1SIUA

Kumamolisin-as e78h mutant
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
354
structure length
354
Chain Sequence
b'TAYTPLDVAQAYQFPEGLDGQGQCIAIIELGGGYDEASLAQYFASLGVPAPQVVSVSVDGASNQPTGDPSGPDGHVELDIEVAGALAPGAKFAVYFAPNTDAGFLDAITTAIHDPTLKPSVVSISWGGPEDSWTSAAIAAMNRAFLDAAALGVTVLAAAGDSGSTDGEQDGLYHVDFPAASPYVLACGGTRLVASGGRIAQETVWNDGPDGGATGGGVSRIFPLPAWQEHANVPPSANPGASSGRGVPDLAGNADPATGYEVVIDGEATVIGGTSAVAPLFAALVARINQKLGKAVGYLNPTLYQLPADVFHDITEGNNDIANRAQIYQAGPGWDPCTGLGSPIGVRLLQALLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords kumamolisin-As
publication title Crystallographic and biochemical investigations of kumamolisin-As, a serine-carboxyl peptidase with collagenase activity
pubmed doi rcsb
source organism Alicyclobacillus sendaiensis
molecule tags Hydrolase
total genus 111
structure length 354
sequence length 354
ec nomenclature
pdb deposition date 2004-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1siuA00
5JMOA 1BE8A 1BFUA 3BX1A 4LVNA 1NDUA 3TI9A 1SUEA 3I30X 2WUWE 1P7VA 3GT4A 3DDZX 4DZTA 3DE4X 3DE5X 1Y3CE 3WIUA 1Y48E 3DVQX 1SBCA 1GTL1 2PMWB 1SBHA 2SECE 1T1IA 3DE2X 4ZARA 3AJ8A 3I37X 3LPCA 3EE6A 1TMGE 1CSEE 3BPSA 4KPGA 1TM3E 1SCDA 1CNMA 1SUDA 1PFGA 1ST2A 1PJ8A 1EA7A 4OMDA 3LPAA 1TM4E 1SBNE 1BFKA 1BE6A 3DYBA 3PTLA 4NE9A 1AF4A 4C3VA 1T1EA 5JXGA 3GCXA 4KB5A 1BH6A 4DWWA 1WSDA 1DBIA 1SH7A 4FONA 4NMXB 4KG7A 1R64A 3PRKE 4OMCA 1SBIA 3D9QX 3HJRA 5I9SA 3ZXYA 4K8RB 3LPDA 2IXTA 1VSBA 1TK2A 5ARCA 1Y4AE 4JP8A 5ARDA 4WOBA 1SCBA 2IY9A 1C3LA 2Z2YA 1TM7E 2V8BA 1SIBE 4WOCA 2W2PA 5FFNA 1WMEA 1SUPA 5AQEA 2ID8A 1Y3DE 2ZRQA 2XRMA 2W2MA 4OV6B 5AMXA 3SICE 1V5IA 4Z2AA 1SCNE 1JEAA 1OYOA 3I2YX 1WMFA 4HVLA 3TECE 4AKSA 4AKTA 1SN7A 2PWBA 2WV7A 1AQNA 2W2OA 3TI7A 2W2QA 3CO0S 4HX2A 2DUJA 1SBTA 1Y34E 4J94A 1V6CA 3AFGA 1S2NA 3DE7X 3EDYA 1SCJA 2PWAA 3WIVA 2XTJA 4NE7A 1SCAA 1TM1E 2HPZA 1AH2A 1NDQA 2DP4E 3CNQS 2G4VA 5B1EA 3UNXA 3I34X 1PTKA 1BJRE 1GT91 1P7WA 1EGQA 3Q5GA 3GCWA 3VYVA 5K7SA 4H6VA 4LVOA 1ZVJA 1A2QA 4M1ZA 1GNSA 1GA1A 1YJAA 1TO1E 2PQ2A 4H6WA 3A3NA 3VV3A 3DE0X 1SUBA 3F49S 5JXJA 5FAXA 3H42B 4YN3A 1SUCA 1Y3BE 3F7MA 1GA6A 1PEKE 1KDYA 2PYZA 2SBTA 3DW3X 2DQKA 2ST1A 1P8JA 2QTWB 1SVNA 1C9JA 5AVJA 3A3OA 1OYVA 2X8JB 1GA4A 2Z2XA 3VTAA 5ARBA 5JXIA 2ZWOA 3DVSX 1DUIA 3D43A 3VSBA 1T1GA 1ZVKA 1AU9A 3AJ9A 1UBNA 1S01A 4DJ5X 1AVTA 1Y3FE 2WUVA 1THMA 4ZOQI 1OT5A 3A3PA 3WHIA 1HT3A 1AK9A 1C9MA 1KDZA 4RYDA 2HD4A 2TECE 1GTJ1 3DE3X 2E1PA 2WWTA 1MPTA 3VV2A 1GTG1 3DW1X 1Q5PA 1AV7A 1GCIA 1TO2E 5FBZA 1YU6A 3QTLA 2Z58A 3LXUX 4I0WB 1KE1A 2X8JA 5JXHA 1S02A 3L1KA 4GI3A 1TM5E 4BWGA 3F7OA 1NLUA 4C3UA 3WQBA 3DWEX 3SQOA 3DE6X 1YJCA 3ZXXA 2ID4A 3BGOS 1LW6E 1Y1KE 3DVRX 3P5BA 1ST3A 3DE1X 1GNVA 1SIUA 5AVKA 1TECE 1XF1A 1YJBA 2SNIE 1IC6A 4CFYA 3T41A 2GKOA 5SICE 2Z56A 3OSZA 4B5LA 2Z30A 1SPBS 1WVMA 3VHQA 3QMPA 2SICE 1WMDA 1R0RE 2PKCA 3GT3A 1C9NA 2ZWPA 3QFHA 4CFZA 4MZDA 2PRKA 4CG0A 2W2NA 3EIFA 5B1DA 4H6XA 2Z57A 1SUAA 3Q40A 1SELA 1KDVA 1Y33E 5CW1A 1SIOA 2P4EA 1MEEA 1Y9ZA 1R6VA 1IAVA 1KE2A 2B6NA 1Y4DE 2Z2ZA
chains in the Genus database with same CATH superfamily
4Z86A 3CZAA 1DBPA 5AVVA 1BKSB 2VRWA 3KFVA 3GZ4A 3JZFA 4NBLA 3HKDA 4QUDA 1DQPA 2BKXA 1JI3A 5LQDA 4Q3LA 3MWDB 4OQYA 1EINA 2BMAA 1UAAA 3U3JA 4ZEWA 4OBBA 4LYDA 1XZHA 4CJXA 1WEHA 3T8YA 4RTPA 3PQDA 4FZJA 4M1KA 2Q8QA 1JEQA 3DE4X 3FDZB 4XVHA 3SXPA 3TLEA 1FDWA 3EVAA 5FF9A 3K6SA 1N2CB 1BFDA 2EFHB 4YCMA 4LXTA 1G1MA 3KU1A 4P53A 3LOPA 4KLZA 5CFZA 3FFXA 4V0KA 4RE6A 4R81A 3FE2A 5E3JA 8ADHA 3RC1A 4UQLA 2QRPA 1XKTA 1A9TA 2IGBA 3BVPA 1U1EA 4CMIA 3O3OB 3ZHUA 2ODQA 2FHPA 3R3XA 5FBQB 3VC2A 2B37A 5J23A 1V7CA 2IZ1A 1L4GA 1N0IA 3L8CA 1OXUA 3C5WP 1QG4A 2V7TA 3SXJA 3AF6A 1VJRA 1QH0A 1W36D 2DFLA 1GRNA 2I8AA 1DQZA 4H59A 1JR3A 4F93B 4H3VA 4OB6A 2AGVA 3MD9A 5ED0A 3SBDA 3I62A 3H5NA 1JA0A 1HUQA 1RLIA 4RTLA 1PFGA 1SZDA 3GA0A 2E9SA 3L79A 4B6OA 1N2GA 2IYQA 1JG6A 1NMSA 3BMQB 2PTHA 2UU9B 5JC1A 2W2KA 1Y89A 2Z9DA 2ZYHA 1GL7A 2CCKA 2CNDA 1ZH2A 3MHTA 1M2JA 3RW9A 4LVUA 1TM4E 3HWSA 2D4AA 4F4DA 3DWGA 3IXLA 5DM2A 5FI5A 3VR5D 3FA2A 4JT9A 1K98A 4WK0B 1BFKA 4Y2RA 3A1NA 3TNJA 1JJAA 2VYVD 3S70A 4BRUA 1QF9A 4YAWA 1L2TA 3L5OA 4DR4B 1GILA 2FEKA 3G7NA 2HMSA 4P80A 2APJA 3LCCA 4NK4A 4B6PA 4W9MC 3W5AA 4JFRA 1ML3A 3LKBA 4MV4A 3ZJVA 1TF2A 5JLJA 4EL5A 3WKBA 1GUYA 2QX6A 4M36A 5F1KA 3R6LA 2EU8A 2OZPA 1P8AA 2R5NA 4A5OA 4JLWA 1SUSA 3KVNA 4WZZA 5IVKA 2GH1A 4MQ4A 4R2MA 4X61A 5A9SA 3VA7A 3SYNA 1VIMA 3WGMA 1PNOA 4FDAA 1FFSA 1GOTA 4R41A 4AG6A 2GZDA 2RKOA 3PXGA 4FXOA 1PR6A 3UK0A 3SHOA 1R00A 2NYVA 5ES3A 4B3IA 1XZLA 3GVCA 3N0VA 4JLBA 3V1MA 4LI3X 1ADGA 3E3MA 4RFVA 3GD5A 3BE5A 3TO5A 1SBIA 1WUKS 5E7QA 3VPCA 1XWIA 2CC2A 1L5FA 1AHNA 3A3YA 4A26A 4FN5A 3ZDXB 3GMTA 4DLXA 2V7XA 1A9ZA 3CNBA 4EIWA 2F3TA 3VUFA 1XQVA 3N2EA 4KTTE 3E7PA 1ARZA 4EITA 4EPYA 3TZHA 3FGNA 2A5LA 5B3JC 4WN9B 4IFTA 5K3BA 1K27A 4ZHQA 3ZCUA 1CCWA 2LTAA 1ZN9A 1ETUA 3AKEA 4HH4A 3LUPA 3PUHA 1QYXA 1XTBA 3PQ7A 1GY8A 2XWJI 4FR0A 4WOBA 2RH5A 4AG5A 3GR6A 3E7DA 3GEGA 2FZKA 3WMEA 4F3KA 4LF4B 5LMNB 1CY7A 3O92A 2ZI7A 4OP3A 2FSVA 1CV2A 1ZIPA 2VK2A 3WLSA 1M33A 2HSGA 4F5DA 1JEYA 5FFNA 1K2VN 2PANA 1X42A 1E9RA 