4PW0A

Alpha/beta hydrolase fold protein from chitinophaga pinensis
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
275
structure length
275
Chain Sequence
NDHATAPTQYIEVNGTRYAYRSLGAPSDIPLICFQHFTGTLDNWDPLITNGLSKGRQLIIFDNKGVGLSSGTTPDNVAAMTADALEFITALGIRYFDVLGFSLGGFIVQYMAHIQPDMIRKIIIVGAAPQGVKVLHTFPDLIARAMQLEPKERFLFIFFEQSEHSRSKGLATLGRLYERTTDRDQDASAQAIGAQLTAITNWGKKTPSFEITSIQHPVFVVQGSNDEMMDTYNSYELFKQLPDAILSLYPDAAHGSFYQYPELFVSQTEYFLDSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Alpha/beta hydrolase fold protein from Chitinophaga pinensis.
rcsb
source organism Chitinophaga pinensis
molecule tags Hydrolase
molecule keywords Alpha/beta hydrolase fold protein
total genus 101
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2014-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4pw0A00
5ALYA 5FPQA 3BJRA 5ALMA 4OYYA 3PFBA 3ZLTA 2XUPA 4ITVA 3K6KA 5HCUA 5IVDA 1YAJA 4LXHA 5C81A 1QIDA 3IULA 5ALWA 3FVRA 5E2IA 4FFWA 4HXEB 2J4FA 1XLVA 3PE6A 2VJAA 3LLCA 4CCWA 4Y2PA 4DNFA 3D7RA 3WWEA 4J0HA 5AKIA 5FKJA 3GBSA 1EHYA 2O2HA 1UOPA 2WFLB 5AO9A 4JEIA 1E8DA 2NW6A 3G9XA 3AIKA 4FTWA 1DT3A 3R40A 1IUPA 3PDCA 4FNGA 1VE7A 5I8PA 2YXPX 3HI4A 2PPLA 2QJRA 4H7DA 4FDMA 1CR6A 4B0OA 5LZ9A 2QJWA 4BAUA 3I1IA 2IIVA 3FCXA 3LIIA 3QMWA 3AZQA 1Q84A 3ZPXA 1QIMA 5ALFA 5CH5A 1WPXA 2XMQA 1CRLA 2PSJA 4GHWA 3P2MA 1XQVA 3OTQA 5J3JA 1EH5A 4W9RA 1TQHA 2XQGA 3C43A 4IH1A 1QE3A 4IH9A 3NGMA 1H22A 4H7KA 2QOEA 4CG1A 4Q82A 1OCEA 1T4MA 3DOIA 1CUXA 1U4NA 3FAKA 2VTVA 2DCMA 2WU3A 4RE6A 2WHRA 4CFSA 5DTJA 1TCCA 1TKRA 1JU3A 1WCYA 2AJBA 4V2IA 2XMDA 2ZSHA 4DMCA 4K6GA 1BEEA 2R11A 4EY6A 1QJ4A 1ORVA 1YS2X 2XUIA 1RWQA 2DQZA 5A7GA 1QFSA 3TRDA 5T4HA 1YB6A 4OB8A 4K5QA 5CMLA 4A16A 2WUEA 4P93A 4ZI5A 3N0TA 1QTRA 5IVHA 2WHPB 3V48A 2OQVA 2Y2UA 2VAVA 1EDBA 4AN1A 3LS2A 1DWOA 2HFKA 4X85A 4UBNA 4E46A 3G8YA 5K5EA 4UBLA 1VXOA 2Z5GA 1J07A 1BN7A 1E5TA 3H1AA 5AKEA 1QIKA 4Y2YA 2D5LA 5IVIA 1DU4A 1C7JA 5K3AA 1QIEA 4U2EA 5KREA 4DTCA 2B9VA 1P0PA 3O4HA 4DGQA 5IH7A 4EZIA 4KR0A 4UHFA 4GWLA 3DDUA 1B41A 2OCLA 1LGYA 1E3QA 4Q3LA 3C6XA 3AUKA 3OOSA 5ALLA 2H7YA 1A8UA 1ZD3A 5A2GA 4PF1A 3R3UA 4KE8A 5AOBA 5LZ5A 1IUOA 1BCRA 3STUA 2AJDA 2J3QA 1TAHA 4XWGA 3OM8A 2X5XA 3KSRA 5HQ3B 3WWCA 5ALDA 3A2NA 3WK5A 2WJ3A 3U1TA 3I2HA 1PV1A 3SC2A 5HQ3A 5CT5A 1BS9A 5HFAA 3EQ7A 2I03A 3DCNA 4MWSA 2LIPA 3M83A 3UUFA 5AIBA 1W75A 4BE9A 2HA7A 5CTAA 1XQXA 2XLBA 4JH0A 1K63A 1NU6A 4QNNA 4GW3A 1ZOIA 2Y2VA 3WLAA 1EK2A 4BCBA 5A71A 1S8OA 1CPYA 1CV2A 1C7IA 4AX4A 4EY4A 3G0GA 5K3FA 3V9AA 4X94A 5LZ4A 2DHEA 1GQSA 1RYYA 4PV7A 2RAUA 3R3WA 1KU6A 4IHAA 4UHHA 4DMHA 2WG2A 1HPLA 3HACA 3Q8WA 2XQIA 1H2YA 1KU0A 5FV4A 4C6HA 1AMNA 4OPMA 4AB1A 3RKSA 4WFKA 5AKHA 2XMBA 4F5ZA 1MAHA 1LPMA 4FLMA 3VXKA 5CXXA 1IZ8A 5HFNA 1EB9A 2RIPA 3I2JA 4G9GA 1K5PA 3KWJA 3BF8A 4U2BA 1WM1A 2QS9A 5E4JA 3FYTA 5BWCA 4KAJA 2R8BA 1CUHA 4KJXA 2XUGA 3R3XA 4LIPD 3HSSA 1QIIA 1EK1A 5EHNA 1ZI6A 4G8CA 4DM7A 1F6WA 3F98A 1N5RA 3BF7A 1CUCA 1T2NA 1YASA 4BVJA 4EY5A 3HJUA 4IH4A 5D7BA 2PVSA 2JF0A 5AI5A 4G4IA 3G0CA 4OUKX 4KAAA 1AC5A 5K3CA 3H1BA 2HU8A 1VA5A 2YH2A 5LZ7A 1H23A 2XI4A 4DNOA 4AZ3A 2ECFA 4G1FA 5CT9A 1CUSA 1YSCA 2Y6VA 4I3FA 3CCBA 4ZRDA 5C8VA 4Y9SA 3RK4A 1L7RA 3BXPA 2G63A 1CUYA 4AXBA 4AN0A 1QGED 4F60A 4ZWNA 4TGLA 2B61A 4DIUA 1A88A 1VZ3A 5JATA 4TVKA 2Z8XA 3L1HA 4MQMA 3HYSA 3H2JA 1X2BA 5ALJA 2I3DA 4J0DA 4C4YA 1MX5A 3RM3A 4H7EA 2BCEA 5AP9A 4E14A 2PSFA 1XQYA 4B85A 4X7BA 1UWCA 3WKCA 2CB9A 3R3VA 4N5HX 2XMCA 3FLEA 3DL4A 3K9BA 2P8SA 4UHDA 4BATA 3GA7A 1ZIYA 2C7BA 3H17A 4Y2TA 4Y2JA 3BL8A 1XZCA 5ALIA 2PBLA 4O08A 2GBGA 3VJLA 3L1JA 5AIAA 2BJHA 5EIHA 3PFCA 3QMMA 3G7NA 4EA6A 5EHQA 1JU4A 2Q0XA 1WB5A 1XQWA 5JAHA 1XRNA 4HVTA 2GBIA 3WJ2A 3JW8A 3ESCA 4QDOA 4AQDA 1HKHA 1HBJA 2QT9A 1QLWA 3TJMA 1QOZA 1J2EA 4Q3KA 4ZGBA 3QPCA 4W1QA 4PW0A 5H3HA 5JD5A 3TGLA 1X2EA 5K3BA 4QDTA 2OAGA 5SYMA 4Q05A 3QM1A 3A2MA 2OLEA 4XVCA 4BCDA 3D59A 4ZV9A 4H0CA 2Z8ZA 3E3AA 4NVRA 5E4YA 4C4XA 2ACKA 4BP9A 3JWEA 4N8SA 1ZJ5A 2HADA 4UUQA 1XZKA 2XUOA 5FLKA 5CH8A 2JGEA 5YASA 3WIBA 5EHZA 4EB0A 1EINA 2IITA 3VJKA 1ZI9A 4U2CA 2WILA 5FOQA 1LPBB 1MU0A 1GGVA 1LPPA 1Y7HA 3WK7A 1IVYA 4Z49A 1N8SA 5AH0A 1MNAA 2HA2A 1BEZA 4M0FA 4PSCA 1IUNA 3I1YA 1ISPA 3WL5A 3WYNA 3JYHA 6YASA 2XLCA 4UBMA 4UHEA 4WDRA 2HRRA 4QE3A 1G42A 4HTAA 2RONA 3IURA 1AKNA 4LXGA 3VDXA 2CJPA 1ZD4A 4BAGA 4CIBA 3G02A 2V9ZA 4XX1A 3OG9A 5DWDA 3HC7A 2YYSA 4WDQA 3WA6A 5C8ZA 2PL5A 1F8UA 4J7AA 5HKBA 2ZVDA 1Y7IA 4J0CA 3EQ9A 1Q0ZA 3KD2A 4KE9A 3BDVA 3AZOA 3EQ8A 5CRIA 2OXEA 2H7XA 1UT6A 5DYTA 4Y2QA 5CURA 1ORWA 5ALRA 4AO7A 4QA9A 3M81A 5LYYA 1EI9A 2JGJA 2JEYA 2OGZA 4WJLA 2Y1KA 1EA5A 1W52X 4KAFA 4ZV7A 2G4LA 4Y2UA 4EUSA 1DX6A 2C58A 2WJ6A 3C5VA 1UZAA 1DT5A 4X00A 3V1LA 3FCYA 3KDAA 1MTZA 3I6MA 4CG2A 2ACEA 1XKLA 2QVBA 2XDWA 5ALXA 2C4HA 4U2DA 4BYMA 5DNVA 4E11A 2RHWA 1C4XA 2WUFA 3PF8A 3IUMA 4PO3X 3R3YA 1EXWA 3O95A 3WJ1A 1M33A 4U2FA 3I2FA 2RHTA 4W1SA 4W1RA 2XQJA 1XZMA 4LYDA 3GELA 2GZRA 2WIJA 1FFBA 4BRSA 3WKDA 1LBSA 3SX4A 1NU8A 5A7FA 1N5MA 4ZXFA 2HA4A 5K3EA 3C6ZA 3DKKA 3PUHA 2O7VA 3BJMA 1R9NA 3S8YA 4DSZA 5AK5A 1JJFA 3RLIA 5AKYA 2BUCA 5ESRA 3BIXA 2XT0A 3F96A 4KRXA 3DJYA 