4PW0A

Alpha/beta hydrolase fold protein from chitinophaga pinensis
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
275
structure length
275
Chain Sequence
NDHATAPTQYIEVNGTRYAYRSLGAPSDIPLICFQHFTGTLDNWDPLITNGLSKGRQLIIFDNKGVGLSSGTTPDNVAAMTADALEFITALGIRYFDVLGFSLGGFIVQYMAHIQPDMIRKIIIVGAAPQGVKVLHTFPDLIARAMQLEPKERFLFIFFEQSEHSRSKGLATLGRLYERTTDRDQDASAQAIGAQLTAITNWGKKTPSFEITSIQHPVFVVQGSNDEMMDTYNSYELFKQLPDAILSLYPDAAHGSFYQYPELFVSQTEYFLDSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Alpha/beta hydrolase fold protein
publication title Alpha/beta hydrolase fold protein from Chitinophaga pinensis.
rcsb
source organism Chitinophaga pinensis
total genus 101
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2014-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4pw0A00
1CFJA 4GBGA 3OTQA 4DNFA 3WJ1A 2JF0A 4J0GA 5ALWA 3R3VA 3A2NA 2Z5GA 3IUJA 4KAAA 5FDFA 5DNVA 3W04A 5K3EA 1AQLA 4IQ4A 4Y9SA 2WIGA 4BDTA 2DFPA 3WQHA 4HTAA 3LLCA 4AO8A 2GBIA 2AJ8A 1JMKC 4BAZA 3WI7A 4KYVA 5CT4A 3BF7A 1K63A 4H7KA 3R3ZA 1R4ZA 1THGA 1EDEA 4DIUA 1AX9A 2HU8A 4DTCA 1UKCA 5LLSA 4BCBA 1BROA 1BRTA 1XZGA 4YX9A 1IZ8A 4FTWA 5IVKA 1MNQA 3DJYA 4OSEA 4JH0A 4GECA 3WL6A 2CKMA 4YASA 5HQ3A 3ZPXA 5FRDA 3T52A 3PI6A 1EK1A 2WJ3A 4UBMA 4LIPD 5HCUA 2PM8A 5AKZA 1J1IA 1DQYA 3QMWA 4P93A 1DT5A 1ZGCA 5EFZA 3N2ZB 4DYHA 3H04A 4ZRDA 2VJDA 2DR0A 4FMPA 1SCQA 2ZSHA 5DNUA 4LYEA 1JKMA 3PUIA 1QIKA 1UK7A 5K3AA 2I3ZA 2AJBA 4HRXA 4W63A 3HSSA 3JYHA 4OPMA 3H2JA 2OCLA 4AMYA 1HDEA 1FFAA 4BVLA 1UT6A 5ALJA 3C6BA 2GYWA 5JD6A 1CUUA 4DNPA 2AXEA 2C7BA 1ETHA 4K2AA 5DLPA 1EH5A 5JAOA 3FVTA 5EHNA 1ORVA 4Y2UA 2X8BA 4BYMA 3FSGD 5F4ZA 5ALQA 1WB6A 4ROTA 4OB8A 3ESBA 2GYUA 1YCDA 4BCDA 3EQ7A 3QBJA 5AKGA 3KSRA 4H7EA 1UOOA 4Y2TA 3R3WA 1LBSA 3E0XA 1F0NA 2H7CA 4ZREA 2WUFA 5FPQA 4A5SA 4B80A 1R9MA 3DDUA 2BJHA 3EQ8A 5FOQA 2QM0A 5AM3A 5DYYA 4WFKA 4L9AA 1JFRA 1ZJ5A 1Y7IA 1QIGA 3TEJA 1ZI8A 4KJXA 1ODTC 5CH5A 1GPLA 1CRLA 1Y37A 3WKCA 1MTZA 2C0QA 1B6GA 3V1NA 1NU8A 3DD5A 4P9NA 1GQRA 5AH0A 2PX6A 3WL8A 2IX9A 1DX6A 4Q82A 3WA6A 4I19A 1UXOA 3QYJA 4OYLA 2QKYA 4J0KA 1HLGA 2ZYRA 1TK3A 1R50A 2V98A 1SCKA 4X6YA 4U2FA 2BKLA 4C87A 2NW6A 4TPKA 5CT6A 1XRMA 2ES4A 1VLQA 2JEYA 3QZUA 3IUNA 2XQFA 1Q0RA 1UK8A 5LP1A 4UFNA 4PSUA 1K6EA 3DCNA 4NVRA 4A16A 5HF9A 1UWCA 1WB5A 4CIBA 2C5FA 2J4FA 2AJCA 1CUIA 4HZGA 1A8UA 4K5QA 2OPHA 4UPDA 1SCIA 4HS9A 1TCAA 3ILSA 5K3BA 2PVSA 3WKDA 4EUSA 5DTIA 4AB1A 1XZEA 3AIMA 4N8SA 2PU5A 1CUHA 2RONA 1UOQA 4HXEB 4G9EA 4IH4A 5CT5A 1QTIA 3FLAA 3QITA 5ALGA 4TGLA 4JNCA 4KE9A 2Z3ZA 1DWQA 4UFPA 5AKKA 2WU4A 5HFNA 1Q0ZA 2ROQA 4X7BA 4LYDA 2XMCA 3DNMA 5ALYA 1CUSA 5JAHA 4H7DA 1XRRA 3C6ZA 1FFDA 3G7NA 3C43A 3AJAA 3C8DA 5ALUA 3WK4A 1W4LA 2XDWA 1EX9A 4H7IA 3KWJA 4CFSA 4C4YA 1N5RA 1GGVA 5ALFA 1LPMA 4I4CA 3WKBA 4C89A 1YB7A 5ALPA 3D2AA 4C4XA 3HYSA 5KWJA 3SX4A 1H2YA 5LZ8A 2VTVA 5AI8A 5I9IA 4BAUA 4RE5A 1RWQA 4UHEA 3SWWA 2HFKA 1CUWA 2WILA 4Y2RA 3S2ZA 5DTJA 4KE6A 1BCSA 1XZIA 3RM3A 3MUNA 4W1PA 3ICWA 1R3DA 4CG2A 3PF9A 2OCKA 4UHCA 2QR5A 2HFJA 4CIAA 3WKAA 4GWLA 1U8EA 3WIBA 2DHEA 4W1QA 3STVA 4PSDA 4X93A 2JBWA 2WIJA 1ZI6A 2GZSA 3W9UA 1DU4A 4UBJA 5AICA 5AM5A 5EHXA 2H9YA 3M81A 3I6MA 2D5LA 2J4CA 3NWOA 4ZXFA 4BP8A 3BDVA 3WYNA 2Z8XA 4IH1A 1CUDA 1XKTA 4BTVA 3GROA 4WY8A 1EXWA 1QLWA 3O4IA 3FYTA 3H2GA 1QIMA 3I6ZA 3VJKA 4E15A 1LPAB 2JGMA 1QJ4A 4QDZA 1USWA 2DQYA 4Y2PA 4JEIA 1WPRA 2ZYSA 4J03A 1F6WA 4Y7DA 1IUNA 5AHXA 1KU6A 3BDIA 3B5EA 1CUVA 1LZLA 1YAJA 3STTA 2OGTA 3X3HA 4X6XA 1EINA 4I3FA 3W2TA 2HU5A 5LKAA 3OPMA 2K2QB 1XZLA 3N0TA 5AKIA 2HDWA 4AMZA 4FFVA 5AOCA 1XZBA 4KEAA 3PFBA 1CUXA 4J0CA 4M0EA 3PE6A 4XWGA 2WHPB 1MT3A 4FDMA 1NX9A 1XZKA 3EIOA 4BE4A 2JEZA 4B9AA 5JIBA 4F0JA 2Z3WA 1G66A 1LPBB 5YASA 3F9CA 5HQ3B 1TKRA 4G8CA 4YPVA 2HHAA 4ETWA 3BJRA 1N1MA 4EA6A 3F96A 4GXNA 5KREA 4FLMA 3EBLA 3LCRA 1EB9A 2XUHA 4ARAA 1XQYA 5ALSA 1ISPA 4KRYA 4X97A 4Y2SA 1YS1X 1QIHA 3AILA 4OU4A 2DQZA 4AXBA 1EDBA 3I1IA 2HU7A 4K6GA 3C87A 3VISA 2QVBA 1GXSA 1XZAA 5BOVA 3WYDA 3WK6A 3AZQA 3DL7A 3I28A 1BEZA 5BWCA 1F0PA 1HBJA 2HA2A 2OQIA 3LP5A 3IA2A 3WK8A 5AM0A 2WFMA 5AKLA 1T4MA 1CUGA 2YH2A 1RYYA 5FXMA 4MJ3A 2BUCA 1XRNA 4TVKA 4PNZA 4UHFA 3DQZA 2VJCA 1WHSA 3STWA 2XB6A 5ESRA 2HADA 2XUAA 1MN6A 4ZGBA 4UBNA 1WM1A 4X92A 1Q83A 5A2GA 2O2GA 4OB6A 4BZWA 5A7GA 5JZBA 2QJRA 4FFWA 1R88A 4QA9A 3DKRA 3MVEA 3PF8A 4UBIA 1FFEA 4Q34A 1E8DA 2HIHA 4DMHA 3H18A 1CUJA 4QWWA 2CBGA 1L7RA 2GBCA 4L0CA 1VXRA 1AUOA 4GHWA 2QMQA 5D3ZA 1EHYA 1CEXA 3EF3A 4LHEA 2CMFA 2WKWA 1CLEA 2B61A 1E89A 4BB0A 2R8BA 5E2IA 4X95A 1CIJA 3WWEA 2G5PA 5ALIA 4EBBA 2HL6A 3DKKA 1XZDA 2OLEA 1UZAA 4U2CA 2XI4A 5KWIA 1G5FA 2PBLA 1U2EA 1ZD2P 5ALEA 3QVMA 4JUIA 4N5HX 4UHDA 1XQWA 1XROA 5C8XA 2FJPA 2WFLA 2X5XA 4UUQA 3BWXA 5T4HA 5AM4A 2LIPA 4K6KA 4PQEA 2XUGA 1IUOA 4WFIA 3E3AA 4H0CA 2XUIA 4B0PA 2XMDA 3C5WP 4MWSA 4X71A 2WTMA 3KOOA 5SYMA 2VEOA 1TCBA 1QGED 3A6ZA 5A62A 3PFCA 4U2GA 5AOAA 1ZD4A 1NU6A 4GEGA 1OCEA 2CEKA 3WK7A 1T2NA 3RKSA 1QIIA 1JJBA 1CR6A 1I6WA 2OGZA 3GBSA 1K4YA 2VF2A 4B84A 1ZIYA 4AQDA 3AUKA 4YK7A 2WM2A 1X2BA 1CUBA 2VJBA 5ALLA 1EK2A 4Q3KA 3WLAA 2JIDA 5ALMA 3ED1A 1EVEA 4QEKA 4QDUA 4LXIA 1QOZA 2H7XA 