4PW0A

Alpha/beta hydrolase fold protein from chitinophaga pinensis
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
275
structure length
275
Chain Sequence
NDHATAPTQYIEVNGTRYAYRSLGAPSDIPLICFQHFTGTLDNWDPLITNGLSKGRQLIIFDNKGVGLSSGTTPDNVAAMTADALEFITALGIRYFDVLGFSLGGFIVQYMAHIQPDMIRKIIIVGAAPQGVKVLHTFPDLIARAMQLEPKERFLFIFFEQSEHSRSKGLATLGRLYERTTDRDQDASAQAIGAQLTAITNWGKKTPSFEITSIQHPVFVVQGSNDEMMDTYNSYELFKQLPDAILSLYPDAAHGSFYQYPELFVSQTEYFLDSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Alpha/beta hydrolase fold protein from Chitinophaga pinensis.
rcsb
source organism Chitinophaga pinensis
molecule tags Hydrolase
molecule keywords Alpha/beta hydrolase fold protein
total genus 101
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2014-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4pw0A00
5E2IA 3OTQA 4P08A 2PPLA 2AJLI 3VJKA 3T4UA 4PO3X 4X00A 4J0DA 3G0IA 4FWBA 4X3CA 4GLBA 2WJ4A 2BCEA 5ALPA 3AUKA 3BE8A 1EI9A 2IITA 3F97A 3IIIA 1NU6A 4A16A 3L1IA 1E8DA 4U2GA 4RE6A 1WHTA 4EY5A 2PU5A 3O4GA 1F8UA 4FLFA 5ALHA 3DOIA 4V2IA 3JWEA 4G4IA 4QDOA 5CT4A 1GQRA 1YR2A 4B81A 1FSSA 1WPXA 2WUDA 2OAGA 5SYMA 1EK1A 1CUSA 1XRNA 3TRDA 2PBLA 4AO8A 2XLBA 5EHZA 5C8VA 3CN9A 3ED1A 4EY6A 2WHPB 2PVSA 3CXUA 5ALQA 1UOPA 4AO6A 4GWLA 4DLNA 5FP0A 4PQEA 3ZV7A 4E46A 2RI6A 4F5ZA 1KEZA 5HKAA 4EA6A 3WL7A 3WJ2A 2Y6VA 2HRQA 2WU3A 1CRLA 4X92A 4BVJA 2GZSA 2HRRA 2ZJ7A 3BWXA 3DLTA 1ZD3A 1CUDA 3SWWA 1YAJA 1U8EA 2H7XA 3QITA 4GI1A 4Q3KA 1F6WA 1K4YA 2HA7A 3WWCA 5K3BA 5K3AA 2HADA 5C8ZA 4U2BA 2VQ6A 2VJDA 1A8SA 5E4YA 1CIJA 4Q3OA 2FJPA 1HKHA 1K5PA 3M81A 2DHEA 2WG0A 4X97A 3PUIA 4H7KA 3BF8A 5YASA 1ZIYA 4Y2RA 3HXKA 1JFRA 4IH4A 4J3JA 1FJ2A 3QH4A 5AI6A 4CG1A 4ITVA 3H2JA 2QS9A 3LIIA 1EK2A 4B82A 1HLGA 3FYUB 5JARA 3BDVA 3K9BA 3WIBA 4BVLA 1R88A 1BE0A 3H18A 4G9GA 1ACJA 1THTA 3D2CA 1ZOIA 1H22A 1Q84A 4Y2QA 1WOMA 3R3VA 2J3QA 4XX1A 3B3QA 3TGLA 1XRQA 1TCBA 5LKAA 2VJCA 3STXA 5KWJA 4ZREA 1YB7A 2CKMA 2WFZA 4FFVA 1VZ3A 2OQVA 1IUPA 2XMBA 4A5SA 1LPMA 2OG1A 3I2HA 3B12A 3ANSA 2CZQA 3DDUA 3WK4A 3LLCA 2PU7A 5CT8A 1CUAA 3C70A 4UHCA 2XMQA 1E66A 3DOHA 1VZ2A 1FFEA 2Z5GA 3PF9A 1R3DA 3E4DA 1UK9A 3WJ1A 1DWPA 2XUOA 1VLQA 1X70A 1E3QA 4B83A 1THGA 2GYWA 3I1IA 2BJHA 5AK4A 3H19A 4N8SA 1ISPA 1P0IA 1IVYA 1AKNA 1SCIA 3R3ZA 4U2FA 1K8QA 4C4ZA 2BAGA 4YX9A 2WHRA 2GYUA 1QIEA 4YASA 3D2BA 4FLMA 3CCCA 1G4HA 2CEKA 1CV2A 1G66A 3KSRA 4B9AA 1CUVA 5CT5A 3U0VA 3O0DA 2DR0A 3D3NA 5IVKA 1VA4A 2VT7A 2OQIA 4B80A 1R50A 3QM1A 1UKAA 4EBBA 3A6ZA 2HA4A 4LXGA 2G4LA 4J0KA 3F98A 5EI5A 2YASA 2JF0A 5HF9A 2H9YA 1IZ7A 4GEGA 1YB6A 3RK4A 3SK0A 4OU5A 1ORVA 4KAFA 4Y7DA 2ONCA 3IB3A 2ORYA 1W6RA 4AZ3A 5IVHA 5ISMA 4LIPD 2J4FA 1ZIXA 3D7RA 3WA7A 1CUHA 3C8DA 4QDTA 3OPMA 2Z3ZA 4N5HX 1UOQA 3WL8A 4BDSA 4B84A 5CXUA 2ACKA 3EQ9A 2VT6A 5T4EA 4M0EA 4AZ0A 2YYSA 4L3WA 3R3WA 1XQXA 1FFDA 3QMVA 5DNWA 1R1DA 4Q1VA 4OB7A 2XMGA 3WK9A 2ECFA 4AO7A 4C89A 5AI9A 4X6YA 3HSSA 3G8YA 4XWGA 5HQ3A 4ETWA 4FNGA 3G9ZA 2J4CA 2WHPA 4EZIA 2WM2A 4N8EA 3DL4A 2XMSA 3WZMA 2XMCA 5JASA 3Q0TA 5IVIA 3D2AA 3FCYA 4K6GA 1U4NA 1QTRA 2OGSA 1Q83A 4XJVA 5HF6A 1DWQA 3C6XA 2HDWA 4WJLA 1T4MA 1YS2X 1MT3A 4FKBA 5HCUA 2B20A 3W2TA 1CUJA 3MUNA 2ZYRA 2VATA 3WKCA 2B4KA 2VEOA 1VKHA 1CQWA 3FLEA 3AFIA 4X7BA 1USWA 1MX1A 1CUZA 4WFKA 5A7FA 3G9UA 3GFFA 5ALFA 3UUEA 4S0XA 2EDCA 2PX6A 4L72A 2JGJA 5ALYA 5AK5A 4QWWA 1QIMA 3RM3A 3I2JA 3NOXA 1J1IA 2QJRA 1XFDA 1XZGA 1DX6A 1FFCA 1Z68A 4E15A 3A2LA 1UK8A 3VISA 1CUFA 3C43A 5HZGA 4UBOA 3C8HA 5HK9A 1O6GA 3WQHA 4BC0A 3I2FA 4X85A 2GBGA 3JYHA 1QOZA 3D0KA 3O95A 4GECA 1LPAB 5K3FA 5FKJA 1ODTC 2XQGA 1A8UA 4HVTA 5JZSA 1N8SA 5EIEA 3QYJA 2XI4A 2DCMA 4JUIA 5BOVA 5AM4A 5EGNA 4HS9A 1E5TA 1TCCA 5CT9A 4IH9A 2QUAA 4OUKX 3EIOA 3U1TA 4OYLA 4Y2VA 3HRHA 4LXHA 2O7RA 4KR0A 2R8BA 3HJUA 3VDXA 5HK8A 2WUFA 3AZOA 1W52X 5JYCA 2WFMA 3KDAA 1MNAA 2QVBA 2H7YA 5E4TA 1XQYA 4OCZA 3V1NA 3IA2A 5DWDA 4WDQA 1MAHA 2XE4A 4Y2SA 4ARAA 4HZGA 3HZOA 5J3JA 3FBWA 4MJ3A 1LLFA 3LP5A 3FVRA 4J0GA 5LKRA 1XROA 2RHWA 5FRDA 1CPYA 1W76A 2BGRA 2JGEA 1N5MA 2OCKA 1RP1A 3STYA 2QUBA 5DNUA 4MWSA 3C87A 1VXRA 1DU4A 3ESDA 5FV4A 2H7CA 3FVTA 4MWTA 3VVMA 5AKLA 3G0CA 3FNBA 4UFOA 2PSEA 4HRXA 1NX9A 2XQKA 2GZRA 3F9CA 2EDAA 1B41A 1L7RA 2XQFA 4FBMA 4F60A 5DLPA 6YASA 1MPXA 3PFCA 4G8CA 3RLIA 2BUBA 1A8QA 2HL6A 1BROA 3G7NA 3IVMA 3R3XA 1VXOA 3EQ8A 2V9ZA 5CRIA 4ARBA 3AIOA 5CTAA 4Z49A 1K6EA 4KRXA 3DKKA 4INZA 4ZV9A 3OM8A 5HF5A 1XLUA 3I2IA 5D3ZA 1ZICA 1ZD2P 3ESCA 2WTNA 2JGIA 3AZPA 3EF3A 5IH7A 1W4LA 4AN0A 1MAAA 4HXFB 5CURA 4F0JA 2PSHA 1GPNA 5AOCA 1EINA 1QE3A 2Z8XA 2WJ3A 3HC7A 3DNMA 3WK5A 3WWEA 4GDMA 2WFLB 3V1MA 2E3JA 3D59A 2G63A 3FWHA 3C5VA 2I3DA 4FHZA 4UBNA 1CLEA 4PSUA 4Y9SA 1XRLA 2ES4A 3ZPXA 1UKCA 5HFAA 4CI9A 1Y7IA 2Q0XA 3GBSA 2QR5A 1XZDA 4HTAA 2WILA 3G0GA 1VE7A 3FOBA 4BBZA 4DGQA 4BATA 4X71A 1H23A 1JU4A 5DNVA 5AICA 2WJ6A 4X93A 5AKEA 3N0TA 1BU8A 2HA6A 4K5QA 3GELA 4W1SA 4ZV7A 2CBGA 3WWPA 4WY8A 5HFNA 3P2MA 3R3UA 4QDZA 2O2HA 1BN7A 1KU6A 5LZ7A 4AMYA 4H18A 1RYYA 4UPDA 4BE4A 5FOQA 2O7VA 1LPNA 4LKOA 2FX5A 3ESBA 2VJAA 1SOMA 4U2EA 4MEAA 5AOBA 4QA9A 3BF7A 4B7ZA 1DINA 2Y2UA 3F8SA 1UFOA 1T2NA 4H7JA 1IZ8A 5FXMA 1QJ4A 2PL5A 