1TGVA

Structure of e. coli uridine phosphorylase complexed with 5-fluorouridine and sulfate
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
250
structure length
250
Chain Sequence
SDVFHLGLTKNDLQGATLAIVPGDPDRVEKIAALMDKPVKLASHREFTTWRAELDGKPVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPLEFPAVADFECTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRHFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNAETMKQTESHAVKIVVEAARRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords uridine phosphorylase
publication title Structures of E. coli Uridine Phosphorylase
rcsb
source organism Escherichia coli
total genus 87
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2004-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1tgvA00
5IFKA 4G41A 3F8WA 2HN9A 1ODIA 3KU4A 4P54A 1YQUA 4TXJA 1PF7E 5CCDA 4F1WA 3LGSA 3KUKA 3GGSA 4JP5A 3PHCA 1TCUA 1VFNA 4R31A 3TL6A 2H8GA 4R2XA 5EFOA 4DAEA 1K3FA 2OECA 1SD2A 4OEHA 3P0FA 1JDTA 1JE0A 1SD1A 4OY3A 4U2KA 4RJ2A 1YBFA 5DK6A 3UT6A 4F3CA 1A9OA 4NY1A 4TS9A 1T0UA 3O4VA 2A0XA 2B94A 4L6IA 4WKPA 4EB8A 4WKNA 1LX7A 1I80A 3OZBA 4UC0A 4L0MA 1T8YA 4YMLA 2QSUA 5CYFA 4MARA 4PR3A 5F7ZA 3NM6B 4X24A 1OVGA 3O6VA 1NW4A 5F7OA 1PK9A 1M73E 4M3NA 5F73A 5B7GA 1C3XA 1PR4A 4JWTA 4TXMA 3LA8A 2RJ3A 4IP0A 3UAYA 1RXCA 1A9RA 5KB3A 1Y1TA 1ZL2A 4DA7A 2BSXA 3INYA 5IU6A 1U1FA 4GLFA 3BL6A 2A0WA 1Z36A 3FB1A 2HRDA 1U1CA 2OC4A 3ONVA 4NSNA 1RSZA 2AI3A 2IQ5A 1PR6A 4TTAA 1K27A 1SQ6A 2HWUA 3DF9A 3UAXA 1FXUA 4OF4A 3OF3A 4EARA 1ECPA 1T8WA 3K8OE 3P0EA 1OTYA 3BGSA 4QAQA 5CCEA 1OUMA 5F76A 2OC9A 4QARA 1ZOSA 5B7NA 1Y1QA 4L5AA 4LNAA 1QE5A 1JDZA 2A8YA 1B8OA 3NM5A 1Z5PA 3U40A 1NC1A 4PNPA 4WKBA 4F3KA 4LZWA 2A0YA 4D8XA 4BN0A 5I3CA 1ULAA 1JDVA 2QTGA 4FFSA 3OZEA 1V4NA 1JDSA 2Q7OE 3EUFA 1U1DA 1CG6A 5ETJA 1Z39A 1SJ9A 5F7JA 3K8QA 1Z37A 1CB0A 4DA0A 3DP9A 1A69A 3FOWA 1TCVA 4D98A 1PR2A 2QDKA 3IOMA 2GUWA 1ODKA 1B8NA 3KVYA 2AI2A 5FAKA 4YJKA 1TD1A 2I8AA 1WTAA 4E1VA 5B7QA 1Q1GA 3EEIA 4H1TA 1V41E 1PR1A 4LNHA 4D8YA 3UAVA 4DA6A 3MMSA 4I2VA 3PNSA 4M1EA 4F2WA 1K9SA 1Z34A 1VMKA 4K6OA 1T8RA 4DANA 4TYMA 1TGVA 4R2WA 3OZDA 1VHWA 1JDUA 3KHSA 5CXQA 5F7XA 1N3IA 4YNBA 1PKEA 3KVVA 4OJTA 4L5YA 4TXLA 4D9HA 3EMVA 1U1EA 3E9ZA 4KN5A 4QATA 1Z33A 3EUEA 4GLJA 1JE1A 3PHBE 4GMHA 2ON6A 3OOHA 3FUCA 3MB8A 1Z5NA 1Z35A 1NC3A 5CYGA 3DJFA 4OGLA 4TS3A 3OPVA 4MCIA 1YR3A 4F2PA 1PK7A 4GKAA 2AC7A 1RXUA 4D8VA 3PNPA 1PR5A 4TXNA 5F77A 4G8JA 1A9SA 2I4TA 1T8SA 4OGKA 5JPCA 1XE3A 1JPVA 1RCTE 3UAZA 4WKOA 2P4SA 3OCCA 4ECEA 4BMZA 1YQQA 3ENZA 1Z5OA 3QPBA 1Y6RA 3FWPA 3NBQA 3IEXA 1OV6A 4BMYA 4BMXA 5CXSA 1PBNA 2PGAA 3DPSA 1PR0A 1ODJA 2XRFA 2ISCA 5EUBA 1RYZA 4L5CA 1RFGE 5C80A 4DABA 4TXHA 2AI1A 1RXYA 4QEZA 4JOSA 3OOEA 5K1ZA 2HSWA 3T94A 4NS1A 1JP7A 1TGYA 1A9PA 5F78A 1Z38A 1A9TA 1PW7A 1LV8A 5EPUA 1ULBA 3E9RA 3ODGA 4TTIA 1YRYE 2QTTA 3BJEA 4G89A 2QPLA 3FAZA 4DAOA 1Y6QA 1LVUA 1G2OA 4QFBA 3GB9A 1V3QE 3DDOA 4DA8A 1PWYE 1V45E 3KVRA 4LDNA 3BSFA 4MCHA 1ODLA 3LBAA 1A9QA 3C74A 1RT9A 1Y1RA 1RR6A 3NM4A 4LKRA 3UAWA 1OU4A 4WKCA 3OZCA 4M7WA 1V48A 5B7PA 1JYSA 1OTXA 1RXSA 3D1VA 4YO8A 3E0QA 4DARA 2OXFA 4TTJA 3SCZA 1V2HE 1U1GA 1VHJA 4QASA 1Y1SA 3FNQA
chains in the Genus database with same CATH superfamily
1A1VA 3NDPA 3ZK7A 2CXSA 4B82A 1N9GA 1SUSA 1VOTA 1I1QB 2YXEA 4Q9DA 4DSOA 4MULA 3LY9A 4Q4JA 2B78A 1ODIA 1L5VA 3BIWA 4ZEWA 3BXXA 4CM6A 1YIOA 2NLOA 5LYJB 2F8TA 3IURA 3H6HA 2FZ5A 3LD9A 2QRZA 3NHZA 3K2QA 5FFMA 4BUCA 5BVHB 1HYGA 1IN6A 3JAWB 1MN6A 5SY4A 2W2XA 5G0WA 4MKGA 4RXMA 5G1PA 5T4FA 4RFSA 4NAVA 1QIKA 3DTVD 1JIQA 4KVFA 4TUYA 2CXPA 1Y33E 5LWQA 2IQIA 4TVSA 3NDIA 2IS1A 3KUKA 3OPYA 3WGHA 5B64A 1G2IA 1BTOA 1T4CA 3PQ7A 4KFUA 1ABFA 3T3PB 3VZRA 2KWIA 4PGAA 3O47A 4IVNA 4D4KA 1QLWA 2NO9A 4LY9A 2OBXA 3RU7A 1N2GA 2NUAA 4G81A 3EVAA 4NFLA 3VU1A 2AOXA 1GNRA 1K3FA 1WUIS 2X4DA 2XWBF 1HDYA 3MK31 5CK4A 1D6SA 2IYPA 4MVYA 3N8IA 1QIFA 2ZUDA 3E3AA 2PUVA 1MORA 3GJ3A 4HYYA 3VNAA 4LGVA 4XM2A 4YJ3A 2KI5A 1V4VA 2RBGA 3AESB 4C7VA 4KQ2A 5KKCA 4N3GA 4NBSA 4RM2A 3RROA 3LZDA 4XGNA 4MINA 4AIRA 3IL2A 3BF8A 5IKPA 1KH3A 3ORFA 2O5CA 1W52X 2COEA 3CUWA 2J0SA 1QRAA 3LT4A 3ZZTA 2VHWA 3ZWMA 2CHGA 3HYSA 3WBFA 5DVZA 4KDRA 1DVRA 2QP4A 1GPH1 3FNHA 7ADHA 5IJ9B 1Z18A 3A9VA 4V1CI 3PCRB 5KUTA 4Z3DA 2J7PD 1A9ZA 1TIKA 3R6WA 1OX6A 5KSOA 5CVDA 2PX0A 5AW6A 2YC2C 1Q50A 4NJMA 2I3ZA 2R7KA 3IUQA 1UZMA 4H60A 5JASA 4BRWA 2PKWA 4ZD6A 1GZUA 1L1QA 1FUIA 1NJSA 2ACWA 1KJ9A 3W6ZA 1OU0A 3KV1A 2C97A 1UJBA 5EWJA 1VECA 1JDBB 3F9RA 4LWQA 4RQUA 4RV4A 3R7LA 3SDSA 4GP6A 4X1IA 2BIFA 3U4GA 4Q1DA 3ZI7A 4EVQA 1AUOA 1VDZA 4LZNA 3UG6A 2W2KB 5BVGA 3L82B 1K89A 2REXB 1GPLA 1KAOA 3CNLA 3QVTA 1LVGA 1C8BA 1WKBA 3DDSA 4XIYA 3K4HA 3SPXA 2HCRA 3W5BA 3KPYA 1ZICA 4G0VA 4KQ6A 2Q6TA 4NQRA 4FFNA 5LQRA 2PX4A 2UUOA 4J4TA 3QXSA 1FXWF 3A28A 3PE6A 4NCIA 4YB8A 5CYFA 5K3SA 2OK7A 2VN8A 2IHVA 4Y2HA 5DEIA 3M82A 2I67A 2X40A 2ZIFA 3ZHVA 4EQ6A 2H1FA 5JVDB 3RRNA 2I9PA 1PN3A 2ZVPX 4ZOLF 4BNZA 1NJ1A 2QLLA 2XA1A 1JR6A 4EW6A 4PXSA 2HT6A 4N5NA 2XECA 1C9EA 5IN4A 1C3XA 4JLNA 3GLHA 4HO1X 2Z95A 2WVGA 2Q3CA 2PK3A 3UTDA 2I91A 3CSDA 3A9UA 1LRKA 2C4VA 4GUDA 4MS4B 4P7KA 