1SIUA

Kumamolisin-as e78h mutant
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
354
structure length
354
Chain Sequence
TAYTPLDVAQAYQFPEGLDGQGQCIAIIELGGGYDEASLAQYFASLGVPAPQVVSVSVDGASNQPTGDPSGPDGHVELDIEVAGALAPGAKFAVYFAPNTDAGFLDAITTAIHDPTLKPSVVSISWGGPEDSWTSAAIAAMNRAFLDAAALGVTVLAAAGDSGSTDGEQDGLYHVDFPAASPYVLACGGTRLVASGGRIAQETVWNDGPDGGATGGGVSRIFPLPAWQEHANVPPSANPGASSGRGVPDLAGNADPATGYEVVIDGEATVIGGTSAVAPLFAALVARINQKLGKAVGYLNPTLYQLPADVFHDITEGNNDIANRAQIYQAGPGWDPCTGLGSPIGVRLLQALLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords kumamolisin-As
publication title Crystallographic and biochemical investigations of kumamolisin-As, a serine-carboxyl peptidase with collagenase activity
pubmed doi rcsb
source organism Alicyclobacillus sendaiensis
total genus 111
structure length 354
sequence length 354
ec nomenclature
pdb deposition date 2004-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1siuA00
4YN3A 4KB5A 2XTJA 3DE2X 3BPSA 5AQEA 4KG7A 1P7VA 3CNQS 4CFZA 1S01A 1A2QA 1KE1A 1AK9A 1Y3FE 4BWGA 3SQOA 4DWWA 4MZDA 3A3NA 1Y1KE 1CNMA 4AKSA 3GCXA 1P8JA 3DYBA 1BJRE 3DWEX 3ZXYA 1AH2A 3GCWA 3D9QX 3Q5GA 3DVRX 1WMEA 2Z2YA 4I0WB 3DE0X 3AFGA 4NMXB 1GCIA 5FFNA 1P7WA 1SUDA 3LPAA 2SECE 3SICE 5JMOA 1YJAA 2HPZA 5K7SA 1OYVA 3VHQA 1KE2A 4C3UA 1GA4A 3H42B 2WUWE 3LPCA 3DE3X 1PTKA 4B5LA 2Z57A 1R64A 4OMDA 2Z2XA 4M1ZA 3DE6X 3VSBA 1SUEA 1NDUA 3BGOS 2GKOA 3DE7X 3DW3X 4LVOA 1GTL1 1V5IA 3I34X 3WHIA 1SCJA 5JXGA 3TECE 1NDQA 4FONA 2SBTA 1TECE 1TK2A 2DQKA 1CSEE 3WIUA 1BFKA 2ID4A 5JXHA 4H6XA 1WMDA 2TECE 1Y3BE 4CG0A 5AVKA 2ZWPA 1TM4E 1TM5E 1OYOA 2PYZA 3DE5X 1NLUA 4C3VA 3QFHA 1C3LA 4H6WA 2W2NA 2W2PA 1TO1E 1GNSA 1R6VA 2W2QA 3TI7A 4KPGA 1TO2E 1GNVA 1V6CA 1Y48E 4DZTA 3UNXA 3P5BA 4NE9A 1T1IA 1C9MA 1WVMA 1SH7A 1Y4DE 5JXJA 3HJRA 4Z2AA 2PWBA 2PKCA 4JP8A 1C9NA 1AV7A 3LXUX 3DVSX 1PJ8A 1TM1E 3ZXXA 1PFGA 5ARDA 5JXIA 1WSDA 4LVNA 2WUVA 2Z58A 1Q5PA 5ARBA 1SCDA 3VV2A 1Y4AE 4OMCA 2IXTA 1SVNA 3I37X 1SBCA 1AVTA 1S02A 1MPTA 3QTLA 3F7MA 4J94A 1THMA 4AKTA 1SCAA 5I9SA 2PMWB 2PRKA 2ST1A 3Q40A 1EGQA 3QMPA 3DE1X 2SNIE 2X8JB 1S2NA 1GA6A 5B1EA 3EIFA 1ST2A 1SBTA 5SICE 1SIOA 2W2OA 1AQNA 2HD4A 1WMFA 3EE6A 1VSBA 2PQ2A 2QTWB 4RYDA 1SUBA 3PRKE 2V8BA 3BX1A 3VTAA 4WOBA 2Z2ZA 1DBIA 2B6NA 5AMXA 2WV7A 2ZWOA 1BH6A 1SN7A 3F7OA 2XRMA 1T1EA 2E1PA 2P4EA 4H6VA 3D43A 3DVQX 3VYVA 1XF1A 2ZRQA 3F49S 3I30X 1TM7E 1BE8A 2G4VA 3CO0S 4ZARA 1C9JA 1AU9A 1BFUA 4ZOQI 1SUPA 3GT4A 5FBZA 1YU6A 1OT5A 1IC6A 1SCBA 1UBNA 3WQBA 2DUJA 1SPBS 2IY9A 2Z30A 1MEEA 3PTLA 2W2MA 3GT3A 3A3PA 4HVLA 5CW1A 1IAVA 1LW6E 5FAXA 2ID8A 5B1DA 1HT3A 1Y34E 2DP4E 2PWAA 4OV6B 1Y33E 1TM3E 1EA7A 3I2YX 1R0RE 2WWTA 1KDZA 3DDZX 4NE7A 1AF4A 1SIBE 5ARCA 3DW1X 1BE6A 1ST3A 1SBHA 1YJBA 1GTG1 2X8JA 2SICE 1TMGE 1T1GA 1ZVJA 3OSZA 1GT91 1DUIA 3A3OA 1SBNE 1JEAA 1ZVKA 1YJCA 3VV3A 1KDYA 3AJ9A 3DE4X 4DJ5X 1SUCA 4K8RB 1SUAA 1KDVA 1GA1A 2Z56A 1Y3DE 4GI3A 1Y3CE 4CFYA 1Y9ZA 5AVJA 4WOCA 1SIUA 1GTJ1 3EDYA 1SCNE 4HX2A 3T41A 1SELA 1SBIA 3LPDA 3WIVA 3AJ8A 3L1KA 1PEKE 3TI9A
chains in the Genus database with same CATH superfamily
2BTQB 4I2VA 3NOVA 4I1SA 4IEIA 4W5OA 2UV8A 4O08A 3ZWNA 4ZHSA 2RBEA 2FFQA 3E53A 4WASA 3C6YA 1DT3A 1PEAA 3DD1A 4GBED 1VXRA 3IDFA 4N5DA 4QA9A 3UCXA 2ILVA 2PZGA 2RSLA 4N0QA 4P83A 3NBFA 5IYZF 2G8NA 4QECA 3LXRA 2D54A 5IPFA 2XQIA 1G21A 1GPLA 3EZLA 1HWYA 2H0RA 5AVRA 3FVWA 3F6BX 4E5NA 1UMDA 2QNRA 5I8PA 4S1VA 4F9FA 2CZCA 4U5XA 4MW2A 3ZU5A 4EF6A 3UJ9A 3PZBA 1UH5A 3K35A 1OH7A 4N3GA 4J1NA 4G01B 4BZXA 1K8RA 3ROZA 4QOHA 4O6VA 4ABYA 2QAJA 4B9AA 2XBUA 4EPXA 1W76A 2ZJZA 3ZV3A 1XCJA 2B99A 5E6RB 1ECJA 1N2CE 1EBFA 1HLPA 1POWA 3NKVA 2E37A 1PVVA 3GJ0A 3TTWA 4DQDA 4O1MA 3PJRA 4Z0NA 3SQOA 3S2SA 4H77A 3A3NA 5K0LA 4OK5A 1XCGB 1ZU4A 3ZDDA 4K8OA 4W1SA 3I4FA 4EB0A 1QRSA 5C8ZA 1GSIA 1XQ1A 4DLZA 4URXR 4IHKA 4EENA 3LWZA 5GJVC 1IJFA 1LPNA 2VDWB 4AN4A 5AW8A 3H18A 5LXTF 3BIXA 2ACWA 2X0IA 4E4TA 3V5NA 1N2CA 1HE4A 2OQVA 2WZBA 3H3FA 1U3GA 1Y98A 1LD3A 1P8JA 3R7WB 3L8FA 4GSKA 2IJGX 1WEHA 4HFNA 3ZXYA 4JXZA 3KYCA 1LBQA 2VJPA 4ZVKA 1GDTA 5EMKA 2HV8A 5KQMA 3HMKA 2B7LA 3FSEA 3IAHA 2W6CX 3I0ZA 1F8XA 3GO4A 5EJIA 1WBBA 3F7NA 3EY9A 5FFNA 5CGQB 4GM1A 2H52A 3NHJA 2OUIA 1OF1A 1OWNA 3HWRA 3NFRA 3OIWA 1S2GA 2Y93A 1T0PA 4QG3A 1YA6A 2I8CA 1RYMA 4ZAGA 2ZIZA 3KQWA 2GK6A 3W3AH 2CLSA 3AJAA 4FQ8A 1V35A 4EEXA 2GZRA 3HB9A 2RE8A 4XR9A 5EKDA 2GB4A 5J9FA 3HJTA 4YP9A 3VR5A 1IOZA 3VHQA 1AG9A 4HSGA 4YJDA 3TNJA 1QVWA 4KRYA 1HA3A 3KELA 4RWEA 1M7BA 4C3UA 1GA4A 1OX4B 3MWYW 5K3AA 3HJAA 4DHEA 4NXMB 5K3FA 1EXWA 3QENA 3LPCA 4PGFA 4DEVA 4EUSA 1J0DA 3UHJA 3B6IA 3TVYA 2J8ZA 2X5OA 1NLFA 6NULA 3DCNA 5L6MB 4Y2UA 5CNJA 4DR4B 1Z22A 3PNSA 1HORA 2CJYA 3LT5A 4ZC1A 4B5LA 3NVMB 1R5BA 3T1TA 1DJOA 4WKGA 5C8VA 1H2EA 1S8AA 3LHFA 1R15A 2EARA 1U0HC 4XD7D 2YHSA 4Z9FA 2AKEA 4RH3A 2FOLA 2PUTA 2JLAA 1UJ6A 1RYZA 5EWLB 3LGSA 4D98A 4J6EA 4D4JA 1GFWA 2PS1A 4ECAA 1Q1QA 3ACDA 2HLHA 3I3OA 5J47A 4PZEA 1QBGA 3M6UA 4EHBA 5C5CA 5GV8A 3AL0C 4WBNB 3TR5A 1H1TA 4LVOA 4BLUA 1ZNYA 2YFKA 4GOMD 4B73A 3IRVA 1R6AA 3RD5A 3CZRA 1QV9A 3H3XA 1LLQA 5CR9A 1WD7A 2IYWA 4ASUA 2DF8A 3RW9A 3I62A 2ZXFA 1C1DB 1HE2A 1XO1A 5JWHA 1PVOA 