC 4LRYA 5IDVA 2VZ9A 4DJFC 3L8CA 2BTQA 3N8NA 3Q3JB 3M70A 2RHBA 1KC3A 3C43A 4WCVA 4ZYUA 1XRPA 1M2FA 3X1YA 3RABA 2HRCA 5FOSA 3H1BA 2G5PA 1VQ1A 3ASZA 3RS4A 3SQWA 5C7IO 2L42A 4IXWA 3ZJUA 1Z13A 1I0IA 4YHBA 3WIUA 4E2FA 1ML4A 5CBPA 4WNAB 4PQYA 1CU1A 3GGSA 1TOAA 4D9KA 5JCPA 2FJ0A 3KR2A 3UUGA 3UCFA 2OKCA 2GWHA 1UWVA 4DREA 2WLSA 1Y80A 3GARA 1CF2O 2IODA 3MJFA 1JAIA 4K87A 4TYQA 4DNOA 4NCXA 1IN1A 3RV4A 4A2PA 2D7CA 2L0XA 3O91A 2R11A 2VF8A 3BRWD 1EIWA 3QHQA 1GADO 2CNWA 3FFAA 1YI1A 1E58A 5B2EA 4Q1AA 2IOFA 2J31A 4GPD1 4K9PA 2H29A 2H48A 1W87A 2GHTA 3G1UA 3HHPA 4DNPA 1CTQA 3OEWA 5HQ3B 4FI3F 1O9GA 2A33A 1EP2B 2EG5A 4GC5A 3W8FA 2X42A 3K1ZA 3K94A 3NHLA 3UAXA 1C7ZA 1S3SA 1OYWA 2BMDA 5D7BA 1RLJA 2WNHA 2OQIA 3KPJA 4NXMB 3STTA 4W82A 2UZ1B 1SVNA 2HCBA 4J76A 1KBQA 2IEYA 2WUWE 3K8YA 2QNIA 4WFKA 4EY8A 4ZV4A 3ROMA 1GR0A 1I36A 1PKXA 4KXQA 2O9JA 3DLCA 4PZYA 2IYOA 1K0UA 3OCXA 3PPWA 4EAAA 2FE4A 2JKZA 3GHHA 2XW6A 2AG1A 4O1IA 3AUSA 2BN4A 1VPWA 1UIMA 4OP2A 5F2OA 1YRAA 4IINA 1ZH0A 4Z86A 1NIPA 3B1WA 3Q41A 1N0HA 5IULC 3U1BA 4DQXA 1FFHA 3C3BA 1KK1A 1GA1A 3PENA 3AZQA 1AK1A 1G0NA 5HQ3A 4RK4A 3BMCB 2GXSA 3MCWA 4NBUA 3GFRA 2C78A 1TT5A 1ULAA 3KAJA 3LVFO 1WB5A 2CE7A 2EAUA 5TDHA 2I54A 1D2HA 1N1MA 2PXHA 5B53A 2QZJA 5JAUA 2P6OA 3HXOA 3HYNA 1XMJA 2H2FA 4HBZA 4B3FX 4J0QA 2VG8A 3PPVA 3LM8A 4QDUA 4UXHA 1IY2A 1WAMA 2ATEA 4GPZA 1QHIA 5K0GA 5AP9A 2XGJA 1TO1E 2ZR7A 4HRYA 1GXSA 2YC2C 4I81A 4JODA 1K3FA 1KZ6A 1F51E 1B2LA 1BWSA 1DAMA 2Q4EA 3DKVA 3DTNA 3PE3A 3RUPA 2ERXA 3RVPA 4BDSA 5KNCA 1U6JA 2XVXA 2GKGA 4QXQA 4RORA 3IE0A 2JGMA 3SZGA 3TLAA 1XZNA 4LRQA 1X3LA 3O4GA 3VHQA 1QPZA 2M1ZA 4KYUA 1P4RA 4LC1A 4MYUA 2EGGA 3ZNNA 2O59A 1DEAA 1EZZA 2O2CA 5KX5A 1XEXA 1L1RA 1SH7A 3BB1A 5HKKA 4BZPA 3TPZA 1LQTA 5BUQA 3V4RA 1KPGA 4AJPA 3ZWKA 5I9IA 3RVBA 1BRMA 1XZ8A 3NT4A 3BFKA 4B4KA 1WULS 3H2SA 3AIKA 3H42B 4CR7A 4RLQA 4PAGA 3VR5A 4K9NA 2QE6A 4Q7QA 1Z4OA 4P4UA 2R25B 1Y63A 2J6HA 3BD8A 5FYQA 2XRMA 3T9AA 3TNJA 2Q6KA 3TQHA 5JBIA 4RE6A 4C0JA 4YT5A 1YKFA 3GGPA 4CT4B 2WP8J 3GNSA 1U2DC 4OBXA 1WCXA 4XIFA 1T3TA 2BKUA 4AY2A 4Q93A 2RK6A 4TS1A 1I94B 5L45A 5TMDA 4H7JA 4M1QA 3WSVA 4CM7A 4A8HA 3M82A 5J63A 1CY1A 3FIJA 3U26A 4P4SA 5DEOA 1KRXA 2VHTA 3H2GA 5EJ2A 3O8QB 3ER8A 3U3XA 5ILGA 5D3ZA 3MYRA 1C2YA 2VZLA 1QDLB 3S2IA 1SXHA 4BUZA 2CL7X 3UJNA 1MPXA 3D2BA 2ZSBA 2HDWA 3I9V6 3L8YA 3KQUA 4AWXA 4P32A 3KZCA 3UWKA 3AI7A 3KL2A 5JS7A 1TU0A 4MYCA 2GA8A 2P67A 2IZ1A 4RNDB 4U7FA 4DDHA 4WESB 5HFNA 3WBFA 4ZI2A 1TF7A 1SZJG 3A32A 3OEHD 3C6ZA 2UVDA 3KLBA 4N3GA 3T4EA 4HQ0A 4ZT4A 4YMIA 2G1AA 1FA9A 2AMVA 2XEXA 4HQ6A 4G0YA 2PNJA 3SNKA 3ZCTA 1HETA 4AUKA 4Q4DA 2EWWA 5K51A 2QVBA 4GRAA 4CEJB 4V0SA 1L7QA 5BQXA 1EVZA 2E2WA 2RBEA 4GP9A 2IKQA 3I8SA 5F4BA 3E1SA 3NWEA 1GN8A 1UMCA 2ZTLA 4U6QA 2R7KA 3IYLW 4WE3A 4AYTA 