4FYWA 4R3UC 5IDYA 3THOA 5AIBA 1C3JA 1U2EA 1TEVA 1OZHA 4OQ4A 4AI6A 1A97A 2ZOSA 5CPFA 4L16A 2C2ZA 3MJ4A 4ZDWA 1DU4A 1LPNA 2RGNA 3LKVA 2YYAA 5JAPA 1ZQ9A 5JIBA 2HT1A 3GEGA 3NDJA 1NIJA 2IZ0A 3IMKA 4UATA 2JFUA 3SD7A 3C97A 5D3KA 1ZW1A 4RKEA 3TD2A 1VRWA 3HYLA 4FB5A 5C32A 5CD9A 4RLQA 2QD2A 2WU4A 2GBGA 3WXBA 2W37A 1PWZA 3FCOA 2WKSA 5HNKA 4K6HA 1O3YA 3Q6NA 3GX1A 1QX4A 1FXSA 2IQ5A 3CB2A 3R3XA 4KO2S 3RBZA 3THSA 3U48A 1PR3A 2WG2A 4X20B 3UWSA 3W34A 4BGUA 1ZH4A 3A1WA 4NBWA 3CVOA 3KYJB 5EVCA 2PUCA 1RWWA 1TO1E 3I9MA 1QH9A 1I6LA 5DYNA 5BV0A 3LTEA 2NT4A 5EMJA 3L8CA 1HLFA 1NVVR 1SQGA 4F4CA 2BZ0A 3SJAA 3EMDA 5KPDA 1Z12A 3DOIA 1W73A 2Y1WA 1XIVA 4Q9KA 2V96A 4LXYA 1X1CA 4B74A 5CVVA 2PKQO 1G20A 3T52A 4Z3KA 3LF1A 2HQBA 2WTXA 1I24A 4L6CA 5EIWA 3FI0A 4MKRA 2C1EA 2FPGB 3GOHA 3KJQA 4KX5A 3VR3D 2F7SA 2V6IA 3FKJA 1O97D 2QI9C 3H0CA 1XU4A 3K9QO 2ZR8A 3EXIB 1NU8A 1S6YA 1NVVQ 5DBHX 2ZRKA 3OUZA 3DEJA 1LI4A 1T4BA 4DC9A 2Q45A 4NZZA 4ZOAA 2OAEA 5EL0A 1ZNYA 2PD6A 1R4MA 4KXYA 3FYTA 5MN5A 1L1FA 1QGYA 4E03A 3HMQA 1B1CA 1HYBA 1YUBA 4B6FA 2OZPA 2IZZA 3BA1A 4PE5B 2JGKA 4QUDA 2D62A 4OHYA 1AKMA 1HEYA 1H2XA 1KEWA 1NC1A 1RAHA 1W1IA 3Q40A 3T7KA 5CB8A 1NDQA 4RHFA 5FWNA 3UB2A 3MFQA 4IJVA 2NQ8A 5TMBA 3GJRA 4CIYA 3WGMA 4QM7A 4LJ6A 4ZAXA 4DQLA 2CDRA 3G3EA 1YDHA 5KNCD 4TVBA 1R0CA 3H18A 3QLJA 3DOUA 1JDVA 1E63A 2BKVA 2CJWB 5EZYB 2VPTA 4U2FA 1R9GA 1WV0A 3P26A 1QYWA 4I50A 4NECA 5B1EA 3FBGA 5IZCC 4QGSA 4KC0A 4YUXA 3BM5A 3N0VA 2ZDQA 4WA7A 3DT9A 1ZISA 3HUEA 4AYTA 1E1QA 4J0DA 2HRZA 4JJZA 4L3WA 4Y0NA 2XNSA 2AX4A 3P2KA 3ZZ1A 4ZYZA 2GPYA 3OU6A 1S4QA 5M34A 3CURA 3W9UA 4ER0A 1ULZA 2HY7A 2XUHA 3KE9A 4RPIA 3BIXA 5C1BA 1RLTA 1TU0A 1YOBA 2OKGA 4U0KA 3B7WA 1ZONA 3OT1B 3IVCA 1D1PA 4GXTA 4CKWB 3PGKA 1IQUA 2PFGA 4DY4A 3ABRB 4K9KA 4M9QA 5JZSA 5A4MS 2AH5A 2WHPB 1R9MA 3ECCA 4JNKA 4PGFA 2I2DA 3X1YA 4ALJA 4AURA 1XCPA 1I2MA 2E37A 2O2EA 1RVV1 2YFHA 2JCBA 5FLXA 1YA8A 1TEZA 1XAIA 1IUKA 1ABEA 1TB4A 1UBMS 1UMDB 2FPOA 3FW1A 3K1JA 4HDKB 1QH8B 4KG7A 3D4BA 4LVNA 2W6JD 4HX5A 4QGHA 5TPWB 1KTIA 1I5EA 2OK8A 2RGNC 2JPDA 4Z4HA 2R66A 1EFLA 2H8KA 2OPHA 3UAVA 3HY4A 4TYQA 4PYRA 4AWXA 4RWZA 1GN8A 5GINE 1GCIA 1UPFA 4MYSA 3WJ1A 3ACDA 5JAIA 4FMBB 5F5LA 3AF1A 1P18A 2ZG6A 1VKRA 4HHEA 1G7SA 3ETHA 4KQJA 1JXAA 2L19A 4H17A 2JI7A 2RHOA 5CM9C 5HCNA 2HLHA 2VNJA 3NHPA 4M1EA 4NBVA 5E2BA 4ZJYA 1TUBA 3HJGA 3AEKA 3IT1A 1JEYA 1LPPA 2JLSA 4II7A 3ZN2A 4UCQA 2QPOA 1JPUA 3GEEA 1QH1A 4Y0VA 2CWWA 4BCBA 2RGUA 4J9VA 1VMKA 2RGYA 3OG9A 3CH4B 5IEJA 3TRDA 1G60A 1M6VA 2ZULA 4QRIA 1T8RA 2CB0A 2JJQA 3V8MA 2NV6A 1NYRA 5IDXA 1XYGA 5G40A 1V1MB 4UUPA 4EA9A 2O2GA 4R71A 4RD3A 1LSSA 4A2QA 1JEJA 1QDLB 2O05A 3INRA 4K5QA 3H3JA 4IDPA 3T7EA 1INLA 1JWLA 1V43A 2AMJA 2DUJA 1RKBA 1RZRA 4N12A 2XUJA 5FI3A 4MK4A 2X0KA 1K8RA 1C0IA 5FEUA 1BW9B 1K9VF 3FETA 1YE8A 1IEXA 2JZOA 3G79A 1YFZA 3KXKA 1I3KA 5KYKA 1X7ZA 3U13A 1MXFA 1ORRA 2JGFA 2QVGA 4H16A 5GM1A 5KEIA 2JKYA 2QU7A 4CDNA 3B6IA 1RWNA 3U16A 3GEMA 1AK1A 4F86A 1DAIA 5HGXA 1P73A 4GFDA 1JE1A 1MB2A 1V5EA 1M54A 3EPPA 3GLUA 3QA3E 1YCDA 2I4RA 1QK4A 3AKEA 5DFAA 4DFDA 1CS0A 3D1JA 5A2QA 3OOHA 1GG8A 1PJ3A 4B3CA 4P3PA 2YUTA 5G4KB 2OV8A 5KBYA 1QFJA 1YOVB 2AMVA 4KUHA 5A5VA 3CMCO 3PLAE 4GWLA 3VMFA 2QTWB 4GBJA 2Y1KA 4B32A 4PS0A 2Q1TA 5A7HA 1QIJA 3N2KA 2I4NA 3PDWA 3WHKA 1FNNA 4RHYA 2WW8A 3T61A 5FUMA 5DGDA 2WAYA 3W8DA 1PBTA 3ZTWA 1YCHA 2PANA 3I04M 4MQUA 2PZFA 1BRMA 3PP8A 3UJ3X 4BJ6A 1SVIA 5BWNA 4E6EA 1VC2A 1KYTA 2VCYA 1Q6ZA 5FT9A 1RC0A 3PTZA 1OR8A 2AC7A 4Q6BA 4Z4EA 1NXVA 1KP3A 2BMEA 2H1LA 2V7XA 1XZNA 2F9MA 5HGJA 4CHGA 1UJ6A 1JHYA 1O6GA 2P67A 3N3BC 1XDGA 1YKFA 1U04A 4K9LA 4BFWA 1ULHA 1ZJ5A 4N7RA 5JRZA 1J8QA 1LLQA 1MP0A 1H2FA 3QBVA 4O1IA 1PIWA 2B4TO 2IBSA 4IUBS 3D7LA 4YT2A 4ENUA 1A9SA 4EY5A 1F17A 2C4MA 3LBHA 1JMKC 4WRRA 3DR3A 3TLGA 3G0GA 4HADA 3K9FC 3B36A 3GDFA 4G4SP 4MUYA 2OV4A 3RS9A 3ZDDA 3QOFA 3ORRA 3LIPA 4TQ9A 3ZJ5A 3GCXA 1NG9A 1WF3A 1KORA 4QPZA 5IWCA 3WNVA 3MAGA 1UPAA 3FDJA 3F5MA 3L02A 1CUEA 4DKJA 3M8KA 2WSMA 2PT7A 3OQOA 2VP2A 4BV9A 1U8CB 2DHQA 1KEEA 2EQAA 3RSHA 4CDRA 2DGDA 1E1NA 5I4BA 4YP7A 3OF5A 3AEYA 5JXWA 4LOHA 1EP1B 3BTUA 2R6DA 5BV2P 3D54D 1IONA 2A0FA 1F20A 3IQZA 3LRXA 2ANBA 4MWDA 4RETA 4TSKA 1P2VA 1SU8A 4GXQA 3BWDD 3KHUA 1PJCA 1IHPA 1KU6A 5K2MA 1QPZA 5JNWA 3HA5A 3TZ6A 5IUJC 3EAFA 4L5CA 4MJ7A 3OURA 4XKJA 5JBQA 3AV3A 1CUVA 1UOEA 2WBLC 3L7IA 3RC1A 1H4SA 1W7AA 1K68A 1GTRA 3IXQA 3M33A 4ZT7A 3VR6D 2Q4BA 1B1AA 4JOSA 4PHGA 4RVGA 5H59A 3AHCA 5K1ZA 3PGMA 2R65A 1VL2A 1N3BA 4Q9AA 3X2EA 3PNLA 3K1AA 4PC7A 1RKQA 2JVIA 2QL7A 2GZRA 2R1VA 3GRAA 1USKA 1FFCA 3OIDA 3FDFA 5SYAA 4A0HA 3T1YB 3ONEA 1PZGA 1L4NA 3TOVA 4CLOB 2ETVA 4EY4A 2Z2ZA 3ESZA 3DEFA 2WU1A 2ZTUA 3KQTA 1O9HA 2IYXA 1U7UA 3N8HA 3G8BA 4QBTA 2CHFA 2GCGA 3DZHA 4FCWA 4AF6A 4MVJA 1UCFA 4ZP1A 5FWDA 2PX3A 2WT4A 3AQIA 1IHDA 4YREA 3WIDA 5A5GA 3DTYA 4TMTA 1NNEA 2NTJA 3L7YA 1NVEA 5BWLA 1ECFA 5DNWA 3GB9A 3RYHB 1GKLA 3EC1A 2A9RA 3R7WA 1PX2A 4ZV9A 3F8TA 4CKZA 2X0DA 4CCYA 1Z68A 2FW7A 3PEVA 5JR3A 4UM5A 3GL9A 3Q7EA 4LDNA 3RODA 1DOAA 1OWMA 3CV3A 3QEMB 3OO0A 3DBHA 2JH9A 1BXGB 1W59A 5THXA 3FMPB 1FP1D 4RK4A 4H0CA 1NJ2A 4FQ7A 4TOIA 4MQEB 4QOEA 1NQWA 2ABWA 