3QJ5A 2XGGA 4JOCA 4FMCF 1KI6B 2EKDA 1V8FA 3BFXA 4YMVA 4LDQA 5BUCA 2PLRA 1TZKA 3H9BA 1TJNA 4IRMA 1NL3A 3KZMA 3ZW8A 3DZGA 2QTGA 5AMXA 2JG3A 1U0NA 4GZ3A 4KI7A 3KT8A 4NCBA 2A8YA 2NUPA 1PGQA 1INLA 2WG1A 4MKGA 2WF8A 4U4AA 2FUCA 1LZLA 5HA5A 3WHLA 4A6PA 3NAMA 1GDTA 2ZBUA 1KH1A 2Z8YA 3I2YX 5G1PA 1V1RA 2W43A 4PLCA 2JASA 3WL3A 1EEXB 2WIDA 4HJRA 3AV0B 3CCFA 1UFOA 2WZQA 5C7OO 4ZHSA 3GVIA 3LDHA 4TRJA 1SN7A 4NCXA 2QUIA 3CURA 3V6LA 3MS2A 2WWFA 2YW9A 4HDSA 1FNDA 1YFKA 1P1FA 3B6JA 3OESA 4H18A 4XX0B 5L7WA 2BFAA 4GMGA 4DLTA 3DFUA 4R1NA 1BO6A 3SY8A 3RYFB 4HD8A 4WKPA 4D43A 5KJ1A 1I7LA 3R3VA 3JPYA 1IOVA 4ZO8A 1OWPA 2JHPA 4J1TA 4MA4A 2I87A 3HN2A 3MMPA 5JJKA 2FSUA 1JWAB 3D7MA 4XGQA 5K5EA 1IATA 1C3VA 2MINB 3S2IA 2DWPA 3GUHA 2PK3A 1H6BA 2VHEA 4BZPA 1IZ8A 2YYSA 1VP9A 1U2EA 2HK6A 2GAAA 3OA2A 3VZSA 1RABA 5C1BA 1JKMA 2DKNA 4O4IA 2HN9A 4U2CA 2EJVA 1P75A 4I1UA 4GBMA 4PXYA 4LDPA 2JLRA 3DE7X 3EDCA 4FZ3A 5ENZA 1N5KA 1ZJ4A 5HIJA 3QVTA 4ALJA 1ZK3A 2FZCA 3ASVA 1Z7EA 4O2BF 5DCYA 4BMOB 3Q6IA 5M04A 1MQ9A 1L7RA 1GEGA 3PSHA 1QTIA 1Z4MA 1SULA 4RF2A 1JMYA 1WX1A 5H80A 4CKBA 1V96A 1UC4B 3EF1A 2Q0SA 3AF3A 5KNCD 2JNWA 3P4YA 5ELLA 2CL6X 2J6BA 4PZCA 4J91A 1NVUQ 2WSSA 3TLCA 3FKSD 1QQAA 3H8SA 2OPHA 1Y3AA 3U0BA 2ZFUA 5BN5A 1PL6A 3IL2A 1E61A 2CLCX 1LXCA 3V4RA 2WM8A 2ETXA 4C14A 1CKEA 2F1RA 4QHSA 3TUZC 3OZ7A 5CIWA 1FX0B 3HKEA 3RVRA 1MJ5A 3UNXA 3I34X 4BZQA 4RZ3A 3TL6A 3DF9A 4ZEMA 1VG8A 2Q9AA 4AXXA 2AVNA 3TRHA 4DA0A 4Q16A 3VU0A 2JC3A 3HS3A 5LBUA 2ZKIA 4CKBB 4OH7A 3PEUA 2GN9A 1PQ4A 3RWBA 5C3MA 4YT4A 2IH4A 1NC3A 2H06A 3AVOA 2D7DA 3QUTA 2F64A 2Q2WA 3ILSA 1NP7A 3B51X 1F6BA 3L3BA 4UMVA 4AZSA 1KIFA 1F9AA 5LP6A 3STHA 2V3CC 3H2YA 3OBBA 1DC3A 3DBHA 3GNSA 4LQ4A 4H6WA 1H1TA 3D6AA 4RYLA 2ZPUA 1SKYE 4XAQA 5HJEA 2WWHA 2DG2A 1QBGA 3HKCA 3DE0X 4PFJA 4E94A 1ZBDA 1W4CA 2DFKB 3RNOA 3TJRA 1V5FA 3OQ1A 4W1PA 3WWDA 3DXFA 4D74A 1F4PA 2EBHX 3G2IA 4LNHA 3OX2A 1WCIA 4WBXC 4O2AB 3VDMA 3RSQA 2IU6A 4YRKA 3N8NA 3L01A 3WV4A 4C04A 1T1RA 1XDBA 1TTPB 3BM5A 3O84A 2PFGA 4L75A 4JYMA 5EIWA 1N9GA 4JYBA 2X0JA 1E69A 5ADHA 2C9MA 1DZIA 3KDSE 1K8QA 1V71A 2EKZA 3IERA 2H1IA 1SVMA 2QRGA 4TM7A 4CGZA 3IV7A 4BEVA 3QVLA 3TRDA 1Q50A 4JI2B 1DRWA 3WGOA 3WK7A 3EXHA 2P4QA 3L4SO 2YJNA 3BMCA 3ZVKA 2NO7A 2X9QA 3NTQA 3B82A 3C3YA 3HRHA 1EVIA 2C83A 3HO8A 4RCYA 2ZANA 4A0RA 5CPBA 1CY2A 1C50A 2ZTUA 2ABWA 2CXNA 2Z6UA 3EISA 4FFSA 1RLJA 3V4VB 4DIFA 4QOSA 4CI9A 3MJ4A 5F9HA 2RKWA 5FA6A 1WF6A 2ZSUA 3WGKA 1H4QA 3IB6A 3JQ7B 3FI9A 4H0NA 1CVRA 3ORSA 4LX0A 1T3ZA 5JPIA 2KPOA 1UJ2A 2ZRAA 1B7GO 4PIMA 4BCDA 3NDIA 2B7LA 3BIFA 1ESNA 1H2AS 3PLRA 4Z1OA 1UIRA 1NX6A 4C2BA 3RFCA 2XXBA 3OLXA 5KX5A 4DMCA 4JI5B 1Z13A 4IQ8A 4DMKA 5JXIA 4DIOA 3SSOA 2FRDC 1EVYA 1YZLA 1WCYA 2QXUA 3PPYA 5EKUA 1T1GA 2BJWA 2QTRA 2QUZA 3A2MA 2NGRA 1CTQA 1JG7A 5T6MA 1P2BA 5IFLA 1M1XB 2O20A 4LZNA 3ES9A 1S7GA 2NZXA 4Q02A 3NAGA 1VBMA 1D6MA 2I4MA 4G5SA 3T61A 3JYPA 1XXLA 4C89A 3H9UA 1DWOA 1DQNA 2JIZD 1J2YA 1XD2B 2YJ4A 1DEAA 3ETLA 3LC2O 4L16A 3SJCA 4BO4A 2AE2A 4RVFA 4BIMA 4E11A 4KNVA 4RGBA 2YWFA 3I05A 5H82A 2JH8A 3IAAA 1G63A 4MQLA 2ERXA 2CWWA 2QRHA 4MDYA 4O1MA 3T4UA 1EVEA 1M1YE 2UVDA 3E2PA 3QEOA 4MV7A 2HWXA 3KALA 1FLDA 1P44A 4YA6A 5BSEA 1F6WA 1TW3A 2Z6VA 1UDCA 4U7WA 1WKVA 3QU7A 4Y6PA 5EZ6B 1EFAA 5HBGA 1YACA 1KIMA 2A30A 2HPAA 1GSIA 4U7GA 3I3SR 2PU7A 3KKLA 1S3SA 5HGXA 4CKXA 1QTQA 4BUCA 2H17A 1QIFA 2XLCA 4RSHA 3SK0A 5CBKA 1VFPA 3LMKA 3WY9A 2YV2A 1C7QA 1L0BA 1YU6A 3EXFB 5EHIA 1TVMA 1XRPA 2NXCA 3I5XA 5AW9A 4PYIA 4KO8A 1E2DA 2PV0A 3AY7A 3L02A 3EH1A 3PNOA 1AXGA 2NTNA 3M6UA 1ZZGA 2X6TA 2BGIA 2RGGA 2YNMC 3E9MA 3H3XA 3HXKA 2B7CA 3IHWA 3ZE6A 4CMEA 1BX0A 1NOKA 4E5KA 5CM9C 2WBLC 1YBAA 2FN8A 3NO4A 1DTEA 1G3QA 4FT2A 4CTMA 3EX7C 1U4SA 1Z36A 3I76A 5BSUA 1XPOA 3TDNA 4NF2A 3D4OA 3X1XA 3CLUC 9ABPA 4IMJB 4BQFA 4ZRNA 2XDQB 1YUNA 5DK6A 1XTZA 3DWEX 1BDMA 3AM4A 3SQOA 1VTKA 4FBMA 2VQSA 3FPLA 4BP9A 5KHOC 1NQOA 4DUYB 3B5JA 3ENNA 1U0BB 3I8OA 2IDZA 3U44B 3PVSA 2ZIVB 5CH8A 1YDEA 4CMHA 3EGOA 2K7FA 1CF9A 5DOVA 1DRKA 3EGCA 1TADA 3KKOA 3P9QA 3RJMA 3PFKA 4L3VA 3UXYA 2LGJA 4D79A 4CKZA 3EIXA 4D9EA 2IUUA 5LDDC 5I6DA 3IBGA 4IDBA 2ISQA 2H29A 5FWXA 2XE6A 3NBUA 1SUWA 2NU8A 3FNBA 5A3VA 5BSRA 3OMLA 5CITA 1K0FA 2WLSA 4RIEA 3IUJA 3BD8A 4PZZA 3T9BA 2FF5A 2B35A 2PXHA 2XIQA 3K1TA 4B80A 4S1OA 4WSOA 4BMSA 4LISA 4AX8A 2N75A 1A7UA 6ADHA 1BDHA 1RYFA 2P9FA 2F9FA 4CPDA 1YWGO 3C3EA 4U0KA 4C7BA 4JJKA 5KMGB 4C21A 2OUIA 2X9NA 4ZOLF 3ZN2A 2VDNB 1Z5WA 3B2NA 4TL6A 5KSPA 1WR8A 1SKBA 2W6ID 3KC2A 4QE3A 1O96B 4ZJPA 1VC2A 3EA5A 2F8MA 1NVBA 1PJ2A 3ILHA 5FWNA 1KF0A 3F5SA 5DLYA 1ZKDA 5AD1A 5LNK1 2GAFA 2QQFA 1JIIA 4PRLA 4W5JA 1E5VA 1IU9A 3WFJA 2O1WA 5E9WA 1S3GA 2YFQA 2JFVA 3IP9A 3I52A 4HK4A 1EX6A 2PR2A 4UEJA 1TUGA 1FUUA 3NVMB 2Q1UA 1NBHA 4QGHA 3L4JA 1BMFD 3MWJA 2IQIA 4RACA 5BT9A 1H2EA 2XQJA 3TRKA 2AEFA 1KAHA 2Y0CA 3K1AA 2CB9A 4IIFA 4NONA 4BB0A 2NUBA 4PN3A 3NPMA 3WYBA 2WA1A 3P2IA 4YRIA 3CRVA 3DV9A 3AYZB 2P68A 2B1QA 2EJCA 3DBOB 3IKVA 3SJAA 1JSZA 4KMRA 2AN9A 1FFXA 2AJBA 2FETA 5F2NA 1ZONA 4EPWA 1B0AA 3FTNA 2QX8A 1OBVA 1JFFA 1KRHA 2FPSA 3PBKA 3AB7A 4D3DA 5CA1F 2NU6B 1M8GA 2YBDA 4MIYA 2PM8A 4UM5A 4ZVPA 1J0DA 1U80A 1XZCA 2XXAA 3O1HB 