1ACLA 2ZYHA 2OGZA 1QIJA 1XRRA 1JKMA 5CH3A 5EHQA 2ZJ6A 3H2GA 5LYYA 3NWOA 1EXWA 2CUTA 4TVKA 5ALSA 5AP9A 2V96A 5ALIA 4BAZA 4QLAA 2WIFA 4P92A 5JALA 2OPHA 1QZ3A 3QMMA 1R4ZA 1IUNA 5ALMA 4KACA 3C6BA 4KE8A 4X91A 4DM7A 1A88A 1DTEA 5BWCA 2PSFA 5HKBA 4DMCA 2QMQA 4EY4A 4BCCA 3IULA 1WHSA 4J03A 1VJ5A 5JD5A 1ODCA 5K3FB 1OILA 1EB8A 3IDAA 4RNCA 2C0PA 4A23A 5H3HA 4HRYA 4KJXA 1JMYA 1CUBA 1E8MA 2I3ZA 4UBLA 3STWA 2HA0A 3MVEA 1EVEA 2O2GA 3H1BA 4YPVA 4Y2JA 2JBWA 3KD2A 1P0PA 1JJIA 1XZJA 4Q3LA 1WCYA 3VXKA 4BCBA 2HU5A 4PSCA 1QIIA 3WKBA 3WK8A 3QZUA 4PF1A 1XZBA 4EY8A 2D5LA 3C45A 4UHHA 2WIDA 1BEEA 1QONA 1MTZA 4D9JA 2B61A 1CUGA 4IQ4A 3LCRA 1X2BA 5JAOA 1EDBA 3G0DA 5AI8A 5ALZA 7YASA 1NU8A 2QRUA 3GUUA 4DMFA 3STTA 4H7DA 4ZI5A 2IX9A 2WSLA 4K2AA 2XQJA 4BE9A 4UBMA 5AHXA 4EY7A 4B0OA 5CXXA 5A7HA 4OYYA 3WIOA 2OGTA 4EUSA 2Z8ZA 5LZ5A 1S8OA 3ZI7A 4LYDA 4N8DA 2YXPX 3E0XA 2NW6A 4MEBA 1TQHA 5AM5A 1U2EA 3S8YA 5LZ9A 2XUQA 3IUMA 2YH2A 5HF8A 5ALLA 2OXEA 3HABA 1XQWA 1E8NA 3I6YA 4CCYA 1PJAA 1QTIA 1UWCA 3BJMA 5AKYA 2WG2A 2XB6A 1ODSA 2PSJA 3W9BA 2ZSHA 4GHWA 2GBCA 5A7GA 1VA5A 1AGYA 1JJFA 4I19A 4RGYA 2WKWA 2PUHA 1CUYA 1QFSA 3B5EA 2V97A 1EDDA 4AMZA 4LHEA 4AN1A 5AOAA 5AKXA 1XKLA 1XZKA 1SCKA 3WMRA 4HXGA 3W9UA 1TK3A 4MQLA 4WDRA 1N1MA 3HACA 5A6VA 3IUQA 5DYYA 2CB9A 1FFBA 2BKLA 2WFLA 1AC5A 2JIDA 1LPSA 4WFIA 2QM0A 3KWJA 4FMPA 4P93A 5A62A 5AI0A 4E14A 3V48A 1LGYA 3WYDA 2QTBA 3E3AA 3WKEA 4U2DA 5EHXA 3FYTA 2HA2A 1L7AA 2PKYX 1ZD4A 5SYNA 3VVLA 2HIHA 4LYEA 3H04A 5AKZA 1GKKA 5JIBA 1LZKA 3QMWA 4B6GA 4HAIA 1E89A 4FTWA 2GBFA 4KE6A 4JNCA 5K3CA 4MYSA 4L9AA 3H17A 1CUWA 2VA9A 2WUGA 4DNQA 1LPPA 5AIBA 3N2ZB 5T4BA 4UHDA 4ROTA 5JZBA 3QVMA 3IURA 2VSQA 3G9XA 3O9MA 5FPPA 2XUJA 1CUXA 1LBTA 5IVDA 1I6WA 5E4JA 3VJMA 1OCEA 4AX4A 1XZCA 1DQZA 3MUOA 2XUGA 4RE5A 4H7IA 5BV7A 5HQ3B 1QIKA 3TEJA 3WYNA 3V9AA 1GQSA 2C58A 3DD5A 4PW0A 4JYPA 5AM1A 3STUA 1DQYA 4OSEA 5AK3A 5IKXA 5AO9A 1ORWA 1WM1A 3HEAA 2ZVDA 3A2NA 4FNMA 1FFAA 4BRZA 5I9IA 1QO7A 4OB8A 5ALOA 4DNFA 1XZMA 4O08A 4BP9A 1UK7A 2BFNA 3WK7A 4W9RA 5AKKA 4B0PA 4C4YA 5AM0A 2X5XA 3FSGD 3M3DA 3DEAA 1Q0ZA 4PV7A 3WLAA 4MQMA 1GT6A 3F67A 5ALWA 4EB0A 2EEPA 1XQVA 4QNNA 2AJBA 1LPBB 2G5TA 1DWOA 4UHBA 1WB6A 2Z3WA 4DSAA 1XZFA 4DMKA 1HL7A 2FUKA 3PI6A 4C87A 5KBYA 1JMKC 2JGLA 2XUKA 3GA7A 1BCRA 1BEZA 4QE3A 3C6YA 3DJYA 5F4ZA 3WWDA 5AKGA 4CFSA 4OB6A 4FBLA 4DMHA 4C6HA 2JGKA 1R9NA 1X2EA 3BDIA 3QBJA 2R11A 4G8DA 2QOEA 5AIAA 2XMZA 3BIWA 4W63A 5I8PA 1XRMA 3FCXA 1AMNA 1O6FA 3SX4A 1C7IA 2XLCA 2I03A 4DYHA 5LZ8A 1WB5A 5K3DA 5A71A 4BDTA 5EIHA 1M33A 2LIPA 3OG9A 3W06A 1MX5A 3DL7A 5BWBA 1TAHA 4H35A 1UT6A 3E1GA 4JYMA 4WFJA 1EX9A 5DTJA 3PF8A 3WZLA 4CIAA 1XLWA 3TJMA 5DJ5A 1HBJA 2PUJA 4M0MA 1YSCA 1TRHA 3H2IA 3M82A 4J0HA 5DYWA 4PSDA 4ZWNA 3ZLVA 5JATA 5AI5A 4UBIA 5JADA 4J0JA 2AJCA 1C7JA 1EHYA 2B9VA 3R41A 4PNZA 4BTVA 1ZI8A 1W75A 1ZJ4A 5AKHA 2CJPA 3H2KA 3ANTA 1BRTA 2RIPA 3X3HA 3S2ZA 1IUOA 4C88A 5JD6A 5D7BA 1R9MA 2BUAA 1F0NA 4CG3A 4JH0A 4IHAA 4H77A 3AIMA 4B9EA 1YS1X 2WQZA 2VF2A 4UHFA 2HA5A 2ZSIA 2WUEA 5CH8A 2VAXA 3IBTA 3DYIA 4DSZA 4NZZA 3MGAA 2OCIA 3FSGA 1VE6A 5LP1A 3KWFA 3I2GA 4Q34A 3WK6A 4UFPA 3ICVA 1QIDA 1XLVA 2D0DA 3WI7A 4BRSA 2IIVA 1P0MA 4I4CA 4NVRA 1J2EA 3DCNA 1EA5A 2QXTA 3T52A 2HA3A 5AJHA 3G9TA 2JEYA 1HDEA 2GYVA 1BS9A 5ALXA 5CBKA 4UUQA 2VAVA 5CH5A 4B85A 4BYMA 1ZGCA 2P8SA 4G5XA 1K63A 3HYSA 1RWQA 1EDEA 4W1RA 4DNPA 3H1AA 4X94A 1EH5A 4HXEB 1XZLA 3Q8WA 4IO0A 3D5EA 4BAUA 5CW2A 3WL5A 4G4JA 3CN7A 4MXDA 1XZEA 1QIHA 4J7AA 1Y37A 1L7QA 3JW8A 5ALTA 2CMFA 1B6GA 1G5FA 5ALNA 1Q0RA 3ZWQA 5ALVA 3I2KA 2VTVA 2XDWA 5AI4A 3ICWA 2OLEA 1MJ5A 1QO9A 3L1JA 1MU0A 4I3FA 4U2CA 3O4IA 3W04A 2C5GA 3UMJA 4TGLA 5T4HA 1CR6A 4BTLA 2O2IA 1TCAA 1LBSA 4CCYB 1H2YA 5LIPA 3K2IA 2RAUA 4WCVA 3K6KA 1VOTA 3EQ7A 2XUPA 1JJBA 5EHNA 5ALUA 1BN6A 1JT2A 3A70A 5JAHA 5K5EA 5ALJA 3A2MA 4Y2PA 3AZQA 3AJAA 5C81A 2H1IA 3STVA 4UBKA 2ACEA 2Y1KA 5EIAA 3QPAA 1UKBA 2XUDA 3V1LA 4G4GA 1AZWA 2HFKA 1ZI9A 4LXIA 1XZIA 3PE6A 4H7EA 4GXNA 1P0QA 1LNSA 4L0CA 2DQZA 5FDFA 1PV1A 3VJLA 2BUCA 5DYTA 2ROQA 3FLAA 4WY5A 4X6UA 5K3EA 2VJBA 1CUUA 3LIPA 4BB0A 5AKIA 5JZ9A 3PICA 4BC1A 1CUCA 3SC2A 2ZYIA 3IUJA 5C7YA 1ZJ5A 3D4LA 1SC9A 1CUEA 3BL8A 1G42A 4EHBA 2QXUA 2DFPA 3AIKA 5T4FA 3DKRA 4DNOA 4M0FA 4C01A 2Y2VA 3QPDA 1CVLA 3PFBA 1HPLA 2WIGA 4J0IA 1UOOA 2XQIA 1DT5A 3CCBA 1H2XA 2OAEA 5ESRA 4YK7A 1XRPA 4X95A 4DTCA 2W6CX 1H2ZA 4UHEA 3RKSA 3AILA 3I6MA 4XIIA 2QZPA 5ALDA 3WA6A 2WIKA 2JEZA 5LZ4A 4RPCA 3RARA 2OCGA 4G8BA 1AURA 2J3DA 3C5WP 1GPKA 5ALKA 4QDXA 1UZAA 1UK6A 2XUAA 5KREA 3F96A 2QKYA 3WWOA 1PFQA 5D6OA 4KEAA 5EFZA 1GPLA 2WLSA 3HLKA 1C4XA 3WL6A 1QIFA 4BCDA 1EB9A 2C4HA 3V1KA 5AM2A 2K2QB 3FLBA 4QDUA 2AJDA 1SCQA 2RGUA 3O9VA 2I78A 5KWIA 4BZWA 1QIGA 4CG2A 1YA8A 4FOLA 2JGFA 4X90A 4FLEA 1XZAA 2W22A 2X76A 1HQDA 3R40A 5ALEA 2FJ0A 2WTMA 5I7UA 5AKJA 1JI3A 4XVCA 5FLKA 4E11A 4NS4A 2HU7A 4TPKA 2C0QA 3ZLTA 1GXSA 3ILSA 3WKDA 4N5IX 3EBLA 3DS8A 2ZJFA 3QPCA 4QWMA 1XZHA 3M83A 4JEIA 1BCSA 2WHQA 3OOSA 1QLWA 3NGMA 4K6KA 5FUMA 3O4HA 1WPRA 2OCLA 3ESAA 5AM3A 4GBGA 4AXBA 3BXPA 4UBJA 1AUOA 1ETHA 3PUHA 3HI4A 5ALGA 1QFMA 1CEXA 1F0PA 2DSNA 3LS2A 4FFWA 5A2GA 1J07A 5LZ2A 1LPOA 