4PW0A

Alpha/beta hydrolase fold protein from chitinophaga pinensis
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
275
structure length
275
Chain Sequence
NDHATAPTQYIEVNGTRYAYRSLGAPSDIPLICFQHFTGTLDNWDPLITNGLSKGRQLIIFDNKGVGLSSGTTPDNVAAMTADALEFITALGIRYFDVLGFSLGGFIVQYMAHIQPDMIRKIIIVGAAPQGVKVLHTFPDLIARAMQLEPKERFLFIFFEQSEHSRSKGLATLGRLYERTTDRDQDASAQAIGAQLTAITNWGKKTPSFEITSIQHPVFVVQGSNDEMMDTYNSYELFKQLPDAILSLYPDAAHGSFYQYPELFVSQTEYFLDSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha/beta hydrolase fold protein
publication title Alpha/beta hydrolase fold protein from Chitinophaga pinensis.
rcsb
source organism Chitinophaga pinensis
molecule tags Hydrolase
total genus 101
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2014-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4pw0A00
3WIBA 5EIEA 1WOMA 2VTVA 5T4EA 2HL6A 3WJ1A 1E66A 5AP9A 4LXGA 2XMGA 3NWOA 4EY7A 4FBMA 4KRXA 3GFFA 1F8UA 3VVLA 4FLMA 1K6EA 1CRLA 4NVRA 4DNOA 1UK9A 1MAHA 2NW6A 4W63A 3B12A 5EFZA 4BRSA 1S8OA 1MN6A 3MVEA 4Q3KA 1W4LA 1WB4A 2JGJA 4J0CA 2OAGA 2B9VA 4Y2VA 2D5LA 2BCEA 4P92A 2B20A 1ZJ4A 4XJVA 3R3VA 2ONCA 2QUAA 1DT3A 5K3CA 2XQFA 3CCCA 1BCSA 2XUDA 1YS1X 3FBWA 4RPCA 5DYYA 3ICWA 4UHDA 2XMQA 2WJ3A 4I4CA 5BOVA 3C5WP 3BDIA 1XQVA 4FMPA 4WDQA 1CFJA 3BWXA 4GEGA 3QVMA 3BE8A 4X00A 4DGQA 5AKXA 1G4HA 2Z8ZA 3ZPXA 3W9BA 1P0QA 1XZGA 1QIIA 4L72A 4MWTA 3K6KA 4DMHA 1Z68A 4KE8A 2WIJA 3ZWQA 5C7YA 2LIPA 1GGVA 3OOSA 4ARAA 1X2BA 4ZRDA 5A7GA 3LCRA 1YAHA 4AZ0A 1GKKA 1K8QA 1JU4A 3C6XA 2WU3A 2C0PA 1AQLA 3FWHA 3IDAA 2H9YA 3PUHA 5ALYA 3QPAA 2I03A 1UOPA 1GPKA 5AKJA 3WK9A 5FOQA 4UFOA 5EI5A 1IUPA 1IUOA 1QTIA 4WY8A 2BFNA 3ANSA 3GBSA 4C4YA 4H7HA 5KREA 1ZI9A 1H22A 4EY4A 2ZSHA 4MEBA 3ESAA 3STYA 2XUOA 2E3JA 5ALWA 1MX5A 2WIDA 4H7KA 1PFQA 1UOQA 2CEKA 3SX4A 1XZMA 4X6YA 4EZIA 5IKXA 2PSHA 1SFRA 1VLQA 4H7IA 1GQSA 1ZD3A 2QTBA 1QLWA 1RP1A 2JGFA 4HXEB 5AK5A 3WMRA 4IO0A 2P8SA 4H77A 1WPRA 4UBLA 5AK3A 2HA7A 3STTA 3STVA 4AQDA 4BAGA 2Z5GA 4KAJA 3WWOA 3WK8A 3KDAA 1UXOA 2GYUA 1WB6A 4BZWA 1JFRA 2XQJA 4BRZA 3FLEA 3O4JA 1Q0RA 4ZXFA 5AJHA 5ALOA 2GZSA 2GBGA 1QIDA 4E11A 2CUTA 3WYNA 4WFKA 2H7YA 3H1BA 1TCCA 2QMQA 3QMMA 5SYNA 4RE6A 1IVYA 2XDWA 1FFDA 3FYUA 2I78A 4U2EA 2EDAA 4DMKA 1Y7HA 1DQZA 1P0PA 3FNBA 1G42A 5DTIA 1EVQA 2W6CX 3WL7A 1RWQA 1XRQA 4WDRA 3FLAA 4QA9A 4OB8A 1BCRA 4Y2QA 1CUSA 4MQLA 5EHQA 5ALNA 2OGZA 3IULA 3E3AA 5AI0A 4G4GA 5E4JA 4WFIA 4FNGA 4I19A 4QDUA 4GXNA 1O6GA 3C6YA 1TIBA 7YASA 2I3DA 2JIDA 1XFDA 2XB6A 4CIAA 3UUFA 2XMBA 1SCQA 4OD0A 3I6ZA 2OCIA 4QDOA 1E8NA 5FXMA 5FPQA 2PX6A 2HU7A 5LKRA 3AFIA 1D07A 4TGLA 1GXSA 3H18A 3PDCA 4Q1VA 4B7ZA 2IIVA 4AMZA 3IIIA 4BDTA 2HM7A 5LZ9A 3QPCA 2PPLA 1DTEA 3IUNA 3V1LA 1QFMA 3DNMA 3WK7A 3FLBA 2Y1KA 1TKRA 1XRRA 1N8SA 5AKHA 1OILA 5DNVA 2VJBA 5AI6A 3ZLUA 1G5FA 4BAUA 3M83A 4FKBA 4FFWA 4LHEA 1XZJA 4MXDA 5A7HA 4O08A 5CURA 2WUEA 3G9XA 1QE3A 4E15A 1J2EA 3DOIA 4QDZA 4W1RA 3VJLA 1Q83A 1EA5A 4W1PA 4B80A 5CXUA 5FPPA 3T52A 2G5PA 1XZLA 3PFBA 2PL5A 4OB7A 4A5SA 4F5ZA 2HDWA 5HKAA 4UHCA 4G5XA 2ACKA 1BE0A 5D7BA 4C01A 1YCDA 1EB8A 3FYUB 3R3UA 3RLIA 1ODSA 4J3JA 1L7QA 2R11A 3KD2A 5CTAA 3FYUC 4G8CA 4WY5A 1X70A 1ZD5A 2ZYIA 3AUKA 2XUGA 4EB0A 2H7XA 4K6GA 1H2ZA 5CBKA 5IH7A 5CRIA 2BGNA 4BC1A 4HXGA 5CH3A 3A2NA 4BYMA 5T4BA 3EIOA 3DJYA 1DX6A 1TQHA 5AKIA 2Y2UA 3FAKA 2GYVA 4X93A 2CMFA 4XIIA 5LZ4A 2FJPA 3QYJA 4IQ4A 1BU8A 2QJWA 2QKYA 1XZIA 1A8UA 4PF1A 3C70A 1CEXA 3BXPA 3STWA 2YYSA 2CKMA 2DHEA 3VISA 1AGYA 2WM2A 3F67A 2XUFA 5ISMA 2WIGA 2XMSA 5FUMA 5EGNA 3R41A 1C7IA 5AM1A 5D3ZA 1CQZA 3PE6A 5FLKA 4J0DA 1QTRA 5T4HA 4OYLA 3F98A 2WHQA 5AKLA 1WCYA 4RGYA 5SYMA 3WA7A 2XQKA 4HAIA 1CPYA 3VXKA 4FNMA 4E46A 1VZ2A 1RYYA 3JYHA 3ESCA 3ESBA 5D6OA 3OTQA 4UFNA 3DS8A 4P93A 5E4YA 4PSCA 4KR0A 4U2BA 3IVMA 3PF9A 3DD5A 3JWEA 5AIBA 3A70A 1LZKA 3P2MA 3LLCA 2GBIA 1SOMA 1QIKA 2W22A 4XVCA 3DL7A 1GQRA 1UKAA 4EA6A 3O9VA 5KBYA 5JALA 1TAHA 3HI4A 4W9RA 3H2KA 5AO9A 1CUEA 5JAOA 5HF5A 2QM0A 1GPNA 4AO7A 1ACLA 3LIPA 1THGA 1U8EA 3H04A 3H2JA 1XKTA 4Y9SA 3I2FA 4Y2PA 1TCAA 1W76A 1MJ5A 3H2GA 4FOLA 4EHBA 4XX1A 3OG9A 4BBZA 1KU6A 4XWGA 1J1IA 3D2AA 4CFSA 1QO7A 5K5EA 4BAZA 1LBSA 3L1HA 3H2IA 1VA5A 4X97A 4ZREA 4U2GA 5YASA 4BC0A 1AUOA 4MYSA 1LLFA 1TCBA 5EHNA 2Y6UA 3PUIA 4B81A 5DJ5A 2V9ZA 4JH0A 1UFOA 1JT2A 1LPOA 3D7RA 4CCYA 4TPKA 5JIBA 3DL4A 5AIAA 1MT3A 5T4FA 3ILSA 4DNPA 3S8YA 4N8SA 1EK2A 3B5EA 2D0DA 4JYMA 2WTNA 2VA9A 4NS4A 5JADA 2O7RA 3IUMA 4OU5A 4PV7A 3WIOA 2VATA 1XZCA 2XUPA 2JBWA 3GZJA 2B61A 3U1TA 1JJBA 1A88A 4K5QA 1QIGA 3QITA 3ICVA 4ZV9A 4J0GA 2VJCA 1KU0A 3DKRA 4Y2JA 3HRHA 1WHTA 2ROQA 1WHSA 5AICA 4BDSA 2HADA 3FCXA 3WWPA 1KEZA 4G8BA 4Y7DA 3KXPA 3HLKA 5HFAA 4ZV7A 4I3FA 2WSLA 2OCLA 5AI5A 1UK8A 1QZ3A 3WL8A 1E3QA 3NOXA 4B0PA 2WFMA 1VXOA 4KE9A 3ED1A 5CXXA 1QIFA 5AKEA 2AJBA 3BIWA 2V96A 3DLTA 4DLNA 1VXRA 5CMLA 3SWWA 5H3HA 4JEIA 1UOOA 5AM0A 1AX9A 3WKEA 4G4IA 4QDXA 5C81A 3D4LA 2HU5A 4FLEA 4UHBA 3E0XA 5HF6A 1LPBB 1QIHA 5I7UA 5LP1A 4U2CA 3WKCA 2JGKA 2WFLA 5JD5A 5DYTA 3I1IA 4V2IA 3GELA 5K3EA 2B4KA 3KSRA 5JANA 1CUVA 1AZWA 3TEJA 4GI1A 4AB1A 1CLEA 1CVLA 1EDEA 1HKHA 4CI9A 5JATA 4YASA 5DTJA 1C7JA 5LZ5A 1AURA 1X2EA 