1GEGA 4Q1CA 4OMFG 3IH5A 4CMIB 4G1CA 4AN0A 1UPXA 4G1VA 1XTVA 1K0UA 1GNRA 2JATA 3IBGA 2FW1A 5CNKA 5B2ZA 5KSPA 5CYGA 4A36A 1JWAB 1ENZA 1P7ZA 4DLUA 4GKKB 3VZSA 5FA8A 3UK2A 1FL9A 3KPUA 4QHSA 3W7VA 4BEWA 2C97A 5AW6A 3FGPA 2VJNA 2OK8A 1IHUA 2QZ9A 4LI0A 3RSGA 5JT1A 1VKNA 3KZVA 3E23A 3OUZA 4Y2RA 2V7GA 1XWFA 1F3OA 3GJ5A 4GYYA 4ENWA 2H29A 3WYBA 3BMNB 2ZAIA 4MEBA 2C61A 3TZ6A 5TRTA 4RTJA 3F5SA 2TRSB 1IUPA 1SWVA 1U2QA 1OZFA 2A0YA 2GNPA 2ZVDA 3C8UA 1N2BA 2JJ2D 4MS1A 4WOKA 4G4IA 4DY6A 3ZW9A 1Y8AA 2Z6VA 3HDYA 4RPKA 4UNNA 6AT1A 2YZ2A 3KCNA 4BO3A 1NMXA 3KTDA 2RHJA 3P96A 1Z4IA 1U4SA 1V4NA 3PQCA 1Q0TA 2ZAGA 2XUQA 3ZH2A 3KLMX 4NBTA 4DZRA 1RYDA 2AD5A 3HVKA 3KSDO 3PHLA 2OENG 3PWZA 2QYSA 1QPBA 2OBBA 1Y63A 1M8FA 2BZSA 1E3TA 4R2LA 2AW5A 2PJZA 5IAEA 5BQ5A 4YYEA 1QTRA 1ZX1A 1ZM4A 1EWQA 4IBOA 1IDN1 2Q3MA 3MLBA 5FHRA 3G13A 4ZN6A 1JP7A 2W5UA 1Z2OX 1C0EA 1S5PA 1UJNA 3QYPA 4JVLA 4XGRA 3ROTA 4US2R 5CUQA 3PK0A 5HEKA 4OHVA 2ONYA 3ASYA 4TL7A 5ICMA 5KC8A 1DOZA 3DV0A 3K0CA 4C4RA 3FXAA 3L8ZA 3LAWA 4LZNA 4DCVA 4LGMA 1TT5B 3COVA 1AZSC 1XRPA 1GTVA 1CDZA 2NO7A 5EIOA 3G68A 3PF8A 3V1LA 5HOQA 1SUFA 4WN9A 3UB3A 3JVEA 3D3JA 5CEFA 2C0PA 1HETA 2A0WA 1U8AA 4YJHA 4B34A 3T1YB 3O8LA 3LO8A 2OCXA 3MOGA 4JLPA 1Y4DE 3HL4A 3IXMA 4I9NA 1GUDA 3JQBC 4IQ4A 3U3JA 1KI3A 3ICVA 1KSJA 2FRDC 3RJZA 4OXRA 3NDPA 1TTTA 2UZAA 5KNDH 1SHKA 2MCFA 5CU7A 3UFXB 1RYYA 5BNIA 1WL8A 3NBQA 5IDVA 4CF7A 5IWAB 3AU8A 4ON9A 1R4NB 3QFCA 3DHWC 4TS3A 5LKRA 4JCCA 2FKAA 4TLEA 1VPEA 1UJCA 2R9VA 3KRTA 1QONA 1N9GA 1WW8A 3U56A 5JLAA 3HYNA 3I9LA 4DIEA 4Y6SA 4ZI7A 2CDRA 3NOXA 4DYDA 4XUGB 1UADA 2G83A 1J7JA 1QVZA 2QPTA 3C6BA 3GRKA 3IPYA 4KXFB 5K51A 3LU1A 4S3MA 5FTKA 3ND9A 1TA4A 4LXIA 2EBHX 4MQMA 2QLTA 3W77A 5E3IA 5EJ2A 1CD5A 3F1LA 3PA8A 3SKVA 4ALLA 5C53B 3KJQA 2DQ4A 1YR3A 4EKEA 5ITZA 3OE4A 3Q85A 5FOQA 4EVSA 4KACA 2QG4A 4J0EA 3GQVA 3N87A 1O4WA 4UOQA 4QYSA 5HKBA 1U28A 2EJCA 2P67A 4ITUA 4MSUA 3ROPA 3TQOA 4ZO9A 3Q2OA 3K6JA 3T34A 2UAGA 4JBXA 1E3SA 2ONZA 3JQAB 3IP8A 3CNNA 3K0AB 2YMLA 4POAA 5L3ZA 3RDPA 4J4BA 1V39A 1KERA 5DYTA 3TE6A 2EF1A 3RUCA 3P4UA 1KC1A 1RQGA 2QIPA 2V1XA 1TUGA 5EHGA 4ETMA 3EGDB 3H4IA 1TK9A 1XVIA 2W0SA 4ZZ3A 3QP9A 4MOWA 2J3MA 2I78A 4X93A 2G0TA 1NRXA 3FNBA 5DHQA 2ZUFA 4RY9A 2P4HX 1GQOA 2XOXA 4DIUA 4DRXA 1XZAA 3L7AA 3WHPA 4BPRA 1KS9A 2F8LA 1ABBA 4M83A 5CM8B 1R2QA 4CMKA 1OAOA 2L82A 3S2YA 4OX9Y 1LNSA 3NCHA 5EQJB 4C29A 1OH5A 5CD9A 2PMWB 3ETCA 5I4KA 3L46A 2GJKA 1EFUA 1Z7EA 3SOZA 3CSSA 1JEDA 3TSOA 5LP1A 2H5JA 4QYMA 2B5VA 3CKLA 3MLEA 2DBVO 3QBDA 2J67A 1P7PA 4Y2YA 3U7GA 1UKVY 1IYZA 1RPNA 3NH6A 1BXRA 3MAAC 2ZCJA 1FTQA 1RI1A 3FJ1A 2UXCB 4R0NA 5DM2A 3VDNB 4XVCA 1PN3A 1RYHA 4NQZA 5JQWA 3BRQA 4LHSA 1USKA 4RL4A 4KQIA 4N9QA 2HLDD 1J1UA 1Z6XA 4HGOA 2VZ0A 1V37A 4I6JA 1UBSB 4CM4A 2PQ2A 4LKOA 1Y4UA 1JHMA 3FCSB 2WJZB 3WMWA 4N18A 1U0NA 3R5TA 5D00A 3UT5A 2X9GA 2X77A 2FPKA 3DMRA 1IDOA 3ET4A 1C0IA 4A2CA 4PG8A 2YW9A 4TKUA 3PXGA 5KSWB 5LFAA 2AOWA 1TZ2A 3AUYA 1PR4A 3GEPA 2O2IA 4MV4A 1QIDA 1ARZA 2Q6TA 3R6WA 3N2NA 4IO1A 4QASA 5K0NA 2B6NA 1U4OA 5C51B 4B3CA 1P74A 4G56A 1U2GC 3RC7A 2BGIA 4FMCB 1T4GA 3E70C 4TLBA 1M8PA 2O3SA 2CMHA 5FQOA 4ZYVA 5DT9A 4IIGA 4LZOA 1N6NA 1R27A 3CVVA 1I4TD 4X6XA 3TNYA 3GELA 3KQUA 3TOCA 4DMFA 2ZRFA 1O0CA 1ZGHA 4V1CA 1F0PA 1K7EB 2HRQA 3F7OA 5L40A 3EZNA 1CUEA 4EY5A 4CQMD 4XD7A 1FY2A 5BY2A 2DETA 3QVUA 5CCEA 4X41A 1FRQA 3PE4A 3VNBA 1U8YA 2GH1A 3MS2A 4FDAA 3X2FA 1GUFA 4GZLA 1OH8A 3ELBA 1MH1A 2OGWA 2B2NA 2VSQA 3K1YA 3MXOA 2AFHA 2Q0QA 4FYHA 2JIQA 2NUPB 4U39A 1ZXXA 3RU3A 4IVPA 4MRSA 4ZP1A 3JQ8A 4NCHA 3ROXA 3A4LA 3MFYA 3ZR4B 4YV2A 3NNDA 2XHZA 3GPLA 2OEPA 3ILHA 3TSCA 5IDYA 2E5LB 1SB9A 4S1WA 3EZ6A 5AR1A 1ZJ5A 1S1MA 1FX0B 4MVJF 4BDSA 1ZICA 2Q5HA 2CNNA 3T7AA 4HPXB 5JAIA 3TG2A 2IYTA 4YV7A 2WYVA 2IUTA 5TARA 2PQ0A 3Q3JB 1VOTA 4YO7A 3HXPA 9LDBA 2QMUA 4H18A 1QO7A 2GERA 2WIFA 4O29A 4PCUA 2WVAA 5GV7A 4HDRB 5A3QA 4CCYB 1V2GA 4HWPA 1T3LA 4FW9A 2QBYB 2P9YA 3BCUA 3CCFA 5GMOA 1FNNA 1VP3A 1UBEA 1VG8A 2XAUA 4YAOA 2QRNA 1FE8A 4R16A 5K3OA 3BQNB 4BMXA 4C22A 4YGXB 4E2XA 3SFVA 5K03A 1C1XA 4M89A 2WZDA 4AMZA 2DUJA 3TAHA 2WG1A 2V9ZA 4LBWA 1M66A 3IQFA 4MO2A 5AKZA 3CSDA 4MRMB 4LYYA 2VL7A 4G36A 4TQ9A 1EBUA 1L5OA 4YX9A 2BFBA 1TFUA 4AL4A 5JAUA 2YV3A 2J3DA 2QZSA 3EG9A 5DH9A 1T6NA 2P6MA 2FI1A 3DOFA 4U63A 5FYQA 1NVFA 1I33A 1DC7A 1IAVA 1QB8A 2LD4A 3EUWA 2B7BA 3MRSA 5GZ1A 2PT9A 4LHVA 1Z26A 1YRHA 3H8VA 4M7RA 5H80A 1KH3A 1RPJA 2Q5JA 3DULA 4AF8A 1A77A 2P3OA 1MO3A 3KOXA 1IXSB 2WJGA 1YZYA 1KJJA 2P9GA 3PVZA 1U0GA 4YAFA 3V8VA 1P4RA 4A6EA 1NVWQ 2PGDA 3HN7A 5CT4A 4DLYA 4W1PA 2G09A 2R4UA 2FSVC 3BB4A 1Z5WA 1T4CA 3SZ3A 3WWYA 2ZZMA 1V4VA 2OBLA 1IMJA 2UXBB 3NWEA 3SJAA 4N54A 1T2NA 5IDQA 3B1VA 3G5LA 4GNKA 4X44A 4XJTA 2IZOA 1T9AA 2BKEA 2VATA 1WTCA 4MARA 4A03A 1JMVA 3LH5A 4PBTA 4KVAA 2PL1A 4LYHA 5IRCD 3AHEA 1Q77A 1UAYA 2DBQA 3SNHA 3ZZTA 3WXBA 1F20A 2JGRA 3PD1A 1NVDA 1SZPA 1IOLA 4FLFA 4K9RA 5LA6A 1TDJA 4JBGA 4JYCA 2YYYA 1QP8A 4WN3A 4G9GA 4P5PA 1EFPB 2GBLA 1P8AA 2JFZA 3V3KA 3WYGA 4C04A 3AVYA 2GPTA 1JXOA 2EFHB 2ODQA 2DE0X 3RGWS 3STUA 1T5TA 3S1AB 1IMOA 3I1IA 2QOEA 3OZCA 1IATA 4ZVLA 3LFHA 2XJ9A 1BCRB 1VSQA 3ANXA 1AT1A 2YCLA 4MKIA 2DHEA 3BC1A 