2XT0A 1H2WA 1LZLA 2HM7A 1OXMA 1TIBA 3NUZA 4UFNA 4GW3A 2QJWA 1Y7HA 3YASA 4J0CA 5AK6A 4OD0A 3H0CA 1XKTA 2PM8A 4Y2TA 4CCWA 3VKFA 1N5RA 2PSDA 3G02A 2JGMA 5DTIA 3GROA 1AQLA 1MNQA 2DHDA 1WB4A 4X6XA 4KE9A 4KRYA 3FAKA 4ZXFA 1CFJA 3FYUC 1MX9A 3FYUA 3O4JA 4Y2UA 4QEKA 4KAJA 1ZD5A 3IUNA 4AQDA 2AJ8A 3C6ZA 3W05A 5JAPA 4MYDA 4G1FA 1GGVA 1MN6A 4KAAA 4OPMA 3AINA 4Y2XA 5ALRA 3UUFA 3DYVA 3DQZA 4ZRDA 2WIJA 4BVKA 4H0CA 2DQYA 4DIUA 3I28A 1CUIA 3BIXA 4BP8A 4ZGBA 4C4XA 2V98A 2ZYSA 2G5PA 4F21A 1QGED 2GBIA 4AB1A 3KOOA 3G0BA 2XUFA 5JAUA 2Y6UA 1GKLA 4P9NA 3OC0A 1YASA 2WU4A 4Y2YA 3ZLUA 4QZVA 1W1IA 3I6ZA 3R3YA 1A7UA 4QLOA 2C5FA 2BGNA 3GZJA 2QT9A 2RONA 1U65A 4KE7A 2C7BA 1EVQA 3L1HA 3R0VA 4KYVA 1ZI6A 4NMWA 2XUIA 2XMDA 4IH1A 3OURA 2XMRA 1TKRA 1YA4A 4CIBA 5JANA 1JU3A 4W1PA 3WKAA 4OU4A 1KU0A 4BAGA 1UXOA 3I1YA 1GZ7A 4Q05A 1IMJA 4G9EA 1ZGBA 1J06A 1DX4A 4K6HA 1DT3A 2HHAA 1SFRA 3KXPA 4Q82A 2HFJA 2XUHA 5FPQA 4H7HA 5JD4A 1YAHA 5AH0A 2X8BA 1YCDA 2HU8A 3PDCA 1AX9A 4H7FA 2RHTA 5CT6A 2AXEA 5C8XA 4W1QA 4BZZA 2WG1A 1MO2A 3H2HA 5CMLA 4FDMA 2DHCA 3BJRA 1D07A 1CQZA 2UZ0A 5LLSA 5D3KA
chains in the Genus database with same CATH superfamily
2F90A 2GWHA 1L3BA 1B23P 2EL9A 5E2IA 2Z57A 2EYUA 2DMRA 3IILA 3PUXA 4KW7A 3TDMA 4F93B 3CEMA 1W2GA 3O8QB 1KWGA 2V7VA 1AXEA 5C7OO 2ZDHA 3OTQA 2AYZA 2OMEA 3Q7IA 2PPLA 4J43A 4ZCMA 3U6KA 1KO7A 3R2JA 4LDNA 4O4IA 5CNJA 3VJKA 4KUGA 5I7VA 3VU9B 1NBEA 1S1CA 1RM0A 3OJCA 3UG7A 3UHJA 1RAGA 4FWBA 2QTVA 4I1RA 4A0HA 4AJEA 2Q46A 1R6XA 4US1R 2CNLA 2D2EA 3GEBA 3E8XA 3DZFA 3NPAA 4RKQA 2FN7A 1AF4A 1BA2A 2VOJA 4UDYX 4WOKA 1QP7A 1JQJC 4NENB 4MS4B 3F97A 2A0XA 1FLDA 2WDPA 1E1DA 1VE9A 1W88B 3GFTA 4AKIA 3BXHA 2F1JA 3DKIA 1YCFA 4REOA 2FN8A 3E05A 3WXMA 3MWEA 4TYNA 1K8RA 2QSUA 1KR5A 5KVAA 2JI6A 4A03A 1NR7A 3Q3JB 5B3AA 4HQLA 2HHJA 1A72A 3NDIA 4EMSA 3HFRA 2G1KA 1O0SA 4A7PA 2YFHA 3FKQA 4QO8A 3KOWA 4EY5A 2YXDA 5LNK6 2PU5A 1Y5IA 3GMTA 3FA2A 3N7AA 1Z06A 1G5RA 2HPZA 3O4GA 2P9FA 1KERA 1XCGB 2ENWA 1MEOA 1F0YA 1FUYB 3DOIA 3DOCA 4UVDA 4ZARA 1T9DA 3JWEA 3ZHUA 1YBFA 1TF2A 1UBJS 2R4UA 4OHWA 1VC2A 3H42B 4BO5A 2FGJA 5IKMA 1UMBB 2W2QA 3UPTA 4MGIR 5FEMA 2J6BA 1OYWA 1ML3A 1WPXA 1ENZA 2OV3A 1Y8ZA 3IKLA 1V1JA 3JARA 1ONPA 3C3MA 3IB6A 3SC4A 2HJVA 4XFJA 4QLBA 4BHTA 2EFGA 2YYYA 2EW2A 3K2QA 2PBLA 3RIYA 1WXWA 3BK2A 4QBTA 3H9BA 3Q12A 3QFFA 5EHZA 1KP2A 1Z5NA 1CJUC 1NRIA 2OHIA 3VJRA 4MJ7A 3F6RA 4L7VA 1SVWA 4Z0NA 4GEKA 4W9NA 2HZ7A 4LDZA 5HJ2A 4FT4A 4NZYA 3DUFB 1UKVY 1F51E 1ZBDA 1HYGA 1AF7A 2FPUA 2QDXA 3C3YA 3NUGA 1W5TA 3OE1A 4YRDA 5B53A 1KAHA 4G81A 1CTQA 3JRNA 3P26A 2BHTA 2QN3A 4J90A 1TMOA 3OEEA 4XW2A 2XR1A 3DO6A 5KTTA 1P2BA 1UOPA 4F2GA 5KYYA 1QVAA 3LY7A 4U7HA 5TEVA 1CT9A 2BE7A 1WTCA 4ETNA 2JGNA 4LVUA 5FP0A 5H59A 3SVTA 2RI1A 1FXWA 3FNRA 4BO9A 4HADA 3D81A 2AOUA 4MV6A 4TWBA 1VHQA 2EX0A 4WV3A 4OQEA 4CKBB 4ZK2A 5ITZB 5IT9A 4W5TA 2EJWA 1JHXA 2DAPA 2RI6A 3NEJA 4QODA 4XCXA 1KKUA 4PICA 3RSQA 3QEMB 3H99A 5ESXA 4QELA 4WMLA 3ZC3A 1GPJA 5HKAA 1LRLA 4BLQA 1NM5C 3I61A 4FMBB 3WL7A 3TLMA 3BIJA 3VYSB 3PDIA 4HX9A 2Y6VA 3TAXA 2HRQA 3UVEA 4I99A 1E1LA 5FA6A 3UKDA 1A95A 2O3SA 5JT1A 1IOVA 3GL9A 2VF5X 2ZJ7A 4WXHA 3SZUA 2NOAA 3O8BA 1GLGA 4HPWA 3BWXA 5A6SA 1CUDA 4CI0B 4P35A 3OCYA 4MCIA 1YAJA 4O2LA 1WXDA 2H7XA 2IELA 4XYMA 4BLTA 5IHXA 3F9RA 2UUBB 2YVUA 3ZJYA 4GI1A 4D92A 3O2NA 4TV8F 3EIWA 1C8BA 3OD1A 1F6WA 5TT0A 2E1RA 1TIKA 4PXSA 3S2GA 5F9HA 5K3BA 4KP7A 1NP6A 3T54A 2YICA 1E9VA 3UXHA 3NETA 3L49A 3R0IA 1EK5A 4L6CA 4HLUC 5BQ3A 2JFQA 3FCUB 3WNZA 3E7XA 1V26A 3A37A 2Y93A 2Z04A 3OT1B 2XNHA 3MQFA 4ATNA 2IHKA 1QFXA 5E4YA 2WMNB 3OX3A 2DPXA 1UFVA 2WM8A 3ZE7A 3AFMA 5EQDA 2ZITA 4EHDA 2B8TA 1C30A 3HYTA 3QV1A 5IZCC 4CKZA 1K5PA 1NRWA 3EZFA 3M81A 2P69A 4YN3A 3C39A 1UP7A 3MS2A 3QFRA 3NBXX 2YWXA 2I2AA 3E9DA 4QPJC 4H1HA 2FMFA 2B25A 1R0CA 1G7CA 2C4KA 2Q8PA 3BF8A 3IGFA 5YASA 3W6OA 3LHKA 1ZIYA 4K9KA 2SHKA 2PKCA 3L8MA 4ADSG 3MWDB 4BEJA 1L8OA 2XUZA 4D02A 4IDBA 3KNZA 2WY2D 3H5AA 4IH4A 4J3JA 1GPDG 1RVDA 2HMUA 1N0VC 2JLBA 1V45E 3ZCPA 2QVYX 3ZYZA 4YIKA 2P3LA 4IVNA 4RADA 3RGGA 1MJHA 3E15A 1K4KA 2ZOSA 4JUAA 3WIUA 3A10A 4FEGA 2QL7A 4G36A 5D5HA 4B32A 4Z4FA 3ZGNA 5B7GA 3MJVA 1BFDA 1UBFA 2B34A 2IVFA 2VPZA 2B9EA 3LYAA 4Q12A 4B82A 6PFKA 3KETA 3A14A 1OZAA 3WRVA 2RHDA 3L1KA 4MW2A 1R4MA 2I2BA 3UPUA 3A4NA 3PEVA 5CFLA 4JMLA 1TYCA 4LZWA 5IAEA 2IY9A 3UJHA 2WWXA 4KO2S 4L5YA 2PH7A 4RABA 1E3WA 2BEUA 1ACJA 3OX2A 4QVKA 4NL4H 3D2CA 3TW8B 5JXWA 3TFOA 1JG1A 1TX4B 2HF8A 1H22A 1Q84A 2O2CA 3PCXA 3QX7A 4CKEB 4MGKR 2WWTA 4V0MA 5BSFA 5LQNA 1WQ4A 1S3FA 2E37A 2J3QA 2C7PA 4H3SA 1V7CA 1O03A 1ORRA 4MNTA 2FPLA 1FQWA 2A9QA 1JDZA 5LKAA 3RJMA 3EZNA 2Q3CA 5FYQA 1VP3A 1ILWA 3J7TA 4U9HS 5ETJA 4NAVA 1WMAA 2AOXA 4DKJA 2BMVA 5EXXA 3GDFA 3FNIA 4P38A 4E22A 3C2QA 3V7YA 3VR3A 3QU2A 4ER5A 5KNCH 3DTVA 1VKOA 1DRJA 1YB7A 2BKUA 2HAEA 1BWQA 2OC9A 3A1DA 4I8XA 4P4SA 4G0WA 1C4WA 1EX7A 4ZU3A 1IHUA 3IQDB 8LDHA 5JFTA 1VZ3A 2OQVA 5LSAA 4W7IA 1N3IA 4A5SA 4V24A 2EGGA 4OHVA 2OG1A 3I2HA 4R9UC 5IJAA 3SHWA 4JT8A 3PWTA 3CB2A 3JVEA 4ZVRA 4JR2A 4XA8A 4KTTE 3DDUA 1RTTA 1GNSA 1VI6A 3ZCVA 4U5XA 2IEGA 2JIRA 4OJKA 2ZI9A 3P5SA 5KOYA 4HUQA 3GLIE 1Q12A 3MT0A 2A14A 4OA5A 5KO2A 