4PW0A

Alpha/beta hydrolase fold protein from chitinophaga pinensis
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
275
structure length
275
Chain Sequence
NDHATAPTQYIEVNGTRYAYRSLGAPSDIPLICFQHFTGTLDNWDPLITNGLSKGRQLIIFDNKGVGLSSGTTPDNVAAMTADALEFITALGIRYFDVLGFSLGGFIVQYMAHIQPDMIRKIIIVGAAPQGVKVLHTFPDLIARAMQLEPKERFLFIFFEQSEHSRSKGLATLGRLYERTTDRDQDASAQAIGAQLTAITNWGKKTPSFEITSIQHPVFVVQGSNDEMMDTYNSYELFKQLPDAILSLYPDAAHGSFYQYPELFVSQTEYFLDSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Alpha/beta hydrolase fold protein from Chitinophaga pinensis.
rcsb
source organism Chitinophaga pinensis
molecule tags Hydrolase
molecule keywords Alpha/beta hydrolase fold protein
total genus 101
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2014-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4pw0A00
3GELA 4BC1A 1EHYA 3I2JA 1LNSA 4HVTA 4A5SA 4UHEA 2RHTA 3G9TA 3P2MA 3W05A 4FKBA 2VT6A 2ZYHA 3IA2A 5ALQA 2XMCA 2G5PA 4HS9A 1PV1A 1XRRA 1YB6A 4DGQA 2ZYSA 5AI0A 5HFAA 4MEAA 3C45A 4H7KA 3E3AA 1XZDA 4J3JA 5AI8A 4L9AA 1NU8A 4FTWA 1J2EA 2Z3ZA 4U2FA 5E4JA 1CUEA 4OYLA 5ALPA 2WIJA 5A6VA 3WWOA 4ZV7A 3GROA 2VQ6A 1XZEA 1HLGA 2OQVA 1K63A 4EY8A 2VJBA 4UUQA 1UKCA 4BYMA 1JI3A 3DYIA 1MX1A 3H0CA 2HADA 2VA9A 3C6XA 2ZJ7A 5ESRA 4KRXA 5ALSA 4KR0A 5EIHA 2PSJA 1QFMA 1TCBA 2K2QB 3BIXA 5KREA 3ED1A 3E0XA 3HXKA 3O4GA 5K5EA 3OTQA 4DNOA 4PSCA 5HF6A 3MUNA 1F0NA 2VATA 4GXNA 1ODSA 4QE3A 2PM8A 5JD5A 3IULA 1C7IA 3I6MA 4UHDA 3FSGD 3IUMA 5EGNA 1VE6A 1ZD2P 3ZLUA 2H7CA 4H18A 2AJ8A 4Y2JA 4GEGA 5A2GA 4L3WA 5LZ9A 2XUDA 3H19A 3WZMA 4M0MA 4XIIA 1QIHA 1S8OA 1VKHA 5AM0A 4EB0A 5HK8A 2Y6VA 1EDEA 2C0PA 2VAVA 4OB7A 3TEJA 3D2CA 1K5PA 4ZI5A 3SWWA 2ACEA 1QO7A 1JKMA 1XKTA 4B9AA 2DHDA 2I78A 1HKHA 3WK4A 4OPMA 2DR0A 4H7IA 3WKDA 4KAAA 1OILA 1YAHA 3E4DA 2XMBA 3EQ9A 1QIKA 1ZD5A 3BJRA 4HXEB 1DINA 3WKAA 3ICVA 3H2JA 5I7UA 3GUUA 5ALOA 3H2KA 4C89A 2OG1A 4X00A 3IDAA 4U2CA 3HYSA 1CUAA 1KU6A 3C70A 5CT8A 2FUKA 1TKRA 5JAPA 1THTA 3EQ7A 4XWGA 1XLUA 3CCBA 1BEZA 5HQ3B 1TCCA 3R3VA 3FLAA 4JUIA 1QONA 1EI9A 1GPLA 1XZKA 3GA7A 2VEOA 2HU8A 2BCEA 4ARBA 1WHSA 4UFNA 2QTBA 1C4XA 1CUCA 4B9EA 3R3XA 3DJYA 4X6XA 1ETHA 4BP9A 2AJDA 1GPNA 4XJVA 4X3CA 3V1NA 4OYYA 2ROQA 3HJUA 4EBBA 2DHEA 4Y2TA 5CXUA 1IMJA 4UHHA 4WDQA 4N5IX 4ETWA 2BGRA 4H35A 3SX4A 1VXOA 4H7HA 4LXGA 3IUQA 4E11A 2X5XA 5EIEA 4G4IA 2XMQA 5LKRA 1XZMA 4BBZA 4DYHA 3WK9A 5KWIA 2G5TA 2HRQA 2WG1A 1YAJA 1WM1A 2XQFA 5IVHA 1RYYA 1GPKA 4EA6A 4PNZA 3WIOA 3V1MA 3AUKA 5E4TA 5K3BA 2QXUA 4MEBA 4BVJA 4QDXA 3HEAA 1E3QA 2XMDA 4BCCA 3G0IA 1FFDA 4X95A 2B9VA 5ALLA 4BP8A 5C81A 5CH5A 1R88A 2XMRA 3IBTA 1ISPA 3ZLVA 2XQGA 1TAHA 4J0DA 4X90A 3C6ZA 1LPNA 1CIJA 1A7UA 5CTAA 2XI4A 4ZREA 3WK8A 2X76A 3DD5A 4TGLA 2CZQA 3PUIA 2JEZA 4G8DA 2WHQA 2PUJA 2BGNA 1AZWA 4B6GA 2GBCA 2H7YA 4DNQA 4K6HA 1IZ8A 1EDDA 3Q8WA 1Q83A 1GGVA 1LZKA 5AH0A 3D59A 1GKLA 1UKAA 3R3ZA 4BTVA 1UK7A 3STUA 4F0JA 4C4XA 4U2GA 2QMQA 3A2MA 5DYTA 1E66A 4A16A 1FSSA 4G9EA 4WCVA 3DQZA 5KWJA 4EUSA 4RPCA 2WUEA 5AKZA 5JAHA 1ZJ4A 1AURA 2D5LA 3R3WA 3DNMA 3RK4A 5IVIA 4E14A 5SYNA 1H23A 2DQYA 3FYUC 4PV7A 2XDWA 1A8UA 2WJ4A 2AJBA 2XUHA 1VA5A 3DLTA 4B80A 1UK9A 1ORVA 5LLSA 1CUFA 4WFJA 5CW2A 4FBMA 3FAKA 4DNPA 4CCYA 3AIKA 3HZOA 1XZFA 4DM7A 1MN6A 2DSNA 2V98A 4Y2QA 1UXOA 1UZAA 3WJ1A 2RI6A 1UWCA 2H7XA 5H3HA 1BCRA 1EDBA 3S8YA 2Q0XA 3JWEA 1X2EA 3RM3A 1THGA 2OCKA 5IVDA 2XQJA 3G8YA 2DHCA 1ZGCA 2WSLA 3R3UA 4FFVA 3ILSA 3RARA 3C6YA 4BTLA 3O9MA 4K6KA 5AO9A 3QH4A 1ZGBA 1LPMA 1SFRA 4KEAA 1CUHA 3AZOA 1QIIA 4J0IA 1HPLA 1EB8A 4F5ZA 5F4ZA 5FOQA 1UOOA 4Z49A 3G9XA 4Q34A 4BATA 5BWCA 2ECFA 1KU0A 4DTCA 5CURA 5C8ZA 1D07A 2JGIA 3O95A 2IIVA 4Q3LA 1T4MA 2QVBA 2FX5A 2YH2A 4QDTA 3TGLA 3ICWA 4KE8A 2I3ZA 2JF0A 5D3KA 1UFOA 3W04A 1GQSA 4BE4A 2QZPA 1VOTA 1DWQA 5CXXA 3BDIA 4X97A 1XQVA 1VA4A 1DT5A 3WYDA 4F60A 5AK6A 1A8SA 5AI6A 5DNUA 4C4ZA 1GZ7A 4BVKA 4B7ZA 3WI7A 3BXPA 2IX9A 4AO6A 4IH1A 2WLSA 4X85A 5LZ4A 5CMLA 4Y2YA 3G0BA 2WKWA 4OSEA 3I1IA 4DMFA 4P9NA 1MU0A 3W9UA 3PI6A 3ANSA 3N0TA 2WFMA 2Z5GA 5YASA 1K6EA 1DWOA 1CUIA 3WA6A 3FYUB 3F98A 3K9BA 1QIEA 5AKXA 1CVLA 4UFOA 3T52A 5AKKA 2PL5A 1TRHA 1U4NA 5EIAA 1XFDA 4B82A 4LYEA 2PUHA 4H7JA 2RAUA 5JIBA 5FPPA 4BZZA 1IVYA 1VJ5A 3GBSA 3WWPA 2ZYIA 4IH9A 1FFEA 5LIPA 5AOAA 3LIIA 4TVKA 3NWOA 2QXTA 2GBGA 3G9ZA 1RWQA 3C8DA 1E5TA 3BE8A 1E8NA 1H22A 1CUBA 4MQMA 2JGEA 3O4JA 5DYYA 4P93A 5JD6A 1QO9A 2QRUA 1ZJ5A 3GZJA 3W2TA 1P0QA 1X2BA 3VJKA 3DL4A 1W76A 2C5GA 5AJHA 3D5EA 5A62A 1JJBA 5K3FA 3O9VA 4CCWA 4DSAA 5AP9A 1Q84A 1XROA 3QMMA 1EB9A 3QMVA 5AOCA 1R9MA 3ZPXA 3FWHA 1WHTA 4DMKA 4KAFA 4INZA 1AUOA 1CFJA 5T4FA 1AQLA 4Y2UA 2O2GA 5K3FB 1GQRA 4C88A 2CEKA 4UHCA 2YASA 5FUMA 2WFLA 2I03A 1UKBA 3H1AA 4G4GA 1AGYA 5ALYA 4GBGA 6YASA 2GBIA 4HRYA 3BF7A 1EX9A 1TIBA 1W4LA 4UBMA 1CUYA 2O7VA 4RGYA 4BRZA 4ARAA 3H18A 5AKEA 2BAGA 2WG2A 2EDCA 5AI5A 2XUPA 4W1RA 2ZYRA 3G0DA 4GI1A 3CCCA 3B3QA 1AC5A 4ROTA 1LLFA 4N8SA 3NOXA 2HA4A 1ZIYA 1NX9A 2H1IA 2DQZA 4I4CA 3ZWQA 4BAGA 5AKHA 1XLWA 3N2ZB 4I3FA 3DKKA 4PQEA 5AM1A 3O4IA 2G4LA 5FDFA 1MT3A 4F21A 1Y37A 3U1TA 3U0VA 5DLPA 3I6YA 3WK5A 1WB4A 4KYVA 1EVEA 1XZIA 1M33A 5ALMA 2PSDA 3KDAA 2QKYA 3L1IA 3IVMA 