4ZWNA 5BR4A 1OZHA 3R6LA 2GM4A 3SGLA 1GZ7A 3IB3A 5EFOA 4CQJA 1U3TA 1IH8A 4OK6A 4HUTA 3EIQA 4D81A 1FCJA 4DEYA 1RJGA 1SUCA 1JBEA 4FWBA 3LXMA 4FEEA 4NBWA 3UJCA 1B8NA 3TM4A 3CUEF 4MUGA 2I1VB 2EEZA 3LLSA 1UMBA 2H7CA 2YH2A 4P7KA 1ZOSA 2AQ8A 3CH7A 3D6FA 4QQ8A 5F21A 4PR0A 1LI7A 2IBMA 3LQQA 1AS2A 3OI7A 2PKXA 4JC4A 5DI3B 5H81A 4FFMA 3VVBA 1J5PA 1E99A 3D0RA 4OLAA 1WCWA 3ZWDA 3H11A 1UDCA 2FWIA 2VS1A 3EFOA 3H5WA 3NBKA 5AXDA 4RHYA 4BRSA 3DQZA 2Q3LA 2IYFA 2GNAA 3AUSA 5HOEA 3GZNB 2ZJ7A 5EHXA 3O1HB 3HKCA 4F9EA 5BOSB 3Q5DA 4WNYA 2HXSA 2WTNA 3WSVA 4JYPA 1YSCA 3T41A 1SELA 3CMCO 4FKBA 3IOYA 1SBIA 3GLGE 1YQWA 2VTBB 1EWVA 2V8OA 3KOOA 4KLNA 4DLVA 1P1BA 1CF4A 1PGNA 1J90A 2EZ9A 3G88A 4E22A 1UBTS 2OV1A 2R85A 1W52X 3IXQA 5JVDA 2L2QA 1T9CA 3C0KA 1EJ2A 4H35A 4QGHA 3CRW1 4ZVRA 5IBRA 2O50A 1UBFA 1LH0A 1ZUWA 1NQ5A 1QANA 1V2HE 1ZD5A 2CMDA 2MU1A 2DFDA 4EATA 4EKYA 4GL2A 5BSUA 3L7LA 3GB9A 2W22A 4PCLA 1V3QE 3UT6A 5BWOA 5G1PA 4U7JA 1BXGA 3GLGA 3AZQA 2GO1A 3I0MA 4WY5A 1TVEA 5DIZA 5CP8A 3GXOA 1RWKA 4JB0A 3HDHA 1KPHA 3WL7A 4CEJA 3TJRA 4R6WA 5DLPA 1ZD9A 3DNFA 4KE9A 3GJ6A 3VU9B 2C0CA 2O23A 2J3JA 1W2GA 1NVUQ 2YWJA 3K2EA 2UXDB 4NEHB 4NPAA 3ZIUA 1QHSA 4BVKA 4DUYB 3FBTA 3KPYA 3R5SA 5EXPA 4F1KA 4EO9A 1E0SA 3NWPA 2I67A 3DBRB 2HNBA 4K9SA 1FDSA 1XVTA 4MCAA 1DEXA 1JPNA 1RQXA 1DEAA 4OKIA 1UP4A 4AJNA 4HY3A 2H31A 1JFFB 1JDBC 2FZGA 3W9BA 1NY6A 4KDRA 3X1ZA 1N6KA 2HIMA 2QB5A 1KPGA 1T5IA 2CHVA 2FGJA 3FTQA 3O4HA 5HBGA 1CUWA 1TU4A 2Y68A 3GFBA 5HUJA 3DTVD 3R3HA 3DZJA 4N7JA 1JTFA 4BNJA 1NUHA 1U1IA 1LRKA 3N5CA 3NONA 4TVSA 5SYMA 3U60B 4Z54A 4ARAA 1PT6A 1Q7TA 3N75A 4OVKA 4YCLA 1EH5A 4UVHA 3BRWA 3HP4A 3WWEA 5EZYF 2XRZA 1A7AA 3W05A 1ZGAA 3ZGOA 9ATCA 2PY6A 1LW7A 5EP2A 1T8UA 4WJKB 2IYVA 4REMA 3GLSA 4URYR 5HRCA 2ZBDA 1E2UA 3IBSA 2RD2A 3EAQA 3FVRA 2NIPA 4OQMA 5A6VA 1A2BA 1F8GA 4M55A 1NSYA 4Y3UA 1LDMA 5AKYA 4Q4LA 4Q9HA 2R7KA 3FPSA 4ZDJA 4CV3A 5CFPA 3CJQA 4C05A 1MPXA 3UWKA 3UENA 3LHKA 4EYEA 2BJVA 3JVDA 2ZJAA 4JLVA 1E7WA 1FLDA 1D0SA 1R0YA 4XRRA 4D5EA 5DGIA 1CJVC 1G0OA 1OX5A 2QIOA 2I8AA 2Z9BA 2YS7A 4XWTA 4C9BA 4CLOA 3T61A 4CODB 3R7FA 1U7DA 4J3JA 3C3BA 1OLXA 1NIJA 3F8WA 4L76A 1YJAA 2YJ3A 3QPCA 3L0BA 2DCMA 4M6WA 1B3BA 1YS6A 3DLIA 4GKVA 3H5VA 1EWTA 3PUJA 1IHDA 1B8OA 1WF3A 2QA5A 2ZSJA 3QVSA 4JT9A 4P4SB 4X61A 5FI0B 5EIBC 4HNTA 4YTEA 1O9GA 4LJ8A 1PP4A 1PWEA 1QTIA 3EXFB 5AK3A 2VNHA 3IYLW 4N65A 2IUYA 2HIHA 2BFFA 4F72A 1SVKA 4G09A 3SZOA 3FH0A 1E0KA 3DLCA 4AY6A 5GIOE 4YPFA 1WPGA 4ZGBA 4OMDA 5C52B 2Z98A 1EJ0A 4UULA 1BHJA 2OHHA 4FGZA 3UEOA 1JIUA 3HABA 4DPMA 3LC7O 2XODA 1QYWA 3DE6X 3O2QB 4C7VA 1BOOA 2QXYA 4ID9A 3AFOA 4JI1B 2NADA 4RXTA 3R3YA 1TQDA 2QE7D 3K0HA 4WUTA 4L5JA 2OM6A 1TKRA 4DV2B 5TF4A 2P6RA 2DPGA 4DR6B 2GA8A 4FT2A 4JU8A 3OZ7A 3BWMA 1V5IA 3OQHA 5LMNB 1PV4A 1V1MA 3TYXA 4QUBA 4PVDA 4EFDA 1J56A 2X58A 4A3SA 3DTTA 5JC8A 2XVZA 1ZGZA 1VKHA 2EF0A 4FYKA 2GSDA 1HXHA 4KLCA 2WHPB 2AUNA 2O48X 2C2ZA 2DM6A 3IO3A 3MTAA 5T4BA 1IJEA 2OHOA 2R1ZA 4KR7A 2RHHA 3VJLA 1LFDB 3JXEA 3NKFA 2VJCA 4JD5A 3R0QA 5FUXA 5IKOA 4EYGA 1L8OA 2OKCA 2VCYA 3KXKA 7REQA 3WNZA 4X90A 3B36A 1XTPA 4PG6A 3VDXA 1J97A 1EE9A 2ZATA 3KAKA 1V7CA 2PVCA 3DEYX 3VNRA 3CINA 1QGYA 3DHYA 2I3ZA 1TIKA 1XJ0A 2P7IA 3CG0A 4YUVA 2NTNA 2XWJI 1HQYE 1T1JA 2OZLB 2W2VA 2ZUUA 4GMGA 4L4YA 1LWNA 1TVKB 1CUFA 1RNLA 3Q6MA 1H2HA 1DRKA 1UXHA 4GX0A 5ISMA 4L0CA 4AKIA 3L0CA 1VYVA 1QDEA 2ATCA 2GZ3A 2R8ZA 4I66A 4Q3NA 1PJCA 3NBUA 4KQXA 4LGYA 5EY5B 2O8BB 3WAKA 2AYXA 1L9XA 3FRJA 1TM4E 4RNDB 4U6NA 1EK0A 3BJEA 1VHLA 2XGOA 1X1AA 3PDWA 3IJEB 5BNFA 3K1AB 3OLXA 4PINA 5TQ2A 4DCGA 1OYOA 2AOXA 3BMOA 1FDWA 4RGQA 5BSRA 5KQGA 1U4NA 3AY7A 2VPPA 1JQLB 5LP6C 5ICFA 1FJHA 1VRCA 2FZWA 1NJ6A 3ZHCA 4K6KA 3CLRC 2JHFA 1E79A 2IYUA 1WXWA 1G20E 1VL8A 4NYJR 2Z2KA 1XZIA 1FP4A 3V8MA 2C59A 4FILA 4JNKA 3V7WA 1YB2A 5FBWB 5KJ6A 1WOMA 3N2ZB 1Q3HA 4PSAA 4F12A 1JDSA 2DHCA 4ZAYA 1KTVA 3PZRA 2C4WA 2EFEB 3IQHX 2O3JA 4X64B 4RULA 1I4EB 3EDCA 1Z47A 4WE3A 3PYLA 4YDSA 4ZOLB 4NOMA 3W4IA 4KPGA 3IJRA 1L5ZA 2JBAA 2Q45A 3ANMA 3GXBA 4IJWA 4EPYA 1H6BA 1PW5A 1RZRD 1OGIA 3JQBA 3FZGA 1K1EA 1G20A 1VA5A 4BVBA 2OAP1 4W5JA 4I5FA 4PFQA 1C8LA 3PCXA 5CXXA 3CH4B 4B0OA 4D0LB 1B93A 5AHOA 4DDMA 2VUTA 4H16A 1P2FA 1V8FA 2AL7A 3NX4A 4FR5A 2A0FA 2W6JD 3DZCA 4PBSA 3SY8A 2B8TA 3I8OA 3IILA 2BFPA 4JVSB 4MQ4A 3VOBA 1T0IA 1N7HA 2PWBA 2QXUA 2WJ6A 1C9NA 1DQYA 1K3TA 1L3BA 2J1LA 4K6GA 3S4YA 2UZ1A 1ZJ6A 3ME5A 3OBIA 4UUMA 1L5QA 3L5KA 4F04A 1YKGA 5DM4A 4LVCA 1KJQA 5HGJA 2XLCA 1QHYA 2JS7A 3COSA 4TS1A 1RHUA 4XOUA 5SZHB 3WK8A 4ADSG 4BX8A 1QUFA 2QPLA 2JCBA 2I3AA 1W36C 4KN6A 3KJXA 3SE7A 1EX7A 3KFVA 1YAHA 2PZJA 2WUVA 4G63A 4M38A 4Q7EA 1FMTA 3MS7A 4RVGA 4XIIA 5T64A 4Q3LA 4X6LA 5DASA 1CYDA 4BGIA 1LF5A 3NM5A 5KVAA 1UAAA 5E1MA 3R6DA 2KWIA 4IGIA 1LVGA 3G2KA 3HV0A 3EA0A 3KZCA 4DLLA 4IRUB 1L5HA 1WUTA 2ODAA 5SYNA 1XF9A 1F9EA 1YMQA 1HEIA 2ZBFA 3C3KA 4MJLA 3S55A 4ENUA 1E3WA 1SVLA 3HA7A 1OE0A 3OFVA 1WZ2A 1S2LA 2HWUA 1DX4A 1DEKA 3FPCA 4FMDB 4LHEA 4P31A 3R40A 4NRDA 1E4YA 4WQMA 4X1IA 3UFBA 2GZMA 3WRVA 5T8KC 1QTNA 3GOHA 1PR6A 2EW8A 4MDYA 1J6UA 2ZYVX 5CLHA 3H6HA 3U0VA 3WTCA 5JDCA 4MWOA 1OI2A 1SB8A 3WLOA 1ZRSA 2B98A 3FNEA 1IZ9A 4ETIA 1KNQA 2NTEA 