4G9EA 4BP8A 2XMRA 1PV1A 1XRMA 3AIKA 5LZ7A 4NMWA 4CCYB 3C8HA 4DM7A 3G0DA 4H7FA 2VF2A 4Q3OA 1B6GA 4B6GA 4CCWA 5AKGA 1XLVA 2BJHA 5EIHA 3VJKA 2QUBA 3ZV7A 4C4ZA 2Z8XA 4F0JA 2V97A 3K2IA 5ALXA 4X91A 4OCZA 1B41A 1VE7A 4AO8A 5FV4A 3OM8A 1CUZA 4Q34A 4BE9A 4OYYA 1VJ5A 5ALUA 1Q84A 3M81A 1Q0ZA 5ALQA 2HA4A 2ORYA 1LGYA 1UT6A 1EINA 4CIBA 2FJ0A 3PFCA 3RKSA 1M33A 4HRXA 3CN9A 1UKCA 3TJMA 4J0JA 1W75A 5AI4A 4UUQA 2ZJ6A 1MU0A 2JF0A 2GBCA 3G9UA 4MJ3A 3WKBA 4AZ3A 3ANTA 2VQ6A 5CT4A 1FFEA 4Y2TA 1A7UA 4BTVA 2WIFA 4A23A 1R9MA 3G8YA 2CJPA 2IITA 4YK7A 1ZD4A 5DNWA 3WYDA 3STXA 3IA2A 5JD4A 2XUJA 2BAGA 1ZJ5A 4FBLA 5LIPA 2WFLB 4BCDA 5HF8A 4ITVA 5AM3A 3V48A 3OPMA 4FTWA 3A2LA 1A8QA 2OQIA 4HS9A 1CUFA 5EIAA 3SK0A 4J0KA 3HSSA 4D9JA 1ACJA 4OPMA 3A6ZA 3F9CA 4L3WA 4AN1A 1ZGBA 4Z49A 2EDCA 4S0XA 4X85A 1F6WA 2XQIA 4P08A 2WUDA 3I2KA 1OCEA 1A8SA 4QLOA 1JI3A 4EBBA 4UBIA 3QH4A 1MPXA 3V1MA 3C45A 1IUNA 2RHWA 4KE7A 1VE6A 5ALEA 3O4IA 5FRDA 4DIUA 2RHTA 4G1FA 1DT5A 1MNAA 4UHFA 5HFNA 3A2MA 1QJ4A 2Y6VA 1JU3A 2OG1A 2ZYHA 2HA3A 2AXEA 3BL8A 2X76A 2XI4A 1EH5A 1PJAA 3TRDA 4OSEA 4IH9A 2HFKA 3T4UA 2XQGA 2WHRA 5ALKA 3BDVA 4ARBA 4UBOA 2DQYA 2HU8A 3G0IA 2HIHA 4EY6A 1JJFA 3KWFA 3I2GA 5JAPA 3BIXA 4FFVA 2YXPX 1XZFA 1MX1A 4KACA 4X95A 2J4CA 3IBTA 1ZI6A 2DSNA 1NX9A 1NU8A 1YB7A 2X8BA 4G4JA 5HK8A 1LPPA 2G5TA 2RAUA 1MTZA 1LPMA 5KWIA 3AZPA 3AIOA 3DEAA 1QGED 5FP0A 4FWBA 5A6VA 3O4GA 1HL7A 1XRPA 4X92A 3WKAA 1ZI8A 2XUIA 1MX9A 4BP9A 3C8DA 3HZOA 4BVLA 5JZSA 4AO6A 1QONA 2QXTA 4BE4A 4H18A 1XRLA 1EDBA 5ALMA 1R9NA 3GROA 4YX9A 1UKBA 4B83A 1IZ7A 1L7AA 3IUJA 4B85A 2RGUA 3B3QA 3BJMA 1CUIA 1MAAA 2QRUA 3DCNA 2Q0XA 4UBJA 1QOZA 5JZBA 3WZMA 4CG3A 1ZIYA 1H2WA 3QBJA 2WG0A 5KWJA 3HC7A 1CUCA 4GWLA 1H23A 2G4LA 4WJLA 2V98A 3QM1A 4AN0A 2XUAA 2FX5A 2BUBA 4J7AA 3KWJA 1THTA 3WL6A 4J0IA 4PW0A 5CT5A 2PU5A 2PKYX 3F8SA 4X90A 4Y2XA 4QWMA 5BWBA 5HQ3A 3EQ7A 4LYEA 3DKKA 5LLSA 1GPLA 2PM8A 2C4HA 1ZIXA 2AJDA 4IH1A 4QZVA 2CZQA 1LPSA 1QIJA 1XZKA 5CW2A 3FVRA 2UZ0A 3OC0A 2HA2A 3W2TA 3ZLVA 1DQYA 5HZGA 3I6MA 3I28A 4M0MA 1BN7A 1XLUA 2O2IA 3STUA 3WZLA 5HF9A 3G0GA 4W1SA 1ORWA 3HEAA 2HRRA 3I2IA 4MEAA 1FFBA 3H19A 3NGMA 1YA4A 5JZ9A 1WM1A 2DQZA 1EXWA 5LYYA 3MGAA 1I6WA 1R1DA 1XQYA 1O6FA 3HACA 1P0IA 5ALGA 1CUBA 2HHAA 4CG2A 5EHZA 1T2NA 4G8DA 5JAHA 4M0FA 3WWEA 3I1YA 1CUXA 4B84A 2VSQA 1SCKA 2FUKA 5AM5A 4NZZA 1ODCA 2WG1A 4K6HA 4KYVA 4Y2YA 2XLCA 4PNZA 4B0OA 2J3QA 3DOHA 1R88A 1CUHA 2JGLA 4RNCA 5IVKA 2HA5A 2QVBA 5CH5A 3W06A 3N2ZB 3H17A 2DR0A 5CT6A 3WLAA 2ZVDA 3D2BA 1CR6A 1R3DA 1DU4A 3WWDA 1CUJA 4QNNA 4TVKA 2PU7A 4UHEA 4X71A 2DHDA 4X6UA 1J06A 1MNQA 4J0HA 2Z3WA 3OURA 3F96A 1H2XA 4KAFA 4GDMA 3PF8A 2VT7A 5C8VA 1XQXA 5ALFA 3WK4A 2RIPA 2YASA 3AZOA 5D3KA 6YASA 5HQ3B 1BN6A 3QZUA 1VZ3A 3HXKA 2ZYSA 2VAXA 4HRYA 3FOBA 3ESDA 3IURA 2XUQA 5A62A 1ZICA 4KJXA 1ORVA 2QZPA 1QIEA 4BCBA 4OUKX 3DYIA 4PSDA 4GHWA 1G66A 3WA6A 1P0MA 4Q82A 3EBLA 4BCCA 3H1AA 1E89A 5ALRA 1N5RA 5ALDA 3DDUA 1ZGCA 3N0TA 3CN7A 5AOCA 3WQHA 4LIPD 4C88A 1VOTA 1K4YA 1K63A 2WILA 2XE4A 5DYWA 5CT8A 1EI9A 2ES4A 1E8MA 3G0CA 5FKJA 4U2FA 3FYTA 2VAVA 1JJIA 3V9AA 2HA6A 4M0EA 4FHZA 1QIMA 5K3BA 4EY8A 1TRHA 3VKFA 2XUHA 3IUQA 4AX4A 4N8EA 1CQWA 3BF8A 2C5GA 3C5VA 1ZD2P 1GT6A 4QE3A 3R3XA 2ACEA 1SCIA 1W52X 4Q05A 3EQ9A 3C87A 1EX9A 3FSGD 2QJRA 3I2JA 3L1JA 4PQEA 4L9AA 4GBGA 5AI9A 4W1QA 4UBNA 4X3CA 2GBFA 5LZ8A 5HK9A 2WKWA 2AJCA 2IX9A 2XMCA 4EUSA 5A71A 2OCGA 4WCVA 3PI6A 5JAUA 4BVKA 2BUAA 2K2QB 3C6BA 1R4ZA 4AXBA 3E4DA 4IH4A 3I2HA 2YH2A 2JGMA 2WU4A 2OCKA 5AKZA 2OGTA 2O2HA 3H2HA 5IVIA 1CUUA 3D0KA 2H7CA 1XZBA 4H35A 5HKBA 4Y2UA 4QDTA 3I6YA 4GECA 1FJ2A 3MUNA 1UK6A 3VJMA 3FCYA 1GKLA 3BF7A 1U65A 1WPXA 3HYSA 4MYDA 2HA0A 3R3WA 1IMJA 5AM4A 5E4TA 3DQZA 1FFAA 1J07A 1H2YA 5AK6A 3Q0TA 4B82A 4DNFA 3G9TA 1N1MA 1VA4A 4LXHA 5AK4A 3GA7A 4Q3LA 5JYCA 5AOBA 1CUAA 5K3FA 5K3AA 4BZZA 1CUGA 2PSJA 1FSSA 2WTMA 1EVEA 1XKLA 4ZWNA 5ALZA 3D59A 4H7DA 3U0VA 1OXMA 4DSAA 3WJ2A 5J3JA 4JNCA 3GUUA 5A7FA 1YSCA 2ZJ7A 2WUFA 4IHAA 2XUKA 4UPDA 4BATA 1HBJA 4LKOA 4F60A 4B9EA 1R50A 2QOEA 4HVTA 4N5IX 2DCMA 4HTAA 4B9AA 1VKHA 1DX4A 4ROTA 5ALLA 1DINA 3LS2A 4J03A 5ALSA 4PSUA 2G63A 2C7BA 5AKYA 4QLAA 4C4XA 2PSDA 3G0BA 5AI8A 3W04A 3EQ8A 1DWPA 3FVTA 4HXFB 3AIMA 3X3HA 1YA8A 4G9GA 4GW3A 5DWDA 3WL5A 3E1GA 1Y7IA 2WHPA 1MO2A 2C0QA 3MUOA 3QMVA 2PSEA 4WFJA 1T4MA 1E5TA 3L1IA 4ZGBA 5BV7A 3WK6A 5IVDA 4FLFA 1F0NA 1QFSA 5HCUA 3WWCA 1XLWA 1NU6A 1YR2A 5FDFA 1U4NA 3W9UA 1LPNA 2Z3ZA 1YASA 4JYPA 2PVSA 3M3DA 3JW8A 5LKAA 4X6XA 4DNQA 2C5FA 2CB9A 2WG2A 4HZGA 1CIJA 2PBLA 5ESRA 3TGLA 3LIIA 3D2CA 3G7NA 1F0PA 2QT9A 5IVHA 5ALIA 2ZJFA 4KAAA 5K3DA 3G02A 5JASA 4N5HX 2JEYA 5I9IA 3WKDA 2VJDA 3AJAA 3D5EA 3O9MA 4DMFA 1JMYA 1ISPA 1N5MA 1XZDA 2WUGA 2XT0A 4RE5A 2HRQA 2WIKA 3R3ZA 1K5PA 5A2GA 1CUDA 4X7BA 1YAJA 3Q8WA 3RM3A 2VJAA 1CV2A 5ALVA 3WI7A 3CXUA 5K3FB 5C8ZA 2ECFA 2PUHA 1Y37A 2OGSA 3O95A 1SC9A 3W05A 1LNSA 5DNUA 4P9NA 5AKKA 1FFCA 1W6RA 4FDMA 3HABA 1C4XA 2HFJA 2QR5A 4AMYA 1EK1A 1BS9A 1AMNA 4H0CA 4Y2RA 1QO9A 3R40A 4JUIA 3AILA 2VEOA 3DYVA 3R0VA 5JD6A 5AOAA 1UWCA 4E14A 5AHXA 2R8BA 3R3YA 4U2DA 2J3DA 5JARA 1CUYA 1BRTA 4ZI5A 1ETHA 3QMWA 3C6ZA 4K2AA 4L0CA 1XZAA 4H7EA 5E2IA 