1ACLA 2ZJFA 1VZ2A 4MXDA 4YX9A 4J0CA 1YA8A 2W6CX 5FXMA 5LP1A 3B12A 5ALKA 2B61A 1CQZA 2OGZA 4DMCA 3V9AA 2EDAA 2J3QA 3PE6A 4GWLA 3WKBA 5HCUA 5A7FA 2CKMA 3WKCA 4C87A 3HABA 4BE9A 1UK6A 1QZ3A 2Y1KA 4Y7DA 3EBLA 1DX4A 2PSHA 2XUQA 2WUGA 3EIOA 3A2NA 2ZSHA 2OAEA 3G0GA 5BV7A 3ESAA 3YASA 4J0JA 2DFPA 1MNAA 4QLOA 2J4CA 1EK1A 5E2IA 4BC0A 1XZAA 5HF5A 2WTMA 4Y2PA 1JMYA 4CIAA 1XQWA 1GXSA 2OCGA 4C01A 3STXA 4X71A 2WHPA 1BCSA 2B4KA 5C7YA 5LZ5A 5C8VA 1BN7A 3ESCA 3QPDA 3HRHA 1IUOA 1K8QA 4GECA 1RP1A 3VDXA 2XQIA 5CH3A 2WIDA 3SC2A 1DWPA 1J07A 2OQIA 3HSSA 1XQXA 4KE6A 2QUBA 4EY5A 3W9BA 4RE6A 2BFNA 3IUNA 4QDOA 4YK7A 4MYDA 3QPCA 1B6GA 5EI5A 2OLEA 3WQHA 1L7AA 3TRDA 5EFZA 5AKYA 4HAIA 3PICA 5AM2A 5EHZA 3B5EA 1H2ZA 4FLEA 4UFPA 2WU4A 4EY7A 2E3JA 3L1HA 5DTJA 3EF3A 5K3AA 3F96A 4D9JA 1YS2X 5T4EA 4W1SA 4BAUA 1FJ2A 3I2HA 1GT6A 5K3EA 1BEEA 4UBIA 4NVRA 2VSQA 1ZI8A 3I6ZA 2RHWA 2VAXA 2CBGA 3EQ8A 3NUZA 4H7DA 3STWA 1Y7IA 4KE9A 1G66A 3M3DA 1WOMA 5AHXA 3VJLA 3WK6A 4ZWNA 4IH4A 3QBJA 5LZ2A 2WJ3A 5CT4A 1LGYA 7YASA 1LPBB 2Y2VA 2RIPA 1L7QA 5ALNA 3G9UA 3A2LA 4AZ3A 1G42A 2DCMA 2PU7A 4HXFB 3WJ2A 3C5WP 1W1IA 4MWTA 5ALJA 3G0CA 2JGFA 1QJ4A 3R0VA 4FHZA 1CRLA 1DQYA 3QVMA 2PKYX 1P0IA 4NS4A 3WL8A 1QIJA 3AZPA 1TK3A 5CT9A 4Q82A 5JATA 3FCXA 1H2XA 2XLCA 4CFSA 2C7BA 4JYMA 4UBLA 1HBJA 3OURA 5ALGA 1CUVA 1ZOIA 5HZGA 1VXRA 1FFBA 4U2BA 5AK5A 5K3DA 1JU3A 3LCRA 4U2DA 1XZHA 5AK3A 3HC7A 3F9CA 2HA5A 2X8BA 4G8BA 5JAUA 4AMYA 4Y2RA 4L0CA 4X91A 2R11A 2I3DA 2BUCA 2JEYA 4B84A 1H2YA 1CUDA 4G1FA 3H1BA 4EY6A 4PW0A 2OCIA 1R3DA 3D4LA 5IVKA 2C5FA 1YCDA 2OPHA 4GHWA 3ESDA 4UBOA 4AZ0A 3H04A 4W63A 3FSGA 2WHRA 3R40A 3OG9A 3DEAA 3FYUA 2OCLA 4G5XA 4FWBA 4W1PA 4X7BA 3I2KA 2VT7A 3CXUA 1PJAA 4ZGBA 5HKBA 2XT0A 2BUAA 4UBJA 4AXBA 3I2IA 5AI9A 4X6YA 4IO0A 3DOHA 1WPXA 5J3JA 3DOIA 1J1IA 4EZIA 2V9ZA 4B0PA 5C8XA 2PSEA 3QYJA 5SYMA 4DIUA 3WLAA 5BOVA 2JGKA 1CV2A 3W06A 1LPSA 1BRTA 2XUFA 4W1QA 4JNCA 1CUJA 1R50A 5JADA 1VLQA 3FVRA 1CUZA 4XVCA 3VISA 2QJWA 4O08A 1T2NA 2WIKA 3UUEA 3OC0A 4QDUA 3S2ZA 2ORYA 1UK8A 4KJXA 1A8QA 5EHXA 1BN6A 2QJRA 3WYNA 4GDMA 4ZRDA 1LPPA 1EK2A 3C43A 2O2HA 5AICA 4BCBA 3MGAA 1LBSA 1CEXA 3JW8A 4HTAA 1K4YA 3VVLA 5D7BA 3BIWA 5AIAA 5ALTA 4H7FA 4OCZA 5CRIA 4FMPA 3ZV7A 4L72A 4Q3OA 1ORWA 5AIBA 2WFZA 2HA3A 4P92A 3AJAA 4PSDA 3ZLTA 1E8DA 2HRRA 4FFWA 5IKXA 3WWEA 4E15A 1XRPA 1DT3A 1ZIXA 1MO2A 4KRYA 5AKGA 2WFLB 4QLAA 2C0QA 2HL6A 1QIDA 1N8SA 2ZJ6A 2GYUA 4J0GA 1J06A 5HF8A 3IB3A 1MJ5A 1F8UA 2IITA 3AINA 5A71A 4FNMA 3BJMA 3VVMA 1SC9A 1YB7A 3DS8A 1HDEA 1QOZA 4GW3A 2EEPA 1IZ7A 3DL7A 5HKAA 3VXKA 3AILA 2UZ0A 4E46A 5EHNA 1LBTA 5AK4A 1LZLA 4BAZA 2XMSA 2XUOA 1DQZA 5A7HA 1ZI6A 4K5QA 4N5HX 3QITA 4AMZA 2Y6UA 4NMWA 4PF1A 5ALZA 2QS9A 5FP0A 1CUSA 1QIMA 1SCQA 1F0PA 5HFNA 4BZWA 5FLKA 1QE3A 4X6UA 2RONA 5ALXA 3H2GA 3LS2A 1JJIA 2HIHA 4QNNA 2GYVA 3OM8A 2AJLI 1YSCA 4QDZA 1ODTC 3GFFA 5JARA 4CG2A 3L1JA 1QTRA 5ALIA 1WB6A 3HI4A 2WQZA 1H2WA 3HLKA 3OOSA 4WJLA 1XRMA 3WKEA 5I9IA 1SCIA 4WY5A 4BVLA 4S0XA 3UMJA 4EY4A 3FLEA 5CT5A 4M0EA 4MQLA 2BUBA 1P0PA 5AKLA 4ZXFA 1EA5A 1U8EA 4NZZA 3BF8A 5JYCA 4V2IA 3G7NA 1WCYA 2Z3WA 1P0MA 1ZD3A 4QWWA 4M0FA 5T4BA 1XQYA 4DNFA 2PVSA 1WB5A 2XMGA 1HQDA 2FJPA 5D3ZA 3R41A 3C5VA 2AXEA 1CPYA 1WPRA 4X92A 4JYPA 2VTVA 2CUTA 2XQKA 4PSUA 2WIGA 1QIFA 5JZBA 2VJCA 3V48A 2Y2UA 4HZGA 3BL8A 5AI4A 4J0KA 4BDTA 2ZVDA 1AMNA 3TJMA 4Y2XA 5HF9A 3I1YA 1UOPA 1MX5A 1USWA 3KWFA 1R1DA 3RKSA 4OB8A 2JGLA 2HU7A 3FLBA 5CBKA 1UT6A 3AZQA 4IQ4A 3LIPA 2BJHA 1IUNA 1OXMA 5JALA 1XRNA 5JAOA 1QTIA 4X94A 1QIGA 3D3NA 1YS1X 3SK0A 3WK7A 3BDVA 5JZSA 5I8PA 5LYYA 4OU4A 2OXEA 4BCDA 1TQHA 2XMZA 2HHAA 1Y7HA 1XZGA 2XUAA 1ODCA 3F67A 5IH7A 3ESBA 1JMKC 2JIDA 4Q3KA 1AKNA 3C8HA 3PUHA 4B83A 4MYSA 3JYHA 2PU5A 4J03A 3C87A 4UHBA 1BE0A 1MAHA 3H2HA 3QZUA 1KEZA 3PF9A 2XLBA 1GKKA 5E4YA 3AIOA 3AIMA 4Q05A 2V97A 4KACA 3D0KA 5AM5A 4X93A 3WL5A 1VE7A 2QT9A 5DJ5A 3ZI7A 2O2IA 2AJCA 4TPKA 2XUGA 3NGMA 2VF2A 2ZSIA 5AM3A 4N8DA 2PSFA 1XZLA 1CUGA 1CUUA 1U65A 2OAGA 2R8BA 4GLBA 1C7JA 3VKFA 2XUIA 4LKOA 4LXHA 3FBWA 5FV4A 3WL7A 4AQDA 5CH8A 2FJ0A 4OUKX 4C6HA 5JZ9A 2JBWA 2G63A 1R9NA 1NU6A 3G02A 3MUOA 3D2AA 1MAAA 3FOBA 2HU5A 4DSZA 2W22A 3F97A 3WWDA 1XRLA 2JGJA 2QM0A 4LHEA 4KE7A 1XZJA 4MJ3A 4U2EA 5ALEA 5ALVA 4WFKA 2PX6A 5ALHA 2VJDA 3R3YA 1F6WA 4QWMA 2HFKA 2C4HA 1JT2A 3FYTA 4BRSA 1XKLA 4CI9A 1Q0RA 3PDCA 4BDSA 5AOBA 2ES4A 4CG3A 3UUFA 2QOEA 3FVTA 3KSRA 5FKJA 4PO3X 1YASA 5A7GA 4WDRA 4AO8A 3IIIA 2Z8ZA 1ZD4A 1CLEA 1ACJA 1R4ZA 4J0HA 1YA4A 4UPDA 3ANTA 2P8SA 3IURA 4B85A 5AM4A 1Q0ZA 3KWJA 3H17A 4RE5A 3LP5A 5ISMA 4LXIA 1XRQA 4OB6A 3C6BA 4QA9A 4Y9SA 5ALDA 5LZ7A 1HL7A 2O7RA 3STYA 2OGSA 3BWXA 3E1GA 5LZ8A 2WUFA 1U2EA 2LIPA 1O6GA 2HA0A 1JJFA 2WTNA 4BB0A 5DNWA 2HA6A 3K6KA 5ALUA 4B81A 2CB9A 4LYDA 3AFIA 4Y2SA 4JEIA 1AX9A 2WIFA 4WY8A 2OGTA 3A6ZA 5T4HA 4FLFA 1B41A 5DYWA 4IHAA 2GZSA 2GBFA 5ALFA 3D2BA 2BKLA 4G4JA 4HXGA 1PFQA 4B0OA 4MWSA 4AO7A 4AX4A 3WWCA 1QLWA 1YR2A 3STTA 2YXPX 4CG1A 2HDWA 1LPOA 3K2IA 5FPQA 2NW6A 1EXWA 3O0DA 3M83A 5DWDA 3FNBA 3OPMA 4LIPD 5ALWA 1O6FA 2D0DA 3Q0TA 4WFIA 5K3CA 1A88A 4FDMA 4AN1A 3PFBA 1DTEA 3PFCA 5ALRA 1XLVA 5BWBA 4CIBA 4I19A 2JGMA 4FOLA 1QGED 4JH0A 3IUJA 