4KAXA 4DDTA 1PFYA 2R4TA 1NJ8A 2Y8EA 1N2JA 3V8QA 2ASVA 1ZZEA 2QUBA 1DI0A 4DPLA 1XQVA 2I4OA 4CIVA 4X8MA 2R6JA 1EK2A 1M6VB 4X9XA 3W8EA 3BE4A 4AY2A 1CY8A 1Y3IA 1EGQA 3ILSA 1X7XB 2ACVA 1F7UA 2ID9A 3N74A 2DUWA 1G55A 3GJ8A 3UJAA 3UJPA 4FXPA 4O4IF 4B74A 3RK0A 1ABEA 1U7XA 3O7MA 3U44A 4GX5A 1P6QA 2EFYA 3PR1A 1QX4A 5C4IA 1MV5A 2JAHA 3EBOA 1OU0A 2JLXA 3A6DA 3SX0A 4GOLD 1IY2A 4WZAA 1CUVA 1NKVA 4PRZA 3AM4A 3KJEA 1U6KA 2VP3A 3MQ4A 3QU7A 3ZNQA 3AINA 3GMDA 5A04A 3LVRE 3B12A 4UEOA 4MS4B 4C6TB 1GVNB 4XQGA 1U2GA 5IAKA 5T6BA 4A4DA 2O7VA 4CM6A 5BSWA 4DOMA 4DCMA 1TUIA 1IQRA 4ZCQA 2AI3A 4NESA 3TMYA 4CDMA 2ZJ2A 2Q4OA 1RAGA 2X9LA 4FBGA 3CZMA 1ZOIA 5CW2A 2PXAA 4GYWA 3C7TA 3RGGA 1J9ZA 1EDDA 4IFTA 4WUVA 2JLZA 5JZBA 1EVZA 1UMKA 3CB4A 2EQAA 4EG1A 3IT2A 3KDPA 4MR7B 2PMKA 4R3UC 3SKXA 4QPDA 2N1BA 1W48A 2WJAA 4RD3A 3U31A 1F51E 4DKJA 4ZI7F 4Z4CA 1X70A 5FX2A 4WK4B 4Q4HA 3H83A 4BN4A 9ABPA 1IBSA 5LOVF 3AETA 2GWHA 1H2FA 1FP7A 2AUMA 1K5GA 1TW2A 1I6LA 4Q15A 1AS3A 1M33A 3WB1A 2AKYA 5E8JA 2DR0A 5DM60 1D9ZA 2IHYA 3ICCA 5T41A 4NCKA 3EWIA 1X92A 5IJ9B 5LSAA 3HGTA 4IOKA 4AUMA 3F3SA 1I32A 4EW3A 5BN3A 1SA0B 1LA2A 6ABPA 3K9QO 2IEAA 3I30X 2IYPA 4TLCA 5FBLB 4BNVA 1VTKA 3U1TA 1NRWA 2XH8A 3LL7A 3HDGA 5E3JA 2QRKA 5EIBD 2OYRA 5AUNB 2M6KA 5LQAA 1T2DA 5MFZA 1FW6A 3EDQA 2HX1A 4KPUB 2XUJA 1SVSA 5J1TB 1FYDA 1W0JA 1R16A 3P20A 4GFDA 1YZ3A 2ZYTX 5JJLA 4GX1A 1H65A 2RAVA 3O3OB 2X13A 2VRBA 1G8JA 4NAUA 1M1NB 4LYDA 1CQJA 5HS6A 2X4IA 2VJOA 2BM9A 4P1ZA 1SHLA 2BUBA 2OHXA 2PJUA 3HB4X 3KTOA 3WK7A 1NBIA 4HF7A 2WW8A 4CI9A 3ENQA 2H54A 2LCFA 3UA3A 2V97A 3FPEA 4IP0A 2FX5A 2AN9A 5ALOA 4M0PA 3K2IA 1GLNA 1W4BA 3H87A 4RMNA 1TEZA 5CVEA 4IOMA 4Q01A 2UU9B 1E2FA 2WSSA 2E4AA 1GZHB 2PUFA 1VSVA 3BZBA 4D8VA 5KQRA 1DX9A 4V0OA 5F2OA 5FHQA 3V4SA 2JGFA 3R3SA 4C7MA 4CTKA 1K98A 3AV0B 4K6HA 5DBOA 621PA 4BP1A 3W5BA 3D6HA 2P2LA 2QR2A 1A1SA 1V71A 2RH9B 4QPNA 2MSNA 4N03A 3A3PA 4HVLA 2BFCB 1IXZA 3NR2A 4IGKA 1XLUA 1W93A 4FKMA 1RE1A 3U19A 2AG5A 4TVBA 4BP3A 2FSVA 1E6KA 4Z1MD 2P2YA 4FZJA 4UDNA 2FJ0A 2O8VA 3RVSA 3UW3A 1PD0A 4D4GA 1FU7A 5DK6A 2J87A 2QYTA 1XTQA 5CGZA 1Q19A 1RKXA 5AW5A 4EMTA 1MRSA 2Q2QA 3LBFA 4O2BB 2X9QA 1DPGA 3I1FA 4WCVA 4HMPA 2EV9A 4GMKA 2D1TA 3HCBA 4OV6B 2H1HA 3UAOA 5JRDS 2KPOA 1M1ZA 1R0WA 2AIRA 1X7ZA 4JK3A 5TGDA 3DO6A 4HAYA 4IZOA 5FD8A 2VTEA 2WWTA 1W88A 2NX2A 5EKTA 3TW8A 1WXGA 2D2FA 3NEAA 1QP7A 1K68A 5ETJA 4P34A 4Q9IA 4YEDA 5COAA 2C3OA 5DW3A 3FDZA 1A9XB 4I4TA 3Q8MA 1GT6A 4ZI5A 4B85A 3QVOA 2ZDGA 3AOGA 1EFHA 4W1RA 3ZKWB 4QBHA 1LBTA 2FPIA 1SBHA 5DMHA 4GEGA 3ZWKA 3CLRD 2IWRA 4HV4A 4GPZA 3HZRA 4IVQA 3TKLA 2CCGA 4CL0A 1QFSA 2WTMA 2W6JA 2CN1A 1DLIA 2ODEA 3AEQA 2I8LA 1X7DA 3NKLA 2JGDA 2I66A 2FE1A 3ADOA 1UJBA 4KE6A 3MRXA 3HBAA 3VPBA 4BU1A 4PLVA 4TV8A 4BS9A 1RM4A 2FEAA 2PANA 3GAMA 4XD2A 2C3MA 5HK8A 3QVVA 2Q1SA 5ALWA 4DBZA 4JL5A 5CBPA 2YKGA 4HX9A 2AYZA 3G5MA 1NN5A 1I7NA 4WNAA 2JCSA 2MR5A 4E5SA 4GAEA 1OB5A 1VXOA 1IEWA 1RRPA 4G0UA 1L6RA 1B26A 2JI7A 4W8GA 4JMPA 4BHTA 3RBXA 2Z8YM 3OWHA 4RKYA 3VR4A 4WECA 2OO3A 2Y0DA 3T7IA 3WL5A 4DCJA 1FYEA 1UJMA 2G07A 5CVDA 3SYKA 4A7PA 1R4AA 1GZUA 4XTCS 5J63A 1T1RA 3FAZA 4MDFA 5B3JC 1EM6A 3F0TA 3F4KA 2Y2VA 4F4UA 1XCPA 1NZFA 5DLDA 2WT8A 2IDJA 3TUIC 2HTFA 3Q7QA 3SSNA 4REOA 4XGIA 1W36D 2PL9A 2DU8A 3C3CA 2JW5A 3C45A 3CT6A 3G0HA 1RRKA 3QVLA 4W7HA 3B6ZA 3GY0A 3INNA 3KSRA 3K70C 3M5DA 2O54A 4X84A 4EIWA 2YYAA 4HGNA 3FNGA 3KT8A 5JBQA 4PHFA 1NVGA 4FN4A 2V5VA 3GHYA 5KVQA 5CA1B 5JROA 2CV2A 1VPDA 1ISRA 2QP3A 3PC8C 4TMZA 4AP6A 2FZVA 2QQ0A 1Z34A 2GLUA 1ZCJA 3GPIA 3DKKA 1KDOA 3EVCA 3GNTA 4RD2A 3BJMA 5SY9A 2PO7A 4EHAA 2XB8A 1Z5UA 2PKYX 4U8GA 4YRKA 2PEYA 2JAOA 4DNPA 3ZWAA 1L3CA 1X7YA 4PONA 1NDHA 4QVGA 4CEHA 2IS4A 1NUTA 3X1YA 1XEWX 1PS9A 1USVA 1W8IA 4NPHA 4ZVVA 4E11A 2EJBA 5L3QB 1WCXA 2IRWA 4JR1A 1IBMB 5J3JA 1BU8A 2BGGA 3WK9A 2OBNA 3AH8A 1QC5B 3IPRA 4RJJA 4AG6A 1C7QA 4IYJA 5HE9A 3DT9A 1PQYA 5AKLA 4EGFA 2ISSD 4EMBA 2O8NA 1K8ZB 4PZZA 4NY1A 4UFOA 1UMCA 3IE0A 1A7UA 3DDOA 3DBVO 2WM2A 5K99A 2GCIA 2AN5A 1NWCA 3DBHA 3K9WA 4KVFA 5BOVA 1MX9A 1KE1A 5B57C 1ZP6A 5L9AA 2R4QA 5A05A 1PYDA 2XXJA 3T52A 2G17A 4PG4A 1PT5A 3H5LA 1DJLA 3QXCA 3C3DA 3P0JA 4ROTA 3NI2A 4PICA 4YFVA 4AICA 1KSFX 2O1EA 4BQPA 3IVAA 2E4ZA 3FWNA 2FSSA 2WUGA 2NU7B 4INJA 3INRA 3DCYA 1ZK3A 2XYVA 4KQJA 1KO1A 2ZT8A 3PFNA 1GZSA 1SC9A 1DXHA 2P69A 3DAHA 2J9GA 4YBRA 5LJLA 3PLNA 5TGZA 3GNLA 5EESA 5C7YA 3GQBB 4HBZA 3ZV4A 4NMMA 2O0LA 3RIEA 2WWVD 2XTAA 2NTJA 2H4WA 3IMCA 1NFQA 4L8WB 1XTRA 1XLTA 2NAPA 3A6HA 1Z4JA 3DVRX 3Q5GA 1PV2A 4JSTA 5AKGA 3ZTWA 4C14A 1QIGA 1S2MA 3O8NA 4LSGA 3AFGA 4QGSA 5IM4A 4FMBB 1E98A 3QVWA 4BE7B 5HWSA 3L2OB 1HC7A 4M4SA 4FNGA 2GXUA 3S2ZA 3LFUA 5KINB 3AKZA 3STVA 4XXHA 2OHGA 2P2GA 2QW0X 4OF4A 4EUKA 2JEOA 5KYNA 3HA2A 3ND8A 3MSXA 5G0WA 3RYIB 5TIIA 1GD1O 2SECE 1GADO 4LISA 1U94A 1UDXA 1N2EA 2REQA 3Q3EA 4Y2XA 1ULAA 1H3FA 3EC7A 3TQFA 1GTSA 3CUSA 2B0JA 2OWDA 4H1HA 1G8KA 3E48A 3CNEA 1M76A 1EG2A 2H06A 3FD8A 2F1IA 3G9XA 3PC4A 4JT4A 2IXGA 4TSFA 3A6LA 4ZAFA 4D3ZA 4E31A 3CVUA 1BE1A 1KJYA 3HJHA 1U0SY 2GYYA 3ONEA 3AT1A 2QJFA 2XCOA 3SE0A 3STWA 4K6CA 4ALIA 4R7TA 5IXSA 2BGLA 3CN9A 5F2EA 4BAUA 3OPNA 3DKVA 1YZUA 2QENA 1GUAA 4NAVA 