3HXKA 4I19A 3DS8A 4W1PA 1H2ZA 1DWPA 5IVKA 4MQLA 1UK6A 3IVMA 2ZJFA 3VVLA 1B6GA 3C6YA 1CVLA 5HK8A 5ALKA 2JGKA 2WKWA 2JEZA 4GBGA 3C45A 4L72A 4FBMA 3FLBA 3V1MA 1CFJA 5EIAA 5ALPA 4UBKA 2G5PA 3C5WP 4UFNA 1WB4A 5LKRA 2CZQA 4Q34A 3NOXA 2UZ0A 2XMSA 5AM0A 5LKAA 2DHCA 1FFAA 2GYWA 1FJ2A 2XMZA 2PM8A 1MN6A 3AJAA 4MWTA 3AZPA 4KEAA 2FJPA 5JANA 4QDZA 5JD4A 3WWPA 2HRQA 1UK8A 3IBTA 1R4ZA 2O2GA 3BWXA 3IUQA 3F8SA 4BZWA 1CUVA 1UKBA 2WG0A 2HM7A 3T4UA 2W22A 1VZ2A 2QUBA 4BDTA 3FWHA 4MYDA 4UFPA 2E3JA 4RPCA 1QIHA 1EVQA 2VSQA 2OCKA 1CUAA 4TPKA 5I9IA 1H2XA 4UHCA 4CCYB 2WHQA 3D5EA 1EX9A 4JYPA 2BFNA 5AM5A 3D0KA 5AI0A 3ZI7A 3B12A 1R88A 5BOVA 5K3FB 1ACLA 5AK6A 5ALHA 3NWOA 4Y2RA 4PSDA 1CUBA 5DTIA 1ODCA 5AI4A 4QDUA 3NUZA 4I4CA 1TIBA 3SWWA 4EBBA 1VJ5A 3D4LA 1AGYA 3R0VA 1HL7A 1NX9A 3D3NA 3C8DA 2XB6A 5AKXA 1QO9A 3WK6A 4FLFA 1AURA 5AI6A 3D2AA 5FDFA 4HXGA 5JAPA 4DYHA 4UBOA 3QPDA 4H77A 3CXUA 4YASA 4ZREA 3H2GA 3WKBA 1A8SA 3HABA 1GKLA 1GKKA 5DNUA 3U0VA 2YASA 3LP5A 3H2KA 5T4EA 1BN6A 2AXEA 1AUOA 2QZPA 3AIMA 3A70A 1JJIA 3W06A 4B7ZA 5ALUA 2HU7A 1ODTC 2GYVA 3DNMA 2VA9A 1UK7A 1WHTA 1MJ5A 3WKAA 4YK7A 2O2IA 4CG3A 1IMJA 1LPNA 2O7RA 2C0QA 5D3KA 5DYWA 5AK3A 4C88A 4PNZA 2JGFA 3AINA 3W2TA 2BAGA 3IB3A 5ALTA 4G8BA 3I2IA 2WFLA 2QUAA 3I6ZA 4X3CA 2ONCA 5KBYA 4BTLA 4IO0A 2ES4A 1VA4A 2ZJ6A 4FKBA 3FSGD 3HEAA 3LIPA 1YA8A 7YASA 3HLKA 4X91A 3V1KA 1TCAA 1QONA 4JYMA 3AILA 4H7FA 5JASA 1W4LA 2WIGA 3BE8A 4BC0A 4IQ4A 3DYVA 4DMFA 3G0BA 5HKAA 4CI9A 4QLAA 1VKHA 5CH3A 4BZZA 4FMPA 1YAHA 1YA4A 1CUIA 2BUAA 5C8XA 2CMFA 1ODSA 5FPPA 1GXSA 4B81A 4E15A 1WHSA 3TEJA 3WZLA 1UK9A 4X92A 4OYLA 4P92A 4X6UA 2XUKA 4ARAA 1H2WA 4KACA 5JALA 2OG1A 4WFJA 2PU7A 2GZSA 3DEAA 4OCZA 2QMQA 1WOMA 3CN7A 1HLGA 2VT6A 2C5GA 1XRRA 1JJBA 3HRHA 5EIEA 1CUEA 1SOMA 3O0DA 1BRTA 3STVA 2DHDA 4OD0A 3BDIA 1VE6A 5JIBA 3WKEA 1CUJA 3O9MA 4F21A 4NMWA 1TCBA 5HZGA 2GYUA 2WTMA 3G9UA 3W9BA 5ALEA 5FP0A 4FLEA 1ZD5A 1MPXA 4FWBA 1UXOA 4C01A 4UFOA 1XZFA 4H7IA 4KRYA 1XZIA 3ESBA 5HF9A 2OQIA 4Y2VA 4CCYA 2AJLI 2CUTA 2PSDA 3OPMA 4KE7A 3LCRA 2HFJA 3H19A 4J0GA 1LPAB 3L1IA 1G66A 4FOLA 2WSLA 1DQYA 1E66A 5DNWA 3ICVA 5AOCA 5IKXA 4U2GA 2J4CA 3ESDA 2Z3WA 1R3DA 5AKLA 5E4TA 4B84A 3FLAA 1Q0RA 4HZGA 3DKRA 3ANSA 2H1IA 3WQHA 1Q83A 1ETHA 1ZIXA 1G4HA 2PSHA 1CEXA 4MJ3A 2Z3ZA 4BVLA 2PUJA 1O6FA 4GDMA 4BCCA 5ALNA 2B20A 2ORYA 4N5IX 3OC0A 3ESAA 3PF9A 4G4JA 3V1NA 1HDEA 1XLUA 4OB7A 1BE0A 1YR2A 4A5SA 3B5EA 2WFMA 3VKFA 5JZBA 4JUIA 3QH4A 4X6XA 3STXA 4PSUA 4GLBA 3DYIA 3DLTA 1XRQA 3VISA 4C4ZA 2PX6A 3ICWA 3WWDA 4W63A 1Z68A 5ALGA 3OURA 2XUHA 2XUJA 1GPNA 2PKYX 1GT6A 4WFIA 5EI5A 4LKOA 4K6KA 2H9YA 4HAIA 4MYSA 3O9VA 3T52A 2EDAA 4HRXA 4N8EA 4DNQA 3STTA 5JZ9A 3FBWA 3ANTA 1BU8A 1SCKA 3G0DA 1U65A 4B83A 5HF8A 2XQFA 1AQLA 1CUZA 2WU4A 4FHZA 1ZGCA 1LNSA 2OGSA 3CN9A 1P0IA 1QIGA 5C7YA 3STYA 4BB0A 2VATA 1W1IA 5I7UA 4G5XA 2FX5A 4KYVA 1P0MA 1ACJA 2WM2A 2VF2A 2GBFA 4LYEA 5ALOA 2C0PA 5HF6A 3W04A 3H18A 1PJAA 4L3WA 3VVMA 2FJ0A 2HDWA 4XJVA 4H7JA 5D6OA 3WK4A 1LLFA 4P9NA 1CUDA 3IUNA 4G4GA 3WIOA 4UBIA 4B6GA 1XZJA 3E4DA 2FUKA 4ETWA 3D2BA 4B9EA 1UOQA 1ZI8A 5A62A 1LPOA 1JFRA 2ZSIA 3QITA 1RP1A 3A6ZA 3F9CA 1F0PA 1YB7A 4X97A 4J0IA 1OXMA 4DMKA 3AIOA 3ZLVA 3R3ZA 1XZHA 2RGUA 4KE6A 1QIJA 2V96A 4QDXA 3M82A 4C89A 2AJ8A 2WQZA 3MGAA 4QWWA 1WB6A 1AX9A 5JAUA 2HL6A 5BV7A 2CBGA 3DD5A 3KXPA 5EFZA 4BRZA 2WG1A 4B0PA 1SCIA 4N8DA 5AM4A 1N1MA 4A23A 5AI9A 2QXUA 4J03A 1VXRA 3IUJA 3F67A 5LZ8A 1MAAA 4BBZA 1TRHA 4JNCA 3GZJA 4BDSA 1D07A 4AZ0A 5AJHA 5KWJA 1JI3A 5CBKA 4RGYA 3UUEA 4WY8A 4FBLA 2XMRA 4F0JA 2OCIA 1QTIA 2VJDA 3O4JA 2OCGA 2WIFA 4L0CA 2BGNA 4Y7DA 3GFFA 2C5FA 1JKMA 4DSAA 1CLEA 5CT8A 3D2CA 1GQRA 1YS1X 2DSNA 1ZGBA 3M3DA 2I3ZA 2VEOA 1XRLA 5JAOA 4Q3OA 1E8NA 4LXIA 4X93A 2W6CX 5LIPA 2ZYSA 1XZDA 3X3HA 2QTBA 2I78A 2DR0A 3FNBA 4AO6A 1VLQA 5AKGA 5T4FA 3GROA 3MUOA 4EY8A 1GZ7A 3WYDA 3UMJA 3FYUB 1I6WA 2QRUA 5D3ZA 5FXMA 3I2KA 4HRYA 3SK0A 5AHXA 3IA2A 4M0EA 5AM3A 2HU5A 4X6YA 5A6VA 2JIDA 3W9UA 1FFEA 4HXFB 5JD6A 4UHBA 4ARBA 1DINA 4FFVA 2OAEA 1J06A 2WJ4A 4H7HA 3F97A 4J0KA 1GPLA 1XZGA 1QIFA 4C87A 3HZOA 1SCQA 4Y2SA 3G9TA 4PQEA 4BVKA 3C87A 5ALQA 4K6HA 2V98A 1THGA 4OSEA 3WWOA 2WLSA 2PSEA 5ISMA 1FFDA 4OU5A 4OU4A 1QZ3A 3ZV7A 1UKAA 2VJCA 5FUMA 5AK4A 3C6BA 2QXTA 3W05A 3WK8A 4RE5A 4L9AA 1JMYA 2G5TA 4J3JA 4UPDA 2XMGA 3H2HA 1YCDA 1XROA 1KEZA 3PICA 1A7UA 5CW2A 1P0QA 3E0XA 5CXUA 2ZYIA 2QM0A 2WIDA 3DL7A 3S2ZA 2EEPA 2JGLA 1SC9A 3FYUA 3BIWA 3WMRA 4EY7A 2D0DA 2RI6A 4K2AA 4QZVA 1J1IA 4G9EA 4QLOA 1BCSA 5A7HA 2AJCA 3VJMA 4X95A 1XLWA 2VAXA 1CUWA 3IIIA 4GXNA 1CQWA 1XRPA 3RARA 5LP1A 2VQ6A 3G9ZA 5AI8A 1PFQA 1CIJA 2IX9A 4GI1A 4X71A 3IDAA 1LZLA 4INZA 3Q0TA 4BAZA 2PUHA 1K6EA 4CIAA 1SFRA 4BC1A 3R41A 4M0MA 1O6GA 2ZYRA 5AOAA 4WY5A 5K3DA 4D9JA 5JYCA 4B82A 2HA5A 1EB8A 2ZJ7A 2HA0A 5ALSA 5DYYA 1THTA 1F0NA 4AO8A 4BTVA 2XUAA 1QO7A 2WUGA 3EF3A 1CQZA 1ZJ4A 3EBLA 2WTNA 2EDCA 1UKCA 5DJ5A 3MVEA 4MEBA 1ZICA 3C70A 3EIOA 4Y2XA 4B9AA 1DWQA 1EDEA 3H04A 2JGMA 1AZWA 3PUIA 4GECA 4RNCA 5ALZA 1XZAA 2WUDA 3WI7A 5KWIA 3B3QA 1MO2A 2VT7A 3I28A 1QFMA 4DNPA 1ZD2P 3I6YA 2ROQA 3I2GA 3WL8A 2X8BA 3KOOA 4OB6A 5T4BA 5ALVA 1MX9A 2PU5A 2XQKA 4WCVA 5EHXA 1MT3A 