2YRFA 3BFKA 1DP4A 5CLIA 1E9RA 1ZRNA 2HGSA 1U9IA 3MINB 4MAFA 3LT0A 3OC0A 4D74A 1SG9A 5IYZF 3T4PA 2QX9A 4ZMBA 3K0BA 1TQDA 3F5QA 5A6SA 4HDNA 2ID9A 3RUFA 1I2ZA 4BLVA 4X0EA 2FJUA 3LQ4A 4B31A 3RKUA 2DF8A 2K7ZA 3RNOA 1VFPA 1DAKA 1FFEA 1HM5A 2LKDA 1Q83A 2IYOA 1H42A 3IHWA 4MRNA 1RKVA 4PONA 2R4TA 4MPTA 4XUGB 5C81A 5CHYA 3RYCA 3H05A 1B41A 1L3BA 3BJMA 5I9LA 2WU3A 1Y6FA 1KRXA 3D1VA 5P21A 4QREA 5LKAA 3FTEA 4PSCA 4QM6A 5HQ3A 3PX3A 1WUKS 2ZAOA 1JIJA 3MD0A 5L51A 1K98A 1SY7A 2HYDA 2VNIA 4I9HA 2JBAA 1Q7RA 4QU9A 1L3CA 5CA1B 4HJXA 1H3NA 4MW2A 2WYWA 2XYQA 4BMDA 2CUZA 4MTLA 4ND4A 1QZUA 1GA6A 1GZ5A 3FMVA 1SVOA 4LAFA 3CCFA 4BE7B 1REQB 1OIXA 1TM1E 1VHDA 4L9WA 3V4VB 1EVKA 4PQGA 3E9YA 4D0LB 1SK9A 4R2KA 3DLHA 1OXTA 3BE6A 3OOWA 4FOSA 1Z6YA 1QMGA 4L8YA 1F7UA 5JCOA 2CLEB 2VP3A 3FWKA 3MM4A 4E14A 3ER9A 5GVRA 2MSEB 4C2BA 1Q7GA 1KO8A 3O3CA 4H3SA 4RLFA 3QSYA 4IIJF 2PKCA 8AT1A 1VRVA 1WXHA 4U3JA 2R47A 4DXHA 3K9NA 1K66A 4B47A 1X7YB 2AOUB 2Z2YA 5CPBA 2Y05A 1YDMA 4B2IA 1WHTA 4JB3A 1NNUA 3WA6A 3JPYA 5HCIA 4D42A 4DW8A 1JB9A 2OXIA 4FMCF 1R4NB 3WHLA 1KI9A 1GG9A 5K3FA 1VSTA 3VU9B 5KYYB 1C9NA 3B2EA 3OHPA 3LUAA 3HADA 2PX5A 5EVJA 5DM70 3C7TA 3LX4A 3F73A 2FQYA 2H7VA 5D01A 1RXVA 3BFXA 1U2GC 2PGJA 3AKYA 4K1XA 4PLCA 4LE2A 1CZUA 2C9YA 1O4WA 3ZE2B 3NOOA 4Z1OA 5BSUA 4I1VA 1TU3A 5KAMA 4AB1A 3KQOA 2IKQA 1XTSA 4MAAA 4P0QB 4PCUA 1LFAA 1LPAB 1IVYA 3NS7A 1MU0A 4BKUA 5I01A 2JVJA 2H9YA 4B8WA 1JA0A 1JQ3A 3BT7A 1X7WB 1AF7A 3NUQA 4TPKA 2P79A 1L4GA 3U0VA 4A10A 1CX9B 1I14A 1NP7A 1X9HA 8ATCA 3CF4G 3T5BA 3NGMA 4CNBA 4QG3A 1E5QA 4MWOA 4F97A 4J1TA 2ZT6A 2JAOA 1TC2A 3UB3A 4AS3A 1SBHA 4RDHA 4OHBA 1M1YE 4R8RA 2DFLA 2ZJ4A 1X0XA 1ICEA 3GT0A 3IBSA 4BY9E 3Q5DA 2PUBA 3HLTA 4QBKA 3MJCA 1I80A 1BE1A 3M9WA 1TEXA 4JSYA 1JSRA 1NBAA 4UC0A 2ZYGA 4NULA 1NF8A 3RIGA 1LWOA 1OIVA 2D2XA 3JQ8A 4OI2A 4UU0A 2IYTA 4Q6WA 2QRQA 3DT8A 3JAKB 3PA6A 4B6GA 4RTLA 1C1DB 4J03A 4HV4A 5AK6A 4IGKA 5KYWB 1KRHA 2X76A 3UCEA 2CLCX 3N5KA 1I4DD 2XQVA 5ALFA 1SUAA 1R6VA 1THGA 3EC7A 1MCZA 1OLSA 3M6XA 1RM3A 2IOYA 4X24A 4MJLA 1KKLA 3LDAA 5DK4A 5TRTA 9LDTA 3Q8LA 3LXXA 5EIBD 3PEEA 4PZEA 1VI5A 1CY4A 4KN9S 3CX8A 3P4YA 3V1TC 2AFHA 2DQ4A 2FAXA 2NZ2A 2X8JB 2CNKA 4I8IA 3RIXA 1PCXA 3RVKA 5BURA 1F8GA 2E5FA 3OQHA 5CAEA 5GTDA 3PDIB 2X4IA 3NUZA 4JWTA 3EIXA 4TXMA 3RVOA 5HOEA 2FNAA 2AOVA 5SZIA 1R5OA 3OTGA 3IAUA 4H1UA 4LJ9A 2BI8A 4JLWA 4PLVA 5LPNA 3DZFA 4DPMA 2QF7A 1PNVA 1Y3CE 1EFPB 1HDZA 1J5XA 4MPDA 1RYDA 1Y1TA 2XZPA 1DELA 3W90A 1G1MA 5TMPA 3AWDA 4GT1A 1W88B 2Q6VA 3LRPA 3K16A 1NM5A 4GI3A 1A3CA 3ASZA 4ZCPA 5K3OA 1XTTA 2YFQA 1WETA 4OQPA 5KVQA 1BQ4A 1OGIA 1XNHA 3BL6A 3H13A 4IIVA 4R3WA 4TTRA 3M49A 4EYQA 5IF9A 3ER6A 3AVPA 5I7WA 5U4QA 4U0JA 4PQEA 1KEUA 1R6BX 2D3TA 3K0CA 4GI1A 4Q3DA 4L4YA 3ESCA 1XTKA 4FSHA 1F7VA 1EP3B 2D13A 2D0DA 3M1YA 5JEDA 4IDGA 4IDBA 2IC5A 2ZSDA 3ZGYA 4AJ4A 4DUGD 1E3QA 1U0GA 1YJQA 3E22B 3VOTA 4HRXA 5K0GA 5G2OA 5L3QA 2JCGA 3ZDEA 4PO9A 2WT9A 2DLDA 2GZDA 1LBQA 2Z08A 5F2KA 3DAFA 1Q7CA 1ZIYA 1ECBA 3FLMA 1JFSA 1I6MA 3ML1A 2JGMA 4XYBA 3KHKA 4Q47A 4CTJA 1FIUA 2HJ9A 4AN1A 5KOYA 2ZSHA 4JSTA 4AY3A 1WDKA 3OOJA 1EUDB 2JAPA 3JZFA 3M6WA 3W9BA 4GMGA 4X71A 1VB5A 2GEKA 3SYRA 4UOQA 3WBBA 4R8MA 5EKUA 2A5YB 3C24A 5C8VA 2EZ8A 5I51A 1LNSA 1PEYA 3NVAA 2HHLA 5IAAA 5DYGA 2OEPA 5JFOA 3ABZA 3A1FA 3GYGA 1LZLA 3PCTA 4PNPA 3LY5A 4YQEA 3UPTA 3WV4A 1FW6A 1T3ZA 2V58A 4UM9B 4FYIA 3TUJC 2RI0A 2JW5A 2ONZA 1RPAA 5JD5A 1YFJA 4X00A 4R9RA 2EOAA 4J1TC 4LTNA 2A0YA 1MQSA 3EXG2 3I23A 3W3AA 1TM2A 4D8XA 2P4EA 4PEVA 3GLIA 3B9PA 3G82C 1DG1G 3EX7C 1DC8A 1P75A 1OLOA 1SELA 3LMKA 1M1UA 1AUXA 3ZQ6A 2C0PA 3LOQA 3MT7A 1M7GA 1V4NA 1VLMA 2OCKA 2WSSD 1E5LA 4BU1A 4ZCIA 1G41A 3U4MA 2C9DA 1ENYA 2Z83A 4IYJA 3USES 1Y37A 4JOBA 3UXEA 4ENTA 2G88A 2H1SA 4NOKA 3D7SA 4B6EA 3JSAA 2X86A 3ZLJA 1AGPA 4UJ5A 4LSGA 4RVSA 3V55A 1FNDA 2HIAA 2GYVA 2LPMA 2QLJA 2XMPA 1FS6A 4ED9A 1QGED 3BCUA 3L0BA 4KLZA 3PVCA 1JXQA 4YR9A 5PGMA 1YE3A 4ISCA 3TL2A 5IF3A 4MR9B 3REGA 3KU1A 2WUWE 4EF6A 1Q3TA 1GOTA 3PC7A 4HPJB 2PKQP 3GELA 4C0WA 3HXOA 4R8KA 2OQRA 1XOIA 1ZRSA 3R3SA 2J6CA 3F6RA 4N47A 3RI3A 4QSMA 1HGXA 3L1HA 3WZLA 3MTAA 2W6ID 5FA5A 5ITWA 3UOGA 4QPCA 3BORA 3NUGA 4LCBA 3RT1A 4B79A 5I7SA 5IU6A 2NZ8A 3IIJA 3OZSA 1ZJZA 4RS4A 3C5HA 2IW1A 1EUYA 1UK9A 3WL7A 1YI8A 2PZEA 3EGWA 4H1TA 3NC4A 3DDZX 1G4UR 3A6KA 4RVHA 4I14A 1L5QA 3FN4A 5F1YA 5IJWA 1JAZA 2CSUA 1NKVA 3BH0A 4D4JA 2DPHA 4JBGA 5IASA 3U3MA 1NRJB 1US8B 1C3VA 1ZBDA 3G7NA 2PX8A 1NM5C 4AKEA 5DIFA 3SZMA 4LSZA 4MQLA 1EWRA 1WMBA 3RK1A 3R3WA 4AZVA 5A9SA 4Z4CA 1CD5A 3AF0A 1L8LA 1R8YA 3QE0A 4XX0A 3PNSA 5CVEA 5EQJB 4EWLA 3K0CC 1LRJA 1MG5A 1XRQA 2PLRA 4Q03A 3M4NA 1U63A 3ADPA 4XD7A 1QS0A 1GTL1 1MX1A 4PPFA 3O8NA 2DHDA 2PRKA 3KEOA 2D54A 3O1IC 1QM5A 1QQAA 1OJLA 3CUYA 5AKHA 2QUBA 1S8NA 3T5GA 1VCOA 2OCAA 2XOKD 3E9EA 5GONB 2EDCA 1R66A 4GMFA 3W1EA 2IA5A 2I6FA 1FOEB 2BF4A 4L4ZA 1NW8A 2D6FA 1IFXA 1HFJA 2VAVA 2ZE6A 3N2NA 4HB3A 4ER7A 1IJBA 2HRCA 3KT6A 4BLQA 2CFSA 3SQMA 3BDAA 4BS9A 1EWVA 3BC1A 3G8AA 3UJBA 1GU0A 2ASEA 4CM8A 4D9IA 1NWHA 3DDUA 1WXDA 1U0RA 4P5EA 3JQ9A 3AR7A 4RD6A 1RPJA 1DTWA 1OQAA 2VSYA 3S2YA 4RZHA 2VHCA 1NUQA 4RK6A 2R2GA 3FHOA 1OFHA 