4PW0A

Alpha/beta hydrolase fold protein from chitinophaga pinensis
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
275
structure length
275
Chain Sequence
NDHATAPTQYIEVNGTRYAYRSLGAPSDIPLICFQHFTGTLDNWDPLITNGLSKGRQLIIFDNKGVGLSSGTTPDNVAAMTADALEFITALGIRYFDVLGFSLGGFIVQYMAHIQPDMIRKIIIVGAAPQGVKVLHTFPDLIARAMQLEPKERFLFIFFEQSEHSRSKGLATLGRLYERTTDRDQDASAQAIGAQLTAITNWGKKTPSFEITSIQHPVFVVQGSNDEMMDTYNSYELFKQLPDAILSLYPDAAHGSFYQYPELFVSQTEYFLDSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha/beta hydrolase fold protein
publication title Alpha/beta hydrolase fold protein from Chitinophaga pinensis.
rcsb
source organism Chitinophaga pinensis
molecule tags Hydrolase
total genus 101
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2014-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4pw0A00
4UBMA 2QT9A 3FYUC 2WJ4A 4H7JA 1GPKA 3NOXA 1T4MA 5EI5A 2WTMA 2QS9A 4U2BA 1JFRA 2Y6UA 2WFLA 3V9AA 4N8SA 1TK3A 4WY5A 2ZJFA 4AN0A 4RE5A 4CIAA 5K3EA 3PI6A 1QIHA 1CUYA 1UK6A 5ALDA 5HK8A 1WOMA 3R3XA 3WKBA 4ZV9A 3UMJA 1X2BA 1MX5A 5DNWA 3WWEA 3KD2A 3DLTA 3F97A 5FLKA 4MYSA 2YH2A 1W1IA 4B82A 3WYDA 3KSRA 5T4HA 2QXUA 5C8VA 4MYDA 2HA5A 1LLFA 1HL7A 1E3QA 4FHZA 1A8QA 1HBJA 4P92A 5LKAA 5EIHA 4YPVA 5JAUA 5IVHA 3AZQA 1OXMA 1YA8A 4X91A 1LBTA 3D59A 1YR2A 2WILA 1ZIYA 2DQYA 3AIOA 1XZFA 1ZGBA 1QO9A 1H22A 3EQ8A 2QJWA 1X70A 1MTZA 1UKCA 1VZ2A 5FOQA 1P0MA 3STXA 4DM7A 3O9VA 5K3DA 3WA7A 3C6YA 4KACA 4UBKA 5AKXA 3UUEA 4X6UA 2B20A 4MWSA 3S8YA 1UKAA 1XRMA 4HAIA 3A6ZA 4U2EA 2PU5A 5EIAA 4CCYB 1J1IA 2PSDA 3PFCA 5JD6A 3DL4A 2QR5A 1UKBA 4FFVA 2ZSHA 5ALYA 1YB6A 5ALKA 5ALTA 4F21A 1YS1X 3NWOA 2XQGA 1XQXA 2CJPA 2XUDA 2RI6A 4C4ZA 1E66A 5SYMA 4B81A 5HFNA 5AP9A 2QTBA 1UWCA 2RHTA 3I1YA 2WIDA 5HZGA 4DMKA 4AQDA 2XQJA 2Z8XA 3O4GA 4W1QA 2WUGA 5ALMA 1WB5A 4Y2JA 1ISPA 4UFPA 4CIBA 5ALVA 1IMJA 1XRRA 1B6GA 5LLSA 3V1KA 1L7AA 1QO7A 4C01A 4KE9A 1VJ5A 1CR6A 1THGA 3G9TA 3ZLVA 2XUKA 4BRZA 1BCSA 3AZPA 3STWA 1TRHA 2WFZA 2HA0A 1K5PA 3DKKA 1XZMA 1MPXA 4UHBA 2BUBA 2QUBA 1R88A 1EXWA 5A7FA 3OURA 4BYMA 3LIPA 5CH8A 1CV2A 4J0GA 4H7FA 5SYNA 4KE7A 5KWJA 1A7UA 1GGVA 4RNCA 4CG1A 1SCQA 3G9ZA 1IVYA 4B0OA 2C0PA 1BEZA 1CIJA 1B41A 1A8SA 5ALGA 2PX6A 4J0CA 4EHBA 4BCDA 2VA9A 1HPLA 1WCYA 1VE6A 1P0IA 3CCBA 4RPCA 2LIPA 4JYPA 4S0XA 3KWFA 2Q0XA 3QMVA 5D3KA 4N8EA 1F0NA 2ECFA 1I6WA 2I78A 5AKJA 2AJCA 1AURA 2XUGA 4AMYA 3H2GA 2ZYHA 1XFDA 2P8SA 1MX9A 5A62A 3FLAA 4C89A 4F0JA 2VJAA 3STYA 2FJPA 4FNGA 2AJBA 3BWXA 1DU4A 2XQIA 1THTA 1T2NA 1E5TA 1VLQA 3WI7A 4AB1A 5HQ3B 2WJ3A 5ESRA 1GQSA 3FOBA 1AC5A 5LZ9A 4L72A 1ZD5A 4J7AA 4PF1A 1W76A 5ALXA 2PM8A 3HXKA 4WY8A 3GELA 4GW3A 2D5LA 4L3WA 4Y2XA 2WG0A 2RIPA 1ZGCA 3C6BA 1XQWA 3JWEA 4EUSA 3GROA 5AJHA 1QTIA 3QBJA 2CEKA 1DINA 4V2IA 2RAUA 1YAHA 1QE3A 2I03A 3B3QA 3F96A 4GWLA 4O08A 2JGJA 4H0CA 2WFMA 3T4UA 3DOHA 1R4ZA 4KEAA 4B83A 2JGMA 3IUNA 3WWPA 1C7JA 1N1MA 2XLCA 4B9AA 3IIIA 5CURA 1CQZA 1CUHA 4CCYA 1ZICA 2Z3ZA 1CVLA 5AM5A 4W9RA 4I19A 4K5QA 2ROQA 1AQLA 4J0IA 1QIEA 1EX9A 1XRPA 4B80A 2QRUA 4ZV7A 4FBLA 4QNNA 4G9EA 2JGEA 5CT8A 1JT2A 3R3WA 2J3QA 4J3JA 3DEAA 4GECA 5AH0A 4K6HA 3H2JA 3FLEA 1XZEA 4MQMA 4BTLA 3DYIA 3AIKA 1OCEA 3AIMA 2Y2UA 4NS4A 4BE9A 3QPDA 3DJYA 2O2HA 1WPRA 2BAGA 4Q3LA 1DWQA 2PSEA 2C58A 2WU4A 5JZ9A 1VA5A 2PVSA 3V1MA 4PV7A 1E8MA 5EHXA 1TCAA 4DSZA 4BE4A 3I2HA 2XUOA 2YASA 2DCMA 1R3DA 1HLGA 4PSDA 3WZLA 3IVMA 1EA5A 4B7ZA 3LS2A 4PW0A 2O2GA 3R3ZA 1S8OA 2CMFA 2HADA 5AO9A 1UFOA 5EHZA 4DNOA 3DDUA 5AKIA 2EDCA 2PUJA 2XMDA 5HF5A 3BF7A 1G66A 4OB8A 5AKLA 2BFNA 5I7UA 4FWBA 4JUIA 1XQVA 2ES4A 3O4JA 3M82A 4B85A 2WKWA 1CRLA 5CXUA 3A70A 4OSEA 4BDSA 3MUNA 2QZPA 3ZLTA 2FX5A 1CEXA 1QIGA 4KAJA 1DX6A 4KAFA 3TJMA 2W6CX 4Q3KA 4QE3A 3PF9A 2OAGA 2HA6A 1LPNA 5DYWA 3ZI7A 4DYHA 5A7GA 1YA4A 2H7CA 5ALEA 1YCDA 3FWHA 1EHYA 1NU6A 4LXHA 3GUUA 1TKRA 4UHFA 3D5EA 3IUQA 1CUGA 2XUJA 3O4HA 1EB9A 5HQ3A 3S2ZA 1DWPA 4DMFA 3IBTA 4KE8A 4LKOA 2XMSA 5AKEA 3WL6A 5JAPA 5AI0A 2DQZA 4XX1A 5JD5A 3C6XA 3HC7A 4DIUA 4AN1A 2HU8A 4X3CA 4QLOA 2QUAA 2B61A 2DSNA 2VATA 1HKHA 2JEZA 2BGNA 3PUHA 3KWJA 2JIDA 3ESDA 1TAHA 4N5HX 4E46A 1E89A 4L9AA 5ALPA 3TEJA 3ZLUA 3EF3A 4UFNA 1JU3A 4C87A 1QLWA 3HI4A 3WL7A 2ZYSA 2W22A 4AO8A 1IUPA 2BJHA 1N5MA 3T52A 1XZCA 2DHCA 2PU7A 4X90A 2JEYA 1ZI8A 2X5XA 1MAHA 2AJDA 1H2YA 1UK9A 3WK5A 1VXOA 3RARA 4H7KA 3CXUA 4QLAA 5CT4A 3RLIA 4EZIA 5DWDA 1U2EA 5FV4A 1LPMA 5AM3A 5BV7A 3ZPXA 1XRQA 3N0TA 4A5SA 4AMZA 5IVDA 3BL8A 3CN9A 2RHWA 2Y2VA 1JMKC 3C8HA 1CUWA 2QOEA 2XUFA 3G02A 5T4BA 1YS2X 3V1NA 1JJFA 2XQFA 4UUQA 1JKMA 3AINA 2G5TA 5ALRA 3HZOA 2HM7A 2OGZA 3IURA 3C70A 5JD4A 1C4XA 3M3DA 1LPAB 1KU6A 4BB0A 1W6RA 5ALSA 5YASA 1J2EA 1K6EA 3DL7A 3R41A 5DNVA 2GZRA 5JALA 3HACA 3VDXA 4DMHA 4GLBA 3PF8A 2ACEA 3R3UA 4EY5A 2V98A 1A88A 2WJ6A 4JNCA 5LZ4A 3WK9A 3I2FA 1EDBA 2QVBA 5FDFA 5A6VA 1DT3A 5AKHA 4IHAA 5AI4A 2VF2A 2WUDA 3A2NA 2OCLA 2XMBA 5K3FB 3WZMA 4X93A 1FFBA 3UUFA 1ODTC 5D7BA 2NW6A 4ZREA 4JYMA 3JYHA 3OOSA 2XMZA 3C45A 1H2XA 3U1TA 3SK0A 1HQDA 2XI4A 3VVMA 2OXEA 3HYSA 2VAXA 1W52X 3I6MA 2J3DA 4WJLA 4F5ZA 1QIIA 4HXEB 1ACJA 4IH9A 5H3HA 4GI1A 1QZ3A 1EI9A 4FFWA 2XMRA 5JANA 2ZYIA 4KRYA 4ZI5A 3F9CA 4UHHA 2B9VA 