1U31A 2ILTA 3FB4A 4WGFA 3IAM6 4MVWA 4QLAA 1L5ZA 2QXTA 1GFSA 1UM9A 3RRYA 1SK8A 3O8QA 3SHFA 3RHZA 3ZBUA 2AQ8A 4GLBA 3A1WA 1P5RA 1TYDE 2R4QA 3L7JA 1YE3A 4REMA 4BNLA 3UCFA 1NMQA 4AKIA 3THXA 3QXSA 3O82A 4LXIA 2ILVA 2WG2A 1K8RA 3HU2A 1XTSA 3AEUA 4BLUA 3RAPR 4A0SA 3RYTC 3PGXA 1I4EB 3VR4A 5U9CA 3EMDA 1R0SA 2QTVA 1TA4A 4M6WA 1M2NA 2P9HA 3O8LA 4M7OA 4O0MA 4OSPA 4DQKA 1D8AA 1XJWA 3JVDA 3TM5A 3TQTA 1P39A 2DSNA 4PG7A 5B6IA 2QZ4A 3Q3CA 1A95A 1TEVA 5ITSA 4XGRA 3EHEA 5JAUA 4KRFA 2PIDA 4RVUA 3Q6NA 4LXUA 2AYYA 3ZDFA 2DVMA 1M2OB 2J9RA 3OM1A 4DADA 2I62A 2GRAA 2FZ5A 2QT1A 2C4HA 1JQJC 4MYTA 4QSMA 1MW9X 2VAPA 4KE7A 2ZIWB 2WYVA 2WTNA 3L0IB 4ND5A 4ZIRB 5DMHA 3OLYA 5LIPA 1NI3A 4LWPA 1VSQA 3DE2X 4PX9A 4HYEA 3SC2A 1EX1A 2E4XA 2KBEA 1KR2A 3F6PA 3VPSA 5HVNA 4TKUB 2CF5A 4I5FA 4ENPA 1E18A 5IU6A 3KL4A 1J97A 5A7GA 5BWLA 1ODSA 1K3UB 2I99A 2XRFA 3Q7SA 4I8DA 1RLTA 3H4MA 3WKCA 2G9NA 5I3ZA 3ICQB 1JHYA 3NUZA 1AUXA 5FBRB 2YJ5A 3LCJA 1PLLA 3NH6A 4MYSA 5TXGA 5B55A 5KJFA 3AP3A 2BEUB 1SUDA 2QA5A 1D8TA 4BNTA 2DCMA 2FOXA 3QI7A 2Y6VA 5JPDA 2RIRA 1XAIA 2G67A 1XCJA 1ZRHA 2UAGA 3A58B 3OG9A 3T99A 3WIDA 2ZBRA 4TS9A 5THXA 3TLGA 4K9SA 5D7NA 5KNLA 3G2MA 5F1OA 4AN0A 4LYJA 1DEOA 1RI2A 2HADA 4KWCA 4AYXA 4C1NA 1IHXA 1O57A 2GVZC 1JAXA 3NW9A 3ANYB 5IT4A 2AZ4A 1Y1TA 2NAFA 2H4JA 3CW8X 3ENZA 3JATA 3HFJA 1I6LA 1IAQA 1NBAA 3JQFA 1CUIA 2NPIA 3NANA 4HPJB 2DAPA 4QGAA 4W8HA 4WNYA 3M4JA 4LGVA 1BU5A 1F2UA 2R4UA 4N9QA 4RUKA 1GGMA 3LQYA 1JFRA 1EP9A 1LK0A 1PJQA 3QLVA 3T0GA 3ZLBA 1PBTA 1JU3A 1ZJJA 2VSNA 1NUAA 4KB5A 4PCVA 2W2LA 2L42A 1DADA 1P0PA 1PX2A 1QHSA 4TLEA 4MLCA 3K09A 5HMMA 4O4HB 5JI3E 2XE4A 4M1EA 4AS3A 4DV5B 4IGAA 3CSDA 5AOVA 1RYHA 5F5LA 3QM1A 4JD5A 4J2OA 1I2DA 3H05A 4K9RA 4PNPA 5FULA 2DPGA 2A0WA 4QFBA 4RAOA 5EIBD 5EN4A 3U39A 1E66A 3BHNA 1S2IA 1RYYA 3C14C 3QI2A 4C3OB 5BMOA 3BK2A 3NKVA 4TTIA 4W5HA 5C4GB 5AUPB 1K1EA 3TTTA 3QVSA 1BQEA 4TQAA 1CUJA 1USIA 5JMWA 4ENQA 1GQYA 3DHVA 3SSNA 2XD9A 1KQ3A 2PG3A 4BBAA 2QRJA 4UJ5A 4KPYA 3T5MA 1WL8A 3G85A 4AUEA 4DV3B 3R7SA 3ZV4A 3LS2A 3G2OA 4CODB 3BZBA 3OE7A 3B1VA 3JWEA 3L1UA 2QORA 3N6RA 5F2KA 2XA2A 1KEZA 1L5WA 4HXYA 5H4HA 1NULA 4DEXA 1GKYA 1SVKA 1A3CA 1Y4AE 2A84A 2IU3A 1Z6PA 2ZJ3A 2VZ8A 1I4LD 4UCWA 5IHXA 2WIJA 2JHGA 1J22A 4KN9S 3UGJA 4CMBA 3TLMA 2DRIA 2XCUA 4I6EA 1JMKC 3CLSD 2B6HA 1TEXA 4JJ6A 1IQRA 3PQCA 4TSFA 3WS7A 2YYZA 4JBWA 4CQMA 3DS8A 1OAOA 3T7CA 3IJ5A 3GHYA 4QVIA 2IHZA 1M34A 4GUAA 4N18A 4X60A 4ITUA 5CB4F 5ITWA 2JFBA 4HDNA 4C0JA 4FOTA 3TN7A 3F9CA 3TZQA 3RJTA 1GPKA 1Q0HA 4DWVA 4ZYWA 3BE8A 3AIKA 1OB5A 3O3MB 2WMNB 4B6SA 2VKQA 1FNNA 4R8VA 4WIAA 4BE4A 5M34A 2IL1A 1JNXX 4AZWA 2BZGA 5JD3A 1ORIA 2AI1A 4FI3F 5H81A 1I1QB 2DZDA 1LF5A 1ZLXA 3GJ8A 4GQIA 3I6MA 4H7EA 2B4QA 1HPLA 4X8MA 4YXWA 4URUR 3MFYA 4DRZA 5KWIA 5IVHA 2IU0A 5EMJA 3Q7IA 5TSDA 1NHWA 2WT8A 4HB0A 1VLMA 1O9HA 4Y98A 1CIVA 3FVQA 4CLEA 1AKUA 3EXG1 1SKMA 1Y7LA 2VH2A 1MAVA 3IT2A 3PYMA 4FT4A 3Q2KA 2B94A 3SHVA 1C0PA 4LHZA 4OXKA 3WNBA 1JG3A 1LQTA 3DR3A 2OKGA 3EYAA 5JFOA 5BN1A 5T4FA 3HZHA 5LQCA 2A5DA 1WCXA 2DLDA 1E1CB 1EWKA 2DFPA 3GT0A 3U4QB 2ECFA 1IHUA 13PKA 4HNRA 2WM9B 2GJSA 1X7XB 4IVNA 4YLEA 4DDMA 3OIDA 5IZCA 1VHQA 1QBKC 3HGQA 3OAAD 2JGAA 3LKVA 5GP1A 3D6UA 4CNBA 5EHQA 4DG8A 4K40A 2Q0XA 3CIOA 1JR4A 1HY3A 1AKRA 3CC8A 3PLNA 3I9V1 4JXJA 1QAMA 1NNI1 3LSTA 3DMRA 2QI9F 4RXUA 1FFWA 3OU2A 5CR9A 3BBLA 1VLHA 3PE6A 2W6PA 5H59A 3HCCA 3RU3A 4HX9A 2NM0A 3WA7A 3K96A 4PSAA 5IYZA 2ZRGA 1UCFA 3OLCX 4QHTA 1VPLA 4Z54A 3VU9B 4QOIA 1PDVA 1NRXA 3WK5A 3MZ0A 4Z7OB 3C74A 4MV6A 3UFBA 4RZHA 1MV8A 4TSKA 4LKRA 1BW9B 2BFBA 5E1OA 2LIVA 5CAEA 2LRHA 5T3YA 2W42A 1PZMA 3TTWA 4RORA 1RC8A 1KJJA 4LF6B 2I34A 4BNGA 5IH7A 4KBFA 1JEDA 1C3XA 4TRRA 1F6DA 4K88A 5D2CA 3C48A 5B6JA 1M6HA 2OHJA 1F2TA 2HFKA 2RJNA 4FSHA 4IHKA 3VZDA 4XM1A 4MVJM 1PGNA 3NAZA 1ZINA 3AX6A 3GJ0A 3K1JA 1YB7A 4ITVA 5LQSA 5C4MA 5LYJB 1Y4ZA 4ODIA 1MC1A 2Q62A 3IAHA 4MWZA 2GGSA 5I7RA 2X1MA 1OFUX 3KKMA 1RAGA 4FOLA 2NZVG 4TXNA 3SIPA 4M1ZA 3K9FC 1NE7A 5JUWA 3LDFA 1YJAA 2N1BA 4KHPB 2XWPA 3OPYB 4MRNA 2Q6LA 2QL5A 1X8JA 4J29A 4JOQA 1KERA 4KRGA 2CY0A 4MUJA 1D0SA 4LGMA 4B3BA 1AGXA 5L9AA 1AO3A 4J4TA 4CCYB 3FYCA 4Z3DA 2FOLA 1AK1A 2BM0A 3BBPA 4M1QA 4NJEA 3WV5A 3RODA 4MZXA 3K5HA 2PO5A 3L8EA 1SOWA 4G84A 3SHQA 3HXLA 3EIQA 3GLHE 2R5WA 5EUQB 3U80A 5BMVF 5KTSA 3V1NA 4KGXA 1OA1A 4FD2A 5LQNA 4BAGA 2BGLA 3L7MA 1IBSA 2ZUTA 2RHRA 3TSAA 4PICA 3V33A 5KYGA 1W94A 1EFPB 2HOQA 5LL6P 2J4DA 3ADOA 2JIQA 2V55B 2W8ZA 1N2ZA 3O83A 1KZ4A 4QNMA 5CM8B 1ZOPA 2JIOA 3E22B 3ICVA 2SBTA 2YUTA 4GR9A 1RI4A 3IJPA 3W9YA 4QZVA 1OD6A 2PN1A 1JKJA 3DC7A 4JLMA 4TTQA 3ZGLA 3KWLA 3CNOA 3I5UA 4DHWA 2M1ZA 4ZREA 2BZ1A 5A3RA 1C9KA 1ISJA 1CJKC 1U7DA 2JKVA 3DQZA 1RXCA 2NZJA 4CWAA 4IY1A 2IGTA 3CN9A 4ZQBA 4U2EA 4MR7A 4S1NA 4CFSA 1U1GA 2PGLA 2AF3C 1YR9A 1NOIA 3NHRA 1WO8A 3UTDA 4EQZA 3NV7A 3DZCA 1UBFA 2ODNA 3LHFA 4QBKA 5K0BA 1N78A 2BEJA 5ALYA 1QZUA 3HDYA 3ZY6A 3B6MA 2JJ1A 4W5TA 3OE1A 3URKA 1GV0A 1W48A 1NBME 1U2ZA 2GN2A 2HU7A 3EASA 2ACVA 3LCVB 3R3HA 1J0XO 3RVKA 3UMRA 1XTTA 1Q74A 2M6SA 3W2FA 1P1IA 3GFBA 1SHLA 4Y2SA 5FBWB 1FDUA 3D43A 4W1RA 5CX4A 1YD7A 2ZBPA 3FDJA 3RVSA 3UT0A 3K2EA 1CEEA 1B1CA 1XKXA 3BMOB 4YJ3A 3GDFA 