1S3SA 1Y9JA 3OFNA 4PLWA 4KB5A 4TXLA 3VTFA 1DQNA 2OCDA 3C3AA 5L7WA 2ZM5A 3CB4A 4ARCA 4PS1A 3OM8A 3ZOZA 2JEZA 3O4HA 1J39A 1XD2B 3D7RA 2HA6A 4H4CA 1JXOA 3FSRA 4NBNA 4WT7A 4Q82A 4QXQA 1VLZA 1W2HA 2QYOA 1ZD8A 3GZNB 5E9JA 2VAMA 4LXHA 5F5NA 1M0WA 3UF0A 4C22A 1ZOIA 4DMLA 1FNBA 3EISA 1W36D 1QONA 2ON6A 3D31A 1N8NA 3FTDA 2O1EA 5AW1A 3O8QA 1JJ7A 4Q4CA 4B7XA 1N1EA 3CY6A 4E51A 1FRQA 4P80A 1E3WA 1R5NA 3H5NA 2AVNA 1ODSA 5AW4A 2BFBB 2ECPA 3ZDRA 1KAHA 3LGAA 1NC3A 4UPEA 3G2PA 5KYTA 3CEMA 1O4VA 2R86A 4XI9A 2CNOA 1UBEA 3HZHA 2GILA 4OYHA 1W94A 4U5XA 4L4RA 3VR4A 4D3FA 5LYJA 1GU1A 1TA4A 2HSEA 3GGGA 4M7RA 4Z0NA 5BVHA 3HZZA 3CXRA 4IVQA 3HYTA 5L4NA 2NZUG 2FCRA 1KC3A 3JAWA 4X1KB 4F45A 2VP9A 2I6QA 4II2A 3JD4A 4GKAA 3DUFB 3ZHRA 2IY9A 2E5WA 3LC0A 1P0IA 3C3KA 1UUFA 2ZFUA 1AKVA 1Q91A 3LP5A 3N59A 4V0ME 3HSYA 2EWMA 3L0OA 4NZPA 2QX4A 1KP9A 1QPGA 5FXMA 1H1DA 2GF9A 2XKKA 4KXWA 1EZ4A 4EF4A 2J67A 4B80A 4D56A 1C9JA 4UOZA 3ET5A 1E3LA 3VDMA 2WWYA 2VJQA 4GKKB 2I4TA 3ZJTA 5AICA 3KXPA 2A9JA 2Z0MA 2WJ4A 4PYKA 5JADA 3T1TA 4DLWA 2J6IA 2X5KO 4PYIA 1RI2A 4IDFA 2Q3FA 2MSNA 3AESA 4BE4A 4BU0A 4ZDIA 4FGWA 3BMOB 4M9CA 4RXUA 4YCDA 1P72A 4XGIA 2G8NA 1DKUA 2B8NA 1ODTC 1KI8A 3FR7A 4JJFA 4NU5A 1XHLA 5C3MA 1GTSA 1XL1A 1L1EA 1KY5A 4A1FA 3KJZA 3GRFA 3KRTA 4YV1A 3G9ZA 3G8YA 1P3DA 1CQIB 1YJCA 2JRCA 5JNRA 1ZR4A 5IJ9A 4YAUA 1NW9B 5JEEA 5UKDA 5FQOA 1A77A 3VNQA 3ZGZA 2QY9A 1UBCA 3ORQA 1BOFA 2QJFA 1SG6A 2J3DA 4MXDA 1SC6A 2PLNA 3TRJA 1GEGA 2GERA 2WPNA 3A3YA 3KAPA 3VC2A 4B2YA 1NBOA 5KNBH 1DADA 3HCAA 3GP8A 1LK5A 3WDKA 2UVDA 2IEAA 2EV9A 1ZK2A 1UFQA 3S6JA 3H7AA 1G5FA 1ZAKA 2Y2VA 2C2XA 1HDGO 2E89A 3TQFA 5L6MB 2GHIA 2NM0A 4B85A 2QLNA 4AZWA 4Q4LA 4QOSA 4AJKA 2Z5LA 1X39A 1Y89A 4P4NA 2WSBA 3ADBA 1JQJC 2IWHA 4RJLA 3X2FA 5E7QA 3RC3A 1Q0LA 4RMGA 1GARA 1ULBA 2GXUA 2OZVA 4ATNA 1QVZA 2HZ7A 2QQ5A 1BXKA 2EIHA 2HADA 1N2BA 2Z3ZA 3ZX5A 1IQ0A 1D2AA 1EVJA 4YRZA 5JVDA 2B6NA 2VK2A 4DBLC 5LZ4A 2WMNB 3UYKA 2D0OB 2X77A 1KMNA 4X3OA 3C4JA 2RMKA 1JFFB 3W4IA 4K9NA 2I76A 4ALKA 2UUPA 3AL3A 5KHOC 2VQDA 2B5WA 1VPLA 2PV7A 1ADGA 3VI3B 1E9DA 3DSRA 4JBLA 1J8DA 5DBFA 4S35A 1PUXA 4MS4A 1GU7A 4W8OA 1L7RA 2B4QA 2LR0A 4IUCS 2WICA 4B73A 3OETA 4LOLA 3B2QA 3KVRA 4GZMA 3STXA 1PJBA 4WV3A 4AMGA 2XUAA 4CHTA 5AVRA 4S1VA 2VUUA 4PGGA 5JHGB 2EKPA 3PUXA 2TMKA 3VU8A 5I3ZA 4DR1B 3IDQA 1C14A 5BMVB 2J5QA 3ETCA 3QH4A 4CQNA 2H17A 2OO5A 3G5LA 5IVKA 3RK0A 1EK6A 1G17A 1IBCA 4G1FA 1F51E 2YW9A 4FCCA 5AHWA 2QY6A 5B1IA 1CRWG 4XTRA 3RUCA 4AXXA 5F98A 3FNEA 2AMFA 1DWUA 1Y3FE 1X1RA 2IOFA 3GWZA 1G0NA 5ICMA 4M86A 3CW2A 3A6ZA 4HKTA 1D09A 2IBMA 3FOZA 4XPIB 1VKZA 3BJZA 2BR3A 4B84A 2VZ0A 5FF9A 4E2WA 2D2IA 4MROA 3H9BA 3TSCA 4X20A 1MFPA 2IIPA 1V48A 2ESRA 3KCQA 3MRVA 4IHJB 4WTOA 3TI7A 4EHJA 4DV3B 4RD0A 1GR0A 2O2SA 4NFYA 4D9GA 1UBGA 4EVSA 5DB4A 3ORHA 4XYEA 4EPWA 4W1PA 4FHDA 4YP9A 1FDWA 2O5VA 3M9XA 1RAGA 3GGDA 3H0EA 4O5OA 3ELUA 4YQYA 4DR4B 3UFBA 1WB9A 5F9HA 4W9RA 3IT3A 4IXMA 2JHPA 3S3TA 2C4NA 3D7MA 1IC6A 2FPGA 3EGIA 3H9JA 3LXRA 5D85A 1Z75A 1EK5A 4LZZA 5EIOA 1XAGA 3I1FA 3E7XA 3CNBA 3EXIA 1ZO8A 3RJTA 3TW0A 5I9NA 4Q21A 3VISA 4RL4A 4YAKA 4YAEA 2A35A 3BTOA 4QJ4A 1HG0A 1U2SA 1YRAA 2X8AA 5KQGA 2QVXX 5ITSA 3TPCA 2XGSA 2B0JA 2AFIE 2F1IA 3CS3A 4BIIA 1JSZA 3C7AA 3U56A 4BNXA 5HJ5A 1VJ5A 5AR1A 1K6JA 4EI2A 4D26A 4L0QA 2Q8NA 1FDRA 2X3UA 2CZQA 1S3FA 1TZMA 2I55A 3HR7A 3OLZA 4P4UA 2GCIA 1AQLA 3NOXA 1N36B 5JSKA 1TOAA 2DY0A 5J58A 2PZBA 4YIHA 2J85A 1AXGA 3PC2A 5D3MB 3CNEA 1AKRA 2XVAA 4YJHA 2JJMA 2IV2X 1NASA 5B1SA 2YZ7A 4J0EA 4I1YA 4LRXA 1JDBC 1NBMA 4EJFA 5K0EA 7MHTA 3A9SA 2YX1A 4BMOB 1SVMA 1NVWQ 1IAQA 4TMYA 1GRCA 2Z58A 2Y0CA 5CA0F 4C4AA 2W6OA 1SKAA 4RC9A 2D5BA 4E2ZA 4QIHA 3CF2A 5G3YA 3DVRX 3W5AA 3LHIA 2QGZA 2AKYA 1GG5A 1R50A 4C4SA 1TVCA 1PQYA 4QELA 3PC3A 5GGYA 5JC8A 3L6RA 3G89A 4N82A 1J21A 1JVSA 1T4GA 1W4LA 1XXHB 5DOZA 1TZKA 2QIPA 4FX2A 4M1ZA 3CTMA 1VG9B 1NRWA 1DAMA 2A1UB 4YRTA 4ZVVA 3OT1A 1W4CA 3WIBA 5IKXA 1VBNA 2PV0A 4CKWA 2VYCA 3HKDB 4GOND 3SXUA 4ESEA 3UT6A 1GFSA 3QF7A 3L5OA 1OC2A 2WIBA 2XKJE 4FMDF 4PHCA 4X63A 2CDAA 2WHPA 3GNSA 4C20A 1JGTA 1I4LD 2R97A 4IZ6A 4P7JA 1PX0A 2WQ6A 2PDAA 2XBMA 1VJ1A 3W79A 1JSXA 2NPOA 3IQDB 4KFTA 1UMDA 1SKYE 2C94A 4MUHA 4HDKA 2BJVA 1QH8A 4ND2A 1SVSA 1Z0DA 3ZCQA 2IZ6A 5TPWA 3K05A 3RO7A 1YBAA 3T0IA 1ONNA 4S1PA 1ONSA 2WNSA 3H2ZA 3MRXA 3NTRA 3ES9A 3QYPA 3B6MA 2QLMA 1GY8A 2CLHB 2RHHA 4QFDA 1O03A 2OO5C 4IYRA 3V8NA 3AGPA 1KI7A 2OXEA 1K8XB 5BN3B 1ZSVA 2JCXA 4R6XA 4OBWA 1RYBA 1O96B 1TUEA 2ZUUA 2AL7A 3AF5A 3JWEA 3NHWA 4Q9LA 4D8WA 4RZSA 5FI5A 2PL3A 3A1UA 4LWZA 4ND5A 4ZODA 5CVJA 3G1UA 2GO7A 4ZRDA 3SSOA 5J47A 2D4HA 1YMVA 4KMSA 2PJZA 3DFIA 3RE1A 1XCJA 1BG6A 2D00A 1PK9A 1P8JA 2PT9A 1IXZA 2PWPA 4G9EA 5BR1A 1IK6A 1MQAA 4LFCB 3QFFA 1VG8A 2YJGA 1BC5A 3HH8A 4NU6A 1C2TA 1L5RA 4NHOA 4NOMA 1PR4A 3PWSA 1ULTA 2BKEA 3JQ6A 1OXKB 1E1LA 2QI9F 2ZIVB 3MHPA 3WADA 4IP0A 4GGMX 5BSWA 1V1MA 1PFWA 2A0UA 2K87A 1RP7A 3N39C 3Q87B 5FLEX 3ADCA 3L77A 4GYJA 4HAXA 4ZU6X 1BQEA 3GUUA 3QBJA 2ZSUA 3BIFA 3LL7A 1E92A 3OPQA 3MJRA 1FTWA 1HWYA 4RKRA 4DA7A 4CXMA 2IIQA 1E8NA 4JYZA 4U63A 1C9YA 2HPVA 1BW9A 2VPQA 1NT2A 1PGOA 2FSUA 2WP8J 1IZ7A 4HQ6A 1MO3A 2V7EA 