1W75A 1USWA 5CTAA 4FKBA 1XZKA 3STUA 4QDUA 2O7RA 3E3AA 1R9MA 4E11A 4G8BA 4BC1A 3G9UA 1SC9A 4K2AA 4EB0A 3WL5A 1ZIXA 3FSGA 2XMQA 1BEEA 2V97A 1A8UA 1EK2A 1MJ5A 3HRHA 1CUDA 2PBLA 4X6XA 4ZWNA 4A23A 7YASA 1H2ZA 4EY6A 4MWTA 4X95A 5EIEA 2OAEA 4GEGA 4MEAA 4KJXA 3FBWA 3W04A 1VA4A 3G0GA 1MN6A 3WIBA 5LZ8A 2HU5A 3D3NA 5AI9A 2HRQA 3BE8A 1ZI6A 4RE6A 1QIMA 1ZJ5A 4X97A 2YYSA 1N8SA 2C5GA 5CT9A 4H35A 5ALJA 2GBGA 4D9JA 3ZWQA 1M33A 4MEBA 4J0KA 1CUVA 4W1RA 4W1PA 5C8ZA 5AM1A 4EY4A 2WU3A 2CKMA 4DNPA 1WB4A 2VEOA 2ZVDA 5CT6A 3QPAA 5DTIA 4KYVA 2XUQA 4GHWA 4QZVA 3TGLA 5ALQA 1XLWA 1CUCA 1GPNA 4BC0A 2OQIA 2VT6A 1XZGA 3I2IA 5FXMA 1QGED 2RONA 3M81A 4UBOA 4OB6A 4EY7A 3DS8A 1KEZA 2WHRA 3D2CA 1RP1A 1XLVA 5AICA 3AZOA 2YXPX 3WJ1A 2ORYA 1VXRA 3NGMA 3O0DA 4AO6A 1KU0A 2PSHA 4KRXA 4OB7A 3H19A 3NUZA 3H1AA 2GYVA 3MUOA 4WFJA 2ZYRA 1PFQA 1XRLA 3L1JA 5KREA 2G63A 3L1HA 3WKCA 2AJ8A 3K2IA 2QMQA 2R8BA 4N8DA 1QIFA 2XLBA 5K3FA 3VJLA 1Q84A 3ANTA 2UZ0A 3IDAA 4EA6A 1U4NA 1XZLA 3VJKA 3QH4A 4C6HA 1F8UA 3SX4A 3JW8A 5AIBA 4WCVA 5FP0A 1WPXA 2E3JA 4Y2TA 5K3CA 2H9YA 5AI6A 4OUKX 4Q82A 4WDQA 1WB6A 5C81A 3LLCA 5A7HA 3M83A 1YSCA 3KOOA 2BKLA 4LXGA 4BVLA 4ZRDA 1QFMA 3DCNA 1XZAA 2QXTA 2GBCA 3FAKA 5ALIA 4BZWA 2XE4A 4QWMA 4X00A 3DNMA 5T4FA 3QITA 4QDTA 4YX9A 1QIDA 4G4GA 1IUOA 3DYVA 5AK3A 1XZDA 1ETHA 4X7BA 5AI8A 3W06A 4QEKA 3QVMA 3IA2A 3BIXA 2I3ZA 4H7HA 4P93A 2HL6A 4Q1VA 1LZKA 3V1LA 1ZD4A 3FCYA 5DYYA 2XUHA 3E0XA 4X94A 5AKZA 1AMNA 5ALZA 1CQWA 1QJ4A 2JF0A 4ARBA 3D2BA 5BOVA 5IVKA 3VVLA 1XRNA 1CUAA 4AZ3A 5AM2A 2WG2A 2HA3A 1Y7HA 1QIJA 3HJUA 5FUMA 4G4IA 3PFBA 4BAGA 5JATA 3WMRA 5EFZA 1RYYA 3FYUB 3DKRA 1H2WA 4JH0A 3N2ZB 4BAUA 4X92A 2EDAA 3DD5A 2WUFA 5AM4A 1EB8A 4HRXA 1ORWA 4PNZA 5LKRA 2WIJA 2WHQA 3D0KA 4UHEA 3FVTA 2OCIA 4LYEA 4DGQA 2OGTA 1U65A 4BVKA 3BJMA 1ZJ4A 4B84A 1AUOA 3SWWA 3VJMA 2Z5GA 4XIIA 4OD0A 2IX9A 3I28A 2XUPA 1CFJA 3G0CA 3QPCA 1VE7A 2J4CA 2BCEA 3CCCA 1UK7A 5K3BA 5AKGA 3EIOA 1GT6A 3H2IA 5AK5A 5BWBA 3ICVA 3RKSA 2HRRA 1JJBA 5C7YA 4JEIA 3GZJA 4FLFA 2HHAA 3FYTA 5IVIA 3WK8A 5ALFA 5HF9A 1CUFA 1K8QA 5LYYA 5ISMA 1LPSA 2R11A 4Y2UA 3WWOA 2QKYA 3I6YA 2GZSA 4QDXA 1N5RA 4AZ0A 5CH3A 1GZ7A 5F4ZA 1G42A 1VKHA 3CN7A 4OYYA 5CBKA 3BIWA 4TVKA 4Y9SA 4QDZA 1LZLA 1CUJA 4FLMA 2C5FA 1ODSA 4B9EA 4U2FA 4C4XA 2WUEA 5A2GA 5AOBA 1VOTA 3E4DA 4FBMA 4G9GA 1SCIA 1LPPA 3AUKA 1O6FA 3PICA 2Z8ZA 3FNBA 4BP9A 1XKTA 1XZIA 3B5EA 4ARAA 3YASA 1YB7A 4OU4A 2DR0A 3WK6A 4K6GA 4NVRA 5DTJA 4BRSA 2PPLA 4Q3OA 5LZ7A 4MQLA 4E14A 2WHPB 3BJRA 2WG1A 2HFJA 2DHDA 2JGIA 5D6OA 2PUHA 4HRYA 1MNAA 4RGYA 4UHDA 3WYNA 2PSJA 2VT7A 4FMPA 4CFSA 5KWIA 4AX4A 2JGKA 1FJ2A 3HSSA 3OPMA 3FVRA 2VJBA 2G5PA 3STVA 3AILA 3R40A 4BCCA 1SFRA 4U2GA 4INZA 3Q8WA 4LHEA 5ALNA 4FTWA 4CG2A 2HDWA 1CUXA 5HK9A 4K6KA 3WKAA 2FJ0A 4ETWA 4G5XA 4A16A 4H7DA 2VJDA 1AX9A 1F0PA 1K63A 2BUAA 4L0CA 5JZBA 1DT5A 4H18A 1JJIA 2XDWA 4DSAA 4P9NA 1WM1A 4W63A 3FYUA 3WIOA 5AKYA 3HEAA 3ESCA 1G5FA 1CPYA 3C43A 2GYUA 1XKLA 4YK7A 1MNQA 1ODCA 3LCRA 4QA9A 4Y2PA 2WM2A 2GYWA 4B0PA 4BBZA 3GFFA 4BCBA 4BATA 1AKNA 3C5VA 3ILSA 5E4TA 3W9UA 4EBBA 5AK4A 2XMGA 2HU7A 2WSLA 3R0VA 4NZZA 5AOCA 2XMCA 1FSSA 2XUIA 3TRDA 4UBNA 2OLEA 5DLPA 4J0HA 2XQKA 1G4HA 4Y2VA 4J0JA 1SOMA 5HKBA 3W9BA 3OC0A 4IH4A 5EHNA 5I8PA 3A2MA 5KBYA 5BWCA 2X8BA 3X3HA 1IUNA 4DLNA 3H18A 4AO7A 4BAZA 1EH5A 4PO3X 5DYTA 5D3ZA 3I2JA 2VQ6A 2CBGA 3O9MA 1MO2A 5AKKA 3KDAA 5E2IA 3QM1A 2ZJ7A 2Y6VA 4G8DA 1MAAA 3F98A 1Z68A 3I1IA 2XT0A 3HLKA 2CUTA 5C8XA 2I3DA 4B6GA 4EY8A 1CUUA 1JMYA 2OPHA 2VTVA 1AZWA 4IO0A 3Q0TA 2J4FA 4LIPD 3O4IA 4QDOA 5AIAA 5A71A 2BGRA 3D4LA 5JARA 5LZ5A 3SC2A 4Y2YA 4GBGA 4N5IX 1L7RA 1QTRA 1VZ3A 3G0BA 1XZJA 5AHXA 5CXXA 3VXKA 3D7RA 2PSFA 4WFIA 3G0DA 3ICWA 4LYDA 4FNMA 3WJ2A 1UT6A 2ZJ6A 2H7YA 1RWQA 3WK7A 1CUIA 4ITVA 2WHPA 1XZHA 1DQYA 2G4LA 3LIIA 5DNUA 1TIBA 4U2DA 1HDEA 4I4CA 4ZXFA 4BVJA 2C7BA 3FSGD 2CZQA 2AXEA 3H04A 3BF8A 1BN6A 1QONA 3FCXA 2JBWA 1JU4A 4BZZA 4Y2QA 3WKDA 3I6ZA 1GKKA 1MT3A 2OGSA 1YASA 5ALLA 3F8SA 1QOZA 3ANSA 1FFCA 1YAJA 4FDMA 1MU0A 3WKEA 1D07A 1H23A 3WLAA 3U0VA 2DHEA 4KE6A 3ESAA 3C5WP 5JYCA 4DNFA 4X85A 4UHCA 3QMMA 5HF6A 2DFPA 4H7EA 1R50A 3EQ9A 2WIFA 1UK8A 4Y2RA 1UOOA 1Q0RA 5HFAA 3STTA 5CMLA 3V48A 4GXNA 4X71A 2AJLI 4AXBA 5ALWA 2O7VA 3QYJA 4HXGA 2X76A 5JAHA 5HKAA 2VSQA 3A2LA 5AI5A 1CUSA 3I2KA 5HF8A 3RK4A 3VKFA 4HTAA 2V96A 1NX9A 4C4YA 4CI9A 1IZ7A 4E15A 1EDEA 2IIVA 4FLEA 1Y7IA 2OG1A 4TGLA 1UZAA 4IQ4A 2ZSIA 1R9NA 4PSCA 3GA7A 3B12A 1L7QA 2H7XA 3H1BA 2HIHA 3P2MA 2K2QB 1DQZA 1AGYA 4M0EA 2GBIA 3K9BA 3WK4A 3G7NA 3GBSA 3ED1A 3ZV7A 4M0FA 4UBIA 1BN7A 2Y1KA 4MJ3A 2OCGA 1EVEA 2C4HA 3E1GA 2RGUA 3C8DA 1EDDA 5FRDA 3WQHA 5IKXA 1ORVA 1LGYA 1FFDA 3RM3A 3LP5A 5JASA 2HFKA 4Q34A 2OQVA 4I3FA 1UXOA 2JGLA 2HA2A 4F60A 5AK6A 4DNQA 1EINA 3G0IA 4BTVA 3OM8A 1J07A 1UOPA 1GXSA 5JZSA 4OPMA 1JI3A 2JGFA 1LPOA 2VAVA 5HCUA 4LXIA 3HABA 5E4JA 2D0DA 3K6KA 3L1IA 4OCZA 5AOAA 4G1FA 1X2EA 3FLBA 5ALUA 1BRTA 3EBLA 1BS9A 3AFIA 1J06A 4XVCA 1CUEA 5FPQA 1SCKA 3I2GA 5K3AA 1WHSA 1LPBB 2WTNA 2Z3WA 4G4JA 3KXPA 4UFOA 3R3YA 1Y37A 4UBJA 5CH5A 5FKJA 2WFLB 4Y2SA 4ZGBA 3WL8A 1BE0A 1P0PA 5EGNA 3C6ZA 4DMCA 2PKYX 3QMWA 4CCWA 2QM0A 3EQ7A 2IITA 3QZUA 4DTCA 