3QPAA 3M81A 1EVQA 1BROA 2C58A 4ZV9A 1ZI9A 3DYVA 1MX9A 2XB6A 2VJAA 2XUKA 1VZ3A 5AKJA 2HM7A 3X3HA 5HK9A 1JU4A 4UHFA 1IUPA 1W52X 2YYSA 4HRXA 3DKRA 4G9GA 5JD4A 3DCNA 1N5RA 2WG0A 3KOOA 4C4YA 2QUAA 1N5MA 4YPVA 4AB1A 1G5FA 3QM1A 4OD0A 1JFRA 1OCEA 1Z68A 3V1KA 1CR6A 3A70A 4G8CA 4K2AA 1UOQA 2HFJA 3WZLA 3KXPA 5DTIA 2CMFA 3F8SA 3STVA 3O4HA 4QZVA 4P08A 3PF8A 4DMHA 1QFSA 1SOMA 4EHBA 4FBLA 4OU5A 1BS9A 3MVEA 3LLCA 2HA2A 2XUJA 3WA7A 1X70A 3RLIA 3FCYA 2ONCA 4Q1VA 1XZCA 1N1MA 1E8MA 2J3DA 2XE4A 1FFAA 2V96A 2J4FA 4CCYB 2B20A 2QR5A 4ITVA 3WL6A 1MTZA 5FRDA 5D6OA 5EHQA 1E89A 4FLMA 1EH5A 1I6WA 4A23A 2WU3A 1MPXA 4RNCA 4N8EA 1SCKA 1TCAA 2HA7A 3I28A 3WIBA 1ZICA 1DX6A 3VJMA 4KAJA 3QMWA 2Z8XA 4DLNA 3I2GA 4QEKA 2PBLA 3V1LA 1XZBA 3DDUA 1CQWA 2PPLA 2WUDA 4UBKA 5KBYA 2RGUA 2CJPA 4UBNA 4W9RA 3WMRA 5JANA 3H2IA 1W6RA 4J7AA 1CUWA 4XX1A 3CN9A 4YASA 1MNQA 2H9YA 1DU4A 4Y2VA 3T4UA 1L7RA 2GYWA 2WM2A 5CT6A 3KD2A 2WILA 5LKAA 3D7RA 4FNGA 4H7EA 1EINA 4K6GA 3HACA 4AN0A 4H0CA 2ACKA 5DNVA 5AKIA 1LPAB 1W75A 4H77A 5HQ3A 2WHPB 1CUXA 1G4HA 3M82A 2GZRA 5JASA 1FFCA 3CN7A 2WJ6A 3I2FA 1BU8A
chains in the Genus database with same CATH superfamily
1FMJA 1RAHA 4JQCA 1EM8B 1JUDA 1TZ2A 3C4QA 3O75A 4MP8A 4NJMA 5JQGF 3EIXA 1O94D 3P71T 5SICE 4BC1A 4IDFA 2FVXA 1ULHA 2HJWA 1DZ3A 1YB4A 2CJWA 4EZEA 2CFRA 2ZIVB 3N8NA 1Z63A 4K2HA 3E6AA 3IXMA 4TTRA 1E0DA 4WZAA 5FWXB 3GPBA 2CNKA 1COWA 3JQEA 3KQKA 1TT5B 4UHEA 5FR1A 3JPWA 1W19A 5F1KA 5SY4A 1UBGA 1CNFA 2J32A 1T6YA 3LD9A 4NK5A 4YMWA 3WRVA 4D56A 1GSIA 3AOGA 5JQWA 4IIDA 5ALQA 3WLFA 1ZNZA 3CBGA 1GDDA 2G5PA 3EIEA 4W5JA 5CJ2A 4JQOA 1KAEA 2CMHA 1JHZA 1N9GA 3SM3A 1SQGA 2JHFA 4ZIRB 3TLCA 4FFRA 2JHCA 3BMCB 1XVVA 4TVOA 1L3IA 3R8XA 1XTSA 3ZHYA 4PRZA 1KR2A 2XE6A 3HR4A 4C78A 4FMBB 4PNHA 1L1RA 1E1LA 4LFBB 1IB6A 3N2KB 3O91A 1KYTA 4LWPA 2GN6A 5CEFA 5JMTA 1OKKD 4GMGA 4EJSC 1PR9A 3LH5A 1WSWA 4L50A 3V34A 3GLIA 3V80A 4DDVA 4PO1A 1UC5B 1Z5VA 1LSUA 1RACA 2G77B 1EQ2A 2O7NA 3FMOB 3JATA 4PZ0A 5AI8A 2ZWIA 1J22A 3N8DA 1BCSB 4R83A 1MO3A 2DWCA 2YZ7A 3KXDA 2FMHA 2QRJA 2Z3ZA 2QUHA 5E4JA 3CGGA 4MVJI 3DZGA 3D3QA 1M6VA 4JI6B 1CUEA 1NQUA 5CVEA 2PWYA 1FZQA 1AHNA 3GZTB 3UOWA 1WKCA 4R41A 3VDNB 3WB9A 5A6VA 4IDGA 1XZEA 4E5YA 1H2FA 4DR1B 1UODA 3LOPA 4PX5A 2OQVA 2QX9A 2Y1DA 4MKFA 5CJPA 3M5PA 4JEMA 1B8NA 4D0GA 1UKCA 5BQXA 3P2KA 4EG7A 2C9DA 4AKGA 5GONF 1OXTA 3C6XA 5T3UA 2Y1WA 5KYKA 4XVRA 5C7OO 3OIWA 5ADVA 1SRRA 3TXYA 4KQ6A 3X0DA 1JTVA 4KQMA 1GQQA 4KRXA 4N7JA 2GM4A 1JBEA 2ZJ5A 4FDUA 1DS6A 2EFEB 5EIHA 4EJMA 1OFGA 1VRCA 4A1FA 1OLUA 4TYQA 4R69A 2NVWA 2PE5A 4Q1BA 5KREA 1FPMA 2IOFK 3ED1A 4N40A 3G2QA 2BEVB 3O4GA 4Q37A 3OTQA 1IB0A 1IHXA 2CNLA 1SEPA 4DNOA 5K5EA 4DG9A 5JO9A 3DLIA 1F0NA 5IG2A 4UU7A 3FGPA 3ZWWA 3OZFA 2V8OA 3DTNA 1EWYA 4HS4A 1ODSA 2OCXA 3RRMA 1P6QA 3VR5D 5A0FA 4F1JA 2PS0A 3LT0A 1LWOA 3WIDA 2DLNA 1C7IA 3AF1A 3ZDFA 3FSGD 3ZX5A 4NCAA 2XMPA 2Q1WA 3CTPA 1YOVB 5H3CA 3ER9A 1YONA 2G3YA 4RS3A 1ZD2P 3I73A 4L85A 4Q24A 4L07A 3DFKA 2BFFA 3NM6B 3K15A 4U9IS 7ADHA 1TT7A 1QCDA 3IDZA 3RF7A 3AI2A 1ZM3A 3LBAA 2HEGA 4XI9A 4ACBA 3A14A 1R16A 2VH2A 4H18A 3BXFA 2DLCX 2GEFA 1VKJA 4Y2JA 3OPVA 3S7TA 3WBKA 2EL9A 5FOSA 1C3OA 5E6UA 5IJ0A 5HOEA 4XM1A 4MWEA 4PSAA 3WZMA 2ZIXB 5HYVA 3N1UA 4RQAA 1QIHA 1Z2NX 3SEZA 1VCHA 2QZZA 4PG6A 3G7SA 3OA2A 3RLFA 1ZGZA 3CEMA 4BNIA 4WTOA 4Z0HO 5HIAA 5D84A 1KVUA 1FP4A 2VL7A 1VKNA 1WCWA 3FUVA 4WX2B 1S7CA 3K0AA 1EDEA 4O4IA 1RWWA 1LDEA 1LUAA 3K16A 5BQ5A 3VZRA 2C0PA 3S27A 2VAVA 5KTPA 1YBMA 4LW8A 5EXSA 3TEJA 4FVTA 4JKIA 4BFWA 1K5PA 4ZI5A 3U48A 1WZ2A 1JKMA 2VPXA 4B9AA 1IIBA 4HF7A 2VUHB 1E79D 2D7DA 1BU5A 1QZXA 2N75A 2QLNA 2B4AA 1OX6A 2DR0A 3REOA 3BERA 3OHPA 4ZMBA 5LYJA 4UUNA 3MHTA 1AGXA 3OOWA 4R1TA 4KAAA 4AJOA 1OILA 1WOYA 3BFPA 2GVNA 1X19A 4ZYYA 5A4IS 1QWSA 1ESEA 3RO7A 2FW9A 3C3WA 3B6MA 3HN2A 4G1UC 1W30A 2C2ZA 4X61A 4YRPA 1JHXA 1MJFA 3GL9A 3GLQA 3ORRA 1SELA 4IJ5A 3VSEA 4B4UA 3L8DA 4ZOCA 1XVTA 4YRKA 4ZZ1A 3MFQA 4MW7A 2J85A 1A9OA 2VDOB 3GX1A 3ICVA 3F7MA 4INAA 3GFOA 4M9ZA 4OHKA 4UTPA 4HB3A 3BYZA 1BGWA 4OGLA 4W9NA 4CQMA 2VHTA 2NUBA 3H2KA 4AY2A 3P97A 2E21A 2M6LA 2OG1A 3UMYA 3IDAA 3GN1A 2ODQA 4PGAA 5FFNA 1XRSB 4EQ6B 3KZCA 3KZXA 5B53A 2P91A 3WRXC 1A69A 1KU6A 3C70A 2VSFA 1TE2A 1N5KA 2YN0A 3JYNA 2FUKA 3C6KA 3TQHA 4LDPA 3EQ6A 1A96A 1QKIA 3U37A 2CF6A 2DUMA 2GHIA 2GPNA 3CH7A 1TM2A 4AJKA 2J4DA 1W96A 3GFVA 3JVIA 4YP7A 4FB5A 1NVFA 1EFKA 2OV6A 3VKVA 4Q9HA 4Y0AA 5GP1A 2RHRA 1V5FA 3EUEA 4YRTA 3JX9A 1YRQA 3CCBA 5L3QB 4RJ2A 1F14A 5GONB 3L7KA 4FGSA 2I8AA 4RK7A 3R3VA 2HC9A 3R7NA 3CZ5A 4BWGA 1ZIPA 1WUYA 2JLBA 3ZD9A 3U3KA 4FE3A 3PXCX 3FLAA 4PG5A 4JUIA 4NR0A 4Q1CA 3ZXSA 1F4LA 1Q74A 4HWKA 3RHSA 2BFWA 4LXTA 1V9LA 3MGGA 1EP9A 2ID7A 4BRWA 4RKEA 2DHQA 3TH5A 2H1RA 4K03A 5EKUA 3ZIAA 2EATA 3GT3A 1WQ1R 3EF0A 4UFNA 1C4XA 3IV7A 1KFBB 4X1YB 4B9EA 1NVBA 3CR8A 4D99A 3DJYA 5KWEA 2XH8A 3PHBE 3DL0A 5EZYA 1PSDA 1OKKA 1AUPA 4K9LA 4WBNA 5TMDA 3C39A 4YBZA 4BP9A 5FH9A 2P2LA 3KQNA 3GLHB 1S4MA 3GLRA 4ZU1X 3JARB 2ISCA 3MTAA 4NSNA 4JZYA 2YWJA 3P4XA 4CHTA 2CFCA 4GX2A 4XJVA 8ADHA 4KJZA 3R5TA 3QYAA 2X1LA 2Z1MA 4HYYA 1WA5A 3W8EA 3BZWA 3RHTA 3WQSB 5K8UA 2ZB2A 1L4BA 1QVZA 1JR6A 2WSBA 5T8KC 3NIBA 