2WFZA 4MWSA 3O0DA 4Y2SA 5CH8A 4UFPA 2BUCA 1XRNA 3H0CA 4C89A 3PICA 3ZI7A 1UK7A 3QPDA 1AC5A 1XROA 2OXEA 2GZRA 2WHPB 2OQVA 3UMJA 4EY5A 2Y2VA 4A16A 2PUJA 4INZA 5CT9A 5ALTA 3HJUA 4BTLA 2XMZA 4X94A 2BKLA 5LZ2A 4K6KA 5ALJA 3V1NA 3FSGA 4UBKA 1BROA 2WJ4A 2OLEA 3UUEA 2WLSA 4DYHA 1LBTA 1ZOIA 2RONA 4C6HA 2DFPA 3AZQA 4F21A 3V1KA 1JMKC 1CUWA 2JGEA 4QWWA 5I8PA 3AINA 3LP5A 3RK4A 1L7RA 1XZEA 1ODTC 2H1IA 4H7JA 4PO3X 4BB0A 2CBGA 2WJ6A 5EHXA 2C58A 4N8DA 5BWCA 1DWQA 4KEAA 1E8DA 1HPLA 1JKMA 2BGRA 1LPAB 1YB6A 2WQZA 1EB9A 1YS2X 3D3NA 4GLBA 2VT6A 2XMDA 2RI6A 5ALHA 2AJLI 1XZHA 4KE6A 2QXUA 3RARA 3VDXA 3ZLTA 4DMCA 3CCBA 2OPHA 1U2EA 1WB5A 4OB6A 2O7VA 2J4FA 3IB3A 3C43A 2ZYRA 4BVJA 4KRYA 1USWA 2EEPA 1HQDA 2X5XA 2XLBA 5F4ZA 3EF3A 5AH0A 3S2ZA 4LXIA 4UHHA 3YASA 4LYDA 4C87A 3F97A 3BJRA 4OU4A 5ALPA 4CG1A 3G9ZA 2JGIA 3O4HA 1DWOA 3K9BA 1W1IA 3NUZA 5AM2A 4ETWA 3SC2A 2DHCA 1BEZA 1IZ8A 4YPVA 4QEKA 5DLPA 1HLGA 3VVMA 1EDDA 2GYWA 4DTCA 2ZSIA 1UZAA 2OAEA 1BEEA 1EHYA 1XQWA 1LZLA 2JEZA 3WK5A 4DSZA 2O2GA 2AJ8A 2QS9A 4MQMA 3KOOA 1TK3A 5C8XA 1HDEA 2PSFA 2I3ZA 3M82A 1AKNA 4UBMA 1GZ7A
chains in the Genus database with same CATH superfamily
3K0CA 1N9KA 1JA1A 3LJKA 3A04A 4HADA 5ECWA 4C4SA 4AWAA 3I9JA 2VTVA 2XA9A 5T4EA 2PAAA 2IW3A 4EKGA 4GRDA 2CCJA 5EE5B 2HL6A 3HL0A 1AVTA 3S3TA 5ECGC 3B1ZA 3S2YA 3ZE2B 5AP9A 4BV2A 3IH5A 1K7FB 2GKGA 2QTTA 2NUPB 3IEKA 4C0WA 2R4UA 1TD1A 1SCUA 3G68A 2GZDA 4MZDA 5CHYA 3A2KA 3B52X 5KJEA 4C1NA 1R2QA 2OORA 3B38A 4RLFA 1XALA 3CF6R 5C4GB 4KFCA 5JQGB 4EY7A 3FGZA 4FBMA 4EIWA 3K9NA 4LF4B 2G8LA 3LPCA 2C9BA 2R6HA 2NO1A 1K6EA 1CRLA 4FLMA 2ERCA 1B8OA 4C5AA 2FKNA 3CYFA 5B1HA 4I3HA 1E9RA 4P32A 3EZGA 4CKCA 5DX1A 1NMZA 1PQUA 4LFCB 3PKJA 4KVGA 5F7OA 5EFZA 4Z53A 2K6GA 2I6QA 3ZGVA 2PLAA 3FNIA 1UJ2A 1S8OA 1WUIS 2NTVA 2R2AA 3H9UA 3MD0A 2GAJA 2LXNA 2NZJA 2CMDA 3E84A 4JI7B 3PA8A 1H6BA 2NVBA 1TC1A 4MLCA 4D4IA 1J33A 2NAFA 2QTNA 3BQMB 4IGIA 1H3FA 2R00A 2AUTA 4MVJM 1MEEA 1UQTA 1UDCA 3FIJA 4X1OA 1N2CA 1X1BA 1O6ZA 2JIPA 3EEQA 4KV7A 3EVNA 3MWLA 3CPSA 1W36C 2YQ4A 3RYCB 2JEOA 3WBFA 1PR0A 2CXRA 3LCUA 2ORVA 3N3BC 3OKAA 4V39A 5DHAA 4QBTA 3SFVA 4BO9A 6NULA 1L5QA 3EXEA 4BL5A 3V33A 4OI2A 4EA7A 5IKPA 2Y76A 2XUDA 4S1WA 4AS1A 4WXHA 5DYYA 4KSBA 1PNTA 3JD3A 3EGIA 3DPUA 2J41A 5JZVA 5CDUA 4UHDA 3QLJA 2XMQA 3RS2A 3QEMB 2C3PA 3T3GA 1UBHS 5DO9A 4F1WA 1NWHA 1ZO8A 2F9LA 4I4CA 4LXQA 5BSEA 2WTUA 2IH2A 4GGOA 1RRGA 1N36B 3PJEA 5DULA 3ZQKA 2UZAA 2NSYA 5DK4A 2ONJA 5B3AA 2P2GA 4CMEA 1S8NA 4FMPA 1RNLA 3A6KA 2ZDGA 3OO1A 3ZWYA 2ZE7A 1E2EA 1OI4A 4GEGA 3K7EA 2MYTA 1H85A 8AT1A 4LJRA 1RXSA 3DLBA 4C6TA 1T0HB 3IQFA 2F59A 4CM1A 1Z12A 3KJXA 2DM6A 4ZO8A 4YT8A 5DT2A 5B30A 3QU7A 1BA2A 1QR2A 2P4UA 3ZGYA 3FUTA 5KAPA 2OT3B 1QIIA 4L72A 4M9XA 3SYRA 1D1QA 4IF4A 3ZHVA 4KMRA 4LC1A 2I67A 2CFTA 5LQDA 4NCHA 2XE8A 1KR2A 4NWIA 3EGXB 2G7ZA 3JYQA 4IVQA 2QLNA 2VHVA 3K6KA 4JT2A 1KI9A 4DMHA 2O8DA 2EKDA 621PA 4TXNA 1T9BA 1J42A 2NTNA 3TEMA 2WIJA 3DGFC 4QLBA 4QODA 4U1RA 2Q5JA 4XWKA 3O8OA 5K6AC 2IU0A 1KRWA 2RHOA 4JASB 4XIYA 3QVWA 3UXMA 3ZWQA 4AUNA 4HH0A 1CP3A 2WB4A 4ALNA 3F2IA 2LIPA 3K31A 4MV5A 3LGXA 2GAIA 2WYUA 1E58A 1Y6ZA 4XGRA 1UEJA 2XVZA 5DI9A 2GN6A 5DRTA 2VDMB 2Z08A 3CSSA 2O0LA 1A8IA 1MAWA 1GUFA 1I4LD 4GZ5A 4JX9A 3BK2A 1XEXA 3L5KA 4OH1A 3CBGA 3IL2A 1MAVA 1N4DA 2EVWX 2YFQA 5JPCA 4X41A 1ZLYA 4IZIA 4IWNA 3BB1A 1IY1A 2QRMA 2Z30A 2Q3CA 3FTNA 2GK7A 3U4HA 1JFLA 3EAGA 2WU3A 1I5RA 2C0PA 2CBXA 3HDQA 4MKHA 4DV3B 4KNVA 4KDCA 2QDXA 3AM4A 2RAFA 5KTNA 1UFVA 1M2FA 2JJMA 3HCDA 2GILA 1KJJA 1NOKA 5CVDA 4R68A 2ECKA 1OV6A 4WZZA 2WF8A 4NJOA 1JR2A 1JHAA 1YU6A 2VCYA 3G59A 3KSZO 1POWA 3BXOA 4R5MA 2OK8A 3IDAA 5EKDA 1CHDA 1CNEA 3RYTC 3PHGA 1A9SA 3M1IA 1N34B 5ALYA 2Q3MA 3QPAA 1FSGA 3JQ9A 3K1YA 4M1OA 4COKA 4LI3X 3SC4A 5IM5A 4EVSA 1GL7A 2FMXA 3DWEX 3E2PA 5C0OE 1E2QA 1GPKA 1SIBE 2BZ1A 1P2GA 1Z2NX 4UFOA 1V7ZA 2FSHA 4LAFA 7AT1A 5JSUA 4LRXA 1BXRA 4D1YA 5JRZA 4HN2A 3L1VA 5B6IA 2ERYA 1OVGA 1EQUA 3JYPA 2Q6VA 4BMVA 3F1KA 3LWBA 2ZIXB 5GOZA 4BWGA 5B2ZA 5B2EA 1BD4A 1GG2A 2ZJ3A 5JYBA 5FA8A 1NXSA 3AL3A 5KTOA 1VHJA 2VQFB 4KVFA 2SBTA 1TIKA 2XUOA 3H6KA 4I14A 1YK1A 3AJDA 3B1FA 3H42B 4BS9A 2Q3JA 3DFZA 1EWTA 3RSFA 5JDIC 1PZEA 1HNNA 3BMXA 2HQOA 5E6UB 1PR2A 1N6PA 3BMQB 3E23A 3RROA 1XZMA 2ETVA 3EZ7A 4DY4A 2R5WA 4EZIA 4PINA 1N2XA 4DRYA 3ICQB 1IPHA 1JGTA 1MJGM 2NU6A 4PNEA 3ZJUA 2R6DA 1UUFA 2FMIA 2JVJA 3DBLA 3H8WA 1NX6A 1IY0A 3PD7A 5CHEA 5AJYA 2OCBA 3VNAA 2C2OA 1U28A 1GQSA 3EQZA 2OV3A 3P19A 4GMXA 1RJEA 2YJ5A 3MW8A 4XCVA 3NLLA 2NV2B 2G4CA 4JA2A 2IJGX 1G0NA 1W581 3OAAD 3B8EA 1Q0SA 3N5CA 3LNTA 1JA0A 2P8SA 3IAUA 3ZGZA 721PA 1WPRA 3LKBA 3MGKA 1J0BA 1NC3A 4I4NA 1MF7A 1RLTA 3PQDA 2JLQA 2PGAA 3NFRA 3STTA 2D7DA 2QLTA 2ZBUA 4KRGA 1ZC4A 1QH1B 2GK4A 4PZAA 1ECPA 2QVGA 1NYTA 2I2FA 3UV6A 4WUTA 2QN1A 3O3CA 5T67A 2VRWA 1Z6YA 3DDHA 4NIMA 3ZD9A 1Q5PA 1BH2A 1BCSB 2FN7A 2HLDD 3E15A 3O4VA 4LUCA 4N4AA 5D84A 3UJDA 4BZWA 1PGPA 3U7QB 3NHFA 4ZCRA 2JIZA 3FLEA 3ICPA 4Z4CA 1HV8A 2RHMA 3O4JA 2LV8A 2V03A 2PO7A 1QCZA 4MRSA 5ALOA 3ENVA 5FBZA 1R64A 1ZHFA 2QD1A 4BQSA 4QBKA 1U6KA 2GBGA 3H8JA 2C99A 3SYMA 3NXSA 4PZLA 5CGZA 1MGOA 1L7VC 2PE5A 3H1BA 1TCCA 2QAGA 2QMQA 2W4IA 