4PSUA 4BDTA 4H77A 3WWDA 1XQYA 3ESBA 4P08A 3G8YA 1E8DA 1C7IA 2XB6A 2V9ZA 2BUCA 3OG9A 4Q05A 5IH7A 1K4YA 1CUBA 1Q0ZA 3MGAA 5ALHA 1ZD2P 4KR0A 2ONCA 4OYLA 1P0QA 2WIGA 1TCBA 1TCCA 3IUJA 1BROA 4ROTA 4HS9A 1EK1A 4J03A 3WWCA 1Q83A 4CG3A 3PE6A 5I9IA 4GDMA 1CLEA 5CT5A 1DTEA 1DWOA 5DJ5A 1BCRA 1OILA 1XLUA 2XUAA 4IH1A 3H0CA 5E4YA 4HZGA 2HA4A 4M0MA 5LP1A 2WIKA 5LIPA 4QWWA 1PJAA 1DX4A 4FOLA 4Z49A 4X6YA 1O6GA 2O2IA 3H2HA 2WQZA 1LNSA 4TPKA 3PDCA 4U2CA 3C87A 3H17A 1XROA 4WFKA 2CB9A 3BDVA 1FFAA 4NMWA 1IZ8A 3W05A 2GBFA 4XJVA 1ZD3A 4UBLA 5JAOA 1CUZA 5T4EA 2QJRA 5CW2A 5FPPA 3VISA 2FUKA 2HA7A 1ACLA 1NU8A 2WLSA 5JADA 4WDRA 1LBSA 4HXFB 5JIBA 1QIKA 2VJCA 3AJAA 3PUIA 5AM0A 1F6WA 4G8CA 2H1IA 5J3JA 1GKLA 1E8NA 3D2AA 3DOIA 1MX1A 3MVEA 1QFSA 3DQZA 3R3VA 4H7IA 4W1SA 3H2KA 4PQEA 3O95A 4XWGA 1ZI9A 4YASA 3BDIA 1FFEA 3WA6A 1GQRA 2PL5A 5CRIA 4MXDA 4UPDA 1U8EA 2OCKA 4OU5A 1W4LA 3IB3A 3OTQA 3G9XA 4C88A 1XZBA 1ZOIA 1GPLA 3F67A 4KAAA 2B4KA 1TQHA 3W2TA 3BXPA 1WHTA 5LZ2A 4BP8A 1EVQA 2ACKA 1PV1A 6YASA 5K5EA 2EEPA 5ALOA 4J0DA 3IUMA 4Y7DA 5EHQA 4HVTA 1BU8A 3IULA 1UOQA 2C0QA 1R1DA
chains in the Genus database with same CATH superfamily
4CM8A 4GM0A 4JU8A 1VBFA 5BN1A 3WYFA 4O2RA 3L0OA 2AEJA 2ZIFA 2G5CA 3BXFA 2LP4Y 4E94A 2IYZA 5C8YA 2B69A 4QBTA 2ZAMA 2CNNA 3GMIA 1N36B 5G2OA 1Y80A 1Z06A 5F5LA 1PBTA 1IWBB 3H99A 1H9BA 2V7BA 3F3MA 2JANA 2I4LA 3FSJX 3JYLA 5DGDA 2QS9A 1EFHA 3IDZA 3OM9A 3TL6A 5KVCA 2BBWA 2ZETA 4LXUA 2F3QA 2IU6A 1WD5A 4NYMQ 1Y9EA 2O2SA 5FFFA 3TLMA 2FH5B 4LBYA 1AKQA 2B4AA 5DSTA 3QF4A 4QFMA 5JNVA 5K8VA 3LCJA 1IU9A 2JEOA 2FOLA 2WF9A 4M9ZA 1QM5A 4NI5A 4E5SA 1IJEA 2O8CB 4E5UA 2F1JA 4S2UA 4RTJA 4J1NA 3PEWA 4IYJA 2BHTA 3HKCA 2IPXA 3E84A 3VO2A 1YZGA 2OSVA 2O1EA 2ZWOA 2YBDA 4NARA 2ZBQA 4YV2A 1CUYA 1MC1A 1TYBE 1UK6A 2C9ZA 4R2JA 4U7WA 5ALDA 5HK8A 3JR3A 3O26A 1WOMA 5A1TA 3PITA 1PFWA 4TVSA 2MIIA 3H1GA 1QB8A 5CCXA 3BXXA 4MQ6A 2GZHA 3RUHA 5REQA 4WESB 4FQ7A 2QXYA 3JQ7A 3ZHOA 1NG9A 5J2TF 3ZCSA 2ODTX 3IR6A 1M8KA 1Y8AA 3O4FA 3VKGA 4FR2A 1QORA 1L5HB 2UKDA 4R2IA 5FLKA 4DV6B 1FSPA 1NKVA 5B7GA 2ORED 3A9TA 1OIWA 4W5HA 5ADUS 4MYSA 1R9GA 2JAPA 3PT5A 1E2BA 1W1IA 3CGGA 1N4AA 3RABA 4M1YA 1RI5A 5JYDA 3GPLA 3HKDA 3UHJA 3KSRA 3IKJA 5T4HA 4MYDA 3CCFA 5JSQA 4PXAA 3RWMB 4HQRA 4MW5A 2VTBB 2DUNA 2ZZNA 2AHRA 3WDLA 2ADOA 3M1AA 4MI1A 4OHWA 2JA1A 4LK2A 4RA6A 4YP6A 3VYUB 4IIJA 4B2PA 2AD1A 1T3TA 3FWZA 1VLZA 1PGJA 1E3QA 1A8QA 2Q5FA 4J0QA 4QOJA 4ZVNA 4P92A 4EA7A 1FP2A 5K99A 3DFKA 2QZZA 3L01A 5BSGA 1HTTA 5LKAA 4J49A 4LVOA 3A6JA 1N2SA 5LU9A 2JC3A 1OXMA 1YA8A 1NW5A 1SPBS 1V0JA 3DHWC 1WZCA 3J81A 3Q4GA 1MABA 4OJYA 3SYRA 4LOJA 4IPTA 4LRWA 4RCYA 4QDJA 3AR9A 4OLJA 2AYXA 3CR7A 5EEHA 4KXNA 1KYTA 1ZIYA 3DBHB 4MUXA 2DQYA 3GJZA 5HDBB 5SZHB 1QO9A 4A1OA 3I04A 3DOJA 3O8LA 2RD2A 1H22A 1KMHB 4XRRA 2QJWA 3FKSD 5KJEA 3NKFA 1K06A 1X70A 4NX2A 2XTJA 3PGVA 1QG4A 4DFDA 2R48A 2X7JA 2UZIR 1JG7A 1C1XB 2IELA 4OAPA 3LY9A 3QP9A 1NRXA 5LWHA 1OV4A 1A8PA 2XJ4A 3STXA 4NAVA 1UBMS 1C7FA 3AG6A 4PVDA 1OXUA 3CF4A 1JQKA 2EFYA 3G2PA 5G1NA 3WA7A 3IV7A 2UDPA 4IX1A 3T3HA 3HXLA 4B8ZA 1O95D 2WSYB 5GZ3A 1NAIA 3CFYA 5IYZF 2B20A 3L6OO 4KQ6A 2XNSA 1QPBA 1V4NA 4CKXA 4EO7A 1ZVJA 2B7BA 2PX4A 3DR5A 2VK2A 1G7TA 2DUUA 4DIKA 3S3TA 2Q62A 5EIAA 2E21A 3ABZA 3GRZA 2HMWA 3GNSA 1VI2A 2QX7A 3LUJA 1KY3A 1MQ8B 5KYGA 1W5FA 1BRMA 4FFVA 1YC2A 1TO2E 1YB6A 1V7QA 4IRXA 3ZWBA 1NE7A 3ET5A 1PFKA 1JHAA 4GOMD 5CUQA 4NCKA 4Z2AA 4MR8B 4V1CI 1EFLA 1V11A 5SZJA 4MDEA 3QSYA 2J9FA 3L46A 2O1SA 1WXWA 3KJHA 1XQXA 4ARUA 3B1ZA 2H1OA 2PO7A 5EWJB 1ISJA 3HQ4O 4ZK2A 4C4ZA 1KEEB 2R97A 4K40A 4BHTA 4YGYA 3B36A 5HFNA 4C22A 1E7MA 5EKXA 2QTBA 4OIFA 2FN7A 2RG1A 1RKBA 3ETHA 4WEQA 4BQQA 2WQ7A 1LD3A 1HEUA 2C42A 2QV0A 2QTAA 2WIDA 1RTKA 3IILA 2OGWA 3JZFA 1TVKB 1L4NA 3L4BA 1JA9A 5A9SA 1M34A 2GHTA 2XQJA 2Z8XA 3DBIA 4HX9A 1P39A 4TVOA 2AG5A 3GG9A 2EZ8A 2W2QA 1SXJC 2G0NA 3GCZA 3OEYA 1VL8A 4QDKA 1Y4DE 1BHSA 5AJTA 1RD4A 2XY4A 1XQ9A 3TX6A 2PWYA 4V1CA 3QFCA 4MUMA 1YL7A 1KAMA 1BAPA 4S3MA 3I3SR 1NULA 4CMJA 4BXOB 5C32A 3NI2A 3AF5A 4FILA 1RJ9A 2Q4DA 4H4DA 1XRRA 2AW3A 4J6FA 5ALVA 2JGDB 2DEUA 2PGJA 2QIOA 3V1KA 4AQDA 4JZYA 3PVZA 2CHEA 5JFGA 3JATB 2EX4A 2GEUA 2P6MA 2Q2QA 4C01A 3DOEA 4ZOAA 4PC2A 1BVRA 3OE7A 3MJCA 1VJ5A 1CZRA 1K7YA 2VPPA 3EA4A 5J9FA 3G9TA 1D2EA 1W5SA 5AUQA 4FC7A 4FR0A 3H1EA 3ZLVA 3C5CA 3OWHA 3TZLA 2PUEA 1BCSA 4C4OA 3FR7A 4DSUA 3DH0A 1TZKA 1QFYA 4TKUB 1IPEA 2HCTA 3DKKA 5K6AA 4DR5B 1XZMA 2NZUG 2W6MA 1G9TA 1FQOA 3W2IA 1GG8A 2B2XA 2FUCA 2AR7A 5A7FA 4KIFA 2HHCA 3JV7A 3ZD6A 1M1ZA 4RHUA 3IMFA 4PS0A 3JZDA 4U00A 3IEMA 5CH8A 2ILTA 3VHXA 2OBYA 5DW0A 5BWLA 3FPJA 4WERA 1QKJA 5AFSA 4JI5B 2CMHA 2DHQA 3QFHA 4D79A 4EB6B 5FOWA 1GGVA 1AN9A 2ZULA 3QV2A 2P2DA 5GIPE 4CYMA 4J1SA 2ZLBA 2Q2VA 3S2YA 4CG1A 1SCQA 2EWVA 2IZZA 3PL1A 4FYXA 5KKAA 5I3ZA 2RI1A 4MS3B 5IDXA 3RJ5A 1S7GA 4Q9JA 2ECKA 2VA8A 2FP3A 3G9ZA 3T4XA 1BEZA 1L7PA 1IXRC 2PZMA 3K96A 3QU7A 4IJMA 1UZMA 1EXVA 1WXIA 1SU8A 3QHAA 4EEKA 5HUQA 3KYCA 3ZQJA 2DQKA 3GLFB 2RBEA 3HCNA 3R7DA 3PPYA 1ZNZA 1M1YB 3B1WA 2Q5EA 2NZWA 2Q6OA 3QJ5A 4EHBA 1MHTA 2RI0A 4OM7A 3M1LA 4DRXB 4CKCB 3ZDFA 4LHZA 4QYIA 3ZE6A 5BMVB 2ONYA 1JHYA 3MWEA 2VPZA 1WCYA 