2WZBA 5DBOA 4MUJA 2C3MA 2G07A 1FYWA 4EBBA 3BD9A 2VQEB 2AC7A 2AS0A 1WD7A 4MP3A 1MC5A 1CQJA 2DFTA 4WK6A 3UJNA 2VZ0A 3RNOA 2HPZA 3ANLA 3FMIA 2QDKA 1LBEA 3G89A 4WXHA 5D7NA 3RG2A 3TMKA 4AN0A 3WMGA 4ETIA 1E9DA 4P6VF 3DTTA 1Z2CA 4TKUA 4MW9A 4UHHA 3CNOA 1F8YA 4WDQA 1GPUA 1KI7A 2AD5A 1LD3A 2N42A 4GRDA 3EFHA 4QNMA 1MAVA 3O38A 1G6HA 1RZ3A 3IUQA 4DC0A 3LYAA 3I42A 2FPRA 2VDQB 1VRVA 2ZE5A 2G40A 2BGLA 3WLKX 2HWWA 4G4IA 4Q7JB 2YQZA 2FUNB 1U3DA 3I45A 5LMZA 5LKRA 1RXYA 2X0NA 3LC2O 4K9PA 3HHPA 4AP6A 4MV5A 1NOKA 3WXMA 2FH5B 3TLYA 1T8WA 3CW2A 2C2HA 2D5AA 2WF9A 3M9XA 4AUKA 2HRQA 2NU9B 1VLZA 1HGXA 1UT5A 1W4BA 2FPMA 2TRSB 3HY4A 4G4SP 1WM1A 3M6LA 1L4EA 4OUDB 5FUQA 2XQFA 1P4AA 3AV0B 4ZI3A 4DJEC 1BAPA 1DXOA 1Q91A 3I8OA 4RS4A 3LZCA 3MWLA 3L0BA 3TOXA 4HK4A 3IPCA 2POQX 4X7RA 3DEYX 4I8XA 3FDZB 4WLEA 1EE9A 4EA6A 4B3HA 1ML3A 4IGEA 4CL2A 4MV7A 1VP3A 3V1MA 3L04A 5E4TA 5K3BA 1OPXA 4L8LA 3KE8A 3QY9A 3N6XA 1Z4NA 4MEBA 4YRSA 1G41A 1HNWB 3RC3A 2VF8A 2CXUA 3ANNA 2XKKA 3REGA 2OHHA 3ZHOA 2ZTHA 5JNUA 2YY6A 6NULA 1I7QB 4U1RA 3F8WA 3ZHQA 1U5BA 4QXOA 3UMFA 2H2IA 2YY5A 1J25A 1WMFA 1G8YA 2D2VA 2XMRA 3L40A 3L4SO 3C74A 3FYCA 4F4DA 5B30A 3EPKA 2VRCA 1F51E 1QHIA 2Y1EA 3UQZA 3LLSA 4II2A 3QEOA 1C4KA 2X6TA 1OJLA 2XQGA 5TJ9A 1TAHA 2AFRA 4UXIA 3W6PA 5AVUA 3I6IA 4NFYA 1G9TA 3IAS6 3PFNA 4MWCA 4IXMA 3SFVA 3W0LB 4IX9A 1UL1X 1USVA 4S1PA 5D5HA 4US0R 3WADA 1ZY2A 3OF5A 5J4KA 1I0LA 3TLKA 3OEHA 2F1IA 4QM7A 2B4TO 4CV0A 5CTAA 1HT3A 4FD3A 1FU7A 1O0SA 4ZREA 5I3CA 4NARA 4B6EA 3WK8A 1KDYA 2C2KA 3ZI4A 3DD5A 1Z2OX 4I7EA 3DWIA 4JL6A 4DIDA 1V3QE 5J43A 4DB4A 1XK7A 4TGLA 2CZQA 3PUIA 2JEZA 2FX2A 1V43A 1U28A 4HXYA 3OIGA 1ZUD1 5FUBA 3R9WA 3SYLA 3K72B 1MP0A 1YC2A 1S1MA 1BXGB 4IVRA 4B6GA 2H7YA 3PHLA 4K6HA 3IX7A 3DVQX 3QG1A 4R7TA 1N2JA 2QJTA 1DO2A 1S01A 3A1VA 1VSVA 3Q8WA 2VJNA 2P3LA 3HO8A 1LZKA 1XWWA 2Y1LA 2BELA 4P0QB 2EVWX 3Q7RA 1KARA 1FQOA 5CDTA 4M22A 1NW7A 1I32A 2QUKA 3OD5A 5K20A 4FN4A 4IIFA 2ZTUA 4Q9LA 1ORHA 2HU2A 4U6QA 5F2NA 3AWIA 3W5UA 1Z4OA 1JR3A 3LY7A 5A4FS 4EYQA 5GGYA 3ZCQA 2ISSD 5EXXA 4B7AA 3A2MA 4EFKA 3B52X 2I1LA 3KQOA 2VP5A 4QFBA 2CLKB 1FSSA 3WLQA 4WCVA 3DQZA 4ZOLA 1N1DA 2MU1A 5GV7A 1Y33E 2IKQA 2B7BA 2OVBA 2ZB4A 1V7CA 1RRMA 1VFNA 2YXLA 1ZJ4A 3DOUA 3WL3A 3ZS8A 1H2HA 3JR7A 2HX1A 4PHTA 3VSAA 3WLPA 3IT2A 1TVKA 3RK4A 4AMBA 4COOA 3F7NA 3EZ2A 2SNIE 4XARA 4YP5A 5SYNA 1V6SA 3HUEA 2OBMA 1DQPA 2M32A 3OJ0A 4XPIA 2D2EA 1GQ2A 4HB2A 1KI8A 2HLNA 4P5PA 5E95A 4ZTBA 4KQEA 5C4IA 2XXAA 1I1HA 1T6ZA 2NACA 4Y6GB 1QCZA 1UWLA 2ODWA 3DLTA 4UMFA 4A3SA 1I6KA 1OUMA 4LKRA 3VPBA 4M76B 3VTAA 2V8BA 2VJLA 1LDMA 3EGDA 3JQFA 3SQMA 3SY8A 3KEGA 4XYLA 4ZMSA 4ZQEA 1Z36A 2RFLA 3MGBA 1Z47A 1RLMA 3A9VA 3P27A 4L74A 5FTNA 3THXB 3C7AA 5LLSA 2Q9BA 3MMSA 1CUFA 4K7JA 5F52A 3HCOA 3FYHA 3FAKA 5D3MB 2V7QD 5F3RA 4DNPA 3ZOZA 1IVSA 3AHGA 1T2EA 5MDHA 4DM7A 3QENA 3HWX1 3KLPX 2Z2JA 2NZJA 1WY5A 5L4SA 3E22A 3UHJA 3PC8C 4IFTA 4EI8A 3EXG2 2F8TA 4O1IA 1NNSA 3SYTA 1RJEA 5FHRA 3FFTA 4M9SA 4EG6A 3AFNA 2HXSA 4M38A 1I4EB 1MCZA 2GZAA 3AP3A 5E8RA 2NX2A 1OAOC 4QPJC 5IULC 2P6UA 2YHIA 1KO5A 4BLOA 1FP7A 1QG0A 3BWMA 3DVLA 4M83A 1KDVA 3ABSB 2C0CA 3IAXA 1P7WA 4F04A 3T7CA 2JAOA 2H5IA 5B3AA 4P3OA 3S8YA 2W37A 4L02A 4D9CA 3QEMB 4RVOA 4M1EA 5F2OA 3GMDA 3WAJA 3D6JA 2V0NA 4TMZA 4BNZA 1KK3A 2V4ZA 2WINI 3JWEA 3T9CA 3KHUA 1EZ4A 2GRAA 1X2EA 1JT9A 2WTAA 3HKDA 4QSMA 2GZMA 5EOVA 5K6AA 2OCKA 2JKYA 4DLXA 1MKYA 1YIAA 3DBLB 1LW7A 3B9PA 2XQJA 3AFMA 1Z34A 1Z39A 3ZQUA 2WJHA 5JC8A 2XYHA 5JFOA 3LAWA 4FFVA 1KNQA 3ILSA 4XFKA 4NLLA 5K0ZA 1YBAA 3RARA 3C6YA 5DB4A 1HNZB 5AVTA 5KO2A 4XASA 4XXHA 2RGEA 5BW4A 4YUAA 3G1UA 1JL3A 4MCHA 5AO9A 4IHKA 4U7DA 1ZR4A 1MABB 3UVEA 3KQYA 3HVIA 1M6NA 1D9XA 4O2LA 4MV8A 4I08A 4PZUA 2FCRA 3WYBA 2OD7A 3ABZA 1QIIA 3PFIA 4J0IA 3FPFA 1OU4A 4O02B 4PIVA 4IX1A 1FK8A 1XMSA 4AKHA 3RFVA 4DBZA 4XWAA 4ZAZA 1EB8A 1O9BA 1D2RA 2R3SA 3GBVA 5F4ZA 2O6LA 4ITUA 2QJOA 2VDNB 1NBWB 1L5GB 1YB2A 2KWIA 4Z49A 4RULA 1F2UA 2QN3A 4NMLA 4Q34A 1A4XA 4AZWA 2FUEA 3L9XA 5BWCA 3IIJA 1UEIA 3MTEA 1KU0A 1SUAA 2DE0X 4ZAYA 4CIVA 1PZFA 1LVGA 2LXNA 2BSXA 3WIEA 5C4MA 4DTCA 2B0CA 1ABBA 4ZEOA 5CFLA 5J5AA 2Y9MB 3OTIA 1D07A 1I3NA 4BFCA 4ND5A 5IU6A 1EK0A 4Q3LA 5LA6F 1T4MA 2V7BA 2YTZA 4ZAXA 4JOQA 4LXYA 5I6DA 2H1OA 2NTVA 3HDVA 3Q3IA 3WAGA 3A37A 2P2NA 2YOGA 5ERGB 3ZHSA 4KE8A 2NYUA 1JBQA 2O0LA 3KJIA 3L4KA 2V74B 4C7VA 4EJ0A 1I2ZA 1EGVB 1GQSA 1S2GA 1T2DA 3D2LA 5T5QA 4XWYA 1JHQA 1VOTA 4ZQGA 3O1IC 3JQGB 3RTGA 4FDAA 1P18A 3EWAA 1M8GA 1W5FA 3FDFA 4QUIA 4IGAA 2C95A 3CB2A 4X97A 4YAJA 1XQVA 5JMPA 4FC6A 1A9RA 3OPYB 1QM5A 2QQ5A 4M55A 3CUTA 2ILVA 4YRJA 4LZJA 1ZKMA 1MX3A 1PE0A 3GQVA 2W2KB 4HSEA 3WYDA 5A5DA 2C3OA 3ILVA 1ZISA 4D6YA 4AZVA 2EG9A 2EIHA 4ZCIA 1GNPA 2OCAA 3K8ZA 2HHJA 5AHRA 1QCCA 5B6PA 1PFWA 1GZ7A 1HETA 4JP1A 1QU2A 4HUJA 1HY3A 5LJLA 3RVQA 1QPZA 2UVDA 2CVHA 1IEVA 2ZYVX 1G63A 4A10A 4IH1A 4UNPA 3LWNA 3UKOA 4PNPA 2VAMA 2XZPA 3W8FA 4BOYA 2BHSA 4NHOA 5B4TA 4QARA 5CMLA 1SG0A 2W6PA 4JT4A 1RMTA 3MD0A 3LZDA 4CJXA 2WQ6A 2BHLA 4N76A 3L6RA 3GIDA 1LLQA 5AXBA 5EHIA 3I1IA 5IF3A 1QNLA 4DMFA 2ARKA 2I6TA 4I36A 3OIYA 2ONYA 1DJPA 2EV9A 3RUIA 3N0TA 1V25A 1BW9A 4NE9A 3IMCA 3HL4A 4DLTA 3HKCA 