1CQXA 2XMQA 2FPXA 4DQKA 5TQ2A 5KYWA 5KUTA 5EE1A 2AVNA 2A9KA 3WB2A 2QTFA 2QJFA 2X2PA 3CBQA 2NWQA 2W11A 1R3DA 3AHCA 1QHYA 4RLFA 3WJ1A 4BV9A 4GWGA 1DWPA 3UGQA 2I91A 4LF6B 4EM6A 5A5VA 3BSWA 9ATCA 1VCMA 3I1IA 3A8TA 2GO1A 1MV8A 3QF4B 4JBIA 1SD5A 5AK4A 1U0RA 2C8JA 1ISPA 2AFRA 2Z5FA 1BMFD 3RUDA 3WBKA 2OHFA 4PLVA 4YLYA 1P45A 3ZEIA 1SIBE 3UJCA 5AHOA 4ARCA 3W34A 2YHIB 4X1YA 1WP9A 3G5TA 1IK4A 1YGPA 1KDVA 3ZG6A 4UPVA 1KY3A 1M8GA 3MILA 2Q1SA 2EATA 1I0ZA 1VL5A 2N0SA 4LJ8A 3THXB 3I3OA 3BCRA 5A5EA 1SKBA 3EIFA 4PZAA 3R3ZA 2B21A 3EEQA 3H8WA 2R7NA 2VDWA 5IM5A 2WHRA 2GYUA 4QSHA 3FIUA 1QIEA 4YASA 5H68A 4YAUA 1G1MA 3NKVA 1G4HA 1SZJG 2IEDA 2CEKA 1U28A 1H0RA 1CQJA 2BI8A 2WJIA 5BYJA 4B9AA 3ZGVA 4CR8A 1CUVA 3IEMA 3DDCA 2AQHA 3FTCA 5F64A 2E55A 3ZZMA 1OXTA 1ARZA 2DR0A 2WD9A 3C7CB 3MQ2A 4GLFA 4NU0A 4YJKA 5BW5A 5IVKA 4ZT3A 2P2CA 4KGXA 3UXEA 1E7MA 5SZKB 2ZBFA 3B85A 13PKA 4NHEA 4MUHA 1NJ8A 4MHSA 2ZUVA 5GIPE 1R50A 3JD1A 2ZZKA 1FP2A 2AVDA 3OD5A 1LNZA 3Q3HA 3LWNA 1CKEA 2C7VA 2YVLA 4I50A 4JL5A 5EERA 4BIIA 3JSAA 3Q5GA 4U7JA 4JI5B 3RRMA 3S1SA 2DQSA 4A2WA 4P86A 2C0CA 4JYZA 2IYUA 3HKCB 1HRDA 5K4AA 1C41A 4QRIA 3QFTA 5HIMA 2OM6A 2OOKA 1YZFA 1QK4A 2FR8A 4J75A 1IUKA 3CMCO 3GNLA 5IWAB 1IZ7A 1KQPA 1NJ2A 2WU8A 3KHUA 1JIUA 3OKPA 4R40A 2HCJB 4YRKA 4D81A 1DKPA 4NDNE 1KO1A 1PR4A 1UWVA 1Q0SA 2OD9A 3O8QA 1SPXA 5ADWA 3J7AC 1ORVA 4G0ZA 221PA 1JIXA 1G5TA 2YJZA 1U8CB 4P1ZA 2D6FA 1JHPA 1E18A 1KDRA 1SVSA 1T10A 3A6PC 1Z3CA 2MTBA 3T9EA 4Q3BA 2OFXA 4ISBA 3W5UA 1FMJA 1FXWF 4RSRA 4U9UA 4RXMA 5E7JA 3JZIA 1E1RA 2PUEA 3DJFA 3D7RA 3DFUA 5A9TA 1AK2A 3FBTA 4XX0A 3WYEA 4BP3A 4CLRB 7REQB 1NE7A 5AUPB 2Z3ZA 1WDWB 2Z83A 3MT7A 1ZONA 3DBLB 4LY6A 3PIRA 2OBLA 1UOQA 4GGPA 4G0MA 2EOAA 5TQ0A 4BDSA 2ZUEA 4B84A 3NGLA 5CM2Z 4IKOA 5CXUA 2B4QA 4PG4A 1NZFA 4D97A 5KTKA 3H5LA 4B6SA 4JI8B 5FORA 4Z51A 2IPNA 2XWPA 3NHPA 1G4UR 3EQ9A 2DJ5A 3VO8A 2R66A 5T4EA 4YFYA 1G21B 5AVTA 3AR4A 3IO3A 3M6XA 1NUPA 1MTOA 1JEQA 3BJZA 4M0EA 4DVJA 3FMIA 4WX2B 3VNBA 1H66A 1QK3A 4GKVA 1XQXA 4LGMA 3NBUA 2BHSA 1UMBA 2AC2A 4Q1VA 1E2PA 3MWYW 3PC3A 4EMUA 3SIXA 3V4FA 2H1CA 2XMGA 3QIVA 5CDUA 4JOCA 2QRVB 4D0LB 1T6NA 1T3ZA 4L16A 4B6FA 5K01A 3UV7A 1E2LA 3FHTA 1J2RA 5AI9A 4YYZA 3VUFA 3F71A 5CK4A 3W2EA 2F48A 1TW3A 1V1MB 3QLVC 5EQFA 3G6WA 1YDHA 1BHSA 3RH0A 1DMRA 2XRZA 2WF9A 4NSNA 4ETWA 3C3WA 1IHDA 4FNGA 5JDIC 2R0QC 3GGGA 3D3QA 4ZYVA 2J4CA 4Y6GB 2WHPA 3WLEA 4EZIA 2WM2A 1OROA 4LMRA 3DL4A 4N8EA 1KZGB 4RTPA 2J9RA 1ZK2A 3JQEA 3LUAA 1VHJA 4UM7A 4D9FA 4G3XA 3ZK8A 3C7AA 4F06A 5JASA 4RF4A 3OPYA 2BZ1A 1D0VA 5T7BA 2L17A 2C1EA 4KGZA 2SNIE 2QRGA 3OWXA 4P4UA 3GAMA 2CWWA 1Z7EA 4OQQA 3PFGA 3WB0A 3LC7O 2DUJA 1QMPA 3ZKWA 2C84A 3DWIA 1F1JA 1IB6A 1QTRA 3AYXB 1Q83A 1DRWA 4K9RA 3MCZA 2REOA 4N0PA 4WT7A 3WISA 5BW4A 1DWQA 4GM1A 3Q3GE 3GIWA 4P53A 3C6XA 4FFMA 2W2VA 1WEKA 5E3IA 2RHRA 5B3LA 1FYEA 2PWZA 4KQXA 3EXEA 2EJBA 1V37A 4G5FA 2X2EA 1CNEA 1M2VB 1WMBA 3JR7A 3RNLA 2F64A 1LU9A 1L8QA 1MT3A 2OYSA 3G1TA 4FKBA 1JLRA 2IDKA 1Z2NX 2O07A 4BQSA 2C7OA 5GONB 2NPOA 4K9LA 4RPHA 4Q7MB 4WECA 5DBGA 1S96A 3TZCA 1NQWA 4BJ6A 2QYSA 1P80A 5IRCD 5MGBA 2JDIA 1J25A 3ODGA 3I76A 3R7LA 1ZNYA 5LJIA 5CCBA 2V7PA 1USWA 2W9XA 3CNQS 1X7DA 1MX1A 1VGRA 3UCEA 3T5DA 4F6CA 5K6AC 2XVXA 4P0TA 5ALFA 3UUEA 3KPVA 2VRBA 4U0KA 3P9XA 2PX6A 4KB5A 3FTQA 2AXNA 1GZ6A 3UJ7A 1DG9A 1P1HA 2X5JO 1WD7A 3DEFA 1IXRC 3P8ZA 2GXAA 1S0UA 4FM9A 2EEZA 3I32A 3A04A 3CY6A 3IFSA 5HE8A 2I9KA 4FQ5A 2MMGA 4F9EA 1ORDA 1Z8FA 3K5IA 1TEZA 1XFDA 2FWPA 2OO3A 4M86A 2XOKD 3DXXA 4YALA 4EVIA 2QR3A 3NHJA 5A4JA 1KEUA 1TCUA 2HZBA 3A2LA 3HCRA 5CCEA 5JBQA 1IOLA 5LQJA 3CB4A 3OFSA 2Y1LA 4J4HA 3VSCA 3GT4A 8GPBA 3DSRA 2BFCB 1Z5UA 1PWXA 1S8AA 3ZVMA 1O6GA 2PXAA 1P81A 3TOXA 4DMMA 2Q3MA 5EL0A 3I2FA 2HW8A 2B94A 1NOJA 2GQ0A 2JJQA 2GN1A 3LY5A 2GEFA 3PC6A 3L0YA 4KKVA 3RODA 3A4LA 1QOZA 2X4IA 1SCNE 1WD5A 3D0KA 3O3MB 4GECA 4BO1A 3M49A 2NVUB 3CE6A 5FKJA 2WZDA 1SJ9A 5JR3A 1TVEA 1A8UA 1M1NB 1RWWA 1ZM7A 2P7IA 2XQGA 3OJEA 3R4VA 1SD1A 3CO5A 4LTDA 4UC0A 3T1NA 1EHCA 2JCBA 2RGAA 4YP6A 1F17A 1JNXX 3O7MA 5G0WA 3QYJA 2XI4A 2DCMA 4KYTA 1UR5A 4NV3A 4OLBA 5SZHB 4ZCTA 1ILEA 5AM4A 5LWQA 2IXFA 2ZI5A 4E08A 1I3CA 1RYFA 3RDPA 3O03A 3KOXA 5DF1A 4MDEA 2PQMA 1UIMA 4JWKA 3HGMA 1EBFA 1ZH8A 5KC9A 5KX5A 3HR8A 4E4TA 4BMCA 3EPPA 5CT9A 3OQOA 3LBHA 1FX0B 1QX4A 3U1TA 4DLLA 4RANA 4ZN6A 1K6JA 1XZNA 4O2AF 1ECLA 4OYLA 1AGPA 1UJCA 4Y2VA 1S2GA 3DDZX 5BN3B 2H5JA 4JKOA 1M75A 3VDXA 2WJPA 5JWOA 3U1BA 1P8AA 1H2FA 1YVRA 3B48A 3RK0A 2J5QA 3KXLA 3AY6A 3MTEA 2RDMA 4JLJA 1TEHA 5KHOC 3AU8A 2NZWA 1R4AA 5BRAA 2ZRFA 2QVBA 1S9DA 3KKNA 5H82A 5K6RA 2X58A 1V8BA 3B38A 3MS4A 4MRMB 1PG5A 2H7YA 3AF2A 1TQ8A 4NYJR 3DVAB 3MWDA 4N3BA 4ZZ2A 5BWNA 3AY0A 5EAIA 1OE0A 2ZIXA 2YKGA 1B93A 1AMUA 2XD9A 2QQEA 4ESHA 5E1BA 3ZE8A 1VKRA 3G2MA 3T9AA 1GWNA 3R1IA 5DNYB 4YAFA 2V6IA 2ISQA 2Y99A 3X1KA 4ARAA 5C9ZA 1VPVA 4JUFA 5DHQA 4RKRA 3UK2A 1Z3IX 3V8RA 4CMJA 4QKQA 4RY9A 3U3RA 3KQPA 4FYKA 5J3JA 1YIOA 2HRCA 4IXNA 4JJ4A 3IOEA 1OWMA 4Q4HA 4DCCA 421PA 2VQFB 4CKBA 4MUEA 2PLWA 3W8RA 1Q1QA 1FTQA 4WNYA 3UAXA 3IPRA 5ITZA 1U80A 4RIFA 1KYVA 1IJKA 3DFMA 3KU4A 1RWOA 4IDQA 4I55B 4MP6A 4CRWB 5FPYA 3ISJA 1JQEA 2BHNA 