3QMMA 3IMEA 1JSZA 1AHIA 1NDQA 1IQRA 2CLKB 4L3OA 4RE6A 4ZAFA 2CZCA 4FEGA 4A0GA 1CY7A 2VUTA 3D5QA 2A5JA 4IV8A 2BKXA 2ZRIA 2ZPAA 3MWGA 5EAIA 2HQBA 1PYOA 4S24A 5LB2A 3R76A 1FFDA 5A06A 2XZTA 3FYUA 2ZXFA 4G0MA 4CLOB 2MT9A 2Z04A 1A9ZA 4RQAA 2FHSA 2H51A 4RKRA 4DKJA 3CGGA 2IE0A 1L8OA 3I04M 4FYYA 2GSWA 3FF4A 4OX9B 1DIRA 4DMKA 1B6SA 4MICA 1O57A 1S2IA 5FBWB 1Y7HA 5CTJA 3D3WA 3FNBA 5IXYA 7ABPA 1G42A 4NS1A 1LBIA 3VPDA 3QKUA 5DTIA 3OLWA 1ZL0A 1CY8A 4Q9IA 2F7SA 2VOJA 3OF5A 1UMDA 1M0TA 4WGGA 3T1NA 3NVDA 5A9TA 5HG0A 4HLQB 2Y1CA 1NJ2A 2IEAA 2BGWA 1T8SA 4P58A 4KMSA 5JYEA 2EAUA 1JDJA 4PG5A 3TAHA 4DDWA 3QU4A 4MV8A 2II6A 3GLHA 1LDBA 2IEDA 3L8HA 4MROA 3VMFA 1U2ZA 1UZNA 2GA9A 1R66A 1XNRB 3CVJA 3KUCA 3QBVA 4JI1B 3PE4A 2NXCA 2PT5A 1TL7C 1XRQA 5FEMA 2IPOA 5G4KA 4TSKA 4HDNB 1TVEA 3PGMA 4OB8A 4FR0A 1I3CA 3QUTA 2H5IA 4DR4B 4GVLA 4H60A 4YC7A 4AZ0B 5B1EA 4C07A 4EHHA 4DARA 3B89A 4D3ZA 1LVGA 2J3HA 4G0YA 3MWFA 1R6TA 1L5GB 1QYWA 1U8XX 5F5XA 3FRIA 3I42A 4B6QA 4C2UA 4MQLA 3JASB 2GXQA 1GG8A 1MIHA 5ALNA 1U3TA 4DIBA 5JAQA 3IULA 4KO1S 5M34A 4IDOA 2G36A 5AI0A 2ENUA 5JC8A 3SQMA 1IJKA 2FWAA 4HAZA 4Y9DA 5E4JA 3R8XA 3V4LA 1QRAA 4ZTBA 2JJYA 1R4MA 2FA9A 4RA9B 4QYMA 2NUTB 1OXSC 2FPWA 3K0AA 1I2MA 3RJMA 3STHA 4CNQA 1L7PA 3I64A 1TIBA 3K1TA 3E9DA 1ADYA 5EHGA 2I2AA 2ZWPA 4W8HA 5G4LA 4ID3A 4XQCA 4L9SA 5K2MA 4HQOA 1NJ8A 2VDJA 1YVRA 4QNMA 3T5MA 2XB6A 5D1HA 4DXHA 2R86A 3OMLA 4TTPA 4X7PA 4OD0A 4N3BA 3VZSA 3LY7A 3AKZA 1H93A 2LCFA 3WXMA 4HQRA 4S05A 1KERA 2JANA 1G20B 2JAQA 1FE8A 3DAYA 4QDOA 4TV9F 1QFJA 1SA0B 1BZYA 5CCEA 1N6NA 5DXFA 5KOHA 3MPUA 2X1VA 3AEUA 4BFUA 5B3JC 1WV0A 1LX7A 1QHIA 1GU0A 2AOUB 1C50A 2BHNA 4QRHA 5HJ7A 1OU0A 1Y6JA 4EA8A 4OGKA 3RIXA 4BO2A 2Q29A 1W96A 5FXMA 3T7RA 3SM3A 1FFSA 1W59A 4M1SA 1CZRA 3IJ5A 4MRNA 4Q93A 3DAGA 4ZGGA 1GXSA 3PDCA 4TGLA 3VR3A 3X43A 2X0DA 4YR9A 2IIVA 1OBVA 2JAPA 4AMZA 4QUAA 5AVWA 5BUSA 3PFFA 1GAQA 4GKAA 2YXLA 4ZOAA 2RHBA 2CV1A 4FMCB 4Q66C 4PHTA 2AJTA 3ROFA 3EEFA 4A03A 4CL8A 3I5YA 2W6JD 2QI9F 1MHPA 3AFOA 3DH0A 3NTOA 3NDJA 2UV8A 2P8JA 1QHHB 4REQB 1S3GA 4QYTA 1FL9A 3KALA 4O0LA 1CK4A 2CXHA 4E88A 5C80A 3OE7D 3BT7A 2VP2A 3E1SA 3GFPA 3OO0A 1UBCA 1FX0B 2BEJA 2UAGA 5IXJA 1NNSA 5AI6A 5FADA 3A9WA 5JJCA 2J9XB 5BVGB 3UMBA 1Q6YA 5HEKA 1I7LA 5LOVA 1TI7A 2FW8A 1UKEA 1G5FA 2X2OA 3M83A 5ED0A 4DQDA 2WNHA 3VO2A 4BNGA 4WIAA 1JEDA 4XFJA 2OPBA 1DQNA 3IDSA 5GM1A 4FFWA 4FFPA 4LHEA 2XKAA 4EHIA 3MAAC 3RAEC 1MPTA 1EM8A 2WIAA 2WUEA 3BWBA 3UO8B 2G1UA 4IPTA 4PS1A 2ET6A 3IESA 4GR4A 4RAOA 3RU3A 1J2EA 3JVUA 3SVZA 3H8VA 3KR0A 3O2NA 1QGYA 4GM4A 4WOJA 4D8TA 3QYPA 4ZK2A 4DC1A 1T9CA 2EJWA 2VYVD 1FRFS 4EWLA 1Q83A 2VUIB 3AFGA 3FMPB 3PC2A 4O1IA 2XVYA 3CZRA 3EWAA 3ACCA 5FPPA 2NNLD 3T95A 3WNQA 2NT3A 1TJYA 2B4YA 1RYFA 2P9CA 4URWR 5K4AA 5IF9A 2JLZA 1CRWG 3ND7A 4HDAA 4F92B 3MMZA 1U7PA 2QRQA 1Y4AE 2DSTA 5IDWA 3V9PA 4FS8A 2ACKA 2IS1A 1BVUA 4WASA 2C83A 1DXHA 2HJSA 3H9EO 4R05A 4PEVA 1PS0A 3PGKA 4EGFA 1KEKA 3RLIA 4JI4B 1ZY2A 4EUEA 5CTAA 1AK2A 4L5CA 4F97A 4BEVA 3KPYA 1FSZA 2O3UA 3FWKA 1ZVVA 2OQRA 2GPWA 3QG1A 3O8QB 2LTAA 3GMTA 3PNBA 3UFXA 1RM4A 1ZD5A 3TFQA 1W7AA 3FJYA 1GARA 2XUGA 3MLBA 4ZHQA 1A2KC 1VHTA 1G64A 5BR8B 2IIPA 3S2EA 2Q7DA 2J7PA 1WF3A 2DTDA 3FUWA 1P1RA 1YHNA 3E3OA 2A9VA 3GFBA 4G09A 3S99A 5H16A 3SR0A 4C2TA 1ZGGA 4ODIA 3UFBA 4DUPA 2YWJA 5BQFA 1XQ1A 1ZUD1 5AJVB 5U1PA 1CSEE 2XWPA 4B87A 1OSNA 1WXFA 3BHMA 3T5GA 3L7CA 4HXGA 1OAOA 1C7FA 3A2NA 4JC4A 4OOEA 5CH3A 3RBXA 1Y8QA 3NC0C 4O2BA 4RJTA 3OJ0A 3HUFA 4BYMA 1FRQA 1NVUQ 1I1NA 1PR4A 1U2PA 1DBIA 2ZVPX 1LS1A 3D6AA 1C4OA 4H17A 4ZCSA 5TR9A 4OGWA 4HNUA 2VCHA 3JAWB 3H0EA 2C78A 2GI4A 1AGNA 1J0DA 4LZWA 1YR7A 3X2EA 5C1DA 2VBIA 3BA1A 4CMAA 3NCHA 5BSVA 2GYVA 3N39C 3D8TA 5I01A 3E3LA 5HJ5A 2ZP1A 3M9LA 3CY6A 3N6XA 3A28A 4WKGA 4HKTA 2P2DA 2FJPA 3QYJA 4IQ4A 1BU8A 2QJWA 1P7ZA 3VH2A 4YT4A 3C70A 1JP7A 2Y99A 3GLRA 1TJNA 4G5QA 5DHFA 1GSOA 3STWA 1JZTA 1YS6A 1TU3A 1XJQA 5HIKA 2BD0A 2O3JA 2X77A 2B8TA 4NH4A 3T0FA 5ETJA 2HEIA 4ZCTA 2DHEA 4D9EA 4YRPA 3VISA 1AGYA 3IOYA 3MPOA 2ISQA 3G85A 5JNVA 2XMSA 3LRXA 4JAVC 2LZ0A 5EGNA 4E2FA 2HF8A 2YWDA 5AM1A 2BCGY 3QXGA 1Z75A 2ZRDA 1SHTX 3DV9A 3NM4A 4M1ZA 5D3ZA 1VKJA 3NS7A 4ZEMA 1E3LA 3THOA 1OJ7A 4XDHA 2O6HA 4MB6A 3SQWA 1QTRA 5T4HA 4XLZA 2J30A 1N25A 3E18A 2XE7A 1SC3A 3BG5A 3PIRA 2CNOA 3I34X 5SYMA 1LJLA 3AI3A 3JQ6A 3OCWA 2QVCA 2V5VA 5TRTA 1N6IA 4ZT2A 1D2NA 3ZXIA 1OIVA 2QROA 3PK0A 1SR8A 2ENWA 3EG9B 2PTHA 4R6WA 2B4AA 1KZYC 4HVLA 2VR1A 3G13A 1TGVA 3BJIC 3ESCA 3JYHA 3SKXA 3QOWA 3KUXA 4B3XA 1G3IA 1YDHA 3CLTD 3P9IA 1XTPA 3RAJA 3DS8A 4IDGA 3ZCQA 4R9UC 5L7TA 4PSCA 2QLMA 3F0TA 2BVNA 3DO6A 4B46A 1IN4A 1R16A 3IVMA 8LDHA 1N0UA 3KELA 3IAFA 3DD5A 4V0ME 2BTQB 3OH8A 3H5AA 1WQ1R 2BF4A 1KRHA 4UPVA 4JJKA 3FF1A 4KXXA 1LZKA 1KARA 2IIBA 4GOLD 1YB5A 4L9WA 5JG7A 3I4CA 3WRYA 4IOJA 3ROZA 2GBIA 2WAMA 4B3JA 1SOMA 1QIKA 2W22A 3K09A 2RE8A 3HO1A 1RS0A 5DT9A 1E79D 4ZALA 2H31A 2AGVA 2SKDA 4CUZA 5BRNA 3QBTA 2OO3A 5J5VA 4EPRA 5JALA 3PGJA 1TAHA 4MYHA 4E2ZA 4W9RA 1UJNA 2Z8YA 5AVVA 2YV3A 2ZBFA 1XPJA 1CDEA 3LD9A 4ZVVA 4FINA 4V1CB 1L4YA 1RJGA 3ZJTA 1E1DA 1TF7A 4BLWA 2QM0A 1Z6QA 1DFIA 4RY9A 1K7XB 3T1VA 2JI7A 3OZWA 4XVQA 2GLUA 