2OD2A 3EZ7A 3L7BA 3ZVLA 2V6GA 4D9IA 2AK3A 4PCAA 4WKPA 4E4YA 4CCAA 3CNBA 1SC6A 2ZI4A 3IBCA 3NVKI 3Q2OA 4OQXA 4P4GA 3K9BA 1CT9A 2VDJA 2YMLA 2YW2A 1GDHA 3FVVA 2F00A 1DJQA 1U9JA 2VK1A 1Z2DA 3B3JA 5AKXA 4Q4AB 4UFOA 3GCXA 3T52A 2WSMA 2WMNB 1G8AA 3NZEA 2H4HA 2EQAA 2C1EA 3GRPA 3OQPA 1XFDA 3TFQA 3INYA 3TMAA 2DFLA 3ITNA 4LYEA 2PUHA 2EWWA 4H7JA 3A3OA 3H0KA 1UC4B 2Z5VA 4HPXB 4J76A 4US1R 4WI1A 5KOJA 3AY7A 4UXJA 3LBFA 5LA6B 2GM5A 4KYUA 5JIBA 2IH5A 2E48A 2P7IA 3GAMA 5A9SB 3EOZA 3DTVB 3NDPA 1PR0A 3KWLA 1D1SA 1PRYA 3WRYC 5K8IA 2C2BA 1VJ5A 5JH7A 1X1SA 4DSNA 4Q9IA 3ZNQA 4KQ1A 2ZAGA 4S1NA 5BW8A 2MMCA 2X1HA 1WKBA 1CEEA 2PZMA 1GAQA 3T12A 1BXGA 1FFEA 4KK4A 1A4IA 4HQ0A 1PG2A 4RJTA 2GDZA 5KVSA 4ZEVA 3NWOA 1GXSB 2BE9A 5EQJB 3E7WA 3EZ9A 1IONA 2GFIA 3BL6A 3V3TA 2F9MA 3U7RA 1E5TA 4ZCRA 2YRWA 4KSYA 5H9WA 5BPHA 2JH3A 3IIEA 4I66A 1G16A 4U4AA 1OSNA 5K8LA 1H22A 1X7DA 4Q4JA 1CUBA 5ED0A 5JS2A 3HPRA 1M1XB 3CINA 3EDCA 4PLHA 1AOXA 4QTTB 4RM2A 4AY4A 2GA8A 1FP1D 1H6BA 4AJHA 1T8TA 3AX6A 3C24A 1Y4AE 3D81A 1HZJA 1SBNE 4C0BA 4S05A 5H4GA 3A27A 5JWHA 4HN4B 3RVMA 3W2HA 2AG0A 1QO9A 4UDYX 5DBGA 5FD8A 1ZJ5A 3GZJA 4CTOA 5JD6A 1JA0A 3ZDZB 2BV3A 2Y99A 3UICA 2BM9A 1L5HA 2GAFA 1EX1A 3OTWA 4ALNA 3N2KA 2R7LA 4KDEA 4L4XA 4RKYA 3OT1B 4TSRA 4UCWA 2Z6UA 2C5GA 4OAOA 5AJHA 1XZ8A 4BNGA 1GYRA 3KQPA 3PHCA 5E1DA 4DCGA 2OK7A 3KQVA 5A62A 5HXAA 1JJBA 3X1ZA 3AM5A 4CCWA 4UNSA 1N33B 3EBPA 4QRHA 1ST2A 4C3ZA 3M4XA 2O5EA 4YT8A 4MUGA 5AOCA 5JSYA 4AYXA 3IAAA 2FSIA 3ZPXA 2VJPA 2ZRMA 4MGIR 1ACMA 2DUUA 1AO3A 3AGPA 1WHTA 3HH8A 3NTUA 5JCOA 4JWTA 1VB5A 2CV0A 3DQPA 3FF4A 3L7JA 5BSWA 3OJFA 3WLEA 2DTDA 2DETA 4TWRA 5EE9A 4AURA 2F59A 3INGA 1QYVA 3PC6A 4RK0A 1FZTA 2QTZA 5F7JA 1SUSA 4EZBA 4B6SA 2PKCA 4LC1A 1H3EA 2FZ4A 1KKUA 3UMSA 3LLMA 3W1VA 4UTOA 4ZI2A 3PVCA 2WKPA 4CQMB 4ENSA 1OXVA 4CF3A 2OAP1 4A36A 3STHA 4JI7B 3MQ4A 1RW4A 4H6WA 4FZ3A 5FPHA 1M7HA 4WKCA 2ZITA 4N9WA 4NZNA 4JI0B 5D2CA 2CY0A 1UKBA 5L3ZA 4U7PB 1T35A 1E96A 2YOFA 2O52A 4G4GA 3U4AA 1AGYA 1Q3KA 4QOFA 4U9UA 3E2MA 1ZHOA 3AP2A 4PG7A 3E3LA 3RAEC 2YQ4A 2BMFA 4FGZA 4BLTA 4YUVA 4G9BA 3F3SA 5NULA 2A35A 3WHPA 2NUPB 4Q7KA 3IE2A 2W8ZA 3T3PB 1CR2A 2WTBA 3BE5A 4II3A 1U3TA 2C8LA 3KUCA 4L5CA 4UATA 3Q0IA 4AT1A 2ZVPX 5KJFA 4X1IA 5LQDA 1Z2EA 4DIFA 4BRZA 2F9FA 1MRZA 3OIDA 2V7GA 4ARAA 3H18A 2Z83A 4LISA 2H2HA 1YVUA 3H9GA 3KB6A 3GRKA 3VSCA 3QPBA 4LJ6A 1JDUA 1ZCFA 1NKTA 1SOVA 2WG2A 2R48A 4FMDF 1NKVA 4GU5A 2R8EA 4W5TA 2IY8A 4KQ9A 3UK6A 4HX2A 2FA9A 2ZYRA 2ZGVA 3QVOA 5DGTA 1VSQA 2XW6A 3CCCA 5I7EA 2NXJA 5EP4A 1VCOA 2VF4X 1WTCA 3B3QA 3SR3A 3OX3A 4WA7A 2X3YA 1LF0A 2B9EA 1AC5A 1J56A 1LLFA 2Q9AA 5BVHB 1EUCA 1I1NA 2YX1A 4N8SA 4MVJA 4BO7A 1LSJA 4A0GA 9MHTA 2MYPA 4KH1A 2NYVA 3BWDD 4REQA 1YRBA 2G72A 4MV9A 4ID9A 4RPGA 3O3MB 1KI3A 2E7ZA 2P9FA 4ECEA 5HX7A 1K88A 1MZVA 2LPMA 1NX9A 1GRNA 4M49A 5SV2A 1NUPA 1LU9A 3H4VA 1GNVA 4J91A 2BIFA 3D8BA 4UZFA 3TUJC 2HSWA 3Q7TA 4KO1S 4D3XA 5AVSA 3SVLA 2QBYA 3PQ5A 1KETA 5G1OA 2QN2A 4N03A 4M9QA 4L57A 1SHUX 2D00A 4MTLA 4XR4A 1AJEA 2YMMA 3KKLA 1AVTA 4HDSA 1V39A 3BD6A 2DERA 1U2RA 4B4VA 4JYCA 2JCGA 2ORED 1COZA 1XLWA 2D62A 3OOJA 5EZ6B 1H9BA 3L6BA 4UOZA 1E5QA 3GFRA 2H1VA 1FDUA 1GM5A 4PPGA 3H05A 1ICEA 2IYTA 3CVJA 3LLVA 4BQEA 5FL7A 1MT3A 3IJPA 1PSWA 1Y37A 4IIEA 5KQRA 1PFKA 1H3FA 3RFUA 5BSUA 3FOFC 1Z8FA 2TSYB 3LXXA 2FSVA 5KNBH 3EGEA 3FFXA 1P9OA 2XBUA 3QXGA 4IO1A 6LDHA 3HCCA 3SICE 1DBPA 3V4ZA 1N7JA 1B76A 2P3SA 5K7SA 4XCVA 1YCGA 3D7LA 1CS4C 1S2IA 1XZIA 2W93A 2ZI9A 4UPVA 3RV3A 5CDUA 2PSDA 4IFIA 3JD1A 2KM1A 3QIAA 1U0RA 2F3SA 2Q6LA 3GFPA 3IJRA 4KBGA 4JA0A 2NUAB 3T9DA 3CPSA 1ACLA 2I2FA 1MJHA 5HBRA 1VZ2A 3VX3A 2PH1A 4MXDA 4CMHA 1MB2A 3EEQA 3FOCA 4YX9A 2E0IA 1CZLA 2I8LA 1V95A 2XRFA 3LVBA 5FOWA 1H85A 2GNAA 2COKA 2ZLBA 3A3PA 1VPEA 4XGKA 5F51A 5K6RA 5ALKA 5B3KA 1E2KA 1YZKA 1TQ2A 2P8JA 5LU8A 3CNEA 2ZI3A 1G1MA 3OY7A 3PKIA 1T3GA 2QTWB 2OQRA 4GS5A 4LG1A 3ZD8A 2B94A 3E5HA 2KBFA 2ZDQA 5EINA 3MC1A 1E6UA 2A5DA 3V9AA 4LJRA 3G59A 2G08A 3G5UA 4POAA 1D8TA 1C3LA 1L5ZA 3RS8A 3TQSA 2BZ1A 2AEFA 2LNDA 3ZGVA 1U9IC 3MINB 4JDPA 4O1HA 1GZVA 3DO8A 3GLGE 2Q50A 3EXHB 4PYIA 4JQSA 1TTPB 4YQZA 2HK8A 4IXNA 1P2DA 4RKWA 5ECDA 5KI6A 2VJOA 1QX4A 2Y1KA 5I01A 4GVLA 4BPBA 1E7RA 1W581 4A2PA 3SR4A 1GCOA 3KB1A 2JPDA 3GJ5A 4H1HA 3UN1A 4OV6B 4DT1A 2EP5A 1KZGB 1NN5A 3RGGA 2WUGA 4EP1A 3D5QA 4ZVSA 1ODKA 2VS1A 4Y6RA 4ZC8A 2ZSHA 3BHNA 4QIHA 4B32A 2JKZA 2OAEA 4FWIB 3WB0A 1KAGA 3EVFA 4LXQA 1KBOA 2A5LA 1RRKA 1J0EA 3EVNA 4YLYA 4RJLA 1Z16A 1VLHA 1UPBA 2EC5A 1NBEA 2PKXA 4MKRA 3HB7A 4R1PA 3YASA 4J0JA 3H6HA 5M34A 1L7VC 3KYCA 3BHJA 4F6LA 5BXYA 1WSAA 1PZGA 2ICAA 2DFPA 3OJEA 5EIBC 1E6LA 3FWYA 4CL8A 4UUAA 3KR9A 4BY9E 2H7VA 1XDZA 3NP9A 1AHIA 1YR9A 3FNIA 3HCEA 3LK6A 5TEWA 3UWOA 5KTOA 3ONWA 4EHFA 1EK1A 4DLKA 5C5DA 4R2MA 1E1DA 3PQ2A 5E2IA 3CUVA 1TC1A 4C0AC 4MLZA 4E5MA 4Y2PA 3I62A 3CH4B 3DXZA 1JMYA 5B3JC 3RFCA 8OHMA 4P36A 2A1UB 3UTCA 1P61B 3PSAA 1PEDA 4C76A 1FTQA 2ZRGA 3AP1A 4KK3A 4WVFA 1FBNA 1PI3A 1CNMA 1G55A 2OTCA 4GWKA 2NSJA 4XFJA 1Y7LA 4H31A 4CQLA 1DCTA 4L0MA 4BKPA 4EI9A 4YPOA 3STXA 5MF6A 4LYFA 4Q4JB 4RD6A 4X71A 1BCSA 3KQTA 4GGPA 4ZOEA 1ADFA 2MMGA 4FSXA 5GJVC 2FN3A 4AS1A 2B4KA 