4KE7A 4BE9A 3I2HA 1J06A 1W76A 2PSEA 4EY8A 3I2KA 3D4LA 1WPXA 1OILA 3RK4A 1CUAA 4OCZA 1EB8A 4KAJA 2QXTA 5DWDA 1YA4A 3GUUA 3H1BA 3HLKA 2QTBA 1QFMA 3WIOA 1H2ZA 3GFFA 2Z8ZA 2WG0A 2RAUA 4G9GA 2BAGA 1BS9A 1XRLA 4G4IA 5C8ZA 4MWTA 4BVKA 4FOLA 4BATA 3FLBA 1E66A 2O7VA 2XUQA 3BL8A 4NS4A 4DM7A 2ECFA 4KE8A 1ZIXA 1CUEA 3O9MA 1S8OA 4EY5A 3O4HA 3CXUA 1AMNA 1B41A 3G0GA 3P2MA 3DEAA 4C4ZA 5J3JA 5HF6A 1W52X 3G8YA 2WIKA 1ODSA 4RE6A 4G4JA 3C45A 4WFJA 1EVQA 4W1SA 2XMSA 3CCBA 1CVLA 4JYPA 1JI3A 1JU3A 5CT8A 3BIXA 1YR2A 2PUHA 5EHZA 2FX5A 1QIEA 3FYUA 2HM7A 4XJVA 3BIWA 2OAEA 2OXEA 5CXUA 1XZJA 3G9XA 2WFZA 3V48A 3WZLA 4CG3A 3IUMA 5HK8A 5AIAA 4B9EA 5JAPA 4J3JA 5ALDA 3AZOA 1DWPA 2VQ6A 3FLEA 5ALKA 4CCWA 4EY7A 3R40A 3AFIA 4F21A 4AX4A 2V96A 4FNMA 5ALTA 4DMCA 1H2XA 3KDAA 3IIIA 3L1JA 3R0VA 3WL5A 1K8QA 2XMQA 3FCYA 1VZ2A 5AKYA 4WJLA 1JT2A 3MUOA 1Z68A 7YASA 5ALXA 4H35A 4X00A 1IMJA 3M83A 2XMBA 1XRPA 3ZLTA 1BN7A 3JW8A 2WG1A 3WJ2A 4GI1A 3I2GA 5IVIA 4BAGA 3I1YA 1RP1A 1LBTA 5JYCA 3QPAA 5AI5A 5LZ9A 3G0CA 5EIAA 3U1TA 1DTEA 2WU3A 1HQDA 4AO7A 4OU5A 5JD5A 4V2IA 3S8YA 1D07A 1W75A 3DS8A 1XZMA 4X90A 1DINA 4UBOA 4UBKA 4FKBA 4UFOA 4ARBA 3DOIA 2WG2A 4QDTA 2I03A 2OG1A 2W22A 1QZ3A 1JMYA 5CXXA 1FSSA 3O4GA 3FAKA 4QLAA 2QJWA 3G9TA 3AINA 4DNOA 5JALA 3R3YA 2EDCA 2Y2UA 1TRHA 1P0IA 2PSHA 3B12A 4HAIA 4CCYB 1IUPA 1TQHA 1TIBA 3ESDA 5AK4A 5EI5A 2GYVA 1BN6A 1BEEA 2W6CX 2OQVA 2BGRA 2WIFA 2CZQA 3A70A 2WUEA 3G0IA 1QIDA 3A2LA 4IO0A 3SC2A 3ZV7A 1VOTA 5AI6A 1UKBA 1A7UA 5CURA 3K2IA 1UK6A 2V9ZA 2H1IA 5AM1A 4FLEA 2PKYX 5C7YA 2BGNA 3R3XA 1CUFA 3AIOA 1H2WA 2VSQA 3QPCA 4CG1A 1X70A 4F5ZA 4L3WA 5T4FA 2BFNA 3L1HA 1FFCA 4OB7A 2RHTA 1YAHA 3V1LA 2P8SA 5EIEA 4N8EA 4AN1A 4DMFA 4WCVA 4BBZA 1DWOA 1MAHA 5A7FA 5DYTA 4UHHA 1LPNA 2WJ4A 1ORWA 5KBYA 2DHCA 1CUCA 3Q0TA 1XFDA 4Q3LA 2OAGA 1J07A 5HKBA 5D7BA 4QWMA 1OXMA 5JANA 2VA9A 4INZA 1GKLA 1O6FA 4N8DA 1XZFA 3NGMA 1HL7A 4L72A 4WY5A 3GELA 4M0MA 4W9RA 3WWCA 4XX1A 5AKXA 5K3CA 1IZ7A 4P08A 1GPNA 4LKOA 3BJMA 2WFLB 5FUMA 1U4NA 3M3DA 1XLUA 2WUDA 1QO9A 4Y2JA 3OC0A 4DLNA 3ZLUA 2WLSA 5JARA 3O4JA 5JZSA 3H2KA 4B82A 5C8VA 3MGAA 1BCRA 3YASA 2HA4A 4FWBA 1ZD3A 2RHWA 3U0VA 2XUDA 5CH3A 4QE3A 3NUZA 4P92A 4J0DA 3WWOA 3FBWA 5EIHA 1N8SA 2GZRA 3G9ZA 3IB3A 5LKRA 5AI0A 2ZYHA 1VA4A 2HA6A 4G1FA 3HEAA 1KU0A 3W05A 3FWHA 1C7IA 4WDRA 1CPYA 2YXPX 3WZMA 3WWPA 3IUQA 2FUKA 1P0QA 4JYMA 1AZWA 1JJFA 1EDDA 4G4GA 5BWBA 3VDXA 4H7JA 3DOHA 1PJAA 2HRRA 1KEZA 1WCYA 1CQWA 4Y2QA 2XT0A 4PV7A 1R1DA 1P0MA 4LXGA 3STUA 5HF5A 2DHDA 5HFAA 4QLOA 1A8QA 5FLKA 3F98A 3D0KA 5JD4A 5I8PA 1LNSA 3C6XA 1XZCA 2CB9A 3LIPA 3LIIA 2WJ6A 1A88A 5K3FA 4QNNA 4X3CA 5LZ5A 5ALOA 3DLTA 4DSAA 2OCIA 3ZWQA 4O08A 5FV4A 4MYDA 1X2EA 1EI9A 2WQZA 5AO9A 3ANSA 3FSGA 3D59A 2XUPA 3H0CA 5ALZA 1IVYA 1EA5A 4X85A 3V9AA 1MX5A 5D6OA 4Q05A 4BTLA 1VE6A 3VJMA 4XIIA 3STXA 3RARA 4Z49A 4WDQA 2E3JA 1LPSA 5IVHA 4B81A 1VKHA 1TAHA 2VT6A 5A7HA 3IULA 3H2IA 1F8UA 2G63A 3VVLA 3FYUB 2DSNA 4Q3OA 2FJ0A 5EHQA 5IH7A 4F60A 3D2BA 4MXDA 3W9BA 2HRQA 4ZI5A 3ESAA 3GA7A 4Y2VA 5T4EA 4HRYA 1VE7A 2Q0XA 2WHPA 3KD2A 3DL4A 2B9VA 1AC5A 5HKAA 3HZOA 2XQKA 4S0XA 3ANTA 1A8SA 1N5MA 1L7AA 2HA7A 4C6HA 2BUBA 1GQSA 2WTNA 5CMLA 5AK6A 4G8BA 1DT3A 1VZ3A 3CN7A 3OOSA 3H2HA 3I2JA 4DMKA 1MU0A 2XUOA 3VJLA 4BDSA 4D9JA 4QDOA 3C5VA 1ZGBA 3ZI7A 4W1RA 1CUYA 3QMMA 4N5IX 1XKLA 2WUGA 1ACJA 1BU8A 5D3KA 1QO7A 4OUKX 4PSCA 1LGYA 3IBTA 4G8DA 1MX1A 4BC1A 1HPLA 2G5TA 4BCCA 3HXKA 5C81A 5T4BA 5JATA 4Y2YA 5LZ7A 2XMZA 4FBLA 5DNWA 3M82A 2HA5A 2IIVA 2C5GA 4PW0A 2WIDA 1QFSA 4H18A 5AJHA 1XLVA 4EZIA 3PICA 5E4YA 4HVTA 1GKKA 4UBLA 1ZD5A 3BXPA 2XUJA 2JGIA 3BF8A 1E8NA 1WHTA 4X6UA 3QM1A 4ZV7A 2PSJA 3FYUC 4GDMA 1E5TA 1QIJA 3H19A 4QDXA 4XVCA 1GZ7A 4MQMA 1MNAA 3CN9A 3UMJA 1LPPA 2XQJA 2B4KA 1ODCA 4B85A 1MJ5A 1ZOIA 4EB0A 1AKNA 2QUBA 2OCGA 3R3UA 4BZZA 3DYIA 2VATA 1FFBA 5JADA 2UZ0A 3ICVA 2QXUA 3G02A 2O2HA 3F8SA 4OYYA 3Q8WA 5IKXA 4BP9A 1J2EA 4DNQA 2XE4A 3K9BA 2ZSIA 1GPKA 3C8HA 1G4HA 1E8MA 4KACA 2RIPA 2VAXA 4AN0A 2OGSA 3GZJA 1CQZA 2ORYA 2JGKA 2ONCA 5A71A 1W1IA 4KR0A 3W06A 1H23A 4X94A 3I6YA 1JJIA 1UKAA 3V1KA 3EQ9A 4H7FA 1O6GA 4GLBA 2C0PA 3HACA 3WL7A 5SYNA 2ACEA 3KXPA 5A6VA 5FP0A 5ALVA 5HF8A 2PSFA 4OD0A 3R41A 4B83A 1DX4A 1LPOA 4LXHA 1C4XA 4E11A 3TGLA 2RI6A 5AK5A 2ZYIA 1P0PA 4U2DA 3G0DA 5AP9A 2PSDA 2VT7A 1THTA 3OURA 1R9NA 5FKJA 3QPDA 1GT6A 5K3DA 4EY4A 3C6YA 5K5EA 3NOXA 3PDCA 2DCMA 1ZJ4A 3WA7A 1Y7HA 4E14A 2AJDA 1MPXA 3RLIA 4EHBA 4AZ0A 1HKHA 5ALHA 2XUKA 1UFOA 4DGQA 1LLFA 2PUJA 1K5PA 5FPPA 1SFRA 3STYA 3C70A 3KWFA 2WHRA 5CT9A 3OG9A 3WK5A 1BE0A 2XQIA 5CRIA 1AGYA 2AJLI 2ZVDA 1TCCA 4X91A 4BRSA 4E46A 2V97A 5JAUA 5AKHA 3HABA 1JU4A 3FVRA 3IVMA 5I7UA 1QONA 3V1MA 1CUZA 3IURA 3BE8A 4BVJA 1E3QA 2CUTA 5JZ9A 2IITA 4C88A 4PF1A 4HXFB 3CCCA 3E4DA 3TJMA 4H77A 4UHBA 1QTRA 1DQZA 4PO3X 1UOPA 4B7ZA 3WMRA 4G5XA 3T4UA 4GW3A 2QOEA 2ZJ7A 2O2IA 3FOBA 4HXGA 5AKJA 2I3DA 4MQLA 2XMGA 4KRXA 1VA5A 3F97A 3WKEA 5AKEA 4C01A 1VXOA 3FNBA 5ISMA 2CJPA 2XQGA 3WWDA 2XLCA 1C7JA 5JASA 1XLWA 1YS2X 5IVDA 2QUAA 2PL5A 3D5EA 2HA0A 5LIPA 2Y2VA 4U2EA 1WOMA 2Y6UA 4NZZA 2QS9A 5AK3A 1YB6A 1WB4A 4IH9A 4ZV9A 3L1IA 3WK9A 4EY6A 5AOBA 5ALNA 5CW2A 2D0DA 1YA8A 