2B8WA 4YRLA 4EG0A 2YOHA 3WLQA 4RTSA 3ZVMA 1XQVA 3SZUA 2XUGA 4ZXPA 6GPBA 5I5EA 4TMXA 4JITA 2QTHA 2IXBA 3QITA 2WKQA 5F3RA 3EVGA 3KBBA 2YWJA 1HZZA 1Z36A 4YMUA 8ABPA 1UBTS 1XDDA 1TA0A 3I2HA 4KR9A 1U1CA 2AFVA 2ATXA 2A86A 5J4KA 2NO6A 3EVCA 1TX4B 3ENWA 4ND1A 4LJRA 3HUUA 3ND7A 5DCUA 3TFOA 3DH0A 3MOGA 2ZXFA 4G86A 1F3OA 4IWNA 4JNCA 5LXTF 4CLDA 2IZ7A 1ENPA 3IXMA 4EYEA 4DEXA 4UTRA 5KWVA 4HH0A 4WX2B 4ZCSA 3U7JA 1XLTC 2V6FA 4EM6A 2X9GA 3Q9SA 5FV7A 2BTEA 1N77A 4ZKEA 3UWKA 1XBTA 2EGGA 3QNWA 4EUKA 4CV0A 1YOVA 2DSNA 4BVLA 3I62A 2H07A 4UUQA 2W58A 1B42A 2RCNA 1U0SY 2ZVJA 1RRGA 3Q8XB 2P75A 2EZUA 3DB2A 1JZTA 4UU7A 1EKXA 1MC5A 2F59A 2Z2KA 3M4YA 1OREA 2GNAA 2PJDA 1NATA 1QPBA 2OC9A 3KKLA 4UUOA 5GGXA 3UKOA 1D6MA 1U90A 3RFUA 2RHTA 5BWOA 2EFGA 2PG3A 2FDRA 1NN5A 5FB3A 5BQFA 2CLFB 2RGEA 2HUPA 3OCVA 1XXLA 5TS2A 1XI2A 2QD1A 4XWAA 4NCHA 1JG6A 4J0CA 4K9QA 1VG0B 3K9GA 3QFSA 4Z9FA 5DM60 1DJQA 5EY5B 4WOPA 3IBFA 1XU7A 3ROKA 1U3CA 3VTZA 4ENQA 1O0CA 1OVMA 4QHTA 5AFSA 4D80A 2JIPA 3FTNA 1WEHA 4HRVA 1YZNA 2WF5A 5F3DA 3TQCA 4HDQB 3JD0A 3JWGA 5AQEA 1E89A 1A7AA 2I4OA 4I3FA 5YASA 4DG8A 5I3CA 2BM0A 4TZ6A 2ALJA 2ZYSA 3PRKE 1R3UA 5ICCA 1WB4A 2BVNA 1IATA 1JWAB 4WVLA 3ZS8A 1JDSA 3N2IA 5JNUA 4XJSA 5H02A 1JAHA 2QWXA 3R9KA 3KB6A 1ZHOA 5DTMA 2M6RA 2WJVA 3WGYA 4YK7A 5ICFA 2HZBA 3NGXA 1AS0A 2H5EA 1H9BA 3AB8A 2F8LA 4LBZA 2RK6A 2HO5A 2HNKA 2JBWA 4E11A 5JBNA 3CC8A 3QK7A 3OEWA 4RHTA 1VBFA 5AK5A 3SX4A 5EI5A 4BO1A 3WYEA 3L0CA 1I3NA 4UNIA 4YMHA 4Y9SA 4IHKA 4X1OA 3KETA 1V25A 3IOMA 1P1FA 3NBZC 2GUWA 2JI6A 3O75A 4E4YA 1WIWA 2FFHA 4N49A 2QQGA 1F5SA 1P5FA 2AI2A 2IRWA 3L4BC 1A8UA 5FAKA 2LGJA 2F8SA 1NLMA 3WJ7A 1MQ9A 3RB8A 3QVLA 3ZBPA 5B4VA 2GKSA 2CUTA 1Q19A 3E2MA 1E5DA 1I7NA 4DNPA 4OJQA 3EXHB 4E1VA 1KC1A 4IJ6A 2LZ0A 4KWHA 4NYMR 4Y9RA 1IY8A 4XSHA 3PYLA 4HG2A 1UP4A 2QRNA 5GQSA 3GGOA 1I7SB 4XW2A 5FTWA 3VOAA 4P81A 2XTNA 5A3RA 4DLZA 1T6ZA 1Y4UA 2YN0A 3PE3A 2PH1A 3RAJA 4G3XA 2C88A 2NTVA 3DZDA 5EEGA 3VR2D 1K6IA 3VTKA 4EAQA 4CF7A 1L5FA 1E7WA 2X19A 3UANA 4IXDA 4CR8A 4DKXA 2FVXA 3Q7TA 3VZBA 3WLSA 4YY3B 3NTLA 4W9MC 4NYMQ 2VLBA 1BU5A 3BVPA 4PPQA 4EH1A 4OREX 2Q07A 1I1HA 2A6PA 4RLHA 1PEKE 1KQGA 2K7FA 2OHVA 4EABA 4FB4A 1W5EA 5BSGA 4N40A 1J7JA 3QV1A 4BO4A 3OM0A 5DW3A 3THRA 2JAQA 4F5EA 2C92A 4FK8A 1W19A 3FDZB 4GF5A 5IJXA 1HE1C 4Y2XA 1ML3A 1GZVA 1WBJB 5EXEA 1J9ZA 1OFIA 2ATCA 2HRQA 2PCLA 4RIFA 5FJIA 4S3MA 3HKCB 5KAPA 4K6OA 3RYHA 1KZGB 2RG1A 1SPXA 3ZDZB 4ZI7F 4IJWA 1NMZA 1M2KA 3JWHA 2GJ9A 1MLDA 3CVXA 1NQOA 3QEMA 3H16A 1DKRA 3AM1A 1BXGA 1G21E 3H1FA 5K8TA 5CJJA 2G17A 3QY0A 2A4MA 2QJRA 2XV1A 4MQEA 1H2ZA 2CW5A 1CHDA 5DCYA 2V9ZA 3I05A 3SC4A 1Y9ZA 1H05A 3K5HA 3MINA 2P78A 1ADYA 1WMDA 1GUDA 4MVJM 1CUAA 3RUEA 5BV1A 4JHLA 1WDMA 5JJ5A 1QYRA 2HQOA 3PPVA 2YWCA 3F67A 1E2MA 4UE6A 4L7VA 1D1TA 2J4CA 1H5NA 3B5JA 4L5IA 4G0PA 3RRZA 1MAAA 2PD3A 5KPJA 1ZIDA 2QAGB 4TZKA 4YNBA 4OXRA 1PKEA 4IDNA 1YL6A 2R9VA 3R9XA 2QNIA 4ZEOA 1Z45A 2VSXA 3W3AD 2P4UA 2SKCA 2G36A 2YIDA 3EMVA 3PJEA 3S27A 3VGJA 2NO4A 2ZE5A 1THMA 4EY6A 1CUGA 1ZCZA 4EDFA 2B7CA 4ZYTA 4Z0PA 1XLVA 1QP0A 1JECA 1OXSC 1SXJD 4LGYA 3L0PA 4DNXA 1RI5A 1KVQA 4IHAA 5D2CA 4GIBA 1N6HA 4CWAA 4LKOA 4MDEA 4FGUA 3SS8A 4YX9A 3K96A 2HHJA 2IEZA 4XB6B 3I58A 5D87A 1RQ2A 5CA1A 1V9SA 2GT1A 2AMYA 3KLNA 5A0FA 1Z35A 1QYVA 2BMDA 3DKKA 4TVOA 4URUR 1UC4B 3ND9A 5FPPA 3B7GA 2P9FA 1K6XA 1REQA 2NVWA 1D5CA 1ONPA 2VH5R 3L9WA 5DJ5A 2O3TA 1SIUA 2PFSA 1Z6QA 2WJJA 2JF0A 4A5SA 2JJ2D 2FSGA 2QMQA 4PSAA 4TLEA 1DCFA 1NW5A 3UXHA 4U00A 3OLQA 4R6WA 2RGDA 3HN6A 1UZAA 5DGTA 1TMKA 5IT4A 3KR1A 1YR3A 4N0EA 4RORA 1I51A 2WNHA 3AY7A 3WL8A 3KL4A 3PFWO 2J07A 4KXUA 1XRPA 1ZLXA 4QPJC 1XD9A 5GOTA 4RQBA 1JTFA 1V1RB 5EN4A 4J0JA 2J46A 2PEZA 4YJDA 5HZMA 3BCHA 2P68A 5TY0A 2AOUA 1X7YA 2VDLB 3OESA 2R4QA 4EJ0A 3OKAA 1PR5A 1C7EA 5C7IO 1CEEA 1S2NA 2OORA 1KH2A 4INJA 1CTQA 5TF0A 3ESBA 4UAJA 4MGHA 3CVUA 3U81A 2F55A 4CG3A 3OM1A 5A4DA 1R4NA 3D7NA 1T1EA 1SHLA 3IB3A 5CHEA 1XV5A 3RJ5A 2J9XB 1OX4B 3VU9A 4PXAA 5KYYA 4DT1B 2Q7XA 2VK8A 4K6FA 3BICA 2P1DA 4R16A 4HYEA 4DRZA 1U3GA 3C3BA 4JL6A 1W4AA 4RL6A 5AI0A 5GIPE 3AP3A 1PFGA 3DE3X 3DV9A 5DV9A 4Q4AB 5T5QA 5TT1A 4LE1A 4EYSA 2QV7A 1QYCA 1KF0A 2N9UA 1TM3E 1CJVC 3OFSA 4F9EA 4TQGA 4NJOA 4G0YA 2ZUTA 4P5DA 1O95C 3C1TA 4PGMA 5A7GA 4J43A 2CSXA 1X7WA 3ITDA 5AK0A 4BLOA 2ZRIA 2DG2A 5TMDA 3IQEA 4I08A 3UHFA 1PL0A 4IMIB 2I1QA 1W85B 4HNGA 3K9WA 3RHTA 1KZ4A 2XNKA 2I2BA 1B3BA 2VRCA 1HKHA 3TF5A 1NVXQ 3RGWS 4WE3A 5E4JA 1YJ5A 4MVXA 2OFXA 4BJ1A 1OZGA 2Z4TA 4OQYA 3AOGA 1JQEA 3HA2A 1J0XO 1M76A 2Y67A 1JHRA 3UWDA 4NL4H 1SU4A 3ENKA 4QEZA 1ISSA 3F4KA 2MINB 1EXDA 2X5JO 1PLLA 1T1GA 1Z7GA 1B6GA 1OHHD 2VUIB 4D3ZA 1MV8A 1OZAA 3JQPA 1XAHA 4RABA 4DDWA 3JAKA 2QLBA 5DYWA 3DYBA 1YQEA 1UODA 1B14A 1C1DA 3FE2A 3JQBA 1KEPA 1QHFA 2Y1EA 1NN0A 3FWYA 1L5KA 4RAOA 2QG4A 3O2QB 1C4KA 1WS6A 2PH5A 1B8PA 4KMMA 2O5EA 1NUAA 2GK6A 1VG1A 3I9FA 4OYYA 3WRXA 2F17A 4X61A 5IBRA 1TJNA 2FSHA 1TAHA 4LJSA 1IOWA 1P74A 2O3QA 2EEPA 2A1TS 5GJVC 2ZBVA 4CGYA 5DLYA 2Y1GA 3OUUA 5DX0A 5DULA 3FPHA 4E5NA 2X8JA 3PA8A 3AI3A 4DHEA 3LPNA 4PG4A 2VO1A 1ZOOA 4MGEA 3AH8A 3PDIA 4DLRA 2UZ1B 3AHJA 3Q3VA 3I53A 3NV9A 2VG8A 4MJ3A 3FM9A 