2MSWA 1KMNA 1ORTA 3C6QA 3E9MA 1PR3A 2N0SA 1ACLA 1EUCB 2DZDA 3LIPA 1F14A 1MRNA 1ZM7A 3EEIA 3MINA 5LXTB 3B3JA 1RC8A 5JJLA 5DM1A 4BLSA 1XKTA 1JEQB 2VYNA 1XMPA 4XQ0A 4HDSA 1XN1A 1X7DA 1MJ5A 1R0WA 2O2ZA 3F5QA 3H2GA 3RVRA 4EABA 3MUEA 1DSSG 2V6BA 4RK4A 2R8OA 3T4XA 3CHYA 4XWGA 4Y8VA 1BYUA 2FFBA 1E0SA 4MKGA 4UMEA 4CFSA 4Q4JB 2I6SA 3G8CA 1QO7A 1QHGA 1LBSA 3L1HA 4MCIA 2CSUA 3H2IA 1JEYB 2CC2A 2OOSA 1OGIA 2X7JA 4D25A 5K0CA 4ZAVA 4Q16A 1XU9A 4QSHA 2CXNA 5EWMB 4PE5B 2NSDA 1T8TA 4G89A 4MA5A 5DSZA 3S7ZA 4RSRA 2GBLC 3FDJA 5T6MA 3HCNA 2OSVA 3KTOA 4MQ6A 4NCXA 1I7NA 1TCBA 3EE6A 2VNSA 3LFTA 4FHEA 4TN5A 1U8AA 3LDGA 2WD7B 4INOA 4L7VA 5JECA 5K2OA 2DBZA 2W0SA 1OFUX 2F8TA 3MOGA 3TMYA 1KY4A 3AL2A 3OZDA 4JH0A 2NADA 4ZEOA 4EVQA 3W3AA 4WVLA 3TDNA 3KTAB 3KKPA 1WCV1 2XYGA 3C1AA 3GT0A 4CCYA 2BN4A 2F2TA 3AB8A 1T24A 5A5VA 1YRWA 4O2AF 2EL9A 3ILSA 3R5FA 5IBQA 3SZ3A 3KTFA 3EAQA 4DHEA 4LE2A 5ED4A 3A3PA 1E2HA 4N8SA 3KS9A 3UMGA 3MXOA 2D0DA 2HCRA 3L02A 4AMVA 3GEEA 1AE1A 2FQYA 2WTNA 5EVCA 5JADA 1Z07A 4AAYA 4TV8B 3VTFA 1UZLA 1PT5A 3GQBB 3RK1A 4TTTS 3T7JA 1KY5A 1AIPA 1MCZA 2D0PB 2JAHA 3UW1A 3LE8A 1OB2A 2GAFA 2H07A 1BJRE 2TECE 2WV7A 4F86A 1GKYA 5CVJA 5FNVF 2R6FA 4ZAYA 4U3JA 1Q44A 3GZJA 1CVRA 1XR3A 2ZKIA 3JAKB 3PHCA 2XBMA 1BAPA 4ZOBA 2FF5A 5JVDB 3QITA 1GHTA 1XCJA 3ICVA 1FU7A 5EPUA 3GZ4A 2PUEA 2IDJA 4JVSB 1BYIA 4TWRA 1FPMA 2F1OA 3V3TA 4XSHA 3DKRA 4RCZA 3IXLA 4HYYA 3UVEA 1ESDA 4Y2JA 2C77A 3KK0A 1WHTA 4UNNA 3OFKA 2EP5A 5DGHA 2ZAMA 4RQUA 1JFFB 1J23A 3IVCA 3W5SA 2DE0X 2VPYA 3R3SA 3WWPA 4EI2A 3SF0A 4LRUA 3KCNA 1KEZA 4G8BA 1VSQA 5G0WA 3PXGA 2AX4A 4OXQA 3TRKA 1VFPA 4D3XA 5KQRA 1UZMA 2GPSA 5LLDA 3QEKA 3BGSA 2YZ7A 1PLJA 1RABA 3HA3A 3T61A 2Q5FA 1UJBA 3OFND 4I1PA 2Z0MA 5HFAA 5HQJA 4WZAB 4BMNA 2CLOB 2X8AA 2QW1A 4PLWA 4ZVUA 1ID1A 1JDUA 1STOA 2NQTA 3CWQA 3DHWC 1YZKA 3AM5A 2BSXA 3G5TA 3OFVA 5CM8B 4DJFC 4DYVA 3T5DA 4BPRA 5T3YA 2EC5A 1V2HE 2DC1A 4B5LA 3MJ4A 3BKWA 3GFVA 4CPDA 3SIWA 2CL7X 1HSZA 4A1OA 1TUIA 5HS4A 4QJIA 2D2IA 5I5GA 4DVGA 1BHO1 1XTTA 3LY8A 3QUBA 4HH4A 2I6UA 2OCLA 2P9YA 4LWPA 4N5MA 1J24A 2XJ9A 3H1FA 2PX5A 1XLTC 3OU7A 3DVLA 1SRRA 4N5DA 2Q5OA 3NOXA 4B0PA 5KNCD 2WFMA 1P9RA 1ADGA 2D06A 3KAQA 3I53A 1MO5A 2AMJA 1GAJA 2EYUA 3UV3A 4E22A 1QIFA 1O95D 2AJBA 3OQOA 2ZWMA 5L3QB 1BDMA 1CJSA 1SXJB 4EPTA 5L3VA 1DJOA 5LYJA 2IYXA 1D03A 1W9MA 2FHPA 1VXRA 5CMLA 3S40A 3S2GA 2UZ4A 4N65A 1UOOA 1TUGA 2C2WA 2W0MA 3IAM6 1EUQA 2XZLA 1VC2A 3WKEA 4IKEA 1PFGA 4YP1A 4MV1A 4JLWA 2YOHA 9MHTA 5EKUA 1L9XA 1ES9A 3VAAA 2QY6A 3OIVA 4UUNA 2QE6A 3E22B 1DJQA 1FDIA 4RKFA 4KQ6A 3D4LA 2UVPA 4XRGA 5ESWA 5IT0A 3RTGA 4A1FA 1F8XA 4C7XA 1XDWA 5SICE 2FZVA 1CJBA 3ELDA 1FXSA 4MIEA 5K0SA 3EZNA 4AY6A 2P91A 2B69A 1V3TA 1IHXA 3OCUA 4PAQA 1YR3A 3K5PA 3KDPA 3T1TA 2R66A 3WKCA 2H8KA 3FB4A 4GWKA 3CRVA 3C4JA 1QG6A 1BKSB 2Z2JA 1W88B 4EB6B 1JTEA 4RUKA 1YS4A 3LK7A 1Y42X 1PEAA 3RC1A 3TVYA 1KAMA 3USZA 2MSCB 4H2DA 3ZBUA 4F4IA 3T5BA 2QTLA 3Q85A 4QHSA 1XNQB 2G9RA 2GHTA 2C03A 4JYZA 4UTVA 1AZWA 4Z51A 3W1VA 1WKCA 5K8VA 1V43A 5TPWB 4WT7A 4EM6A 4L51A 1QLHA 1FP1D 1NIJA 1M0SA 2XT6A 1ORHA 2ATVA 1NR1A 3HPQA 4G5SA 4M49A 4XWYA 1IDOA 1CVLA 1HKHA 3JSXA 5JATA 3TF5A 4KDEA 4G0QA 4RV5A 4WLUA 1RHRA 2OBYA 4HH3C 1D5WA 1QCCA 5DKFA 4DANA 1UH5A 2D3TA 4UM5A 4WBXC 3OLYA 1KI2A 3EFOB 4CQMD 1O0BA 1DBRA 4O3MA 4QGGA 3U9TA 1HXHA 5DF1A 4QFCA 1MVLA 1CQIB 2BTEA 3AIKA 3E9ZA 4RF3A 1C4WA 3RSSA 4ARCA 3M0EA 3ZBTA 3IELA 4V0RA 1F2TB 3Q5GA 3NQ41 2XCOA 3ADCA 3ITDA 4JZKA 2QYSA 4CYMA 2H1FA 4P82A 4FCVA 1K3TA 3SNHA 4A8JC 3AHFA 4EI9A 2B94A 4HUTA 1YHZA 3MLAA 3Q3JB 3RIYA 3NFYA 1VMIA 2Z5VA 1M6NA 2ZAYA 1K9SA 1XXLA 3M8KA 2GPJA 2VS1A 1O8CA 2QTRA 2P4HX 1VIAA 3EBPA 4NLLA 1U9YA 1OI3A 1CB0A 3VJKA 2QUBA 4Z7OB 3MJFA 1RWNA 3CJTA 3ZDBA 1R4AA 2ZRKA 3CKMA 5JSZA 1VPWA 1M75A 4US0R 1OQAA 1VPTA 2V97A 4JXKA 4L22A 1CFZA 3H9QA 1AS2A 1XL0A 3NBKA 5HE9A 5LOVB 4DV5B 4FZJA 3NRCA 1W19A 2JZCA 2O50A 4U9HS 1F0KA 3E81A 3I09A 3FUXA 4ETNA 3KLOA 4J07A 5KU7A 2ZXEA 1YKGA 3Q9SA 5FLYA 4DQKA 4EQZA 3MHTA 1XXHB 1M2OB 3QXSA 1ISIA 2CV0A 4FJ1A 1B41A 2EX0A 3LQ4A 4TUYF 3CGWA 4KQJA 1T9AA 4R1MA 1YF3A 3QJGA 5J23A 3OM8A 4JJZA 4Y6RA 2C9CA 3PX2A 4LF9B 3JSAA 5B1YA 3D4BA 1PJ2A 2PMBA 3BZUA 4P86A 1YDFA 2GCPA 2OOKA 2PGJA 1WHSB 3UWSA 2PXAA 2ON6A 2VRBA 3TGWA 1ACMA 2WU8A 4X61A 3I92A 5ALUA 3D6MA 5IK2A 3BFPA 1TA9A 4NZMA 2WWWA 1AUQA 1N6RA 3BM5A 5JJIA 2I4TA 4X44A 3E9CA 1Q0ZA 1XEWY 3NORA 4JEUA 4YUXA 1K6IA 1U94A 2WNSA 3PR3A 5A4JA 5ALQA 2D2VA 1FTQA 5B58C 1R3UA 3CZ5A 3RRXA 2FJ0A 4HWGA 2HPAA 1OPXA 3HLTA 1LSUA 3EN0A 2EBFX 1SVOA 3TINA 3VI4B 4J1SA 4NDAA 3TI7A 1LH0A 4JC0A 3N86A 2IY9A 1GNVA 5HIJA 1Q17A 1EAMA 3DW3X 1LS6A 1W75A 4H3VA 3HWRA 4RMJA 1O3YA 1XDGA 2XTJA 1AS3A 2AFIB 3BQ9A 1VYHA 4CF6A 4L9RA 1QX4A 4A15A 3T3NA 2I87A 2GN2A 3L6RA 1MU0A 1OYVA 2VSYA 5G1NA 2I4OA 2JF0A 1QH9A 4LDZA 5FBHA 1RRMA 2A5YB 1M8JA 3M1LA 4P0TA 4DDHA 5JJKA 1FFEA 3HN6A 3CSUA 4XYGA 2Q3DA 3JPWA 3NEJA 3D6UA 4Y2TA 1OX6A 3T94A 1A7UA 1JILA 1LK5A 1NUSA 3JQAA 5FUVA 5LNK1 4BMPB 3UK1A 5BWMA 2IYSA 2WD8A 4MJXA 4XDZA 5CA0B 1L1QA 1R9MA 2LCIA 4MITA 1G20E 3O75A 1G41A 2YVLA 1H6CA 2WKQA 1ZMOA 2W2XA 3ETDA 4IIEA 4R2KA 2ZUTA 4C4OA 5EUCA 3GD5A 3DONA 2IHUA 2Q99A 