4J0HA 3ZLVA 2Y1KA 4B6GA 2GBFA 3HC7A 5ALRA 1MO2A 1QIFA 5HZGA 1G42A 1SOMA 4U2BA 4RGYA 5CH8A 5K3FB 1YSCA 4RNCA 4BC0A 1MX9A 1UK9A 1VJ5A 1L7QA 4RPCA 2VAVA 4FBMA 5DJ5A 2QT9A 2XUFA 1LZKA 2EDAA 4K6HA 1XRQA 3I2IA 2J3DA 4B0OA 1Q84A 3JWEA 1PV1A 3G9UA 1H22A 4FHZA 3H17A 1W6RA 2JGFA 1M33A 5LZ2A 3D2CA 1XZHA 4A23A 2JGLA 3F67A 5AIBA 5AI9A 4J0JA 4ZWNA 3O9VA 3LS2A 5LYYA 4BRZA 3SK0A 5AM2A 2PU7A 2ZJ6A 2JGJA 2Y6VA 4KAFA 3TRDA 3A2MA 4NMWA 6YASA 5LZ4A 3OM8A 2ZJFA 5HK9A 5EGNA 3VKFA 2WSLA 2C58A 2YASA 5E4TA 4AO6A 1AURA 1SC9A 2JGEA 2R11A 2GBGA 3H1AA 2YYSA 1CV2A 2I78A 5BV7A 4Y2XA 4FLFA 1U65A 3UUFA 3O95A 4CI9A 3O0DA 1ZICA 3D7RA 3QH4A 2VJAA 5E4JA 2C4HA 4AZ3A 2EEPA 1MAAA 4MYSA 3IDAA 3ESCA 3UUEA 2RGUA 2ACKA 1XQVA 1FJ2A 3G0BA 3K6KA 4J0IA 4CCYA 2HA3A 3QMVA 3E1GA 2QZPA 4QZVA 4FNGA 3AZPA 3DYVA 4Q1VA 2XLBA 3AIKA 1ZI9A 3VVMA 2H7YA 2QRUA 1PFQA 1ACLA 4M0FA 2J3QA 2XMRA 1YASA 3I2FA 5CTAA 2PPLA 3FCXA 3D3NA 1QE3A 4DSZA 5CBKA 2G4LA 4MEAA 3B3QA 3HI4A 3VXKA 3PUHA 3HJUA 2BCEA 2WHQA 2O7RA 5DYWA 2B20A 5AI4A 2BUAA 1XQXA 4H7HA 5H3HA 3HRHA 4ITVA 4MEBA 4J7AA 4IHAA 2X76A
chains in the Genus database with same CATH superfamily
1C0KA 1CFJA 3LL4A 5FTMA 5IKEA 3ONFA 2DTXA 3FMFA 2X8AA 4OJNA 3WJ1A 4EPYA 1V35A 3PWTA 1OLXB 2PRSA 2Q9BA 4MKFA 3GLRA 1F2TA 1SKMA 4GPEA 4G24A 3H42B 3EAFA 3ZZ1A 3UMBA 5E3JA 3WDSA 5GINE 2Z5GA 1TKBA 1DAEA 1WXXA 2FCAA 5IF3A 2WVHA 3ZTTA 4LZAA 3CEHA 3V7FA 3D02A 1DCFA 2HD4A 4ZT2A 4TYNA 3H1GA 1EG2A 2HEIA 4BWGA 1IFXA 1UXGA 4E2WA 3OWHA 1E62A 3B51X 3P9YA 4OY3A 4Z7NB 5KNDH 5IU6A 4Q6WA 3L8YA 3QSYA 3LOQA 4NE9A 3F2VA 1TW2A 3HN2A 5J2UB 4UD6A 2DFPA 4AULA 3WQHA 4BQIA 4DS3A 3GV0A 1ZJZA 3OJEA 1MDFA 2J5KA 4F3KA 4WLOA 3LLCA 2GBIA 2PL1A 5AESA 5CDUA 2YXNA 2QW1A 1R9GA 5EOVA 1BQ4A 3UJBA 1G2IA 4N3BA 3USES 2ZBFA 4OHFA 1TZJA 4LOJA 2QSYA 4KZKA 1E2KA 1OTXA 1DUVG 1UDBA 2CLHB 3BL5A 1O08A 1K63A 4BGVA 4MIKA 1RZRD 1ESEA 2ZBDA 3SR4A 1R4ZA 1ECBA 1THGA 3LUFA 2NU9A 1IJBA 3R6WA 3FTFA 4EFDA 2X7XA 5C7IO 4WLUA 5KB3A 1ZMRA 2HREA 1XWFA 5IXSA 5KSZA 3DBIA 5ICFA 5JSHA 1NM5A 2BD0A 3G2JA 4LBVA 3VH4A 2HU8A 4G56A 4GPIB 4JIGA 4D97A 1IB6A 5ARDA 4RESA 4EFNA 1PRYA 3HU1A 4ZQHA 3H5IA 4DTCA 3JQRA 2GEFA 1WRBA 1FUUA 4AJJA 4DCGA 2OK7A 3AR7A 4M8KA 4L22A 5LLSA 3I23A 4RGVA 7REQA 4CHTA 1QPZA 4BNWA 1T4BA 3DF7A 4D3YA 4BECA 3PXDA 1I9GA 3QVVA 3C3CA 5H81A 3JYPA 1XZGA 4YX9A 1OHHA 2ZANA 3LDHA 1IZ8A 1UOEA 1W8IA 3HN6A 3UV7A 4BTEA 3S1SA 1MNQA 3GEDA 4RSRA 3TL2A 3GFVA 4NY1A 2EU8A 5IDYA 2GVDC 3KUDA 4WN3A 4GMFA 3A7EA 1OKKD 3IAM1 3OMXA 4PO1A 5ER9A 4IIJA 4NC9A 2INGX 4Y6QA 1B3RA 4QO7A 1XCBA 2BGIA 3PSAA 1LNZA 3CLSD 1XJQA 2XHZA 4UQPA 1J0CA 3OSUA 4ND1A 3PE3A 4O4IA 3WO0A 1ILEA 2FVXA 4HQ6A 4KIJA 4LY0A 4BEJA 5L40A 1H8EA 3C5CA 5ECGC 2RKBA 5U9CA 3CTMA 3D8BA 3LG2A 2VI5A 3TQRA 1PEYA 2DOKA 2C4NA 3DE0X 3AMVA 4V0ME 2VPZA 3KB8A 1EK1A 3RYCB 3E48A 3NBXX 3ZNPA 3SPXA 5TPWA 5JH7A 1IQRA 3CMMA 4LIPD 2FJUA 1JJVA 1A7AA 3NDRA 4Q3DA 4HPJB 5DGXA 5FTNA 2XDQB 3U3RA 3GAZA 2YUIA 4KPUB 4NZOA 3MYRA 3P7MA 1EEXB 1W87A 1I1NA 1I36A 5IDQA 2HN9A 1G98A 4GYKA 4P93A 3V8EA 3GK3A 4BIIA 2HJWA 3N3AC 4CKWB 5KNDA 1LLCA 3N2ZB 5HW0A 3MS7A 4RKWA 1WW2A 3IP1A 2WP8J 4D4LA 3VOAA 1HSZA 1ZN9A 2P62A 2VDVE 4FB4A 3EIHA 2V6GA 1E2DA 4YJFA 4XWKA 2DR0A 4FMPA 1MFZA 2JGNA 3UMYA 3WLMA 1YJXA 2OQ2A 1QV7A 1Y81A 1BTOA 2AXPA 4L07A 3FZEA 3OT5A 1AS0A 4M7RA 4S2UA 2HWKA 4CM8A 3EA0A 4LYEA 4R1NA 4YC7A 2BFPA 4O5AA 1QHEA 1MJGA 1QIKA 1RBYA 2FA9A 1M6VA 4O2BA 3W3AH 4AZ0B 3OX3A 1V8PA 1J1ZA 1KIMA 3NB0A 4PAWA 4CE6A 2IHKA 3N2KA 2AJBA 2WUWE 2HYIC 3SM3A 3W4IA 2Z0MA 1EP3B 1YRBA 2YC2C 4N3AA 2YUTA 2VP5A 2NT3A 3CRW1 3JYHA 4KHZA 3LPCA 4OPMA 2OCLA 1CHDA 1HDEA 3KUUA 3UMCA 1DHTA 3IDQA 5BUQA 1RWPA 4JYAB 3G5AA 2HDOA 1UT6A 1MP0A 5ALJA 5YASA 5IJ0B 4P5PA 2C7VA 3OTHA 3UJ7A 3RC8A 3CGWA 3EZYA 1ZGJA 1JLLB 4AUEA 2ERCA 4UVDA 1CUUA 1ML4A 4XTRA 2CJWA 3MERA 1P4SA 1XTVA 5J58A 3V8QA 5KJ6A 3WTBA 4HB4A 1YZHA 5BV1A 1TQ8A 4J1SA 4JJKA 3MJSA 3NWPA 1EH5A 3RU7A 3AUFA 3UAGA 5EHNA 1LW7A 3EAQA 3X1JA 1ORVA 3PNPA 2W11A 1EDZA 3RTAA 4DEXA 2ODQA 2X8BA 4EK9A 4F2GA 3FSGD 4TTQA 5I9BA 3UMSA 3WV5A 5K0CA 3H16A 2ZAIA 1Y9DA 1ID1A 3KE8A 2ZBRA 4G23A 3JVVA 2QTAA 2ZU0C 4K6FA 1YU9A 1TZKA 2G7ZA 2I7XA 2NZ8A 3SR3A 3X1WA 3TW0A 4YN3A 5GMOA 3DVAB 2I5PO 4PQYA 3PEEA 3EIWA 1VLVA 3OTGA 4NR0A 1IWBB 4TRMA 1WXIA 2W2TA 4TL9A 2CSXA 1LV7A 2IBMA 1GG9A 1M6NA 1LJLA 1UOOA 2WWWA 1U1DA 2P2GA 3R3WA 1HM5A 5CLFA 5IPFA 1LBSA 3HZHA 1Q17A 2QYTA 5IP5A 1QCYA 2R6AA 3UMMA 1M9NA 2H7CA 3JATB 1GTL1 5BYKA 1SUFA 1KFCB 1Q0HA 2P6UA 2UZ1A 3HPRA 3QFFA 1R9MA 1SVMA 3R5TA 4IQ8A 4RIIA 4X54A 3W8RA 3FNFA 3LY5A 4GOJA 1XNRB 4KIUA 4PYIA 2BEUB 4NNJA 1RQNA 2O3JA 4LDZA 1SZDA 2BJHA 3CZAA 5D2CA 3ZWOA 1PU2A 2DT5A 5FOQA 3VPDA 2QM0A 4UJ5A 3NBYC 4AN4A 2JFQA 3LQFA 3OT1B 3STHA 4WFKA 2VRCA 3R9XA 1XCLA 5AOVA 3JQ8B 3ANMA 1IOVA 1ZJ5A 4FSHA 1QYDA 1BDBA 1L7OA 3LGXA 5D84A 1H6BA 5IARA 4P83A 5CH5A 3JWJA 4G0VA 5KOHA 4HAYA 1BC5A 5IXYA 4L7QA 3VO2A 3ELYA 2O5VA 3KZNA 3IE0A 4XD7A 4TZ6A 4N65A 5JS1A 3PT5A 4KTTE 2EATA 4RK7A 3PNBA 2VK8A 3SYLA 2P2YA 3EDMA 2VJYA 3IX7A 3T3OA 1XKQA 2RB5A 3QXJA 4D9EA 4BZPA 1FYDA 3LZCA 3SVZA 4ERNA 1O94C 1QYRA 5JPIA 2G07A 1Z7YA 4HPXB 3AH8A 3MOGA 4ZHQF 3KTDA 3MTDA 3PUVA 