5DW0A 4DHWA 4LISA 3PQ2A 3H5TA 1Q21A 4QWWA 3SM3A 4XTCS 1TZBA 3I2YX 5KO2A 1Q0ZA 3AY6A 4J07A 4A2PA 2GEFA 1KO4A 1ODLA 5AJYA 3VR4D 2EW2A 4KQKA 1EFVB 1SKQA 4GX2A 5DHAA 4AP5A 1GVHA 4JXXA 2V3CC 5DRYA 1PEDA 2UYHA 1W88A 3LFTA 1IRXA 1Z13A 2FRXA 4HGNA 2Q5QA 3D3WB 3I3SR 4G1BA 5DIZA 1PV4A 4B3FX 2P6NA 4KXVA 1IN5A 4AKGA 3BZUA 1YK0A 4KYIB 3G1TA 2BCJQ 4IIHA 4P2GA 4TS1A 5ICEA 3VVLA 3Q98A 1BEZA 4NU8X 4WKCA 2BR5A 3FFXA 1VE3A 1Z4MA 4CG0A 1YCGA 3A3OA 2H57A 1ITZA 3L04A 1BHJA 1SHTX 2Q50A 4OO3A 3JYHA 4JU9A 3WIVA 3DL0A 5LFAA 3KOUA 1RADA 2RB5A 2NXCA 3SHFA 1H8HD 1P7WA 3R5TA 4CLHA 4IJMA 5DHTA 1JYSA 1UKZA 1SVLA 5DYYA 4LV6A 1RXSA 3KTAB 3E22A 3BDVA 3GMSA 4Q9NA 5FBLB 4PYJA 5CBKA 3QUBA 2OORC 3IV6A 3MJTA 1EG2A 3FPJA 3I12A 2F67A 3C3JA 2WU8A 4FYKA 4HNRA 3SCZA 3SEQA 3ZR4B 4ZIRB 3DOCA 1J49A 4I9FA 2YASA 1T6BY 4YYZA 4ZT2A 1J00A 2DHRA 2HF7A 3RUPA 4LGCA 4L02A 3VZSA 3QA9A 3WWOA 1GNTA 4TRNA 2BEJA 2J8ZA 5CH3A 3O95A 1KOGA 4OQLA 3D0KA 4EY8A 1EUDA 4MVJF 5CB4B 4RM3A 1X9GA 4HDMB 3GJ8A 2EF0A 2C0QA 5ER6A 3FGPA 2QXYA 2VC2B 3HWWA 1AS3A 2AJ8A 4FQ8A 1U65A 4G0ZA 4I8DA 5HRCA 1ZKMA 3Q72A 5JXIA 4V1CB 2A33A 5JQWA 1ABBA 4X7PA 1SPBS 4DB4A 2VYND 1UBHS 1NAHA 1QO0D 4Z1MA 4KX3A 5FV4A 3NHKA 2GAFA 2H2IA 3JQQA 4JK3A 2PWAA 4D7AA 2PSDA 4WY8A 1M2EA 5CDFA 4A1OA 4RZXA 3EEFA 2O52A 3PDUA 4I1IA 3L43A 4L9SA 3WLOA 5ALWA 1IH8A 1UKBA 2XE4A 3FYSA 4MMYB 1GM5A 3K0AB 1NBEA 5AW0A 3MRTA 3ETDA 4CQLB 5ALEA 3C3WA 4EG8A 4M8NE 4KQIA 4P34A 2ZBFA 5EXDA 4DAEA 3ZOKA 2V1XA 4ZAGA 2DQZA 1HTBA 1PDOA 2QW8A 2IVZA 2NZXA 2XMDA 4FLMA 4K6CA 5HFNA 5AESA 5MHTA 1YL5A 1FY2A 2X8WA 3TGWA 3K9HA 5IANA 5K99A 3L9XA 5KKNB 5FYDA 4UOEA 1OX5A 3T3EA 5CDUA 1QE3A 4ZT6A 3SR0A 5KIAA 1ADJA 3JQBC 2OLJA 3QKIA 1QC5B 3WZMA 1E6KA 2YJ5A 2O2ZA 1SD1A 5LQKA 3LZCA 4WESB 3RRYA 1GFIA 2WLSA 4DGQA 5JI2E 1EINA 1OKKA 2Q1WA 1CSEE 1YZTA 4MR9A 3I01A 5ECWA 5HRAA 4LX0A 4TTSA 3O2NA 1JLHA 1TQ6A 2QENA 3NIBA 3DZGA 4UD2A 5FPQA 2B37A 4B7UA 2AEJA 5G0TA 1B0UA 5HVNA 1N6KA 3INTA 1E6EA 4J0GA 4M1KA 1P29A 4OHFA 5EIFA 3I1IA 1FTYA 4O6VA 4UCFA 4IOMA 4S1TA 3PRHA 2DT8A 3R3UA 1G5PA 2C4UA 4N48A 1YD7A 5IAGA 3Q10A 4WKPA 3UB4A 3ZW8A 4MA5A 3AUFA 2IDMA 1G291 3DOOA 3LCJA 2VYFA 4ZQCB 1WCWA 3ZY5A 1LX7A 5CVCA 1Z2OX 3AUJB 2R7LA 1CQWA 2C5EA 3DULA 4RTPA 4B3GA 2BFFB 2HDWA 4W5JA 3MTGA 1US8A 3GPDG 5H83A 1FSPA 3LT2A 3O2JA 1LF0A 2YYZA 1ZW6A 2J0UB 3QOWA 4MKZA 4X95A 4NOJA 1Y3BE 1QG6A 2CL6X 3OEED 2WMDA 3OVMA 4W5OA 3ANXA 4WK2B 4M54A 5IZ4A 4HGPA 3U7HB 1W2WB 1N0WA 2DTXA 3HY6A 4W7HA 4I1SA 3S2GA 1QSGA 4FCVA 3BZWA 5KTNA 3IP3A 3SYNA 2R1ZA 4LK3A 2HIHA 1PQWA 5FNVB 2ZI6A 5KMGB 2DUUA 5BQPA 1JVBA 4MH0R 1SULA 3ZY3A 3EXEB 2B1GA 2CXHA 1ZI9A 2JZNA 2ZANA 3CM0A 3FCYA 3GDGA 2EYUA 4FS8A 5ECYA 3W9SA 4MKXA 2OCXA 4ID9A 4BVJA 1FLVA 3RS7A 4NH0A 3ER8A 4HFMA 1P3JA 2RK3A 1DNPA 1CUCA 2ZT7A 4EG6A 3MWKA 1QOZA 4J8PA 3OQ1A 4O3FA 4DPKA 1BOOA 2D0IA 1E77A 3VNSA 2B8EA 3EG9B 4Z86A 3WGZA 4IY1A 1AQJA 4RUKA 3O4GA 4GQBA 2W0MA 4JN6B 4J3NA 4KYTA 4OHOA 4DBZA 3AINA 4ZU1X 3E8XA 1NLZA 1SK8A 1JKFA 4H2DA 4JAVC 3ZZ0A 1GVNB 2V4ZA 3JZAA 5FNZA 1CEQA 1G20E 2UYOA 1NNI1 1E1KA 1D9XA 3MRSA 4YONB 3FB1A 4H9GA 2Y4OA 1BVRA 4G36A 1D8AA 2XQGA 4G84A 3M6UA 1FVFA 1XWIA 2W71A 4YRMA 3WLTA 2C7QA 2VYVA 2PJUA 2VHEA 1XD2A 3A7EA 4E3ZA 4OI0A 5BSVA 1NBMD 4Z51A 3GZNA 1SA0B 4X97A 4XRRA 4CG1A 4Y2TA 1E2BA 1L9XA 4G65A 3U7EB 3V4FA 1CJBA 1RQRA 3FJOA 2AN5A 2VCEA 3LPCA 1ZKDA 5JARA 1L7NA 2D3WA 1NYLA 3EB9A 2SNIE 5DP2A 4PYMA 2BFBA 1ESZA 3DQPA 3CH5A 5LL6P 4V0OA 4PSUA 1X3LA 1IOVA 3HRIA 1MOQA 3MXOA 4RNCA 5G02A 3U7IA 2ONKA 1DX4A 1ELOA 3P0EA 4NBKA 2FZEA 4PNEA 2YHBA 1V26A 4JCOA 4QAQA 4X41A 2DFKB 3NFYA 4ILKA 3SQWA 1LCIA 2O9JA 1KERA 4G4GA 3WYFA 4CEHB 4W6QA 1SCNE 1ZGJA 2C8VA 3L4KA 5KI6A 3KM0A 1M8JA 4CDMA 4X1KA 3W5SA 4F12A 2DH6A 3PUYA 3DUFA 4ZANA 3W6OA 4ERNA 3IKVA 1A9YA 4KUGA 4B3JA 3C1OA 3W2HA 5ARDA 5TGDA 1NUTA 2L17A 2Y6VA 4AJOA 2P9HA 4BX0A 4JLBA 3T95A 1XN1A 2R8ZA 2WHRA 3PTLA 4K26A 1JJFA 2JJ1D 2QUAA 4KGZA 1KARA 5K0BA 1M2HA 2BEVB 3PPIA 4QX6A 5JZVA 5FBKA 2BSAA 4HQFA 4Y1FA 4BN0A 2QLTA 3HDVA 1TE2A 2W43A 4H08A 3OQBA 4M83A 4UASA 1QORA 3SXPA 2JFOA 3NASA 5BN5B 1A72A 1V8DA 1KETA 3DGFC 4CF4A 5EUMA 3ZWQA 4PVCA 3LCVB 2FB9A 4PBTA 3BMOA 3LKZA 3IIIA 2JAWA 2RKWA 3RH0A 4CI0B 1K6MA 4V0QA 1S9HA 3IIEA 4KAFA 4QO8A 5E1DA 4F8JA 4C30A 2Q6KA 2ECOA 4M46A 4C78A 2OILA 5C0OE 1PGQA 1CQIA 5EQTA 1CJMA 4D98A 1DX6A 3LWNA 3M81A 4JGIA 1WZEA 1QZZA 3AVQA 1W5AA 2AOTB 3EDOA 3UNXA 3NKFA 3C3YA 1C2YA 3FBTA 1PO7A 1ZFNA 4FW9A 1K88A 4DIBA 1L8OA 3SU8A 2IS6A 1S01A 5IP5A 1C1XB 4IRUB 1GZSA 3GK3A 3U3ZA 1HT3A 1UDCA 3FYUB 2G09A 2JH8A 4LI0A 1GZHB 2XKAA 4YBZA 3Q7IA 4MRAA 3VJKA 3UMYA 3ADOA 4Q18A 4GQIA 1N2HA 2SICE 4WY5A 1R6XA 1HNXB 2POCA 4EFDA 4MYCA 5E3JA 4S24A 2AS0A 4IHQA 3WP1B 3AFNA 3P0HA 1R15A 4MUNA 2GQ0A 3UJ9A 4UNRA 3TGLA 3LT1A 2Z56A 2D1TA 3A1EA 2FP4B 3GVHA 4LS3A 2V0NA 3Q1KA 5HE8A 3KZOA 4MMXB 3N2ZB 3VR5A 1Y3AA 4OPMA 4EJSB 1T2UA 3FFAA 4JP1A 3FPSA 5HDBB 2ES4A 3NONA 3DFZA 2W2LD 4GW3A 4YJGB 4IUDS 3TM5A 1I5OA 1V9CA 2H18A 1QF6A 5DZSA 2H7XA 1JFFA 3UYLA 4F2WA 5C9ZA 3IFSA 4HZUB 1L4KA 1C0LA 4FPXA 4UCXA 5IN5A 4BATA 5L95A 5DTQA 1KK3A 3DEAA 5I8WA 4I1UA 4OI4A 2QHXA 3G2QA 4BJ5A 5LZ9A 4RIIA 4B44A 1B74A 