2WZQA 1ZD4A 3EMBA 4EH1A 3W0LB 1M7HA 4AXXA 2JKYA 3IIEA 5C4IA 1XEFA 2Q7XA 5DLQC 3ZY3A 4IIDA 1BIFA 2GTIA 4H1VA 5C3MA 1UR5A 2BAGA 3DLAA 3KSUA 5F5NA 5PNTA 2NU9B 1ZJ5A 3TFOA 1A9XB 4GM1A 1C9DB 4Q47A 1KEPA 4R1LA 4XCXA 2WFLB 4EQ6B 1DBQA 2RBKA 3P32A 2ZJAA 4N48A 4MGKR 3SE0A 4PGGA 4ITVA 2D1QA 4NG4A 5AM3A 4J0EA 3OPMA 1U11A 2W2KA 3VHQA 3KJFA 1YVDA 3I62A 1P5JA 4C6RA 2EZ9A 2MINB 1UT5A 2ST1A 1KOFA 1P7PA 4R51A 4EVRA 2NXWA 2W7TA 2E49A 5JS8A 1IBRA 3R7DA 4X6LA 1CUFA 2VKTA 2PCLA 4J0KA 1PWYE 2C2YA 1U0EA 3DBRB 4TTQA 1E6WA 2WJGA 4EYKA 3A6ZA 1EFPA 3ES9A 3CONA 4KWHA 3AF0A 2GJ9A 3RGWS 3KOWA 2IP4A 2EDCA 3GT3A 2C92A 1YI1A 1IM2A 4L75A 1V35A 2VZLA 2I8LA 1AF4A 4Q3DA 5JCZA 2A1TR 3I9V1 4C30A 5ULLA 3KJEA 4S3MA 3EH1A 1OCEA 5IJXA 1ZG3A 3CC8A 1VRVA 5AVTA 4YUAA 1Z4MA 4EP1A 4GR9A 1JI3A 2P3OA 1D4AA 2TMYA 3AB3A 2ZJOA 1E4EA 3GJYA 4GMGA 5IEBA 2AVDA 4RFSA 1MPXA 2JLRA 1UDXA 4FD3A 4H6VA 2V7VA 2V9PA 5AD1A 2ZW9A 4JU8A 3NHYA 1VKRA 1WBJB 4PX3A 2AF4C 1RXWA 1QHFA 3CKYA 3IPYA 4QARA 2B5VA 1TMOA 4MVJA 4RXTA 1HYEA 3O1JC 4ZMRA 1D1SA 1EEXB 1LWOA 3O4IA 5LC1A 5J5AA 3WSWA 4C6SA 1DDGA 5CX1A 2YWRA 4C20A 1U2SA 3FX2A 4G1FA 5FO0A 3QFSA 3V1TC 3WLLA 2VPTA 3MBIA 4P36A 3SJAA 1XRSB 5A3JA 4XD2A 4DQVA 4K7JA 4P3NA 1P1IA 2Y6VA 3TQQA 2OHIA 2C54A 1EDOA 1NSFA 4MR7A 4DMMA 1CNMA 1T9ZA 5GP1A 4ACAA 5LMCA 3HDGA 1I4EB 2HXGA 4GDFA 2H4WA 3LT5A 4E5YA 2CT8A 2Q3BA 2BE7A 4CM8A 3E48A 4JEHA 4QGSA 3NHMA 1PJAA 2KJQA 3NX4A 3TD6A 1BWQA 4G1CA 3VM6A 4HB0A 1Q7GA 3GMDA 5L3ZA 5CDTA 3T4UA 2JRCA 4IIJB 3HBLA 2WHRA 3CT6A 4HB2A 2B6NA 3CIOA 5KWSA 4FFBA 4P0PB 2HU8A 4JLBA 5CDGA 1ZHOA 2HIHA 3AF5A 1RAEA 1RWOA 3IQZA 3QEOA 3VU9A 4YAUA 1VHLA 2CK3A 4LDQA 1JJFA 3K9QO 1E6EA 4LJ5A 4DLVA 1RI1A 3NNDA 4LOJA 2O2DA 2Z1DA 2G83A 3DMTA 5HZHA 5M04A 2KBEA 4EFDA 1NG1A 3WAJA 2BSQA 2RHGB 4AF8A 4FNOA 3LGAA 1DG1G 1O0SA 5A0FA 1XOIA 2ZB2A 4FFVA 4QBIA 1ZGAA 3DW1X 3KBOA 1HLFA 1G5RA 1IOZA 1E2PA 1SUWA 1KVRA 3PNKA 3P4YA 3JQPA 1S8AA 2JA1A 1E1RA 2RGWA 3MMXA 5COQA 4EA9A 1QQ5A 2R79A 4KX3A 4R4JA 3RTDA 1PYDA 3FLMA 2CDCA 4G37A 1S2LA 4I1VA 5B4TA 2AZDA 5E6RA 3MBKA 5TXGA 4BMXA 4OKIA 2I34A 2FEWB 4BZXA 4Q18A 3G1TA 2RAUA 4XD7A 2O52A 5FWDA 1IHPA 2QTCA 1WKBA 1TEZA 5EMLA 1ZXLA 3M89A 1EFVB 2G9UA 4DG9A 1ARZA 1QZZA 1WNTA 4MVWA 4LBVA 3OTWA 1F2UA 2HMAA 1XMXA 3FDFA 4JLKA 4KNWA 5EP1A 1EK5A 3PQFA 3QKRB 4X20B 3ZDAA 3NT2A 3QX9A 1M9NA 4OGFA 1Y6GA 3KJQA 4AKTA 3UJAA 1OZGA 1YVUA 3IUEA 3GN1A 2N9UA 2AXPA 2QP3A 1LC0A 2R8ZA 3RT7A 2GWRA 5DNYB 4MVJH 3PGXA 4R1SA 4MPDA 5TPZA 5BN3B 2YOGA 1HL7A 1N7GA 2V65A 1XRPA 2Q1UA 3IEPA 1U7ZA 2B1GA 3KKOA 3LYUA 1MC8A 2EGHA 4P4SB 4B73A 2VJPA 3AI7A 3DAHA 5LQRA 1Q20A 2FEAA 2OG2A 3GJQA 3HE3A 1RZVA 3OQHA 5E6SB 4EJSC 4N0PA 5C1OA 1D6SA 1HE2A 1LK0A 2IGTA 4BVLA 4ND7A 3QVLA 1NHGA 4DWWA 2HPZA 4CJXA 4AO6A 1ZJWA 1XU4A 2OCPA 3LZDA 3MTEA 1JAZA 4Q6WA 3AEYA 3I3OA 3E4CA 5K0BA 4CKXA 4ZT4A 3GGSA 3H87A 2I1VB 4HDRB 1HFWA 2W00A 3K0FA 1I1OA 1A0OA 3M34A 2PKQP 3QLUC 4H18A 1DOHA 2I6XA 4WEQA 4WKNA 5I9LA 2QJFA 3BORA 2QP9X 1R9NA 1T43A 2BBWA 1GUDA 1ZBQA 3HSYA 5KOJB 1GGEA 2Q62A 3OIWA 1TW3A 3L0SA 1WXQA 3A7EA 3ULKA 4A2PA 2J31A 5KINB 1IZ7A 3KB2A 2C29D 3Q72A 1QV6A 4L1KA 2DECA 3BJMA 5LU9A 1A2QA 1BW9A 1OHHD 2VPXA 4O5AA 5EJFA 1YQWA 4FW9A 2QMZA 5LLTA 1GV1A 1MAAA 2QRUA 4WA7A 3TIIA 2Q28A 4E21A 2YN0A 3LKZA 4Q4LA 1Z15A 2HUNA 5EY5B 3R20A 3V2IA 4QVKA 4CG3A 4MUIA 1PR5A 3AEXA 2JJ1A 1H2WA 2HTFA 3ASVA 4OMUA 1MJGA 4XUGB 3QBJA 3QXXA 4I6JA 2A9OA 1ULSA 3NW9A 3ZU6A 1TUBA 4P5DA 4FU0A 5HXAA 3BHJA 4Y9UA 4YV7A 2G17A 1WMEA 2JHCA 4C4RA 3EY9A 2VNAA 4KI7A 4GM0A 2G4LA 3VPCA 5IS2A 4KBGA 2DQSA 2P3QA 2REXB 4URHA 2VXYA 2G5CA 4ENVA 4KB5A 1L8AA 3EC1A 4L4XA 1EBBA 1WMSA 1X13A 4KXFB 1IXSB 1CP2A 4UCQA 3T7SA 3CUUA 3D64A 4IKOA 3WL6A 1O94C 4YMLA 3DOUA 4A6DA 1I2ZA 2QLFA 3E9YA 2PGOA 1UJMA 2JARA 1QM5A 4IAOA 5DDIP 4KCGA 3NTLA 4K6CA 4F1JA 1TX4B 5FOUA 5G0TA 3GLIE 1GD1O 2IYLD 4KRFA 3DM9B 4ZARA 4QNRA 1NQWA 2OO7A 1WS6A 3A14A 3KXLA 3PWTA 2H0RA 1AB6A 1SN7A 4PYMA 4UKDA 1F48A 1MG5A 2NVUB 2ZI3A 4UVEA 5C1PA 1DC6A 2HWXA 5ELLA 3L2OB 4HBZA 4DLTA 4UUAA 5ESDA 3RIGA 4UOEA 2DWUA 1ZIXA 2YHUA 4U39A 4HAXA 4OSPA 4WK4B 4KOEC 1M66A 1YJ5A 4BBJA 4CMJA 1G291 2CJFA 3AIIA 4IH1A 2R97A 4R2HA 4EG3A 4UHJA 1ZH2A 4PG6A 1KO8A 1ZJJA 1L5OA 3N8HA 1C3OA 3OM1A 4R3WA 5A1JA 1OFGA 2C2ZA 1NPTO 1WBBA 5JTUA 3BTOA 3OC0A 2HW8A 1J20A 1M8PA 4ZAXA 3I04A 2Y0BA 1MC4A 5K8UA 4JBYA 5EJ9A 2VTDA 4LEIA 1UP6A 4PQFA 3W2TA 1JQEA 3A9TA 3T4EA 2J9GA 2VP3A 5EZYF 1XHEA 4HLUC 4BQFA 1MIOB 2CJWB 2VSFA 3G5UA 5BMVF 5HZGA 3I6MA 3ISVA 1JH9A 3CZAA 4NOLA 3I28A 3AR7A 2GCIA 3AY7A 3H9BA 4EO7A 4ZI7A 5K0GA 3KKNA 5IYZB 3C74A 3WZLA 5HTKA 2OFFA 1P33A 3LPAA 5FNZA 1C0LA 3DZBA 2HK9A 3QFCA 1N8KA 2L19A 2WJAA 3AUFA 3EZFA 4Z4GA 1I9CA 3I2IA 2WYIA 1B93A 2NYVA 3LBAA 4MEAA 1BWRA 1UXIA 2FOIA 2Z6AA 1MR3F 4X8OA 3ZWDA 3U48A 5KTSA 1E1LA 1YA4A 1ILEA 1EWQA 4B76A 3U3RA 3BAZA 1WM1A 1Z5NA 2WE7A 3DUWA 3KKQA 2FFAA 1QCYA 2P67A 2G9ZA 3MGAA 1QORA 1U5BB 1XQYA 4WZAE 2IWHA 1PN3A 3COYA 2PMWB 3CURA 3EDMA 4RCYA 4XRRA 5EEHA 4RETA 5I47A 5HKKD 3ESQA 1P0IA 3UICA 4RVGA 2B8NA 1R8YA 3BWCA 1WCIA 1H4SA 2IWRA 4WRRA 4L57A 1T2NA 1FS5A 1OZAA 1XZQA 2A9RA 1S01A 2QUJA 1TK9A 2PH7A 3D2LA 3WWEA 1CY0A 3T5AA 2N47A 3JALB 