2DUJA 2HSZA 1CSEE 1XE3A 3DKIA 4C6TA 3QVXA 1NJ5A 4CL0A 2MIIA 3MGKA 4Q7EA 4TQAA 5AJXA 2OPBA 2AE2A 3EVZA 3QU7A 5LZ5A 1V8FA 1WRBA 1BN7A 1ADJA 3ESCA 1G2IA 1A27A 1JDVA 2Q8NA 3NH6A 1N6IA 4PNEA 2PLAA 3DMPA 1RP1A 1TIPA 2PANA 3VDXA 4EECA 2XCTB 2V0GA 3I92A 2F9LA 1SCNE 4GMHA 5KNBA 2LV8A 1ZQ9A 5D3MA 4YAIA 1J07A 1NAHA 2I2XB 2LCQA 1H66A 2NV6A 4C5AA 1C5KA 1I0ZA 5KU7A 1VSUA 2GDJA 4DW8A 1O0CA 1TJPB 3TAUA 1H4TA 5KC8A 3UJHA 5FNVB 1J97A 2NQ2C 3L8EA 5BYKA 2P9QA 4DLLA 3GLGA 3DKPA 5G0SA 1UFVA 4OHPA 1XQXA 3IL2A 3CRZA 3IBGA 4TM8A 3UO8B 3GRUA 1DDOA 1NURA 3KOMA 4MRPA 4RE6A 3MBKA 2H9IA 3IR7A 2OECA 2EWVA 2B8EA 2X1VA 3IUNA 5G0WA 4MYDA 4TS4A 1V9CA 1EX7A 2DJIA 3PX2A 3QPCA 5EI5A 4DVGA 4F8YA 3EOAI 5EFZA 5AKYA 4NZ9A 3WLIA 1Y5NA 3GG2A 1AB5A 1PD0A 3MTGA 2CVZA 4UUBA 4QBHA 1H2ZA 2B8JA 3X2EA 2WU4A 3SXUB 1KSGA 1IQ0A 2VHUA 5CFNA 3I05A 4LK2A 3ZXUB 5JI3E 4IR7A 1HKUA 3W6UA 3G17A 3AHEA 1GTL1 4C3UA 3K9FC 4BWVA 1N2OA 1PZHA 1G18A 2HQSA 1FVHA 2QRKA 4G6ZA 4RZ3A 3VC2A 4J1QA 2EKDA 4TM7A 1I3MA 2YHBA 2GETA 1AB6A 2VHXA 4YT4A 3DVRX 2Y1OA 4F38A 4GDFA 1JDNA 4YA6A 5E6UB 1P7PA 1FJ2A 2F90A 1GT6A 4LSWA 1L7DA 1XNQB 4Z7JA 4WZZA 3FPAA 4QUGA 3N8KA 3G2HA 1T9ZA 1U2ZA 2PBFA 1YU9A 2WF7A 4Q6BA 1X14A 2E87A 1ZM2A 2GAIA 2ZYAA 3OP4A 3OQJA 4LWQA 3USZA 4DDKA 2GPSA 3FHTA 2F3TA 2MINB 1GRVA 5FLEX 4PLZA 1B23P 2IOQA 2V59A 1O89A 2HEIA 4BNFA 1T3LA 3FLMA 4HNHA 3P32A 4W9MC 3L8FA 2PMDA 1TQ4A 1L7PA 3OLVA 5KDDA 1X7YB 3CLKA 4K9DA 4F9GA 4ZVPA 4W6ZA 3STWA 4X1IB 1FDOA 1IXKA 1QR6A 1P2UA 4IOMA 1U04A 2PUVA 3M3DA 1TTHA 4HLUA 1WOMA 3H87A 1XKXA 1YFKA 4FYVA 2N0SA 5AHXA 5BMOA 5EMMA 4JI5B 1FYFA 2ZZKA 3G2IA 3VJLA 4M1KA 4ZI7A 1T5DX 4EHJA 2P5UA 1F2TA 3EGXA 3QBJA 5LZ2A 4FFBA 5IZCA 4Q1DA 4D26A 3RUDA 1SVMA 4REOA 3OJWA 3ADDA 3NWBA 4Q00A 4B7CA 3HU2A 4OJMX 3CX4A 2P6PA 2QQ0A 2TMYA 2EL7A 4NYIQ 4Z4QA 3SQLA 2ZE8A 2X6QA 4E4TA 4E94A 5DN6D 1ZUNA 1L7QA 3U6KA 3L4EA 2JAUA 3IPXA 4FQ5A 3DV0B 3G9UA 3C4VA 4JVOA 3V3KA 4CTKA 4IUCS 2GPBA 1XEWY 5JSFA 1OIXA 1G42A 2DCMA 2PU7A 3CURA 2F1KA 4YRCA 3TAXA 1JR3D 1K5GA 2QU8A 3KSUA 3NHPA 3WJ2A 5IDQA 3ME5A 1OTYA 3V4SA 4G5RA 1H69A 3ZU5A 5G53C 5ALJA 1XJWA 3WJAA 4B33A 5I9NA 1W48A 4NOLA 3K0KA 2QWXA 3COSA 4TOIA 4MWBA 4RTLA 2JGFA 4YB8A 4NEQA 1TX4B 5KSPA 4JR1A 1I7DA 4TRNA 5H16A 1KMHA 2F3PA 2V5VA 3PQ7A 1KDZA 3H42B 2NTYC 3QEMA 3OFNA 1W9HA 5K0EA 1GYQA 2C3UA 4DYDA 1HMYA 3HN6A 1CY6A 1LNQA 3BGWA 5ILQA 5B4VA 4OBEA 2HGSA 2PQ2A 4MA5A 1ZH0A 1TT5A 3TVTA 4PEVA 3AZPA 1LCIA 3OWHA 1GAJA 3BD8A 4F3CA 5CT9A 1NFQA 3PDWA 3LBIA 3K5IA 4R1LA 2FQYA 1R6VA 7GPBA 1BDJA 2X58A 3B8HA 5JDIA 5J1SB 3D6FA 5J1TB 2XD4A 5LJIA 3AVYA 5BWNA 2FJUA 4MVJM 1WVGA 3CONA 3BQMB 2IYSA 4OY3A 4WBNF 3RUAA 1NRWA 4X1YA 1P31A 1FNDA 1OQAA 3PPXA 2JD2A 4IV5A 1BWRA 3JTMA 3L9WA 1H2EA 1UAAA 4U2BA 4ZQIA 1MH1A 3DT6A 2WPDD 2YV5A 4R3UC 4UM5A 3CRRA 2FEAA 1NMXA 4UDOA 5FBRB 4E2XA 1BGXT 3AKDA 1V26A 4IEIA 1XN1A 2BKXA 1PEYA 3BJIC 2ETVA 2FE1A 4V3BA 2JHAA 1KGSA 3GPDG 1RIFA 2C31A 5EAIA 2VZ9A 1VIVA 4AC9A 1XU7A 3MWKA 4OXIA 1M6VB 3IP1A 3AJ8A 3FVQA 3URKA 4AMYA 3MWFA 1Y3DE 3ZN2A 4BO4A 3ZW8A 3JSAA 3IDQA 5KSZA 2E4AA 2I3DA 1JX6A 1RBZA 4B84A 3TF5A 2MSNA 1DP4A 3ECAA 2VWQA 1QU3A 4CIWA 3T1YB 2FG7C 3SKYA 3G23A 2A0FA 4WAUA 1PO7A 3B1KA 3D4LA 3DW1X 2C5FA 3DBRB 2H0QA 4JFAA 5CGQB 1DSSG 1SG6A 5LA6A 1UT8A 2GA9A 5AW3A 5ER6A 5JRJA 2GF2A 5IJ9A 3WOVA 2NVBA 4DR7B 4NJOA 2VLIA 2QTTA 1RHKA 2BEUB 1G7CA 2NZ2A 3NH9A 5IS2A 4QPZA 1N6KA 3ONEA 5T6BA 3QI2A 4BLPA 1HL3A 2O2DA 1DBWA 4YP9A 5K8VA 1UANA 4RD3A 4YMSA 1QC5B 1UMCB 5ICMA 4KPFC 3GVIA 2GERA 3IHKA 1EFVB 2HQRA 1B2LA 4G5XA 2Y93A 3MLBA 4FWBA 4RAOA 1GCAA 2IWRA 3ZU3A 4YMTA 3WLRA 1KWGA 3JWJA 3HCRA 1HTTA 2NXWA 1SZJG 1C9DB 4U7GA 1RIIA 3KQHA 1JEDA 3WGHA 1HORA 4YT5A 3WDKA 3PL1A 2R1TA 4EYOA 3AEQA 4DY4A 2J33A 1PD1A 1FJHA 1J2YA 1M8JA 4MTCA 4X44A 2ODNA 3KB8A 5CFRA 2BUAA 1JHOA 2FXVA 4NV0A 2ZOSA 4C5CA 5JJIA 4XKJA 4AXBA 2AW3A 3I2IA 1F06A 3GJZA 3GGJA 1WPXA 2KE5A 4NYJQ 5AHOA 4RENA 3TVYA 2XZLA 1A9TA 3AUTA 3DOIA 4KQJA 4O1MA 3S4YA 1KVSA 2XT9A 3ROXA 1B0ZA 2VP9A 2X4LA 4UVEA 5ERYA 3RRJA 4M8LA 1NBOA 2FYTA 2QD4A 3RSCA 2NSDA 3FZEA 2BMJA 1RHQA 4NBLA 3T3GA 1N0UA 2VYNA 2WAYA 1L1QA 3ELWA 1NMSA 2Q27A 5J5CA 3V8VA 4YXFA 1EVJA 4WCDA 3WNQA 3VH3A 2SKDA 1E6CA 2VQSA 2E4ZA 3PIRA 2C7GA 2ZWPA 3F9RA 3RT7A 4DBLE 4DWJA 1X9GA 1CV2A 1J1UA 1KVRA 3PEEA 4Q1AA 1BRTA 4HEQA 1CDDA 4YCBA 4W1QA 4LSZA 1L7BA 3ZLBA 2GWHA 1PJQA 5KTTA 2I4TA 3G85A 5DI9A 3V7WA 2BDTA 4LMRA 1PJRA 1CUZA 4TQ9A 4XVCA 1D04A 2QJWA 1XIVA 4P22A 1Z6AA 1FUYB 1ZZGA 3K8QA 4ZVVA 4GD3Q 2WIKA 1ABEA 4AJ9A 1B1CA 3UUEA 2HI0A 2NO4A 4EJ6A 1Z74A 1J9EA 4TMXA 4RPJA 3S2ZA 3H5NA 1TJ5A 3RSZA 2HO4A 1I4TD 2WVHA 3AOEC 3GJ6A 3L7CA 4HATA 1JI0A 3TX2A 1A9QA 1O9GA 1NMQA 3BMNA 3E7DA 3V2HA 1A7AA 2PWPA 1Q7EA 1BN6A 2NXNA 2YL2A 4P7BA 2QJRA 4EF6A 4ZRDA 4LGYA 4LXUA 3PDHA 1LPPA 2B37A 3C43A 5IAJA 1Y5RA 2I6FA 2Z08A 2GAJA 4K8OA 1FNNA 3JW8A 4B47A 3HL0A 3PE3A 5JAZA 4HTAA 3VVLA 4HMOA 1B8UA 3QV1A 1YACA 1KERA 4ZOLB 1T4CA 3FNHA 3BIWA 4OP3A 5AIAA 1M1NA 2WWVD 2Q21A 1J33A 2W8BB 4OCZA 3R0JA 3E3NA 3UA4A 4EFDA 3MWJA 2N1MA 4TL9A 5CDYA 2ISQA 2M2IA 5BY2A 3TQTA 5KOHA 1ENPA 3OZDA 3PITA 4JJEA 3GEDA 4MS4B 3AJAA 4V3CA 3V1UA 1DEXA 2YBEA 3OA0A 4YO7A 1NVVQ 4RH3A 