4NDZA 1J0CA 5CIWA 1OHHD 5EUMA 1R64A 3Q87B 2J0EA 1YNOA 5EKSA 5CFNA 4K86A 1ECFA 4PLFA 4U4AA 4HD8A 5D84A 5ALPA 1U9CA 2QTTA 2YJ4A 2WM9B 4PV7A 4XWAA 3MGCA 5FADA 4H1UA 2BF4A 1L0BA 2OG2A 3BGOS 1JT2A 2CZQA 3CPSA 3FWYA 4L02A 4AZVA 2XADA 2HB6A 1XGKA 2CYBA 2PAAA 2V4ZA 2ZRJA 2XB4A 2CHUA 2QMOA 4JP1A 4Q4JB 2IU0A 1SK8A 4EL5A 1D4OA 1E63A 1UPBA 1UZUA 4I14A 5E9JA 4EYKA 4DSOA 3D4PA 2VWPA 1WUHS 4W5WA 4BDTA 1P4AA 3PQEA 1N6IA 4KR9A 2PO5A 1I01A 2I2WA 3RRNA 3MMPA 4BV3A 4PNHA 1CDDA 1Z4QA 3JZMA 3BB1A 3FFXA 3QX9A 1T5LA 4ITRC 1NDQA 1Q7CA 4JX8A 1ZC3A 3UATA 4MWTA 3AUUA 2XCRB 1MDFA 3VPHA 4IRMA 5D3QA 2GPBA 3B2EA 4HDMB 4JT8A 4LJYA 2YICA 2DQKA 2IX9A 1EXMA 1QRDA 1BCSB 1RDFA 3FLAA 1MGOA 2LPMA 2AMJA 1IUOA 3L77A 4GUDA 5FPQA 3EPJA 1HZJA 2NXWA 2JFFA 1IB6A 1GG2A 1CIVA 3MPUA 1RAHA 1ZH4A 3HN6A 5EP1A 2OZEA 5JJCA 3DBLA 3ACCA 4BKPA 3ZY6A 5CDTA 4FM9A 4BGEA 1ACMA 3RRBA 1JEQA 1E5DA 4CG0A 4CHGA 3EXIB 3GROA 5LP6A 2WQ7A 3OFKA 1DKOA 3OQVA 4RYLA 2FZ4A 1SCUB 1T34A 3AHCA 5F2NA 3MB5A 2P6UA 1WA5A 2J33A 4I3GA 3KZKA 4KWHA 4BB5A 1K4YA 4LRXA 3S5JA 2ETVA 3IIMA 2NQ2C 4JFAA 1BX0A 1RWMA 3GRPA 4ZGWA 5JZOA 1VFNA 3KKZA 3V8PA 1Z75A 2HPVA 1GU0A 5K6RA 4J9UE 5G53C 1YB5A 4TWIA 2VZLA 1HZZC 2XYQA 1Z4LA 1A27A 4IJ6A 5A3RA 5JQGA 1HE1C 3F5FA 5U4QA 1UC8A 4M1YA 5B6PA 3BH6A 3ZE9A 4XGNA 4CMBA 1ENYA 1PEDA 1PR0A 3LJKA 4OL9A 1UBCA 4ENSA 1I7SB 1RMTA 1S2OA 2ZUBA 3HDVA 4L8GA 4UHJA 1MO2A 4XX0B 3UUGA 3D2AA 3ZGZA 1R6VA 1ZYUA 2XITA 2ANCA 3OZXA 2NW6A 4FB5A 2G67A 1KQOA 3EXEB 3HVIA 3K94A 5AWFC 3UM9A 3VTKA 3BZUA 4B3MB 1OBVA 4FGUA 2W2KB 5L3RA 1XDWA 4I9GA 2NTVA 4LJAA 3WFZA 1IK6A 3ULKA 4M9RA 4Y18A 2NG1A 3ZU4A 3PC7A 4EFLA 2V9CA 2OSBA 3AOEC 1SRRA 3KALA 5L3SA 4CKBA 2Q27A 4WV3A 3EIEA 5FWNA 4XFJA 1EUQA 4DGQA 1L4KA 2B4TO 4NHOA 5JNLA 3TW0A 4BWVA 1XN1A 3W2GA 4OX9B 3V1KA 3KSBC 5JXJA 3FJYA 3KS9A 3FTNA 3D1VA 1XNHA 2PGJA 2CD9A 2VXYA 1QNLA 3UXEA 2DFNA 3HCFA 1FZTA 3D7RA 4J43A 4DUGA 3IBCA 4KEAA 5EQFA 1E5QA 2ZU0C 3MGAA 4D45A 2HFJA 3A2NA 3LP6A 5CJPA 3ZTTA 2CF6A 5JPDA 1MEJA 3EEFA 4XLTA 4DLXA 2B21A 3QM1A 2RHBA 4N0MA 1XG5A 4RJLA 1Y8ZA 4KAFA 1ZR4A 4MDEA 1AUQA 1N8TA 2TMKA 3FGZA 3DMHA 2XNSA 3T7KA 4C0QC 2DFLA 4LHZA 4MPRA 3MJSA 1XP8A 4DCSA 3AILA 1DP4A 2BSAA 1QQ7A 2HMVA 2B9VA 1GPYA 3GWGA 2EBFX 2ZZKA 4PZ9A 4N6NA 2QN7A 5T8KA 3KSAC 3FNIA 4XVRA 4D97A 4LF9B 1B00A 4OMCA 4MB2A 1OIVA 3FGNA 1XUOA 5I7WA 1CNFA 3DOCA 4URFA 5EOVA 3K70D 4AVYA 3AW9A 1ULTA 4R9VA 3ID6C 4D25A 2OHIA 1TADA 3HYCA 4DM3A 3ED5A 1UKYA 3HZHA 3OT5A 1GRRA 3F98A 2Q9CA 3GJTA 3HCDA 4G2NA 1E7RA 4M60A 5AW7A 1JXMA 1FFCA 4KIWA 3JYNA 4G0YA 4RA6B 3W1VA 1JQEA 3MCAA 3I9MA 3Q9SA 4CMEA 2A9QA 4CDNA 5GTDA 4IUCS 2FQQA 2ZUWA 3F7MA 2Z2IA 2VRNA 5A9TA 5A9SB 3UGKA 1MVLA 2WMDA 2YV1A 1UFOA 4PG7A 1Z6AA 4M0EA 2F3RA 4IQ0A 3OJXA 4JGIA 1W75A 2VTKA 2JIMA 1YULA 3ICPA 2BLNA 1QNFA 4ND2A 2UDPA 2GHIA 5EC8A 4DQXA 5FKJA 3M3HA 1Z4KA 3OPYB 1JE0A 1T2CA 4FI3C 4W8HA 4HXYA 3STTA 4YAKA 4HHEA 1S2NA 1XQXA 5JS2A 3JS5A 2PTHA 4GQIA 2BGJA 2CL5A 3H8SA 2RJOA 2VTDA 1Q0HA 4NCNA 4Z3KA 1U0LA 6REQA 2A84A 2DWPA 1H3NA 5DYWA 1E32A 4C03A 3VHXA 2HHHB 1YJ5A 2VJQA 2CEKA 3C8ZA 2ZG6A 2C92A 4U2DA 1QYXA 2HHCA 4LA4A 2UYGA 2YQ4A 4OOFA 3QU5A 3T3PB 4BFXA 4KE8A 4E2WA 1AQLA 3PGLA 3AVUA 2WF6A 3TTVA 1XROA 3UUEA 2J48A 1H6CA 5EE3A 5EZ6B 3LY5A 3WIBA 1Z4MA 1F48A 1KK3A 2A78A 1IJKA 2COKA 4C3ZA 4L72A 4QBTA 4A2WA 3IJPA 2XA2A 1DBIA 1F2TB 3AJRA 4URVR 1T0BA 1RTTA 2QP4A 4GX2A 4FZ3A 2XUHA 1G3IA 3LYLA 4AF7A 4C1BA 4YR7A 5CVJA 1RC1A 4M9XA 4KE7A 3C6XA 4ZEWA 4DV0B 4CL3A 3HYLA 5ALNA 4AZ0B 3WGVA 4L2IA 2FP4A 2C2OA 2XUGA 4QTZA 2F43B 2ZRPA 4PAQA 5JFTA 4EPWA 3OKCA 4RS3A 5JAZA 2ADFA 4E21A 3KUXA 1FSZA 2ORIA 2R6AA 3L07A 1ADGA 3DDUA 4PZLA 1Z6ZA 4EG8A 3QE9Y 4JJZA 2QWXA 4UOZA 4YP5A 5IFKA 3JAWB 2H8GA 4B31A 1QHHA 4WLNA 2I0FA 2H2AA 4K9PA 1OFUX 5DSXA 5F7JA 3V4PB 3HK2A 1AV6A 1RKQA 1NFFA 2XJ4A 1SMKA 4RFSA 4X94A 3EZ2A 3SHFA 1FW8A 3FSRA 4C07A 5CLFA 5LD2C 2F8SA 3AERA 1XXHB 4LDJA 4WSOA 4X71A 2OMKA 3TEMA 3VOTA 3GU3A 3IALA 1WXFA 1XMIA 2F2TA 5FBQB 3TTSA 1NNSA 4PLZA 2WQ6A 1E96A 2CB0A 4MH0R 2C2WA 4ZARA 1LJLA 3LLCA 1GHTA 4NEGA 4CEIA 2I62A 2RHWA 2R87A 2ADOA 1QHIA 2JVIA 3MWFA 3L4KA 1LSUA 4HNAA 4WK0B 1JJ7A 3ZX4A 4M8NE 1Z74A 3I76A 2QVYX 1XPUA 1EFVA 3OZTA 4PYKA 2ZYGA 4GRIA 5H0IA 3T7CA 3E0QA 3QG1A 1OT5A 1EJBA 3K73O 2VZ9A 1EBBA 4K03A 1DEHA 2JFPA 1VM6A 3JYQA 3FR8A 4K9OA 4BB9A 1G9TA 5BVGA 1UBNA 3QK7A 2P9EA 5AVUA 4Y2SA 4IOLA 2JAQA 3F3KA 4P7GA 3SIXA 5IEJA 4EARA 2WMNB 1L4HA 3DFIA 2WAYA 4UVDA 3OOHA 4QDUA 5CTAA 4G0OA 4A82A 5B2EA 4PHTA 2ETXA 3CWZA 1J2JA 2YZGA 4RZ2A 4Y2QA 2XQGA 5IK2A 4WD3A 3NHRA 1GQ2A 1EFRA 1O8BA 2C57A 1TPYA 2R1VB 4G8CA 1MAHA 3TBFA 3BH7A 3IVMA 2GOYA 4KQKA 4EFNA 4IUYA 5ESWA 1BYIA 1FDTA 4UTNA 1LW6E 4ZKDA 4CMGA 2GKGA 4R8KA 3KR1A 3WJ7A 2CVQA 2XYHA 5B1DA 3HKEA 3EDRA 4B4UA 1C1YA 1DWOA 1B76A 1J33A 4KC0A 4Q1BA 3K9LA 4YXWA 3ZWBA 1K2WA 4CM1A 4FOTA 3EQZA 4XSHA 3CZAA 3AIMA 4DMRA 3NPAA 4XLZA 3X3HA 1GM5A 1UQUA 1HTWA 5IS2A 5M7EA 4XB2A 4I8DA 3H5OA 4P82A 3RFCA 2OCAA 3KB1A 4K26A 4IGAA 4NE7A 4UMVA 5H7XA 3R2JA 3W04A 4EM6A 2Y0PA 2PFGA 1PK7A 3DKRA 4TKZA 2FG5A 1EK5A 4EY7A 1BDHA 2ODNA 4MV0A 3P9XA 3AFMA 3O0TA 2DSTA 3I9V6 4OSOA 1I36A 2ESRA 5EIXA 1I80A 2PN1A 4X95A 5SZKB 1O6CA 1IZYA 2UYOA 