3BDAA 3IKMB 4EA8A 3ZD7A 1PJ2A 3PK0A 2G6TA 2J9GA 3CRQA 3WLHA 1F4PA 1KAMA 1XROA 2PZKA 5KNLA 3PITA 2G3YA 5E6UA 4CNQA 5BOSB 1N2ZA 2BONA 2Z9DA 5JY1A 1CPYA 1SC6A 1W76A 2BGRA 4H1UA 4YV7A 5FTLA 1VL2A 1N4AA 4BLRA 3L4JA 1K3FA 3SBEA 4DRYA 2BSAA 2QUBA 2NU6B 1I13A 4D3XA 1LEHA 4I46A 4J4BA 5IX8A 4CM4B 3RYHB 1FVOA 3AR5A 3CUKA 4KRFA 1YQEA 2FRDA 3U49A 4AS2A 1U5CA 5FV4A 2JIQA 3BWMA 4LCJA 3FVTA 4MB0A 4JUCA 2FWJA 3HB5X 2YYAA 3G0CA 4UFOA 5CDTA 1UZNA 3UK1A 5B30A 1LLQA 1A5BB 1NX9A 1SXJD 4GRIA 1FBTA 3KKQA 4MUIA 4G0VA 4KVAA 3L6OO 3F9CA 2EDAA 1E64A 2CT8A 3N76A 4FBMA 4RA9A 2J7KA 3EUAA 5JEDA 1A71A 1MPXA 1SU7A 3AWDA 3HGTA 3SQOA 2KYRA 1QHHB 1YZ3A 1JU9A 4YAIA 2V5VA 1R6AA 2HL6A 2NVOA 3V4SA 4DZRA 3UJNA 2KLBA 4FZ5A 1VMAA 4YHHB 3ZK7A 4MMYB 5BNTA 3QOYA 4LJKA 1CC1S 1GUZA 1MHTA 4MYRA 5ESWA 2YJ3A 5KYWB 3ZW8A 1ZCJA 2QNIA 3AFHA 1M72A 2C4NA 3IQHX 4DJJA 2FN4A 2QX7A 4LFAB 1QLHA 1VXOA 1C1DB 4JI1B 4E4YA 2IPAB 5CRIA 1YFKA 2J30A 1U6IA 2HT6A 3BWBA 3AIOA 4FNAA 1QS0A 1VIYA 1W0JD 2FB9A 4M1SA 4WXYB 1QC5A 1M34E 4P0PB 5JSHA 2OD7A 2P1ZA 1OGYA 4A4DA 3HGQA 1ZOOA 2ZKLA 4ESVA 4ZZ1A 3DKKA 3EGOA 1TO2E 1YQGA 1RLTA 1KZHA 1ZQ1A 4CNBA 1WG8A 1EG2A 4KXFB 4CWAA 1QV7A 2Q9AA 3E2MA 4UTXA 5IXSA 1L4EA 4GLJA 3I2IA 3L6EA 3DW3X 3OCUA 4FSXA 1GTMA 3T34A 2ZIAA 3OIFA 2VYND 1R4MB 3OCWA 4GSYA 1DKQA 3D8NA 1S1MA 2HDOA 1G7SA 2I80A 4PIVA 1COWA 1TO6A 3DVSX 3GT7A 2Z09A 3ZV5A 4CMEA 5IH7A 5DLDA 4HXFB 4QD3A 2YV2A 4F0JA 4R16A 3T7RA 5AOCA 4AZ3B 1Z6GA 3Q3IA 1PWZA 1W1UA 5L3SA 3UWSA 1OZHA 1R18A 2OG2A 5DN6A 2VNIA 2NT4A 2NO1A 4CETA 5IT4A 2O1EA 3MGCA 4ONEA 3TQQA 4DLKA 1YC5A 2WFLB 3DCIA 1U3DA 2ET6A 2X1HA 2YZNA 4MLDA 2F4VB 1G59A 3OOHA 2CN1A 4TV8B 2I8CA 4YJFB 3INGA 3SVLA 5GGXA 1JEEA 3IJ5A 5KTOA 3EPRA 1X7ZA 1OA0A 4BQEA 1J5EB 4LMPA 5LR6A 3VPBA 4LK3A 3IT2A 2IYWA 4PSUA 4AECA 2R1TA 3H13A 3JALA 3ZPXA 3UY4A 2VNKA 3GEEA 1UKCA 1RXWA 2MSWA 1ML4A 1P6UA 1AN9A 4IWYA 5E6RA 4CKYA 4UNSA 3HKDA 4Z8YA 5EZ5A 3UHPA 4LF4B 2I6XA 1QK5A 4IV8A 4NS1A 1MA0A 2EKQA 1QVZA 1HDCA 3JQCA 4ZYLA 2IU4A 4HUQB 2B5VA 4LXTA 1U2GC 4R01A 2B78A 3MWKA 4BJHB 3WQHA 4BKMA 2ECPA 4A9AA 4DGQA 3ROPA 4BATA 3PENA 3QENA 1TA0A 1TU0A 4L22A 5LMUB 2QTVB 4QYSA 2WJ6A 1IY8A 1F12A 5JHGB 5AKEA 5UKDA 3N0TA 4ZEOA 4EFNA 4IGKA 1GU0A 3GDOA 2HA6A 2Q2NA 3NHLA 3ZEAA 4PXYA 4X64B 3OX4A 1RJFA 5GOTA 3TCKA 4BNVA 1QQBA 2YHBA 5EMMA 2X5KO 2CBGA 3WWPA 1I8TA 1V3UA 3RC1A 4WY8A 7REQA 3P2MA 3VC3A 9LDBA 1LH0A 1GQ2A 3EOBI 5ES4B 1ISIA 5ULLA 1EFDN 2QUIA 1N2OA 1WXEA 2P4HX 3PI7A 3GJRA 3RIGA 5K45A 2AN1A 4GPEA 3VNUA 1SU8A 1RYYA 4UPDA 1ZVVA 2Y0DA 2H2AA 1URPA 3B2NA 5ICEA 3GVXA 3H5NA 3O8LA 3UA3A 5IDQA 2O7SA 2XMPA 4RZIA 5CLGA 4YMVA 2ZE6A 4G24A 4LKOA 4ZU1X 3VU0A 2H4ZA 2HRDA 2V0CA 7ADHA 5HUJA 1Z35A 3SKYA 1SOMA 3OICA 4LYGA 2QPOA 1IOWA 2H4JA 5DSZA 4D9MA 2GHQA 1GNVA 1I14A 4Q47A 1QJCA 2OHHA 5ECGC 4WZBA 4HEHA 3RYTC 5KVCA 3L07A 5U9CA 4AS1A 5D1NA 5JCOC 4U2KA 5CG2A 1IZ8A 5DOVA 4JENA 3S2EA 3FMFA 5AVZA 4TYWA 2OGZA 1MR3F 1MC1A 1JKMA 2YWRA 3AVOA 4ZOLB 4LOJA 2CYCA 2FXIA 1EUDA 2YJ4A 2ZWMA 3H1TA 2K6GA 2QPLA 4RMNA 1C29B 3DZHA 2CUTA 1DTSA 3OM0A 5AW1A 2Z43A 2B1QA 3G17A 2P6MA 3JVVA 3UT5A 4RTLA 1NDHA 2QQGA 1Z9BA 5ALIA 5EZYF 3OBIA 4QLAA 3ZTTA 4ZIRB 1Z63A 3SE0A 2CE7A 2NMVA 1B3RA 1I7NA 1QZ3A 3QMMA 1SCBA 3TZLA 3DLHA 4DCNA 5IFLA 3VNRA 4LQLA 1T1JA 1SHZA 1TJ3A 3BGWA 3R23A 4K05A 4X91A 5JCOA 4DM7A 3M34A 1MRSA 2JLVA 1DTEA 1T2EA 3SJZA 5BWCA 2PBRA 3EXHB 3WMFA 2EZ9A 1AKTA 1U7ZA 3BD9A 3MJRA 5EMNA 3ZNNA 4BIMA 5C53B 1NMYA 1FUKA 3PXEA 4Q37A 5CTJA 3PWZA 3PHLA 4KJZA 4NG5A 4EKGA 3O74A 4QX6A 2D1RA 4ID3A 4R4JA 4HB2A 3JQRA 1FRZA 1SY7A 3C6QA 4J0EA 4R2MA 5BURA 5LQMA 2V58A 3GUYA 4E5SA 2CLSA 4HQ0A 2ZPAA 4NE9A 3M6VA 1P6QA 1NNUA 3WV5A 3WDMA 4F86A 1ZMOA 1U7HA 2A7XA 3HQ4O 2QZJA 1VLJA 3D6NB 5EJ7A 5I7AA 4I50F 4DR4B 1K75A 4A23A 2FQYA 5H3HA 2F1RA 1X19A 3LAWA 2EXXA 3N0XA 4OBWA 1E2MA 2PKEA 1JHUA 3EDOA 1CUBA 4QOJA 1JVNA 4ZA2A 5LP6C 5HOQA 2A1TR 2FN3A 4RF2A 4YR9A 4IOKA 4NHOA 5JZOA 4MQUA 4V0RA 1T43A 3STWA 4EG6A 2HA0A 3WHLA 2IYAA 4MR9A 3MVEA 5GONF 1M7BA 4JAVC 3H1BA 3ZE0B 2VCYA 1NJGA 3JZMA 3O1HB 5ENVA 4P7FA 3KD2A 2FSPA 1Y34E 1JHZA 4XGQA 4S35A 2R3SA 3P0IA 4YAKA 1WR8A 4MKHA 2OCBA 2FZ4A 3VXKA 1SG6A 3CW2A 3LXRA 1ADGA 1EAMA 5HOEA 5JC8A 1C3JA 4OQMA 2PUGA 4RU1A 1EUZA 1N1DA 1DP4A 1SHTX 3OJWA 3KZKA 3GU3A 5BO5A 3BRWA 2EZTA 2ZUCA 3C3BA 3DEJA 5C7LO 2OENG 3K1YA 4PU0A 2Q28A 4H17A 3G7SA 3KQNA 3H9QA 1TC2A 2HK7A 1BS2A 2PUWA 1D8TA 3FGPA 1T2VA 2COUA 1BD4A 4BFSA 3PLRA 1XDDA 4LQ4A 3C45A 3OZBA 4D9JA 1HT2E 1Y4UA 1LV7A 1OFVA 3B1XA 3KKZA 1FTNA 4YXFA 3UWMA 4B4VA 4FJ0A 1YULA 3IYLW 3LQRA 4IQ4A 2GKGA 2AG0A 3UJPA 3HM9A 2D2XA 2X6RA 2W4QA 3RTEA 4MRVA 4IYJA 1UFRA 3M5DA 2OC4A 1JLSA 3L4BA 3PJGA 3ZXYA 4DPLA 1NT4A 1OBCA 2XY4A 1FFYA 2Q5HA 1GGHA 1DCKA 1JSCA 5CDGA 3EG9A 3EPJA 2K5UA 2PQ0A 1GYQA 5D85A 2WICA 4ON9A 7YASA 3ZJ4A 5IFKA 4N03A 1N92A 2QRUA 2VZEA 2DFKB 3GUUA 3PT9A 2BFDA 4DMFA 1LF0A 2CL6X 1T0BA 4EDHA 1A4IA 4Y8VA 4QGAA 4C0AC 3HWX1 2QE6A 2BZGA 2OORC 3E5HA 3M6LA 4LBYA 4W1PA 2A35A 5MFZA 3FF4A 3BQ9A 4AP9A 2JLUA 3TQOA 4HCJA 3ZWNA 2PN1A 1DKRA 2XQJA 3JX9A 3ME5A 5CLFA 1Z8NA 1VP9A 4QTZA 2P91A 3ASVA 5AHXA 1CW2B 2DBZA 1CU1A 4PCUA 4EW3A 4UTRA 5LJLA 2FF5A 4G0NA 2PZJA 1W5BA 