5JS6A 1O5TA 3FBGA 3LH5A 2W4IA 5LIRA 4JP3A 3QOXA 4U6SA 4DAEA 4A0SA 4TUYF 2O8CB 2GSDA 4RMNA 4J75A 2IWRA 1NR5A 3PXUA 4BRWA 1NXWA 2JHCA 1VBFA 3R4VA 3WA6A 5LC1A 3TFQA 2GAOA 3IKTA 1FL9A 2AMLA 1REQA 1FYWA 5LOVA 4C3ZA 4OYLA 3NMUF 4J0KA 4JLUA 2BEWA 4PG8A 3QELA 5ICCA 5EPEA 4LVOA 4MPTA 2IUFA 3OBIA 2RHLA 1I4WA 4LOHA 4C7JA 1X19A 3N76A 2CFTA 5IW8A 2AG0A 3BD8A 3L6RA 5EWJB 2VF8A 4O63O 2HIGA 3UB2A 3PD0A 2EG9A 4JT9A 4V0MA 2I6SA 3LP8A 4IKEA 4EPTA 4F86A 5C5IA 4W5RA 3AFHA 1ZP6A 1WDKA 4KCGA 4Y2HA 1WCXA 1HEIA 4BO4A 1HFEL 2H4YA 4GWGA 1QC5A 4UZFA 3NC1C 3KR1A 4K6OA 4XCXA 5FBRB 3ZHQA 4BX0A 1RAAA 1H2AS 2AR0A 4J9VA 5KTOA 1DPGA 2XYQA 4FDLA 1D3AA 1HYBA 2G6TA 3OI7A 1AUPA 3ROMA 3HUUA 1N9GB 3EY4A 3PU6A 4UC0A 4F2WA 1XA4A 5BPFA 3R9KA 2JBAB 4WEQA 4BFTA 1UXIA 5TQ2B 3NBKA 1W96A 4K40A 3X1YA 5B6IA 5LP1A 1JIKA 3THWA 3ZCTA 1IZ9A 2GGSA 3M33A 3ER6A 1GUBA 4MVJM 1PO7A 2OT3B 2YWDA 2VUHB 4L0QA 2J9GA 4NF2A 4NVRA 1DBIA 4WZBA 3RF7A 4A16A 4BNZA 4TVSA 4D9CA 4OI2A 3KAKA 2EVWX 2JL1A 3ROXA 1EFAA 4DR1B 1THZA 2J87A 1E2MA 2J4FA 4XQEA 1WTAA 1CUIA 4G5YA 4BKQA 5KI6A 2FPSA 1FYEA 2UYHA 3T9BA 5GADl 4QFBA 1G2OA 4MV1A 2XHEA 3IJ5A 4KU4A 3UMGA 4Z2YA 4YJ2F 5LXTB 2ALJA 3PUZA 4CBVA 1TCAA 3INNA 2AYZA 3JZDA 2HHCA 4KYTA 3HA5A 4KXQA 4QTZA 4X1IA 4AAYA 4WZZA 4UUNA 3ZHSA 4EUSA 1XZEA 4YDSA 4CR6A 5KYWA 2F1OA 3OZCA 1UOQA 4PS0A 3TGPA 3S8MA 3LW8A 1CDOA 4M60A 1ZGGA 2VXCA 1ULZA 5JCJD 1FQKA 1QTIA 1V8FA 1EQAA 3F4LA 3GRZA 1HF3A 1WTCA 2I7VA 5A04A 1KC1A 4KQJA 2H48A 4JNCA 3L41A 1DWQA 2BMJA 1HH4A 4JQZA 5LP6B 4N4AA 3TRKA 5JHHB 2X1HA 3V7WA 1NW9B 4OJQA 1RW4A 1PCXA 2E7ZA 1N77A 2UU9B 1ZN7A 2WU4A 3QFHA 3Q8MA 2QD3A 2B8EA 1ZN8A 2C4TA 5HFNA 4EAAA 3H99A 4L8LA 1AE1A 1TIKA 4X7BA 1JEDA 1FSZA 1HLDA 3R5XA 2C5SA 2XMCA 4LYDA 4MAAA 2VT2A 2Q3EA 3SBEA 2X42A 3FZNA 1PS8A 1CUSA 1R0SA 3KZ1E 5JRJA 4OATA 3INRA 1IXKA 1UEXC 1W9HA 4G65A 1Z45A 3KM0A 3QKRB 3RUAA 3GPLA 2FYTA 4LAFA 4R01A 1AMUA 3FFTA 3TG2A 1ZSYA 5A2QA 3CB2A 3G7NA 1R9JA 5DM70 3T9CA 2ATXA 2RI1A 3WK4A 1UAAA 1GRRA 5HQJA 1EFVA 3KJFA 3QWFA 3MT8A 2FN4A 1ZKMA 2DT8A 2WSMA 2B5VA 3DC2A 4JJ6A 2YVAA 3FRIA 2CUZA 4UCQA 4CFSA 3CO0S 4BN0A 3R8XA 5K2OA 3ET5A 4HJXA 3VOBA 1X3LA 2JCXA 4ZYWA 3UENA 2E4VA 4PPFA 1HETA 3EFHA 4I4CA 1GAJA 3WKBA 2NU7B 1V37A 4C0KA 1YB7A 2C9DA 3O93A 1LXCA 1CP2A 2ZUUA 5ALPA 3ZCSA 4BFXA 3HYSA 2ZUVA 3K1ZA 5KVCA 3SX4A 2VTVA 3IP7A 4FFMA 1X15A 3I83A 3ZHOA 5CA1A 1JBQA 3ROEA 2QQGA 1C4OA 2NUAA 3MJFA 3SJZA 1HQCA 3HP4A 3O3OB 2IU4A 4ER7A 2HW8A 4FZVA 4Q9KA 3VR0A 4F45A 1T5OA 1BJTA 4MV5A 4OBEA 4RVSA 1G3QA 1M8FA 2O8NA 4BXOA 1H05A 4LZNA 4IIUA 5AJTA 4A0QA 4LJRA 1DDIA 1QLHA 2WILA 3S2ZA 3G5MA 2BR3A 5GONA 5GGXA 5DTJA 1YDEA 4KE6A 1BCSA 2I7DA 2VPYA 4DVGA 2YIJA 1XZIA 4NE7A 4C03A 1ZW1A 1QJCA 1U7XA 3DXZA 3B2EA 4G5GA 4OX9Y 1A9SA 1O0SA 3D9QX 1GO2A 5EE5B 3H1TA 2OCPA 2NU6B 2BSXA 2J5RA 4TTRA 4ZCMA 4DIEA 2JLAA 2HFJA 4I4TF 1JN0A 2C84A 4FK8A 4CIAA 1WZCA 5IHXA 4I1IA 2IYEA 1CULC 4X3PA 3V8NA 2BFBA 1G5TA 1HDGO 1YJBA 4QATA 4W1QA 3R6TA 3LCMA 3C41J 5CX1A 4C3UA 2FZ4A 1RPZA 4D3XA 3Q3JB 2JBWA 1T3ZA 3H2YA 4RIEA 2G4VA 3JRNA 4D1YA 2O2JA 3UK7A 4LXQA 1JQLB 2GZSA 3B78A 4F7DA 4UBJA 3ORFA 5F5NA 4LFBB 3AOGA 5FA6A 2NZYA 3ZQUA 3ZDQA 1N2IA 4DRZA 4YRTA 4JODA 2VHTA 3W1EA 4LOKA 3AHGA 4LMPA 2JK1A 1CZHA 1EE9A 3RUFA 1WABA 1C4WA 2IH4A 1Z2OX 3CZ9A 3HA3A 3TUZC 3UWMA 3FOFC 3HE3A 3Q3HA 2VQSA 3R23A 3GYGA 4ADSG 3PQ8A 5I4IA 3WYNA 1BKDR 2KMLA 3ZGLA 3I2YX 2JHGA 4TXNA 1XEXA 1D6SA 4BTVA 3DAFA 3GROA 4N49A 3V4SA 1HT2E 2Y27A 2BI8A 5CB8A 4C76A 5KYTA 4EQ6A 3NU1A 1KJQA 3HGMA 3ACDA 4IO1A 4AG5A 3FYTA 3H2GA 4CDRA 1GM5A 3AEUB 1QIMA 2X9VA 3BSWA 4Q3BA 3U3KA 4ZYLA 1RWKA 2A4MA 5I7VA 2RH8A 3PNKA 1VKNA 1LPAB 1RTTA 1MO4A 2Z9BA 4I4IA 1Q2XA 3W2IA 4HFJA 1H1DA 3K0HA 4QDZA 3NAQA 3IEVA 2O8FB 1M7GA 4TL8A 1NUTA 9MHTA 2B98A 3E05A 4G0UA 4DIDA 4J03A 4WPGA 2C94A 4R8KA 1JPUA 2IPNA 3GF4A 2RFLA 4P4NA 1E9DA 4DCOA 3AESB 1IUNA 2ZYVX 2P65A 5AHXA 1KU6A 1UT8A 3DZIA 3B5EA 5IAJA 1KMQA 3FNEA 4FGLA 3CNHA 4XYLA 1CUVA 1FU8A 1F6DA 1TM5E 3AVUA 1A0OA 2OGTA 3BSSA 1IWPB 1WCIA 3X3HA 3R3JA 1QH1A 3W6ZA 5KNCH 1EINA 4E2ZA 4G6ZA 4WERA 1CQXA 1PQ4A 4DARA 3NWBA 1C30A 3W2TA 3PQ4A 1X80B 4JGBA 5KKCA 4GZ5A 3I6IA 3B1FA 2HMTA 4DKXA 1PD1A 5E2BA 3EPJA 2K2QB 1Z0AA 2PGIA 2C4WA 3VTFA 4H2DA 1Y8QA 1M0EA 1HTWA 3N0TA 1FMTA 3E27A 2H85A 3E8XA 4PAMA 3HZRA 1ZOOA 4M0UA 1TQ2A 2QZ9A 3PFBA 2X9QA 4L2IA 4M0EA 4EMBA 3D3KA 3LO5A 3BB1A 4XWGA 3TS1A 1YWGO 4KR6A 1I3LA 2KE5A 2PA3A 3CR7A 1XZKA 2D1TA 1P9RA 2JJ8A 1RAEA 3BK1A 1N32B 4E94A 3INYA 1E1QD 2VBGA 2IVZA 3HVUA 3ONEA 1F9AA 4X1YA 4FPXA 1JEOA 3V33A 4R5MA 4UE6A 2G17A 3I30X 3RKRA 1LPBB 1QKIA 4O2AF 3ICQB 1GNRA 1NBEA 1L7PA 4QBFA 3RIHA 2W6MA 2WSSD 3A1NA 5AJYA 4BWVA 2XB2A 1KZ6A 1Z5ZA 4YPVA 4ETWA 4YRQA 1QNFA 2WF7A 4LRTB 1X1TA 3EXFB 4DMMA 4WVFA 3F96A 1GSOA 2NYAA 3L8EA 1AHPA 1FUEA 1JXMA 4V0KA 3NBAA 5JDIA 1UWKA 3EXIA 1CR2A 4IDGA 1BA3A 2B1QA 3LCRA 4LNUB 3ZX5A 3BRCA 4A8JA 3DTVA 4DT1B 1MB0A 1NYRA 3I01A 3L6EA 1ISPA 5MDHA 2V3CC 3ZD6A 4LF8B 1V6AA 1OV6A 4NOJA 4YWHA 1PT9A 4D0LB 4KRYA 1NX6A 3OZWA 1ZCAA 2BZSA 2WAXA 2P2SA 3M4NA 4NOLA 3CLTD 4NJOA 2O5RA 3JYNA 4K2HA 5ILGA 4KN9S 5AVOA 3ZEIA 2F8MA 1DKNA 4HEHA 4JWTA 3A6PC 3I1IA 4ZU3A 2MIIA 3ZR4B 4K6GA 4WQMA 