3MUFA 4M60A 3AJAA 2XZOA 2CL7X 3G02A 5L3RA 3IELA 3W3ZB 3P32A 2Z1NA 3USZA 1TRHA 2Q4RA 4ALKA 1A5TA 3NB0A 3W04A 5LLTA 4DA8A 2ZUEA 4BO0A 1KKMA 4HGNA 2CXOA 1YULA 1JZQA 2H9AA 3Q1LA 5LQJA 2YDYA 1ZH4A 4F5YA 3TAUA 1JG1A 1KP3A 2IJGX 1U2PA 1YB1A 1Z5GA 5D85A 2A9RA 5CCDA 4C2TA 3TE7A 4X1YB 1N2OA 2C95A 2PJUA 3LYUA 3HUDA 1HDXA 4ZT3A 2BFDA 1F5SA 5CK5A 2C2ZA 4I4LA 4OHOA 2JS7A 1T6XA 2O6LA 3QU4A 2JLQA 2HU8A 3OTQA 4DMGA 1HYQA 3H2JA 4EL0A 3IPCA 2V03A 4Q4HB 3WBKA 3DDSA 1M6YA 2WMOB 3HZOA 4RU1A 3MOGA 2QB5A 4IIVA 3GPDG 1MR3F 2PL5A 4EUSA 2VBGA 4JB8A 1CHNA 2NUAA 3TEFA 1NBOA 4OYLA 4Z5XA 2ACKA 1DZ3A 4CW7A 3LC7O 3FBGA 4N5LA 2G1KA 4FLFA 3M7IA 4NYMQ 4BNDA 2HCFA 4ZXPA 1NY6A 2VQ6A 4QYMA 1ILWA 3FJ1A 4PQEA 1CYEA 3LLVA 5KCMA 1DJOA 2G5TA 2BOVA 5E6UB 3GHHA 3D81A 3H2BA 5KPDA 1NYLA 3IMCA 5FR2A 4DLUA 2PUCA 1Z0DA 1U0HC 3EGDA 4ARBA 1P2VA 1GYPA 1L5QA 5IH3A 2X7HA 1YF3A 3F4BA 5KYUA 2UZ4A 3BWEA 4LDZA 3SE0A 3WLAA 1P6UA 1UKVY 4AF7A 1N7IA 2W90A 4LZOA 3DB2A 3CLHA 2PBFA 1XOIA 1BNCA 2RIPA 3BRCA 4ITRC 4OD0A 5LA6A 4EGAA 3P9NA 3OOHA 2A0FA 3QVJA 2RHTA 1PJTA 4EG4A 4Z6KA 4NMMA 4AY6A 4OI0A 3BGOS 1DEXA 2NPFA 1P1RA 1UK9A 1Q1GA 3BXFA 2R1VA 3PHGA 2QVLA 2ZRIA 4OBEA 5BSWA 1Y1KE 5IDQA 2P1RA 1ODFA 3GJ4A 1Z88A 3AY6A 1JDVA 4Q9NA 4ZPJA 5CXUA 4X71A 2DR2A 2DLCX 5HZGA 3W8NA 1BVRA 2A88A 4HN2A 4MULA 4KYVA 2UXDB 5AVKA 1NP3A 2Y4NA 3KTAA 1N8NA 4GP6A 3RFVA 1PL0A 1ZA2A 5H7XA 3GXBA 2QUBA 3UKDA 5CA0F 3VR3A 4QA9A 4CMGA 5IVPA 3TQOA 3ZJTA 1PR4A 4CTOA 5AW7A 2AK3A 2Q4BA 3SQMA 4ETWA 3LT0A 4B5LA 1DX4A 2QLLA 4ACAA 2Z30A 1X86B 1P7PA 2GHQA 5LKAA 3U60B 1J56A 4PG6A 4OMFG 3L6RA 3D8TA 1FQKA 3SQNA 1SY7A 3B6IA 3ZZ1A 4DMMA 4Y6LA 3E6AA 3I64A 1L5OA 1TD1A 3F6BX 3MSCA 3QMPA 5DM1A 3Q7RA 1EE9A 5CFNA 3TRJA 5G3ZA 2I6TA 4YJ2A 2B4KA 3L07A 2WQ6A 4EGFA 1RS0A 2QL9A 3IQIX 3ZDAA 1ES9A 3W6ZA 4PNZA 3ZZ0A 2REBA 1GEEA 2HJWA 1J24A 5HS4A 4CFZA 2QSJA 1B8NA 2QEQA 3ZHBA 3UMMA 2PRKA 2BM8A 4AK9A 2W2NA 2RHGB 4NCHA 4POAA 5KTTA 2OCXA 3T1HB 5F1YA 1Z6TA 4IXDA 4OUDB 2QF7A 1SCUB 4NZOA 5FNVA 1F4LA 3HB7A 4MGYR 3RU2A 5JYBA 4PZDA 5H83A 4LF8B 4WASA 4CV0A 3E18A 1U0RA 5LJIA 3FPAA 4G8JA 4DIEA 1GGEA 3DQPA 1DDOA 3H87A 1KK3A 4OL9A 1SELA 2WUGA 2IEGA 4LYHA 2IYLD 3F9IA 5FLKA 1CFJA 3VM6A 2B1JA 2BTQA 3HXTA 1XVIA 2CL0X 3OHMA 4UZEA 5EMHA 4E6PA 1VLJA 5TJ9A 1GNPA 1R0ZA 5I51A 1O8CA 1YGYA 2C61A 2P4EA 4JGGA 3SFZA 3TH5A 4AECA 1O1YA 1WSBA 1EHIA 1OZHA 3D8HA 3MNFA 1X7ZA 2Q3MA 2FYTA 4YT5A 1KQNA 1GU7A 4M0MA 3S2YA 1EUZA 1NXSA 4HEJA 1OXBB 4D80A 3C70A 1ICEA 4CDNA 1X9HA 4G0PA 3PJRA 4B44A 3AZQA 1OE0A 1O4WA 1ORRA 1UPTA 2RI1A 2V7GA 3A4LA 2AOUB 3KQYA 4RV4A 4C7MA 3GEMA 4MR9B 1UKEA 3ABIA 4WXHA 1R37A 3HA7A 2IYZA 4ZI2A 2VHVA 3ORHA 3GNQA 3EVTA 2GCOB 4RJJA 1V8OA 3KFXA 5AJXA 4DXAA 1NUQA 3QE4A 3UANA 2AB0A 4I1OA 1ZC4A 1T3LA 3I4CA 1N0UA 4MUBA 4OHYA 2H2IA 3AC0A 4PYNA 1TD9A 4HQOA 3RHSA 4ZVKA 1W44A 1WDKA 2VDLB 3HJHA 5ALOA 1I24A 2YL2A 3O21A 1KYXA 3ZCRA 1TVEA 4Q9AA 4GF5A 4L3WA 1I32A 4MVJH 4RQBA 4EP1A 3DDZX 3QLUC 4EI9A 3GJRA 5J58A 2O6HA 3GOHA 3S0JA 2NT4A 5FUYA 2EFCB 4G6ZA 3UMYA 1SEVA 5DYIA 4P38A 3ESBA 5TVKA 2H7YA 1WUTA 1KO4A 1NONA 1EE2A 2I2WA 3G59A 2EFDB 5CT5A 4L0CA 3REGA 3ABZA 3RVJA 1K5PA 4G1CA 5F33A 2HGZA 2I6QA 5K0EA 1UP7A 2PMWB 1SBHA 3OETA 4OQ4A 2IV3A 4DPKA 3ELUA 4AI6A 2WNHA 4H1UA 3CVVA 1YJ5A 1VGQA 2WD7B 2Z8ZA 2YDXA 2HL6A 1SWVA 4L5IA 1Y8ZA 4ND7A 4NCJA 3AZPA 2PWPA 2WNSA 3Q7PA 5HEKA 5L3QB 1BD3A 2A4MA 1OB2A 4UOQA 3FN4A 4AUMA 4E14A 1SKQA 1V11B 1MW8X 4GP9A 2B4RO 4EYSA 2SHKA 1N1EA 2JLAA 3VPFA 3D0OA 1TPYA 2HLDD 4E2XA 1NLYA 4RDXA 1L8XA 3PEYA 4NYMR 1R6TA 1JZSA 3E35A 3JQAB 4O2BA 3X1KA 5REQA 2I76A 3VNQA 5L7TA 4CEJB 1P0QA 2GEKA 3ZHVA 3J80A 4DG9A 5E2AA 3ML1A 1DAMA 1XGKA 1CRLA 2FSFA 1QJCA 3ONEA 2PMCA 4LQCA 4R2LA 2BONA 2O0LA 3A1SA 3HE3A 4LDRA 3T06B 3QH4A 4A10A 1ZM9A 3FCXA 3RS7A 1XP5A 2LVBA 5B2ZA 4BVLA 1YBMA 3NONA 3E8MA 4KXMA 3MWDA 2DMRA 3OF5A 4JAVC 4B4VA 5EJ8A 1YR3A 2CLKB 2XB8A 3PD7A 2OG2A 3QITA 2FN9A 2A9QA 4IJ5A 4KRYA 4L7QA 3H2HA 4OI1A 1NT4A 4C3VA 2YHUA 2F90A 4CKCA 1XZBA 4K6HA 3GCXA 4KRXA 2GBFA 3FDZA 1CZOA 2JAPA 1EB8A 1I6KA 4GX2A 2ENWA 3GARA 2QZJA 1WDTA 3MUEA 3P97A 1MB2A 1DBIA 2ZE6A 2CHQA 4GQAA 4Y6QA 5GJBA 1JI0A 1W8DA 1Y63A 1ZD1A 2C3OA 2R751 3KPVA 4NH0A 2ZYUX 3IR5A 5DU2A 4XIYA 2R00A 4OEHA 2BP7A 2Z9CA 4KCGA 1K7XB 1NVKA 3PNLA 4EJ6A 3HA2A 5E9JA 1SKYB 2A0XA 3NIGB 4RF4A 4UTZA 4IVPA 1RXUA 1W5FA 1PZXA 3EA4A 4L08A 3ZLTA 2WJYA 3GLIE 2WWRA 1HRKA 5FB3A 1T0BA 4NMHA 2IS1A 4R1TA 2XEXA 5FOXA 1V4BA 1NI5A 2FZWA 2OD9A 5KVQA 4C7XA 2R6ZA 1HZZA 2A5JA 5LPNA 3K92A 4Y2PA 2V7WA 1Q0ZA 1TZJA 2FMUA 4P33A 4HSEA 2PKYX 4PSDA 5SYMA 1PHPA 3PUIA 3NHFA 1GZHB 1DAHA 1WPRA 5EI5A 3S1LA 1NIPA 3L6OO 5EJAA 2JGJA 4CRWB 2IA5A 5FO1A 5ARDA 1XYGA 1O0SA 3MPUA 2J31A 1P9NA 4Y2XA 5EZYB 1CERA 1G41A 2LWIA 4RFLA 1C3LA 1W87A 3O03A 1XMPA 4HGQA 3VPDA 5BV1A 5AW0A 2CXSA 2GPTA 1JXAA 3H6HA 4UBIA 4UUNA 5DP2A 3W1EA 4IPTA 3ZGOA 4F3NA 4WOCA 1T9GS 1DKUA 2C1EA 1U3WA 4JSTA 3OVMA 2D00A 4Z0HO 3I5AA 3LX5A 3OZSA 1FFEA 3PCRB 4GOLD 3ZG6A 1G5RA 2P9TA 3DLCA 5AW8A 1Q0UA 3LRPA 2X8WA 1KA9H 1P29A 1DEKA 3H2KA 5AJYA 3UHOA 5I7HA 1S3FA 2XCQA 5HIKA 3RBAA 3IBFA 3M6FA 2P79A 1CZNA 1FU7A 1YAHA 1ORVA 4Z2AA 3BQMB 3QVVA 1JJ7A 2AXNA 3TSYA 1I3OA 2WZDA 2IPNA 4ADSG 