2ZRDA 3GHYA 3CZAA 3KELA 3VZDA 5IJ9B 4AS3A 3WIOA 1N57A 2GTPA 3JASB 5LDHA 4DDWA 4PBTA 3RSLA 3GFRA 4H4EA 4LZJA 3HSKA 2CJYA 4BJ3A 2UUOA 1M0TA 2KJQA 3ECCA 4N8DA 1V1RB 1K88A 2FPOA 2PBZA 3EXG2 4QU5A 2GD2A 3COZA 3HNOA 4FJ1A 4JL6A 3W6UA 2W6JA 3E0XA 3I37X 1TQHA 4INPA 5I47A 3EGIA 3UFXB 1U2EA 4UXJA 1CHNA 1AB6A 1U2SA 1XZPA 2APJA 1G63A 1P1CA 3EZ7A 1TF5A 2E2WA 5J5CA 1KEEB 2YIDA 4GVPA 4TQGA 3IUMA 4TQUS 5HF8A 1IG3A 3ETDA 3N2NA 1OB5A 4OP2A 1F3LA 3P52A 1AGXA 4NCXA 4C2BA 1XU7A 1XQWA 2R8ZA 4TS4A 1JIVA 1ZBQA 3I6YA 4JJKA 1MFZA 2GFQA 2WA1A 4C14A 5AVYA 2O8NA 3FWYA 1U98A 2ETXA 3FZQA 1QTIA 2NU9B 1P73A 3U9SA 4D44A 2BR3A 3P9IA 5BQOA 3VU8A 2RGDA 1VFNA 2H5LA 1C3EA 1J0DA 3T35A 1ODSA 1DUIA 4L74A 1KDTA 3E82A 2ONKA 2A0WA 3GH1A 1QPBA 3HCWA 3RTCA 4DLBA 2VTBA 5JLAA 1D6JA 1QR2A 2GBCA 2PZAA 1Q0UA 4UOEA 4I19A 5JNVA 1AGYA 1JJFA 3UO8B 3ZIUA 4JUBA 3Q15C 3GLVA 4U7DA 3R7BA 2IPOA 4EFMA 4MMZB 2X7JA 1CYEA 1CUYA 2UZIR 2CLFB 1PVVA 4DR3B 3PL5A 4GR5A 2LR0A 1C9JA 3O91A 2QLMA 1ZK4A 3WLPA 3GGSA 4F38A 2Y8EA 4O0LA 4IW3B 4FFDA 3BGSA 3K3PA 2Y92A 1C14A 2EHJA 2FW9A 3D0OA 4CMBA 5BV0A 5AOAA 4L5AA 5AKXA 1OVMA 5JJKA 4ETIA 2O8FA 1XKLA 1MG5A 4ZO4A 3CM0A 1PQYA 2EL7A 1L4UA 3RVRA 1NW3A 1TM7E 2BOVA 2VVTA 2VRCA 2DG2A 1DLIA 5DWVA 3IP1A 3K2EA 3CW8X 4HXGA 4LSWA 2J67A 3SR3A 4IIJB 3RIEA 5AQ1A 3PRJA 1ZOPA 4IFBA 3DXZA 2BH9A 3HACA 1QVVA 3VTFA 1I32A 5DYYA 4GE3A 5F76A 1MJGA 2Z6VA 1KIFA 1L4FA 2AG6A 2UYYA 4RZ3A 4Y6LA 4ZC1A 1W46A 1U7WA 4NJMB 4RXUA 2NVBA 2PZMA 1ULTA 1A4UA 1M2HA 2J0QA 1PQ4A 1IHYA 2ERYA 1J99A 3IV7A 1NWHA 1AC5A 3D6TB 3GAAA 1UBRS 3KQTA 1NJ5A 3MTGA 5EUCA 5T3YA 5B6JA 4PAMA 3CHYA 1HTTA 1KQNA 2JKYA 3RQIA 1N2XA 1G2PA 3ZBUA 4OQYA 4EJFA 1M2OB 2RH4A 3GRUA 4AF8A 3H3FA 4HDKB 4N65A 1PR3A 1E6EA 2VDJA 3CRNA 3GCGA 4TT3D 5AI0A 2TECE 4IHJF 4PN7A 2J85A 4N76A 3RS2A 1CK4A 5LA6B 1UAYA 3OZGA 4I55F 3UJDA 3N6XA 3D4NA 3I9JA 3NTUA 4U63A 3WKEA 4KQHA 5KCMA 4BMZA 5BSGA 3ZJUA 3V7NA 3IMFA 1YB4A 3A6EA 3VKWA 3BD6A 3FYTA 3D8RA 1A97A 3D3KA 3HKEA 1ZD4A 3EMKA 4HGNA 2OXIA 4D46A 4RO0A 1QRAA 3RUIA 1PYOA 3R7SA 1SKUA 1PR1A 1Q17A 4LYEA 4HJXA 4JT9A 3PVZA 4BLSA 4L75A 3CNNA 1PP4A 1PR6A 4OBEA 1GKKA 4LJLA 2BFBA 2ZJ2A 4MPDA 4MW4A 5AKZA 4YT2A 1N6PA 3WYGA 5JIBA 2XXAB 3QMWA 2RH8A 1XEWY 1UBGA 1H6DA 1HEYA 1RWVA 2NAPA 3UOWA 1B15A 3K6RA 3LRXA 4LRQA 4QTYA 4RMHA 4WN9A 2JI9A 5GWXA 2INGX 1SUCA 2GBFA 4H08A 4BEBA 3VMFA 4OJNA 3QA3E 4TV9F 4JNCA 5K3CA 4GPAA 3UH0A 4C03A 4KGVA 5BVHB 1L4BA 3AOEC 3H5WA 4UTVA 5CFMA 3JQBA 1UM9A 2H2DA 3B9QA 1C5KA 4CR6A 4AJPA 3PUYA 4YJFA 3H17A 2O4UX 3IODA 4ZOAA 4OOFA 1CUWA 3V3TA 1NTRA 4ZCLA 1LPPA 2OV2A 1KXZA 3R7NA 5AIBA 3EA0A 4UHDA 4ROTA 3L41A 4RJIA 3SF8A 1MMFB 4B47A 4BV3A 1JXAA 4IGAA 5BT9A 5CXSA 5LD2C 1LJUA 3H7AA 3G9XA 4A2CA 1C0EA 1TM1E 1WU7A 4B48A 4GC5A 1WE2A 3VJMA 4LF8B 4UMDA 3RG2A 4BKOA 1OCEA 1T0PA 4AX4A 2BTQB 3SN6A 1FP1D 1QP8A 1DQZA 2QTZA 4KN6A 1QV9A 2MSCB 3ABRB 4QDJA 4ZMSA 5IN5A 3WE7A 3CT6A 3NHYA 2B1JA 4H7IA 3KJQA 5J23A 1RI5A 5CX4A 5CBPB 3S70A 4ZVOA 5CYOA 4QSMA 5CVJA 2GHRA 4ZAVA 2ZWPA 1Y8AA 2ZJAA 4M98A 3TEJA 4UUNA 3S2IA 1U8FO 1YB5A 3WYNA 4A6DA 5H9WA 4L2IA 1J24A 5FBVB 1XPUA 1G0OA 4AZVA 5IAOA 4FR0A 3IOBA 1DQYA 4OSEA 2B2XA 3SHVA 3GGJA 3E3MA 1THZA 4NBKA 4OQXA 3CBGA 4RC9A 4B31A 1SXHA 5AO9A 1GRCA 2HMVA 3BZWA 4IL5A 1ORWA 1CXZA 1WM1A 2PMBA 4M7WA 1RJGA 5ED0A 3HEAA 3RQSA 2QTTA 2BBWA 3RYFB 2ZB4A 3SBXA 4DQDA 3OF3A 3ROFA 1HT3A 3RYIA 2C96A 1UKEA 2GBPA 5IK2A 2Y71A 3EXHA 4FMDB 1V0JA 5C35A 1BX3A 1E5LA 1XD8A 4QHYA 1E0JA 1N9KA 2YOHA 3CSUA 1FDIA 2HYDA 3GYGA 1BKYA 4HH1A 4I1SA 1KJYA 4G86A 1N8TA 3FDJA 2FMUA 3BTSA 4FI3F 2HQRA 2VSFA 1QV6A 3BMXA 2BT4A 4NYMR 5LB2A 3RBZA 4KGDA 1TGVA 5AKKA 3RTAA 1BE1A 1NONA 5JCZA 1GGNA 1I4DD 3I58A 2XH8A 1L5QA 2OCAA 1GZUA 4MR8A 4QUIA 2R1ZA 1MEJA 3P7MA 3FCEA 2REQB 1D6NA 4J8PA 5KTSA 1CE8A 3L04A 1KYQA 4MQMA 2O8CB 3F67A 3H4TA 4HAWA 5KC8A 3PU6A 1OX4B 2B5WA 1BFUA 2RGEA 2YY6A 4WGGA 2OE2A 4Q3AA 3ZWKA 3A25A 3HBLA 4Z7JA 4IM7A 2BLLA 5IAAA 1T9HA 3NYIA 1N9GA 3QUAA 1RJEA 5GAJA 5T67A 5JROA 1G6KA 1HT0A 3ANMA 2Z2JA 2GYYA 1U5BA 2D74A 2G5TA 2QRJA 4S2EA 5DEOA 4EKEA 2Z6UA 3E9MA 2BEKA 1U9IC 1JJVA 2YJNA 4LWOA 1ZRMA 4YI5A 3ZY6A 1DE0A 4ZZIA 5CFQA 1H8HA 3QOWA 8ATCA 5KTNA 1BE8A 4DWJA 4FZJA 1XZFA 3Q9NA 3G2OA 4CMGA 1HL7A 1Z25A 1UBOS 4Q24A 5KBYA 3EZ6A 4BFCA 4AAYA 4WNCA 1P9WA 3K09C 3OQPA 4MITA 3DYBA 3JAMA 2I6QA 4C9BA 4P5EA 4NNPA 4FMCF 5DRTA 2AF4C 4BGVA 1E1QA 2W0SA 3JCZA 5DCWA 4EPTA 3SC2B 5F4ZA 4RQBA 2YUIA 5DM4A 3AR2A 2Y1OA 3FPKA 4X41A 1MO3A 3WSTA 4ZJUA 4O2BF 4KR3A 5HMMA 1JPUA 1KI7A 4XCQA 3T9CA 5E3JA 4DMHA 3CNHA 1KO4A 2JGKA 1VE1A 1XPJA 4L5CA 5LQSA 1JHDA 4HYEA 3QBJA 2CXOA 4KLCA 1RBQA 4QTUB 3RSCA 1GRQA 2R11A 4NXMB 2ZRKA 3HXQA 3PHGA 2JS7A 1ZITA 3SDZA 5AW0A 4EARA 3SJBA 5ER6A 5AIAA 1KFBB 3I1FA 3DEIA 2ZJ5A 1EA7A 3QY9A 2YL2A 3ILHA 3Q4GA 2V6GA 1Y9AA 2DUMA 4LE2A 4QBHA 5KPJA 1OWLA 2BBSA 2WD8A 1AMNA 1N32B 4PHCA 10MHA 1FMFA 3T5AA 3CNEA 2PG3A 3MMSA 5EG5A 4DYHA 4Y9RA 2OZLA 3DOJA 1A9QA 1WB5A 4Q1BA 3D31A 4YFVA 1RMQA 5A71A 1R2QA 3S2YA 4BDTA 5LLTA 1A5SB 1U90A 3QX3A 2PEYA 3PXDA 4G2NA 3HHEA 1DKOA 1JBEA 3CJTA 3VVBA 2QVXX 3GZNB 3NT5A 1V35A 1K9SA 5KNBD 2QD1A 1QGYA 4DBVO 4HMQA 4BFUA 1EVZA 2JPDA 1KFKB 4RHXA 3H9JA 1TAHA 