3D0RA 1NVDA 1RXVA 2F90A 3WG9A 3JAWA 1UIMA 3GDGA 2VVTA 4XQGA 4C08A 4MX8A 4ANFA 4U39A 3KWFA 4S0XA 4MPDA 4R9NA 3PC7A 3QV1A 1BOFA 3CWZA 1Z0SA 1LDBA 1OSNA 1XVTA 4HDKA 1JLHA 1A2OA 1I6WA 3ONDA 2WC1A 5FI5A 1KMQA 2AJCA 2JKVA 1EWYA 1RXEA 1SQGA 1ZBDA 4G1CA 4ZT7A 2Y66A 3SKYA 1DC7A 2YVAA 1QDUA 4AMYA 4GM4A 1E59A 1XFDA 3KT6A 3O84A 4DLBA 4S05A 1F4VA 4P36A 4L07A 3T9AA 2UZ1B 1UPXA 2QMEA 2B30A 3IRVA 2FG6C 2AB0A 1FP4B 4ZC8A 1CF9A 2IHJA 3STYA 4KOEC 2FJPA 5BVHB 2GM4A 1HYBA 2XYGA 4FHEA 2AJBA 5EP1A 3SDBA 3JU3A 3TTSA 3R7SA 1E6LA 2GT1A 3GVIA 1THTA 1T2NA 2R79A 1EP9A 2FN9A 2Y92A 2XXAB 3WYBA 3E58A 1I5RA 3B6JA 1UWKA 1DRJA 4RS4A 3H5RA 3UK2A 4ZK6A 4B1FA 4TZTA 5LU8A 3FXAA 4MO2A 5HQ3B 4IL5A 1ZD9A 3VKWA 1JIKA 1ZH6A 2WJ3A 4QBHA 3PFKA 1YK1A 5ESRA 1I30A 3N2LA 3DLIA 3RTDA 3VR6A 1G60A 3ILYA 4IGKA 1B74A 2GLUA 5LZ9A 4G9BA 4M6WB 5KPDA 1IFXA 4N6OA 4PC3A 4CMHA 3U4CA 2CJWB 2JFFA 4DTIA 2FNAA 2Q4RA 3O47A 1XKXA 4MRMA 4UXIA 4IFEA 3W77A 4D6XA 2J3JA 2P9HA 1CRPA 3FTPA 4Y6SA 5CB4B 4WY8A 3ZVLA 1WULS 2YL2A 2D5LA 3UOAB 4AFNA 1Z8FA 2JJYA 2C2YA 4K9KA 621PA 1FYWA 3HB9A 2P9EA 4IG4A 3Q9UA 4GR9A 3IUBA 2RIPA 3U7JA 4GLFA 3C6BA 2INGX 3GJ0A 4D80A 2IPNA 1XQWA 2C59A 3KQHA 1NHWA 4EUSA 6Q21A 2H92A 3GROA 4QOEA 1EVIA 1QTIA 3B38A 1DINA 3A9CA 3P96A 3WGQA 1QE3A 3F96A 5A5FA 3O90A 4MJLA 3R44A 4H0CA 3KQUA 4Q4AA 4JUBA 1BKDR 3DC7A 3AY3A 1W4AA 1CJMA 3OEHA 4PWYA 1R4ZA 4LYHA 4Y98A 3MIZA 2R6FA 3TLCA 1RWNA 3ANYB 4UZFA 1SRRA 4B83A 3NR2A 2HCFA 1E7WA 3JTEA 3TIXB 2XZLA 3NTQA 4XGRA 3P2YA 2HTEA 4YRMA 5HM8A 4C2TA 2PBRA 1PWXA 2Z98A 3MBIA 3WWPA 3B6IA 2E4AA 3BSYA 1ES9A 4TWBA 3SYKA 2POCA 2UAGA 1EFAA 1R4AA 4ADSG 2UXBB 1TD1A 2AA3A 3IALA 4N9QA 4BQSA 4CMEA 5KTSA 1OI2A 1J49A 1CQZA 1KI8A 4XUEA 4AY4A 4YMVA 5BYJA 4CCYA 5IG2A 1XDBA 1WD7A 1ZICA 1Z16A 3BMQA 1V35A 3NEAA 5H9VA 2V9CA 1KOJA 4XYMA 2ZS8A 4UVIA 2GAJA 2PMFA 4P3OA 3ZHBA 1S96A 2I7VA 5CLQA 5TX7A 3RB8A 5A5GA 1RU3A 2OHHA 3GJSA 1U0JA 4HH1A 2ROQA 3PHCA 4I1IA 4M87A 4QVGA 3RVNA 1E2EA 1OJLA 4UKDA 1IN8A 1H4VB 1W1UA 4S1PA 2B0CA 3Q88A 1J09A 1TKCA 3VR4A 4QUDA 3RRZA 4EYQA 3ELBA 3QVXA 4JB2A 2OAP1 1FCJA 2BH9A 2GJKA 2QRUA 4D4MA 4ZV7A 4JT9A 2IE0A 3GZNB 4OJMX 1J5PA 1FTWA 3E4CA 1JT2A 4A27A 3RTEA 5LQRA 3LC2O 3UJ3X 5HJ5A 4K6HA 3H2JA 3QVVA 1OX6A 2B35A 1YB2A 2IEIA 1LW6E 1ID1A 1P2BA 1VYHA 2IEDA 2JK0A 2KLBA 3DYIA 3KZNA 3OEED 3D6JA 4JT8A 3PC8A 4B3IA 5EMHA 1XRSB 3VH1A 1X7XA 2Q6TA 1OX4B 4RANA 4H31A 3KCNA 2BBTA 2V7PA 4NS4A 1VJCA 4CHGA 1P6UA 4R83A 1AT1A 1NVAA 2H0RA 3AUYA 4EH1A 4QHSA 2BMDA 4Z2YA 1MFPA 2X0NA 3DDOA 5DHSA 4MV1A 4NFYA 4NONA 4Q3LA 3LY8A 5I9LA 4MYRA 1LBIA 4HZUB 2DM6A 2B8EA 2IYUA 4PLTA 5CYOA 2QMOA 1R6XA 2ENWA 2IFTA 3O94A 2FMHA 3OQPA 2C58A 5J2UB 1YMVA 2CZGA 3RUDA 3J81k 2WU4A 2ORIA 3D7SA 5AJXA 3ZZ1A 1DIHA 3V1MA 2DULA 2CXOA 5EMLA 2J9XB 2RKWA 3RRMA 1TCAA 4WKPA 6REQA 1VGQA 4BE4A 2COKA 3AF3A 1Y6FA 2CL6X 4BGEA 3I2HA 1WZNA 5ELXA 2YASA 3ZJTA 1CNMA 1JHOA 1JQJC 3PEEA 1L7XA 3N28A 2CNKA 5DXFA 3S44A 2J7PA 3HBJA 4PSDA 3GQBA 4CBVA 4BEWA 2YWGA 1P73A 1FVHA 1AV6A 2IS6A 2QMYA 2VUIB 1YIDA 1EA5A 2OBFA 5IT9A 4R5MA 2CMFA 3H2SA 1L4FA 1LS1A 1UFOA 3OAAA 3PUXA 1PD1A 2O7QA 1CJTC 2B83A 4X1IB 4QPPA 4D4HA 5EHZA 5KTPA 5CLHA 1KZHA 4RGVA 1YZQA 2FWIA 3C6QA 3TOZA 3AR2A 1EYZA 2PUJA 4RJKA 5G0TA 1ORDA 4A8HA 4EJSA 5DM4A 3IESA 1UINA 3VSAA 1DRUA 3NT2A 5HF5A 1OU4A 1N2EA 2QVZX 4FFNA 4F91B 1DHTA 1FPQA 2JCSA 3EGWA 5EKDA 3ZWMA 2Q6IA 2D1TA 4RLHA 3NDJA 2NP7A 5F7JA 3PD0A 3EVFA 2HMUA 2ARKA 5D1NA 3H9EO 1GNRA 1Z33A 3PRYA 2GM9A 2HV8A 2BKXA 1G4UR 3GGSA 2FI1A 2XXJA 1EUYA 3MTEA 3OFND 3DLHA 3A70A 5T67A 2OT3B 4QL3A 4OSEA 4A6PA 1M2HA 2DETA 4YFVA 2O2YA 4ZD6A 1OKKD 2W93A 4HDNB 4NU8X 2EW1A 1P2DA 2A9KA 3RVMA 5BMVF 3AF6A 1SUDA 4ZCSA 1ACMA 4JVOA 1DC3A 2DUWA 3PBKA 4EHAA 1JG2A 3PF9A 4QG7A 4RWEA 4XTCS 3LUDA 3N70A 5DYWA 2ADFA 2AOUA 4A7PA 3KVNA 3LX5A 1QOPB 3CRMA 4GQIA 3FWHA 2VP0A 4R7ZA 2Y68A 1FMJA 4Q1EA 3K2QA 4LXHA 1XTBA 1ZKMA 1YGYA 2CWDA 3PK0A 3OIFA 1EWVA 2O50A 2CCJA 3SF0A 3NHBA 4F1KA 4ZTZB 2PCLA 1W46A 4EGFA 4IBOA 5JU6A 2Z9CA 1TLFA 4II2A 3IOBA 2VIIA 2PD4A 4LJYA 3EZNA 5FLYA 1AUXA 1LWNA 4C89A 1DKNA 4AI6A 2TRSB 1EB9A 3KUXA 3V3TA 2GN1A 3ML1A 1VPEA 2WJGA 4Y1GA 3W7BA 2FR0A 1ECFA 4FS8A 4MKXA 2VNIA 4E5NA 1JR3A 1U94A 1MOZA 2AN5A 4DMFA 3NIBA 4OFWA 3A27A 3N53A 4LKOA 4ZVLA 2ZT5A 2QRMA 1DPFA 2PVCA 3KT3A 1FQJA 1LVHA 1U2PA 1VRWA 3TQOA 1PZFA 2ZTUA 3EJ6A 3FNIA 1W5EA 5E6RB 5D5HA 2Z2XA 5B7QA 1X87A 2XIQA 3MS7A 4FOTA 4HWGA 3UWDA 1Z37A 3HC7A 3QWHA 1T1JA 3HCCA 3PWKA 3QLVA 3CH6A 3ZHCA 3NGLA 4DIUA 4X3CA 3WNZA 3CF0A 2OQ2A 4O2BA 5E8RA 2B61A 4IV5A 1N57A 1VBKA 2GJSA 2WF6A 2DSNA 1E9FA 3A4IA 3H11B 4ZQEA 5TJHA 3Q87B 1YV9A 4EKNB 3WGKA 1ZGJA 1U8UA 1B4DA 4EGSA 1H0KA 2Y0EA 3S7TA 1ARZA 1O6ZA 1N2XA 4D02A 3AKZA 1TM5E 3IQIX 4Q01A 4F2WA 4GX0A 2DERA 2BFWA 1RBMA 1P7WA 2ACVA 4NBLA 4CMCA 4DCOA 1F1JA 1WABA 1TAHA 5EJ7A 1D1SA 3KOZA 1KPHA 2GHRA 3KTDA 3QUQA 4N5HX 1WPGA 5EWLB 3PHBE 4L0DA 5CVDA 3T3DA 4RJIA 2LGJA 4BVHA 1ZR4A 5CDGA 2BM8A 3UFXA 3ZV5A 3EXFA 1SNYA 4ITRC 2XE6A 3EF3A 4UFNA 1HE2A 1EFVB 2J5RA 2OORC 5F64A 2JATA 4Q7QA 3D3WA 1NXPA 3ZD8A 3TLZA 4RORA 1RAAA 4D99A 1P5HA 4AWXA 4D0GA 2VSYA 3SP1A 4BNWA 1NI3A 2CHFA 3AI7A 3A0RB 3BE5A 4ESEA 3PEFA 3H5VA 4F9TA 