4BE4A 3DOHA 1K4YA 4YPVA 1HQDA 1GPKA 1FFCA 1XZEA 3CCCA 4HS9A 3E1GA 2JGIA 5HF5A 1XZBA 3WK9A 2HIHA 5JADA 4B80A 5LZ2A 3O4GA 1USWA 1EVEA 2XUQA 3H0CA 1DX4A 1Y37A 3O4IA 2BUBA 2HA3A 3FYUC 1LZKA 4XIIA 4QWMA 5JARA 2H7CA 4H18A 4MEAA 4Q1VA 1W6RA 2XE4A 1R1DA 3QVMA 2OGTA 1VOTA 1DQZA 1XKTA 5AM2A 2CEKA 2XUFA 2BKLA 4FNMA 1CUFA 4GEGA 4EHBA 3A2LA 1LBTA 1G5FA 3G0IA 3WL7A 1TK3A 5DLPA 1UFOA 2CKMA 2HA6A 5AKKA 4S0XA 1MX1A 3QYJA 5AKJA 3N2ZB 1W76A 2GBCA 1R9MA 1U8EA 3QPAA 5CT6A 1XRMA 5AM1A 3AFIA 1XFDA 5AKZA 1X70A 1L7QA 1WPRA 3STWA 2B4KA 2X76A 3QBJA 5LLSA 4LHEA 1L7AA 1E89A 4DLNA 2VJBA 5CT4A 5EGNA 1JMKC 2QKYA 4NZZA 1A8QA 1XZLA 3KWFA 4X90A 3QZUA 3FOBA 1CUUA 4P08A 3YASA 5BWBA 2HHAA 1EDDA 4UBJA 4QEKA 1E8MA 2V97A 4YX9A 2WHPA 1JT2A 3WL6A 3ED1A 4BP8A 1FSSA 3ZLUA 3DQZA 4MXDA 3QMVA 4H35A 2ZYHA 2DQYA 2K2QB 1LPSA 5AICA 2J3DA 3PI6A 3ZWQA 1BROA 2OPHA 1IZ7A 5HK9A 2WFZA 3FVTA 1U2EA 2XUDA 3K2IA 4AMYA 3MUNA 2BGRA 5SYNA 3FSGA 1OILA 3WA7A 5F4ZA 1UOOA 4AMZA 2Y6UA 1DTEA 5JZSA 3WZMA 3GUUA 3C8HA 3H2IA 2JBWA 1K8QA 1MNQA 3ILSA 1CUGA 5FRDA 4ROTA 1R50A 2QR5A 2DFPA 4NS4A 2WIKA 4G8DA 4J0JA
chains in the Genus database with same CATH superfamily
3QPUA 1UAYA 1FFHA 4IIUA 4TTSA 1JDUA 4DSNA 4OYYA 2W2LA 3DO6A 5KHAA 1DIAA 1I01A 2JAXA 3KE8A 2E6KA 2FV8A 1SBYA 4R68A 3DB1A 3K6KA 4YUYA 3ZI0A 5IVDA 2GFHA 4HWTA 1SC4A 1NWCA 3CLKA 3QKWA 1QIDA 2HHLA 4JMPA 1RRMA 3FYHA 5F9HA 2QMZA 1ZA2A 4YA6A 3FCCA 2FPSA 4A1FA 1JI0A 2QZJA 4HXEB 2J4FA 5L3QB 5EMKA 4GEKA 3AK4A 3VI4B 3PE6A 2G1PA 4JI2B 5B3JA 3ZC3A 2GETA 1JJVA 4HAOA 2IU6A 2DULA 4CCWA 3GEDA 1JEYB 3G17A 1ZISA 4RK7A 2GNPA 4ZMSA 5B3JC 2NV2B 5FKJA 3FDZA 4JLVA 3OLWA 1SK8A 3TRHA 2O2HA 4RA6B 3BTOA 4WQMA 4DRZA 2F1OA 3CNBA 3LA8A 4JEIA 2QQEA 2R7NA 5B55A 3Q7SA 4CMJA 3BXXA 3R6TA 1PQUA 2GQ0A 3G9XA 2I2FA 3V34A 2EP8A 3AIKA 5LXTA 4L6CA 3CX7A 4KQKA 5INTA 1ESMA 4WE3A 5AW6A 4BO6A 3ASZA 1JEQA 2BC9A 2J6IA 3IAHA 3MRXA 3VHLB 4A1OA 2C7QA 3HG7A 3X0DA 1ZR4A 4TYPA 4PTYA 3T7RA 5I8PA 4LQLA 3CLUD 2PIAA 3CNQS 5T67A 2IYTA 3HI4A 1QGUB 1XALA 1VE9A 1NF2A 3C1OA 3O1LA 3K3PA 2QUHA 2DLNA 4RAOA 1VSVA 4HVCA 4AK9A 3L1VA 2QJWA 4BAUA 2RC5A 3LIIA 3BDAA 5FNVF 1H2BA 2FPOA 1HMPA 4BXOB 1T3LA 2JFUA 3FIUA 3ZPXA 3E2MA 4QM7A 4ZO8A 2I1QA 4R1LA 2O23A 2QTVA 3BGVA 1C3LA 4ZEWA 1Z16A 2IH5A 4FE4A 5CH5A 3R7NA 3B52X 1QE5A 2O2YA 1DDOA 1WPXA 1HRDA 1CRLA 2PSJA 2XMQA 2R4UA 3OMLA 4GHWA 4KPUB 4KTTE 3C7KA 4GPIB 2DG2A 2Z9DA 1W4AA 1XQVA 3BIOA 4WXPA 3AI7A 3DGFC 4E6PA 4NFLA 2IXBA 1TQHA 1YFLA 3G3EA 1TM3E 1U2DA 4YJDA 5J2UA 1GNVA 1E3WA 2NTNA 2I8CA 3C43A 3QSGA 4TUYA 3T9BA 4HFNA 2CSXA 3EODA 3KT0A 4IDOA 3WS7A 2LRHA 2QD5A 2VJMA 4XSVA 3OLVA 3U44B 2DBQA 4H7KA 3LRXA 1JG6A 2K7ZA 2HJ9A 4QIHA 1E3DA 3II6X 4JLJA 1HSZA 4F6LA 2ZR8A 4TVOA 2C9OA 5KU1A 1Z6YA 3DOIA 1CUXA 3A6DA 3DL0A 4EJSB 3AVYA 4C2TA 3K70B 1IQ0A 2BSQA 3QOWA 1CDEA 1PZMA 1YQUA 3ROXA 1Z8FA 4BOYA 1XDSA 4M6WB 4R2XA 2AWNA 5AW3A 4DQVA 5HPYB 5THKA 3KHKA 2Q3EA 3PB3A 1U4NA 4GX1A 3RKRA 4MUMA 1Z6AA 5CFRA 2PZGA 4Y6RA 3FPJA 2Z8YM 4MIYA 1IHPA 1DBPA 1Q7BA 5H3CA 4AMUA 5F78A 4RE6A 1FYEA 1WSDA 4CFSA 5ULLA 4YP9A 2ZUSA 1VPDA 3MIIA 4OY3A 3G6KA 3OIGA 1I2BA 3F90A 4PZDA 4WJKB 2AJBA 4YCSA 2A2ZA 2E6UX 1DBQA 3X1WA 2ADOA 2QNIA 3PP8A 3QUBA 2J3IA 4ZD6A 1PK7A 2NADA 4ALLA 3A4IA 1YR9A 1EXNA 3EIHA 4HFRA 3EC1A 5J4YA 1P1CA 3C7DB 1QJ4A 1ORVA 1YS2X 2XUIA 3A9SA 5IJ9A 2WD7B 2DQZA 3KJIA 4UEWA 5A7GA 2FPKA 5HSGA 4B43A 4CF3A 2C78A 4KLRA 2XDQA 4R1QA 5AUQA 2BGGA 3GMDA 2ST1A 2R2GA 2RK6A 4G97A 1YB6A 4XQ9A 2CHFA 4K5QA 2FDRA 1Y48E 5CMLA 3ZWCA 4C3UA 4JVOA 3LP8A 4HS4A 1WV0A 4P93A 5DWQA 4ZI5A 2ZE5A 1DTWB 3G5TA 3IC5A 2FWJA 3OFND 1Y9EA 3LTEA 3N0TA 1QTRA 4HDRA 4IDFA 1OH5A 5IVHA 5FQOA 4DDUA 2R1VA 3KBBA 2BVNA 3W90A 1N7HA 2PKWA 1IBCA 2BKVA 4GMGA 5JSFA 2XCRB 2ZANA 1NTOA 3DHEA 4YLEA 3K94A 2DOKA 3AR6A 3ESQA 4WVFA 4D8VA 1L5YA 3MEQA 3OTIA 1DGQA 3LV8A 1YQWA 2D62A 1Z47A 2VAVA 3TR6A 4QNRA 2JI6A 2R9VA 1GILA 3U1BA 3GFPA 3H75A 2ZIZA 4MUFA 3FOAA 5EYPA 1L5HA 2HFKA 3UAZA 1KI6A 1FLAA 4IUCS 4MKZA 1F0KA 4NEGA 4B5KA 2HBYA 2ODEA 3PV0A 4G5OA 4QFCA 4WV3A 1M1NA 1HM5A 5CLFA 3VZRA 3I58A 3NS7A 1W2WB 2CF5A 1HDRA 3G88A 4OREX 4UBLA 1VXOA 1J07A 4X66B 4BX2A 1BN7A 1UOEA 4LY6A 4ENRA 1DQPA 3ZD6A 3H1AA 5BSUA 5AKEA 4OGGA 5ECDA 4Y2YA 2D5LA 1XMOB 2P7IA 5ADWA 5IVIA 4E03A 1OY1A 4E3ZA 3R20A 1C7JA 3LDAA 1FC0A 1B15A 3IAUA 1H1DA 4DTCA 3CR8A 3PFWO 5IARA 1OLXA 1UBCA 2C7GA 2NZ8A 2QX7A 1V8FA 4K1XA 1V11A 4H27A 4MINA 1ISRA 1ZEMA 5CX1B 3THYB 4XIJA 1KIMA 2OCLA 3P9QA 1H69A 4M8NE 3UAOA 1LGYA 3OF2A 2P91A 3GQBB 2QI9C 5HOQA 3HN7A 4IRXA 1GDTA 1M0WA 2BFEA 1YDWA 4G37A 1R8SA 4MUNA 3OECA 1A8UA 1JE1A 4GZ5A 1FYWA 1AKTA 5FA8A 4UCFA 3D8UA 3T15A 3KEQA 2O2CA 3DEIA 2XEDA 2ZU6A 3PE3A 2RMKA 5ENZA 3LHDA 1NFRA 1UIRA 1T15A 2IH4A 4FHEA 4MV1A 1BSVA 1VJ1A 1ZBDA 4O8ZA 1KVTA 1YCFA 4OUDA 3O8RA 3CC8A 1R16A 4NE9A 1IUOA 3STUA 4XX0B 4BTEA 4NMMA 1EFRD 1Z4PX 2J3QA 4N3AA 3OJOA 2I9KA 1JWAB 1XEFA 4R8MA 3CVOA 4K81B 2WHEA 3PYXA 4M22A 1M5RA 4HX2A 5FTKA 4C0HA 4O29A 1F8XA 3HCCA 3W34A 1A8IA 3KSRA 1N0HA 2CVFA 3LF1A 1H5NA 4ENWA 5H4GA 1K06A 4FGZA 4OIMA 3AONB 1I2AA 5HQ3B 1K4KA 3LFHA 5ALDA 1I2ZA 1E7YA 2QLNA 3DVQX 1ZK0A 3QMPA 4HQRA 1C1YA 1C0LA 3DOCA 2CXQA 2JD1A 1RJWA 3NTQA 5M34A 