1HDZA 1WX1A 2HHAA 3T5AA 1ZX1A 1MZPA 1Y4DE 3EDYA 2FU5C 1IDOA 5DOVA 4OCZA 3DVAA 1Q22A 3DR3A 3JQ9A 1LBIA 1N6HA 2XYQA 3I2KA 1T2UA 5GQSA 2XEDA 1X1SA 3KEFA 4XCVA 4LGCA 3SXUB 3HEBA 1HT2E 2F9MA 2ZT5A 4HAVA 3RGWS 1ZOPA 2NXNA 3C3MA 3WSWA 1V6SA 2JGAA 1V1RA 5G0TA 4FZJA 4QVKA 5DK6A 3I9FA 4ISBA 1FNNA 3FBTA 3HJNA 5SZKB 5HM6A 1DUIA 3QY0A 1X8LA 3F7NA 1S2GA 4FIDA 4DV2B 1K86A 3JQEA 3E58A 2IUEA 3A1UA 5DK4A 2FSGA 2IYUA 1JIUA 4IWNA 3LA6A 4M38A 3ZQ6A 1RADA 1RDFA 4J8PA 5CLFA 1UPTA 2KI5A 3B20A 3WFJA 4KRFA 1ZHFA 2H1FA 2I71A 2P62A 2WNIA 4C89A 3F5QA 4CKWB 2IPOA 4BAUA 2P40A 3HN7A 5AW6A 1W0KA 4QPCA 1XNGA 3G5LA 3RUAA 2MINB 1NW7A 1B14A 2D2FA 2NT4A 2UU9B 5FD8A 1GL3A 1PQ4A 4MJ7A 3PICA 4NBLA 1QKKA 1S8OA 4IS2A 1FXUA 3SHTA 2WJYA 5IH7A 3LK7A 4U02A 2ZQYA 4N40A 5E4JA 4TUYF 2DQKA 3ZXIA 1DAFA 1KP3A 4KUGA 4ZIRB 4HYYA 4I2VA 4HH0A 1BS2A 1IE3A 3HMQA 5I9MA 2IBTA 1DCTA 2BWJA 2G28A 2N1MA 3GUYA 4OI1A 1OR8A 4P4LA 2B2NA 3TKYA 1GFSA 4GWGA 4IAOA 4OGGA 1N4AA 1GAWA 2YW2A 2HF2A 5KYYA 3RROA 5HGXA 4BE9A 5BYKA 1XWWA 5U1PA 2ECQA 3TZQA 4BQQA 2IYRA 3DFZA 2ZYGA 1DEHA 1U28A 2R60A 3PU6A 3TRFA 2HYIC 3AHGA 1WMEA 5EZSA 4D7AA 3A14A 2OV2A 5HA5A 1UWKA 4Y8VA 1M0SA 3RU2A 2I87A 5L53A 3PBKA 1VPTA 2HOQA 4EM6A 4ECAA 3DLHA 1SBQA 4FDMA 3FHTA 2C9DA 3N2NA 4HQLA 4Q7EA 2WYUA 4QT0A 4F93B 4EEXA 1CUVA 3N5KA 4XPIB 2A9VA 5IKMA 3X2FA 5L6LB 4BMDA 1TEXA 1XVLA 4LA4A 4M0CA 1I4WA 5LQMA 4P82A 4CEHA 1WZIA 2E1PA 3CF0A 2H0RA 4JP1A 4FJ2A 5K01A 3MS7A 4HN2A 4X1OA 1VLHA 2ZSEA 3OT5A 3KWFA 3C6BA 2MMGA 4RD2A 1B16A 1SXPA 2OO3A 4IBOA 5BMVA 3GLIA 3EK2A 2EKLA 5EP4A 2X0JA 4KLRA 1B3RA 1FX1A 3OZUA 1RXUA 5AK6A 5I7OA 3K7EA 4HPXB 3U44B 1WS6A 1COZA 1TM5E 1VPDA 5I7EA 1SVLA 3K70C 4RV9A 3PUXA 3ZN2A 1L9XA 1OVMA 4C78A 1H2FA 2R1VA 3VISA 5IXYA 2BFWA 4FLEA 3E1KA 3GXBA 1T5IA 2XKAA 1HOTA 3UMMA 5I4IA 2C31A 4MUXA 4RETA 2VSXA 3EFOA 1J99A 1YZGA 4R68A 5FV4A 2FE1A 4LXYA 3L4BA 1Z6QA 3NHRA 4LWZA 5BV8A 3RC9A 3K0AA 3JYOA 2VKQA 3JALB 1EGMB 1JL3A 2ZVJA 1VECA 3N39C 4P5DA 4RK7A 3JQAA 1U2GA 5DNVA 3EARA 1BE1A 4U9UA 2EKZA 2D2EA 3GIWA 1Y9JA 2DX7A 2QD1A 3SCZA 1XIVA 4M83A 3UH1A 3DULA 3V9AA 5CFOA 3BG5A 3K5WA 1PJBA 4PLYA 1VLVA 1Y6JA 1E1YA 2VJYA 3IR7A 3ZGNA 2X9GA 4EP1A 5CYPA 3ABOB 3GD7A 3W6NA 1UZLA 2J8ZA 1S3GA 2CNNA 3MLBA 1ZH8A 2L17A 2OA0A 4RD1A 4EL0A 1HGXA 3VO9A 3VSCA 2A3NA 3E9ZA 1OHHD 1I80A 4R3NA 1QPGA 1X74A 2QY6A 3I5UA 5AJWA 4LVOA 4COKA 3JD4A 4L07A 4XW2A 1N0VC 7YASA 4KQCA 1TNDA 3RE1A 1V2GA 3EIFA 5KNBH 1SC6A 1S7CA 2DP4E 1KY3A 3HSYA 3KVVA 4GMXA 3UY4A 1W1IA 4P81A 1EZ1A 4W7IA 3MPOA 1OBFO 3UK1A 1CNMA 1N5JA 1T9CA 3QWFA 5JAMA 3K9LA 2KS6A 3LSTA 4UXJA 4BBJA 1NW6A 5K20A 1TQ2A 2F3SA 3PGXA 5A7FA 4JV5B 2WHYA 2ACWA 1Y5IA 2R1VB 3GN1A 1U3DA 2XWBF 4PLZA 2PAFA 2YHIA 4WVFA 5EJ4A 4TKZA 5GVSA 3DOCA 5AKYA 3A1CA 3DMFA 4BQIA 1DJPA 1P9OA 3VA7A 4DSUA 