4MWBA 3GVCA 3TZKA 3RS7A 1C50A 1U3UA 2FK8A 3WBKA 1B8OA 5B1HA 2IZ6A 1N4DA 2GCIA 4KQCA 4CMIB 1SIUA 1EBUA 4NEQA 3WGGA 1UMKA 3OUZA 2RGAA 3CPJB 1KVUA 3L04A 5FL7D 3FDFA 4DCUA 2XE7A 4CLRA 1NUQA 2AI1A 3QU2A 1N9GA 4AMGA 4U4AA 5EOVA 4AF8A 1Y4SA 5EZYB 4F9EA 3AB3A 1C3VA 1D5CA 3WVNA 2AH5A 1X7GA 1ONBA 3LDUA 4AG3A 1NQUA 2Q0QA 5E6SA 2EFJA 3IAM6 1JW9B 5AOVA 3KEMA 5DBEX 3KRTA 1BHJA 4MW2A 3LNTA 5F9FA 4EZIA 3ASZA 4O1MA 5DWDA 4EGAA 1U2EA 3QPWA 4CKEA 4TWIA 1Y8CA 5LJLA 5KDDA 3BQMB 3LI2A 1BMTA 2O5RA 4EYSA 2B4RO 2YCLA 3ADKA 3P0FA 1FS5A 1YBFA 3ZPXA 1DDOA 1XRQA 4XARA 2J6CA 1EFCA 1P9WA 1Z3CA 3Q7SA 3WIEA 4A5SA 1DXQA 3L6BA 4IKEA 4OKSA 4UDXX 4DCVA 2GB4A 3FPGA 3BL8A 2PK3A 3CZMA 3PUYA 1QLHA 3C3WA 3RLFA 3ND9A 5EP2A 1TZCA 3I92A 5EAIA 5LVAA 1KWKA 5EXXA 2XUFA 2M6SA 1L4LA 2ZR0A 3AY6A 3MUEA 3VNBA 3L2OB 4JLNA 3EAQA 1YQWA 3W8EA 4MB0A 1PZNA 3ZQ6A 4BMZA 4ER7A 2GBLA 4MSUA 2VHYA 1P8JA 5FBLB 4EHNA 3V1NA 1BQ4A 4GOJA 1COZA 1PNTA 4CMGA 3EAFA 1R12A 3GPBA 3NPAA 1LQTA 5FTWA 3TUZC 2B36A 4ARZA 5I9SA 1KZ6A 4UUQA 4YJFB 3EIHA 5JAZA 4RPGA 2OCPA 1D6SA 3F5QA 4EMBA 5JISA 1OAAA 4PICA 4E7PA 4IZHA 5J2UF 4YAOA 2L42A 3HZOA 1Q74A 4LOKA 3TRKA 2B0JA 3GLGB 2AEFA 3A4LA 4S1VA 2OGZA 2Z2JA 3RQIA 5TT0A 1ML3A 1K5GA 4CWAA 3C70A 2NZJA 2RDMA 2CFSA 3TCNA 1W93A 3T7DA 3G0OA 5B3JA 1PR1A 2FETA 3M3DA 4EW1A 4K03A 4UAVA 1XNJA 2F00A 2VFAA 4GZLA 4N0MA 5JEDA 1VJTA 5KDLA 5C1OA 1LPAB 2V7XA 3UG6A 1O96B 3K05A 4K9OA 2Q6KA 4BB0A 4OQDA 2LTAA 4B7XA 3ZR4B 1Y8RB 3DE2X 5YASA 3VOSA 5IBCA 2B3DA 1K6EA 5AHRA 1VLVA 1MB2A 3LKVA 3TPFA 5B1DA 4JSTA 2NM0A 4UAUA 5HVNA 2B4YA 1F2UA 1J2YA 1FFSA 1PWYE 5E0KB 1Y1TA 1MO4A 3QXJA 3V7FA 1NI4B 1VCOA 2ACEA 1GCIA 2BEVA 1I3NA 1ISHA 1CEYA 421PA 1XHFA 3EGOA 4DV1B 1W96A 2VTEA 5HE8A 2NVUB 2BSAA 4AN4A 5LZ4A 3FGPA 3O7MA 2SCUA 3O8NA 4P4SA 1GNSA 4U02A 2AXQA 3V4RA 2F9FA 2ISSD 2NT4A 3GA5A 1DCMA 2ZBDA 1O95C 1RDFA 4XOIA 2VF2A 1G2QA 2WUDA 4GMGA 1E60A 1U0EA 4YP7A 2AKEA 1UEXC 1KO4A 3GLIE 1V5WA 1NBEA 2ATCA 4HF7A 4CHTA 3WZMA 5GJVC 3GXBA 4GC5A 4FYPA 1QHFA 3ONVA 4YRRA 1E2MA 3AK4A 2P11A 4NY1A 2BZ0A 1YRHA 4ES6A 2CLIB 2YW9A 1I2DA 3ZDBA 2CV0A 2CHVA 1HEYA 1GV1A 1GO2A 1I2BA 1WMSA 4KUHA 4Z86A 2QSJA 3SY8A 3MMZA 1RKVA 3HPRA 3EGDA 3MZ0A 4RYLA 4W5WA 3SHOA 2VRCD 3KJFA 5B37A 4CV3A 4C04A 1E2JA 3H9UA 1FXWF 4RL6A 1YDGA 2AI2A 3NB0A 3U1TA 2HMVA 4JIGA 1HQDA 1QPGA 2HLHA 3BE4A 3ORFA 3F73A 1UC8A 3DL0A 3K94A 4MICA 1ZHFA 3NFYA 3RU3A 4QYTA 4E5KA 1B8PA 2A58A 2V0CA 1U1DA 5F52A 4KSCA 1SCNE 2RCNA 1X1QA 1E99A 3JASA 5TARA 4EMUA 2EYQA 3MT9A 4V3CA 2V0NA 3DFUA 3RGGA 3RSQA 4UVEA 5K8TA 4WJLA 3EXIA 4QICA 5LD2C 2P1DA 3IXLA 1AUPA 2PBFA 3QEKA 5CB0A 1P2SA 2ISQA 2QN2A 2ZI3A 1FY2A 2E4XA 3WLLA 5JMPA 3ZWPA 4B2LA 3PI7A 4IIBA 1DXHA 4B3JA 1TE2A 3KB1A 3KC2A 4IH9A 5C8DA 5H3HA 2X8JB 3FETA 3GRCA 1KDYA 1RPZA 2E48A 1L1RA 5E8JA 4G01B 4OO3A 4MCIA 3U4GA 1EAMA 3EC7A 3Q6MA 4KVGA 1KE2A 3UANA 1DJPA 4R6WA 2G9UA 2PLAA 3TLJA 1ILWA 1U9YA 2X19A 4BWYA 2NU7A 3W79A 3F9CA 1JF8A 2XCLA 1T9AA 2VZLA 3MGCA 2FSVC 2GN6A 3O2SB 3AKDA 2X0EA 4R69A 2X2EA 3HSKA 3STUA 4QDUA 3E3AA 1QZUA 3GFSA 5TPWB 4E11A 4IMJB 1EX6A 2WYUA 4RY0A 1TDJA 2ZKIA 3LOQA 1PV4A 2YHIB 4LYYA 1DJQA 2VRNA 4GI7A 3G9UA 4PIVA 3WLHA 5H3LA 4NXMB 3VYTB 5ABPA 1ZIXA 4S04A 3PLNA 2YMMA 4J2TA 1ADJA 3ZOZA 1QVZA 2VXYA 1WDMA 4JGBA 2ZATA 3K7EA 5AVTA 5HKKA 3OF5A 4G63A 4ZDJA 4G1EB 3FTFA 3AW8A 1NP6A 2V97A 1OR8A 3C4JA 3IEPA 2WTAA 3LXMA 3DLBA 1FNSA 3HCAA 2ERXA 1Y82A 1E0AA 3IQEA 1KGDA 4ZWNA 4X6XA 5JXIA 3NJ4A 2RAPA 1Y4AE 5BMOA 2PFGA 2ID4A 7AT1A 2H4FA 4C5AA 3MRSA 3IKMB 5HNKA 1ESDA 3ZH2A 3BCSA 1N32B 4N7MA 1OGJA 1Y5NA 4GX5A 3RIXA 2FN8A 4ZRNA 2PRIA 3PIDA 4RVDA 1TD9A 1X86B 2WB2A 3UAWA 4B6FA 4EI7A 5JUWA 3G0GA 1MN6A 2XA1A 4FZ5A 4Q6WA 1EAYA 4YCDA 2O57A 2EX0A 2OE2A 3D3NA 3WS7A 1QHSA 2XDQA 1F8FA 1M2VB 1FLAA 4NK5A 4DVGA 4N0PA 2H31A 5H70A 3S5UA 4D6YA 3ISTA 1G2OA 5LSAA 1ULHA 2G1PA 1N6OA 3N7TA 1IHYA 3HB7A 2BGJA 2IEYA 4RE6A 3TN7A 4Z6KA 2WWYA 4MP6A 5HP4A 1Q7BA 3DZHA 4X97A 4DSTA 2YYSA 2M6RA 1W35A 2H07A 2PWBA 1N8SA 2R4TA 3IOYA 3NKLA 3OQNA 5CT9A 2VDKB 4YAUA 4YRNA 2C3OA 2YIDA 4X6LA 3RC3A 5ALJA 3MJEA 1Y1PA 1X3SA 1E94E 1PWHA 5BUZA 3PGKA 4P4NA 4BNGA 1IEQA 5LNK6 3WFJA 2YJTD 3AESA 3UW1A 3NDBB 1PYOA 2Y77A 4YS6A 1ZIPA 4MRNA 1NMQA 2BTQA 4JP5A 2LNDA 4W1RA 2NUPB 3DHYA 4C07A 2OZPA 4KO8A 5AM1A 1NLFA 2YHSA 1FU8A 1WPQA 1KBQA 3AFMA 3G5LA 4N9WA 3OA2A 2MMGA 3K0CC 2OKCA 4WEOA 1VIMA 3EBPA 5C5IA 1R37A 1QYCA 2MYNA 2O7SA 4BN4A 1LQUA 1TM2A 2BM9A 4CL3A 4JI1B 1GCOA 1KEWA 5KHAA 3T15A 1OYWA 5DF1A 4NL4H 1XLWA 2HWUA 3BFPA 3I6IA 3MB5A 4MRSA 3PQ6A 5LQSA 3RR2A 5AQ1A 4FE4A 2OQIA 1P61B 1F9AA 3MTDA 1I5OA 4IXTA 3PQ4A 4LDAA 4ZT5A 4FCVA 3VSEA 2E2WA 3OHMA 2WY2D 1TJ5A 1A82A 5JLJA 2ALJA 4HB2A 4L78A 2I6SA 1WX1A 1NONA 2CVPA 4IY1A 3VU9A 5C31A 5JSZB 2ZZKA 2AT1A 3M4NA 3SOZA 1UANA 1B26A 1ECGA 2AVDA 1UJMA 2YHAA 3GDHA 4KBYA 2NUBA 3D2CA 4F93B 4P0QB 1FDOA 1N0WA 1Z07A 2BV3A 3SQWA 3AZOA 3HWRA 3ZGNA 3AR4A 1AN0A 1TO1E 4TL8A 2KLHA 5HSGA 3NGMA 1KFEB 4D57A 3IJEB 2YTZA 5EESA 1I3MA 1NXTA 2EKZA 3VH4A 4AO6A 1FX0A 4CLHA 1XBTA 5ITVA 2VDWA 1KU0A 1WMFA 1ATZA 2C4NA 2OM2A 2QPTA 4ZQGA 5C80A 5EMJA 4B3RB 3NW9A 1OIVA 3W34A 3L02A 1R18A 1DJNA 3MLAA 3NEPX 4Q00A 1U3GA 2GYVA 3BHMA 4Q1AA 