3DAPA 1M2JA 4CN8A 1X7XB 3ADBA 1RKVA 2QVLA 3M9LA 3PZBA 4AT1A 3HNPA 1SIWA 4G41A 1FC0A 1SOUA 4IUYA 3O90A 3KJIA 3ZE9A 2J0UB 1W36B 1YJXA 4V3BA 3E1GA 3LG2A 1X9HA 1XN4A 1JHAA 2J31A 3WDKA 4BNMA 3SQNA 3JWGA 4QREA 4BKRA 3LLSA 2BGLA 2KPOA 2M1XA 5DTJA 3WZLA 1XLWA 4Q39A 1HBJA 5F78A 2PUJA 4M0MA 1YD7A 5LXTA 1DC3A 3IT3A 2D59A 4OF4A 3UMYA 1YSCA 3U37A 4C1BA 2PA0A 1FW6A 1FQOA 2FSIA 2RHJA 1D2GA 3PCRB 4WCFB 2FK7A 3LTNC 1VIAA 1E7SA 3M82A 4RJKA 4ECEA 1FYXA 2X19A 4QRHA 3LYHA 1M3SA 5IUNC 4KWIA 5AYVA 3NVAA 4N3GA 4BNTA 3ZLVA 1TMYA 2UZAA 2E7ZA 3KB8A 3QVTA 3QUSA 3RC7A 3QGMA 3U7QB 1FYFA 1QG0A 2W7TA 1U0OC 4I4IA 4UBIA 3OFNA 1X74A 3LKBA 3HU3A 3D8HA 2G4CA 3T7CA 2O1SA 2IBSA 1XMOB 5IUJC 4W82A 4URZR 1DBRA 3G89A 1C7JA 3THOA 1NF9A 1XTZA 1RADA 5AHWA 3TG2A 1MO4A 2AOTB 3ID6C 3NRJA 3UXMA 5H02A 2IXBA 3H3JA 5CEJA 4AICA 1A27A 1ZI8A 4MVXA 4Z4QA 1U4OA 3FRIA 5CB4F 4I36A 2GM4A 4IMIB 4GP7A 5L7TA 3DMPA 4OSPA 5SZIA 3A9VA 1JLLB 3H2KA 4LWQA 4ZT7A 1K5DA 1RXYA 3OT5A 4IDHA 1S6YA 4C4RA 4DUGA 2RIPA 1O9GA 4DXDA 3C3DA 3NI2A 4LC9A 3S2ZA 3X3HA 1XXLA 2E18A 5D7BA 3BHNA 1R9MA 3UYLA 2BUAA 2QT1A 4TMYA 1F0NA 1VL8A 2XKAA 1EEXB 2VXCA 3DR5A 3QPVA 5FPTA 4R2WA 5EZYA 4BYGA 2C9ZA 4GI5A 4JH0A 4WXMA 1IPHA 1XCBA 1PRYA 5FBQB 2JARA 2XWSA 4P84A 4PX5A 3TNYA 3Q7PA 2AG5A 2DPHA 2X0EA 1Z29A 1HX7A 1TVMA 3DQQA 1FDVA 3DAFA 4GXQA 1SRQA 4HZIA 5C4GB 3EFBA 4D9NA 4ZU6X 2E4AA 1WVGA 4AY4A 4KQGA 4HNQA 4FHFA 5IJZA 2GN2A 2VH1A 3SQLA 2H59A 2BMFA 1NN3A 4D57A 2BELA 4B33A 3I92A 2I34A 3PFWO 3R0JA 1WX1A 2JLAA 2QLTA 1ISHA 4NZZA 2FPIA 3C3CA 3DGFC 2OCIA 4B3FX 3K9QO 5JALA 2O6LA 1TEVA 4JY7A 3I2GA 3FR7A 1ZVMA 2AN4A 1Y7TA 2AX3A 3ICVA 5EJFA 2D0DA 5IAJA 2BMAA 3DXYA 3WI7A 2CF5A 4BRSA 3VC7A 4JOBA 1DOZA 3TQTA 4NVRA 1IYZA 1WUJS 1J2EA 2PMWB 2AN9A 4N5NA 2JAOA 3H9GA 3DNFA 3PGXA 1USIA 3MYRA 4P7KA 3GDWA 2E48A 4X1KA 3OP4A 4YVFA 1L9XA 721PA 1JG6A 4FB5A 1MQSA 2ZJ1A 4GXRA 3EMVA 4YRPA 2JEYA 1HDEA 1CIVA 1XP8A 5BW8A 4ZQBA 1IRXA 1O89A 1BS9A 1WO8A 2QPTA 3E8SA 4HDKA 4E5NA 2H1RA 3U19A 5C5IA 3PXCX 4KWCA 1FMCA 5FNVA 2Q7XA 1SEVA 1NI3A 3IOYA 3IP5A 2GARA 3OTIA 4LX0A 4B85A 3ZDDA 2HXGA 4BYMA 1FNSA 1LY1A 3K2BA 3U9TA 4EO4A 2P9JA 3G88A 5DV9A 4G5XA 1KE2A 3GT3A 2C3YA 4PIPA 3DGEC 2ZJBA 4FPXA 3UAVA 2IPXA 5JXIA 3GJ0A 3DMGA 3IP7A 5FI3A 4DNPA 1L5FA 2HQSA 2VBGA 3OE7D 3U0BA 4X94A 4YP5A 4C0XA 4HXEB 4FOOA 4DXHA 3OQIB 3G1WA 3I5UA 4M1YA 1NQXA 3CRRA 1V8ZA 2BFDB 4TS9A 3GLRA 1F6DA 5DXAA 1TJ4A 3P4XA 2H00A 2AN5A 1Z12A 2CLMB 3AUFA 5CCDA 3Q87B 1E3WB 3DBOB 1KP9A 3OVMA 4CM9D 3NGXA 1G20B 4YEDA 5HRCA 2B6NA 1X80A 3AR8A 1I30A 1K68A 1Y37A 3ZQUA 1NXWA 1L7QA 2HXYA 3JW8A 4HK4A 3FGNA 3AETB 3TZHA 2Q3LA 4C6SA 1MHPA 1UEIA 3TWOA 1APBA 4R1TA 3DE6X 3ZDBA 1FLNA 2CMFA 2DYKA 1JT9A 3BXGA 5KHLB 5LP6B 5AJZA 5DHRA 6ABPA 4WBXC 4RVUA 2CHQA 2I71A 3LBIA 3TJRA 3I2KA 1OXBB 3I6QA 1Z0SA 1PL0A 4NMMA 4OIFA 2HWYA 2JBHA 4YUXA 4C04A 4ZAGA 3R4CA 3CT4A 3ICWA 1E2BA 3LC1O 1QO9A 3BAFA 3L1JA 3N8IA 4OI1A 2O3JA 3MUEA 3W04A 2IBMA 3NJ8A 4NFLA 4CQMD 5K09A 5EJ5A 3GGPA 4K9DA 3UMJA 1GNRA 3AB7A 2FMHA 5T4HA 1LDBA 4CM3A 2EIHA 4F5EA 1C7RA 3VYUB 3W0LB 3NBQA 4B6RA 2ODAA 4FHDA 2O2IA 2OTCA 3HN6A 1FNBA 2R9VA 2VI5A 4BNNA 1EZZA 2UZ1A 1H2YA 1VI5A 4V0NA 2RGRA 3K2IA 3BE4A 5DGTA 3LLVA 1EWQA 2CNWD 2HI0A 2D7DA 1PL8A 1SKQA 4YJ3B 3T3GA 2QA5A 1I36A 3K0BA 4CEJB 1YR6A 4L8YA 4L3VA 3PGJA 5TQ2B 1NMSA 1KBZA 5DHPA 5J2TB 3IXLA 1VOTA 1GM5A 4JVMA 2J6HA 5K6AA 4J0QA 2CJFA 3EF1A 2F1OA 2NUTA 3IAM1 3QWHA 3KHSA 4J07A 1WCIA 4KN8A 4JV5B 2CUNA 2L69A 4MS4A 4H0FA 3BKWA 3BMOA 5ALUA 4ACAA 4MS3B 4ZKDA 1J9GA 1XZQA 3HMKA 1RYDA 2JGAA 3A70A 4MAFA 5JAHA 5JXGA 5K5EA 3Q9LA 3AW9A 3F5SA 2NU8B 1LVGA 2RHCA 1YC2A 2HUNA 3O4RA 1FZQA 1O94A 4QU9A 4XB2A 4XTRA 2HIMA 3TZQA 1BMTA 2YNMD 3NHRA 1QTNA 1NLUA 1WHTB 1Q3TA 4B5KA 1Z6PA 4YRQA 4N01A 3STVA 3G2HA 2W37A 5HQTA 4DZZA 3IHTA 3AKEA 1QNLA 4KR6A 1MH1A 3IPYA 4MGEA 1DTWA 2IH4A 1UXGA 2HREA 5HX7A 5IG2A 1YHZA 1PFWA 3PDWA 1PSWA 1LK0A 1XMXA 3HPQA 4DJAA 2JH3A 2GWRA 1EXDA 1JDSA 2W71A 5BR7A 5IASA 4S1TA 2HFKA 3IUBA 4PWYA 5F9MA 4WLVA 3WLJA 2D7JA 3EC1A 4LXIA 4AROA 3COJA 1NC3A 2GUGA 4N7MA 4CT0A 1T0IA 1SU6A 4EKIA 2Z4TA 3PE6A 3CURA 5TNXA 3L8FA 4TUYA 5A9SB 5JMWA 4TX1A 2H65A 1X7WB 2CMGA 3KUXA 3AVTA 1P4SA 5CLIA 2J6IA 3IP8A 3ROEA 4ZOLA 3GPDG 1O5TA 4BUJA 1WQ3A 3L7JA 3ZHZA 1RBMA 2IUSA 1GR0A 1PV1A 3N2IA 1KSJA 4P4NA 5NLLA 4WUTA 3VJLA 2BUCA 3BN3A 5ICGA 4RM2A 1K7XB 5TMDA 4CTMA 1WDTA 2GKOA 2JVJA 2BP7A 2QL6A 3QUBA 3A1EA 3C1UA 2RBGA 5EJIA 5BSUA 4KNYA 1CHDA 1ITZA 3KAQA 1AH2A 2CC2A 1UDBA 2IHTA 4I5FA 4IEFB 4O2RA 4Q7EA 5AW4A 5K3EA 1A1VA 5KEIA 3RD5A 1BX0A 2YVKA 3WY9A 3UNXA 5JJCA 3R8FA 3K0AA 2VNSA 2CMKA 3FUWA 3VH1A 1N5OX 2C4VA 1W85A 3LIPA 3L6UA 4L0MA 5AKIA 5JZ9A 3AR7A 2HWUA 3RYIB 1RDFA 5D00A 3MB5A 4QXOA 5ELMA 1HL3A 3UMRA 1RXCA 1JEYB 4ENRA 5KWEA 4CM5A 3IUJA 5C7YA 4IDDA 2GB4A 2EG5A 4PFKA 5G4KB 5C5EA 1ISMA 4FHGA 4R68A 4FONA 1U2ZA 2VT2A 4A1FA 3K53A 2A59A 1PVDA 1Y8CA 3JPWA 3NR2A 2QXUA 4KOEC 3HP7A 5JZVA 1E0KA 2HJHA 3HDQA 4H27A 2XCQA 1P62B 2E6UX 4WN9B 4DQ0A 2GPTA 2YV1A 4FFOA 3T8YA 2FOXA 3TIIA 2OBMA 1OVGA 3AYZB 2QTHA 3HKBA 1NWCA 3L7MA 3LY9A 3L7BA 3UT6A 2KHZA 3IEPA 4IKEA 4RD1A 3JZDA 3FFBA 3LUKA 4JJEA 1PUJA 1Z6TA 1HPLA 3PFBA 4IIYA 1JYFA 4OHOA 