1Q7CA 1IQ0A 1EYZA 1K5GA 1T2FA 2C0QA 3EVCA 3FVWA 4PIVA 5E6RB 5EGSA 3R76A 2ZT8A 3OJOA 1FYDA 4WY8A 3WGJA 3WL7A 4I5IA 3HYSA 2IBSA 1K7FB 1YBFA 3EZYA 4X8HA 5CJJA 1MVLA 1Z7GA 3DTTA 5D87A 4ID9A 1JR3D 2OV3A 1G4UR 3IP5A 4GZ5A 3LOQA 2QWXA 4RA9A 2QSYA 3HDGA 3MT8A 4N5DA 2G6BA 4WCVA 1EJ0A 4J0DA 3WXMA 2XUQA 5ICCA 2PUHA 4MKIA 4N5IX 4P9NA 1R0XA 5LQUA 4FOSA 1ZVMA 3TEJA 2BBSA 3BXOA 3MYYA 3D6HA 4JELA 4BNWA 5FHRA 5IKXA 3KB8A 4C03A 1F4VA 5EVJA 3E84A 4JJFA 2GZMA 3C97A 3LUBA 1JN0A 4MCIA 4J75A 3KQQA 3R4VA 3DVLA 1KL7A 5NLLA 4ZK2A 3AFNA 1HOTA 1TZBA 1YRAA 3L2OB 2P6UA 3RS3A 3CGWA 1QDUA 1APBA 5JAHA 2I7VA 1G8HA 5JS6A 1W36B 1LI4A 2FMXA 3LRTA 3LDAA 3B1XA 3CR8A 4BEWA 4Z3KA 3IV6A 1AUVA 1CY8A 1OV4A 4EFDA 1Z0AA 2VDWB 2ZTVA 3OFJA 3S7TA 5A1TA 1UL1X 3PGJA 5DPMA 4BVEA 5JCXA 2HK9A 3EGEA 3NEPX 5EXDA 1U8ZA 1HH4A 1NVVQ 3LWNA 1NDQA 2WJ6A 4Y2TA 3SF0A 2DP4E 3ZE0B 4BMVA 1YQ9A 5E2IA 3WLHA 1QUFA 2KMLA 4N12A 3CVYA 1NXVA 1K68A 2O06A 1G21E 3HA5A 2FHSA 1SXPA 2G0TA 2EJBA 1LA2A 2FWIA 1UH5A 3UMSA 4BX0A 1CRQA 2YHIB 4Z4IA 1U7WA 2PMDA 3KZNA 4Q9KA 4NCIA 4AMVA 1JSLA 1PW5A 3KSDO 5BURA 3CF4G 2W5UA 3RYFA 2OZLB 4PQFA 1V48A 1YQUA 4V0SA 3T4XA 2E6UX 3V8VA 2QD2A 4AJHA 4B4KA 5HZMA 3DR5A 3OEHA 5FRDA 1BN7A 5J4LA 3SVLA 3VH3A 4YRAA 5ITZB 2IHJA 1TW2A 3PQ8A 1H5NA 1TAQA 1KEWA 3HEBA 4QRHA 1ODCA 1R12A 4TWRA 5EWJA 2IS4A 4HUQA 4LQDA 2MINA 2VPXA 4HXFB 1G9SA 5CK4A 1K08A 4MPDA 4B7UA 3SJZA 1CK4A 3VR6A 1B3BA 2IY7A 2QMHA 1NSTA 5F23A 4JP2A 3TQSA 3F49S 5A71A 2AFIA 1UBJS 1J4AA 2M98A 3JSXA 5TS2A 1TF7A 3A36A 1LPOA 3HUFA 3JQ9A 4Q5IA 4F84A 3PNVA 2M9MA 2XW6A 2R44A 4OXQA 5LWHA 1SXJD 4FFVA 1XQWA 1FNBA 1TYAE 1PT5A 2PZJA 3L7YA 5IKOA 1EPUA 4CG1A 3ZGYA 4IXTA 4QPCA 1MNQA 3JYOA 1E2PA 5BYKA 4M3NA 2PBLA 1ISGA 3R7FA 1P0IA 3THOA 4C3ZA 1GTVA 1LDBA 1YE8A 3IEXA 4HDKB 1U8EA 1W0KA 1DLIA 1JQ5A 1Z26A 2I2BA 3K20A 4PC6A 2ZIFA 4DPMA 3QPAA 3DXZA 2PX3A 5K9ZA 3DLBA 3DPUA 2AKAB 1NKSA 3HRIA 4IRUB 1RBYA 3I09A 3I6IA 1NYTA 1XHFA 1WUYA 2OFXA 1P77A 3DW3X 1FX0A 1UAGA 2D8MA 1G5TA 2R7NA 1Y7IA 2YXBA 1ZWKA 1YAJA 3KEFA 1HE8B 3ZY2A 4Q4AB 4BO7A 4FS8A 4W82A 2DLNA 4E07A 1GPMA 1LWNA 3KYDB 3P96A 3WVNA 1QHEA 3DFZA 1DKMA 1X1EA 1IQUA 1MA0A 3KV3O 4QU0A 4P7FA 1QIEA 4YP6A 3O8RA 1TXGA 4BO1A 1QIKA 3ZDBA 5HIMA 5MN6A 4AP9A 2MSCB 5ULLA 2B8WA 4UTNA 4H17A 3OTIA 4NEGA 1EESA 1YVEI 3TUJC 1CG6A 3OCVA 3QKSA 1XU4A 4BGDA 1B6RA 3UM9A 2FUNB 1JMVA 3IIMA 16PKA 4J2HA 1HMPA 1IEWA 5ARBA 3OFSA 3T1NA 4LZAA 2VDJA 2VSYA 1W8IA 3FVRA 1DUIA 5IZ4A 1PYOA 1QK4A 4QYIA 3Q9NA 4MRSA 3IIJA 2H1HA 3HK2A 2XYRA 1Y5RA 2NO0A 4O2AA 4RZQA 1XCMA 3VUEA 5K0ZA 4CCAA 1BKYA 3I01A 4R5MA 2O7NA 4JY7A 1YIOA 4O0LA 4DWOA 2V98A 2VP3A 3DMPA 4BFCA 4HAWA 4X00A 5JRZA 1OI7A 1QJ4A 1A4XA 2DFVA 4FKBA 1KTVA 1S9DA 2EQBA 3R5SA 2HRBA 3HWX1 3PXUA 5DHUA 1ADFA 5FTKA 4AKEA 1W1UA 2WSSD 4UTRA 3DUFB 2QJTA 2YVAA 3R5HA 2E1PA 4F06A 3QXJA 1VE5A 4MYCA 2AFHA 3HGTA 3IAUA 3V7FA 2IVFA 1X8KA 1KK1A 3P52A 1RQPA 3DGFC 4NEHB 4Z9XA 3TNDA 4EJSC 4DCPA 5G0VA 4FIZA 2HWYA 4JQOA 1VJTA 5BYBA 3RSZA 1I80A 4Q9DA 3KT6A 2QMEA 1IXYA 2JLSA 2C7QA 3K0FB 4FGZA 4M8LA 3VYTB 1RVDA 3I61A 2IBTA 3PEVA 4M87A 3FZGA 2IDKA 2WMYA 2C5LA 4YJKA 4KL8S 1HEUA 1A8PA 1MC4A 2YOGA 3DTYA 4NJOA 3SJBA 1YQQA 1A9OA 1M6NA 1SIWA 3W8FA 2G1PA 1MFPA 3HRKA 4M83A 1TYZA 3ZYCA 1QM5A 5BYAA 1TT7A 4R8RA 1J90A 1M7HA 3GJTA 4JUCA 1ISIA 4N6OA 3L7CA 4O3FA 3FZEA 4Y1EA 5F2OA 5T8KA 4EGSA 3FPCA 2VUIB 1OFVA 2A58A 2ASVA 3DNMA 4G0YA 4NICA 4XB6B 1BXGA 5EPOA 5TDHA 1QE5A 4K9LA 3VSAA 1B8UA 1QHGA 4EDFA 4C3UA 3QFCA 3VVLA 3CZ5A 2XSZA 3BYZA 5B3AA 1A2OA 4JN6B 1R9GA 3CJRA 2FKNA 4MB0A 4ZRDA 2RHOA 4M0FA 3RKRA 4B3TB 1IWBB 3BKWA 5F4BA 1LDYA 2HHJA 1DVRA 3WMFA 5HF9A 2HHLA 3R3JA 2WFZA 3L7IA 2FCAA 1JHOA 3GWGA 4XUCA 3ZH9B 1QGUA 1XZKA 4BV3A 1GD1O 2P2DA 1AMUA 4E1VA 1JT2A 2CXRA 1XEXB 2X5KO 2DKOA 2OESA 1NVVR 2D5AA 3BN3A 4HY3A 4TLCA 1N34B 4CMKA 2JBAB 1U3TA 3DAPA 3HU3A 4Z2YA 4TVKA 4HADA 1BRTA 1UKYA 2AC7A 2Q4DA 2QLMA 2CUNA 3B6EA 4KJZA 1V37A 1YCFA 3OCUA 3ESQA 1QC5B 4NJMA 2WOJA 1JVBA 1T6ZA 3DUWA 2O8FA 4M21A 1N7HA 1USKA 2Z56A 3HL4A 3OSZA 5TLSA 4F9EA 5C1OA 2CJPA 3FPFA 2YJ3A 1O6FA 1PLJA 1XDUA 4KP7A 1T25A 4KYIB 5B3LA 1DDIA 1E9VA 2FR1A 3ORRA 3R0IA 1UDAA 5AKZA 2C7OA 2W4IA 4FX2A 4QLOA 1VL6A 1PLKA 1YOBA 2PKCA 3ZOZA 5FLXA 1CJSA 4UNSA 2RONA 5EVCA 4UU7A 3DQQA 1DT5A 1JDPA 2DFTA 2QN2A 4U5QA 2RGUA 4FR2A 1Z0ZA 1NI4B 4D4HA 5H9WA 3C16C 3SKXA 5CVVA 5H68A 1MH9A 2X9VA 2XDQA 1I7QB 1VYTA 3NS7A 4L9WA 3TPCA 2SKCA 1W19A 3EFBA 2H2FA 1C9DB 2OSBA 3IP1A 2D59A 3CINA 1R10A 2HF7A 4DSNA 3KHTA 2ONKA 1QRTA 1QHHA 3E5RA 5B1DA 1VPTA 2DH5A 3VAZA 1SUAA 2WUFA 2WUEA 4HNTA 5LOVA 1BU8A 4TTAA 3YASA 2JAOA 1Y33E 3GPIA 4B3HA 4EGJA 5CIQA 2HMAA 5CW1A 3WWPA 2IPXA 1GTRA 1TIBA 2C2OA 3QPUA 4YQEA 3TYXA 1YS7A 2GUWA 2DHEA 1ORHA 1MMFB 1N6RA 2XQIA 2I55A 2R6AA 2OBLA 3MJCA 4OHVA 1NQ5A 5ALPA 5T6BA 2WPNA 2YJGA 3HH8A 1Y4SA 3ZI7A 4LW8A 4N3GA 4TN1A 1C8VB 4DIKA 3HLTA 4YMHA 1RFLA 2XOXA 5KMGA 4KN6A 1EGVB 3AVVA 1U8CB 2OAGA 3RLFA 3L41A 5I9NA 2RGAA 4W5NA 4FMBB 1P4JA 4A8HA 2EP5A 1MFZA 2FGKA 4QXAA 4RGVA 1IN4A 3ZBTA 2P0AA 2RHWA 4B83A 4ECEA 4OXRA 5DYGA 4TUYF 4YPOA 1JA9A 5K3CA 1P61B 2OA0A 2R1ZA 4M1WA 4EH1A 4V2UA 5CD1A 4BLVA 1BG6A 1Z16A 1XVLA 1ZGJA 2V9PA 2PMFA 2YWXA 1EFDN 3CB2A 