4P2BA 1X1DA 3UO8B 2QVBA 1VL1A 3WADA 4BNNA 1AUVA 1GXSA 1XZAA 4QVGA 1JG2A 3I52A 5BOVA 5BY2A 621PA 3VC3A 3FNQA 1FTWA 3DL7A 3DDWA 1DAFA 2QYSA 3I28A 3OFVA 1J49A 3BHNA 5CM2Z 2VQFB 3C5HA 1YCFA 2EWWA 3C74A 3ED5A 1OXUA 3LP5A 3IA2A 4ZHQB 5AM0A 2WFMA 1M10A 3AP3A 2OMEA 2P75A 2DRIA 2C4KA 5FCDA 5U4XA 1N33B 3KVNA 3KE9A 5AKLA 1KEPA 4CF6A 2YH2A 2YN4A 4TUYB 1E7QA 2DBYA 4MW5A 4RY2A 4EFKA 3IE1A 4Q4CA 3E82A 2W71A 4QUJA 2CLDX 5TMDA 4E7PA 4MJ3A 1ZG3A 2FETA 3I32A 1NRXA 4UAUA 3I72A 6CHYA 1XRNA 4PNZA 4UHFA 2YY5A 5TSDA 2JJ2A 1T6XA 2IS6A 5KSYA 2HQRA 2C20A 1EFPA 1WHSA 3FNRA 3JQCA 1XGKA 4HQOA 4Z9FA 3ZIUA 4KH0A 1P17A 2HADA 4BNJA 4EIWA 3ND8A 3IODA 3KJNA 1NUPA 4JYBA 1TI7A 5JMOA 3M2TA 4B76A 4X6LA 3KB6A 3URKA 3HG7A 2JASA 1H1LB 1Q83A 2V7GA 3AIIA 3IRUA 2HF9A 5A2GA 1EVJA 2EC5A 2IYZA 2V54A 4BZWA 5EZ5A 4DA4A 2X4GA 2LP4Y 1D09A 2CEAA 3RSCA 3GFOA 4L8FA 3GEHA 3RC9A 4U9IS 3VGPA 2PEZA 2BBTA 3ZWCA 2QJRA 2VDLB 4C7XA 4F4HA 4QA9A 5L3RA 1DC3A 4AY4A 3LYUA 3SIWA 4AS3A 2RKOA 5D00A 4BFZA 4WBXC 4L4RA 5CYFA 2NXCA 2CNDA 3ZDYB 1JAIA 4GUAA 3A25A 4FQ8A 1E8DA 4MUYA 1DRUA 3EGXB 3SHWA 2NV0A 4DMHA 3D43A 3HBAA 3RAPR 1DSSG 2QK4A 1FLAA 3EF0A 5HBGA 2I9PA 1CKEA 2PYZA 3OTIA 3COSA 1H6AA 5KNBA 4B7AA 1BDIA 4YLEA 1D9ZA 2FW7A 3IH5A 2GBCA 1UBMS 1E9RA 4GOMD 2IF0A 1C41A 3WHIA 3KJIA 4IHKA 2ZTHA 3D64A 3VHRA 1ODIA 2E49A 1R0LA 2WYHA 2HX1A 2QMQA 4KQKA 5TC4A 4B7CA 4TZKA 3NHZA 5L53A 4YJ2B 4NCKA 4F92B 1WMSA 4RUKA 2BEVB 4HPWA 4K9KA 1QTQA 1S8FA 2PQ2A 4CWAA 4E6PA 1L8XA 1KI3A 2R6ZA 3TZCA 1N7IA 3SYMA 4KQMA 1IY1A 3W90A 4J3NA 5L7TA 4XQ0A 2W2NA 1GZHB 3QTBA 1NQAO 1CLEA 3AR6A 2O6LA 3C16C 4R81A 3K9FC 1E89A 3E3MA 4C4OA 1VYHA 2R8BA 1LI4A 5K6AC 3T3DA 3UK6A 3WP1B 2BMWA 1X7YA 3EXHA 4MQBA 5BN3A 1J7KA 1T0IA 2FDCA 4MYUA 1WMFA 2C8VA 2JB9A 2ZJBA 3Q3IA 3KXKA 3NCHA 4ML3A 1XTZA 4M6WA 5JUWA 2AXQA 4Q48A 2JAXA 3W7BA 4ZI7A 3ISJA 1FFXB 4U2CA 5G0WA 1ZRHA 4FFDA 2GCNA 5A3VA 2DFNA 3OX4A 3EZGA 2QJTA 2GWHA 2VZEA 2ZI4A 3RVKA 3ASZA 4X8LA 1N1DA 4D3FA 3QVLA 1Y33E 3N58A 4LTDA 1BDMA 3TSWA 4YQFA 4YT2A 2OHGA 3C48A 2Q2QA 1XROA 4Z0TA 3HFRA 1QWSA 5E9QA 3NVKI 3M4JA 3TTUA 2VHQA 4CKCB 1UJCA 3EQ2A 2CKDA 3K31A 4UUQA 1GR1A 1S0UA 3LCUA 4MH0R 4X3OA 5GY7A 2OXIA 1QANA 3WDMA 2FLWA 4DMGA 5AM4A 1ZUNA 5AVTA 3OLXA 2VSFA 3AUTA 3E9QA 2I6FA 1ST2A 1AKYA 1A8PA 1W44A 2B83A 2CFCA 2H2IA 3N5CA 4LMAA 1K66A 4PE5B 4RXMA 4TROA 4IOMA 1WW8A 1E5DA 3V4LA 1OX4A 2QAJA 3EEIA 3O0TA 1KDVA 4H0CA 1MJHA 1WDMA 2XMDA 3EGEA 3PVSA 5LA6A 4B71A 4MWSA 2EJTA 4IJQA 1A9RA 3MELA 3HFJA 4UEKA 1IDN1 1VI5A 3FR7A 1W36D 2YRXA 3GA5A 3TLAA 4C0JA 2BGWA 3L6DA 2JJ1D 3WGQA 3ET4A 1EUDA 5B1YA 2RGNC 1FRQA 4S3MA 3BXFA 3CF2A 3BJIC 3QEKA 4YWJA 4EJ0A 4CKYA 3TLMA 4G97A 3PB3A 1Y1QA 2OCBA 4R9NA 4JB0A 1UH5A 1W4BA 1V7PC 1OT5A 2YVLA 1L7MA 3G68A 3BA1A 2FHSA 2YXDA 1U3VA 2P68A 4MPDA 1QYIA 1NU6A 5KQMA 3KO8A 3E7DA 1S3FA 4OKNA 3KB1A 4YT8A 1FU4A 1T2NA 1JHXA 1L4KA 3RJ9A 4JI0B 4RETA 5ECDA 2GARA 2YTZA 3DKVA 4Z3DA 3QVXA 5JQGA 4J4HA 3P9XA 2YICA 4R31A 1M7BA 1Y5RA 3EGCA 1QX4A 3K2BA 5BV2P 3DL0A 5DHSA 4B84A 5IVPA 3ZE2B 4PQFA 4NU8X 5LU9A 2WQ6A 2XTZA 3HDTA 1EFHA 3OZXA 4OK3A 4PBTA 4RD6A 1L1EA 2JATA 2VJBA 4QJ5A 5KEIA 3CNQS 4PBSA 2IYWA 5ALLA 1F3LA 2R25B 4I4TB 4ZALA 5EXPA 4WESB 4YRKA 5JYBA 3SQXA 5ALMA 3QPWA 3WJAA 3GVCA 1YDGA 4QEKA 4JLKA 4OAQA 1B43A 3E9CA 5T5QA 3WYGA 1F5NA 3WOVA 5FOXA 1DMSA 1VLZA 3GP3A 1QK4A 4XW2A 2B2CA 2IA5A 4MW2A 5B57C 1XWIA 1E7MA 4K6CA 4MMYB 1B0PA 1NASA 4O29A 3GRKA 3SF8A 1P81A 4M9CA 2WAAA 3TCKA 3RWMB 1LK5A 1DZIA 1W76A 1TU0A 1TA9A 4G2NA 5C8YA 3O9ZA 1N2XA 4IVPA 4KVAA 5IM5A 3DZBA 1NWCA 5B2EA 1OILA 3BWDD 3C6KA 3W2FA 1D5WA 2IF2A 1NQTA 2PO7A 4GH5A 1EB8A 3EULA 3TFWA 3GLFE 4ITRC 3LUGA 4ER0A 2J0UA 1G19A 3Q9SA 3PUWA 3OLCX 4O2LA 6LDHA 3F8TA 1QHFA 3PHHA 4YIHA 1UBRS 2QTBA 3ENNA 1FVXA 4P7KA 3ZH2A 3HB7A 1QFYA 4IDBA 3PGVA 4J1NA 5IT9A 2VTEA 2JD0A 3IMKA 5EUQB 1J8VA 1DJMA 1WUIS 2AOUA 2WSBA 2F1JA 2Q5OA 3DAPA 2Z8ZA 4M99A 1GAWA 4WAUA 3NHSA 3D31A 2VNSA 3H0KA 1UKVY 1ZEMA 4G4IA 2YVQA 2VPTA 3HPQA 4L9SA 4NP6A 4BATA 3FLBA 5KYUB 1HMPA 1CP3A 1E66A 2HT6A 3BL8A 5DU2A 4FIZA 5C4GB 3OHSX 3GLGE 1VSVA 4YO7A 1JAXA 3W5JA 5EJ7A 3HWX1 5FJIA 2QUZA 3LKVA 1C7RA 4XWAA 4NXNB 1FLVA 3D6VA 4KE8A 4JQSA 3O9MA 3ZJ5A 1FNSA 1HE2A 1X7HA 4XM1A 2Y1XA 4EY5A 1PL6A 2VDOB 4R0VA 3L0DA 4TS3A 3ANNA 5MFZA 5CHEA 2CL7X 1AMNA 4Z9XA 2CYAA 3RWOA 1MORA 1N6RA 2E18A 3N0XA 3DEAA 3P2MA 4CEJB 1Z33A 2EGGA 3VOTA 3M6MD 5JXGA 5C34B 1YKFA 1W52X 4ZYZA 5KYGA 1ODSA 1WEKA 3OC6A 4RE6A 5IZCC 1MC4A 3TQHA 2QR3A 4P80A 4R5HA 2YWEA 4PXAA 1B8PA 2J7PA 2XWBF 1N9ZA 3O73A 3MXTA 2FWIA 1C3EA 2NO1A 1ZK3A 4LZZA 1IMOA 1EFKA 2R6R1 3DR5A 4JYPA 2QV0A 2GM3A 4QGFA 3HXQA 3CZMA 2PUHA 3QVOA 3DD1A 4ZQFA 1U0SY 1QIEA 2G0TA 1G8JA 1Y6JA 2PGOA 1MC5A 2QX9A 2ZT5A 1SQ0A 4O2AB 1QVWA 4FWIB 4WCFB 4XRRA 1KY2A 2XSZA 4C6RA 3SFVA 1JW9B 1KH3A 2H65A 3OZTA 4S0ZA 3KVYA 4JI8B 2PFGA 2P11A 4G09A 2WFZA 1R8JA 1G60A 3L0YA 3G2LA 3WZLA 4CG3A 1HX7A 3HMQA 3IUMA 1UT5A 3RUEA 5AIAA 3BMXA 4NARA 2PVCA 4B9EA 2ZE6A 5I8WA 1G8PA 4D79A 4JR2A 4LECA 2CW5A 5BSEA 1L5OA 2D00A 4PLYA 2IXEA 1PR5A 4ETNA 1ELOA 2EBWA 10MHA 3AZOA 3TBKA 4C78A 1F2DA 5EKTA 1XVUA 3NYWA 2VLBA 3VNRA 1N5IA 4RA9A 3JQAB 4IQ0A 1XAHA 2EQAA 3K70D 4IG4A 