3RW9A 2A35A 2BELA 5BN5B 3CX7A 4AKTA 1KOLA 3HDTA 3ID6C 4RABA 4WV3A 5CJ2A 1LPOA 3Q7TA 2JFHA 2Z5VA 1JDTA 4LQDA 3KQTA 3OEED 3STHA 5A9SB 3BULA 5JRZA 1E1LA 5CD1A 3EZGA 2IK8A 4JP2A 4KWTA 4BVGA 4LE2A 2ZUCA 3PDWA 1Z6GA 3DEJA 3ETCA 5DU2A 5T4HA 1I5OA 3R44A 1ZSNA 4RSGA 1XVUA 1GEEA 1JRLA 2IYEA 1QIMA 3TFWA 1A2OA 2IOYA 4BMOB 4AQDA 5BP7A 1AZSC 4JFAA 4DV0B 4LJYA 4LNHA 3GJSA 2QZPA 5F5NA 5JZ9A 4UDXX 3A1EA 3ZCRA 2LE0A 1A2BA 4NDAA 1TEZA 1W5BA 1LI5A 4REMA 4BVBA 3N76A 1SOAA 3MJEA 2ID7A 3OOHA 4WBXC 3SOZA 3SQNA 1FFSA 4ND8A 4BX3A 1J8QA 2VDPB 2PRSA 2FZKA 3P5BA 1YV9A 2W6ID 3QGMA 3L0PA 2VA9A 5D86A 1Q1NA 1TYDE 3GZTB 4Q6BA 3SZRA 2N47A 4ZCTA 2XADA 3FVRA 4ZICA 1YS4A 4Q03A 4TUYA 2BFFA 3FMPB 3OCJA 1YACA 621PA 5KSZA 4QYWA 4A92A 4DS3A 4R8LA 3IVRA 3VPGA 1QKIA 1R66A 4YMVA 3O8OB 1XLVA 4J7AA 4PR3A 3ZHCA 5IPFA 1RAFA 2HKIA 5B6JA 2JIZA 1V11B 1J20A 2AMLA 1KVRA 1JDJA 2I7CA 1WVIA 3BK1A 1TKAA 2ASEA 1PX2A 1AD2A 3N3BC 4HSGA 3V1LA 1HC7A 2YJ4A 4EHHA 3SWWA 1IBKB 3S27A 3K6KA 2XOEA 4LGVA 2FUEA 4ZO4A 1EINA 4EUSA 1RABA 3PR3A 5I01A 1ND6A 4KQ6A 5JAPA 1E6MA 1NQ5A 2CJPA 1V1JA 3R20A 3ZZNA 3HKCA 1MJGM 4RACA 3GLGB 1SR8A 3EPPA 1QIEA 3CRW1 1CRZA 1C8LA 3D2AA 3F96A 5K6TA 1T1IA 5HIIA 2REXB 2IEZA 5BO5A 3ZLUA 4CUZA 4OH7A 5HVNA 3CZMA 1QU3A 1MH9A 1TLTA 2V98A 5AK3A 2VJLA 4ZQCB 2XPCA 1KJQA 1OAKA 3PC6A 2BYTA 4MHTA 1DCMA 3PHBE 1WEHA 4B31A 1M7GA 1L3CA 2B7LA 4GE0A 4Y9SA 2BM1A 2ACKA 2HA6A 3TF5A 1T9GS 3FR7A 3UENA 1H3EA 3OCUA 2BGRA 3AT1A 3FB1A 3IAHA 4RFSB 1NMYA 3CT6A 1TQ6A 2BIFA 1ADYA 5KPJA 4YBRA 3HCFA 3ORQA 3U7HB 4QYSA 1XTIA 1UKBA 2B5OA 1FQOA 1YE3A 3T1OA 2JGDA 2BOVA 3H9JA 4GYWA 4TT8A 1HDGO 4O4JB 3WMGA 4BQPA 3BT7A 4GMDA 2NUTA 1VDMA 2VP4A 3HCPA 1PV4A 1NNUA 3EMKA 3H2BA 1GQSA 2IH2A 3QMVA 4O2BB 1XDDA 5EQJB 3UV6A 1SCNE 3A2LA 3AGQA 3FROA 3G2OA 3GXOA 3IFSA 3JARA 2KSQA 4ZCPA 3LDAA 3JSAA 4HCJA 5I5EA 5AM4A 3A36A 2LKCA 1DBRA 4WHMA 1Q7GA 2E4AA 2HJHA 4N6NA 1FXWF 1M2GA 2WWHA 3AUFA 4FS3A 3NHFA 1VTKA 1LBHA 1VHQA 1XFAA 2ZYUX 3U1TA 5LOVA 1XLTA 4WZBA 3MWFA 4OB8A 3HXPA 4C2BA 3ZJTA 3QFRA 5FQNA 3LDGA 3WIOA 1U5CA 1GARA 2GTIA 3AEUA 5IT0A 4M7WA 1IBMB 2FZ5A 4BVEA 5HJ7A 4QSHA 1KQOA 4S1VA 1A4IA 3AHCA 1DC6A 2OZLB 2EX0A 1E3JA 5FPYA 3VAZA 1UK6A 2WB4A 1W1UA 3OIUA 4KDCA 2RE8A 2YFQA 1MC4A 1RKQA 2AR0A 2CUZA 4DR4B 4B2LA 1IVYA 3AG6A 1SELA 3E3NA 3KAKA 1ZXLA 4KWEA 3DZFA 2J6IA 2C7QA 4O0LA 1QFJA 3P9IA 4G1MB 3W4KA 5KSOA 2I4OA 3RTBA 2GZSA 3GO4A 4KDRA 5D5HA 1TO2E 1SIUA 3DVRX 4G67A 4LZZA 3VJMA 3T7AA 1NW3A 2FN3A 2BZ0A 2J3QA 3PXEA 5F3DA 2V4ZA 2G8NA 1QS0B 3SYKA 2BP7A 2ONKA 2ZJ8A 4ZJZA 3VKUA 3ORFA 1Z5UA 1I2DA 3ORYA 3SSMA 1YCFA 2ZWOA 1RZRD 4OK3A 4CIYA 1HNZB 3BA6A 4LTMA 4Q1BA 3VPDA 1BG6A 3VU9A 2CV2A 2PZJA 4YGXB 3T94A 3S8EA 5FTKA 3PHCA 4CV3A 4F7WA 3IPAA 2A1UB 1KIMA 2QPOA 4FGJA 4HWGA 4WNAA 1N0UA 4C6TA 3MB5A 4XLLA 