3GGJA 1FDRA 3WWOA 3S2ZA 5FJIA 3RKSA 4KWTA 1B42A 5G3YA 4EOGA 3TM4A 1VDMA 1B74A 4FFBA 3IVXA 2VZLA 3W3AA 1GZDA 4EYQA 4C05A 4O08A 1X77A 4Z53A 4RPLA 5GIOE 1GPLA 3DOCA 4FKMA 4JHLA 3S2SA 1U3DA 4J8PA 4F9GA 2YIVX 4QGFA 4XJTA 2IZ5A 2G9UA 1DMSA 2UYCA 1HF3A 4BP1A 2EKBA 4F97A 3LE8A 1T3GA 3T5PA 1A9XB 1XQ6A 2QAGB 1D2CA 1GTL1 2B1GA 5KX5B 1QGDA 1IXRC 3JXEA 4ZARA 4IH1A 4X1KB 3KKKA 3EWAA 4MW7A 4E09A 1RZRD 2IOYA 4P7GA 3Q3VA 1X80B 1F1JA 2GBPA 3MJSA 2XKJE 3NHYA 1CJUC 1JR2A 5DTJA 1OU0A 3VKFA 2VT6A 4LC0A 5CVDA 2XYPA 1YS2X 2Q5QA 3E48A 5JTUA 2XHZA 3GLGB 3CZCA 3DTNA 1T9DA 10MHA 4CR7A 2GYVA 1GZ4A 4II3A 1HE4A 1PJ8A 4HTFB 4DWJA 4EYGA 4PPQA 4OLBA 1B43A 1L5HB 2O48X 1LNSA 3T7KA 1FU8A 1V1MA 2Q1XA 3ADPA 3G0OA 4FFNA 3JVVA 2X2PA 4PCAA 4YWJA 4JK3A 1LW7A 2QV0A 2FSSA 4A91A 1NZFA 5EKTA 4EI2A 1V4NA 3GRZA 3QPVA 4IUYA 1H6AA 1L7MA 2AIRA 2ZSAA 1VLLA 2VPYA 3PRYA 1SXJE 1XZPA 4IGKA 2FMHA 3RVNA 2OENG 1YB6A 3DYBA 4KKXB 1GZ3A 4ZCPA 3CNLA 1P9OA 5HJ2A 5EWLB 1JU9A 1M2OA 4P31A 3GD7A 1JDJA 4KPUA 2EIHA 3BIJA 3JWPA 3W6UA 3B78A 1OH8A 1KNQA 1EM8A 1RCTE 3KEMA 3EF3A 1AHIA 1E5DA 2WU4A 1DWQA 3EUFA 3EBPA 1RAAA 1S5PA 3OOWA 2FR8C 3N2GA 4EVRA 1PS0A 4ZIRA 3KQLA 3EAQA 1JBQA 2DBRA 1RQXA 3AKCA 3T7DA 4Y6RA 5K8UA 4YMLA 3ZGZA 3W4JA 1U7ZA 4TKUA 2GXUA 4Z4HA 3SXUA 1OX4B 1C1YA 1MQAA 1RJ9B 3UAGA 4RK5A 3KT3A 2CZQA 2WKRA 3BSWA 3GQBB 4FE3A 3VMMA 3HCEA 2W98A 1M6VB 4TOIA 3ND8A 2Y05A 3ZXYA 4A36A 2OR3A 221PA 3NHLA 3R3UA 4PQYA 3KUKA 4I1SA 3GUCA 3A28A 4RMJA 3GLHB 1O0BA 1CQWA 2AUMA 2BEUA 2JJ8A 5K20A 1ISMA 2GPBA 3R3ZA 1U9IC 2UZ0A 3JWGA 2JF0A 1F2VA 2BZSA 4K0KB 3DO6A 3U7HB 1T6BY 4XPZA 3VR4D 2ZIEA 5IDVA 3TR6A 2OOKA 4ZI5A 5DX1A 1QHFA 3O7WA 3CKLA 1VQ1A 2B4AA 3JD2A 4CUJA 5F51A 1D1QA 3WDSA 4ASUD 5ADWA 4JS0A 2EG5A 4YMSA 3EWSA 3BWDD 1KS9A 3DAHA 5T64A 4BO3A 2I78A 1SC6A 5KPJA 2Y1KA 3D8SA 2W2PA 1JIXA 2IPMA 3FKJA 4RGQA 3DJFA 4OXIA 1Z4IA 2R68A 1D3AA 4R3UC 3P0JA 1V45E 2HCTA 2QM8A 3D6TB 2WFAA 3L8MA 2WYIA 3N9IA 1IYZA 1GCGA 2VEDA 3MILA 3O4GA 1O95A 2OGWA 4KH0A 4P22A 3ZHCA 2IEIA 2ZRQA 5HKKD 1C3JA 2IH5A 3ZK7A 4CL3A 1R5JA 2E2WA 1LNZA 4XJSA 4CF5A 1KO8A 1EFRD 5ALUA 5EJGA 4EKDA 1I94B 4O4HA 1A5SB 4US1R 1S8OA 4RK0A 3DP9A 4RK1A 1L8LA 3KL2A 2BJVA 4YCJA 2BRUA 5HGJA 3G8YA 2NG1A 3VPGA 1A0OA 2PX8A 3KJQA 4HPXB 3BGDA 3V7WA 1VMKA 4YMIA 3QFFA 1NKTA 4WK2B 2DBVO 1WXEA 4G36A 3AHHA 4BNKA 2TYSB 1NW4A 1W59A 4B46A 3VSCA 2O0JA 4K05A 2Q28A 1G5QA 4CKWB 3GPLA 1GPDG 1KOGA 1JJFA 1R1DA 2VP5A 4GYKA 4ZD6A 1WY5A 3F71A 1RWBA 3LZ6A 4NI5A 1M2WA 5CFOA 2GOYA 3HGMA 2BBTA 4IZ6A 3AWDA 4XVCA 4J43A 3H8WA 5IABA 2ZJ6A 4QO8A 4TKVB 3M6IA 2XTZA 4GL2A 3EGIA 1IXZA 2QN1A 4L5BA 2PGJA 3F5FA 2IF2A 2AWOA 3A05A 2V54A 4DLYA 1AV6A 3CEHA 3HYRA 1Y34E 3U3RA 2Y77A 4P98A 1ZHHA 5I7FA 2ZULA 1G16A 2W6NA 2YWHA 3EBOA 1XELA 4FN4A 5JCJD 3PTZA 1E2EA 3UA4A 3RK1A 3QFSA 3J81A 2JFNA 2GXAA 4LFCB 1W25A 2W2LD 3RLIA 1FSPA 2HHCA 3CPJB 2GR9A 2GM9A 5CM2Z 1ECLA 3LUKA 3OQNA 4GXTA 3P2KA 3V97A 3SG0A 2HTEA 4OU4A 5JALA 2ZYDA 4TV8A 5DYYA 1FDIA 4OGLA 4CIWA 1GPH1 2GRUA 5FADA 3JYQA 4Q3OA 3L1VA 2IHBA 5DDIP 4NS1A 4RFSA 4YGYA 5BQ3A 3PC7A 3C15C 3G8CA 4MGZR 5T67A 3M3PA 4B74A 2ZRDA 5GWXA 3CEJA 1FXWF 4JI3B 4DLKA 5C8YF 2XGOA 1BJRE 4EENA 4U2KA 3K2BA 1K6IA 3V8PA 3PPIA 3U5ZB 1CLEA 1P7WA 1XXHE 4X7BA 2JBHA 5EJMA 3C3BA 4M8IA 1I6WA 1ZUHA 3K0AA 1ZN8A 4JQSA 4DLZA 5AVUA 3RS2A 2ONCA 4H6VA 3G8AA 4NFLA 4E7OA 4NWIA 3BL5A 1LH0A 2QVXX 2HLHA 5D3MA 4MMXB 1WP4A 2F43B 1EVKA 3U4QA 3OE7D 4PG5A 4LZJA 1TU4A 3UJAA 1U4NA 4YEDA 4HG2A 4ME6A 4KDCA 3T3MB 1X0XA 1X7XA 3PNBA 4NV1A 1PP4A 4P7KA 3A1VA 5ALZA 3F6SA 5JJ5A 1DIHA 1YA8A 2Y4OA 3R74A 3VHXB 1H3NA 2ZDGA 1X13A 3ZI4A 2UUBB 3EC7A 4U2DA 3TTSA 3LW8A 2ZXFA 4GD3Q 3B89A 4R40A 3NDRA 3BHMA 3D3QA 1R6XA 1VMDA 4TSFD 4WUVA 2ON6A 1P4GA 1DARA 3AYXB 4P0TA 5TQ0A 1YOVB 4Z9BA 3FCUB 4QEKA 4YMTA 3GDHA 3R6DA 4BQNA 4HF7A 4YR7A 2BMJA 2X13A 4NU8X 2YZ7A 1EUQA 1BMDA 4UU8A 1A9QA 1ULTA 5A7FA 1NLMA 3U9TA 1UBEA 1ZQ9A 1C2YA 3OCYA 4KR0A 2GJ4A 4EG8A 2H1FA 2O0KA 1G64A 2XB6A 3PPWA 1QPZA 3OQIA 4OHKA 1Z4JA 4YXWD 1GTSA 1PO7A 2HIAA 4G1BA 1CR1A 2R9VA 5JHHB 4M1OA 3ZJ4A 5I7VA 2H4WA 1NQWA 3S1AA 3UJ8A 1J0AA 2GD1O 4P82A 5JYCA 2KSQA 3IX7A 3C8HA 3NJ8A 3KLNA 3OJEA 4BE9A 5DHQA 1T4GA 4D8UA 1C41A 1LNQA 5D3ZA 4CR6A 3NXKA 5HDQA 1PVVA 1FJGB 1VE6A 4YP0A 2OXTA 2MSKA 3FFWA 3T0IA 4PZLA 4FCWA 4GM4A 4XYMA 4ZV9A 3TCKA 4WBNB 2PUFA 1JHRA 4O4JF 3UFXA 3UAOA 1RHJA 1QYCA 3A9WA 1QGZA 2ZZNA 1WXXA 3TGPA 4HZGA 2B69A 1QMPA 4B17A 3VDXA 4XIGS 3G0IA 2Z2XA 2YHAA 4BBPA 4JIMA 4F6RB 5CEEA 5K03A 3VI3B 3RI3A 3O31A 2J30A 5BR4A 3F98A 3ROPA 3TVYA 1XFDA 1L5SA 3HBNA 5EC8A 5BSFA 2ZQ5A 4B84A 6REQA 4LXXA 1VKNA 1JAHA 4L3OA 4I55F 4TMZA 1YA4A 3TQFA 3CGGA 3E4CA 1T9KA 1A82A 4MIEA 1DLJA 1SVOA 2PS9A 3U7EB 4H6PA 5CBPA 2WE7A 4KAXA 3AL3A 3L9XA 3ZWOA 5EYPB 4G9EA 4B0PA 2FQ1A 1F60A 4ZO9A 4JB2A 1FFAA 4W5WA 2OO5A 4FHZA 4WESA 4JKIA 4J7CA 5I9LA 4DCTA 4HUJA 1ZICA 4CTNA 5TF0A 1UDXA 4IKOA 5H8WA 2AJDA 2O8CA 3L4BA 3LXXA 2UYQA 3H04A 3LQ2A 4OA5A 3VZRA 2CNBA 5IM4F 3CUSA 2QD1A 1H69A 2ATIA 2O2JA 4BFLA 2C84A 4IIEA 4Z7JA 4BFVA 1YC5A 1Z4PX 4X1IB 2VJBA 3LUGA 3R5FA 1ZFNA 5BOVA 5EMMA 1O6BA 4HVTA 4WFKA 4DR1B 4NZPA 1WY7A 3QEAZ 1G2PA 4GG1A 3GA7A 2D0PB 2J9XB 1M3SA 2MSNA 4BN4A 3QKWA 2GARA 1JHZA 