4LZWA 1G5TA 4R1OA 5LLSA 3RV3A 1WHTA 4H4DA 4B7UA 2BHSA 1DELA 4JOSA 1A88A 3VU8A 4AJ9A 2O2ZA 1YASA 2W98A 3T7DA 4BO7A 1DUVG 2PU7A 2Y3IA 4GZMA 3EXHC 1RVDA 5DPMA 1I7DA 1H2YA 1S9HA 3THSA 5KJ1A 5MDHA 2JI8A 4MIYA 3PNYA 1E3LA 4FYVA 3W8DA 1FIUA 4ZOCA 5FUBA 1CS0A 1Y5NA 1NJGA 1RVV1 1V25A 1W85A 1G18A 1KYTA 2MWMA 1WUIS 1G8FA 3K1TA 2V6FA 1GAQA 1YJCA 4HOYA 1PR1A 4DY4A 2ZTSA 3DDHA 3DWIA 1E4EA 3PDIA 4Y1RB 2RGYA 1XHEA 4R8RA 3TQCA 2FP3A 3V7NA 5KKNB 1ETHA 1H66A 1T8RA 2WYIA 3Q0EA 2GEJA 4XYBA 5I7AA 1E1YA 3KZ1E 4HQNA 2XOKD 2WZCA 4V0MA 1JG1A 2DH6A 1UPUA 4RH0A 3W5IA 1T4DA 2H7XA 2JAXA 3FYDA 2B1JA 4OUDB 5B3JA 3D64A 4ATNA 4C4SA 2FEXA 1EK1A 1P5JA 1QKJA 5LDGA 1VYTA 5AIAA 1UBHS 2Q0SA 3EEOA 4ARIA 1WCV1 3CCCA 5IJXA 4YUAA 3JWIA 5FUQA 1BGVA 5A5FA 2VUUA 1MD9A 1PGJA 1G17A 2FAXA 1YRAA 3NEPX 1CKEA 1OXTA 4E7PA 5FB3A 4YRRA 4RXUA 2BR5A 1IBLB 1STOA 3PE6A 2VJAA 3MNFA 2CVPA 5PNTA 2OLKA 3T3GA 3L7IA 3LUGA 4DR1B 4EG4A 1YTUA 3CB2A 3DM5A 1H2RS 3RRYA 3WP0A 5KDDA 4ZVPA 1B6SA 2NUTB 5KOHB 4RJ2A 3CNOA 1BMTA 2Q3JA 1M34B 4RDXA 1J49A 2Q6KA 1ZUIA 1P4JA 4RANA 4TWRA 3OO0A 4S1NA 3VH2A 8OHMA 5A1TA 2F00A 2QVXX 5JAMA 2ZS7A 3GLRA 5JC1A 2J45A 4FUTA 2QT9A 4HQ6A 4RZSA 3N9IA 1NOIA 4EB6A 4P0QB 1P91A 1I2BA 2WFLA 3C1AA 3FG9A 2X8AA 1PJLA 3DDNA 3JRXA 1G16A 1GRCA 3C15C 3KSZO 2ZSKA 2ZAMA 3VNAA 4RLFA 3OVMA 1R5JA 2HSGA 3ZK8A 3GFPA 2J5XA 2QRZA 2VCEA 1QQAA 1VLMA 2WAAA 4BC1A 4R8VA 5B64A 1WUJS 2F3SA 1CS4C 3L8MA 3HN2A 2NZJA 3M9XA 3WL4A 1DDIA 5ICSA 2XGJA 3BQ9A 4OYYA 1Z6YA 2Q4BA 1J8YF 2ZDHA 1IE3A 3B6JA 3HXKA 4H3SA 3WLMA 2GO7A 5IX8A 3SEQA 1JJVA 2JDIA 1XAHA 3R4VA 4ALKA 1X1CA 5BWCA 2IIVA 1YHNA 2EJWA 4MZDA 4TM8A 2WWFA 3LF1A 3F1KA 3P2YA 3UCFA 3K09C 3ISTA 3U5TA 4YAUA 5JZMA 1N8SA 2QVGA 3T3NA 1NYLA 3K1ZA 3D3QA 4OA8A 1FFHA 1EVJA 1G8MA 2VNJA 4JBYA 4QKQA 3UKOA 1KBQA 4W9MC 5DXAA 3W2HA 1CEYA 1E9DA 2E5FA 3G9ZA 3KT6A 2BH9A 3KYDB 4RK1A 1MKYA 2IZ1A 2VHEA 3LPNA 2HF2A 2BI7A 4IGEA 4TV8F 1JJAA 4ZMRA 4YVFA 4U1RA 2O3RA 2WZQA 3H1BA 1H94A 4FSXA 4PPQA 5TV2A 1DIBA 4DNQA 3NS7A 2V6MA 5CAEB 2ZDQA 3I9KA 4IXWA 1ICIA 4ZI2A 5ILOA 2OO5A 1W30A 2IF0A 3FX2A 4F5WA 3HO8A 4DDVA 3DV9A 4EMUA 2HDOA 2HHAA 4NI5A 4L0QA 3W4JA 3M0EA 3CY6A 5FOTA 3BFJA 4GM4A 1NXXA 3M6MD 5CH8A 4ZPXA 1V8ZA 3VH1A 4WK2B 1JEYA 3PYXA 4I6EA 1GTMA 4IIJB 2IYQA 4LJ4A 3E9YA 5KOHA 4QBFA 4KGVA 4O2AA 2VF8A 5A9RA 4LE0A 5K7SA 5IAAA 3HR8A 3IE1A 2DKNA 3EZGA 3X1XA 4B45A 4ENVA 1X7HA 1XZEA 1U3FA 5FTWA 3K9GA 4DFDA 3U4QB 1TX4B 2C2MA 1N2ZA 1YD7A 2RK3A 3HNPA 2H1SA 1NU8A 4DA4A 3FZEA 3R41A 2RHTA 1BN7A 1QFXA 4MWGA 3STHA 2RHGB 1P2UA 4FK8A 4HWRA 5LMCA 4HDCA 5IBCA 1NQTA 1THGA 3C7CB 3FN4A 2IEBA 3IELA 1KYZA 4BNWA 1BG6A 4RESA 2B1GA 1UK7A 2PJDA 5BSTA 1HQKA 3E15A 1M6EX 4PS0A 5AFSA 2I6FA 2F3TA 1Z5GA 4ND6A 4PZUA 3V4OA 1I3CA 4ZAVA 5FWXB 4UM7A 4BASA 3IXLA 3V48A 1PLLA 1XTJA 1Z2DA 4JJ6A 3U4CA 2KI5A 4FYPA 1GTL1 5I4CA 4NV0A 2XDAA 3CPHA 2MSWA 4KXQA 4ZO4A 4GECA 5F7ZA 4ND1A 3FHLA 3RIXA 1GYPA 4KJZA 2RC6A 2ZRDA 4DN6A 1K6JA 4YIHA 4ZHQA 4PAMA 2X1HA 4LOIA 5LMUB 3VGPA 1WB9A 1Z5NA 1W4ZA 2HCTA 3B2QA 3OH8A 1V26A 4D4LA 4D9HA 4AJOA 5K8VA 4N0PA 1L1RA 4FE3A 3L49A 1H93A 4HVCA 5DW0A 1FX1A 3V32A 4ZCRA 2YNMC 4MQFA 3B7WA 1Z68A 3N6RA 2BKVA 3QWAA 4Q19A 5IASA 1KNXA 2DTXA 1PFUA 2QP9X 2SBTA 3C8MA 3EPRA 3DMTC 1U02A 3V1MA 4DL9A 4KN9S 3CLSD 1MEOA 2Q1TA 3PEUA 1WJGA 5K0EA 3AL3A 1LX7A 2HFKA 2O7RA 4ZU6X 3JU3A 1TD9A 5JSUA 1NVAA 1QQTA 2JGLA 3ESRA 5U1PA 5AHXA 4BMYA 3OQBA 4K7JA 3C5VA 3NWJA 1ZZGA 4PPFA 1KJNA 3A4YA 3CZ4A 4H6XA 1OWPA 3QHPA 1ZEMA 1FU8A 2CEAA 3CLUD 1P45A 1Y3BE 2XI4A 1LEHA 1DLJA 2EBUA 3MT7A 5EUBA 5JPIA 3OWOA 3FSGA 3T3HA 4C08A 2O5VA 2IOYA 1T13A 1MH9A 1W4RA 2ZBVA 1KEWA 4BZPA 5ECDA 1UDRA 4EGSA 5IM4F 3EPPA 3MAGA 3ZHVA 2I6UA 3EF1A 1U0FA 1D5CA 3D5EA 1ECCA 3QFHA 4BNYA 5BV1A 1AKQA 1NHWA 2VT6A 4U00A 3G9TA 5KWJA 5IC4A 4PIPA 1YZQA 2DUMA 4DS3A 5E6RA 3ZD9A 4AJIA 1QRUA 3O31A 3LBNA 3TL2A 4P0PB 5IKEA 1UINA 3PJFA 2AOTB 1KYVA 4CMHA 1CR2A 3AKCA 1KZGB 1T2VA 2RMKA 3BE8A 3FWKA 4MAMA 2J4FA 3R3WA 5DU2A 1P6XA 2VXOA 5E7JA 4DABA 2W2QA 2XOKA 4NBSA 4AP9A 4UTPA 1I7QB 4Y7CA 3GT7A 2OORA 4C0HA 2WB4A 3OT4A 5KTRA 3ZD6A 3EWNA 1TA0A 5FI1B 1OBCA 2JFHA 5DCLA 3TX2A 4Q93A 3TW6A 5JFOA 2VDWA 5HJ7A 4PYJA 5ADWA 4WFKA 4RTMA 2OFWA 3IBYA 4QWMA 1XD9A 1G7CA 2WTAA 1JR4A 1GRVA 2Q4TA 4L8VA 4MNTA 4R54A 4YLGA 3R7WA 3SI7A 5FBVB 1I2AA 4OHXA 1H9AA 4NBLA 5LYJB 4A0FA 4B4OA 1ENPA 1SH7A 2QQ5A 4QUIA 2A94A 2GPAA 2XDYA 1Y1RA 3JQ7B 5AI6A 1HDGO 4RPGA 4F5YA 7GPBA 1CUSA 3DMFA 1GPH1 3CRNA 3BGDA 4M0CA 3WGTA 3RAFC 4B3RB 1VBKA 1IM8A 3GP5A 2PDAA 2VVTA 2PD6A 3VZCA 3DLTA 1UK9A 1J39A 2WJ4A 2X8WA 4I1VA 2M1XA 4GU5A 2O2JA 3I2FA 4DLAA 2PT6A 4ITVA 4E2FA 3LBYA 3KQPA 1CF9A 3I6IA 2M6SA 3AHGA 4NCIA 4PVCA 4ACAA 3C85A 3OPYI 4NMHA 1ZR2A 1Q5PA 5ARBA 3BKWA 3CS3A 2E6UX 2XSZD 3GYGA 3PI6A 1OX4A 4L0MA 5BSGA 2BELA 3UBTA 2CUNA 4I36A 4FDVA 5I8WA 1IK4A 2DSNA 1V41E 2R8YA 2V1UA 3QF4B 3NJ8A 4HGRA 2ZYIA 1AN9A 1ESNA 4NV3A 2H4JA 4U2FA 4B6OA 4BLPA 2B35A 4KFSA 3C5CA 3IUJA 4WEQA 2Q3BA 3IAEA 4HJXA 4URWR 1ISGA 3HFSA 1ZLYA 4R1TA 3RU9A 2IC5A 1LPBB 3ER9A 2BWJA 2X5JO 3WWPA 3KFLA 4DE5A 5EWLA 2PQ6A 1JI0A 1IBCA 2AZXA 2GEFA 2AG6A 5BQXA 5ES4B 1QVVA 1LLCA 3PFKA 2I76A 3UMFA 3EOZA 4CTMA 1I4WA 4F5EA 3RKUA 4WBNA 4WAUA 