2PUFA 3TZHA 3KVRA 3M70A 3IBSA 2IDJA 1QF9A 3AJEA 4CLRB 3SC2A 4QECA 3O3OB 1IQUA 1GRNA 3EYAA 2GJ4A 4LJLA 1BS9A 1X7GA 3I34X 1V5IA 3HFSA 4N7RA 2AKAB 3TQHA 1GAJA 5DI3A 1ZMXA 4CL8A 1VBFA 4KWEA 4V0MA 2BFPA 3L7YA 2I03A 3TTUA 1LEHA 4I9HA 3KLNA 4YDRA 4F06A 3OQOA 3VV3A 5F52A 1C0KA 3SF8A 5EXSA 3RS7A 5IM5A 4QUKA 3ZOZA 4MV7A 2WJGA 3N2LA 1UP4A 2VOEA 3KHTA 4Z3OA 2VDLB 1MRSA 5MF6A 2GEUA 4OSOA 4FQ5A 1DRKA 3AB3A 2PUVA 3T7EA 4JH0A 1AD2A 2PRJA 3TKAA 3KV1A 2RB4A 4TSRA 1O08A 1YBMA 2JFPA 1HX7A 1MC8A 1UAGA 3D31A 4FIZA 2Y2VA 3BMXA 3BXOA 4KXYA 5ESXA 4ENSA 2AFIE 3UAXA 1AHHA 3CVXA 4F56A 1F14A 1N8NA 1S8OA 1SMKA 1P80A 3FA2A 4RCYA 2IHKA 5LQMA 1Q5PA 2HSEA 2R6ZA 4MROA 2FGJA 1J22A 2ERYA 5KVQA 1GN9A 4N3BA 5K3FA 3AEUA 3FR8A 4JU9A 3TB4A 4A9AA 4ZT2A 1UFRA 2C5LA 1E7QA 2ZTLA 4AG5A 1QOQB 4Z7NB 2P9TA 2X2PA 3H16A 2DERA 1GQSA 5P8WA 2LGJA 4LRQA 4TQ9A 5B1EA 1LX6A 2HPVA 4P6VF 4C6TB 1II8B 2IYVA 4NPHA 1Z25A 4IGKA 4LS3A 2W70A 3H83A 2KB0A 3GLGE 3M9XA 1EEHA 1SVUA 3Q8WA 4GBJA 2HR1A 1EAMA 1PR5A 2B82A 4S1NA 2H3HA 2XQIA 3FR7A 2ACWA 3EH1A 3IP6A 3SC4A 4QVIA 1GNPA 4S2UA 5FD8A 4OPMA 3ZHZA 3DFFA 1TU4A 4OOFA 3RTAA 2VK2A 4F8YA 3C39A 1HSOA 1PYDA 1CR0A 5AKHA 4WKOA 2C7OA 2V4UA 4WPGA 1N32B 4Z8YA 4MQ5A 3H4VA 2O0MA 4FLMA 1RZRA 2ZSFA 3GLRA 1E2NA 1EB9A 4CTOA 2QIOA 2RIPA 3I2JA 3NORA 1C9KA 1M2NA 2IW1A 3PWKA 4TTRA 5AW5A 5IBCA 1OKKD 3ESZA 3B36A 4KSYA 4R9NA 4ZVQA 5E1BA 1LFDB 2HO4A 1DEXA 4JHLA 1V39A 1X1EA 2VDNB 1KZYC 1T1GA 3D8NA 5BRAA 3BF8A 3ZTTA 3DOEA 4XYBA 4D74A 121PA 1WM1A 2QS9A 1HE1C 2G09A 3OM9A 5D86A 1H94A 2W6NA 4S0ZA 4BKUA 3MRTA 2XE7A 2Q3HA 3QWAA 2EP5A 2AN3A 4KJXA 1ENYA 1ZNZA 3HSSA 3K1AB 4L7VA 4OYHA 2BEUB 3VSCA 1RWBA 4QPPA 2GVNA 5HDQA 1QIIA 1EK1A 3QLJA 2V9CA 4QUDA 2YJ4A 3HYNA 5EHNA 4YR7A 1USUA 1XPRA 5JS2A 3IFSA 2II6A 4ZPXA 4TKVB 4DM7A 2ZIVB 4JENA 3W3ZB 2X4DA 3F98A 4KO8A 4F72A 1N5RA 1XL0A 1IRXA 1IN7A 2YHSA 3A7DA 1J0EA 4M0UA 4PVCA 5EA2A 5JCJA 3HCPA 3BF7A 3IGFA 2MINB 1XK7A 5HIJA 1HQCA 5EJ2A 1LWOA 1V0JA 4C0XA 1DKOA 1WSAA 5ITSA 4BNNA 1EIWA 2M98A 4MICA 4MQBA 4E1AA 3G2LA 2ZJ1A 2AR9A 3KZKA 3FM9A 5F5LA 2G70A 1ADBA 1XG5A 3AVVA 3NHSA 3W7VA 4D8UA 1NBIA 5D7BA 1U2PA 3A9UA 4X24A 1WSBA 1NDHA 3L49A 4IIJB 2D1QA 4JLMA 4KFRA 2Z43A 4Q5IA 1PJLA 4ZJUA 3FVWA 5KPJA 3QOYA 1RZRD 4C30A 2EF1A 3K92A 1WXDA 4R54A 3ZU5A 3ZYCA 2H06A 4LJ8A 1UMKA 1KF0A 3G0CA 3PD7A 4O4IA 3KR1A 3V7YA 3IJRA 4NAHA 2WWVD 3GD5A 4R81A 3TSAA 4KAAA 2NPIA 5JLJA 2A1IA 1B8UA 1E5VA 3JVUA 1UMBA 3L8HA 4DJDC 4R83A 1FRVA 5K3CA 5K6RA 4ZJYA 4PM4A 1TUBA 3FHLA 4YJ3F 4AYXA 2O07A 1GU0A 5TEWA 1NSYA 4N1AA 2YH2A 1KS2A 2WVHA 3CXRA 3Q6NA 4I4IA 4OJYA 1T36B 4PGAA 4BNGA 2VF5X 4TL8A 2QA5A 2BI4A 2Z0MA 5ED4A 1GZHB 1C8KA 4N5NA 2JFNA 5CT9A 4BV2A 4E5MA 1Y6FA 2RJNA 2HWWA 1MZVA 1T9HA 5JV5A 2GM3A 2W6IA 4I3FA 3WQSB 1F5NA 1E5DA 1VIAA 4BUZA 1FPMA 3B51X 3ADPA 3FMOB 4YAGA 4GE3A 4L4SA 3RK4A 2O8VA 3WYEA 1W1UA 2ZXUA 2CFIA 4EGJA 2HRCA 1F3LA 1RPJA 1D3AA 1YI8A 2YMPA 4RVHA 5FTNA 1BVRA 4HZIA 3VX4A 2PD4A 1CUYA 2H2GA 5KTTA 4AXBA 4DSOA 1LX7A 3U3DA 1WBJB 1QGED 4KPFC 3IKTA 2BBTA 3KK0A 1FFSA 5F1YA 1ZH0A 2H2IA 4ZWNA 1R8JA 2UKDA 2ZR7A 5TRTA 1IDN1 3HXPA 2Z8XA 3ANYB 4TVKA 3L1HA 1NUUA 1VLHA 1AXGA 2NVUB 4JELA 1CKEA 1X2BA 2Q29A 1H0HA 4JNKA 3R9WA 3WMEA 3ILHA 2BFFA 3AY7A 4I9NA 3QVWA 1YDGA 1HDIA 4M0KA 3CLSD 1VPLA 3LYAA 4PCAA 2V3VA 1ZZGA 5KOYA 2BCEA 3U7FB 3C3WA 4E14A 2VPQA 3C3MA 4DLSA 2JZOA 2PSFA 1DJNA 1XQYA 2ZUCA 1UWCA 3HGQA 1W4ZA 2H1WA 2RB5A 4HNVA 4PS1A 5LQCA 1T1EA 2VF7A 2X4IA 3R3VA 2NT4A 3L8GA 1QP7A 5EG5A 1UXJA 3OZDA 3ZY5A 3DL4A 4JWKA 2P8SA 4F4DA 7MDHA 2OGWA 3B20A 1WPQA 3I9MA 3LX5A 1P4JA 2IYRA 4K9KA 2ZUEA 1LF0A 3FF1A 1JDBC 4JROA 3GA7A 4HJXA 1T6ZA 5J23A 1VDMA 1ZIYA 1J2YA 4TLLB 1X7WA 3H17A 3PEWA 4HDSB 4MPJA 4Y2TA 5JQGA 2BBWA 4ARCA 2PGNA 3P1JA 4D9CA 1NNLA 5EN4A 2M6KA 4D9MA 5ALIA 1R27A 3NCTA 2PZJA 2Q1XA 4QJ4A 5EWJB 1TRKA 4Y0NA 2ZRFA 4CMKA 5LU8A 3FTEA 1MAUA 3CUEF 3R3JA 4RDHA 5CXSA 1VCNA 3L1JA 3GLIA 1KS9A 4LWOA 4RFVA 3WLMA 2R00A 4Q7JB 1JFTA 2LW7A 1B3RA 1BFUA 2C96A 2JBHA 3JQCA 1R0BA 2Q1SA 3ICCA 3N59A 4FFPA 5EKDA 5C32A 3FRJA 2C4NA 5EHQA 2PKQP 4D9NA 3IEMA 3EZYA 4O3FA 4Z9XA 3AP2A 1TECE 4CRWB 1D4AA 3ZU3A 2Q0XA 4MQ6A 1II9A 4NULA 4O59O 4ADSG 3SN6A 3DEFA 1MGOA 4CBVA 4K6MA 1WRBA 4LQCA 5TARA 4BMVA 5JAHA 2NIPA 1WCIB 3LWBA 1XRNA 1XMQB 3EXHA 2AXNA 2GBIA 5IF9A 1UMCB 5BVHA 1OT3A 1GRQA 4CV2A 3P9XA 4QDOA 2HMWA 2P4QA 5EY5B 5HEKA 3I64A 4KXWA 2FDXA 2B69A 2O2XA 2JIZA 1QLWA 2XNDA 4QO7A 1IIBA 4MQFA 5TGTA 4NENA 5DFAA 1JPJA 2PSSA 2PNJA 4DDWA 1M6VB 1NKSA 4Q3KA 2I22A 2VUIB 1MVLA 2NU6A 1GG9A 4IO1A 4MCIA 3QPCA 3BE6A 3EXAA 3AVOA 3QTBA 4KHZA 3VR1A 4NBWA 4PG4A 4W1QA 1D9ZA 4J16A 1E4VA 4IF4A 4PW0A 3TLKA 2RAPA 5C37A 3TGLA 5EIBC 3OIWA 4C0LA 1R64A 2UVPB 3L1KA 5K3BA 4MVJI 3F4BA 4YCJA 4ARIA 3DWIA 4QDTA 5JS7A 1RBMA 2JLUA 4D9FA 3FHOA 3SZRA 3E61A 4EJSC 5BWOA 3KRTA 3FTDA 3KQHA 2OAP1 3K0CC 1OASA 3ZK8A 2F9MA 1TI7A 4HJRA 5CM8B 2FQXA 3R6DA 2Z2IA 2VXBA 3IT3A 5F51A 1Q7CA 2OV3A 1ZN8A 1IY2A 1GU7A 4XVCA 5FWXA 4ZV9A 1CY4A 2EJUA 3F7OA 1XDGA 4C76A 1T8PA 1XNGA 4X1IA 3FHCB 3PVZA 5D00A 1W59A 4NVRA 1YJAA 5E4YA 1DDIA 3GT7A 2ACKA 2FPIB 3Q1LA 4DWJA 1R8QA 1Y3FE 4Z1MA 3GJ4A 3RSCA 4QULA 1RZVA 1F4PA 4EABA 1DIBA 4D44A 4UPVA 