2NPIA 3KO8A 4WXHA 3UICA 4AZ0B 4N1AA 5DO9A 3R8XA 1EXDA 1QGDA 3NM5A 3ERCA 2G63A 4EO4A 2XVMA 3UMSA 3WLJA 2VCYA 2B6HA 2H4HA 4PLWA 3GCGA 3UMFA 3ZE9A 2AJ8A 3O8OB 4P5EA 3WMGA 2XZTA 4GKVA 1JKFA 4DIOA 2LV8A 3UJ8A 1CR4A 1T9BA 1JLLA 2O05A 3MEQA 3T3PB 5F2OA 4CL8A 4TZ6A 2RK4A 4NULA 1FP1D 2P6RA 3KAQA 4R2HA 2XTMA 4JYCA 5K3FA 2WHEA 5NULA 3U17A 3GLIA 4P58A 4LZNA 4DZZA 2BSQA 1SOVA 2DWUA 5HBRA 3KQSA 3K4PA 4QT0A 5A0FA 1IOWA 2IHBA 1C1DA 1U4NA 4URUR 3W3AH 4Z8YA 4ZCIA 3QH4A 4GRAA 3MJHA 2VTDA 1PS9A 2NSHA 1Z6AA 3EVAA 3IDFA 3WHPA 2X86A 1XEWY 2AX4A 1V7ZA 4IGAA 1VRVA 2GASA 2MR5A 1SVIA 1F8UA 4HK4A 1D1PA 2QN8A 3I09A 4HL6A 4MYCA 4R9UC 1W1WA 4C7OA 1Z9BA 3PNPA 3IC5A 1LLCA 4HMOA 4K6MA 2Q7OE 4CFZA 1NXSA 3IQXA 1B15A 2QTVA 2IEAA 2G04A 2ZXFA 4FDLA 1N92A 2H9YA 3HK2A 3KPWA 1VPDA 3EVBA 1E61A 2IRWA 1NOIA 2XWPA 4Q82A 1Z83A 1WB6A 2DBQA 4RCVA 4ZCQA 5C81A 3LLCA 1MA0A 2NPFA 3K4QA 2ZIEA 3SIXA 3R74A 4NTZA 3WAJA 3UV3A 2XDAA 1XCGB 3AUTA 4ON9A 3TMAA 4DV4B 1U1CA 4BVLA 1V39A 2X5KO 1RAHA 3HMQA 1KDRA 4ZRDA 2CZCA 2I62A 4H59A 4DHWA 1IMOA 1XZAA 4G5SA 2EJBA 4GG1A 4K81B 4WKGA 2Y71A 3FR8A 4UD6A 4XE5A 3UMCA 4EAQA 3DT9A 1PR9A 3NV7A 4KH0A 5ICEA 5TGDA 1S3IA 3FAKA 1IY2A 5DHAA 1PO7A 1J2TA 4QWMA 4X00A 1H8EA 1VKOA 3F5MA 4HN9A 1JAXA 1CVIA 4P35A 4Q3NA 4YCNA 3RROA 3O1JC 3ZNQA 3CQ9A 3PNBA 3IEKA 2PGDA 4XVHA 4C2AA 3WO0A 4ZV4A 4KIGA 1YHZA 3ZDXB 1IUOA 2OWEA 5HZHA 3DBLA 4QUKA 1AHPA 3AEUB 3FWKA 4FFRA 5HGJA 3PD7A 2QRZA 1XZDA 3R6DA 5G0UA 1QGUB 2XITA 1XJWA 2XNDA 2O23A 2V0GA 2BEUB 5CD9A 1Q22A 1GN8A 4PHTA 3OWOA 3QVMA 1KDZA 1OHHD 1R0YA 3IA2A 3BIXA 2PE5A 2I3ZA 2HV9A 2C03A 2VEDA 4FQ8A 4H7HA 3JCZA 3HP4A 2FWRA 3F8WA 3CSDA 4P93A 2HL6A 3G89A 2G0TA 3OHPA 4UTOA 1IJFA 2IOHA 1W49A 1ZRSA 4CEJA 1C8KA 1LC3A 5DYYA 1DCFA 4P3NA 3E0XA 4X94A 5IJ0A 4RPHA 2Z6AA 4WXRA 3HXTA 3I12A 2M6LA 4DQKA 3HCFA 1CQWA 1TFRA 2J59A 5KJ1A 4EG8A 2BZ1A 4QGAA 2O3RA 4GOXA 3OTOB 1UMBB 4D2IA 3CG4A 1HT0A 1CQJA 4QATA 1C9MA 2ZE8A 3NGXA 5TGTA 5G53C 3VVLA 5KJFA 1SIBE 3KQPA 1JWLA 4OBBA 4QOSA 3W3AD 3H2BA 1ZMXA 4ZI3A 1CJSA 5BORA 3GLVA 4IFBA 1G21E 4KJZA 2AX3A 2YFQA 1UZNA 4DLSA 1QIJA 3WDMA 2W8BA 2H51A 2G9ZA 4UM8B 5FUMA 5BW8A 2D5IA 2GMWA 3MYYA 5A9RA 1RQXA 4HAVA 4HWKA 2WWFA 3WMWA 3DQQA 1V5IA 4WWHA 1RYYA 3DKRA 3QWAA 4ZANA 1UP7A 3PGMA 1GGKA 2AN9A 2QG9A 5DGCA 3MOIA 1NR5A 4WXYB 3THXA 1IIRA 4HOYA 3I58A 1LWOA 4OSPA 4BVFA 3SM3A 1ORWA 2HN9A 1PW7A 1EFTA 1YXMA 4IDGA 3ZN2A 4BBJA 3G0HA 1B1CA 1T36B 3TTWA 4QBKA 4CF7A 2WHQA 4UHEA 2X6TA 4JEUA 4NOJA 4NCAA 1GYQA 2F3SA 2J85A 1RI1A 2XA2A 5LYJA 3SJBA 5B4VA 3O75A 3TYXA 5FLXA 5CIWA 2HF7A 1UJCA 3LBAA 2FLKA 1ENOA 5EC8A 4DT1A 3RRXA 1XK6A 2VBCA 2RKBA 3ZVMA 4JBYA 4B84A 2WDZA 3VJMA 4ZICA 2FZKA 4XKJA 2IX9A 2OLJA 2JFHA 3NOQA 1P7CA 1XR3A 3IIJA 1CFJA 2OHJA 4B3SB 5TT1A 2PL9A 1ABFA 1T9DA 4GPTA 3CUUA 3QFFA 2AZTA 5B12A 2HMYB 5F9HA 1RCUA 4Q9NA 1H9CA 3LWNA 4IVPA 4RFVA 3TLXA 1SBZA 3CCCA 2RJOA 3B6ZA 5L4LA 1DLIA 3VR0A 4R8RA 2XYVA 4K0RA 5G4KB 2AR9A 1HT1E 1PQWA 2RJ3A 4KQGA 3I42A 2P5UA 2FWAA 5AK5A 3TBFA 4M37A 1HK7A 4D56A 5BUQA 2J31A 3RSFA 3LVBA 5GVRA 3ICVA 3NHFA 4WZBB 2J46A 2JIPA 5FWDA 3RC9A 1W8IA 1U0LA 1WU7A 1L4KA 2N1MA 2GQ0A 2PZJA 4AG6A 4LDNA 5JJCA 2C94A 5J4KA 3WK8A 1U7UA 4JN6B 1VI5A 3VH2A 1L4BA 4AW9A 1CUFA 1G4AE 1K8QA 1VPVA 1SVNA 3QVOA 4RD4A 3CMCO 5LYYA 3I5MA 3VQTA 1E3MA 1N2CB 3DDHA 4BLRA 3O82A 1G8AA 1LPSA 4PC7A 2QJFA 1F3OA 3SYNA 5KNDA 3DLPX 4CIWA 2A0KA 4K9MA 2QKYA 3RAFC 3TQQA 2NYUA 3I6YA 1AKUA 2GZSA 4XD7D 3PENA 3WYCA 4L51A 1SUIA 3SR0A 1KZGB 4IDOA 3BRWA 4TTSA 1NV8A 3MERA 5JWOA 7ABPA 2WJYA 5KKCA 1SKQA 4Y9DA 1M3SA 1GFZA 5E1DA 5IANA 5HGXA 1HG1A 1TF7A 4JHXA 4BU1A 1KI3A 1WIWA 2OKGA 1OLUB 3CLUD 1O9BA 4DSNA 1Z63A 1V9CA 4Y9SA 4I50A 1K1EA 1YR8A 1T6BY 1TC2A 1XK7A 4EHFA 2JLBA 2HHJA 4QDZA 5CLFA 1LZLA 4HAXA 4IXMA 3DB2A 1ODSA 4CEIA 4XD2A 3IAUA 3L40A 2AL7A 1NJFA 2PGOA 4MR9A 1C4OA 4YO8A 4B9EA 4GVLA 4YMUA 5JNUA 4B4OA 3THYA 4C4XA 3U1BA 3MCVA 2DUJA 2X8AA 1M8FA 1W2WB 1CKEA 2CJYA 3KLMX 4DKJA 3O8QB 4C2UA 4ZDWA 4RLSA 5ERGB 1HKUA 1TLLA 5JRDS 2HGZA 1ZEMA 2IL1A 4JUDX 2PHZA 1Q7CA 3FF1A 2FPGB 4D3DA 2TMKA 5LA6B 5KJCA 4RPLA 1OBVA 2ZBPA 1GTMA 1E4VA 1ENPA 3O3MB 3PFHA 3QXSA 5TE9A 5L53A 1Q11A 2DTEA 4EHLA 2HJWA 3A4NA 3E3NA 3NTRA 1GYPA 1T6NA 1D6JA 3E53A 1GQFA 4Q37A 1MQAA 1OOEA 2A88A 5UKDA 2FUG6 1L7OA 3A1EA 1QV7A 1JILA 1X39A 4IIUA 3ETDA 2E5LB 1VRCA 1SU6A 4UQPA 1YVUA 5CYGA 3AEKB 4RSHA 4IG9A 2C1EA 1DKOA 3RK1A 3LYHA 2ETXA 3CPSA 3JQAD 5FD8A 3RE1A 2VWQA 3UJAA 1XAGA 3AFOA 1SBCA 3CS3A 2B99A 4ND2A 2VAPA 4NDAA 1G8FA 1YB7A 1YVRA 3RHFA 1SD1A 1WF6A 1WV1A 2AC2A 5C0OE 3SQMA 3WK6A 1G5TA 2LUOA 1NVKA 2RGWA 4WADA 1GA6A 3QSGA 2FPOA 4F45A 1ULSA 2GKGA 3D43A 4GIBA 4Q3OA 1NXVA 4AECA 3WGHA 2NYVA 5CHEA 4RWZA 4C0BA 3PC2A 2J1LA 3NEJA 1FU4A 4GYKA 5LXTB 3BJRA 1PL7A 2BEWA 4QTYA 1H9AA 2C04A 1O97C 4Z53A 4YHBA 5BR1A 2ECOA 2XB2A 3HJAA 3DCJA 1WY7A 4K28A 3U4AA 4BIMA 4BQFA 1DEOA 3ZGVA 1YTLA 3P9SA 3AL2A 4LXTA 2C8LA 1T3GA 4CFSA 1UBGA 3GF4A 5KWIA 1BWPA 1EQAA 4LNUB 3WGIA 1E69A 2JGKA 2RJNA 1FJ2A 1U6JA 1WDLA 2ACWA 2NNLD 1T4CB 2XRMA 3LVQE 3L0PA 2GILA 4KPUB 3LWZA 4XGQA 1EKXA 2A6PA 1R8QA 2P7IA 5K05A 3O0TA 3H86A 1GPDG 2ANCA 4UUNA 1IHDA 1I51A 2G77B 1Q91A 3IE1A 1WR8A 2HIMA 3KE8A 