4RQUA 3RKRA 1U9JA 3V3KA 4J0IA 4A73A 4CGZA 3U48A 1UOOA 3WAGA 4CL0A 1OOEA 4NF2A 5BVGB 4H9GA 3I04M 2XCSB 1ANKA 1JAYA 5EKTA 4KQ2A 1SUEA 2P0EA 1DRVA 1H2ZA 1XXHB 2GK4A 1OIVA 3ICCA 4X95A 3RKSA 3VI3B 1JUDA 5BUCA 3HNRA 2O54A 1E92A 4XIIA 1MABB 1T24A 2CHGA 2ECQA 3LYUA 5ALDA 3RUAA 3SEZA 1GTZA 1D2CA 4IQGA 4AZ0B 4EB8A 4MW7A 5LZ4A 2CDCA 2R00C 2ASEA 4R1MA 1L5MA 1C30B 4YA6A 3C5WP 4M6WB 3D6JA 1GPKA 1NHGA 1AHPA 1ZWKA 2FAXA 3GNSA 3F6BX 4IY1A 3LZ6A 4YRTA 2CL7X 2GESA 2I55A 3ZCTA 3ZXXA 5H16A 3WMGA 2QUZA 3AOEA 2BBOA 1A4RA 2V7TA 5G41A 3VU1A 5D6OA 1P2TA 4AY2A 2GLXA 1P18A 4UJ5A 4KEAA 3RSGA 1YBMA 4M9CA 4I8IA 4GM0A 1Q92A 4I1OA 1IXKA 2FLWA 2WLSA 1TEXA 4MVJA 2CVQA 3E23A 3M5CA 4JN6B 4ALKA 5CNMA 1QMGA 3ET5A 3IBFA 5ICCA 1QIFA 3QV2A 4EG5A 3O84A 2IBTA 2I2FA 2VG8A 1EB9A 1CULC 3C7DB 1AHHA 2CEAA 2C4HA 3DMRA 1IQUA 3V42A 2ATEA 2H3EA 3G82C 2ZT5A 1O0CA 2WT4A 5CJJA 5J2UF 3PKJA 3A05A 4QDUA 5CVTA 4P33A 2G4VA 1SVMA 1GUFA 1GN9A 3FVQA 1IIBA 2PQ6A 3KLOA 2C2XA 4QUHA 3O9VA 4Z8XA 1SCUA 3GX1A 1OBFO 1QIGA 4CG2A 1KBOA 1YE8A 3SZRA 1MVNA 2XB9A 4YP0A 2FFHA 2JGFA 3TK1A 1O97C 2DJIA 5T3UA 5CHYA 1TFUA 3NC4A 1DOAA 4XSGA 5TGZA 1DV1A 3UFBA 1TAUA 1GTJ1 2CJWB 1WW3A 4R8VA 2XT6A 4YONB 4MROA 3WGVA 5L7WA 4NABA 3GLGB 1YS4A 2MSDB 1GUDA 1DQPA 4GOJA 5ALEA 3DWGA 2P2GA 5JAMA 2REQA 2VK4A 2QJTA 1VCHA 5FLEX 5I7UA 2MYNA 3PUJA 3GBVA 3NIGB 5C1OA 5FLKA 3DH0A 2XZTA 1XTKA 4FINA 3RU9A 1DIRA 1ZN9A 4QVIA 1G8PA 4E11A 4AKEA 2XGSA 1DJQA 1RXSA 4PLTA 1SVUA 4DILA 2OP1A 1XVTA 3Q6NA 2X23A 4P4SB 2GRJA 4ZVVA 5K0NA 3K8ZA 3ZVRA 5BNIA 1I6LA 5B64A 3VI4B 1Q1ZA 1RS0A 3BZBA 3NP9A 3ZHOA 4EYGA 4HRVA 3VH4A 1ABEA 3H75A 2DBVO 1UFKA 3ZVNA 1P7PA 1LK7A 5JAQA 2EGHA 3WKDA 3IA7A 1N2EA 4L4YA 1K7CA 4N5IX 4QPPA 4EHKA 4M38A 3WTBA 5LMCA 1A8IA 2ZB3A 3PDJA 3EBLA 4M49A 1NBIA 2ZR0A 3ND8A 4KC0A 2WUVA 2GJKA 1QZUA 4JU8A 3WGTA 3QVGB 4Z9YA 3A31A 5HQJA 1BC5A 3IOMA 1IN7A 4TN5A 3MD0A 3QPCA 4KH0A 2PXXA 4UULA 4JLWA 3JQ9C 4XIJA 1K27A 4JA2A 3WGLA 4HDOB 5HKLA 4QT0A 1T3HA 4NZMA 2P9GA 2IEBA 4JC8A 4LTNA 3A7DA 4CTOA 1XZHA 4F3NA 1E20A 4Q5IA 4HQKA 1YDGA 2P8JA 1BCSA 3ST7A 1J00A 1QLWA 4FE7A 5D01A 3KQYA 3NHAA 3THYB 5DW0A 4IZ6A 1P5HA 1XHEA 3I72A 3FPGA 5FUMA 3O4HA 3UV3A 4JVSB 5KKCA 1UQTA 1X6VA 3FSJX 3LGAA 1D2AA 1BSVA 2JLQA 1C2YA 2OCLA 1CB7A 1G64A 2XVMA 4KRGA 5H5JA 4OK3A 5CHEA 5AM3A 1YUNA 2G40A 3JYQA 1JXOA 5GM2A 2VWPA 1Z2AA 1SZCA 2HJGA 2O8DA 5BSKA 4F92B 5KOJB 3PD1A 1DPFA 3IELA 1DG3A 1WVMA 4DAOA 1F0PA 1KI8A 1ZC3A 2NNLD 3ZZ1A 3DLIA 3HBAA 4FU0A 4RTRA 5A2GA 4LKRA 3ZR4B 5AVXA 3N59A 4QNMA 2HX1A 2IDZA 3HFSA 1Y1PA 3R5XA 1LPOA 1TUBA 4EG7A 2XT0A 1CDZA 5B58C 2CV2A 3SHQA 1J0AA 2EFCB 3D3WA 5IJ0B 1QKKA 1RYMA 4BQFA 2YZ2A 2FPIB 4G5RA 1RJ9A 1LZLA 3T5GA 2FUG1 4F85A 1CEYA 1F5SA 4WEOA 1CS0B 1JQBA 3HJBA 5EJ2A 5C1PA 1W4AA 1OLUB 1HLFA 3PWKA 2WTXA 4TLBA 4GW3A 3HXMA 1A2BA 1SOAA 2FEOA 3TL3A 4YRIA 1SVIA 5HSGA 3HJCA 5AK6A 4FBGA 4X66B 3H0CA 4M1WA 1XKTA 3EEIA 4Y2TA 3VMMA 4CCWA 4X65B 5FO0A 2VCHA 2Z1NA 1II0A 4YLGA 2I6FA 3N39C 1VE3A 1Y4DE 3R6LA 1HNNA 1NUTA 3PPIA 4G4SP 4I5DA 3LBNA 4PZ0A 3H5VA 5J58A 1HE2A 4PZZA 3GROA 3WWZA 4Z1MD 4Q9HA 2H06A 5J1TB 4TKVA 1AQLA 4CEHB 4OA8A 2VL7A 1R0WA 1INLA 1PT5A 3P2YA 2DQKA 1BOFA 1Y8RA 1WB4A 2C4WA 4I3HA 4DLAA 3GRRA 3IAFA 3QE3A 3LT0A 3NU1A 4KRYA 4ZZ3A 3V46A 4IXTA 2H2GA 5H3CA 1OHHA 5FLXA 2WKQA 3FYUC 1GPUA 3DHNA 3O4JA 5AJTA 4JC5A 1W36C 3L0DA 5F7JA 3KOMA 4YJ3A 5AW3A 5AXCA 2C9MA 4D8YA 1MW8X 1G4AE 3EQZA 4WXEA 5CNIA 1I4TD 2Q2VA 1DSSG 2CUKA 4WH0A 2BGKA 1NF8A 1XU4A 4B8YA 1A4XA 3IIMA 4F4FA 1ZD5A 1QUEA 2FG7C 4AQDA 4B6EA 2FSSA 2XRMA 2JJ2A 3C6ZA 3PP8A 3W05A 1KE1A 1DC4A 4NARA 3T1TA 1ZY2A 4V1CB 4TZ0A 1CEQA 1O96B 1MN6A 1PWHA 2I62A 2O5EA 1I9GA 2KWIA 3GMSA 1N5KA 4LSGA 4Y2XA 3CKMA 4CODB 4XDZA 1XEXA 3TNLA 1GP2A 2L0XA 2V6FA 1UP6A 2QTRA 2GN4A 3KU1A 5FJJA 4EO7A 4BVKA 2IZ7A 2XNDD 2DQYA 3GVPA 1CUIA 3BIXA 4BO8A 3BRSA 2ZCUA 1U3TA 4BU0A 4ZTUB 1U11A 4F1KA 3O6VA 2V3CC 4UDNA 2YWCA 5DXJA 4JS0A 1NFRA 1TKAA 1VYUA 3QG5A 1JS1X 1VBKA 4P8RA 4F21A 2GBIA 1PJRA 3MSCA 2NACA 3KOOA 4OQNA 4U1RA 1O9BA 1NPYA 4CF5A 4KQKA 3AQIA 3W1VA 1GKLA 1A9TA 2QK4A 1TYEB 2QD3A 3RS0A 3ITEA 1I7SB 5TRTA 3ZDZB 2O59A 4KZKA 4D3DA 3WLMA 1KS9A 2Q5IA 1YASA 4Z9XA 1NQAO 1W8IA 1AKUA 3ZHSA 4BLWA 2G5GX 1SO8A 1E9DA 1CVIA 2Q0QA 5COAA 2PGXA 3GFVA 2Q4RA 3JPYA 2BF7A 1A7UA 4P58A 2C5FA 4IIDA 1Y1LA 3FTEA 4LY0A 4KMSA 5K8CA 3P9YA 3IL2A 4MTCA 5EZQA 4DIFA 2QT9A 3JSXA 4ANFA 5IC4A 3SYKA 4DADA 4HUJA 1L7DA 4KE7A 5IBCA 3L1HA 1J90A 1L5YA 1JR4A 1ZI6A 2OFPA 4P83A 4B3RB 1U99A 3BHIA 1POXA 4RJ2A 1SIUA 5J40A 2XMDA 3RK1A 2WF5A 1MPTA 1N3YA 4ND8B 5DASA 5C34B 1N5LA 4AVYA 2NPFA 1KH2A 3HKCA 3LHIA 1J97A 1UT5A 2XOKA 3BXOA 4ASUA 3HVIA 2NU8A 4PZEA 4LF7B 1ONNA 4OVKA 1JU3A 2VXOA 1ONBA 5PGMA 3WNBA 5K7SA 1ZGZA 3F5QA 2ERCA 4KMRA 2EBFX 3BSSA 1DRUA 3L92A 2FCAA 4OU4A 3FHJA 3NG1A 1V2HE 4O33A 1LW6E 1SXJB 3QWAA 1ZR2A 5FT9A 2H1LA 2YBEA 3GUVA 3FE2A 4IDCA 1OFHA 3MJTA 3I1YA 5HCNA 4PYQA 3GJ8A 5BSRA 3TEMA 3ICEA 2HC9A 5E4FA 3VR0A 2RK3A 5A3JA 4G67A 5GVSA 1H2BA 5LUAA 2ZVQX 2AYYA 1MDBA 1ZGBA 4OHCA 2GZ3A 5B7PA 1DC5A 4CLXA 1XA4A 1E2QA 1U0TA 5G3YA 1V16A 5JFGA 5JNSA 4WPGA 1SFRA 1LFAA 3KXPA 5BYBA 4Q82A 4K6FA 4AMBA 4CDRA 3U7FB 4ZRNA 2PL1A 3QSGA 3T7EA