3F74A 2W8ZA 4AT1A 3HVIA 4RZIA 2IELA 1IUKA 3OEED 1IEXA 3A1WA 3RFVA 2O8BA 1N2OA 2FEXA 3JY6A 5DBHX 3ABZA 1AQYA 4RXMA 4B84A 1SCKA 1SBCA 4Q1AA 4TKVA 1QTNA 3N2IA 4ZDWA 3HKCB 5JS2A 3DTVD 1ODCA 2HMUA 4HGYA 4R84A 2B8WA 4K6HA 4Y2YA 3ILXA 5CVUA 4YT2A 5FPHA 3HB0A 4Y7CA 5JRDS 1SXJE 3AJEA 2FR8A 1R6UA 1ZHHA 4QPZA 1DCTA 2ZU0C 4AWXA 5EMKA 2FMHA 1CUHA 3FYSA 4BFXA 1YUMA 2IYTA 3C3DA 3CR3C 3I76A 2ZYWX 4FS3A 3BIOA 4GRIA 3U7IA 2HA5A 2I4IA 3VPAA 1MJNA 2OD2A 2W98A 5CT6A 1C1DA 3DE5X 1EVKA 3WLAA 4YRCA 1XDBA 3RYFA 3NBYC 5CUQA 3OQBA 3IV7A 2J9FA 2ZVDA 1II8A 3D2BA 3GVXA 4M9QA 4TLLB 2OQ2A 4K05A 1DU4A 3KQOA 4ZODA 3OOEA 2ODQA 1DFGA 2GUGA 1IY8A 3D6TB 3WWDA 4CIYA 1B6RA 4QUGA 2A6PA 4XUDA 1IK4A 3HJTA 4TVKA 5FCDA 3E53A 3A3OA 2FI1A 1JR6A 5DCWA 4LBYA 2Q2VA 3M9WA 4UHEA 4LC0A 4B48A 4BNWA 1PW5A 4CFYA 4ZPXA 2GD6A 1Z0DA 2VWHA 4X6UA 2JHGA 1CDDA 4GS5A 2NUAB 1IRIA 1E2UA 3WFJA 4MUMA 2VTKA 4AKSA 2I6TA 4ESVA 3VJRA 4A8PA 3VR6A 1HG0A 1KVUA 1P3JA 2BGTA 2GZ1A 3C7KA 3CZMA 4OIFA 3ESRA 4KAFA 1OB5A 2B4TO 5L51A 4MR9A 1JDNA 4KO2S 4ZO6A 1Q0LA 2H1HA 2HNAA 3MFYA 3NTUA 2E6KA 3MWDA 4OHYA 7MHTA 1VYTA 4ZCLA 2VZEA 1DRJA 2FPKA 2IC5A 3NI2A 4LTMA 4TRJA 3Q41A 4X1YA 5KHLB 4CGYA 4UCWA 3FDZA 1QOQB 1UC8A 3VPXA 3OZGA 1RM0A 3CX4A 2UUCB 4LGYA 1JSLA 1J0AA 2WAYA 4KQIA 1ZNYA 4G1BA 4JMPA 4M46A 4TWZA 5K51A 4JY7A 5DHUA 4U6QA 5K7SA 2QN2A 1QMPA 2IPLA 1Z7YA 2RIPA 2WU0A 4YMIA 3LY9A 4IHJA 2VDQB 4MUYA 5D3KA 3LK6A 5HQ3B 4QYIB 4RY0A 3VPSA 3CLVA 5I4KA 5B1DA 3FKQA 1SVUA 5ITZB 1WDLA 4ABYA 5IUNC 3AVXA 1MAUA 3GO4A 3O1HB 3VYTB 1L4LA 3WLRA 4Z9AA 3N2YA 1QMGA 4HRYA 1XCPA 1BOFA 4GE0A 4ZU1X 3ZY5A 1L5RA 3FOBA 2BZ0A 1HE4A 4GLFA 3L82B 4YRGA 2XUQA 4QELA 3AVPA 2PR2A 2QZPA 1QIEA 2AQ8A 1N5IA 5IG2A 4BCBA 4TMFA 4IQ0A 4IGKA 4JBLA 3U3OA 3HB9A 2NNWB 3DYIA 2Z95A 4R2IA 1KIMA 4TL8A 4TL9A 4JLVA 3EDQA 5CCDA 1RAGA 3BC1A 4MV4A 4QTXA 3T9EA 5TLSA 5IP5A 4D9HA 1FK8A 4UATA 3KJHA 2G76A 1A5AB 3G49A 5ADHA 2C84A 3MWJA 4BCCA 3GU3A 1KZ9A 2PRKA 1QKJA 5EG5A 1V5GA 3UHJA 1KIAA 4NXNB 1XF9A 2H2DA 3C1OA 1ZKDA 2V0GA 2RD2A 4JT9A 4OY3A 5AOCA 3U49A 1D2EA 2SHKA 4LCJA 4ZZ2A 1LV8A 3OU2A 2Q1YA 4TMXA 1FTGA 2CLCX 3ELUA 2DFTA 3UPTA 2NYAA 1XD2A 3GJZA 3QWHA 2E0IA 3NB0A 4PC6A 3THSA 3GVIA 3OT1A 4JU9A 1AKRA 3AM3A 1ENPA 1K63A 1V6AA 4LJSA 1ATZA 1XXHE 4M7WA 2JASA 3E58A 4QPDA 5DYWA 1TJ3A 2WJZB 2I54A 1ORRA 5CJ2A 1S02A 5MDHA 3WWZA 1UF9A 4HDKB 1QHNA 4YIHA 1UXHA 3S55A 3KQNA 1E8MA 1KETA 4C7VA 1JE0A 1F9AA 4OJTA 1YMUA 1MUUA 2A7QA 2I8AA 2O2CA 3TG2A 1Y3CE 1JJIA 2FNAA 3A9VA 3DE4X 1YS7A 2HA6A 2XNCA 3PC8C 2CLHB 4M0EA 1Y89A 4MOWA 3OLCX 4Q4HA 1EFTA 3GZNB 1F5SA 1GTJ1 3NPMA 1QIMA 3REQB 2QU7A 2PX8A 1E9BA 3DWIA 3VR6H 1TGYA 2R7MA 5TS2A 3K92A 1JH8A 3NBQA 1C30B 2HCJB 2ZE6A 1U0RA 1Q3KA 3GUYA 3ISJA 2C2HA 5DB4A 3D0RA 3G9QA 1ZD2P 4HYEA 3LC2O 4B4VA 2OKGA 4QE3A 4UNQA 5BPFA 2WW8A 4HUJA 3H9JA 5I9BA 4F9FA 4YJ2A 4F1KA 4F2HA 4NG5A 1Z2DA 3TB6A 2BP7A 3JQCA 4EFMA 2VUUA 1KJZA 4NCAA 4EGCB 1RWPA 4D3DA 2P5TB 4R83A 1VIVA 1TJ4A 1A98A 3L1JA 4F3YA 1OWMA 3NDBB 3EIFA 3IODA 3CPEA 8MHTA 3X1MA 1QU3A 1N3YA 1NVMB 1RC0A 421PA 4PIPA 3H4MA 3AY6A 1DJNA 1YRYE 4QXPA 2AFIE 1JHMA 2IYZA 2P0YA 2AZ4A 3FHLA 4KVAA 5TEVA 4M1YA 4NYIR 4P5EA 2FRDC 4HDMA 1YV9A 2HRZA 1JKIA 1Z06A 4RA6A 3CRQA 2EP8A 4JVNA 3T7IA 3WB2A 5HK9A 2WKWA 1W93A 4RM2A 2IX9A 5K09A 4HNGA 5EQFA 1E77A 2DJ5A 4NONA 5A71A 2OCGA 3L79A 5KYGA 3PI6A 3Q3CA 1NLUA 2K2QB 3C6BA 4TM7A 4ZANA 5AW9A 4IY1A 5F76A 1JKJB 2C8JA 2YHSA 4YROA 3E4DA 1WXIA 1UM9B 3LO8A 3C3JA 2JGMA 1K6JA 1KP9A 2VSOA 4UU8A 3NTQA 5AKZA 3GWGA 2OGTA 2JLVA 2O2HA 1YKSA 2HRBA 1BXGB 1XNHA 3KQSA 1ZSNA 2OV6A 2C7OA 5TQVA 2CNNA 4MNTA 1CUUA 2PQMA 4B75A 4BJ3A 4GL2A 3JQ7B 4F72A 1GZDA 5AJXA 1XZBA 5JDCC 3PNLA 5IABA 4HAOA 1JECA 2PZMA 1TIPA 3CR7A 3K0CC 3VFDA 1QYDA 3PNPA 4H35A 5DHQA 2F1IA 3I6YA 1PIWA 4GECA 3QELA 4PG8A 1M8GA 3O8DA 4MYTA 3MUNA 2FKAA 2VQEB 3QG5A 1YZVA 4QL3A 4EMTA 3VSAA 3FIUA 5LD2B 2DKOA 3CRMA 1HDOA 1TU4A 4HAVA 4C0SA 2H0AA 3OEHD 3WLNA 3BF7A 1OV4A 2PFGA 3IKTA 2DPMA 1PT8A 4PGHA 4RH0A 5SYAA 1VMEA 2FWIA 2OORC 1M6VA 5F7XA 3K71B 3R3WA 4MV0A 1BMFD 3BWYA 1MV5A 3WV5A 4BGIA 3UT5B 3U3MA 1HKUA 3PQCA 2QEQA 4FZRA 3VZRA 3EIHA 2JD1A 5CVVA 4EEKA 5LDDC 3PEYA 3EZLA 2C4MA 2GN8A 1FF9A 2C5LA 4K26A 1A8PA 1ML4A 1N2JA 5BN1A 4A26A 4ASUD 1BQ4A 1V16B 2IZ7A 1C29B 3RJTA 1DPGA 4AUKA 3U40A 4AS2A 1I6KA 2WDPA 3G9TA 3QVVA 2FLKA 5LQSA 5CFOA 2QAIA 3O2JA 2JBAA 5LP6F 2DOKA 1VA4A 3G2PA 4LXHA 4BQIA 3GA7A 2BEWA 4N82A 4RL4A 4GC9A 5GZ3A 1WBDA 1QF9A 3R9KA 2R00C 1JIKA 5KZMB 5K3FA 5K3AA 4P22A 1Q21A 4C3UA 2XRYA 1Z7BA 2Z9BA 4BZZA 3ZXXA 3PR2B 5JH7A 2YJZA 2RC6A 2H17A 2QRGA 2WTMA 1INLA 1MB2A 3QTTA 4Q39A 1J0XO 1WLSA 4IF6A 3PQ3A 1H65A 5J2TF 4DUZB 4JBXA 1N5DA 3HXLA 3QY9A 1QGOA 2EKZA 2G70A 3GJSA 4RJ2A 2XSZD 1XU7A 2C9OA 3CUVA 1XVVA 2I3GA 2XECA 4V0SA 5HJEA 5CYGA 4DSAA 4N6NA 3K20A 5KC9A 3ROXA 2H1RA 1II9A 1OI2A 4FFDA 1JLKA 3BEOA 5F12A 1IU9A 3N0RA 1YSCA 2VHQA 4QM6A 4CKBA 2WUFA 4YGYA 4BJ5A 1HFKA 5F3DA 4CDGA 4CMEC 2QRJA 5KSWB 1J9EA 1OWLA 2Q8PA 1IK6A 5KTTA 5MGNA 1GQ2A 3A6JA 2X22A 3KYCB 4A0SA 3FPGA 3KLNA 4OLHA 1T2CA 1ZISA 4B9EA 2H1OA 4JLMA 2OBBA 3DBHB 4N5IX 5G0UA 5MF6A 3L0ZA 1QDUA 1EQ2A 3ZIUA 3E6AA 1TPYA 3AUXA 1PG2A 4QUBA 3FMOB 1O03A 3L6EA 