4GUAA 3N8DA 4CT4B 5HRUA 5I5GA 5B3LA 3WNVA 4U2GA 1Q21A 2O0KA 3R5HA 1IHUA 4INZA 3Q8WA 4LHEA 4KKXB 3T7JA 1W85A 2FPUA 4FTWA 4CG2A 2C5LA 3FVVA 3UMBA 4JQCA 4QM6A 5HK9A 4XLTA 3C8MA 3C3CA 4UTVA 3UGJA 1JDPA 3TVTA 2BGKA 3LSYA 3IKLA 1SIOA 1A98A 2QX8A 1VECA 2RHHA 4DIFA 1VDZA 4K9SA 4EJ0A 1XUOA 1YBVA 4YA6A 4J8PA 4UUAA 4A16A 2VUSA 2VJDA 1AX9A 3AR7A 1A0OA 1F0PA 2JI9A 1D03A 2ZSEA 4PTZA 4G3XA 1ODIA 1R00A 1TO6A 1JVBA 3IO5A 3NTLA 4QFCA 4DLWA 3L7AA 3K8OE 2WZDA 1T15A 3H5TA 3M49A 4L4YA 3SHTA 4GLJA 4C0XA 1N1DA 4O1IA 5DM70 3KAJA 1GL3A 4JLAA 3EEIA 3OZBA 5JVDA 3CKKA 1X7YB 3WIOA 4ZI7B 4E08A 5DCLA 2XH8A 3NPMA 2MINA 4H60A 1G5FA 1JPVA 1LB1B 2VT3A 3A1FA 4KNWA 3X1ZA 4TLMB 4OK6A 3NATA 1H2AS 3RHTA 1S5PA 1I4TD 4U7HA 3GP8A 4S0ZA 2I2AA 4Q9KA 1G59A 1RQNA 2GYUA 2GZ3A 1LSSA 1ODCA 4KWEA 3CX3A 1CY4A 5KHOC 3IKVA 4FGZA 2VZ9A 4OSOA 1LJLA 1KKMA 2YW2A 4Y2PA 2XGJA 1Y4UA 2W90A 1IQPA 4LC0A 4ZQCB 1UBOS 4DJDC 1V5FA 2IY8A 4MLDA 1UKZA 2OQRA 4TRRA 4QTZA 5L7WA 2YJNA 2FVXA 4ZAFA 1XYVA 2OB2A 2Q9UA 1NSYA 1LEHA 2NU9B 1MVNA 3SNHA 2JAWA 1YRAA 3Q5GA 1TUGA 3KM0A 4XVQA 3S81A 1GZSA 3DT8A 1SJ9A 2ADMA 4EBBA 1NW8A 3H83A 5AK4A 4RHEA 1K8RA 3D7LA 3TXXA 1KPIA 2HU7A 1BVYF 1JDUA 1Z22A 1O4WA 1T24A 1ZM3A 2ZIUB 1P1FA 3KKOA 3LP8A 1Z5UA 2AFHE 5EXPA 4DLYA 1U7OA 1EFUA 3A05A 4P54A 4AK9A 2VOEA 4X84A 3SHVA 2YQZA 5F4BA 3CJRA 1N2OA 3JRXA 3LFTA 4V0LA 5CA0A 1KO1A 3GEGA 4GYYA 2FRDA 2OLEA 4UBNA 5DLPA 3I5XA 4L85A 1XTZA 1NPTO 4TROA 4ZVTA 1M10A 4Q02A 1U3VA 2PKCA 3CRVA 4DQDA 2H8GA 1QHHA 4M0CA 2J0SA 5BSRA 5HKBA 4M1QA 3EWAA 3RRNA 5HJ7A 1DKQA 2R8PA 4G89A 3WB9A 3OC0A 1NRJB 3ETGA 4IH4A 3A9RA 8MHTA 3CRQA 1S2MA 5KYNA 5DVZA 1Z4KA 1B93A 1WCIB 3ROGA 3NJRA 3RJZA 4F86A 5KBYA 5LC1A 2EQAA 4E09A 4KXXA 3UF0A 4R01A 1BXGA 1NDUA 2WZBA 1S8AA 4OM8A 3K8ZA 1E1RD 2ZRMA 3ZBUA 1GT91 4KYTA 4UU1A 2O0HA 3PGJA 4F4JA 5GJCA 1EH5A 1OXVA 4QAQA 2I80A 2XT9A 5DYTA 3N75A 3X1WA 1FJGB 2Q8NA 1U2DC 1Z08A 2PLNA 3EGVA 3LT1A 5KMGA 3CLVA 3KJIA 4YQFA 3W2GA 1PVDA 2H57A 4MEJA 2I99A 2IODA 3GD5A 5HUHA 5CITA 1FQWA 1VKZA 1PD0A 2WI8A 2GPTA 4JGIA 4DA8A 4O3MA 1NSTA 4QFDA 4ZC1A 3N6XA 2LR0A 2BHLA 3MJVA 3PDWA 1E63A 4KI7A 4PLCA 3K1AA 4TYYA 4LVNA 3F98A 4BNFA 1Z68A 4BNXA 4UZEA 1U9IA 1KXZA 4NOKA 4QC2A 2I3DA 1JG6A 1RKUA 3AP1A 3F9RA 5BN5B 3WLTA 5AXBA 1OFUA 4EY8A 3DW1X 1JMYA 5DTRA 2OPHA 2XTAA 4PNHA 2I6XA 5BN3A 1KERA 4WBNB 3A1NA 1AZWA 1E58A 3IEIA 4QD3A 4P7FA 3JQ8B 3I5AA 4URVR 5TY0A 4US1R 4BJ5A 4QQ8A 1PK9A 2FUEA 3ASUA 3M89A 1UEIA 5F12A 3E05A 3LPLA 4D8UA 4W5RA 3GVPA 1NURA 3TVYA 4MO9A 3R2JA 3F4KA 5A71A 2W37A 4OQEA 4QIHA 4AJPA 4ZCTA 3CNEA 3GZTB 1DAKA 1B8VA 3SC2A 5IJWA 3OD1A 4HC4A 4WY2A 5DOVA 1L5RA 1E2FA 4OG2A 4K9QA 2G8NA 4FONA 1ST3A 4GNKA 1XKQA 4XR9A 2LIVA 4M9QA 4NJEB 1YQQA 5ELLA 1HE8B 4HNAB 4Q4CA 2YIMA 2VWGA 2X9QA 4QKQA 4L4UA 2X2OA 3IE2A 2QTWB 3UVEA 3REOA 2VJLA 1LC0A 4B6PA 4W5QA 4BPBA 1XMQB 4AD8A 1IDN1 3DMDA 2A86A 7REQA 1OH6A 4HYEA 5LA6F 3OTWA 4AT1A 4B7AA 1MJHA 1TPYA 2FKAA 2E87A 2Z6VA 3DVRX 3VYRB 4UOEA 5C2JB 4TRNA 1XPRA 3M4YA 4EG1A 1HZZA 1S2GA 5EUMA 1VFPA 1ULAA 3H6GA 4KMOA 1MPTA 3RUFA 1XVIA 3EW9A 2FSVA 3B82A 1DBVO 3WK7A 4JENA 1G20B 4ITVA 4AX8A 4GBED 2PO5A 3GRPA 5AVOA 3WRWA 1PDOA 1QXSA 1B23P 2G4LA 4B71A 1DAMA 2V5VA 3ESYA 1HDEA 4EP1A 1F2DA 4I4CA 5LQUA 1NJ8A 3O3OB 4RA9B 4BVJA 3BWMA 2ZUFA 2DFNA 2C7BA 2AYYA 3IPAA 5JC1A 5JT1A 3LDHA 3BF8A 1MC8A 2IWRA 5JBIA 3TZHA 1PQUA 1L4HA 1M6VB 4YJKA 5AYVA 3LBNA 5LXTF 4QPCA 1ZSVA 1JU4A 3NZEA 2UYHA 1AH2A 4PSAA 2DKFA 3DEKA 1HY3A 1EVLA 3JVUA 4US0R 1FFXA 3SIWA 4BZZA 1EZ4A 2CF6A 5C7OO 2ZUEA 5KU7A 2WJJA 1GKKA 3HFJA 3JX9A 4MW4A 2ZXUA 4WV3A 3E82A 1Z8HA 1CS0B 3LKZA 4OHVA 2IV3A 1YASA 2BMJA 2ZTMA 1VKJA 3VTAA 3ZGYA 2QX4A 1IZYA 1QOZA 2P1RA 3ANSA 1REQA 4N4AA 1J0EA 4DWOA 1OBCA 3PU6A 4R1PA 4D7AA 1KFBB 4FDMA 3EODA 3IEVA 4RHTA 5TC4A 2QL5A 2PV0A 4GMXA 4LSMA 1T26A 4OK5A 3N8GA 2AFIA 2WPDD 4UM5A 1LTHR 2WV7A 4A3SA 5JPCA 1ODFA 4RHFA 4KE6A 3HNPA 2NTNA 2P6UA 2O1XA 3OIVA 5BUSA 4AUKA 3EXEA 3EAGA 4MZDA 1JDJA 4F8EA 5HF6A 2DFPA 4F9GA 1R50A 1IN1A 4NDNE 1BSVA 3O03A 4F4IA 1EFPA 1XTRA 1Y6ZA 1UK8A 5LNK1 1ITZA 4YJ3A 2FG7C 1T6ZA 2A0WA 1ADGA 2W58A 5ICSA 2ICAA 1P1IA 1TM1E 3HFSA 3F7OA 1OAOA 4OGFA 4EX7A 5KOJA 3TIGA 1Q12A 3BH6A 4OATA 4UEQA 3ZE8A 2IBSA 4E33A 4FZRA 4TMZA 1K6XA 4NPHA 2CXQA 4DVJA 1NATA 4MVJE 2XEDA 1QWSA 3IPCA 3PRJA 1L7DA 5HFAA 2TYSB 1U7TA 3EDRA 4KBFA 4X1OA 3RTGA 4R98A 4ZZIA 4PRKA 3NHSA 1UPAA 4PO1A 5C46F 1XF9A 2IP1A 4Q4JA 4X71A 4D3ZA 2AJLI 4JS0A 4ESOA 2NSLA 3K70B 3D6AA 3PVCA 5LQMA 4AXBA 1JZSA 3K0CA 2IK8A 4UUPA 4ZI7F 4YECA 2AZMA 4Z3DA 2JAUA 4GYWA 3TLYA 1HSOA 5JAHA 4JOBA 5HKAA 2REQB 2D59A 2OECA 1NXWA 3A2LA 1FF9A 3QU9A 4BRWA 1PN3A 3LSTA 4NCXA 3ZEAA 1Z7EA 2G6TA 3KPVA 1VLLA 2VDNB 4PX3A 3EW7A 5KTOA 3LTNC 1ZUNB 1T43A 2J87A 3RI3A 1K6IA 1E1QD 1L7VC 1JWBB 3EOBI 1EK0A 3NNDA 5F3DA 3QE4A 5DHTA 3VC7A 3WGNA 5LP6C 3G2KA 1QFJA 4OXRA 3JWPA 4IUCS 1LY1A 5TV2A 1ZA1A 4JUFA 2XRZA 4EKYA 4LRQA 3A14A 3VNRA 4IJQA 5ADWA 1H65A 2OC9A 4CI9A 5CXSA 3D9QX 1ZN7A 1IZ7A 4D8YA 1SG6A 4MS4B 5HBGA 4DLKA 3ADPA 3FPBA 3ZCUA 3CKLA 3OWXA 3A3YA 3UKOA 1P2VA 3ZY6A 1B16A 2R8XA 1NLYA 1ZGAA 5EQJB 3R76A 3R1IA 2A0YA 2G88A 4OKNA 4RZSA 3D2LA 4FGSA 1SD5A 2GYYA 4TKVA 2WP0A 5IAJA 1SEPA 