1VXRA 2WTEA 4BJ5A 1TLFA 3BZUA 1LJ8A 1AC5A 2C3OA 1L3BA 1FTNA 2HLDA 4OQFA 3K32A 1A9SA 4ZV7A 4YRDA 1P8JA 4F8JA 5IXSA 4Y2UA 4BWVA 3CZPA 1R15A 2IJGX 3OQ1A 5JQWA 3EAGA 1F60A 3VOSA 2QP9X 4B76A 1GRVA 3PT5A 4WMLA 1CQIB 3M5WA 1P1HA 1CY4A 2R751 3ETEA 3V2HA 1J21A 2Y4OA 4X24A 2W48A 4H0CA 1CEXA 2XTJA 2J3KA 3CSSA 1XDZA 4DBLC 3L18A 4HWPA 4JLUA 5AOCA 5E2AA 1QGUB 1IHPA 1ORHA 1PIWA 4UTZA 2GJAA 2WP0A 4CKCA 1OH6A 3A06A 1JQ3A 2H1IA 3K9QO 2IEGA 2TECE 4WCDA 1N5IA 4CDMA 1BS1A 2P4SA 5F2EA 4CXMA 2FB9A 3BCRA 1CE8B 2QRPA 1RQLA 1QGZA 4REQA 8GPBA 4FT2A 4CDGA 4UOZA 4OXQA 1WSWA 3DL7A 3WE7A 1GAXA 2GERA 1A9YA 1L8AA 5AXDA 3O8RA 1JAXA 2FWBA 1T2CA 4L5JA 4C14A 1UIRA 2JFXA 4MRAA 4ALIA 4CLDA 2QR2A 5BOSA 2VQEB 5FDFA 1XJQA 4XM0A 1Z0AA 1E1DA 3PITA 4L4SA 3S4YA 5HXAA 2JAHA 4ARSA 4K9SA 3HM2A 4BO9A 1UKEA 3S8YA 3DPIA 3T4UA 3H04A 3U3DA 3P0EA 3KNZA 5DGDA 4YLEA 4X3OA 5HS4A 3OA0A 3NH6A 3ICQB 5EXDA 1GNQA 1K63A 1Q16A 2WYWA 5KQMA 4NCBA 2HREA 1CY7A 1Y37A 3CF6R 1D07A 4MYTA 4UQOA 3SEZA 4ZEVA 4DIDA 4ZOLA 1QGDA 4DG9A 3ET4A 4AY5A 1TGYA 1G60A 5KYVA 2Y4NA 3FMGA 4M2LA 4UOEA 1X13A 3I9JA 4JKYA 3RS2A 1MHPA 3UOWA 5I7VA 1YJAA 1B1AA 3HXMA 5SYAA 1YD7A 1E7QA 4EHDA 2REOA 4QYMA 4YB8A 1L7XA 4KK4A 2YWGA 4OHBA 2CNLA 2ZKLA 1YFLA 3N8GA 2ATCA 4D0NA 2I6QA 1FMJA 2AN1A 2OGWA 2G6BA 5HKBA 3PE6A 3BA1A 1G6Q1 1QX3A 3KCNA 4AIIA 4ASUD 1IHUA 2YNMA 5F64A 3P8ZA 4DA7A 2RGCA 4QJ4A 3U6BA 4S04A 1OU4A 4ZC1A 3VR6H 2V0CA 4MV4A 1O0SA 2ENWA 3ZHOA 2IYFA 2Q0HA 2WQZA 2A86A 6CHYA 2NMVA 3TSOA 1EUQA 3ESAA 5SYMA 3JZAA 4BQNA 4BLTA 1H9CA 1TM1E 2VHJA 2WTUA 3S99A 1NVTA 2DSNA 2O8BA 4LNUB 4AROA 5T8KC 4UCWA 3OIFA 3PHJA 4H7FA 4RBNA 2GLTA 1R4MA 5H0IA 3H4MA 4CFSA 1XKXA 4Q1CA 4BDTA 4FHZA 4GR9A 5C2JB 2EV9A 2IITA 5FOQA 3HDVA 4MDEA 3FM9A 3EIEA 3ZUPA 4TLLB 2WW8A 4KGXA 2IV3A 3DFUA 2VAWA 2DCUA 2O1WA 1LLCA 3JRNA 5SY6A 2J9YB 3QVLA 3ZKWA 4F12A 3MJSA 3V97A 1R27A 1GPAA 4M4SA 4TS9A 3JWIA 3BXEA 4Z9AA 4OA5A 2BFBB 2P6RA 1ACLA 3IEPA 1QQTA 3FZEA 1ZNYA 3L40A 4EHJA 1CCWA 2J87A 3G0BA 5JMPA 2YXDA 1X1AA 2QG6A 3D6FA 2B94A 4CR8A 3J80A 4BNHA 3TRJA 3MWYW 4BO5A 3CV3A 2BKXA 4PHTA 2PIDA 1G8YA 1DDOA 2PZBA 1XJWA 4N0EA 3VNSA 1XXLA 3V7YA 5EVJA 3AFNA 4PZLA 4Y6GB 1BW9A 2KWIA 3ESXA 3VKVA 1YH3A 4EA9A 2J4FA 4EJ0A 5JIBA 3L7NA 3ZPXA 1Q1QA 2QN7A 1WXFA 3L6DA 4AY4A 3H8SA 2XTNA 5ERXA 5EE0A 1PNQA 1YCGA 4X97A 1SHUX 2V9PA 5A9RA 5E2BA 1XP8A 3IBGA 4NQRA 4BJHB 4BXOB 4M9QA 2IBMA 5ED4A 2V6BA 1TCVA 1Z6PA 2OM2A 3KOZA 3LPNA 2CFTA 3GDGA 4X65B 5EJEA 2PL9A 1R4NA 3KXDA 5I4BA 3NCTA 2WJHA 2IKSA 4X3CA 1M6WA 4KAJA 4EF5A 2WKRA 4Q05A 1CUSA 1E0KA 1G8AA 3GDFA 4HQOA 4CG2A 3N8HA 5JR3A 1YTUA 4I8DA 2I6XA 4MQUA 3NFYA 2DHEA 1KDYA 4QU0A 1DJNA 5AW9A 2NG1A 3ZQUA 1R00A 1ZLYA 2OBYA 2VLBA 5F2KA 1G5FA 2GPBA 2F48A 4DV6B 2W6NA 1M1YE 1RLOA 2C77A 3KJEA 4JR1A 4U7JA 4XSHA 1P2VA 4XRGA 