4BAUA 5KVCA 4QTUB 2CSXA 5DSTA 1NT2A 4N0DA 4FKZA 3TJMA 4ZI7B 5AKLA 1YKFA 1II9A 1QWOA 3RV4A 1C0LA 1OFTA 2X0NA 4Q03A 4DYDA 3MF4A 1HL7A 2CDNA 2W8BA 3R2JA 4V0LA 1DC4A 3I9JA 4WH0A 3WIBA 4W5QA 2G70A 3ZU5A 5HUQA 3SQXA 2I3BA 1KY2A 7MDHA 1Q2UA 1U2GA 4NFHA 3WKAA 3H5IA 2FDRA 2XGMA 2C4KA 2DWQA 4DCJA 3I8SA 2GWHA 4YRJA 4U39A 2VN8A 2C5EA 4JX9A 3U6KA 3ONVA 4RKEA 3V3TA 1II0A 2F62A 2WJAA 3O95A 4PBRA 2JL1A 3I2HA 2ID4A 1PRYA 2A14A 3NTLA 4IIJA 1E0AA 3C3PA 1OT3A 1A8UA 3LBIA 3SLKA 1MJGA 1AY0A 1IUKA 3DVRX 3P5BA 4RLSA 3E7FA 3SX2A 1UJ6A 4X1YA 1EFHA 4PWYA 3GF4A 4CHTA 3ZBQA 5M29A 3P71T 2DTXA 2IELA 1TECE 3ODPA 4LY0A 4ZVMA 1CRPA 4BV8A 5ER9A 3T1VA 3QW2A 5HUJA 1VB3A 3C6XA 3H97A 3IILA 2BGKA 2AWNA 1KMMA 3AP1A 4OXXA 3LF2A 1ZJ6A 1XTUA 2C97A 2DTDA 4HAVA 3V4LA 5F3DA 4RTSA 5K8LA 2GPAA 3WL6A 4ATNA 3L1IA 5CCBA 2QT0A 4L4ZA 5GJWC 1X8XA 4GIBA 1QYRA 3JTMA 4EF5A 1F9EA 3TLAA 5A4IS 3M34A 1XKQA 4FCVA 5B1SA 1EU1A 2JJ1D 4JQYA 1BS2A 1L1EA 1RKUA 1RKQA 1X0VA 3RKUA 4CLXA 5HR5A 2PUDA 2A6PA 1CXZA 3D3NA 2V1XA 2EP7A 4MNTA 1RHRA 3UXMA 5E6UA 3GG9A 3DA8A 1PGPA 3SDZA 4G23A 4O25A 3CZPA 4ZXFA 4BDSA 1Y80A 1YI8A 4GBED 2M6LA 5DNYB 3AFMA 1EKXA 7YASA 5DISB 3KJHA 3PL1A 3AY3A 4DLLA 2P35A 4RMHA 2HKIA 4G1UC 2ADFA 3L8ZA 2WPDA 2YVUA 1RP7A 5EIOA 2PJZA 3DZJA 3S44A 3SKVA 4QUJA 2Z57A 3AHDA 4LXHA 5IMSA 1Z38A 2OK8A 3UG6A 4P4LA 3UPUA 3ED5A 3R0ZA 1JHAA 1X94A 3P20A 3MXTA 2XCTB 2PUVA 2Y68A 3I9FA 5FQOA 3UW1A 5I4IA 5IM5A 1UKCA 4DYHA 1U3CA 3IE1A 1XI2A 3GB9A 1DEHA 1TMKA 4CMJA 2OC9A 2VF7A 4HWGA 2XJ4A 4A6XA 3LQ4A 1ISSA 1D5CA 3B13B 3MK31 1TU3A 2FEPA 2NU9A 4DIBA 1R2QA 1YZNA 3FZNA 5BR8B 3NMUF 2OBBA 1KEUA 1FQJA 1IAVA 4XWWA 1KAGA 1S1CA 5DOZA 1KE2A 2IYWA 3HBJA 3JVEA 4MX8A 5EAIA 2O2XA 5AI5A 1RM4A 1DAOA 1J33A 1YTLA 5AK6A 4I1YA 1I0LA 3A9TA 4OF4A 4BS9A 1OPXA 4Q1EA 1ZLYA 2VFAA 3IH5A 1JW9B 2P1DA 2UYOA 4EW2A 5AHXA 1IN5A 5MDHA 4WI1A 4M7WA 1UDWA 1U7OA 2RHMA 1YVRA 2ZW9A 5JMOA 2WABA 3LBAA 1VHWA 4ER7A 5HK9A 3T9DA 3ROTA 1ZUNB 1QS0B 3L1HA 1HQCA 1TKBA 2YCLA 1A8SA 4GI2A 2J7KA 2RK4A 2V9ZA 2NSLA 3MJTA 1RYMA 5JBNA 3VC1A 3FPJA 1QO0A 2IPOA 2ZB4A 1E89A 3HM2A 3AEKA 4J3JA 4ZKDA 5BRJA 2I3DA 1SUEA 4RELA 3BGIA 2HXGA 4FOOA 1J9GA 4OUDA 4LFBB 1CUAA 2ETVA 2VHWA 1P7VA 4CN8A 4P93A 4EHBA 3NYWA 1R8YA 4DZTA 4BWFB 2OGUA 4ZJYA 2GFQA 3EEIA 4YMWA 3IAS6 3A9VA 4L9SA 2J5KA 4C78A 4E2ZA 3R7WB 2O7RA 4GBJA 4CM7A 4EO7A 3L7KA 1X9IA 3QKRB 3E1SA 4M9CA 2IYVA 4YACA 3TNYA 1Q6YA 3FNGA 2SECE 1SM4A 3E2IA 3IOBA 3GO4A 4XM0A 2JA2A 1VSVA 4UHJA 1D5WA 4WHMA 4TTJA 2MDTA 4U2GA 3VR3D 2JFOA 3LPCA 1KK0A 3U7FB 1KMHA 4G8CA 1KAQA 1WPXA 5JH7A 1JFSA 3HP7A 1TMGE 1K6MA 2I29A 4CMCA 2I8LA 2PFSA 4XD7D 4I36A 3OKCA 1AURA 2XCRB 2XVMA 2AOUA 2FFQA 4MR9A 3UC5A 1L5GB 1ND5A 4O3MA 1M5RA 4I81A 4BNYA 2GCOA 4UU0A 1ZG3A 2AYZA 2OV8A 3CM0A 3K9HA 2YX1A 3MRVA 3PGMA 3TSZA 1KRWA 4TGLA 3EVZA 3NNDA 4MW2A 3HUEA 1KMQA 4RNDB 4XDHA 2FWJA 2QRNA 2I7XA 2X42A 2FG6C 3HZRA 1X3SA 4WY5A 4DTCA 1TVKB 1RQNA 3G2HA 2XITA 4PRKA 4MINA 1M7BA 2GK7A 2XUOA 3JVIA 4N49A 4X85A 5JE8A 3SDSA 4EVSA 2O4CA 5K8VA 1H0HA 3T3NA 2PDAA 2GB4A 3ME5A 4OUKX 2RBGA 2E6KA 5DK4A 4PM4A 2PYIA 4R2KA 5B3JA 3RTAA 5J4YA 4YAIA 1XTVA 4ZGWA 1CWUA 1OBHA 1G21B 2B30A 4IQ4A 3FUXA 3TL3A 3IODA 5JD5A 1XKLA 2Y6UA 3AJRA 4TVOA 1XTIA 1X1BA 2Y0BA 3KXDA 3OD5A 4HAIA 4IXWA 4MCJA 1JTFA 2O5EA 4KLRA 4ZJUA 4CZ2A 5KQPA 2ZSIA 2QTZA 3A4IA 3EHDA 3FZQA 3JAKB 3TE6A 1PR5A 4KOAA 2J41A 2Q27A 2HC9A 3L7BA 2R79A 5JY6A 3KUCA 5IJWA 1FNCA 4L9RA 3W06A 2VRNA 2Y1CA 2WD7A 4M54A 1I13A 3ZIAA 1X7HA 4MUYA 5CLHA 4ML3A 1T24A 4XWAA 2CD7A 1R3UA 2XMRA 5L3QA 1AZTA 5AP9A 2HSEA 2UZ1A 2QL7A 3D7KA 1WE2A 1DWUA 4BJ5A 2XY4A 1UQTA 1G2QA 3EFEA 5BYJA 2OUKA 4K8RB 1J8FA 3IUEA 4Q1BA 1N3BA 4EHKA 3CLTC 4YAFA 1AQYA 3DLHA 4CEJA 1UPAA 3HEAA 2CKDA 4JMLA 4J07A 4AMGA 3TLYA 3GY0A 2CXUA 2OKCA 3Q15C 3P94A 3JAWA 2AF4C 3GVHA 1FBTA 2E7ZA 1GSOA 5EPEA 3WWYA 4A0GA 3K05A 1A50B 4MVJE 4D0NA 4ZOCA 1RJDA 1VKOA 2EC5A 4A0QA 2IS6A 3VO1A 4QX6A 1PHRA 3CB4A 3E9RA 3KYBA 1SCBA 1CUXA 2IY9A 2EKLA 2WILA 3HVJA 1G18A 3AIIA 3ODGA 1DHRA 1H9BA 2OGTA 2Q5CA 4RD0A 5EOVA 3FPBA 2OCGA 4YCNA 3LUAA 1HTBA 2OD2A 4HLDA 4KUHA 2JZOA 1QP0A 2FZVA 1OZGA 1Z0KA 1M73E 1YGPA 2ID8A 5GGYA 2C5GA 3H0KA 4ABYA 4EQ6B 3W7AA 2QR3A 3OX1A 1EJ2A 5A5FA 2YICA 1IOWA 1Z29A 4LYFA 3EG5A 4QDXA 4CE6A 5A7HA 3TBKA 3VBCA 2EDAA 2HO4A 4NX2A 1V5IA 2GA8A 2QD3A 2P62A 4GOJA 2IPLA 3FH0A 2G36A 1QRAA 3AFIA 4IHJB 3QWBA 4U8GA 3F5DA 4BXOA 4G97A 1RHQA 4FP9A 5JSZA 3IRUA 3MTAA 3TECE 3RVMA 2J6IA 3A04A 3OPXA 3SJUA 2V6MA 4A2PA 1PJSA 2QSZA 2CV1A 5ICMA 2YWGA 4G9BA 2L0XA 3N2LA 5TNXA 1SXQA 2VZEA 1LGYA 1R6BX 2WV7A 3C4JA 1ETHA 4WKGA 3QLJA 4N9WA 4KV7A 3IPRA 1EIZA 4PG8A 4NBKA 3T1YB 2O23A 2ZBGA 2BGUA 3RK4A 3UWSA 1MOPA 1RWXA 2FZEA 2AMFA 2OG1A 3VJKA 5CVCA 2QJWA 4M8KA 4QDOA 5ALXA 1EVQA 3ROFA 4IYRA 4NYJQ 2P6PA 4L15A 3QENA 2ZSEA 4F6CA 1PNRA 4YJFA 5TT1A 3FPSA 2BFNA 1TJYA 2PNJA 1Q3HA 3AB8A 3RIHA 3D2LA 3PJGA 1I4DD 2GETA 3VZCA 2OV1A 1IWOA 2G1JA 1BX3A 1I30A 1WHSA 2QTCA 2WFMA 3K0KA 4KITB 3ETGA 4H3KB 3M4ZA 1VXRA 1XTJA 4NZYA 2P9EA 4BMPB 3FKQA 4D99A 3FPGA 4QRIA 4QUHA 2PWAA 3UV3A 1A2KC 5D84A 2AFRA 3U17A 2K7ZA 3PFHA 2VDQB 2MTBA 3VU3A 2VWHA 5DXAA 2FV8A 1L7VC 3FF4A 4U9IS 2PRZA 3PXXA 4K8OA 3OCJA 3U13A 3QTTA 