4ES6A 3GCDA 1MF7A 2RC6A 4YBZA 5CH8A 5B5SA 5BN3A 1ZPDA 1CJSA 1IH8A 2X9LA 5EWLA 5YASA 3TZBA 2D2EA 2MR5A 1QK4A 5C9ZA 1UC4B 2PFGA 1W581 3I83A 4PYKA 1XN4A 4HKTA 2C8LA 1NQTA 2YZGA 1ZI9A 2J9YB 4U2CA 4X1OA 2P2DA 2VNSA 1NR7A 3KNZA 2B30A 4ZCMA 2NG1A 1MFPA 5C52B 1GGVA 1NRIA 2O8DB 1YZQA 2XIJA 4DWWA 4JB8A 2UZ3A 3TB6A 2AN4A 2C04A 2OG2A 4JJ7A 5A0TA 1UUFA 4Z49A 1W4RA 4B7XA 4DPMA 4K8OA 3U4MA 2R6GA 1MNAA 3TEFA 2A0YA 2P5UA 3C6MA 3WLNA 5AVYA 3ORSA 4R9RA 4OX9Y 4H6PA 3WLTA 4IKPA 4IIGA 3F78A 4ZT6A 3SFVA 4KRFA 1VE5A 2B34A 1E98A 3HU5A 3I1YA 3WL5A 1CRPA 3WYNA 5J2TF 3NEAA 1O77A 4I50A 3N28A 4UBMA 4CGYA 1XKQA 1LBQA 1FU4A 1ODFA 4LDRA 3Q3GE 4KP7A 4QTTB 1IM8A 1DRUA 1OU0A 3IURA 4URYR 5B58T 3H1TA 2OYRA 1AJEA 3GRFA 4Z4QA 1T6XA 4BEVA 4XEUA 3ZJUA 1AS2A 2ZVQX 1JH8A 1BNCA 2XCLA 4XIFA 2WNIA 1KOLA 4NXMB 2QN3A 3M9WA 4AWXA 4BAGA 2CL0X 5HJ2A 1QX4A 3WBFA 4PBTA 4CIBA 2AN9A 2V9ZA 2PZAA 3P4YA 4E5NA 3FTPA 2H8KA 4ABTA 1S89A 4YAWA 1MUUA 2C1XA 4U7DA 4ZYTA 3A9WA 3SSOA 3HC7A 2VL7A 2A9RA 3RSQA 4UW9A 4QDKA 5J47A 1Y7PA 3KAKA 4CIDA 1CRQA 4J07A 2J9FB 4GZMA 5C8ZA 2CDBA 2P79A 4BQIA 1JNYA 1QXSA 4GZ6A 5CA0F 1SBIA 3AW8A 1ESCA 4O0MA 3AEZA 4XUDA 3WRXC 1Y7IA 4YT8A 4WI1A 3E23A 3ZK9A 3EQ9A 2DC1A 3OIYA 1SVIA 3DXZA 3DZCA 1BVUA 1MDFA 1YDHA 1E79A 4AG3A 3OO1A 3ZE7A 4IKEA 2TECE 3CT6A 1RYEA 1YONA 3AZOA 3DONA 3ROKA 4ETNA 4URUR 4L2IA 4F2GA 1Y3CE 2PL1A 5ITVA 5KHLB 4NOLA 3VHXA 1T8TA 3F9RA 4OUDB 1NUAA 1NBME 3LQRA 2VKTA 3R5SA 5F1OA 4BKRA 2HYDA 4H31A 4KXXA 2H7XA 3RVBA 5DYTA 3WLLA 4IOKA 3WISA 4YWJA 1RAGA 5KDLA 1ORWA 3WO1A 4UXHA 3UANA 4EFNA 1W2GA 1KZ7B 2KM1A 4RMNA 4P32A 3C7AA 4IIJF 1EI9A 1JHMA 1T43A 4ZT4A 1JZQA 1M8FA 2JEYA 3K0FB 4HSEA 5KJFA 4GG1A 4IX9A 4ZT7A 3W5SA 4F2PA 3BZUA 1SUPA 4GDFA 3KAJA 5DGDA 2ZAMA 2WF9A 5COBA 1AHNA 4KAFA 4BLOA 1V11B 5CX1A 5EPUA 4I66A 4ZV7A 1F2TA 2G4LA 5JISA 3ZCPA 2VP5A 5F3DA 4ZV4A 1DX6A 1G4AE 1ONOA 1P29A 2C58A 4HR7A 4PZLA 4YECA 1YQGA 1T1RA 2BKXA 3AVUA 2WJ6A 2WMOB 1DEOA 1QVVA 3ZKWA 4DIFA 2QTNA 1ZNQO 2XADA 1K9VF 4YRZA 3PD1A 3ZE2B 1RKQA 3HFGA 3UPTA 4DA0A 4P4GA 4YP0A 3V1LA 3FCYA 3SEZA 4ZYLA 1MTZA 3I6MA 4BGDA 5I45A 4BASA 3BG5A 4OLJA 1DMRA 1JG2A 3LCJA 5EQTA 1S2DA 5ALXA 9ABPA 3OTOB 4D9HA 4MKRA 1S3GA 1U8UA 3E4CA 1XU9A 2E5FA 1DC4A 4PONA 4JD5A 3KKKA 3PIDA 5GJVC 2XBUA 1PFVA 2HDOA 3LCVB 5DNVA 3EZ7A 5JMWA 3JX9A 5KYKA 3QX3A 3ZJVA 1T5BA 5AFSA 2BPOA 5BMOA 4RTNA 3SC3A 2WUFA 3NM6B 2JJ1A 3ELYA 3PF8A 4YI5A 5G53C 3IUMA 2Q6IA 3BRWD 1NLUA 3QA3E 3O95A 3DUFB 5I7VA 1O9GA 1M33A 2XCTB 3KKEA 1VPWA 4QGAA 3B6JA 1KO7A 1KOGA 2EZTA 1J2TA 2W0SA 4FMBB 1U2RA 1XA0A 2HU2A 3GFSA 4W1SA 3C85A 4C7OB 3NJ8A 3OWHA 4D8YA 4EGQA 2H1OA 1R4MA 4H3SA 1KSJA 1ZUWA 2ONKA 3ZCRA 4M89A 2PL9A 2V7XA 3HDYA 3KYIB 4LYDA 1QFJA 4C2BA 4C3ZA 1GTRA 1HQYE 3PFNA 2IUSA 3NBXX 4X45A 2QLFA 3EUWA 4BRSA 2CUKA 5IHPA 4BEWA 1BQ4A 2G72A 1NU8A 2C9MA 4U7JA 4DLXA 3QFFA 3RYFB 1B0PA 1OZGA 4F46A 3DD1A 2B1QA 5K3EA 2B2CA 3OE5A 2SKCA 2O7VA 2PS9A 4OO3A 3OAAD 1W5SA 1ISJA 3O47A 2VYVA 1PFWA 3AHEA 1RM5A 2IY8A 3R76A 1G5RA 2ZYVX 3RLIA 4DARA 2VS1A 2DTDA 1Z07A 5IXJA 2BUCA 3LVFO 3RREA 1FTQA 3OEED 4FW8A 3EH2A 5DM0A 5IAOA 1ZP6A 4UEKA 5BR8B 1GPJA 3UAGA 3BTUA 1TZ2A 4RVNA 3R5TA 3NETA 5IZ4A 1E69A 1E6WA 4DBLC 4HMOA 5A3QA 5BN5A 4YDQA 4I19A 1Y4DE 4DLLA 1CBUA 1UQTA 3PXDA 4Y3UA 1VMEA 1EUDB 1KVUA 1PHPA 1YR6A 3FAZA 1PW7A 1YU6A 2EAUA 3KJGA 1H2ZA 1G5HA 3HMKA 4IXWA 3UQYS 1DWPA 2B4RO 3BN3A 1QFXA 2EZUA 3I3OA 3Q0EA 4BUCA 2QPAA 1L5MA 1SU8A 5IJXA 3GN2A 1OLUB 1K8XB 3R7BA 3BULA 2FZEA 3QXXA 4KAXA 4MQLA 3FGNA 3TRKA 5I4BA 4GXRA 1UK6A 2GCGA 4FFDA 4FM9A 1BWRA 3T1HB 3IVMA 3PRKE 3VVLA 1DC5A 2XPCA 4H3HB 1CVLA 4M76B 5HK8A 5J2UB 3RVOA 3FD8A 3SIXA 1FFYA 5JJIA 3BILA 4AT1A 3D3WB 1Q14A 2GWHA 3A9CA 3AGQA 4LYYA 3T9EA 3ULKA 4AQ7A 1V7PC 3KB2A 1VE1A 3PQEA 3TNDA 3UTCA 1GXSB 3F7TA 4OVKA 1EXMA 2WKWA 1P45A 1FP4A 3JQFC 4NBTA 3BRSA 3R3HA 3LCUA 5BPHA 1JQBA 1CULC 1ZGHA 2CZCA 2Y67A 5C1BA 3NLLA 3FLBA 4ACBA 2C95A 1ADGA 2ZRIA 1PO7A 3ITEA 3OAAA 4FYIA 4IIEA 5CXQA 1Z0AA 1CFJA 2HX1A 2D3TA 2Z2XA 5EIAA 1EQUA 3JQAB 4CPDA 1ZL2A 2PH1A 1GFZA 4UFNA 1NJFA 2PTGA 1W34A 2CNWD 3OKPA 1GGMA 4LRTB 4RHCA 3VR4A 1ML4A 1PQYA 4GPEA 1K2VN 3AGPA 1XL1A 3I76A 1G2IA 4FI3C 1E9BA 3ENZA 2N75A 2WAYA 1EM8B 2XT6A 3WBJA 1Y9AA 2VZ9A 5ARCA 4B3TB 3TBHA 4BBPA 1CZLA 4JVNA 2DRIA 1L7DA 2OO5A 3PDHA 1FFAA 3MLBA 2P35A 4YONB 1X1DA 2BLNA 2HI0A 4KVGA 3R44A 2VNIA 6GPBA 5JH7B 4DMLA 3VNUA 2YFHA 3I9V6 2EFYA 2Y1OA 4PC1A 2ID8A 3R9XA 4NCKA 2H2AA 4H1TA 4UZEA 4YRBA 4LDAA 1X3SA 5JSYA 4YLYA 4MWTA 5IAAA 2P5TB 5L4NA 3U3OA 2CLFB 3TLGA 2BTQA 4AJLA 3X1JA 3BT7A 1NI4A 4LHVA 1PK8A 1U2ZA 3U4GA 4HTFA 3BMOB 1O4WA 1TLLA 1Z4JA 4C9BA 4CL3A 2YJ3A 3LMKA 4RJLA 3NTXA 4B4UA 3VNRA 1EXDA 2ZB4A 4RAQA 4LUCA 3TTWA 4PVDA 4RLSA 2Q45A 1KH3A 2YC2C 2GHTA 2YXDA 3ISJA 4ZHQB 4HRAA 4AWAA 2O2GA 2PKEA 5KSWB 2WSIA 4B8WA 3BWXA 2B4TO 2Q21A 3IUQA 4YB8A 4DC1A 4HNTA 4ID9A 3LCMA 2J9FA 2QVCA 3S6JA 5BSWA 3JR3A 1W85A 2I6FA 3RRNA 3JALB 4B3GA 3HH8A 3FI9A 4KXUA 2WT4A 4AZSA 3BWVA 4MW4A 5FH9A 1KGSA 3RSOA 2W22A 4WKBA 2AOUB 1WP4A 5EFOA 1WKCA 2JKVA 2WM8A 3D7KA 3EPLA 1DAIA 3VDNB 4MYDA 1TMOA 4UFPA 3PXEA 2YJZA 3CW9A 2BMEA 3KQTA 2AD5A 4OM7A 4QGFA 1V7ZA 4JZYA 5IJWA 2AEFA 2VP0A 3JQ9A 4MJLA 