4KV7A 4GZ3A 5M3BA 4O3MA 2I55A 3G7SA 3VQTA 2F9MA 5FTNA 1BW9B 4JXKA 4TKVB 1CZKA 1JSZA 1GR1A 4DJTA 2QW8A 3HY4A 3BJRA 3QWIA 3UHPA 4C6RA 1WUKS 1YDWA 1C1DA 3E1GA 3F6CA 3FMGA 4WKCA 4E5KA 5JQGF 2B61A 1GZVA 1ZXLA 1V45E 3AF3A 2YYZA 1O1YA 3DE1X 4OGFA 4CMIA 3CR8A 4DANA 3QF7A 2FDXA 3CLKA 2FDCA 3KLOA 3U7QB 1XPJA 4EG3A 4OU5A 1NM5C 4Q3EA 1WDTA 5ESXA 1LPMA 5K3SA 5B36A 1J7KA 5P8WA 1WZEA 3SXJA 4BLTA 1QAMA 3QEAZ 1KDTA 3BF8A 2XWBF 4W1QA 4ZA2A 3SHTA 5JIBA 1XELA 2HD4A 3G85A 5A7GA 3SQXA 4LMRA 1XJQA 3N7TA 2R25B 2EHDA 1Q74A 2C77A 2Q62A 3D6AA 3GLQA 4YROA 3SS7X 4Z4GA 4E32A 1NT2A 2WYOA 2PS9A 2VIIA 2X4LA 1C4XA 3WYNA 3X1KA 4AWXA 4Y1EA 3ZWPA 1QJ4A 2Q7XA 2FJUA 3MC1A 5KUTA 4Z7NB 2JVJA 3SZLA 3N2LA 3CMMA 1DHRA 3ETJA 3OWXA 3KE9A 3EVBA 4QE3A 3W5JA 5AMXA 4N82A 3LCVB 5I47A 4HDOB 1VPVA 4H31A 4R41A 2HC9A 3A1SA 4YO8A 1OXBB 4PEVA 1C2YA 4G5YA 3ZUPA 5DTMA 2CXPA 2P75A 3OE7A 1E9VA 3D6TB 2IY7A 3RS4A 5HGXA 1IEVA 1GTZA 2CL6X 2FSGA 4KNYA 3SEFA 4H6VA 5CB4B 3VYVA 4CU5A 3EUEA 4F56A 2AFVA 3PHIA 2B4RO 4JBIA 2DFKB 2K4MA 2OE2A 4KIUA 5ESDA 4KNWA 2XYPA 3OEHA 4BKOA 2IHBA 2X7JA 4UMDA 4UPVA 5IG2A 1TM7E 1LI5A 1TT5A 1U9ZA 3OOYA 5FTJA 2QSYA 2ZI3A 5JD6A 4E51A 3IOBA 2VFAA 2B4QA 1TJPB 4QXOA 4YMIA 5ECWA 1H22A 2GPYA 3GLFB 4N3AA 3SC2B 3UMVA 3PIDA 1W87A 4OGGA 4B82A 4L8LA 2Q3DA 1XWWA 2M2IA 1QYIA 5EIFA 4COOA 1CVIA 3JY6A 4UOEA 3TRFA 3UFXA 1USUA 2V45A 1HT0A 3AYXB 1P0IA 4L9AA 3ABRB 5HR5A 3SIPA 1R4NA 2LDBA 1YU6A 4KSYA 3SIRA 1IRXA 2RAFA 1O6ZA 2XWSA 1RXYA 4BRWA 1L2TA 2IUSA 1XL1A 1YHYA 1JV2B 4O4IB 1K4KA 3UV3A 4MJ3A 4LSZA 4F38A 5JR3A 4EO7A 2OOSA 1C7JA 3KKEA 4JR0A 4LRQA 4R84A 1H05A 1U99A 2VDPB 5FT9A 2C83A 1TYAE 4G8BA 1Y4ZA 3W6ZA 1UL1X 2NYUA 1YBFA 1CETA 1ENOA 2C03A 4EY3A 4G37A 4PHCA 4RMHA 1KP3A 1MEEA 4TN1A 3BCSA 4WXMA 1N5IA 4D57A 1RPAA 1BC5A 3ZY5A 3WLSA 2HMAA 2KW5A 3EBLA 2VYVD 4MVJI 2YNMD 4EUNA 5IHPA 4XH9B 5FEUA 1DV2A 3KEFA 4O2RA 5E3HA 1PZEA 4IYRA 2GQ0A 1DIHA 4KZKA 2POQX 3V00A 2VDMB 4PGGA 4UU1A 1QG6A 3VJMA 4GNRA 1S3IA 3BXEA 2H1LA 3CXUA 1NTOA 1HSOA 2H16A 3JQAA 3K0AA 4PTZA 2BFNA 3OEWA 4G5GA 5BYKA 3FOZA 2GN2A 3RVRA 1FNCA 4ZVUA 3Q1LA 4I6GA 1P5HA 5DX1A 3EGDA 4AZWA 1NLZA 1ZRNA 2XF8A 3FCEA 5HE8A 3TIXB 3WDMA 1EA7A 1O2DA 3BWDD 3KG2A 1MNAA 3N8KA 3RTEA 2OCBA 4OQNA 4NPCA 3TPCA 1UBOS 2JIZD 5FBKA 2DULA 2FSUA 2Z0MA 2ZRMA 2Z2JA 2VC2B 3NVDA 5ALMA 4B0PA 2H2GA 5C3MA 4KH1A 1KJIA 2X1LA 2BGMA 3EXHA 3FCYA 4JC0A 5JD4A 2H57A 1JKXA 1XK6A 1WSBA 2DLCX 1TF2A 1KO8A 1Z4NA 3HUEA 1G6OA 1WO8A 2C5EA 3D2BA 3U3XA 2FMXA 1WXHA 1NMQA 2IP2A 2PIAA 1RI2A 4MICA 4DSTA 3RJ5A 3ANSA 5FNVF 2WYWA 1FS4A 1CUYA 1KMQA 1X0VA 2FA9A 2K87A 3W6OA 1M2NA 5JH7F 3DLBA 3MWJA 1KI9A 1F1BA 3U7RA 1DAMA 2DUUA 4B84A 1O5IA 1HOXA 1UZMA 4HAWA 4TTPA 3VZQA 1EAYA 4W82A 1KDRA 2KQUA 1EFCA 2OV8A 1OXVA 1GO2A 3A9UA 4FGSA 3A6FA 4LYJA 1DSSG 2A0UA 5DN9A 1QAOA 5KNBD 4JEMA 1AZLA 1GQRA 1PLKA 1QF9A 1TZMA 4PC2A 1VKZA 2D2EA 2HM7A 1OOEA 3TQSA 4EFMA 2IK8A 3PL5A 3VVMA 4YRZA 3ETNA 2BSQA 3E9QA 2PCLA 4RF3A 3ZVLA 1V7ZA 1D5WA 1GA1A 1N5MA 2GZ2A 1FBNA 3H99A 3KD2A 1ZW1A 1L7RA 2FWRA 4HR7A 2F8MA 3LK7A 1UEXC 4L1KA 4LPSA 2O8DA 3KJGA 1CDOA 2I6QA 3ELYA 1JLSA 2BEKA 4UARA 4YQYA 2WTUA 4M54A 4RD1A 3MM4A 5HQJA 5HYVA 1HQDA 2FPPB 3Q9UA 4GIBA 1R88A 4F96A 3NEJA 2ORWA 1OR8A 2RH4A 2WU1A 3GT0A 5DFAA 3OT1A 3G2OA 1CU1A 4ZCPA 4F2WA 1A9OA 2H00A 4OYRA 4ZALA 3VU0A 4YBZA 4CG3A 2CLOB 3HY6A 1B74A 1GKUB 5IWCA 3DFMA 5CT8A 1CEEA 1NW5A 5KYYB 3KQKA 1KEUA 1ORDA 2MHCA 4KZPA 3UJNA 2CSXA 1U81A 4QJ5A 5FLKA 3WL8A 2NUPA 2QVZX 4ND8B 1QR6A 5ALXA 3U9LA 4DAEA 1HX7A 1R37A 3ENZA 1Z33A 2C95A 2DR2A 3VJKA 5J4KA 2YFYA 2QR3A 4LDNA 4WXEA 5I7EA 1VHWA 5TJ9A 5K8TA 1EEXB 1FX0A 3G8YA 1UJ4A 2Q8PA 2VPIA 2ROQA 1JEOA 2VYNA 3QUBA 4RIEA 1QU2A 4WWHA 1ZGCA 2PZAA 3C16C 3BPSA 2CC2A 1DUSA 1XTBA 1LSSA 4HNSA 3ADPA 4A0GA 4HDRA 1IUNA 1U2SA 1HG1A 2X0DA 4CCYA 1B42A 1ISPA 1EKXA 2AMYA 2WIKA 2Z8ZA 4RZQA 5H02A 4C6SA 2JIOA 4E5VA 2UYCA 2QBYA 1NAIA 4PRKA 5JWRA 1PAUA 1FSSA 2A30A 4LWQA 1NRJB 2FRVA 4GI2A 1D2CA 2PUBA 3M89A 4QD3A 1EDBA 1ZK1A 3AHHA 3K09A 1J07A 4MHOA 5CX1B 3ZJ5A 1RRCA 1G98A 4G5SA 1PG0A 2AB0A 4MRMA 2VUHB 1DE0A 1D2GA 3E05A 1D2AA 4XGKA 1IQ0A 1XMJA 3EPLA 3MJ4A 4TTQA 4DWWA 8GPBA 2YRXA 3PIRA 2TS1A 2ZIAA 5TEVA 4PZDA 3ZWOA 3VA7A 4QRHA 3CZ5A 4J07A 1E9FA 3KQYA 4CIWA 1LI4A 2EZTA 3GRAA 4QHTA 2FK8A 2IYZA 3LCCA 1KP2A 4Y98A 4ZQCB 1CNMA 2EHJA 3PHJA 4HEA6 1Q2UA 2I3DA 5IFLA 2AMFA 3ZHBA 2XCSB 3WMRA 3KOWA 4DZZA 1AN0A 1K6EA 5FFMA 1RJ9B 5BSFA 3U61B 4JB8A 4G6ZA 1QHGA 5F77A 2YIDA 1M9NA 1H4TA 1K06A 4KRXA 4DLWA 5L6LB 1Z0IA 4W99A 4Y7DA 3LBAA 1L1EA 4I81A 5KNLA 4C2UA 1BJRE 1UBUS 2NZXA 2EJUA 2QRHA 4AUEA 1T5BA 3MJVA 5GJCA 4JCOA 3FLEA 1H1DA 2VPXA 3D9QX 3RF7A 4A0SA 1P7YA 5LNK6 1T15A 2M98A 3USES 3OPMA 4YUWA 2PWYA 4IV5A 2DLNA 2HRCA 3OLVA 1OVGA 4JASB 2AFRA 1U2EA 2YX1A 4BX2A 2VNSA 3J7AC 2EGGA 1E9BA 1DJPA 1P29A 2V0NA 3COYA 5BN1A 2QNIA 2L69A 2P4SA 5JHHB 5TMBA 3O8BA 1DO0A 3PQ8A 3DD5A 4AUNA 3WIDA 5FL7D 2UUBB 1JJIA 2K7FA 3IMEA 1O5TA 1MRZA 2VQSA 3OCXA 4QFCA 1E77A 2HXGA 4OBEA 4QDTA 2BKLA 4TV9F 3WL6A 1TIBA 4HB3A 4ID3A 1X9GA 1EFPA 4OHRA 5JSHA 3HBLA 4YP6A 5G02A 1NZDA 2C82A 2D62A 3AEKB 3HDJA 4D8XA 3S1AA 2YWBA 2BW0A 1BCRA 3NATA 2OB1A 4JZYA 1COWA 4BQSA 4NYJQ 2BY4A 4ZK2A 2XBMA 