3SC6A 1DINA 3IP7A 1FXUA 2Y1FA 2OP1A 2YVQA 4J03A 4UNSA 1PNRA 1W0CA 3Q1KA 4FDLA 3CMMA 2IHTA 1LWNA 1U1GA 5J9FA 4AZWA 4QLAA 1ZVKA 5AK3A 4EECA 3WQBA 3M6UA 3ONDA 2R8EA 1GQYA 4I4TF 1TF5A 1V8PA 2NX2A 4NYMR 2B36A 4MS1B 1N9GA 3G0BA 4J4TA 1COZA 5AI8A 3RUIA 2AW3A 1C3XA 1FVFA 4ZQHA 1U6IA 5FQOA 4ER7A 1G0OA 2I76A 5K0EA 1C9JA 3D0OA 3W2FA 2PH5A 3AIMA 3GJ7A 2ORIA 1FUYB 3EYWA 4BE7B 3IPAA 4V1CI 4HMPA 1HZJA 1TEVA 4NPCA 1GN9A 1NT4A 2G9QA 2W83A 1FIUA 1VM6A 2PBFA 3GRKA 3JRNA 4I50A 4FUQA 4MUGA 1VIMA 4DV7B 2RG1A 5DRYA 6ABPA 4LMBA 4YV0A 3O2QB 4YBRA 3CW8X 3OX1A 2GQ0A 2C0QA 3N8DA 3QMVA 2PSEA 3HDTA 2ZXUA 3TJRA 1CS0A 1T4MA 3AVOA 5FORA 1QQTA 3I52A 3UKDA 3KV1A 4R41A 3GLIB 1ZM9A 1Y34E 3T6KA 2O1SA 4ZGBA 3U4QB 2IOFK 5BV7A 2A0YA 3PGVA 4UVIA 1C9MA 3WK6A 1HT2E 2TMKA 3C6KA 2P78A 3UCFA 3X1ZA 4MWGA 1OZ0A 5JMPA 2H18A 1IM8A 3ZK7A 1XBTA 1XTUA 1LA2A 4RPGA 2PMEA 2PGLA 1XLWA 1KQPA 5EWJA 2Y9PB 3U4AA 2BHLA 1V1RB 2HMVA 3LI2A 4ZPJA 1NJ5A 1YR2A 4JUDX 1G6OA 5IAKA 1UJ6A 3K94A 3Q9LA 3NXKA 4KUHA 5FDFA 1Y1RA 3MWEB 4F4JA 3W9UA 1FDOA 1LPNA 1CR0A 3EY4A 5KSYA 4MGIR 3O6VA 1XB2A 3TIFA 1D8TA 2ORWA 3HJRA 1OX5A 2PVSA 1REQB 5L3SB 4NJEB 3JW8A 3M3DA 3SHVA 2GSDA 3GGJA 5FI0B 4K03A 1G17A 3Q1LA 4M7OA 4AYWA 4DNQA 1TTPB 2NU7B 4B40A 1VCHA 1IB6A 5IBPA 5JNLA 1TVKB 2G06A 2IY8A 4TKUA 4YUWA 1R0LA 3GJ3A 1FYEA 3Q6MA 5AW2A 4Z4IA 3GRVA 1E3IA 3F47A 1F0PA 3P2EA 2GEDA 2J0UB 4FHCA 4ERXA 1U1FA 4YAEA 4ZEWA 4ZYWA 4F2GA 2JEYA 5KS2A 4G5FA 1IWBB 3ZZNA 1EZ1A 1HDYA 3GIDA 1I8TA 1A96A 4CL0A 2J9YB 3VDMA 4MKZA 1FUUA 4ML3A 4Y2GA 3O9MA 1IB0A 1IFXA 1U0SY 1JMYA 4OQQA 2C8KA 1HOXA 4QGBA 5CIQA 1XZDA 4GRAA 4YDRA 5EQJB 5I9MA 5TT1A 2WIKA 4YQFA 3R3ZA 1RPAA 2DAPA 4X7BA 3AUYA 4IZOA 4MUAA 3MF4A 2V7QA 3RS9A 3ZK8A 1RM5A 1WD7A 2PL3A 2HLPA 4AVYA 3DZ8A 3GT7A 3GHHA 1DQRA 4BVAA 4OMCA 3I5UA 2ZS9A 3ECSA 1JBKA 2A5LA 1CV2A 3SMQA 1DZ3A 3V4SA 2J48A 5LQCA 3B1KA 3K8ZA 4HN9A 4NMMA 4NYMQ 4RV4A 2ZDQA 4WNAB 3SX2A 2PQ6A 2HNKA 2ZSJA 1H1DA 3TOXA 4LK2A 1OFUA 4BJ1A 1FMTA 2F43B 3NATA 4QAJA 4R8MA 1OGYA 2G07A 4WZBB 3W6ZA 5AUOB 3O95A 4NICA 5LWHA 1KAHA 4RZUA 2QL5A 3OCJA 5DNUA 4P9NA 2NU8B 2XCIA 1JJ7A 1W6RA 4XJXA 3P1JA 3RHZA 2HFJA 4LG1A 3QFRA 4GI3A 2AOTA 2QR5A 1XYVA 3AUTA 4AMYA 3W5JA 2QJOA 3UMVA 3ZXUB 1B16A 2XXAB 1XMQB 5DXJA 1QAQA 3OPNA 3QWFA 4YACA 3PB3A 1W2HA 5I9TA 3U0BA 3BBPA 3ZU3A 3R40A 4BJ6A 4ZO9A 3SOPA 5J2UA 4RQBA 2E9SA 2DBVO 3DYVA 2QF7A 5FNVB 2AMFA 1M72A 4C0BA 2RK6A 4NFYA 5AOAA 1UWCA 3PQ8A 4NV1A 3R3YA 3SSMA 2O8FA 3BMOB 4BX8A 3VU1A 1CYDA 4HLNA 1D6NA 4UM7A 4YJHA 2EFJA 3TYXA 4BXOA 1CUYA 5DM0A 1NVVR 2IZZA 5M5BA 4B09A 3UB2A 3ECAA 4JT8A 3QMWA 4GOOD 2ZUDA 4CDMA 5A4AA 1ZBDA 2Y1DA 1X80B 2Q6TA 1YJ8A 2RH9B 2IGBA 3OOJA 4L0CA 4N0EA 2V7EA 3E35A 5EUQB 1P7CA 4JUFA 3U37A 5B6JA 1H1LB 2WTXA 3KJIA 4Y2SA 2WY2D 4F45A 2FVXA 2XGOA 1NF9A 3RC2A 5DP2A 1XRNA 3OCZA 4R40A 1TTQB 3H0CA 2HMYB 4WWHA 3R09A 2PUCA 2Y0PA 1NBEA 4IS3A 3ZI7A 1T35A 5MFPA 1VLMA 4P4TA 2PDAA 4L08A 4P35A 1SJ9A 4R7ZA 4BB9A 5BSRA 3PKZA 4M89A 5AVKA 4R9RA 3QPDA 4YJFB 2QPAA 4J9UE 1NVTA 4H1WA 4I99A 3IR5A 3VSCA 5DBEX 2V5AA 1ZK2A 1XROA 1NSTA 1HTWA 1XELA 4YRLA 1S3IA 5CXQA 1W49A 2J3LA 2NUPA 1MTOA 4EY5A 3D02A 3TZLA 2GVNA 4DT1B 4RTLA 1WMAA 5JI3E 2JH3A 4F9EA 2PUJA 1NOJA 4INZA 4CKZA 2NG1A 2B9EA 4QDKA 5JQGA 4BTLA 1A7AA 1SO8A 3BL6A 3HJUA 2XMZA 3PC7A 1AGPA 4FOSA 1A9PA 3IP6A 5U4XA 3LSTA 2GFHA 3QE0A 1EDZA 4G1MB 3U7FB 1WZ2A 4K6KA 5ALJA 2ZITA 5KYXB 4OREX 5GJBA 1CXZA 3BCUA 3D7MA 4CM6A 4MVJG 4AYXA 1BROA 1GZUA 1P0FA 4D98A 5F7ZA 1F3LA 3GR6A 1X0XA 3PQ5A 2OLEA 3WDKA 1P2UA 4ZYVA 2O5CA 3DLCA 2C97A 1GA1A 3C3EA 2WLSA 2R5NA 3RBVA 4X65B 3HYCA 3ETJA 3AHIA 3QV1A 4URVR 2JIZD 1CUWA 4EUFA 2JGEA 4RK1A 4YP6A 3WGTA 4F91B 2FJUA 3R9XB 3NHKA 3CX7A 1HLPA 3S2IA 4ZYLA 2DG2A 3LP5A 4IDNA 4DBVO 3RYCA 8GPBA 4LJLA 1XZEA 4GZ6A 4F84A 1IBKB 1E7RA 2CVPA 1CHNA 2H1IA 1XQ6A 1T2AA 1Z4KA 2B82A 2XR1A 3FJ1A 4YFVA 3VV2A 2C7QA 1TLFA 2VDKB 3HRIA 2MSNA 3JATB 2JFHA 2OZKA 3EPRA 1DKLA 4KL8S 1PL8A 4DCPA 4ZVPA 5EHXA 3HJGA 3VH1A 4WESA 3QKSB 4N8DA 3WBKA 2PUFA 4D9BA 1DWQA 4TMKA 2ECQA 3QEMA 1RAHA 2H92A 3KB1A 4P33A 4OFBA 5GMOA 4BQQA 3L7MA 3SYTA 1UAAA 2NLOA 5HIAA 1JKMA 3HUEA 1PJLA 1WW8A 1EVIA 3SSOA 1DAKA 4AJ4A 3JWJA 1LPAB 4GPD1 1L4BA 4GXQA 1OVMA 4KFRA 4MW9A 5IXSA 1R4NB 2VRNA 5FPKA 2R68A 5C8DA 1DZIA 2V7XA 4QGFA 3D3NA 4MHTA 3C4VA 4PYOA 4DJJA 1DKPA 1H9BA 4IL5A 1FSPA 1EM6A 3JRWA 1V1JA 4R2WA 5A3QA 1GTVA 3SHWA 1ZH6A 5FHQA 4QC2A 1H9CA 4RVDA 3R7WB 3EZ2A 4GLLA 4KE6A 1LB1B 4RF5A 3RARA 3INGA 1PZXA 4RD4A 3ZLTA 4EI8A 2D1YA 1ZJYA 3B53X 2YWXA 3IAHA 3KJGA 5B5SA 2OHFA 4HDQB 4AIRA 3ILYA 2HHLA 4R2MA 3EGXA 2OPHA 3RJZA 1GA4A 1U2EA 3OBIA 4KLZA 5AW1A 5K6AA 2YL2A 2B1RA 2O7VA 3RKUA 2J4FA 1MBZA 4TN1A 1JL3A 1SBIA 2FF7A 4PLHA 2BC9A 1E3WB 5KTMA 4G0VA 4K9RA 5C7IO 1Y63A 1P0CA 2G25A 4XLTA 3B6IA 3HJBA 5JPIA 5LMUB 2EGUA 2X5XA 2ZANA 2XD9A 1E1QA 1PQWA 3ADOA 3BJEA 3WDMA 1TJPB 1VL8A 4A0RA 1SXQA 4LXIA 1NN0A 2GCOB 3V34A 4D74A 1QJCA 3YASA 1XMVA 1R0CA 4C87A 3S8EA 2CUZA 3K3PA 2UYOA 3BJRA 4MYRA 4OU4A 3ZY6A 4I55B 1UZUA 3A3YA 1D3AA 2PAFA 4BO5A 2GEJA 1WP9A 2RH8A 2AW5A 3AERB 2X5KO 3RDPA 1Z0AA 5LIRA 3WIDA 2A5GA 4AJLA 1RU3A 3AUSA 3GJRA 2G8NA 3FOAA 2Y0DA 3K9BA 3SD7A 3UXEA 4DYDA 1X1RA 3T3OA