1XUOA 4EY7A 5EY5B 3HB1A 3SIPA 1KJWA 1FFWA 1T6BY 4JLPA 4MWGA 4JBYA 5LJLA 1R6VA 2PCJA 4LDQA 1IPEA 3X2SA 1YOBA 3LA6A 4KXVA 4AX4A 5KTPA 5LM3A 3TOVA 5DTQA 4YDHB 4INJA 3RIYA 2GA9A 1U63A 4REQB 1H2XA 5DZSA 2WQ7A 4E2XA 4H1UA 3TTVA 1EK5A 2CJFA 3KDAA 3PC8C 4GSYA 1ZRMA 2D4AA 5FUQA 3FFWA 3EMKA 1IG3A 2AZ4A 3DSRA 3GQBB 1D9XA 3IAM6 1G63A 3IIIA 3L1JA 3LHFA 1VKRA 4QTUB 3RYHB 3OX1A 3WL5A 2PZEA 5JU6A 1EXVA 3EFEA 1P7CA 1NOJA 1KYQA 1COZA 3O4FA 4XYGA 5AKYA 4NZNA 5I7AA 1KMIY 5A4KA 4P1ZA 4AJHA 3UMVA 5ADUS 1QOPB 1ZSVA 2PT6A 2V6FA 1GPH1 1VHDA 2OENG 1RFGE 3JXEA 2G72A 3M4YA 4QOIA 1KYTA 3Q6MA 4AF7A 4Q7MB 4RF2A 2AOTA 5C9ZA 5K8JB 1GY8A 1P60A 3GGJA 3ZLTA 1OU4A 4MVJG 4RWEA 1G5IA 4LRSB 1UMBB 5CX4A 5LQAA 1Z47A 3WJ2A 3QWAA 2GPNA 3CW2A 1P1IA 3LT5A 2Z56A 3CUKA 2ZS9A 1BWSA 4M38A 4XDZA 4XAQA 2ECPA 1U0TA 3A3YA 3H4IA 5J43A 1RLJA 3BOSA 3FIUA 5DCWA 3I1YA 2EW1A 1MG5A 1ODJA 1RP1A 2F3RA 4JL8A 3ZGXA 1J97A 3U3OA 3DHEA 1KP9A 3TIGA 2YHAA 3MIIA 4WMLA 5AI5A 5FR1A 4EITA 5LZ9A 1I3CA 1C5KA 4C5CA 1XDUA 3E2IA 3GLFA 4B44A 1W1WA 4LFAB 1IG0A 2OBFA 1QFJA 1DTEA 2KBFA 3KWLA 4HNGA 4YUVA 4UM9D 1E9VA 3CINA 4WOKA 1HQDA 2IS2A 4R4JA 5KOJB 2WMNB 5AJZA 3B70A 3KQMA 3QG5A 5SY9A 2NUBA 2XTNA 3DS8A 4U6NA 2QTMA 1J70A 1XZMA 2K5UA 1UJMA 3OO0A 3VH2A 4COOA 1K5GA 4XIYA 4DJEC 4HX9A 1RQLA 3C8UA 5EWLB 3CNNA 3B85A 3VU0A 2TMKA 1V5EA 2IRWA 1K6MA 1DINA 3VR3A 2PLWA 1L7XA 1OAKA 3DT8A 3Q15C 1Q6ZA 3EVZA 5GJVC 4IVRA 3ZDRA 2AR9A 4NBTA 2WG2A 3JYOA 4MS4B 3BM5A 5H59A 4BUJA 5A02A 3EC2A 3WHPA 1L5RA 2ZAOA 3FR8A 2WT9A 3AETB 1MX3A 2C1ZA 3PDHA 4CR7A 1Y82A 4ENPA 5JBIA 1ZBDA 4WCFC 2CDCA 2H4FA 2FPXA 4B6JA 6GPBA 1YL5A 4FDUA 5D1NA 1Q0UA 1EUCB 4FYVA 5LYJF 3I1JA 3O4GA 4XWWA 3IKJA 3LT1A 2R8PA 3GLGA 3K92A 3KAPA 3Q88A 1E1CB 3M5CA 4Q93A 1D4AA 4TKUB 4DNOA 1FS6A 3GEMA 3LAWA 3PX3A 4IWXA 2EDCA 5HPYB 4WXEA 5JALA 3ZJVA 1TRHA 4LYHA 2WF8A 1UQTA 1Z0SA 2OY0A 3ZK9A 4Q66C 3QQ5A 4JI4B 1T2CA 2ZPUA 4LC9A 3RRJA 3GBPA 3IDSA 1SELA 3BICA 5JNVA 4PXYA 3GNTA 3ESDA 2QTZA 2YQ5A 3NDPA 2GYVA 3L8ZA 1NVXQ 5AK4A 2JZOA 5EP2A 1QRAA 5EI5A 5DN6D 1VMKA 3EAGA 5L95A 4DLUA 1P5FA 4J0FA 4TSKA 4E22A 2W42A 4H6VA 5TT1A 3SBOA 5TF0A 2CNWA 2XGGA 1ZJJA 2H52A 1R8SA 4PLGA 3U4DA 1IC6A 2IW1A 1SU4A 3BSFA 3TMKA 3ROGA 1XAIA 3MWEA 3JQ9A 1YRAA 3DFIA 3CBGA 4TZTA 3ZV7A 5BORA 4W5TA 1M2KA 3TD2A 3WX0A 1Y80A 1AGXA 4AY6A 2ADOA 1LSUA 1V45E 2ZR8A 1T1EA 1TM1E 1RKXA 5FPSA 4BVFA 2OCYC 5F1PA 3D6UA 3CF4G 3HUFA 5CJ2A 3UOGA 1B23P 5IKMA 5TGZA 1A7UA 5EQJB 1H3EA 1TJ3A 2N47A 5CLLA 4YRPA 4EG4A 3I62A 2BLLA 1Z18A 2H59A 3WLKX 2V9ZA 2ZOSA 1F0KA 2H1IA 2HO4A 2PKYX 2H2FA 3QK7A 4FLEA 4L6AA 3ZK7A 2ASVA 4WKPA 1M2JA 2NG1A 2GILA 3K0CC 5A0VA 5BR7A 3NLLA 2EX4A 4F2PA 1D2MA 1XALA 3E5NA 1CUFA 2ODBA 3VPCA 2B1IA 4M37A 2AV6A 3O8QB 3OY2A 3QFTA 2X19A 1DUIA 3GEGA 4LA4A 4QEZA 2GM9A 4ENSA 3B6EA 4BO7A 3WL3A 2OO5C 2ZTMA 2AA3A 2GX6A 4IFEA 1GSIA 5LBIA 2XXAA 3FZQA 4AS1A 2YIDA 3JVIA 2G9ZA 1U6JA 5IT5A 1HV8A 2P2LA 4ZVTA 4DC1A 3KJQA 3L1HA 4F5YA 1UC9A 5JJIA 2GD0A 3I8SA 3T5CA 1ABEA 2ANCA 1TAGA 2QL5A 4FW8A 1YAHA 2F1KA 3IEKA 2M9MA 4OK6A 1T34A 1OAAA 1UJNA 1XTIA 4FQ7A 3RJZA 2VDWB 1H3FA 1N1GA 2P9HA 1PJ4A 4RTLA 4X7RA 1RMYA 4HH3C 3DTYA 3TSZA 4FX5A 1JL3A 2RHHA 4ZVKA 4DMFA 2BISA 2QX4A 1QG4A 4LX8A 1KK1A 1JKFA 2DYKA 3D6JA 2B4RO 2CLEB 1TLFA 2QX6A 3QOYA 4FDVA 1AB5A 3TR5A 5KMGB 1JEYA 3FPLA 3LBAA 2PO5A 3M6UA 4DB2A 3I45A 3FHTA 2ODTX 3WNVA 3FPAA 1YH3A 4MJLA 5AW6A 3ECSA 4FNOA 1VGRA 3LFUA 4IJ5A 4A6XA 4BLWA 2HO5A 1GPJA 3Q0TA 1MRZA 4GE0A 4NS1A 2QN1A 3NANA 1W94A 4ZT4A 1ADCA 3D2LA 1DWUA 2GZ1A 4D82A 1M1YE 3PKJA 3ZVMA 2BL4A 2OAGA 2PLAA 1J07A 1DAMA 3VKVA 3KQQA 4QWMA 1RWVA 3E6AA 1E20A 3O82A 5IK2A 4S12A 5F77A 1OXMA 2D62A 4K9NA 1GKLA 2VSYA 1W1UA 4AYTA 821PA 3QNUA 2RJOA 4A0FA 2I55A 4B8WA 1NBOA 3T3EA 3VYVA 5ARCA 4MA0A 1HL7A 4TYPA 4WY5A 1QRDA 4L5CA 4M0MA 3REGA 3U4HA 4W9RA 2ENWA 2RJ3A 3CSDA 1YGPA 2Z08A 2XVMA 1J6UA 1YE3A 3GJ0A 1SOWA 2QQFA 4PWZA 4R1LA 4ZAWA 3CC8A 4AF8A 4MYTA 4Q3AA 2JBHA 4WSOA 3ZDAA 3K20A 4YQZA 1M1ZA 1NUSA 2VP9A 3AV0B 4AMGA 3HDJA 4HGYA 4P08A 1RJDA 3ZDEA 1GPNA 3BJMA 3IE2A 3PENA 3SZLA 1PEKE 2A1TS 3OQIB 1LLUA 1YC2A 2G0AA 3M3DA 3M6FA 2CHQA 2ESRA 3ZS8A 1G9TA 3TN7A 1WKVA 1WW3A 1YL7A 5HRAA 4LOAA 4MAFA 4N3CA 4YMWA 3ZWDA 4DL9A 5T3UA 4EKIA 4BKPA 1Z4PX 4E14A 1G64A 3OLVA 1N0HA 4MPRA 4BBPA 2IEDA 4CIYA 4A6EA 3ZLUA 3O38A 4LDPA 2A9VA 5JARA 3JQFC 2O05A 4KBYA 4FS3A 1L5KA 3U3ZA 4HVLA 2IBSA 4F5EA 2KHZA 5DTMA 1I1OA 5KYXB 2F8TA 3SQOA 4B82A 4WLFA 3TLGA 3H9UA 2WU8A 5FT9A 3TAUA 1YK1A 4TRRA 3CRMA 4MQFA 4MDFA 4MA4A 1DC6A 3ZDCA 3LWDA 3RBXA 1ZD3A 2IXGA 4G5OA 4TQUS 3U0VA 1CBUA 4RULA 1Z8FA 3CPEA 3EDQA 3S1LA 2YNMC 4KGVA 1E98A 2IY8A 1GPUA 3UTDA 5AJVB 4QE3A 5A9TA 4HOYA 2WWFA 2YCLA 3QENA 4J0DA 2DY1A 1JR6A 3WWOA 2CXNA 3HS3A 3NG1A 2PUWA 2XJ4A 3RRFA 3R6GA 4CYMA 3HKDA 4ZTZB 4DR4B 4YRZA 1GFZA 4YXWD 1OMOA 4DM3A 3TVYA 4CMHA 5A9SB 3BMNA 4URYR 2MYUA 3R20A 1VA4A 3T3GA 2HA6A 5CXQA 5DNYB 1YJCA 1QDLB 2H0RA 3P0HA 2NMVA 4B3BA 3Q5GA 5EZ6B 3FWHA 2QMOA 3DZCA 4OL9A 4B3CA 2IPOA 4ZOEA 1A5ZA 5JS8A 3UPUA 4WDRA 5C0OE 5G1PA 3RJMA 3TOXA 3WWPA 4M9SA 2XIJA 4MLDA 2ASEA 2PV7A 4J91A 1WMEA 2ZITA 2L82A 4G41A 2I4OA 1K86A 3KOUA 1CG6A 1JIIA 3DM9B 2WTUA 4V38A 1BHJA 3I9NA 3L18A 