4B73A 2FEWB 3H0CA 1XEWY 1JFLA 1HL3A 3K0HA 4JL6A 4XUEA 3VGPA 1QQ5A 3ZDDA 3H2KA 4LJLA 4NQZA 3ZHTA 1DKMA 4GPBA 4X7RA 3T7KA 3AB7A 1DKQA 1R5OA 4PO1A 3T99A 4NOLA 1KO8A 2HJ9A 3W5UA 5I7HA 4RS4A 2RHCA 3BK7A 4YASA 2OCPA 3EGOA 1IY0A 4PYMA 3HFRA 3QEOA 1PGPA 3A31A 1KS2A 2R6ZA 5IYZB 3ZZTA 3CSUA 1RT9A 1FDRA 1MX3A 2FPRA 3HP7A 3G1TA 3JQGA 4MCIA 1OFIA 1R4AA 4YP0A 4MW9A 4BECA 4DBVO 4EI9A 3LBFA 4ZCRA 1E2IA 1BGXT 1QIHA 3UHOA 5CA1A 1E60A 2MSDB 3G9XA 4LQ4A 3O2NA 1X0XA 3Q3VA 2JJ2D 5CR9A 3I76A 2Q6TA 1UWLA 2Y9MB 4JBYA 3L1VA 3DE7X 5K03A 3OWHA 3C3YA 3JASB 2NUAB 1GNVA 1Z39A 3IVGA 3DYBA 3KVNA 2EX1A 1G6KA 1ZMBA 2LRHA 1SQSA 3E0XA 3FCOA 2ORWA 3H5IA 2M6SA 4KFUA 4JITA 4WJLA 1NLMA 1OC2A 1B8UA 3HR7A 4HHEA 4G4SO 3SHOA 4BFXA 1EX7A 3EBLA 4D56A 4ARZA 4ZHQA 3U81A 3AGPA 3L6EA 3F7OA 4ZKDA 5C0OE 3U7GA 2IZ5A 4PZEA 4XVHA 5JDCC 1E1RA 2A1TR 1XYGA 1YC2A 1YOVA 2B0JA 2XE8A 1D4AA 3G02A 3LNCA 4D9CA 3ZWDA 1VFPA 2RAVA 4EDFA 1UDRA 1IM5A 1KRHA 3LQ4A 4NAHA 3FTFA 1NVGA 2FMXA 4KJXA 4MUAA 1SQFA 1Y5NA 3F5SA 1FU8A 3WLPA 3WZLA 2XZTA 4XVRA 4LZPA 1AKEA 2ZIXA 3A1WA 1N6PA 3B1VA 3BH7A 1FQWA 2I2BA 3DSRA 3TL6A 1RHKA 3MTJA 1NXTA 1XP5A 4BP8A 1JQBA 3AW9A 4JC8A 4Y6PA 2K5UA 3HYCA 2VP0A 1U5BA 3U7JA 1R3UA 1U2ZA 1NC1A 2HLPA 2CLOB 4LDQA 5EVCA 3RV3A 1KBZA 2XF8A 3G6WA 2QAGA 2X0EA 3MM4A 4FW9A 2C8LA 3LP5A 1E1CB 4GI2A 1CZUA 1N5RA 2YV4A 2VRCA 2AD5A 1FNSA 1UDWA 1O6BA 1P91A 1REQB 4ZQGA 4FOTA 3I62A 3NWJA 1V96A 3PJFA 3VSDA 4BNDB 2IHYA 4F5EA 2QAJA 4NI5A 5F78A 4QU5A 4RIGA 4JCCA 4BKUA 3Q8KA 3O4JA 1GKYA 4PZ9A 2O2JA 3TZHA 2XCRB 5M04A 2R86A 4GNKA 1Z8DA 1X7DA 3E3MA 2JIDA 1VE9A 2MTBA 4AXBA 3REGA 4LGYA 1VB3A 2PLRA 5A5FA 2EHJA 3IURA 5EHZA 4P3OA 4JJ6A 1E63A 3OZSA 3W0LB 3ELDA 4D81A 2BHNA 2OCKA 2PT6A 3SSOA 3LT4A 1X8JA 2HPVA 3EEBA 3R7WA 1NG1A 4CE6A 4BVHA 4H59A 3H3FA 3ILVA 5E4FA 3LT5A 3PUKA 1NLYA 4H1TA 2FJPA 3QFFA 2IHZA 4XD2A 3H84A 1A1VA 3JYQA 4TV8B 4K88A 1Y1SA 2A1IA 3GEIA 1YFZA 4IFEA 4ML3A 3MJVA 2J1LA 4N41A 5KWSA 4KAAA 5HBRA 1M2WA 1WUKS 4K40A 5BSHA 4KP7A 4F5WA 2H5IA 5BUSA 1OAOC 2CXNA 1ZGHA 3EFEA 2E0IA 3ESZA 2IF0A 4LG1A 4JBHA 4A16A 3TECE 4B6GA 2VPPA 3RWMB 2ZBPA 4RTJA 1C8KA 1KAGA 3UJDA 4PXYA 3D0RA 1OKKD 1GTL1 4UREA 3CEMA 4C01A 1I6KA 2NVWA 1I30A 4BKOA 721PA 2Z4TA 4KE9A 1Q5PA 5AJUA 2GAFA 1M2VB 3BD7A 1XXHE 4WJZA 3C3WA 3IDZA 3KSZO 3CA8A 3L43A 4ZC8A 1DC7A 4KJZA 4YRCA 5AI5A 4BO4A 1G291 2C2OA 2OHVA 3HN2A 2FWIA 2QPTA 5TF4A 3UCEA 2H4HA 2UVPB 5ERYA 4IDHA 3PYXA 4WDQA 4BGUA 3SBDA 3U80A 4JT9A 1RCFA 2FG5A 2BLNA 2JGRA 7AT1A 5FKJA 2X9LA 2I4MA 2YMPA 2GASA 2Z98A 3CX6A 3ES9A 3GV0A 4G8BA 3T06B 4A10A 5A5EA 2XWPA 2C2KA 2QLNA 4LHYA 1W4AA 4XX0B 3AR8A 4N47A 3ZDRA 4G5YA 5AHKA 3ZVLA 5FLXA 5G53C 1APBA 5E38A 4RULA 1IN5A 4HBGA 1Y6QA 5EHNA 2ODBA 5ALVA 3EISA 4XLZA 5CGQB 5B3JA 3WIEA 4BBZA 4Z4EA 4FYPA 3NGMA 4G0MA 2R2AA 