2I33A 4Y6PA 1YE3A 4CCYB 1WETA 2WHQA 2C1ZA 1EK0A 1OF1A 3LWZA 4ZEOA 3PLRA 3QXHA 1YZYA 1EX9A 3NIWA 4FJ2A 4AAYA 2VCEA 1KVRA 3ROZA 5M5BA 4LSMA 1A2BA 2PBZA 2OESA 1G21A 5DI9A 2LDBA 4D80A 1UMDB 2QUZA 3EFEA 4RC9A 2CXXA 2HQSA 3KHUA 3IA7A 5ALHA 3QYPA 3HBNA 1HNZB 2LR0A 3NWOA 5CEJA 4PSDA 1Z8HA 5DTIA 1EX6A 1IM2A 4DLVA 4GL4A 1F6DA 2ZDQA 3FWPA 3LM8A 4I4CA 5DASA 3F9IA 3VNBA 5HX7A 2E0IA 3UK2A 1ZMTA 2GILA 3AI2A 3FZYA 5JDCC 3TAHA 4Q9AA 3RS4A 3T3EA 2O3UA 3WGHA 2F67A 221PA 2Q2OA 3T9DA 5JNWA 3OFNA 3RHFA 2WNSA 3EISA 1HL7A 3LT2A 1OI2A 1YZVA 4EELA 3D3NA 1CDDA 3HBAA 2X5NA 3QBDA 5JZOA 1IZ0A 3BEDA 4HNAA 5AKXA 4PLWA 1PFUA 3H1EA 2ORVA 2EARA 2J31A 5D5QA 1UC5B 4EI2A 4RTJA 4UASA 5E0OA 1MH1A 5AI6A 5KOHB 3K15A 2NUPA 4J1TC 4ROSA 1U02A 2BJVA 3FYSA 2B8NA 1OI7A 2P65A 4H77A 2FCAA 3QBVA 4F3KA 1V26A 4DLBA 4DXHA 1ZXLA 4PHTA 1G6Q1 1PD0A 3M5CA 1VGRA 1R0YA 2QW1A 4TXHA 1Q0TA 1HH4A 1TJNA 3DOFA 2I91A 4DWOA 3NRCA 5KX5B 1CR4A 1GKKA 5IC5A 4D3ZA 1MBZA 2YJ6A 1PLJA 4NENB 5DNUA 2YASA 3PTZA 5B3KA 2R7MA 4R51A 1DKNA 2XV1A 2ATVA 1AQJA 3A3NA 1TAUA 5EE1A 3JRWA 4RKEA 4WKPA 3SXUA 2WMDA 2FEXA 3AUSA 4WLNA 4GWKA 2D4HA 4EYOA 1AUOA 3QIAA 2VPTA 3ZK7A 3LTNC 1E4EB 3EZ6A 3KOMA 4OAOA 3U4AA 4CV3A 1U6KA 3SJAA 1W94A 4WADA 4B7ZA 3H5VA 4LXXA 4Z3KA 3A28A 4J94A 2HU7A 2ZKLA 1ODTC 3DNMA 2VA9A 2FWAA 4XA8A 1KQNA 4RQBA 3GFTA 5T3UA 5D01A 1CJTC 3LX6A 3HSKA 5THXA 3WKAA 4JLNA 2F3RA 3GLSA 2JI8A 3F5FA 5FBHA 2C8JA 2JH3A 4L95C 1NRJB 4H4EA 1VSQA 4GC5A 5COQA 3ZU6A 4JLAA 3AP1A 2YW9A 1Q1EA 2IA5A 3DBOB 4XDGA 4ZARA 3HZHA 2Z2KA 4AKIA 1UJ2A 1Y1LA 3PCRB 4BLVA 3PNVA 4LGCA 2ZUTA 1CHDA 1ONNA 2BAGA 4G8BA 2WFLA 1I4DD 3OT4A 5F3RA 2UDPA 4BRUA 1AY0A 4X3CA 4DZZA 3RVPA 1ECPA 3IJ5A 3KTFA 3AF3A 2C94A 2EU8A 2FFJA 4FGLA 6AT1A 1G9XA 4L16A 3GP3A 3LPCA 4L0MA 1H05A 3THRA 2AYXA 2Q2QA 3IVGA 1KMNA 3P2KA 5FCDA 1YZLA 4MOWA 3SZOA 1PS8A 1LWNA 2GUGA 4BQRA 2ZK7A 1EK6A 3TOCA 2XOXA 3S1SA 4QBIA 1O94D 2YWFA 1U7OA 3L8YA 3LU1A 1OXBB 4M3NA 4A7PA 1WEHA 3E03A 3IPAA 4X91A 1PIWA 5IWCA 4ZC8A 2F90A 2YY6A 2WWFA 1QNFA 4JYMA 4ZHSA 4LE0A 4H7FA 1E61A 2VDWA 5JASA 3ZVKA 3LL4A 1N92A 3I8SA 1JTEA 5JCPA 4LQ4A 4RY8A 4AP6A 2CK3A 2SNIE 4IQ4A 3H7IA 2GBLA 3DYVA 4ZN6A 2XZOA 3OE1A 1KNXA 1OLOA 4OQMA 3BPSA 3G8CA 4PPQA 1NYLA 3M1LA 1Z7BA 2VK4A 4H4CA 4KLNA 4AROA 3HCBA 1XT6A 4N0DA 1SIWA 5CH3A 3A1DA 2JD0A 1KXJA 3EZLA 4WOBA 4BZZA 3H6HA 2P40A 3IDFA 1YAHA 3N8NA 3OF3A 5KDOA 1VL5A 3WIEA 1T2CA 2A9JA 4KN5A 2UUBB 1X19A 3SZUA 2CMFA 5FPPA 2CJFA 3FPGA 4B4VA 2VHVA 2AQHA 2P0YA 3H3FA 1NF8A 3NDRA 3UMFA 3U56A 4GPTA 4DR4B 2GPTA 2BISA 3JAKA 4WN9B 4W7HA 5LM3A 4GYJA 5D5HA 3PQ3A 2H1SA 2TS1A 4IDAA 3WZLA 4DJ5X 2H4WA 4LY0A 1U0GA 5K05A 4C3OB 2Z3VA 2PRYA 4D5GA 2V03A 2V7PA 4HB2A 4TT3A 3MCTA 4XOUA 3KQNA 2Y0PA 3RC7A 2GAJA 4QD3A 3I6IA 1TA0A 4H1HA 4PYIA 1MO5A 3U3ZA 5AVTA 3ZUGA 4FW9A 1IBKB 3IAS1 4D3DA 4X41A 1NJ2A 3KKMA 1G98A 3T7IA 4J3NA 2OG1A 2O06A 3RJMA 3HB7A 2WJPA 4GOJA 3W6NA 3DEAA 2GM4A 2QZ9A 5HM8A 1ID8A 3T5PA 5KX5A 1ISSA 1J2RA 4V03A 3M4XA 2VT6A 3B60A 3NYIA 1NX6A 1E0KA 4RH3A 1LKZA 2LD4A 2QRVB 1PWEA 3A6PC 2FETA 4JQCA 1JHQA 1NYRA 2D8MA 4L4UA 3T6KA 1U0OC 2PN1A 3U31A 2W2VA 4IIJA 2NUTA 4F86A 4EHHA 3O0DA 4O5AA 3EIQA 4ZZ0A 3STVA 1FTWA 1A9XA 1AF4A 5A4KA 4GC9A 5DHTA 3IS3A 4V39A 2QLMA 1KBQA 4I5DA 3VNVA 1TCBA 4CR8A 3EVNA 4F6RA 4QVKA 1Q2XA 3UGTA 4S1OA 3MAJA 2DZDA 3W9BA 2SBTA 3BQ9A 4O2BF 4PGHA 4B3BA 1PNVA 4FLEA 1ZVQA 2QDXA 2WA2A 3N6VA 3U7JA 1JAXA 1IY8A 4QL3A 4CF6A 1S2IA 2VRWA 1UXOA 3F74A 3JU3A 4NEQA 2M9MA 2OECA 3IUEA 3K1AA 2QENA 1DFIA 1PQ4A 2K4MA 4UFOA 4B33A 5CA1F 1HLFA 3LZDA 2XVMA 4X44A 3UZUA 3RYTC 4XDYA 1E2FA 4CL0A 4UTNA 1NOIA 3EEBA 3QE9Y 1I0IA 3JALA 1Y6RA 4DZRA 1Z73A 1JKXA 3GJ3A 3CWQA 3LOPA 5JBIA 1OV4A 4L4XA 2ZRBA 4RENA 3RYIA 2I1LA 4Z4FA 3B3FA 2PXXA 1TKCA 2OQIA 3GXBA 4JLSA 1BKSB 2AG5A 2NQTA 2O3TA 3D2LA 3INGA 2DQKA 4Y2VA 3M7IA 4BFWA 1J0AA 2CBZA 4LV6A 3ZWDA 2CUTA 2PGOA 3A26A 4MS3B 3OPMA 4E3WA 1A9SA 2I2BA 1TZJA 4XB2A 1T5SA 2GASA 5CA0B 2G17A 2IV3A 2AMLA 1EUZA 4RLHA 2HFJA 1Z4QA 2FEPA 4UVEA 1LPAB 1OI4A 1UM8A 3CA8A 5CGZA 3VOSA 1EUQA 1KETA 2CD9A 3D64A 1M1NB 2REXB 4RSGA 2WHXA 3ONDA 5KQRA 1YB4A 2WSLA 3BJZA 1YZFA 3PHBE 4PG5A 1O8CA 4HEA1 1M74A 1Q0SA 1GIAA 3ICVA 3ZNNA 4DCPA 4PANA 3ANXA 3ESDA 3MMXA 4R3WA 5DHAA 3H2YA 2PX5A 5HKKD 2Z3WA 3IV6A 3KDPA 3EMVA 3WIDA 8LDHA 1GUDA 2QU8A 1Z13A 4IDQA 2ZEJA 3KG2A 4PYQA 4FD3A 4V1CB 2UYHA 2EL9A 2JD2A 3DKRA 3ANSA 2CSUA 1Z5NA 3O8LA 4B09A 1J23A 2H1IA 3OF5A 5JCOC 3CY6A 5DV9A 3USZA 3DP9A 2MYNA 2W2OA 4OA8A 4QOHA 1L7NA 5EL0A 1OIXA 3WQHA 4E7OA 1G4HA 2GPWA 1U1DA 1Z88A 1D4ZA 1J8MF 1O6FA 1PK9A 2PUJA 1Y4UA 2UVDA 3F5DA 2PGAA 3AP3A 3HU3A 3OOJA 3EFHA 5EPEA 5ALNA 3GCZA 2ORYA 2PYZA 1L6RA 4N5IX 2IHZA 2I4LA 5F4BA 1P2VA 3OC0A 4R2MA 4P34A 3JRXA 4ASUA 2O5EA 3ESAA 4PX3A 1QHYA 1C4OA 3QLUA 2ZM5A 4BN0A 2ALJA 2PQ2A 4TTVA 1HDEA 2ONJA 3ROPA 1KMQA 2A1TS 2IHTA 1G3IA 4QPCA 1NYTA 5F5XA 4DA9A 1XLUA 1YD7A 1RHUA 4PLFA 5DN6A 1T2AA 4X65B 1D6JA 1N9GB 5KQPA 2IXAA 5IJ0B 1U0BB 1I8TA 4PX9A 2E89A 2NVWA 4OQ4A 5E6RA 1MDBA 3B5EA 3FH0A 3WGNA 4A5SA 4F5DA 2RAVA 2QRQA 3UYLA 5CLJA 3A05A 5CCXA 3D6HA 2ZWAA 4HYQA 4FX2A 2F3PA 2QSUA 3STXA 4C1BA 3BH0A 1NVTA 4NCXA 3T7KA 3L8FA 4DHWA 3JZAA 2ZWVA 3KE9A 4R8KA 