4N76A 1QTQA 4UBOA 3CH6A 4AIRA 2Q9UA 1BIFA 1J8MF 1DTEA 4DLRA 5AD1A 3WGUA 2Z2XA 3OG9A 3QX8A 4BVFA 4BLVA 2A8YA 3PJGA 4I9UA 5DBGA 2B8JA 2ZWIA 3ZBUA 3HBMA 2QX9A 4FBMA 1AUOA 4MYHA 4Q5IA 5K6TA 4FFPA 2WHRA 1GVHA 3AW8A 3ZCUA 2G5TA 1GILA 3BVPA 5EIEA 1ZMXA 3REQB 4EAAA 5DI3A 1XFAA 2XNDD 2QX8A 3UOGA 3JSXA 3MQ2A 5K09A 3NYWA 1QVRA 2LNDA 2YNMA 4BNHA 5M29A 3OJEA 4BJ5A 1IXRC 2OV3A 1K2VN 5ECGC 4WACA 2RKBA 1PR3A 3GZNA 3L0OA 1OBOA 4RTSA 1JFVA 3OAAD 4JZKA 4P98A 3QI7A 3R77A 4J9VA 5DX0A 1NW3A 5BOSA 4HATA 4ZVTA 3VKHA 1K7XB 1NMYA 2FFBA 4ZCTA 1JN0A 2ZXUA 3HSYA 2OQIA 1NWHA 5AVYA 3B6MA 4Z8YA 3KR2A 4JLBA 5LCXA 2VTBA 2QMYA 3KC2A 5DXJA 2P90A 3IP9A 3EISA 1SO8A 5A3VA 4HH3C 3H9GA 4K9DA 3CRMA 3ORFA 2A1IA 2P2DA 4IDDA 3T9FA 4YUYA 1LWOA 3JVUA 1UC9A 2IKSA 1Y6ZA 3PXBA 2C04A 4NONA 3SLRA 4BQRA 1FQWA 2P40A 2YN2A 4OHBA 5AXAA 4RGBA 3AQ4A 3OFJA 4ZGGA 1U9JA 3H0KA 5KWSA 4ANFA 4F6RB 4UFPA 4QXRA 1NV8A 3I2KA 1U3CA 1ISSA 1JJFA 1U8CB 4FX5A 5JS7A 3QELB 3CM0A 2RHLA 2XMRA 1PJBA 4O5AA 3HXMA 4ZTZB 2P1ZA 3RM3A 1ZS9A 3GP8A 1QIFA 5BN4B 2WDZA 3VU9A 1TCUA 3M4XA 4X00A 4PQRA 4IICA 1ZH6A 5FJIA 1SXJB 2ABWA 3VHLB 3V4ZA 2JGIA 2Q7OE 4PGMA 3JWJA 2Z95A 4DQ0A 1VKOA 1P9NA 3DBRA 4JEHA 3KQQA 1KY4A 1U0RA 5FTMA 4D26A 5DHRA 1AHNA 1R10A 3NIFB 2NV6A 3OZAA 3V80A 1JFFA 4O2AF 1JFRA 2Z6QA 1E66A 1JVSA 1RQ2A 3LA8A 2Q1YA 4G97A 5KU1A 1BD3A 1ESZA 3PJDA 2WIBA 4XSGA 4BV9A 4NLLA 2QRQA 1ID8A 3RVJA 1YT5A 3AESB 1ZDMA 1TRHA 2R1TB 2L42A 3H2GA 4L4RA 2OYCA 2P65A 3V4VB 3WGYA 1J5XA 3WR5A 4B6PA 5L51A 1BX3A 1UQTA 3B48A 2O0KA 2EX4A 5TNXA 2V4UA 4JJFA 5A5DA 2Q2OA 2G5GX 4MR8B 1E6CA 4L7VA 4KFUA 2PX5A 3R74A 1F14A 2P0AA 3IQWA 7YASA 5AKJA 1N5JA 3R7BA 4RBNA 1O97D 3LKVA 4FSDA 2IQIA 3PPWA 4FYJA 4IDFA 3WK4A 1JDPA 2ZR7A 4LJ7A 5FAKA 3GJSA 4N3CA 5I5EA 2ZUEA 4JI6B 4JJ8A 2Y4OA 2PPLA 3G6WA 3ZJYA 3WA6A 5ALIA 4Y2JA 1PFQA 3LXUX 2W2XA 4GMHA 4RSMA 4OXYA 4DWOA 3N8GA 3SYNA 4I5IA 4BMSA 1HH4A 5AICA 4B3TB 4L95C 4FZVA 1GPBA 2WWRA 2FQYA 1OXUA 2D06A 3N0WA 1L7EA 3QWFA 3DNMA 4HQFA 1WSDA 1QYDA 2YVAA 2Z58A 4GMXA 2UYYA 2WF8A 3IUNA 1E1QA 4NV1A 3HGQA 4QPJC 1JNXX 2HQBA 2PGNA 3ZCTA 2F17A 1AUVA 1WM1A 5DYIA 3LTNC 4YUXA 2IX3A 1QORA 4P4SA 5BSVA 1ZI8A 3ZVRA 5JNVA 1U7UA 2LKCA 3EXFA 4KP7A 3Q2KA 1I94B 2R6ZA 1B73A 1M8KA 1WQ1R 2GKSA 2JLWA 4FS8A 1Q1AA 3KNZA 5ALYA 3UKDA 2YUIA 5IULC 5J40A 1RCTE 3CJTA 2Q5QA 1MU0A 1EE1A 3GBPA 4JSYA 1L8LA 2C9ZA 3SBXA 5LKAA 2IHNA 1TNDA 3E7DA 3ESZA 3L0YA 2XYRA 4MUAA 2I34A 2I7TA 3DYIA 2J85A 2WF7A 2WG2A 4RLQA 5FH9A 4DB4A 2H9AA 4HQOA 3AR6A 3H4MA 1HT2E 1XU7A 4MKZA 3RARA 1QP0A 4KDFA 1HE3A 4UXHA 4JI5B 4EWLA 3KU4A 2WPDA 2Z1NA 1XJCA 1IOVA 5JY1A 1FYXA 4B3DA 2E48A 3I12A 4QU8A 3NJ4A 1PNVA 5FV4A 1W5BA 1XAIA 3M5CA 1QRTA 2PKQO 3ONWA 1MTOA 1ZUNB 4OMUA 4X66B 4IQGA 2YWFA 2XR1A 4Z0HO 2WHPA 2XZLA 2HY7A 1OT3A 1WAMA 3DT6A 4C30A 3DCJA 2WWXA 4AMVA 3JW8A 4HWOA 4BVHA 1N0WA 4GBJA 5IABA 2P9QA 4BE4A 2OT3B 2OC4A 1C0LA 2JJ1D 1U5BB 4JUBA 4M1MA 2DMRA 4L5YA 1SQSA 1WDLA 4L51A 4MXDA 2AZTA 2CSUA 2REXB 4II2A 1E6UA 2ISCA 2ZBQA 3HP7A 5B7GA 1G5PA 4D8TA 1JEEA 2HWYA 1IEQA 1ZMBA 1ULZA 4BNFA 3RYTC 3W8RA 4NCJA 3R7DA 3TPFA 1TVKA 1BA3A 4PTLA 2IA5A 3BIOA 4N12A 1NVMB 3WDLA 1PWYE 3B9BA 2VT3A 5KYVA 5A4DA 2WVGA 4LFBB 3PB3A 3AF2A 3VTAA 2YHAA 4TQUS 1L5VA 3ITDA 2O8BA 2I2BA 1N5DA 1RKVA 3C5WP 4BVGA 3DZIA 3IR5A 3H0CA 1I2DA 5KNCD 1OQAA 5HFJA 1NKTA 2EXXA 3K1AA 1X3LA 1KZ6A 2FVXA 2QZJA 3ON5A 3RSOA 3TR6A 3IPXA 5BWMA 4P4UA 4J91A 3ASZA 1R5OA 2IZ0A 2VXBA 4QGAA 5TQVA 4B4DA 2G71A 16PKA 3GI1A 4IJQA 4NZ9A 5C2JB 3AHFA 5CT9A 3IUBA 1I6WA 2GVNA 4D9MA 2DR3A 2Q1XA 4IH1A 4GR9A 4BKRA 4F45A 3QLUA 3PSAA 1Z0JA 3QJYA 3FA2A 3TMKA 4J2OA 3ZTYA 5EJEA 1NVXQ 3S40A 1KTIA 4NOKA 1LRJA 2Q3EA 2VJYA 3WLQA 1ZM9A 2P4EA 3L7JA 2Q8NA 3EQ9A 3D43A 3KOYA 4RVNA 2R7NA 4DMGA 2NV2B 2CUKA 4AI6A 4UM5A 4ZOLA 4G1UC 2R8EA 3L40A 1S2IA 521PA 5L7YA 1VJ1A 2BFAA 4TMKA 2PRZA 4D44A 5L95A 2XIJA 1QGDA 1VLLA 3KB8A 3V7UA 3W5UA 4QHYA 1LPSA 4RDHA 1VCOA 3KWMA 2LXNA 4Q7JB 2CDNA 2JANA 4LBYA 4RABA 2GTPA 1GGVA 5TQ0B 1P0CA 5P21A 4OB7A 5ADVA 2QLNA 3BTUA 3BXFA 1DAEA 4MVJG 4RH1A 4I4LA 2PU5A 1E2KA 3LC1O 4OFZA 5HZHA 1ZM7A 3RHFA 4D80A 2VKQA 4IDCA 1P81A 1UXOA 3S2EA 4R5HA 2A1UB 4I4NA 4OQFA 4R9RA 4F84A 2W7TA 1QZTA 3PGVA 4AX8A 2WFZA 3C41J 2OP1A 1LDYA 1SG9A 2YDYA 2D2IA 3OCWA 1QG4A 1ZONA 5TPWA 3ZVKA 2WLTA 1L4LA 2N75A 1XLVA 1FFAA 1ODJA 1OY1A 1OPXA 1X94A 2AJDA 3ZDFA 2IY9A 1JLKA 3EZYA 4CLEA 2VJMB 1XRQA 4LXQA 4AJHA 1RTKA 1V11B 1NUQA 1BDJA 4D4MA 4ZMSA 2ZIXB 1JR3E 2QLLA 4G0MA 3PLAE 3D3EA 1J21A 2OD2A 2Z9DA 4WXYB 1M2HA 1C3XA 1N1MA 3IAM6 4BKQA 4GRAA 1V3VA 2FOXA 4FDUA 3CX7A 2DGDA 4F2PA 2AQIA 3Q6NA 2G9VA 2P68A 3D81A 4LRYA 4Y2HA 3WIOA 4WVFA 4HUQA 3WHLA 2H2FA 4CR8A 1N2GA 2JI4A 4PPYA 1RPTA 3L93A 1ATIA 2V7UA 4G81A 4TWZA 1V5EA 1QPGA 1NNUA 2ID8A 3IHTA 3FJOA 3LK6A 4LOLA 1KXJA 3MUEA 4UZFA 3CG4A 3JD1A 3ZX5A 1YVPA 4L8YA 1HSZA 3WDSA 1JR3A 5K01A 3C74A 2P9FA 4X1YA 1RMYA 2A86A 1JPVA 1BOFA 3IAS6 4BX3A 1CG6A 4RETA 2AE1A 4E5YA 3I4LA 2VYQA 4BXOB 4A2QA 3RWMB 1R0RE 2J4CA 3ZU2A 2ZJ1A 4DC9A 5DB4A 5JYCA 3AU9A 5AVOA 2HWWA 1VCMA 3FYUB 1E8NA 1P72A 5EE1A 3ZG6A 5ALUA 1X8XA 1L7NA 4FYIA 1U8FO 3WV5A 1M6VA 3NTQA 2IV2X 4ESHA 1SM4A 1WNTA 3MJCA 3HNOA 3QTBA 1X7XA 4JGGA 1KPIA 2BEVB 3GFFA