3FWNA 2JLYA 1S0UA 3CKKA 4U39A 3U5TA 3W6UA 3HBMA 1NR1A 2YC4C 1KJQA 3GJ6A 3NIGB 3VBEA 1E1MA 4BDTA 3K8YA 5AUPB 2CNNA 2B83A 1PFUA 3V9AA 5LQAA 3SQLA 5BMVA 4MWSA 3TCXB 4ERXA 5CFMA 3E1GA 1XUOA 3ROXA 3EXAA 2F1KA 2WWGA 4CQMB 4L28A 2E55A 1LSJA 1SXIA 2NXJA 3FYHA 4B33A 2HM7A 5A3JA 5CXQA 3REFA 4EKYA 1IOLA 1CRQA 1YJXA 1J7KA 1PFQA 4XPIA 5FBHA 1R27A 1PJQA 2QXTA 2V6GA 4G0OA 1LSOA 3B48A 4M0LA 1NYTA 2C2BA 2IOHA 4L5YA 5H68A 2WOJA 1KZHA 3WC4A 3AL0C 2GKOA 4TTQA 5EMLA 2VF4X 2B21A 4IHJA 3THWB 2QGFA 4KRGA 4E31A 3FUUA 2WUDA 4D3DA 3H1EA 3UVEA 4EUFA 4BGVA 5JCXA 1RFLA 3ERCA 3TIFA 3VKHA 2QYSA 1Z33A 3ZUGA 5F52A 3RAGA 1KKUA 2VK4A 3PHBE 3FOBA 4LBYA 5FOXA 2JHGA 3T8YA 1CYEA 3TZLA 2RSLA 2OP1A 4CL3A 3HN7A 3FHTA 4CTNA 2IIVA 2BEKA 3IAM1 3LY8A 2BGMA 4OB7A 1PYOA 1SXHA 3PFHA 2DMRA 2Z6AA 1Y6ZA 1DV2A 2DR3A 3G85A 2UZ4A 2CXTA 3M6MD 4IEEA 3L4EA 4IGEA 1O9GA 1XHFA 3PEFA 3K2EA 1BS9A 1V16B 3O8OB 5TXGA 1I6WA 3DBIA 4K8OA 3TPFA 2Q5EA 1CDEA 2F2TA 1UT5A 1V2GA 2RGXA 2WZCA 4HXFB 1R00A 3P20A 4OFWA 5FUWA 1XEFA 5B3JA 1E6WA 1CJSA 4ARIA 3DCJA 1GT91 1DPGA 1YUMA 1A7KA 4YAIA 5GJBA 4Y9UA 4AXBA 4GI5A 2QN2A 3FUTA 4HXGA 4QUHA 2A9OA 1QFMA 5D3MA 4B8YA 4FR0A 4LY3A 3AVWA 1M7BA 3GAZA 2D0PB 4G8JA 2O07A 3PWKA 3SMVA 1VE5A 4OA5A 1VCNA 4I9UA 4OGKA 3C6MA 4BX9A 3OIGA 5JPCA 4DV5B 1L2TA 1JPVA 2P41A 4HGYA 4LBVA 1XEWY 3K3PA 4WLEA 3AFHA 3H8JA 5AI5A 3TZHA 4K87A 1IL0A 4Q7MB 3IMGA 4OHCA 1DCKA 2GVNA 4G5YA 1P1BA 2VF7A 3I92A 2OA0A 3TZBA 1E0SA 2ORYA 2BBOA 4LG1A 4A8HA 3KEFA 5L7YA 3IEXA 2WK1A 3DE7X 3GVPA 4QVGA 5A3VA 5K51A 4AX8A 2C2GA 1ISIA 3OCXA 5D5HA 2DR2A 1XXHA 4HWKA 4M89A 1N5KA 2C2HA 2GF2A 1T0BA 2BONA 2NTEA 3N75A 2A1UA 1PBNA 2BKUA 4GOXA 2XCSB 1RWOA 3CRNA 3ANNA 4G4JA 1P60A 3KYCB 1DO2A 3HKDA 1Q7BA 3MYYA 5LJLA 4BQIA 2FUG1 4E2YA 5HS6A 4A4DA 5DF1A 1LSUA 2Y2UA 3QU4A 4ALLA 4ZEMA 4XJVA 1EB8A 2P6PA 4ROTA 1KZYC 4KUEA 5FOSA 2HSDA 3OHSX 4P32A 3L7KA 4BNDB 4EMUA 4BMCA 4GUAA 1EDZA 4OGWA 5EIAA 3ZWXA 6Q21A 1AK9A 4IDQA 2QXUA 5LYJF 1RXYA 2GBLA 2RHDA 1IN1A 1B6RA 5BORA 4B3RB 3ICOA 1IUPA 3VKGA 4MVJE 3A3NA 5DM4A 3U1TA 1GDDA 5ABPA 4RV5A 4JI6B 5BN3A 2QR3A 1E9EA 4IFBA 4I4CA 1Z28A 3A4VA 1MX9A 1O96A 1Z38A 1YQTA 3HCFA 1JKMA 2Y9PB 4A73A 4GWGA 5F3WB 2IITA 1CQPA 1LDEA 1O7JA 1YK1A 2P0AA 4KWCA 1DAPA 2KS6A 4LIPD 1U28C 2HDNB 3ZK8A 3O0TA 1YR7A 2NGRA 3SOPA 3ODGA 1OBHA 1WW8A 3UW3A 3U0BA 3WB2A 1OBVA 2Q2WA 4P0TA 4YAGA 1Q0SA 3HXQA 2MIIA 3KKOA 3RU9A 1VYVA 4G9GA 2IF2A 2GM5A 5LZ5A 3OZAA 1XGKA 2GD1O 3CPJB 4C7MA 4PX9A 4P8RA 3OMXA 1QCYA 1RQPA 4GMKA 4CMEC 3VR0A 1C41A 3HHPA 1N75A 2Q3HA 4WJKB 3TLYA 1XZGA 1G8YA 2ZTMA 5EESA 5JAMA 2DJ5A 3JRNA 1GHTA 1J22A 1B2LA 4CVNA 3RK4A 4DCMA 4KR2A 3GFPA 1G7TA 3DDWA 2HV9A 5E6RB 1P33A 2XT9A 3KQUA 3GBVA 3UENA 4C87A 4X93A 4ENPA 3NHYA 5T3YA 2IDZA 3PFFA 4X90A 1ZNWA 3H19A 3SDBA 3FRJA 2I3GA 2WYUA 3T9EA 2UU9B 1V9LA 4KE9A 5B3JC 3IQHX 4FFLA 1G6KA 4WACA 2HJGA 3I0MA 3L40A 3BA6A 1VTKA 3GLTA 2V7GA 2Z57A 3ICVA 3STWA 3LW7A 1UQUA 1LJUA 1XPOA 3PR2B 4DARA 3UA4A 1BSVA 1S4MA 1JR3A 2ZSIA 2AXPA 4EHKA 1VE9A 2EG9A 3D8HA 3DLCA 4KBFA 3EOBI 3IVAA 4PG7A 4HB0A 1A95A 5JVDF 2SKEA 1QOPB 4KBGA 1LC0A 4FJ2A 2JL1A 3T06B 621PA 2ZS9A 4ADSG 1CZLA 1E2HA 1WQ1R 2BHRA 2GFHA 3AQ4A 3HC7A 3D3KA 2FKAA 4GC5A 2W98A 4L57A 5BPHA 1EVEA 2O8FB 3P2OA 1KH1A 2ODTX 2YV1A 1L7EA 2PGIA 3PUHA 4F5DA 4DV6B 1SC9A 3D3EA 1N5IA 4DMFA 2W93A 1G8GA 1GTMA 1FUEA 4MUJA 5A1TA 3KZVA 1L6RA 5EJEA 3H1GA 4UHJA 3WLJA 2XTMA 4MDYA 5KJ1A 1KJIA 2F43B 1OFVA 2XLBA 3PK0A 1Y8CA 5B37A 3NWPA 1A5ZA 2FN9A 1RWPA 3FYDA 1FFDA 1ZSYA 3C14C 2TECE 4ZVNA 1MH1A 2GR9A 3UUWA 3E70C 2H9IA 3UPDA 1YJAA 1VFNA 3EPRA 2EZ4A 4FEAA 1GYRA 1NQAO 3FSEA 4YP6A 1BH2A 3QIVA 3PNQA 4KO8A 2EJCA 2OESA 1QJ4A 3QKWA 2XB4A 2DPMA 1UK6A 2GBLC 4MNTA 2VJPA 5JRJA 1U7XA 5H5JA 1NVUQ 2MCFA 4RD4A 2OVBA 3LLUA 2C8LA 1Q0HA 4P4LA 2L69A 1HNWB 1FLNA 5CYOA 3TIXB 4URVR 4EG3A 1F6WA 1UDAA 4TL7A 3I52A 3QELB 2PAAA 1PNQA 2XYRA 5DSZA 1CZKA 1HE8B 3JU3A 2B1IA 2ZR9A 3DVLA 4CT0A 4N4AA 2AN1A 5IXYA 4R1SA 2WYOA 4WDQA 1YBVA 3A04A 3C8MA 3CQ9A 1XLWA 4Q9IA 2NVBA 4XM1A 2FW8A 3V2UA 4EG4A 5IC4A 1T91A 2C84A 5ALIA 4ZT4A 3HJCA 3D8TA 5J4HA 3ZY2A 1PE0A 5J4YA 4HR7A 2EBWA 3QYFA 4WNAB 5I4KA 1NXXA 3R6GA 3TEJA 3WMWA 1VJRA 1OROA 5H3HA 2XAAA 1GGHA 4MSUA 1FTQA 4BC1A 3KQNA 2YJ3A 5JNTA 1SCAA 1RIIA 3A4IA 4U6SA 4WZAE 3O4VA 4ITRC 1DLIA 1OWOA 5ALDA 4JXZA 3EXHA 3FJ1A 2QQFA 4DYHA 2NSLA 3IT2A 4DIDA 1P6UA 1Y7PA 3UW1A 4LOKA 3RUIA 2V9PA 3M1IA 4WKNA 3QVXA 4LF9B 2GI4A 2AFHE 3P9ZA 2HUNA 3VPHA 3JYNA 2IU0A 4DIEA 4F06A 3OFKA 3U1BA 1WXQA 1NTOA 4C21A 1M0EA 1RYMA 1S96A 2E6UX 4L0MA 3L7OA 5L53A 5B12A 1M3SA 3O8BA 2BY4A 3NGLA 4NS4A 2A5FA 1IBKB 3E5RA 4KPFC 1FJ2A 2HTEA 2QTAA 3LFUA 1KNXA 4MA4A 1ECCA 4TTTS 4DQ0A 3K92A 2EFHB 2HMTA 3WNDA 2N42A 3EWIA 1NW4A 1W49A 4GOJA 4N5DA 5EZYF 3FDZA 4RDIA 3R0QA 3UHAA 4ZMSA 2G06A 1ZD2P 4M3NA 4XJXA 2J9ZB 5C7YA 3HKCA 2I6TA 3B6KA 2X1HA 1TKBA 3K0EA 4YHBA 2QIOA 1HORA 2F48A 1A50B 3FGNA 2PPVA 1CFJA 4PO8A 4TKUB 3O82A 5SZHB 2FH5B 4ZTZB 1YFLA 1WBDA 1KAEA 3Q8WA 5ADWA 3O0DA 4QODA 1ZI8A 1VL5A 2C54A 3BSWA 3Q7SA 1X9IA 2G07A 2RGGA 3EW7A 2FOIA 2O23A 4QHYA 4QJ3A 4MICA 3GLFE 2DC1A 3HA3A 4M6WB 1VL0A 1M8GA 5DNCA 3HXMA 1VA4A 4RAQA 3ZC3A 4CKBB 3ZD6A 3U31A 5THKA 