4BO7A 3VNUA 2NO4A 2ANCA 3OY2A 4EPTA 4XVCA 1I14A 5J5CA 3KEMA 1N5KA 1VPLA 2VLIA 4KOEC 2YKGA 5I8PA 3CB2A 1TZ2A 3NEYA 4PRZA 2AOUB 4KR2A 3VNAA 2C96A 2WM9B 3TOZA 4UQLA 4M7PA 1BD3A 2JKYA 3AQ4A 3DZDA 3HA2A 4G1VA 2B61A 3ZTWA 5ITVA 2CJFA 5IZCA 2RG7A 1KAEA 1VKOA 2O8VA 1DGQA 3AJ9A 3L7DA 2QXYA 3U4CA 5TS3A 2FPLA 1V6AA 4F2DA 4C3UA 4UBOA 3ZY4A 2ON6A 4CW7A 1V16A 1I2BA 1TF5A 3TG8A 1SXIA 1ZINA 1LLDA 1JG1A 4HEA6 3TIVA 4CODB 5JMWA 4G0UA 4D4HA 2ZRNA 1Y98A 5FI5A 1JU4A 1E7WA 1XTQA 3DYVA 1NI4B 3Q5EA 4KPYA 3KHSA 1GRRA 1CWUA 1PT6A 5ALYA 2DUNA 3EDRA 4PX2A 2YJ5A 3SS7X 3DO5A 1S8NA 1SUIA 2IQIA 5AVZA 3NFRA 5JHGB 3ZKAA 2YHUA 4OGLA 4YUXA 5KDLA 4FFRA 5HK9A 3CGGA 1H5QA 2PUBA 3QE4A 4H6PA 3V80A 1VZ2A 3RSGA 3TD9A 1XZHA 1XMXA 1E92A 1T1GA 2FQWA 4KXLA 5IDQA 3OAAA 5IJ0B 3ITDA 3FWZA 4J1QA 1FLDA 3ROPA 1UBFA 1S7GA 5KSPA 5M34A 2IHJA 4FD3A 5I7UA 4B4VA 2E5FA 1I9GA 3U4IA 4IEIA 3GLIB 2H5JA 2XUDA 2XMCA 4GXQA 4PGMA 4S0ZA 3IEUA 3H2HA 3WLEA 3Q87B 4R5MA 3BH0A 2SKCA 4ATNA 3LUBA 5FWNA 3A6DA 3C1AA 2YWBA 1IBLB 1N5OX 4F3RA 3ZCUA 1CULC 1XVIA 5EE5B 5LB2A 1Z73A 5EXPA 4H7IA 2FPKA 2C82A 2XJ4A 1GQQA 1GUFA 3U13A 3AESB 4ZWNA 3BRCA 1XN4A 1Z35A 3AYZB 2ZTMA 2OCIA 5FL7A 4MV1A 3S7TA 3UAOA 3RLFA 5ITZB 3IP5A 5JFGA 3QWHA 1V1RB 5KVSA 3MOGA 3VZBA 1M2JA 3BWXA 2P5SA 5DI3B 1P5JA 2JAXA 2NAFA 3SNHA 5HILA 3UMRA 4KG7A 4U9IS 2O14A 3DL2A 4YV0A 2P1DA 4OXKA 2QVZX 2IDZA 3V42A 5CEJA 2O50A 3OZXA 2GYYA 2B4RO 3Q98A 5CAEB 4IHAA 5K7SA 5B7PA 1EAYA 2R00A 3QPBA 2JBAB 2HLNA 1EK1A 3D1VA 1BGWA 5J2TA 3UWOA 1E9VA 1FYVA 1KJNA 4FN4A 3NHZA 3OE7A 1D0VA 5TX7A 2IXFA 3KQKA 1JEYA 2AVNA 3H5NA 4BMNA 4QJ3A 3OURA 1FB5A 1RXIA 2R5FA 2QVGA 3AW8A 4BVKA 2DB3A 3AESA 5CYOA 1FZTA 4MR9B 1KAOA 4P4GA 2BFDA 3QA3E 5BN4A 3LH5A 2JIMA 2R4QA 1E0JA 4CU5A 3VZCA 3MILA 4MPDA 3U5ZB 4LV6A 4G8JA 2WU3A 2R8PA 1JDBB 1H8ED 3K09C 3TQOA 4BBAA 2QMYA 2AHOA 4O2BF 2YOFA 1FSGA 5MFZA 3KSMA 4UM7A 3K0AB 4MKXA 3ZWCA 4L0MA 4EHBA 3AVWA 4B7AA 4FKBA 4JJ7A 5H16A 1G3RA 1TZKA 2JFOA 1A9TA 1USGA 3PUZA 1BVRA 3EUAA 4BKRA 4J6FA 3NXSA 1IATA 2BGTA 5IYZF 1LLFA 1GGJA 4R01A 4QJIA 1XMSA 4PGGA 4KQHA 1QM5A 2WG0A 4TTRA 2H08A 1CP3A 1OX4B 3U7EB 3VZDA 3ENQA 1UP4A 5JNVA 3VAYA 5LOVF 1F2DA 1ZHHA 4K05A 4EBBA 1P0CA 2I6FA 4B75A 2C9OA 3QPDA 5ISMA 4I4NA 4N8DA 4Z7NB 1IJBA 1L5ZA 1SC3A 2QTTA 3BYZA 5HJ2A 1NF2A 5GV8A 3RSZA 3GDWA 1K8QA 3AUKA 3GEMA 4N3BA 1GIAA 1W4RA 1BE8A 1NU6A 1W0CA 1J2UA 1KJIA 4LIPD 4TLDA 4Q7JB 4CCSA 3AVTA 3GRUA 1ZONA 2P1ZA 2ZW9A 3MGGA 2WMDA 3PGKA 2WM8A 4LZAA 1ZSVA 1PEAA 3LQRA 1BEEA 2RCNA 4FOPA 1CY2A 1NOKA 2Q3JA 1RI5A 4KRGA 2I4TA 2JARA 4MWEA 3SR4A 1O58A 3SP1A 1ILWA 1WU7A 4AQ7A 1PEKE 4FHGA 2J9RA 4K0RA 1E18A 4ZAYA 2V7XA 3ELBA 1C1XA 1M8PA 1SA0B 3HKDA 4AZSA 2I4LA 2Z57A 4TLAA 2QTGA 3ZDAA 3S5JA 2XWJI 3CG4A 1OWPA 3SKYA 1KWGA 3ICCA 5FBRB 1LJLA 3KOOA 2IYVA 4KQ9A 3N0TA 