5IT0A 3QW2A 3KL2A 4CU5A 3Q7EA 1YU6A 3OIGA 1V5EA 2WSSA 2ZTLA 3FN4A 4QEDA 4PYKA 2WYHA 4EMSA 1AOXA 1N8KA 2JJ2D 1H0RA 1B0PA 1KH1A 2HIHA 5MFPA 3M6MD 4B43A 1QYWA 4OJTA 2QB5A 3D7MA 3EUWA 4NBUA 4GOOD 3UXMA 3FNFA 4PQRA 4GP9A 1ZM2A 3FOFC 5DTQA 1L3BA 2OZLA 1RXSA 4PLPA 1QX4A 4M0EA 3K9BA 2QRJA 2HQBA 5BSTA 3H3XA 3G7NA 3WK4A 5KINB 2C96A 1KETA 4I4LA 2W6JA 2JCYA 1T8YA 3ZV7A 3WICA 3FH0A 4LNAA 2YWHA 2H4ZA 4M1SA 1IATA 1BN7A 3O1HB 3WLNA 4BFLA 4MJ3A 3DZCA 2NUAA 5FJIA 5BQOA 3NWPA 3ZWOA 1ZD8A 2P0AA 1YHYA 2ASEA 3WV5A 1C30A 1PCXA 2C4HA 2AK2A 3HWSA 2RGUA 3QWBA 2JFXA 1A71A 2HT6A 4R0NA 3C8DA 3OQIA 2ZSAA 3CLSD 1NT4A 5JO9A 3M9LA 4MTLA 5BV1A 3I45A 1M2OB 1CE8B 1NQAO 2VDQB 1PLLA 3CY6A 3GVHA 1OROA 3D4NA 4XFKA 3R9KA 3VGJA 2JJMA 4EVRA 2E4YA 4I4TB 3OCCA 1Z82A 1ZJWA 2YZKA 1AK1A 1LGYA 1WVMA 2XBUA 3MWJA 3TZEA 3RIMA 1SPXA 1VE9A 1YRQA 3CT4A 4QUEA 1EUCB 3W5HA 2R85A 3R4VA 1PV2A 4DR3B 2OWDA 2OQVA 1A96A 1G6OA 2HYIC 1QH0A 3DOUA 4D26A 4I3FA 4K1LA 1I80A 1KYVA 2AW5A 2A8YA 3DXFA 4R7GA 4OP3A 4YH1A 1G55A 1OWLA 4EHKA 4L5CA 4RD1A 4F60A 4WBNF 4KXYA 2HK7A 1C29B 1EINA 3G0IA 5TLSA 3OM8A 2NZYA 4O4JA 6GPBA 3W9SA 5J4YA 1GXSA 4Q93A 3VR2D 4DBVO 4FVTA 3P4XA 4OPMA 5DP1A 3MGGA 4A8TA 4AKSA 1LFDB 4GOLD 4FHDA 4PIMA 3OLWA 1ZH0A 3AB7A 1WHTB 4MW1A 2VAVA 4KQHA 4WVLA 2VHXA 1P2GA 1IBCA 2FY8A 3HABA 1NKSA 3AL3A 3CC8A 2TMGA 1OYVA 4IXDA 1XMIA 4QTTB 4BFZA 2IBMA 1X7DA 2LWIA 1GNLA 3S1AA 4V24A 3WJAA 3DMGA 1FTQA 4D81A 3N39C 4WSOA 2NZ2A 1PF7E 4NYJR 1II8B 1UMCB 3HJBA 4BIIA 4LF5B 4G1FA 2EW8A 3RBAA 3FLBA 2IUTA 3AUAA 4K9LA 5ALUA 3W1VA 3Q7QA 1FS6A 1BRTA 1RQGA 1U81A 4NYIR 3EBLA 1YL5A 1GSAA 3BKXA 4MNTA 5HIJA 1OPRA 4CM8B 1G16A 1S2DA 1WG8A 2ATVA 1W29A 3NWEA 1TEHA 2CD9A 1S1CA 1U7ZA 3QHQA 4RKQA 3ZBPA 1XT6A 5TNXA 2ZFUA 4Z5XA 5LLTA 3H5OA 3LF2A 1IULA 4YREA 5K3AA 1EBFA 2YUTA 3NP9A 4I2NA 1IVSA 1AVTA 5C8YB 3M6FA 4ZAZA 2QG4A 3IP6A 2VZ0A 1KY5A 4UFOA 1P4SA 3AHDA 1D2AA 2O5VA 3R3YA 3SR3A 5K6TA 3ZCRA 5EJ8A 1O6CA 1P7VA 3KYJB 1U5CA 1U31A 2G7MC 4Y2SA 4MWZA 3GDOA 5DNAA 5F73A 1Q3HA 1FJXA 3WL8A 3T4PA 1RPAA 3QF4B 1P0PA 4OP1A 2W2PA 4DMCA 1EK5A 1RM0A 1SBYA 3GOHA 2FPKA 1EG7A 2Q6LA 4G23A 3QMWA 4IILA 3ZZ0A 4O63O 1XALA 3C2QA 3HA5A 1DZ3A 1YB4A 2KX7A 1FB5A 1GGNA 3IT2A 3HKCB 4HYYA 5LJIA 1FYDA 1DCKA 2ZI7A 1YQDA 1QRAA 2W2KA 3QZUA 4GXTA 4WXMA 5CGZA 4DXAA 4F12A 3ZVKA 1AU9A 2YNMD 3OQJA 1XQYA 3ZI0A 4MVJI 3AR5A 3R7WA 3H4VA 3HU3A 3USCS 2A3NA 2EHJA 5REQB 3G8YA 4BO1A 2B2NA 1CIPA 3JQ7B 3K0FA 4URHA 3UJ7A 1QP7A 5AR1A 5TQ0A 1GYRA 2PYDA 1XJ5A 3A06A 4GEKA 5GM2A 4CN8A 1HLFA 2PGNA 3ESXA 4GSKA 3OFNA 1NNEA 2V9ZA 4JVNA 3HP7A 1J20A 4C4YA 2RSLA 4M9RA 1C1YA 1OKKA 1Y48E 3LRXA 1TIPA 1Z4JA 1CUBA 2O3UA 3OETA 3NAQA 4JC5A 3A6EA 1ZOSA 4CR6A 3PDHA 1NQXA 3HKDB 1CZKA 3QEJA 4NQZA 3WLMA 5ECGC 1BMQA 1LCIA 1N6HA 3ZU6A 2H08A 3UHAA 4QHYA 3LXXA 1TCCA 2YUIA 5JNRA 2XAUA 2WINI 1U90A 4QSMA 1YMQA 5D84A 1UM9A 3CLUC 4HS9A 1MH1A 4IIJB 4RA6B 3NYIA 3O2NA 1NUPA 3DWGA 4XWKA 1ZKDA 4CG3A 2OYSA 3PE6A 3NX4A 5P8WA 1KI7A 3TI9A 1KQPA 1P0FA 3NVMB 4HNVA 3OEWA 1CXZA 1R0XA 3KYDA 2C7RA 2C7PA 4ARIA 4HEA6 4RLFA 1DTEA 5ES3A 1QGYA 3T4EA 1XCMA 4BNMA 3N86A 2F48A 3A3OA 3BAFA 1JAZA 1MABB 1GU0A 1JV2B 1O2DA 3KB2A 4R41A 1XL1A 4TS9A 5E4YA 4L76A 1H69A 3E5NA 3AT1A 3U9SA 3FNRA 5CB6A 4HVAA 4L57A 3UJHA 2WIKA 5I9NA 5KVVA 3SEFA 3DTYA 2NO6A 1KNXA 1QHYA 2IX3A 2HBYA 1O54A 2P40A 1F2VA 5K8CA 4EJMA 1EGMB 1O6GA 1UQTA 2OUIA 4TYNA 5E95A 5EKUA 1YJCA 1ZG3A 2IYQA 2YS6A 4PYRA 3TTVA 1EEHA 1GUFA 1U8TA 4QECA 4RC9A 1PJBA 2H5LA 3E61A 4TPKA 2HHHB 3PR1A 1MJGM 1VTKA 1NV9A 3ISJA 3RS2A 2V65A 2IYEA 4HB0A 4IMRA 3ZI4A 3KJEA 2IKSA 3EVEA 3B3GA 4C0WA 5H16A 1W5TA 2PMBA 1FFAA 3NMUF 1F4PA 1HFJA 4TTTS 3ZU5A 1NJSA 2QP9X 2HZBA 2YVUA 4DLTA 5GADl 4NV3A 2TS1A 1WQ3A 1MV8A 1VSBA 3ELUA 3EOAI 1KVRA 3GDFA 4URFA 3D3KA 4ZJYA 1AA6A 3TINA 4KI0A 2QROA 3V00A 1YI1A 1NNI1 4RHCA 1G3MA 2LZ0A 1F8GA 2Q1WA 3HDYA 4N3CA 3WGLA 4ZEOA 1P19A 4LQDA 4OHBA 2FEXA 5JAOA 3A9WA 5K0TA 4CN9A 2QRQA 3CGWA 3L77A 1CF4A 2RBKA 3KBBA 2ZSUA 4UJ5A 5B1IA 2QJRA 3OE1A 1HNNA 4HGPA 3AVVA 2HX1A 3K9NA 4JJIA 5JADA 3NCTA 4GP6A 3DE1X 5SV2A 1V3UA 1RT9A 1V11B 3K5HA 4ZPXA 3K9FC 1IN4A 2J9FB 2ZBRA 3RVPA 4FP9A 3F8TA 4HXFB 4EDFA 1QIKA 2VQEB 4KRFA 4UNNA 5DZSA 2PYZA 3PUIA 1M0SA 5EKTA 4MI3A 4BASA 4DLAA 4G8CA 4OQYA 1FSGA 4QHTA 1DDGA 2I2WA 2NV2B 2CDBA 1NN1A 2H1IA 5ESDA 3L06A 1GKLA 2ZIGA 1E8NA 3D2AA 3E5MA 4B6JA 1MX1A 2FUG1 1SHTX 3QENA 3ZU2A 5A9SB 1M34B 3NRJA 4W1SA 5JAMA 4BVGA 2IWHA 5B58C 2QM8A 4TL7A 4REQA 5KVSA 3T3MB 4V1CB 2AI3A 3EYWA 4JQZA 2JL1A 3V8QA 4Z9XA 5JH7A 4HAOA 4NCIA 4DHEA 2HBRA 4RJLA 2J67A 5IAKA 2DOKA 2XCSB 1RJ9B 4MXDA 1F9EA 1R0SA 3EJWA 4FFMA 3E5RA 4RGBA 4AJ4A 1A04A 3SXJA 4J4TA 1P31A 3KX2A 2OO3A 3OTQA 5JXJA 5F3RA 3GA0A 4C88A 1I36A 4HR7A 5SZKB 5IT5A 1XZBA 5BNWA 4PGGA 1SGWA 1ZOIA 3FMPB 4NYMR 4JASB 5KJ6A 1BCSB 2B1GA 2ZRQA 2B8WA 3VO8A 4KAAA 1N77A 1TQHA 2RGBA 1T29A 4ARSA 4CDMA 3FMIA 3G5UA 3JD4A 1RLOA 4I1UA 2C8VA 1T4GA 1E2QA 1XEFA 1BE1A 1XXLA 2OK8A 3FTDA 4KDCA 5E1BA 4BP8A 5LZ2A 4JL6A 1H2HA 1PV1A 3JQ9A 2CLDX 3KVYA 4HWPA 4J94A 5ALOA 2LD4A 4I6JA 5FFNA 4EUEA 4XB2A 4ZN6A 4EIWA 1XOIA 1SKYB 2EP8A 3JZMA 3DCYA 3IUMA 5EHQA 4N82A 4BUZA 1KHHA 3VPGA 3VHXB 2Q46A 2NZVG 1H42A 3DAFA