4V03A 4ON9A 2X6RA 2IYRA 5CDHA 1E8DA 2HRRA 2IUFA 2ZIWB 3CMMA 1A9YA 1XRPA 2NNWB 4IIXA 4N6GA 4E15A 3TXXA 3QF7A 3KEQA 5TQVA 3QRWA 5E7QA 1MO2A 2P2ZA 2XTNA 3E27A 1TM4E 3DHVA 4KGZA 4ZRMA 1NP7A 3IQIX 2C0QA 3K0EA 2FPIB 2RGRA 3IR6A 5M29A 5IM4A 1QIDA 4XIFA 3IQXA 3A05A 1YRLA 4QU0A 5ENZA 2VR1A 4DBVO 5C3MA 1ILEA 3WV4A 4NENB 3AWDA 1Y4ZA 1WCIB 2YWFA 3C3XA 3G1TA 2GM3A 4Q9AA 4CUZA 5B7PA 1IDOA 3CLTD 1MJ5A 4R1OA 1F8UA 1N2CA 4MLCA 5HG0A 5KPDA 3VC1A 1DJOA 2FFBA 2QAIA 1RWBA 2ZSDA 3HWSA 4TMKA 3K4QA 1SC9A 1K5HA 3T9BA 1E3TA 2NAPA 3BHIA 3BTUA 2FEOA 3F8TA 3HYLA 3FE2A 4TTIA 3P2EA 3DS8A 4XD7A 4I50F 3IEPA 5A0TA 1V47A 4GYJA 4EM6A 1M76A 1R9GA 1E2NA 4ZODA 5FBHA 2X8JA 3DA8A 1S2MA 1W1UA 1SZDA 4YMVA 1QK3A 4L9SA 2K7ZA 4XWWA 4GW3A 3C7CB 2ZPTX 1N0VC 3F1LA 3G5TA 4LNUB 3IPRA 4R1SA 4Q0MA 1DLIA 1UJ6A 4YCSA 5BOSA 1J24A 1W1WA 2XODA 3ZU2A 2D1YA 4WACA 2IFTA 5AK4A 3TO5A 4C03A 1F9EA 1D5CA 1FFXB 2HSJA 2J0VA 2MSWA 2XUOA 5HZMA 1GNRA 1DQZA 3EVCA 2W4MA 1ZI6A 1T5IA 4M37A 4LOHA 1GQYA 1XTJA 4DLZA 4E5KA 1QHFA 2LGJA 3RSOA 5C46F 1ECFA 2BGJA 4OYHA 2KBEA 3OY2A 4NMWA 2C8KA 5LDGA 4PC3A 5DOVA 1MRSA 1U8XX 2PVPA 2PZJA 2QS9A 2RCNA 3DE0X 4FYYA 3DONA 4E4RA 3DE7X 2XNCA 1CP3A 3LBHA 4Y3UA 4GYKA 2OXRA 5BSRA 4BZWA 1N2BA 3TG8A 1Y8RB 2NWQA 2WA2A 4Q15A 1JKJA 4IUYA 5HKKD 4QUDA 4JGBA 3PQ4A 1DNPA 4ME6A 4W5RA 3L7OA 4D81A 2WJAA 1FF9A 3H9BA 2ON6A 4U6SA 5TR9A 3UV6A 3ZZ1A 4EW1A 2CL5A 5GJWC 3GD7A 1FMTA 4JU8A 3SDZA 2ATVA 4MKHA 1ID1A 2A7XA 1BX0A 1VPVA 3F6SA 3PXUA 4G5SA 2H3EA 4RZ2A 2VTKA 2JAWA 1YSCA 4H1WA 2AXQA 4KPUA 5TPWA 4PICA 3ZGYA 3M6IA 3NNSA 1ODTC 4D4KA 3COVA 1NQVA 2PZLA 2BFOA 3D3KA 3L1JA 3P9QA 4PYQA 5F7ZA 3IUSA 2II6A 3LP6A 2D0OB 1O5IA 5EIXA 3I5YA 1N7IA 2ESRA 3N2GB 3I52A 3QA3E 4DXHA 4CF4A 4PYOA 1KWKA 2B1JA 3V4PB 4C0SA 1H2WA 2GCGA 2VP4A 5LSAA 3M6AA 1M2KA 3LG2A 4HHEA 3LJKA 2PNFA 4N5MA 4NI5A 4C7JA 4D4LA 4F06A 5DE3A 4WJLA 3W34A 3SIWA 3WKEA 1K6XA 3NTLA 1TYCA 2CDRA 2R6JA 3MN1A 3RVOA 4JI2B 1NDHA 1N1GA 1OC4A 1SHZA 4L3VA 4NYMQ 4C2BA 3UGTA 4KXMA 1EJBA 1K0UA 2CW5A 4M0EA 1WU7A 1NYLA 4DWWA 1NX6A 1NP6A 5AKLA 4ZXFA 2YWRA 4P4UA 4QG3A 1C7FA 1ZUIA 2W2KA 4KNVA 3C3KA 1LTHR 3U19A 3H3FA 1P8AA 3FI9A 1OF1A 3DBRA 4FR0A 1C81A 1ZM4A 2G0NA 3MJFA 3TQCA 1WCYA 4ERNA 2WKQA 2R1VA 4OQYA 1U6IA 1JYSA 4RIEA 5T4BA 3JQDA 3OEWA 1ZNQO 4KQ2A 2B21A 2ZJ4A 1KK2A 2D2IA 3CQ9A 4KDRA 4YDHB 5CA1B 1LBQA 1YS6A 2FR8A 1WB5A 4D9MA 1BIFA 1JPNA 2OB2A 1BVUA 2ZIGA 2FJPA 4I4TF 5D3ZA 2O2ZA 3WV5A 1F1JA 4KO2S 4Y0VA 2IS1A 1OYWA 3U7GA 2J8ZA 4RORA 2UUAB 1X92A 4HNRA 3GFQA 1E2GA 3QOXA 4BVAA 2QUJA 1BG6A 3H9EO 5KVQA 5TS2A 3W3AD 2QTVB 4ESOA 2JFFA 3X1YA 2H1SA 5T7BA 2XQKA 1V7ZA 2DPHA 5ILGA 3MILA 4ND8A 2WIGA 1QIFA 3PHIA 5JZBA 1BWQA 5T67A 4ER3A 1HG1A 1HZZA 5LMNB 4BMPB 1FSFA 2SHKA 3UFBA 5IWAB 1NBMD 1QNFA 3ABQB 4CBVA 1U0BB 3GA0A 1P9WA 4NBKA 2C04A 4LRTB 5TQ2A 1PF7E 5CA0A 1NLMA 1A76A 2PXXA 3DVAA 1MMFB 5AI4A 4CYMA 1QLJA 4QX6A 3OBIA 3P26A 4ALJA 1KP9A 4BLVA 4ZJZA 5AW0A 2WWIA 5I47A 2PO5A 5EJ5A 1E1MA 2FU5C 1T1GA 4BNXA 4CM9D 2ZVDA 5SY9A 1AMNA 2X8AA 4V2UA 3H8WA 4MPJA 1B42A 4RZHA 1OZAA 4Y2XA 1U2DC 3Q10A 4M0LA 2A5JA 3M9LA 5EJ2A 5HF9A 3FIUA 3ENVA 1GKYA 1F20A 3RTEA 4HNAA 2GRUA 3I8SA 3KWFA 8LDHA 4EMTA 2UZ1A 5TDHA 2QROA 3EH1A 5HGXA 4HYTA 1TDJA 3DTVA 4QPNA 1H4VB 3AZQA 3OCCA 1I2DA 2IDKA 3R4VA 1VGQA 4JJ4A 1M1UA 3AMVA 3E22B 3FTPA 1VIYA 2Z56A 3BXGA 3OM1A 5GJCA 3UJBA 3ZX4A 4CM1A 4EB6B 2SKCA 5KTRA 2IS6A 1XG5A 4EPXA 5DU2A 4J7UA 4CKZA 3GN2A 3K32A 3TZBA 2F55A 4CGYA 1FTGA 1N0WA 5I5GA 1P45A 1R37A 3GNSA 5C51B 3TW0A 1G6KA 4DADA 2WP0A 3S1LA 1NUTA 3BDVA 2BFEA 4MZXA 4XH9B 2BMAA 3QXHA 4DBLC 4ZCTA 3V4OA 4RSGA 5I8PA 4KTVE 5KQLA 4GWGA 2OXEA 1Q7BA 1RLIA 1TQHA 3TNFA 4CUJA 2ZRHA 3ZY6A 1K68A 1WWKA 2AGVA 1X9HA 2P9GA 2YFYA 1CY1A 1KH1A 3E3OA 1XZGA 4KMSA 1CJCA 4I5FA 1SHLA 1U28C 1ZMRA 4K9KA 3PHGA 5JROA 4LJKA 2FW8A 3VSDA 3C7TA 1Y0BA 2Q4BA 3C8HA 3I3SR 3NHBA 3PUHA 4UDNA 1FQWA 5DO9A 4F3YA 3JYHA 1T8YA 1QK4A 2F1HA 2BFAA 4M46A 3AF5A 3VVCA 3OEHD 4F2WA 1DADA 3IUPA 4MW6A 1R74A 3W5BA 3S5UA 4UTVA 4UHBA 5E9WA 3PNLA 1UXGA 1U90A 4GRIA 1TEXA 4JOBA 5LD2B 5EJ8A 1HDZA 3L92A 1CU1A 2IW1A 3IGFA 4LRQA 5C8YA 3KL2A 3NHAA 1JLLB 2ZRAA 2ZG6A 4B7UA 1E7QA 3L0DA 2Q7XA 1WIWA 1M5UA 4CU5A 1GKKA 3IBYA 2DH6A 5H70A 1A9XB 3P0RA 4II7A 4K6OA 3NHWA 5FX2A 1NW8A 3BA1A 3TLEA 5LBUA 4X93A 3RH0A 4XRGA 4TVBA 1V11B 1EVIA 3U4IA 3QJGA 7MHTA 4M0PA 1LY1A 3QVKA 1ZVJA 2VYVD 2MT9A 1VBFA 3WOHA 2AYYA 4A0SA 3AVPA 1TK9A 3EZLA 3ILHA 4ATNA 4EA7A 4KG7A 3NYWA 3IEMA 3OPQA 2W6ID 1P1IA 4OQPA 3TBFA 1ZNYA 1U5CA 2QW0X 2X3FA 3W3AA 4DS3A 3R7WB 3NGMA 1KDOA 4X8MA 2JJMA 4QJ3A 5JCJD 2VF2A 4FZJA 1D4FA 2BMDA 3WQQA 4CUKA 3AUUA 5C9ZA 2J5XA 4KXFB 2XXBA 4FFMA 1BQEA 4CM8A 3U7EB 4WHMA 4L0DA 2L17A 1OYOA 1MQAA 3PXGA 3UJ9A 3QPWA 4OHYA 1CUUA 1Q11A 1DE0A 2OAGA 5H82A 2FWMX 5F9HA 1C7JA 1PGQA 3DD1A 4MUFA 1SUCA 1Z0JA 4GVPA 4YVFA 3TM5A 5KHLB 1C0LA 2N1BA 2Y0PA 2CLSA 1KPIA 3CKLA 2G7ZA 2OOKA 4QNRA 3FBWA 5FV4A 5HJ5A 4OLBA 1CE8B 4AG5A 5EMNA 4ARZA 2GZHA 5IAAA 1XTQA 4GLOA 4AQDA 1PG0A 4ZYLA 2Q45A 2X7XA 4L8GA 5AXAA 4C6HA 4MSUA 1X7WB 1ZITA 4FHFA 2WB4A 2FLWA 2MR5A 1ZKDA 2JBWA 2QTRA 4GG1A 3ETDA 4LNUA 2O2CA 3VRHA 1NU6A 1SB9A 1ZA1A 2JD1A 3K5PA 3MUOA 1Z18A 3RC7A 3HSKA 3CJTA 3GLHE 