1E9CA 3NBMA 1JQ3A 3R75A 4L8YA 3SYMA 2ZUVA 1AH2A 3NGMA 3X0DA 2VTBA 2IWRA 4F04A 2IHYA 3KB6A 3WYGA 4BWYA 2ZRHA 2F3PA 2WWWA 4FGJA 3HC7A 1MAAA 5JO0A 4K26A 4GX0A 4LXQA 1EZ4A 1RAEA 2QYSA 1AUQA 1B8VA 3K73O 1RXEA 1YRQA 3FCYA 3GCWA 4L72A 8AT1A 4X5OA 1E7SA 3QYPA 3G2LA 1FW8A 1NVWQ 1L8QA 1Z18A 4HQNA 3FUTA 4M0KA 5EERA 3RASA 4TMXA 2Q2OA 3FWKA 1U0FA 3MGAA 1OIWA 3A9CA 3G9ZA 5CTJA 2O54A 4KZPA 5EQDA 4D9JA 1LLDA 2FQWA 5ABPA 3MGBA 2N1MA 1G98A 4HDMB 1YDWA 2X23A 3V7UA 4YUAA 2Q3HA 3QX9A 4ZQGA 1VIDA 5AUNB 3TXAA 1IY2A 2BFCB 2CHFA 1YCHA 1M1YA 3NHSA 2VYNA 4QU5A 4TL7A 5I7EA 1Y5MA 1DHTA 1N1MA 3FOBA 3ROGA 4TTTS 2AUNA 3HMKA 2KS6A 3ULKA 1X2EA 2NSDA 3ST7A 2JVIA 2XMBA 1D6NA 2BEWA 3O5AA 5I48A 3M3DA 4P0PB 5BVGA 5LYJF 3UJNA 2FRDA 3PWSA 1WDLA 1G20E 2XA9A 4NNPA 3ADDA 1NJ8A 3W5IA 2BISA 1HDCA 3HJAA 3VO2A 3VJRA 5J2UF 1GA6A 1XSEA 4ANFA 1QGOA 3HPRA 4KO3S 5ALVA 1AXEA 2C92A 2YN2A 4J3NA 1NNUA 4C0KA 3ZUPA 5L3SA 1H4VB 3AFOA 3CA8A 2EFYA 2O4UX 3DLAA 4O59O 5F5NA 5HCUA 1Z17A 4P3KA 3S40A 4C4PA 3R9WA 1F17A 2AQHA 2PX4A 1WUIS 2KE5A 3AOEC 3LLUA 4WZBE 3GCZA 3ABSB 3HKDB 4HQRA 4M0EA 4S1TA 1ZRSA 2C88A 1B8OA 5DVZA 4DEYA 2OZVA 1V7ZA 3KBOA 3KLMX 3PF8A 2YHIA 2FPLA 4M4SA 2VYVA 3K9NA 1JWBB 1AKTA 5MN4A 4ZYLA 1OVGA 3IOCA 5IAAA 3Q3HA 1UM8A 1JEQB 3K6SB 2WEKA 3O26A 2I9PA 2HY7A 4AMYA 1B16A 1HQYE 3EY4A 1E79A 3TFOA 1YONA 4LWZA 1CJMA 1RW4A 4R6WA 5U1PA 3CIFA 2J33A 4FQ5A 4JEMA 3ZV5A 4IH4A 1ZHFA 3VOTA 1XX6A 3F1KA 4QFMA 3FMFA 3G0GA 5AJWA 3ZV6A 4CMIB 1UZUA 2E37A 3N2YA 4NCAA 3KTOA 3J7TA 5DYTA 1HG0A 2VCEA 5IARA 1EXMA 1FF9A 1K3FA 1PE0A 2Y1DA 2YNMA 4KO1S 3AKZA 2F3UA 2EW2A 3VSBA 1Z5UA 3PWKA 5LQKA 3FR7A 3SS7X 4CQJA 2W6JA 4FLEA 3EMVA 1V16A 3PHIA 3EOAI 3DPSA 4AWBA 2X58A 3ZJYA 4YNBA 2CEAA 3VTFA 4Q3NA 4G67A 1JG4A 1N5OX 4AO6A 3EH2A 1EDZA 1ULHA 5DGXA 4XR9A 1YQGA 1G3UA 3OZCA 3QF4A 3OLVA 3JASA 4NZ9A 4RYDA 4D9GA 2HU5A 1RPTA 3LK7A 4HDKA 1GTJ1 2OQ2A 4TMFA 4LVCA 2G07A 2WWTA 3R4CA 2WY2D 3OQJA 4B3FX 3IUPA 1CS0B 5JZBA 1D7OA 3ZWQA 1SJ9A 1DC8A 1TIPA 3WE7A 5KQGA 3H5AA 1KYZA 4CL0A 1C4KA 1L6RA 2HA5A 3G3EA 1L3BA 2FFBA 3ETEA 2P9QA 1QZ3A 4NAVA 1FRNA 2AN1A 4WMLA 3C0KA 3NTVA 5BV8A 1E3TA 5JAZA 3RIEA 2B9VA 3KIPA 3LXUX 3NP9A 4D8VA 1P1KA 3OEHD 5I7WA 2L82A 8ABPA 4XIIA 4KWHA 3ET4A 4YAEA 4KNYA 5FJJA 1L8AA 3C6KA 3ZXSA 3GOQA 4AIRA 1EFKA 4C1BA 1NVEA 1GAQA 3MCAA 2JCGA 3QU9A 3C5CA 2BF7A 1GN8A 4RHFA 3M0EA 3VR6D 2L2QA 3FSRA 3S6JA 2HSZA 2ZWAA 3DKVA 1NLZA 3F7OA 5D6NA 4H4CA 4TT3A 4YRFA 2AZMA 1DGQA 2FKAA 2I3GA 5BPHA 1I10A 2PEZA 4PX2A 2BBOA 1EG7A 1KHTA 3NHUA 1D0IA 2OVFA 4IUCS 2QVYX 4N3CA 3TXXA 4PC2A 3VAAA 2QSUA 3Q8MA 1J1IA 3NNNA 3NC4A 3O38A 1Q11A 3WL4A 2Q6OA 1XNQB 3OMWA 5K2OA 3UENA 4Y2UA 3WLFA 4MRPA 4EFNA 5DXFA 1OWMA 2QGNA 3BCSA 1XVTA 1RWVA 1W0KD 2YUIA 3PDJA 5T5QA 4ZHQB 2QMOA 3C24A 4M8SA 4JLJA 3BE6A 3SX0A 5EE9A 3RBVA 4HGOA 1LPNA 3FI0A 2OHHA 2R7MA 1YZTA 2WDPA 2YXPX 4BKMA 1FYWA 4OJKA 3MTIA 5AOBA 2BFEA 4PNHA 4ZVNA 5B1HA 3IUNA 2VEOA 3S5JA 3MIZA 4EA8A 1GTZA 3K70D 1WDWB 1HE1C 1JEYB 2E4WA 2OV6A 3RC7A 2P4UA 3O9VA 2YXDA 1SXJB 1Z25A 2OMEA 4E32A 2QPOA 1D6SA 4BQQA 5EUMA 3KJFA 4US0R 4UHDA 3SD7A 3KEGA 4QTZA 3R7LA 3OEYA 1E5QA 1O9GA 1RM5A 2IPAB 1FDOA 2E4VA 5BSTA 1AZSC 1AB5A 3FKSA 2C4VA 1V1RB 3KWMA 2FTKE 3DNFA 4MCHA 4UQPA 3C4VA 1TGYA 2GF0A 2VT7A 3T3DA 3L0OA 3COPA 3OZIA 3T5GA 1QU3A 5K6AC 1KGSA 4ZWNA 2FWNA 1W4BA 3C8MA 4CG0A 1CD5A 4MPPA 2QM0A 3ILYA 4ZALA 2NYUA 1KI9A 2Q7DA 3ZQKA 4HQ6A 5HX7A 3AR2A 5FR1A 3WSTA 2V4MA 2WVAA 5TE9A 4AJ9A 4B32A 2KI5A 4IF6A 3OT5A 3WFZA 5JI2E 1OYWA 1KJ8A 1UJCA 2TMDA 2DE0X 2FAXA 4DLNA 4PHTA 2EHDA 2GM3A 3MSXA 1DKRA 4MV0A 2IYUA 3PQ6A 4AX4A 2GQ0A 5CDHA 1UMBB 2R6JA 2EKQA 2X40A 4DVGA 5L51A 3DBLA 4B7ZA 3IVGA 4GNKA 4HEQA 2E4AA 5C46F 3E0QA 1P81A 3NOQA 1P3DA 2R85A 2O8DB 4E3WA 3ETNA 1B00A 4PE5B 3O2QB 3MHPA 5T57A 4GM0A 5DGDA 3WXBA 4YRRA 3T7AA 4EUEA 3CTPA 1O54A 2Y2UA 4P92A 1U8YA 4MQBA 5K8IA 3DO8A 2X2OA 4QUEA 3SZGA 2D0DA 1UC8A 3KCQA 2C99A 5EHNA 4C0HA 5JDIC 3GFGA 1Y8QA 2XRZA 2BUBA 2VLIA 4YV7A 3AT1A 3NBAA 4KNWA 2A9FA 4Z4EA 1MQ8B 2SKEA 1G4AE 1B26A 2BCJQ 2ZKLA 4IUBS 5E1BA 3KQNA 1ZVQA 4P35A 4DABA 4QT4A 3Q41A 3OQVA 1NVTA 5BN5B 1M2FA 1FB5A 2IP1A 3GRAA 1LVUA 3L7AA 5DASA 3ZQ6A 4EB0A 4CL2A 3FOFC 3F73A 1ECPA 1JDTA 1NI4A 2ODEA 3JZMA 2I4OA 5AXCA 3E0XA 3REOA 1GO2A 3HKEB 4OVKA 5JAIA 4D9KA 3MB8A 3EDMA 5E9QA 3WNVA 4G1VA 1EXWA 1WRBA 2C9YA 2FPOA 2X8BA 3D2AA 1IE3A 4MWOA 4RHCA 4PC3A 2PV7A 4ZOEA 1SKUA 3ZEIA 1B6GA 3OOEA 1ENZA 4JI0B 3WBFA 3GT4A 4Z9FA 1KP2A 1T9ZA 5KDOA 4X20B 3VNVA 3ROXA 2EVWX 4QGSA 4CM8A 2JCBA 2H16A 3IQZA 1W4AA 1FNMA 2R6R1 3E82A 5BNFA 5LP6B 3RRMA 5ES4B 1DT3A 3DBHB 4MKHA 4PIPA 1XPRA 2QHXA 3NC0C 3D4IA 4TYWA 1NUHA 1V9CA 5KNBA 1X1AA 1T1IA 3H5OA 4IBOA 2B5VA 2JI9A 3HKCB 4L0DA 4KDFA 3MQ4A 3KOZA 1BA2A 1IIBA 4LBYA 3LGSA 4Q3EA 1R9NA 3FPKA 3MJDA 4UU1A 2VPTA 3ZH2A 3ZPXA 4B09A 4FNGA 2X6RA 5DX8A 4QUAA 4OOEA 1DG9A 5B1IA 4IJ6A 2FE1A 4KPGA 1S8AA 2SCUB 4IAOA 3TTYA 4D4GA 3U56A 1JKFA 3CUYA 3WGTA 3ROQA 5IAKA 2F6RA 1NVFA 1A4RA 2L17A 4Z0TA 2FLVA 4EFMA 1COZA 1GKLA 2ZYSA 1PD0A 4YRZA 2I7TA 2Y92A 3D31A 3LJKA 4KAFA 3EXHB 5FUVA 1PX0A 2A9VA 2FFHA 3HVKA 2G4CA 1TJ5A 3BMCB 2JARA 1GGNA 3A32A 4IFEA 4LOJA 4G26A 4PRYA 3E9DA 3FR8A 2A9KA 5F64A 3R8CA 3QVKA 3A6GA 3G79A