3S8YA 4Y6LA 3UW3A 1OBFO 1RFLA 4IZIA 3V4OA 3DLTA 3Q3VA 2CFOA 1TO1E 5C8YF 3OZIA 1SD1A 4K9NA 1PTJC 1L3CA 3VISA 2ZBPA 5TY0A 4WNYA 2CNOA 4Y2HA 2ECOA 4NFHA 3WWDA 2A9QA 3GLHB 1VHJA 2JARA 4LX8A 5DDIP 4C7MA 4XQEA 5KSPA 2W11A 1RABA 2WBLC 3OURA 2XUHA 3Q41A 4K0RA 1GPNA 2WWGA 2UU9B 1QO0A 2IWRA 4F2HA 3D3WA 2Z5VA 2X9NA 2H5JA 1FFXB 3MG9A 5BXYA 2C5BA 2X3UA 3NCHA 2H9YA 1XMXA 4K6KA 4MYSA 3O9VA 4FOOA 2VJPA 3BXHA 4M60A 2J0VA 4XX0A 2IXFA 1NY6A 2EDAA 5JOQA 3SZMA 2AC4A 1J8QA 4EW2A 3C24A 4AS2A 3D7MA 3SF0A 2IW3A 1B2LA 2R8OA 2EOAA 3E7DA 3VPCA 4YUXA 4G0VA 4AJKA 4TMXA 1EVJA 3R5KA 5DO9A 2AG0A 1Z3CA 2NZYA 1BDJA 3AKYA 4QQNA 3FBWA 3NHBA 1HYQA 1NQUA 1QYWA 1TYDE 1SCKA 2PNFA 3JPWA 3SYKA 4KR6A 4B83A 1TPZA 5I9SA 3AY3A 3I5XA 2H3EA 2JIQA 1JG7A 3JQGB 2ERXA 4TRJA 1LNSA 3OFKA 5MGBA 2YICA 1DSSG 2J41A 3CN9A 2I4RA 5BSEA 2Q6KA 3PSAA 2PG3A 4R1PA 1ZGAA 4TTPA 3STYA 3UKDA 1GZ6A 1PFKA 4P33A 2QVGA 2VATA 2OD2A 4W8GA 1W1IA 1OWNA 3PITA 4JB2A 3B3GA 1G20E 4KYVA 4YYZA 1ACJA 2AFHB 1ZYUA 3KKZA 3VOTA 2F00A 2YIVX 1QR2A 3QI7A 2MCFA 3HXMA 3S2SA 5SV2A 3WGJA 2HGSA 2GBFA 4IRMA 3WGIA 2FW0A 4PRKA 3KKOA 3N74A 2QGFA 4NCNA 2I2AA 4AU1A 1R4NB 4WCFB 2BHSA 3LRTA 1EKXA 4L3WA 4R2IA 3DCYA 3KQOA 4ZQEA 1GCAA 2X1LA 4XJVA 5DLEA 2YJNA 2WDZA 3PUWA 5H5JA 3VTZA 5D6OA 1HDYA 1NULA 1X1TA 2FPGB 2KE5A 1JPVA 5JT1A 4IJKA 3OD5A 4NZPA 1R7RA 3IUNA 3O1IC 3GAFA 3GB9A 4JASB 1KAQA 1O6BA 2F3UA 3OOEA 5CVDA 4PN7A 1Y5RA 1TEVA 3EX7C 3KPJA 3WIOA 4WXMA 3PZBA 5GOTA 4Z99A 7GPBA 4MRMA 4UTPA 2TMKA 4PC3A 3ZXSA 5MFPA 1FOEB 4TQGA 1JDSA 1RDFA 3CNEA 4ETWA 2IX3A 4DA7A 3ETLA 3QX9A 4OHFA 3GPBA 4ZU3A 4B4DA 1FIUA 1UOQA 1QDEA 1ZI8A 5L53A 2QZSA 2YVKA 3RASA 3L6DA 3VC1A 1XEXA 3ECCA 1ELOA 2Q4BA 2QX8A 3PL5A 4W5OA 3MT0A 3QUSA 4B7UA 1RI3A 4OGFA 3E9CA 3M4NA 3B7WA 3AUJB 2H8GA 1XTSA 1SA0A 4LK2A 1I4WA 1I2MA 1R0CA 4NV1A 4OGLA 3RV3A 4KQJA 3BMCA 1IHOA 5GP1A 4AF6A 3MELA 1YB7A 2J45A 3PC7A 2QTFA 1IOLA 3L46A 1OXMA 1WCV1 3ERCA 3AIOA 1L3BA 4Q00A 3PDJA 1OX6A 4D02A 4IIVA 1RRKA 4WUVA 5EYPB 3E9RA 1RMYA 3CEJA 4BLWA 2RGUA 4COKA 3PK0A 4Z1MD 3MB5A 3PFKA 4C4OA 4QDXA 2QUIA 4MQEB 1URPA 4EMBA 3WBBA 2YRFA 2ZXFA 3HS3A 4QAJA 3W1VA 3MGAA 4QWWA 1AZLA 4HATA 5SY6A 2AR0A 3C8MA 1RPNA 3UJHA 1AX9A 1N2ZA 1B1CA 3T7JA 3AUFA 4ZVRA 1Z9BA 4Q4JB 3TSOA 3ZW7A 5FHRA 5JAUA 5J2TB 1GTMA 3FPCA 1EDOA 3VTKA 3DO8A 2BM1A 3P2IA 2WG1A 5M29A 4PLPA 1TFUA 2R0QC 4IDNA 1SCIA 2RHHA 5KYYB 1JFFB 2PKQO 4LBYA 1BE1A 1N2HA 1DEAA 4L8FA 2DFLA 2HJSA 3WLRA 3FZNA 5A06A 2QXUA 2Z95A 3CM0A 3QEMB 3QBEA 3IUJA 4JSYA 3EZ9A 3F67A 3DHYA 2EJWA 4PPNA 4ETMA 3KT6A 3KOZA 4M1KA 1SOAA 4EHFA 2NTYC 1G7TA 4BYGA 3JQQA 2EBWA 1DPFA 2ZM6B 4YHBA 2W9XA 1QK5A 3JZDA 4DV2B 4DJTA 2EW2A 3QXJA 4AZ0A 3BEOA 4BDSA 3X1MA 4PR0A 3REGA 1LK5A 3CNLA 5MGNA 2FQWA 2ZIEA 1PT6A 3NKVA 4HHEA 2YZ2A 4TUYB 1KI8A 4IL5A 5CBKA 1D2RA 1N8TA 3V6MA 2CXHA 2CXUA 3CX8A 4ML3A 2FEWB 2Y05A 3UUEA 1C7EA 4L22A 4P3YA 2JCSA 3M2TA 4FBLA 4PO1A 4QREA 1Z33A 4MUAA 3PJRA 1JIQA 4ZVSA 3KLPX 1G8GA 2O50A 3NBUA 2UYQA 1UBUS 2BFBA 5TQ2A 3WHIA 2X7HA 2PX0A 3OX2A 3VHRA 1J39A 3B38A 5DP1A 3QJYA 2BM8A 2QL6A 4TT3D 3QXSA 1OWLA 1T5LA 3S4YA 4BMYA 3GFFA 4BXOA 1ML3A 3PQ6A 4NBRA 2G0AA 4OHXA 4Q9KA 4DLUA 3WFZA 3KB1A 4I8XA 4KK4A 3EUFA 1QCCA 1MAWA 1CLEA 2EWWA 2JFHA 1PL7A 2VIIA 3EGVA 3MCVA 4JLUA 5CT8A 1SXHA 1YS1X 2D00A 4JB0A 3BFXA 1F9EA 5H16A 2C4MA 1JLMA 1WS6A 1LRKA 2VEOA 3CSUA 1WP9A 4N39A 3NIFB 3N76A 4XIYA 2XKKA 5JAOA 5AJVB 4Q3OA 1V1MB 4YUZA 5ARBA 3VDRA 5LMNB 4H15A 2O3JA 4G41A 4DY6A 2PR7A 5LIPA 2OUKA 2OT3B 4G07A 5LXTB 3DZGA 3O83A 1TC2A 2H48A 3NJRA 5IEJA 2EZ4A 3IP1A 1T5IA 1ZVKA 3GRZA 1GITA 4NYIQ 1M6EX 2DR0A 1W0JA 3FNBA 3OU2A 3O82A 4J7CA 4UC0A 3N3AC 3PPIA 3TIFA 5JSHA 3HVJA 5KJ1A 4MR9B 3MUOA 1Q22A 4ISBA 4EY8A 5KWSA 2C5HA 3GDHA 5HS4A 3RR2A 2ODWA 1L8OA 3DHWC 3HB4X 4MK4A 3LDHA 5D3ZA 1P7PA 2C20A 4AP5A 2M6LA 2C4WA 4I9UA 4GS5A 4MSUA 4RZ2A 1MA0A 3A10A 3LC1O 4UOEA 2NQ2C 2VWPA 2OSBA 3DMTC 5FIUA 5AM3A 1W2HA 1KO1A 1SEPA 1JIXA 2IP2A 3OLCX 2AW3A 2IHJA 3TOVA 3TZ6A 4ERNA 3O8CA 3D8RA 4L5IA 1FFEA 1DEHA 1V47A 5IMBA 1FXSA 2VDMB 1XYVA 2QSJA 3KQWA 4XPIA 4C7VA 4JDPA 4RSRA 4DBVO 4CV0A 3E9QA 1SHJA 1GKIA 1MR3F 2YVQA 3JVIA 3J80A 1NW6A 2QP9X 2N3ZA 5EOVA 2XNHA 3UA4A 4MDFA 1ZM7A 3TLYA 1XP5A 3SAJA 4JUAA 4HSGA 2AGVA 3FDZB 4H7HA 4MLPA 5E9WA 6REQA 4F84A 3F97A 2JH9A 4CDNA 3Q6MA 1SKAA 1XZGA 2GXUA 2G3YA 3EMDA 1QIFA 2IUYA 3PC3A 3IHTA 5CVJA 3TLEA 3EEIA 3OTGA 4ZMBA 2PE5A 2KWIA 1S02A 5HE9A 4HK4A 3OCCA 1Z0ZA 3GUCA 4PWZA 4S04A 5AJWA 5EWMA 1T4CA 3R7AA 4EZEA 2DPMA 4IJ5A 2VBFA 4R2HA 2HXYA 5T41A 3C87A 2F1JA 3JD2A 4MYTA 3UMBA 2QV0A 4AJ9A 5KYGA 2N46A 1DC7A 4RJIA 1TT5B 4DVJA 4HWRA 3VPGA 2JC3A 5CEFA 5CYGA 3WWOA 5I4KA 3ZVRA 3O3NB 1JHUA 1WVIA 4TL6A 3FUUA 2HLNA 4N5MA 3E3NA 1T1JA 2H59A 2FE1A 3NW9A 4KU4A 3ASUA 2H92A 3DMTA 2ZUVA 4XIGS 3ZBPA 1O58A 3TYXA 5A5EA 3L7OA 3CZQA 2QD4A 3O91A 2YWDA 5ECYA 4PGGA 1VLZA 2D5AA 4TWBA 3ZV7A 3QBTA 2VJCA 4UVDA 5AK4A 4O63O 1A8HA 1U9JA 2RAFA 3IEXA 2FZWA 3KPYA 2QL7A 4PZ0A 4TKUB 1J24A 2C31A 3A1NA 3E58A 4NU6A 2BDEA 2FDCA 3EXHB 2VHXA 5GOZA 3TCNA 1B0AA 3HYRA 3UK1A 4EB6A 2JKYA 5BYKA 3AW9A 2BMWA 2DM6A 3VV2A 3W7AA 1YCDA 3S81A 4MV4A 3TW8B 4RD0A 3DTTA 4ZALA 4D4LA 1ZDMA 1JN0A 3MS4A 5HP4A 1U1CA 2HGZA 2IQ5A 