3UFXB 1K8ZB 5TY0A 1PL7A 2OO3A 2W22A 1Q1GA 3QUSA 4G1BA 1QKJA 5CLQA 1YMVA 4GR5A 1ODIA 2OBBA 2OXIA 1DC5A 2SECE 2QD5A 3TSAA 5HKLA 4A26A 4O5OA 4LHEA 2VIIA 3O8NA 1VYTA 4KE7A 1XZJA 4RLQA 1R0RE 1X80B 1YQ9A 1VBNA 2NV0A 2OO5C 3CO0S 4AJLA 3IR5A 4B3BA 5HJEA 3HXMA 4WFKA 1Q7TA 2P9JA 1HDIA 4RTOA 2PX6A 3FRIA 2ACVA 5C53B 3O47A 4QOIA 4OIFA 4DRZA 1JKJB 2WWRA 4Q21A 3RYHA 4G25A 1F6WA 1IOZA 2C4HA 1JT2A 3C7DB 1T34A 4HFJA 3K0CC 3AM3A 3EUFA 2B69A 2Z8YM 4Q7LA 1CY2A 1H42A 1NSTA 1OXBB 5I9MA 3SBOA 4QAQA 1W49A 1SKBA 4HI0E 5FCDA 5AOBA 4TV8B 5C3UA 3GVXA 1G21A 1JH9A 5JS6A 2V6BA 5AXCA 4Q4HB 2HBQA 3BCRA 3CYFA 2D4HA 4PO3X 3LDAA 1YASA 4TKZA 3Q7EA 2FSGA 1ISFA 1HE8B 1R8XA 4OQ4A 3FJ1A 3A25A 1APBA 1MW8X 1E5LA 5CVUA 3JQAA 1W5SA 2D3TA 2Z8ZA 1K3TA 1TM5E 1VBMA 2ZUWA 3IIIA 4MV0A 2BGKA 4M6WB 1ZD4A 2B35A 3LX8A 2NO5A 1UP7A 4YR7A 5HMLA 4Z4EA 2CNNA 3E70C 3F4LA 4J0HA 3N3BC 4LFCB 1AA6A 2J5QA 3GJYA 3G8DA 4AZ3B 4CF6A 4CHGA 2WIAA 3D4BA 3CWZA 3I23A 1XC7A 3AHFA 4JB3A 4JWKA 5JRDS 2IBTA 5AM4A 5TGZA 4K9SA 5DTEA 2W2OA 1RCTE 1YQEA 4G0YA 1IJBA 1CJKC 1CQJB 4U7FA 2ZIUB 4J0EA 2NP7A 2YFQA 3P0IA 3TINA 4DY6A 5JH7B 1NBAA 5IWCA 2XIJA 4XLLA 2NU8B 4TKMA 5AUNB 1WTAA 1YU6A 3A3YA 4L15A 1T10A 1XRQA 3ADOA 1TLLA 1N57A 1PL6A 2IOFA 2XAAA 1U1FA 4OB6A 4TTAA 1HFJA 2AEMA 4QA9A 3PD7A 4JVLA 3B53X 1XEAA 4M8KA 1VKZA 5ELXA 3TECE 3HKBB 4HV4A 2QHXA 4M0DA 2C59A 3E1GA 4IS2A 3TBKA 3WZ2A 2LIPA 4YV0A 2NQTA 3NVDA 4D9BA 4X20B 1N7GA 1MO6A 4EO4A 1Q21A 1THMA 4B6PA 3NTRA 1Z0KA 5L51A 3QQPA 5CA1A 2WHXA 1KSHA 2YV3A 4I50A 4IJWA 1UJMA 4R1NA 3TOCA 1AUVA 1EG7A 5EPOA 1XXHA 2LZ0A 1E4YA 5JCJA 2ADOA 2BDUA 1C9MA 1SU7A 1ONOA 5CNKA 4UE2A 121PA 3OX4A 1TJ4A 4CM4A 4G86A 4RU1A 5EJ7A 3SHVA 3CLHA 4ABYA 3F4KA 5L6MB 1B41A 2RH9B 1L5HB 1DHRA 1X1DA 2PMEA 2RGNA 2QX8A 4IHAA 4CLOA 3FOWA 2FPSA 2PWBA 3EISA 3IHTA 1M2HA 1PAUA 4KN8A 4DVJA 1K89A 4H1VA 2RI0A 1N75A 2BKLA 1EWTA 3PRKE 2C7QA 2YZKA 2QTFA 3VR0A 3NUQA 3NORA 2ZUVA 3IUEA 2CF5A 3CNHA 4L16A 2A6PA 4HH0A 3ZCRA 4YS6A 1PV2A 2OFFA 4ZO9A 4Z9BA 1QV6A 3EX7C 4AO7A 1YBVA 2GEBA 3ZWPA 4AX4A 3DLHA 4X8OA 3WWCA 3EIWA 3JY6A 4UARA 1YR2A 2JLYA 3KFVA 2WD9A 3VVBA 2YXPX 3WGVA 1XYYA 2A57A 1NVEA 2VNHA 1GGHA 1POWA 3OLQA 4JNKA 1GZHB 2HDWA 4Y30A 1E3LA 5CPFA 2F48A 4BP1A 2G76A 1UDRA 3H86A 3IE0A 3H4MA 3RT9A 4A0HA 2ZUFA 3ZHXA 3NHSA 3V4RA 2PS1A 5LVAA 1V37A 2BPOA 2GKSA 1GL6A 2W48A 2DKOA 2Z2ZA 3KKPA 4IEEA 4LRUA 5EUCA 2CBXA 2NW6A 3DBHA 3O0DA 4GE0A 5BUZA 4JXZA 1PR5A 5ALWA 3SJUA 3D4IA 4I55A 1PS0A 1XTPA 5C7IO 1RHMA 3Q0TA 1UM9A 2XTZA 4WFIA 1T6NA 4ZVLA 1OH5A 1IFXA 4RPKA 2EBFX 4GUAA 1I2MA 3WIVA 2ZK7A 4CF5A 4H3VA 1T5HX 1P1BA 1QSGA 4CQNA 1T5LA 1RR6A 2B7CA 2BC9A 3E05A 4DA6A 1MC8A 4Q1EA 3U60B 5ALRA 5TV2A 1W35A 1WBJB 1GPAA 3PDJA 1DXQA 1JTEA 5G2OA 5BVGB 4HLUC 4A8JB 2PUDA 1DHTA 4J4BA 1PWHA 2R8ZA 2PO7A 1G8KA 1AXGA 2C2GA 2IHBA 5DW3A 1FC0A 2Q5EA 3SC4A 3EIHA 3IOBA 3Q6IA 3R7LA 4XEUA 1KQFA 4FOLA 3GZNB 2GK7A 1YI8A 1WS6A 1D7OA 2DPMA 2HMTA 3H16A 5KX5A 1C3EA 3LSTA 3NAMA 3VPAA 1G2PA 4X8LA 1JAIA 2GO7A 4UU1A 4CT0A 1FW8A 4V02A 1IHPA 1BROA 5A06A 3H7AA 1JZQA 1M7BA 1PT7A 4GICA 4I1RA 4ZV9A 4D1YA 5K2MA 3EHDA 3U4QB 1TUGA 3T1NA 1B0UA 3ZGLA 1H2BA 1MX9A 2DTXA 1KDTA 1CHNA 4MUEA 4D3ZA 3OT5A 1JVSA 2HAEA 2FWIA 1SBIA 4RDIA 2QE7D 2HMSA 2XOKA 3SJZA 1ND5A 2OT3B 4WKBA 2LKCA 3X3HA 1XCBA 3RHFA 1F8XA 3P20A 4UHFA 3IQEA 2J0SA 1WCIA 2RIRA 2AG8A 4KIFA 3F6RA 4HDAA 1WF3A 2CXOA 5ARCA 1F3LA 4X3PA 4PLTA 4LOAA 4G9GA 5JD4A 3TW8B 1NBMA 1A7KA 3V6LA 1JEOA 2CLEB 3DCIA 1N5RA 2CHVA 4FYPA 3TBHA 3PR2B 3H2BA 8ATCA 1FTNA 2FPPA 4C4YA 4KQGA 3P4UA 3VAZA 3EVDA 1N5MA 2R5NA 3JALB 2I6UA 1FTYA 2GUWA 5I8WA 4NHEA 4AB1A 2WZDA 4TSKA 3JS5A 2A0XA 3GLUA 3VR2D 3I9V6 4PHGA 3V1KA 1NVWQ 4KB5A 4JXKA 2A4MA 1HQCA 3G5AA 4UU8A 2I7TA 4UULA 4BRUA 5LOVB 4KO4S 2Q5CA 2NU7B 3UXEA 3O2SB 1CR6A 1ONNA 1QF9A 1VL0A 4P4LA 2ZEJA 1PR3A 2KYRA 3HNOA 2ATIA 3T4XA 1NHWA 3EG9A 3DHWC 3NVMB 4KVGA 3Q2IA 2VSYA 4YJ2F 4PXAA 1UEXC 2O5VA 2DMRA 3ODPA 3WZLA 2R7KA 5K45A 1VJRA 3KXPA 5DGHA 3FYDA 3WSVA 2PR2A 3F8SA 4YDRA 2ZAOA 3UH1A 1FJXA 4B74A 4QZVA 2VYFA 1M66A 3LM8A 1SZCA 2A86A 2YHIB 1FUIA 4FN5A 1TMKA 4DMHA 5JEDA 1P1RA 3RTCA 1BFDA 1QFSA 1SOMA 1QQ5A 1T9BA 2ZSAA 3FPEA 4LQ4A 4MAMA 4FBLA 3PFFA 3CZAA 1B00A 1Q6YA 4P3KA 4OU5A 5LN1A 3MVEA 3MTJA 2EKZA 5GADl 1KRWA 2W2LD 3GQBB 2AXPA 2HA2A 3WA7A 3UPUA 1IBSA 2QV0A 1M1NB 3MRTA 1C7ZA 3ZJUA 2WWHA 1TFUA 1AGPA 1Z2PX 5HIKA 5IVHA 1PFUA 2ONCA 2JEOA 4NP6A 1I7NA 1XZCA 3BWCA 3UMVA 3T5AA 5IW8A 1OX5A 1X87A 2OV2A 2XJ4A 2XE4A 2AHRA 1O97C 421PA 4BV2A 4CM9A 1TZCA 1BWSA 2X13A 4U9HS 1FFAA 1E0SA 2GFQA 2I66A 1BC5A 2V96A 4NE7A 4CCYB 1ZAYA 1L5YA 2QR5A 4G81A 2J08A 1MQSA 3RRXA 2I5PO 1G5IA 4MVYA 4WKOA 1P29A 2BHRA 4GI3A 1X80A 4ZI7B 4QUKA 1E89A 3JWPA 1Z0DA 2DPLA 2JIZA 2VOEA 3E8XA 4FLMA 4P53A 1I6WA 2INGX 4ETNA 3KFLA 2XOXA 3NETA 3F0TA 1QH8B 5FHQA 1FXWF 3PV0A 4KFSA 3RTDA 2C42A 3NHFA 1SKYE 4S04A 4B79A 1H8EA 3KPUA 1QG2A 3EXIB 3RS0A 3I28A 3W90A 4AIIA 1O96A 4IZIA 5TVKA 1CF4A 2WTEA 4L5JA 4PO9A 5KYWA 4KAJA 2OV4A 3EWIA 2P9TA 4NCHA 2CHGA 2PQ6A 3SD7A 4ZDJA 2FRVA 2I1QA 2I54A 3MYRA 1E9AA 3TJZA 4EKYA 5A3QA 1JKXA 4F12A 1F7VA 4NS1A 4F6RA 1Q0UA 4KIGA 4CU2A 1RWKA 4LV8B 1W85A 3THWB 1N6NA 3DDUA 1WBBA 1QUEA 1ZK2A