3AVPA 3E3AA 1U94A 4AWAA 4X6YA 4EFDA 4MUBA 2KLBA 4J7UA 4JLWA 1IUPA 3PQ5A 2WSLA 3SXPA 4XH9B 3TEFA 3P2MA 3EXIB 3Q0IA 4EG8A 3FWNA 2FPGB 3T8YA 3EXAA 4WINA 4EUNA 1V39A 4D0RA 1IOVA 3CLUC 2HA5A 3OCWA 3OF2A 4MVJM 3ZZ1A 4D3FA 1KJ9A 3JWJA 4DV4B 5B2FA 1R8XA 1OZ0A 5JCJA 4CKYA 5C7LO 2JLXA 1N5MA 1IAVA 1PYGA 1TYZA 4K6GA 1U1GA 3B6ZA 1O4WA 3NYQA 4PZPA 3PC8C 4BMZA 3QG5A 3B52X 4YRAA 1J56A 2IH5A 1GUBA 4BNVA 2VH5R 1IB0A 1E1NA 2G6TA 4HGYA 4BV8A 1K7FB 1OLUA 2OORA 3I8OA 2R6AA 4L16A 1K1EA 3NIGB 5LQRA 4QXOA 4B6PA 3GW8A 5ALRA 1D1QA 4S1NA 1J1UA 2UV8A 1GSIA 3ESYA 1T4DA 3IXMA 3FTQA 4CEHB 2V55B 1U0GA 1QIIA 3FPEA 4M87A 4LVCA 5NULA 3VHLB 2X15A 3E9YA 4OI0A 1R88A 1QC5A 1DSSG 5J2UB 3VYVA 2PUVA 2IT1A 2XE7A 3LCRA 1RFGE 3EC1A 3VI3B 3EGXB 5CAEA 1A5BB 4JSTA 2D00A 4M98A 4Q15A 4DLTA 5CFPA 3HUDA 4QOFA 5EFZA 4TN1A 3SICE 3HA5A 1F5SA 2JLUA 1CFJA 2PGXA 1T24A 4K8RB 2R8YA 3OLQA 2G9NA 4BC0A 2WSSA 3JQ8A 4AO6A 1XAIA 2X8WA 1R0KA 2A7XA 4F8EA 1CT9A 3NXKA 2GJ4A 3VPFA 5JSFA 2QRVA 2ZM5A 5DP2A 1TPYA 5BPFA 5K0TA 2IS2A 2DBQA 3WLLA 1T3ZA 3PCXA 1L7OA 1SURA 3KQYA 1JJVA 4D9IA 1X7WA 3PHLA 3GOHA 1Y8QB 4M0FA 4BN0A 4KQ2A 1NR1A 4H1HA 5K0ZA 2HT6A 5JSQA 2YXBA 1COWD 4EJFA 3KLPX 5B7GA 3H8WA 2VPQA 1N92A 5EQFA 3X1XA 3U3OA 2NTNA 1MEEA 5KINB 1KQGA 1MW9X 3MWDA 3LOPA 4KOAA 1K27A 2R1ZA 2ZTUA 3N6VA 3PKIA 4IDQA 1WTAA 1IEVA 2X40A 1NF3A 4Q7LA 1J0EA 3L7JA 5IDWA 3GLIE 4RTQA 1E7YA 2HSZA 2BFAA 4PANA 1RBMA 3ZOZA 5I5GA 1D4FA 4H4CA 2PH7A 3LK6A 4IJVA 3P9ZA 1PW7A 5DX1A 4B9EA 2QTLA 2G1KA 2QRLA 3B36A 3R6GA 1ULZA 4RZQA 3MEQA 4EJ6A 4W5NA 2YVKA 1Q1AA 3AZPA 1VRWA 2W6OA 2F3QA 2HZ7A 4E32A 4L22A 2WFLA 1TL7C 3FTNA 4Y2JA 3B9BA 1AUQA 5FBQB 1KEEB 5C31A 4LX0A 4IKEA 2AEMA 2L69A 4RTRA 1RKUA 3KZXA 3EUFA 3BQ9A 3EDOA 2BRUA 2J6BA 1QC5B 5EEHA 4KBYA 4EF6A 4BLQA 2D2IA 3HB5X 3U4HA 1UDAA 5LIRA 1LW7A 3A58B 4O2AF 4CI0B 4D43A 1TD9A 2IHTA 2C0PA 4YJKA 3RVMA 3WLJA 3HJGA 5HWSA 4DC1A 4L08A 3LWDA 5E0OA 2QOEA 2A5LA 3K1AA 2FRDC 5G2OA 2OSBA 4BPRA 2QT1A 1L7NA 2Q3MA 4C4XA 3BMQB 3DV0A 3T7JA 4RZ3A 1CUIA 1TM3E 1UBUS 1K7YA 2D7JA 1QQ7A 2P30A 2YASA 3LKZA 1GCOA 1RPNA 2E3JA 2DF8A 4XGKA 3ZOKA 3DBLA 2XDAA 3RRYA 4DUGD 2QUZA 4ZZ1A 1JQDA 3PKJA 2YWRA 5J5VA 3RUDA 1UAYA 1YONA 2QRKA 3CR3C 4JB3A 3L93A 2PSHA 4BN4A 2CHVA 2I7VA 4F6RA 4WQMA 5C51B 2PWBA 3OEYA 4X85A 1PS0A 3IBTA 1TVKA 1N2CE 1YDHA 3R5KA 3N7UA 4MGZR 4YAEA 1RWWA 2F8SA 1GZ7A 3T3DA 2GM5A 2ZE5A 1S8FA 3GGOA 2DTEA 2BUCA 4RW0A 4OQNA 3PEEA 2ZSHA 4B3JA 5LXTA 5FO0A 3JZIA 1E9SA 5JI3E 4MGHA 1RQXA 5A2GA 1PNTA 3IUEA 1XF1A 1K9SA 2D4AA 3ND6A 3OMLA 2GNPA 4J16A 4WK2B 5TB5A 4DBLE 1VC2A 2VNIA 4L3WA 5A4MS 1C81A 1XZGA 4XAQA 5FP0A 1XYVA 2IIQA 2IY8A 2JF0A 4G63A 5CUQA 5MGBA 4B74A 3TRHA 4JLOA 2I03A 4ZMSA 1V8DA 3B6JA 3ZQKA 2BM9A 2LNDA 3KQOA 4MJ3A 4V3BA 5IU6A 3UH0A 1MFZA 5FWXB 2VXOA 1EUCA 4UHBA 5E7JA 