1T26A 1AZWA 1NXPA 1FYXA 4IAOA 4TXJA 5EZYF 2ZU6A 1JJFA 1N6IA 1IDOA 1CB0A 5BV0A 5ES4B 1TM2A 1V1MB 1XK7A 2QU8A 4FGKA 4GM1A 3AKDA 3WQRA 3ZVNA 5BWBA 4ZEVA 3EVEA 1MZVA 1LRKA 4FN5A 4JUAA 3GUYA 1C9DB 4NZYA 4F84A 2R1TA 3E3LA 2HCJB 3K8YA 3JQ7B 3IKMB 2YWFA 3QTLA 3FDZB 5HIIA 3UG6A 3DOHA 2BW0A 2YWXA 1YZ3A 1SCNE 2BF4A 5D5QA 2X9GA 1MUUA 1IATA 2HRRA 2WTXA 3GYBA 1SUSA 3ZNQA 3GN1A 4G1CA 4I5EA 4DR3B 5K0NA 5CPFA 3DYBA 1GNPA 2HGZA 5TXGA 5A1TA 5FPKA 1YZQA 4Y2QA 4L08A 2XT0A 1V11A 4PV7A 1X1SA 2AMJA 4GR5A 4IKOA 5EP3A 4B73A 2XBUA 2DUMA 2CLCX 2GFIA 2DHDA 5HFAA 1DO0A 1A8QA 1V26A 3VHLB 5IWAB 1P5JA 1BMFA 1SIUA 2H9IA 3F98A 3MHPA 1WSDA 2V5AA 3NHPA 2I66A 3EVAA 1VYUA 3QF4A 1MOQA 4MGEA 4ZU6X 4X45A 5KJEA 1JTFA 1BIFA 5AUNB 5JD4A 2GEUA 2DBZA 1JQDA 2XR1A 5K45A 1A9QA 4QNRA 3LUDA 2EFEB 4DLZA 3GQVA 4MGHA 1XZCA 3I5UA 3TKLA 3AKZA 2Q7XA 4HWPA 2X77A 1YB1A 2R6CA 4MS1A 4OQFA 2ORVA 4BJ5A 1AA6A 1YFKA 1SXJB 2HZBA 4PU0A 3TPCA 5L3QB 2BFMA 4E5NA 4CLDA 2CVFA 1M1YA 5EYPB 3M5PA 1OPXA 4RV9A 3FVVA 4OI1A 1TTTA 2BWJA 1Q3HA 1IBRA 5FTJA 5HA5A 3W8NA 2FFQA 3CUWA 2H1LA 3ROFA 5FV4A 3WZ2A 3D0OA 2PKQP 1X2EA 1WPGA 2WQZA 4C0SA 1H9BA 4NZMA 3ORQA 4HDRA 3O8OA 2GEVA 2GA8A 2G1JA 2JJMA 2NIPA 2Z09A 2WTEA 4LRUA 5FOUA 3ZY5A 4ED9A 4AQ7A 3H0CA 4EHIA 1J20A 3QKTA 3R7SA 2NZWA 4X85A 4QYIB 3D3EA 4TN5A 5DBEX 1MX5A 3WGOA 3TCXB 1SUWA 4IXDA 5A06A 2QYOA 5D6OA 1AY0A 1HG0A 5B1DA 3I5AA 3CH5A 2V3WA 3PKZA 2Q07A 4N48A 1KFEB 2QYHA 1MRNA 2ORWA 1C3XA 2BFFA 4Q4JB 1IIBA 2BZ0A 1EFDN 4RD0A 3RARA 3C1TA 5K0LA 3TTWA 2X2OA 1KI6B 1JTEA 2ZZKA 1Q91A 4DREA 4QSHA 2IUEA 4HGQA 1U7ZA 1CZKA 2HSGA 3LDGA 4TV9F 3TNJA 4MP8A 1OI4A 1L9KA 2IW3A 3HCBA 3OFNA 2QTTA 2GHIA 4NFLA 3H2IA 1F8UA 4XYEA 5FWNA 1CRQA 1M83A 2H0QA 1C9JA 2XAUA 1UPTA 3PV0A 4KPFC 1JZTA 4CRWB 4LSWA 3LKDA 5TB5A 1L8AA 3HVIA 3N74A 1FPMA 2BKUA 3ONWA 4F60A 1ZUD1 4CM9A 2LKDA 1K8ZB 2CMDA 4JCCA 1K4KA 4MXDA 4OFXA 3UT6A 2DR3A 4HNTA 1P1BA 2YL2A 3N2GA 4TM8A 5D86A 3IVGA 4LFCB 4IQFA 3ROPA 3PFFA 3V4OA 1XBTA 3RVMA 3K53A 3PJRA 2OV2A 3MT7A 5LYJB 2Q0XA 4KC0A 4L16A 1CSEE 4OHKA 3QP9A 3DL4A 1XMIA 3TLJA 5LMNB 3ABSB 1QS0A 2BTQA 2ERYA 2W93A 2WU1A 3BWCA 4M98A 1UDWA 2EKPA 3H6KA 4KLZA 5E6UA 4ZA2A 4LQCA 3SDZA 1ZM3A 3ASUA 1TQ6A 1L5VA 1NYTA 3FVWA 1C8KA 3TRJA 1A8SA 1JI0A 1SHJA 5CBPB 3P9IA 5JCPA 3I4CA 1O1YA 2VUTA 2WTNA 1OSNA 4FXOA 1JPNA 1VJGA 2O20A 4KFSA 4ARUA 4LCEA 4BNTA 4NJEB 4K9RA 4LPKA 1WDTA 2R1ZA 2IEZA 4FCWA 1L3IA 5B58T 4GGMX 2X0EA 1FX0A 3T95A 1OXKB 3M34A 3SSNA 1E3EA 1U9YA 4R2WA 1KYYA 3KEMA 3DWFA 4DMKA 3CISA 1RPTA 5KHOC 4U7JA 1SIWA 2G9QA 3GFBA 2ZRQA 3B1YA 4XPIA 2VSXA 4RADA 1C8BA 2TMDA 2NAFA 5ERGB 2VBCA 4CL8A 1JQ3A 1HA3A 1N5LA 3C5VA 3R24A 2A94A 1KXJA 2R86A 2NNLD 3IPAA 3FCCA 4MCJA 3CHYA 3E1SA 1U7DA 4HZUA 1UJ4A 3IV6A 2W8ZA 3K4HA 1PJTA 1XKLA 3QMMA 2WJHA 4N5IX 4H0FA 2EW2A 4JD5A 1V25A 2DM6A 8ATCA 1ACJA 2UZ3A 2OYRA 4W8HA 3KOYA 3WGZA 3QU2A 4YJ3A 1ECPA 4G8DA 2Y1WA 4KKXB 1CY2A 2G5TA 3FGPA 3ZDDA 1RSZA 2ZS7A 3H5LA 4ENWA 5T4BA 4XEHA 2TS1A 5KSWB 1W19A 1ZU5A 2XMZA 4IRMA 1ZOPA 2GI4A 4FBLA 2JIQA 3L6BA 1W5AA 3N7UA 3WY9A 1JP7A 1QO0D 3MCZA 2YJTD 1J22A 1NF9A 1WXEA 2IIVA 2JAHA 3JRWA 1OH5A 2Q4RA 1E4EB 1Z0FA 2QAGB 3CLHA 4O0LA 1Q19A 2V0GA 5AW9A 1T8TA 4KQ9A 4RYDA 1N36B 3CNBA 2LCFA 1KP2A 4KUEA 2ZR0A 1JKJA 1X9IA 3PR1A 3QPBA 1S96A 1TUBB 3Q8LA 3OF3A 2V7UA 3PPXA 2Z6QA 2BEKA 1A2QA 3Q7PA 3N8DA 4E08A 3GJQA 4HVTA 5E4YA 2EX0A 4MB0A 1PGPA 3KLMX 4UBLA 3BXPA 4D9GA 4PFQA 3IO3A 3L5OA 2FPIB 2JGIA 1E8NA 1WHTA 1R5JA 3AHEA 4X6UA 3PFKA 4QHSA 4U7FA 5HRCA 3NIBA 5DASA 3FPEA 1L4GA 4ZAFA 3ZWKA 5IFLA 2D2XA 2FPPB 2LVBA 4OM8A 1J99A 1TXGA 3FD8A 1NFFA 1KJ8A 2X6TA 4GDMA 5JNWA 1E5TA 1KYWA 1Q1NA 2LW7A 2VNJA 5G41A 3BWYA 4H4CA 3VH1A 5L3VA 5LDDC 2JFGA 1J33A 4HN4B 5DX8A 2H6EA 2ZQZA 1PWYE 2ZRNA 1RRGA 1X87A 3KHUA 4QJ4A 4CF5A 3JAKB 1IQPA 3JASB 1U04A 1OLXA 2W2PA 1LPPA 1VPDA 2WWRA 2XQJA 2YJ4A 2IZOA 1JNXX 2A58A 2IQ5A 3IIJA 4ROSA 4W5WA 3A9TA 1NW7A 1VHTA 1G9XA 3OUZA 4PNPA 3AVYA 1JXOA 2IU0A 5LD2B 3C6MA 3OCZA 3C3XA 3BA6A 4HWSA 1AKNA 1ZIOA 1T1GA 2R84A 3R3UA 4IWYA 3TZEA 4BZZA 1PEDA 4X7PA 5CCXA 2QP9X 5FB3A 3I37X 4XVCA 3ICVA 4B32A 5LQRA 3RWBA 2Y0CA 4ND2A 1FNCA 1ZUIA 1S01A 4HEQA 3SLGA 2QXUA 2BF7A 4LBZA 5J2UA 3M49A 2EJVA 3F8SA 4OYYA 4P7GA 4V0QA 1XHEA 2XVXA 2AZTA 2ZB7A 3BD6A 3FGNA 1IBSA 2PAFA 1A5TA 4DNQA 1KZ9A 4IWNA 2XE4A 3AFNA 3D7MA 1ZL0A 3K9BA 4R68A 3V9PA 4F97A 1GPKA 3HXTA 2E55A 3GH3A 3EIQA 3JTEA 4CMIB 2WYWA 2GUGA 1YRHA 3E1KA 3IT2A 1U2GC 2RAFA 4FFNA 4G01B 3SU8A 1G4HA 4IPTA 4S1OA 4CCSA 4CMKA 4YUXA 3BBPA 4Z4FA 2HDNB 2RIPA 1WQ3A 1E32A 2BVNA 2VWHA 3H8SA 3P96A 4KACA 1JQJC 5CFLA 4KHPB 1KJJA 4KLRA 4LCBA 4PRKA 1W1IA 4KNWA 5LB4A 2QB5A 2XGOA 1R5NA 5SICE 1C3OB 4X94A 4PCVA 3CX6A 2GWRA 4CZ2A 3I6YA 3UHPA 5FBLB 3ASVA 2J6IA 1KRHA 5AW7A 5EINA 3X0DA 2C3OA 1XLTC 1G2PA 3P9QA 4M89A 1F38A 4OHZA 4UEQA 3EQ9A 1QSGA 3P20A 1R6BX 4ND6A 3C3BA 4FR0A 4QQFA 3A1UA 1NJFA 1ILWA 1R6UA 2FZGA 3D7SA 2FSFA 4B43A 1YQQA 3WL7A 5SYNA 3NHRA 3NJ4A 2GXAA 3KXPA 1OFTA 5FP0A 4C7MA 1C8VB 3THXB 1GARA 1OR8A 3RFVA 4ZGGA 3EODA 4ZAGA 4LGMA 1I0ZA 2C8LA 2QAGC 4KQFA 1CCWA 2XX3A 2BKXA 2O1SA 4B83A 5EJ5A 4MKZA 4QGSA 3RF6A 2DKNA 4E11A 4EI7A 4EB6A 1URPA 3UK2A 3MWFA 1SWWA 1Z6YA 2DB3A 