5AKEA 1VE7A 3ZK9A 2EQ5A 1TLTA 2IPLA 2VJYA 1UEIA 1W44A 2FUEA 3BOSA 2VHQA 3BCRA 4JVMA 4R40A 4DIUA 2QAGA 4Z1MD 5IH7A 1D8TA 1NJ6A 1V6AA 3EVFA 1DOZA 3U62A 2OSBA 3K2BA 3ZY4A 4YV0A 3USZA 3D4NA 1OH6A 2H7CA 5K3AA 3OJ0A 1MHPA 2X9QA 3S68A 2PUFA 2V0GA 3ZBQA 5AJZA 4GKJB 5CM8B 2QTRA 2WSIA 3LDUA 5CH5A 3FIJA 1ADCA 2WIDA 1JEOA 4JT9A 2JFBA 1YR1A 1USWA 4CIXA 2B35A 3QJ5A 4HPXB 5HG0A 3H1AA 4I5FA 1EGHA 1K7YA 3TO5A 2HLPA 2V7VA 1BD4A 3P52A 4H6VA 3UHJA 6NULA 2PN1A 3BMCB 3Q3CA 5IXSA 2B4AA 3GA0A 4C76A 3TYXA 3DYIA 3CA8A 3N70A 4OIFA 3HJTA 4XIGS 1PTJA 3AUTA 4IDDA 1G5QA 3TI9A 1Q1QA 3DL4A 4AU1A 2BGJA 1ISHA 2EHDA 1LA2A 4UZFA 1FYVA 2DLCX 4N8EA 1MJNA 3JVUA 4RDXA 4H6PA 4HQOA 4LVUA 2OV6A 1L5NA 3WKEA 4YRSA 3NTUA 4F56A 1ESCA 4UPVA 2CLSA 2O2IA 1FFWA 3NM5A 1V5IA 1V1RA 4LRQA 5LVAA 2BC9A 1FDUA 3DE5X 4DWOA 2OHFA 4LC9A 3D3NA 4DIOA 1O77A 2ZYDA 2E49A 5THQA 4DR2B 2PRJA 3WFJA 3B7PA 3KSZO 1DC4A 2GK4A 4HEA6 1YCFA 3ZDXB 1B00A 1GNLA 1NA5A 3TQIA 3EXHC 5C34B 1XX6A 5CFPA 2B2NA 3SC6A 4UW9A 5IJ0B 1HQKA 2FV8A 2CVZA 1ZIXA 5T8KC 5TQ0B 1OX4A 1IDOA 1SOVA 2C9BA 4DT1A 1IMOA 3ZIUA 2Q7OE 1W1UA 3EUFA 5E4FA 3JX9A 4UVDA 3ZHTA 4XIJA 4TYNA 5TR9A 1BU8A 5ES4B 1AUPA 4Q4AA 1H2WA 5A05A 3EQ9A 1DTSA 1FUKA 3AFIA 3WK4A 4Z7JA 2FPMA 1DINA 4DRYA 2O8BB 1A69A 1XEAA 1I0IA 4GLLA 1SKMA 1LPSA 1UBLS 5ALXA 2IHZA 1P2TA 2I7VA 2QJOA 1JLMA 3FDIA 3C1UA 4LDRA 2UUCB 3KR9A 4AS1A 3FTPA 4PW0A 3DCNA 4Z7OB 1E58A 4RENA 4N3AA 4F4DA 1W85A 4KAAA 4N3CA 3EFHA 1WY7A 2ZRGA 1H2EA 3I0NA 3PJDA 5DHPA 3WHIA 4BV3A 5ALJA 4DNQA 1Y8ZA 2W5UA 2CY0A 2Y76A 1F48A 1T9CA 4V2UA 1U7ZA 5BRJA 1PT6A 2ICAA 3S1LA 4DDKA 5A06A 2I1WA 1HETA 2EJTA 4JFRA 3E7DA 3PRJA 2OE2A 3IODA 5HKLA 5IFLA 2MINA 5JG7A 3PICA 4HEQA 4AF7A 3DV0B 3V42A 3ZHSA 3R8XA 2W7TA 3NDBB 4M0PA 3TE7A 3LYUA 2CEAA 2VP6A 2WJWA 2QL9A 3AILA 2F6RA 1NUHA 4ND6A 2J3MA 3ELYA 4YEDA 2XGGA 3DV2A 2JS7A 2GBIA 3FJYA 4TWZA 3W77A 1I5RA 4OHRA 2QAGC 2YR0A 3U9SA 1YNSA 3CE6A 5J2UA 4KXFB 3D5QA 2XQJA 1VI6A 3G1WA 2B2XA 4CLEA 5IAKA 3VNBA 1FDTA 3CSSA 3DPUA 5ADHA 1ZP6A 2WP0A 1EXWA 5HM8A 4WK6A 1N4AA 3EOAI 2HXYA 1WSDA 2UZ1A 3MMPA 1MV5A 4PM4A 1RYNA 2JHCA 2FWNA 3O90A 2JI8A 3NZEA 4CL8A 2R8XA 2ERCA 1C8KA 3QOXA 1O87A 2AE1A 1KGSA 2ZXUA 4Y1GA 2G82A 2C3PA 4BX2A 2CYBA 4DBLE 3OECA 4KE8A 4QJBA 2GVZC 3KT3A 3PCXA 1EFVA 4L22A 3WAKA 2V6BA 3LCUA 4R2WA 1PTJC 2FG7C 1I9GA 2V8OA 3EJ6A 3LC1O 4E5DA 3D3WA 4EEZA 3C4VA 4FDTA 1EGAA 1VHWA 2ZWAA 3G17A 1S8AA 1U8UA 3NJ4A 1U8TA 2UVQA 1XDBA 1IU9A 4UPDA 2O7QA 2ZYTX 1USUA 2DPXA 2G04A 3L41A 1F12A 2VPWA 3VO8A 1VMDA 3JZMA 4UJ3A 3A6JA 4WK0B 4REMA 4KNYA 2OT3B 3DE1X 2NZWA 5EP3A 4KN5A 1H4TA 3BQNB 3OC6A 4HS9A 4MWCA 2BSQA 3SQXA 2UXBB 4BQRA 1ID8A 3KTAA 2NU8B 3WL5A 2Z4RA 1E9VA 4WCFB 5C35A 3STHA 5K09A 1FQJA 5AOBA 1SMKA 4DE5A 2LIPA 3E1SA 4GMHA 4R8VA 4ZIRA 3S5UA 1ZDMA 4DY6A 1E7QA 3M70A 1HMYA 4TV9F 3R6DA 3H2IA 4RF5A 5E0OA 3STYA 5IM4F 4KR7A 1E6LA 3DWFA 2WAXA 2CFOA 3WLNA 1L1RA 4M0UA 1ZIPA 4PRZA 2AYYA 2JCYA 4OP3A 2JGJA 4JGBA 3REQB 4ZJUA 2EF1A 4CR6A 5IRCD 2BMJA 4Q93A 4AO8A 5FTLA 2BHSA 5CB4A 2FN4A 3OPVA 2A9VA 2D7JA 4HDMA 1P0QA 1HY3A 5JAOA 1G18A 1PSWA 4RIEA 4LFAB 1OH8A 1OXVA 1MBZA 4C06A 4FWIB 3N6XA 1HNNA 4TTPA 5AWFC 4KLRA 3ZGVA 2E1PA 4PFJA 1MB3A 4M0CA 1MR3F 5J5AA 1UQRA 3GJXC 5A2GA 3MN1A 3A26A 4YN3A 3S2UA 3ILXA 3WYDA 5KTKA 1OB2A 5C8YF 4JEMA 3SC3A 1TTHA 3BTVA 2Z1NA 1JDJA 4FGSA 2GLUA 5JANA 5ALUA 5FBVB 2GN6A 3KUCA 5BOVA 4ZGBA 1KO1A 4GOLD 1FNCA 3ND8A 3K0AA 1VGVA 1ZVQA 3HACA 2VPPA 3PNPA 4LEIA 3ZJUA 2XEDA 4MCJA 1TKAA 5LUBA 4U7PB 4CQLA 3EXFB 1K3UB 4F4IA 3BXPA 2PEYA 4G1CA 1A8PA 3CLTC 3JWIA 3S70A 2JI4A 4CCAA 4F9TA 4EFNA 3BL8A 3MGGA 5T6BA 2NSHA 4W8HA 2B1JA 3WGJA 4TKVA 2QW1A 2EXXA 4X7BA 2VK1A 3E3LA 1EIZA 4HEA1 4ZEXA 2WMYA 3SG0A 2AG8A 1H9AA 4JI1B 4BLTA 4E30A 1EZZA 1QC5A 1HDEA 3QYJA 3FWPA 4BVKA 2PO5A 3R75A 3VBCA 1OV6A 4WESA 3KD2A 5ADVA 3UBTA 2CHUA 4UBLA 3K6JA 4ARSA 3SIWA 2FFBA 2NUBA 2I65A 5BW5A 3M0EA 4B6JA 1RABA 2QU8A 3B5EA 3FWHA 2Q4OA 3N8KA 5REQB 2LXNA 1GPAA 4HAVA 5M5BA 1PD0A 4NMLA 4KAJA 5TJ9A 2B4YA 3AF4A 3OPYI 5CA1F 2H54A 3DLTA 5JRDS 4RYDA 3OFJA 5AKGA 1MEEA 2AQIA 2PSJA 4UDYX 1YKSA 1NRIA 1BDJA 3GEHA 4JR2A 2FN8A 1KY3A 4BKRA 3H2JA 3EDCA 3EPLA 3W05A 4N8SA 1CP3A 1C3OB 3A9WA 1XCBA 3DS8A 4YJ3F 3F3MA 4NZYA 5CDSA 1EPUA 1RFGE 4DV0B 2BBSA 1J56A 1U9JA 2FRVA 4F84A 1WUYA 4LQDA 3TLZA 3UOWA 3A6FA 2G9QA 3C6XA 3NYQA 2QBYA 3I9V6 5ALSA 2BFFA 4GICA 1II9A 3JVDA 3F74A 2XB9A 4D57A 1QAQA 4MR8B 4DPLA 2PUDA 1JAIA 1PS0A 2QR5A 3PLRA 1F1JA 4RKWA 2P9TA 3AV0B 1A9TA 2GVDC 3D8BA 3WLMA 3N6VA 1EVQA 4WSOA 4CM3A 2BUAA 3GNTA 1RHQA 1HEUA 1OWPA 3E5HA 2GA8A 4RPKA 2HFKA 4LYJA 3WL4A 4EB3A 4F6LA 3J80A 2P65A 3C5EA 5JS7A 1O2DA 1JS1X 2POQX 3MUEA 3QJGA 3U4AA 3HXPA 4BVGA 3CRMA 5FNVA 4PANA 5PNTA 1M5TA 5KMGA 2QX8A 2GK7A 2CDBA 3EXEA 2HWWA 5C8XA 3VXKA 3MC1A 3TRKA 1RAFA 1NN1A 2AX3A 2GUGA 4HQRA 4WCDA 1X77A 2XVMA 1R4AA 1XTUA 2PWZA 2VAWA 4PVDA 3L7AA 1NVTA 1L3IA 4FHCA 3BSFA 3E27A 4H35A 1KBQA 3P2JA 4NEGA 3KELA 1R0YA 4I3GA 3EG9A 4QU5A 5ITVA 1R0LA 2G3YA 4Q7QA 4YRBA 3IP1A 3WK9A 4BZWA 1Z6GA 3C87A 2P9CA 3H4MA 1PYDA 2NSDA 2Q0QA 4Y6PA 3X1XA 4EB6B 5DGHA 3B85A 1YS7A 4G8CA 4QUIA 3EGOA 2YV4A 2AC4A 2OZLB 3UT5B 2V5VA 4ZMRA 4H3KB 4FLEA 3OIVA </