2LCQA 1O96B 4AKTA 4OL9A 3IQDB 1IBMB 5AT1A 4WUTA 2FZKA 3I45A 1OXUA 1SHLA 1PI3A 1P0QA 1M2EA 5LLTA 2JFXA 2D59A 1U99A 1TT7A 1VYVA 3IV9A 4RTMA 1YZNA 4F3CA 8ABPA 3GEMA 2WINI 4GVPA 1TCVA 2WIDA 3QA9A 2G9ZA 4O1IA 3BORA 5K0TA 1M2OA 5LIRA 2ZIGA 4WBSA 4BS9A 4KWTA 3WMFA 4IIHA 1F1JA 3COJA 1L5ZA 1YQEA 3ABOB 3LI2A 4G3XA 1UPUA 1UWVA 2RI6A 2L2QA 1MABA 1PG2A 3M6AA 2P6RA 3V4VB 4CLOB 3UWSA 3O73A 4HZUA 1KRHA 4WN9A 4JI6B 2W42A 4BZXA 1JLRA 2YWCA 3G2QA 2J5RA 2Z6VA 1RQXA 4RH1A 4PBSA 5TPZA 4BMZA 1BCSA 1MKYA 2J3EA 2Q7OE 4P31A 3SOPA 4BFZA 2PUAA 3A1EA 4K6CA 4QJIA 3EG9B 4X95A 2JFGA 1GR0A 3MTIA 1K7XB 1FDVA 1P9WA 2GFIA 2GPYA 2DU8A 3PHGA 5HFJA 3TL6A 2FUCA 3G2HA 2QB5A 3PGA1 4NQRA 4GXNA 5TQJA 2Z1MA 2ZJYA 3B1YA 3VR5D 1RRCA 4JUDX 1P7CA 4I7EA 2Q4DA 2H08A 1JAZA 4YJGA 3ZQKA 5K4AA 2RKBA 3FWKA 3KJXA 1U5BB 2VQ6A 1Q11A 2GB4A 2A7XA 4G0UA 3CRMA 1CE8A 3VZCA 2BHNA 2ZWPA 1IZZA 3F0TA 4M46A 5FBRB 1PFQA 2R97A 5DSTA 2P6NA 4DEVA 3KR9A 4FYWA 3DZFA 2AI1A 2POQX 2FSVA 4OI2A 3LT1A 1HE4A 1UMBB 4JFAA 4LZOA 4Y1RB 5G4KA 2WWYA 3FCOA 4JITA 5EUBA 4RXMA 1F12A 3Q0TA 4V0OA 1V16B 3AX6A 4GNKA 2ZTHA 3HDTA 2ZB3A 4C7JA 1NNEA 4BNTA 3IE2A 2QM3A 2A0UA 1ZESA 3VYSB 4G1CA 3UYKA 2W48A 2WJAA 2YY7A 2JFFA 1NT4A 1BAPA 2X0JA 5TVGA 3AY0A 4MW7A 2AOWA 3VU8A 2OTCA 1WZEA 1LVHA 2ZYRA 2VHWA 2C9YA 1W48A 2BWJA 3JQAA 4U8HA 4ZEMA 3IMEA 2P2YA 1ORDA 4WLVA 4QM6A 1QPBA 2I4IA 1KEVA 2D1SA 4DR6B 3H9QA 4N65A 2F3QA 4ESVA 3JAMA 5GJWC 3TS1A 4CM8A 1WWKA 2VP4A 1AOXA 4LZZA 3RVMA 3A8TA 2GOYA 2JS7A 4FGUA 2ANBA 1KJWA 1JECA 1NNI1 2ZJ7A 2DY0A 4RJTA 1K08A 5KTPA 1WABA 3ABRB 3MOIA 3MGGA 2CVQA 3AFHA 2QDKA 1VHQA 1WULS 2JCYA 4OBWA 3V7UA 3CVYA 4BTVA 2NLOA 2QZZA 1T35A 2Z4RA 5DHQA 1ESZA 3UAYA 4ER5A 1T5OA 5ILOA 3EF3A 1KL7A 3U3RA 2QBYA 1BW9A 2O3RA 4Y6OA 2AC7A 3UXYA 1J33A 3EAQA 3ZS9A 2P68A 3K0HA 1RLTA 1FYVA 1V1RA 5CVVA 5ITZB 4UATA 4UEJA 5AHKA 1JXOA 1LI5A 3KJHA 5AVJA 4CM3A 2YVLA 1JHAA 5DM70 3HZRA 4MEBA 4TYYA 1FCJA 3CH5A 3HR7A 3NEJA 4JJ8A 4Z0PA 5CB0A 1XPUA 1ZNYA 3SS7X 4XPZA 1EUDA 1DOAA 4Y2XA 2CYBA 5IYZA 3P9PA 1JEOA 2Y1WA 2H7VA 5EXEA 1LSJA 2EX1A 3GFRA 1ENPA 4URHA 3H04A 4BFTA 1VPEA 2BSXA 4PNPA 1ZLXA 2GN2A 3F5SA 1B0ZA 1ECJA 2F3TA 2R48A 1ST3A 3H5LA 3P0JA 3PUIA 4RNCA 2WUDA 4TKLA 5EE3A 5B1HA 4BWVA 2YZ7A 1HG0A 1HOTA 2VJQA 3D0QA 4MKHA 5KYTA 5JLAA 2PKCA 2W4QA 2NO4A 3KPWA 3I28A 3GRVA 2XRZA 1G2PA 2VPPA 3H87A 3T5GA 2PS1A 3A06A 3DDNA 3C4QA 3LUJA 3UTDA 4A6XA 5AVKA 3I6YA 4OV6B 1XJ5A 1XRSB 3F6BX 1FSGA 2WYIA 2L17A 3M3HA 1QVWA 4E07A 4CF5A 3HRIA 3EXEB 1EHIA 1U63A 3K2BA 3UBTA 4MWZA 2NYVA 5HGJA 4JJ6A 4OB6A 5T4BA 2CLHB 3GRPA 4G84A 1NVKA 2YHAA 4YROA 3QVGB 4H1UA 4JXKA 4Q21A 2PU5A 2J48A 2JVJA 3EGXB 4GP9A 4ND8A 3NO4A 1VLVA 5G0UA 3AVWA 1TVMA 4U00A 3WSWA 1P7VA 2VUTA 3NJ4A 1S2NA 1T91A 3P27A 4E88A 4B4KA 2XRFA 1GZDA 1Z2EA 1WDWB 3DZKA 3H11A 4TRMA 3TOXA 3UEOA 4A10A 4CLXA 1U9YA 2VDKB 1GPKA 4U7TB 1JAIA 3NVDA 2ATIA 5ER9A 4QOIA 1ZNXA 3CCCA 3RFVA 4HH4A 4H1WA 1EVYA 1CZKA 5HF5A 3ODGA 4YBRA 2QMUA 2FH5B 3EVZA 1YVPA 2BF4A 1GWNA 1NUTA 3HNPA 3LVRE 2VH2A 3P2YA 2DAPA 5G1NA 1WXXA 4DG8A 3L5KA 2PGJA 5C7IO 4Q12A 1USWA 1EVEA 2AK2A 3BK7A 4CKCA 2FGKA 4WK4B 2HK9A 3UXMA 4POAA 3GRKA 4RKYA 2B1RA 4Q1EA 2V6BA 3O4IA 3UATA 4AICA 1VKZA 2BUBA 2JCGA 2ZJ5A 1PJQA 1LZKA 2OCAA 4IEEA 2HKIA 3H6KA 4I4NA 1WL8A 4G26A 3B9QA 1QPGA 4MEJA 3EJWA 3LHKA 4MPPA 3R6LA 4JXJA 3OQVA 3F47A 3WLKX 4DV7B 1EJ0A 2FMIA 1NOJA 4R05A 4DJFC 4OFXA 1J8VA 3E18A 3GEEA 1S2GA 4Q1VA 3WIVA 3I1JA 1W6RA 4OLFA 4EECA 1A97A 3UBMA 2XE4A 3FWZA 1R1DA 2CFTA 2O6LA 3IIKA 1NVWQ 3QVMA 4RV9A 1M3SA 2BMAA 4KVZA 1SG6A 5L3RA 1NASA 4R0NA 1KJYA 1FYFA 3KTDA 4IJ6A 1XKTA 1ZCBA 3I6BA 4FWIB 5DW0A 4EF4A 2Y92A 2C3MA 3C7TA 2PYDA 1S4QA 3HUTA 3FUVA 3O93A 2A57A 2H57A 2BGMA 2XYRA 1N1EA 4HGZA 2ETXA 1RNLA 1VIYA 1U2TA 3JYLA 3BWBA 3R0JA 4FNMA 1JQKA 1VI6A 5DIZA 2PGLA 4GEGA 4X1YB 1B7GO 5FUBA 3DA8A 5IKMA 3QF4A 4P7BA 4QEDA 4BNJA 4YXWD 1V3QE 2A1UB 2HIGA 2CKMA 1VJDA 2HC9A 3NNSA 4XSGA 4AZ0B 1P7YA 4BNIA 2ACVA 1JMVA 4FFOA 3BM5A 3N0RA 4WA8A 1DRJA 2PRIA 3GFQA 3UJ8A 1QYXA 4CE6A 4P7JA 3LGSA 5DOVA 1S3SA 3V80A 4E5VA 5D1NA 3Q2IA 1KZ4A 2JJMA 1QKIA 2PO7A 3LC0A 4R71A 5LP6A 1ZSNA 2W8BA 1QLHA 2OHFA 3AKCA 3AUAA 4MUBA 5F2KA 1O1YA 1RYHA 3BD7A 1DARA 1ZW1A 1KOFA 4KO4S 4L5AA 3ZDFA 1XRMA 3QU4A 1MA3A 1A9YA 1XMPA 3CSDA 3HJNA 4OKIA 4HX5A 4PIMA 3LSTA 3IIEA 1XFDA 3V8RA 4B31A 3P19A 5M04A 1GZ3A 1X70A 1MG0A 1Q0QA 2B4KA 3AB7A 1C9NA 2E85A 2P2SA 1NWHA 4LA4A 3ET5A 4TWIA 2GF2A 3A3PA 2CK3D 5KB3A 4HG2A 4U9HS 1E89A 1LBEA 1TUGA 3QEJA 4OK5A 5FPSA 5AW8A 3LFTA 5E3JA 1WD7A 4U7PB 3N6XA 1JMKC 1Y5MA 2CF6A 3IP7A 4GE0A 3KR0A 4D6YA 3P9KA 3IPXA 4O1MA 3ENKA 3EARA 1CYDA 4KQWA 1A8QA 4LNUB 3VA7A 1F4LA 1XEAA 3VX3A 2QMOA 1DELA 1DKLA 1FVHA 3SM9A 1S9DA 5ICCA 1GLVA 1DBVO 1B14A 2NXJA 2QAGB 3A6GA 2VBIA 4FNOA 4D3FA 4ZAZA 2O8FB 2FN4A 1H93A 4P08A 4YDHB 3JAWB 1EJBA 1P4SA 1CC1S 1EDDA 1JVSA 2P9QA 3OWXA 4IILA 4X7MA 1OH8A 4Y1GA 2WHYA 4Z0NA 4QEKA 1NGSA 1B4DA 2V97A 3NXSA 1WHTB 1SZJG 2OBXA 1CY7A 4RIEA 3UMVA 1RHKA 2ZIXB 4PO9A 3EY4A 4PAWA 2PZBA 5CDTA 1JT2A 1SCDA 4BP8A 5BW5A 1BA2A 1FSSA 3MCWA 4U1RA 4YEDA 1OE0A 4PS0A 4MXDA 3QMVA 3V2HA 1T9BA 1Z4LA 2DE0X 1QMPA 1OIWA 1RZ3A 5TF4A 2JCVA 3LQFA 3K53A 4YV2A 1DV1A 1DKQA