4B8YA 1D03A 3AHHA 3EDRA 5FL7A 3U1TA 4CUJA 3TGLA 2Y92A 2ZIXB 3DOCA 2VHWA 1GL6A 3M9WA 1U4SA 4TYYA 3L82B 4J1TC 1KE1A 4ZJPA 1CLUA 1L6IA 3G0DA 1F4VA 2BM8A 4YV0A 5FBZA 1T3HA 4KWIA 2V8OA 3RYCA 3F6SA 3VNVA 2X2FA 2IYVA 3GFQA 3WE7A 1DZ3A 3AY7A 3IIKA 3UANA 3CVWA 4AG3A 2R97A 1TUEA 4IXNA 3B5IA 2JG3A 2F9MA 2ODEA 2XDQA 2I8LA 2XOKA 4M54A 5AT1A 5KDDA 4UULA 1I4TD 3GFGA 5FKJA 2QVYX 1GT6A 3ORRA 5K3DA 3C6YA 4LVNA 4CKWA 1KP3A 1CWUA 1PI3A 2ECKA 2GRAA 1DJLA 1B0AA 1XF1A 1O94A 4HGPA 5EZYB 1X38A 4YUZA 5B30A 1JHDA 2EKBA 5KYYB 2OL4A 3IQHX 2QVGA 4C7OB 2B7CA 4L78A 1NKVA 3LBNA 2PZKA 1OLUB 5ELMA 4A2QA 3JAMA 3BH0A 1HORA 4MUHA 1ZJ4A 1ESNA 1BMTA 1X86B 4BMYA 1TQ4A 2HSJA 3T15A 4YMTA 2FEAA 2PAAA 3F6EX 3I05A 4PX2A 4N6GA 4MGIR 4AZ0A 3MJTA 4NBLA 2RKWA 4M9ZA 4NI5A 1Z3IX 5ALHA 3RYIA 5KVSA 1BO6A 2VDJA 2VDKB 2XUKA 3QKSB 5DYNA 1NPDA 3WIVA 1GOTA 1EWRA 3EG9B 1MRSA 2PUJA 2Q8PA 3RJ5A 1Z5NA 1TJ5A 5G2OA 1J2RA 1K5PA 3UNXA 4RMHA 3OMLA 4TYQA 3A10A 3DVQX 2X22A 3STYA 5HSGA 3UXYA 4F12A 1RADA 1E5LA 1LRLA 1WZEA 2GM4A 2VP0A 2GN4A 2JHAA 4BNIA 5IJ0A 1L7VC 3NHYA 4QRIA 3OQOA 1T1SA 4N40A 2WZQA 2WHRA 1JLLA 2IEBA 5CT9A 5KKNB 1U90A 3AVQA 4GRIA 4V0LA 2EAUA 1UIMA 1ZNQO 2Q6LA 3EGWA 3P0RA 4FKMA 4ZN6A 5CRIA 3AY6A 1ADBA 2ZVDA 3GEPA 5DW0A 2YY6A 4UE2A 4F2HA 1RYNA 4UDXX 2XYVA 4WRRA 1PDOA 2WIAA 4Q19A 5FWDA 4QOEA 3KD3A 4BRSA 2Z5FA 1WY5A 2BI7A 2YXBA 3CMCO 4E46A 3P0JA 2O1EA 1SZCA 1H4VB 5FNZA 4DUGD 3FETA 1NRIA 3TTTA 6REQA 3HABA 3O8BA 2DUWA 4ZTBA 4DMLA 1NYQA 1Z3CA 1J9EA 5FYQA 1L5GB 5I7UA 1HSOA 1M1UA 5A6SB 1EGMB 1S4QA 4R6WA 1UAGA 3A1DA 1BCRB 3U4CA 1N2OA 3W3AD 2NXJA 2O2EA 3ZZTA 1CUZA 4P33A 3BE8A 4TN1A 3F71A 2RAPA 3FB1A 5JZ9A 3MMSA 1LF0A 1O95A 2IZ0A 1WETA 5HE9A 1KDTA 5F98A 4DGSA 1AV6A 3NHJA 3U9LA 3WGYA 1KEEB 4WGGA 4YAJA 4B5LA 1ZMTA 2PMDA 5GQSA 3LF1A 1I5OA 1O0BA 1PT6A 2OSBA 1GPYA 2ZBEA 1WY7A 2HTFA 3ENKA 5KU1A 1OYYA 4BP1A 3OUUA 2QTVB 4H77A 1WNTA 3RT7A 3RV4A 1QTRA 2Q46A 3T5GA 4DEVA 3JATA 3NDIA 4UVEA 4EG5A 1W9MA 2OQRA 4O33A 3WLFA 1QYXA 1SBTA 4DA0A 1XDWA 2VNAA 4F5WA 4E70A 3F6PA 2EEZA 4HZIA 4DIKA 1UFVA 2BEUA 2XD9A 3D81A 2WLTA 4UM8B 4RDXA 4OP2A 5GTDA 3SGLA 2ZFUA 4B7ZA 1KI9A 5CAEB 1RE1A 3OT1A 3R3SA 4G5XA 3K6SB 1JHPA 2IZ6A 1LBIA 4GW3A 2QOEA 4JR0A 2I2BA 3JQ8A 4LK3A 1TRKA 4TV9B 4LJLA 4G0YA 4WH0A 5U4QA 3UPTA 1LSSA 5DW3A 1T9GS 1GR0A 3HV0A 3V1TC 4E5DA 1B7GO 2EIHA 3RC7A 4G0OA 4DN6A 3K6RA 3NAZA 3MINB 1KYZA 3A6GA 2QUJA 3EMBA 3DH0A 5THKA 4OQNA 2MSCB 4FC6A 4OTZA 2Q1TA 1AGPA 4HH1A 4QYMA 1AB6A 4LXTA 1FP1D 1XTRA 2A9PA 2G83A 3GLIB 3AP2A 1XSEA 1RCFA 3HGTA 4XEUA 5BQXA 4FGUA 2H5EA 4V3CA 1XLWA 4BNDB 1XFAA 4HXYA 2HA0A 3JQ6A 3ADOA 3T1QA 4I4LA 3ISTA 4U2EA 1ZA1A 5M5BA 2X9LA 4NZZA 2QS9A 4KBFA 1I4EB 2Q5HA 4CPDA 2OUKA 1WB4A 5AJWA 4CM4B 2O8CA 1SULA 2HTEA 2I8AA 4EY6A 1R16A 3KFXA 1WP9A 1RHMA 5DHQA 4JSYA 5BPHA 2IEYA 1S2GA 2IHTA 2QRMA 1PG5A 4LI0A 3GP5A 4G25A 3I39X 5AW5A 4Z54A 1U8XX 3ZIAD 4ZO7A 3CZQA 2NXWA 2Y1KA 4P54A 4S1PA 3WNDA 1L7EA 2JLCA 3HC7A 5EWJA 3J80A 3UFBA 1MO2A 2PNFA 1NG1A 1Y9AA 2BLNA 3AF0A 2AOXA 3ESZA 4E5YA 3JQEA 1QVVA 3TDKA 3A4NA 3OE7A 1LDBA 2AQKA 3F7OA 2XYRA 4FN4A 4QUKA 4TMFA 5LDGA 2I2AA 4PY2A 5J5CA 5ERYA 3OE5A 4A03A 4UD2A 2OAQ1 2RHCA 5G0UA 1BDHA 3F73A 4C7BA 3ZCPA 4ALNA 2X15A 2L0XA 1UDAA 1DBWA 3ER9A 4RK1A 3EJWA 4ID9A 5SY6A 4WY2A 2DLNA 5LMUB 2GCGA 1N9GA 3W78A 4JLVA 4MZDA 3WYAA 4ABYA 1NVVQ 2JBAA 3W1WA 3ETEA 2ZWOA 3HR8A 4MVYA 4QFMA 2RBGA 3A04A 3R5JA 4R1QA 3VVCA 5LQNA 2PWYA 3CU5A 4ICIA 4II7A 1LLQA 1NDQA 2IYAA 3BREA 4ON9A 2AH5A 1RWXA 4Y1RB 1C3VA 1E18A 4ZKEA 4B3JA 1J2JA 1LZKA 1W5TA 3B1XA 4IGKA 2B2XA 3VU8A 2AKAB 2AFHA 2NPIA 4AJKA 1PR6A 3PD7A 1TZCA 4TQAA 1XRQA 2B7LA 3F6CA 3KS9A 4B4KA 3ZGZA 5L7YA 1XVIA 1QDUA 3ZCVA 2J3DA 1N2BA 2F64A 3HCPA 1O6BA 1Q84A 2TMGA 3BE6A 3JWEA 4NFSA 2QSZA 1SA0B 3DO6A 3G8CA 5LXTA 1OH6A 3TD9A 3VJRA 1CU1A 3OJ0A 3M5WA 1O8CA 2ZUWA 1KO7A 3OU6A 3NTLA 3QVKA 4CVNA 1KQOA 1IHOA 4NEQA 4UXIA 4BO9A 2ZT6A 3F3YA 1W6RA 1Y42X 5L6MB 3ABRB 4MMXB 4PLHA 5CVJA 1ZESA 2J0VA 3U16A 2AZMA 3NHUA 1MFPA 1E6EA 1L5SA 1XZHA 1ZGZA 2UUOA 2WK1A 3CLSC 1NVTA 1AQ6A 3F67A 1PLLA 3KPYA 3NAGA 1PLJA 4R1OA 5BSUA 2KBEA 1RXYA 5AIBA 4J0JA 1EDOA 4ZWNA 4CKEB 2OHJA 4P4GA 1MZPA 1NURA 4ZZ1A 3O9VA 4L5YA 2EJUA 3LS2A 4XM0A 4NAUA 2C98A 1EXNA 3SK0A 3P9PA 1EP1B 1MKYA 4YLYA 1KY3A 3L4KA 1NA5A 1T8RA 3FWKA 3NC4A 2XKBA 4ZQEA 1O3YA 1WAMA 3TRDA 3JTMA 3K96A 1YZVA 2MINA 2OYCA 3VDNB 4NMWA 3VAYA 6YASA 5LZ4A 1DS6A 4INPA 3VHQA 3ZVKA 4MYHA 3VBEA 5JTTA 1VSTA 1ZLYA 4EKYA 2DWQA 2YASA 3I5MA 3VAZA 3BORA 4KB5A 1BD3A 2AC7A 2R11A 5K9ZA 2F3PA 2XCTB 3GVXA 1LU9A 3QKRA 4R9SA 4QHYA 2PXXA 1ZH4A 3AR3A 4DA8A 2ZYTX 5HJEA 5F7OA 1IBCA 3CR8A 4IZIA 2KM1A 4KGDA 4E21A 2Q99A 4ZHSA 4UDOA 1UBKS 4TWIA 4RPHA 4PHTA 2R751 3ZS9A 5JAIA 5LB2A 2PXCA 3TR6A 3KZOA 1CY8A 3UMFA 2QTLA 1RKQA 2WJJA 3IAXA 4GP7A 1PKXA 1EUYA 1J8FA 1ZICA 2HZ7A 3H1PA 4BEVA 1BEUB 2JH9A 3EIXA 5HWSA 3IHLA 5IM4F 3CWQA 5HP4A 4H4EA 5KCZA 1BOOA 1FU7A 2ZE5A 1CVRA 3L2OB 3Q2IA 2I29A 4D3SA 1ZM7A 2HNBA 3O91A 3IOBA 1RT9A 1AXGA 2CWDA 3DLIA 1UBUS 3IAFA 1LVHA 3IUBA 3NIDB 5BYJA 5BQFA 1FIUA 2Y3IA 1ZVKA 1O77A 4IBOA 3TOCA 1CQIB 3ZTWA 1W73A 2ACKA 3R0ZA 4DRYA 5CM9C 1E3IA 4PYKA 1UP6A 4OQYA 3G0BA 4NYJQ 2QGNA 1IIRA 2HA3A