1UEJA 3CLTD 2YR0A 3CH5A 4PTZA 2V96A 4BTLA 3MWEB 4DTIA 2PX2A 3WNVA 1IPHA 3KKEA 1AIPA 3WGTA 1E5TA 2BI7A 4AJLA 5JANA 1YTLA 1EFHA 4GI1A 5E7IA 3REQB 3ZY6A 1YVEI 1FW8A 1H8HA 4YRSA 4GL2A 2Q07A 3QFHA 3L06A 3QPVA 4TYMA 3F7TA 2OCYC 3VUFA 4DPLA 2XR1A 3R3YA 1M66A 3O4RA 4L85A 1XMVA 4RDHA 3HLTA 4MVWA 4B3MB 1B8PA 1F2VA 1ECJA 3D64A 2VP5A 1AY0A 4HOYA 3GC6A 2Z5GA 4TTTS 1GFWA 4EGCB 2QLJA 4NFYA 4CIVA 4Q1FA 3WS7A 4AMBA 1DWPA 2ZT7A 4MYDA 3UMVA 4HMQA 4NJMA 4OXNA 5IVPA 3DUFB 1SOVA 1FJHA 1OLSA 3U9SA 5SV2A 4DCPA 1ZL2A 4D3XA 2EFEB 2H1VA 5K3AA 2X86A 1K6IA 4M88A 4EQ6B 4HQKA 2FMIA 4ZDKA 4LX8A 1L4MA 4QTXA 1ISPA 1AGXA 4C9BA 4AC9A 4GOOD 3V4ZA 1EKXA 2H9YA 2OTCA 3TZEA 1LLQA 1Y7TA 4TXHA 1FNMA 1QDUA 5DRYA 3UF0A 2X9NA 2QN1A 4UM8B 5TARA 3HJFA 1IN8A 4MUGA 4Q0MA 1ML3A 4ZEMA 4F3KA 2ZATA 5GWXA 1G41A 2QYOA 5GTDA 3KBBA 1NMZA 1VE1A 5BV0A 2R0QC 3LHSA 4QULA 2C3PA 2NU7A 1JVSA 1U0NA 5D6NA 2FWAA 2CDBA 4BV2A 2NP7A 2RCYA 3F46A 4HSEA 4ZEXA 2KHZA 1Z4JA 3OMXA 3A3KA 3OWXA 4R9UC 3TAHA 1NUQA 2QZSA 1MDFA 1A3CA 3LRXA 3LT0A 1TECE 5F1KA 3M2TA 4DDWA 4P0PB 1JHMA 1USWA 4FGLA 3KO8A 1NBMD 3CZRA 3R5FA 4OK6A 5IEJA 1RYMA 1L5YA 2COUA 1FU4A 4DDTA 4CKBB 1LBTA 2BGMA 3L7LA 1K3UB 2PGIA 3PUIA 4JVOA 1KZYC 2RGEA 1NVWQ 3SPXA 3JATB 3TQRA 2J0UB 2I6GA 1M0EA 2FRXA 4F9GA 3HRHA 3P1JA 5FF9A 3K05A 2AYZA 2FUKA 3MCTA 4HMPA 1WV1A 4MPTA 4B81A 1KI6A 3HP4A 4WGGA 3A9UA 3P4XA 3W5CA 3F90A 5DSTA 1VLQA 2A9RA 3AEQA 2FEAA 3PFFA 4G4GA 3CN7A 3KDSE 4LJ6A 5JUWA 1RXWA 4Q9NA 4GKJB 3OSZA 4ZTBA 3KJFA 1GZDA 1W4BA 4Q3CA 4U2BA 3NAMA 1ZD1A 4ZOLF 1Z0KA 1UFOA 3FWKA 3KQWA 1GL7A 2RONA 1BWQA 2XSZD 2VEOA 4B6RA 4O4IF 1OMOA 3THXA 4K9DA 1ISFA 1EFPB 5NLLA 2CV1A 2GAAA 4YAFA 1E66A 1KHTA 3BS4A 3UMCA 4U2GA 1QHNA 3A6KA 4MI3A 2Q9BA 1UADA 2XXJA 5ED0A 4KSYA 3K20A 3R41A 4BS9A 3UGJA 1NVVR 3E5RA 4F0JA 5LDHA 4EGAA 1T8WA 3C8ZA 3E5NA 4CQMD 1R0CA 1PJQA 4L7VA 4ZQHA 1DTEA 1YUNA 3P7MA 4C4TA 3IIKA 2R4UA 4DCTA 3UVEA 4JQOA 3PQCA 4RQUA 4BNKA 3ZWYA 2JVIA 5KYUA 2XYPA 3EC2A 3HWX1 5MGNA 3ROEA 1E3WB 3DBIA 5ALIA 4H16A 1WNFA 5DB4A 5DTIA 1M6EX 4ZCLA 4CMKA 1OPRA 5TXGA 2F8MA 1UWCA 2Z3VA 4LHXA 3AU8A 4B3BA 2IYLD 2AT1A 1UXJA 4DRXB 3GLFB 3WLOA 4FYWA 3TQCA 2XNDA 2Q3FA 5DYNA 2PRJA 3A1SA 2R47A 2C5GA 4G5HA 4KSBA 3RIHA 3ZHZA 4KPFC 1KI1A 1Y3AA 1K66A 1S2IA 2M32A 2MYUA 1G66A 2Z09A 3LXMA 4OHUA 5AJTA 4FEEA 3LW8A 3HCNA 2YYYA 5KCMA 2RGAA 3STVA 4WZBB 3FYUA 3I4LA 3UA3A 3BAFA 3UWMA 3FHJA 4BOYA 3BORA 4HH3C 4JUIA 4MHSA 2UAGA 1BFKA 1OXBB 2VUIB 5AW2A 1T3SA 3EVDA 2GEFA 4JEUA 3LRPA 3RT7A 3EVTA 3K8QA 3OX1A 4MV3A 3JD0A 4N0PA 1W4LA 2FN7A 4NRDA 1ZUNB 2VDMB 1P3JA 1EDBA 1Q2XA 2OXEA 1CVIA 3QY9A 3K2BA 3M6UA 3WYBA 4YMHA 1Z5GA 4IXTA 4Q9DA 1OH5A 4MUIA 4LK2A 1NTRA 4CLOA 3PXGA 2F8LA 1N2XA 2FKNA 1EP9A 4J16C 1W6RA 4RH1A 3TX6A 5P21A 2AXNA 1U2RA 3H65A 3RVQA 1UXHA 4N5DA 2R7AA