2UYGA

Crystallogaphic structure of the typeii 3-dehydroquinase from thermus thermophilus
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
141
structure length
141
Chain Sequence
MVLILNGPNLNLLGRREPEVYGRTTLEELEALCEAWGAELGLGVVFRQTNYEGQLIEWVQQAHQEGFLAIVLNPGALTHYSYALLDAIRAQPLPVVEVHLTNLHAREEFRRHSVTAPACRGIVSGFGPLSYKLALVYLAET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 3-DEHYDROQUINATE DEHYDRATASE
publication title Crystallogaphic Structure of the Typeii 3-Dehydroquinase from Thermus Thermophilus
rcsb
source organism Thermus thermophilus
total genus 46
structure length 141
sequence length 141
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01220 DHquinase_II Dehydroquinase class II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.9100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Dehydroquinase, class II 2uygA00
4CIYA 1J2YA 1V1JA 2XB8A 4RHCA 4B6SA 4CKYA 1GTZA 2XDAA 1H05A 3N8KA 2WKSA 2Y77A 3N76A 3N87A 4V0SA 4ZC1A 4B6PA 4B6QA 4CIWA 2CJFA 3N59A 4CIVA 4CKWA 1GQOA 3N8NA 3N7AA 3LWZA 4CKWB 2Y76A 4KIJA 4KIWA 4B6RA 4CL0A 4CIXA 2C4VA 2BT4A 5B6PA 2XD9A 4CKXA 2XB9A 4KIUA 4CKZA 2Y71A 3N86A 4KI7A 1H0SA 5WRFA 4L8LA 4RC9A 3U80A 1H0RA 2C4WA 2C57A 2UYGA 1GU0A 4B6OA 2DHQA 1GU1A 3KIPA 1D0IA 1UQRA
chains in the Genus database with same CATH superfamily
4X65B 3ENKA 1UQTA 3IAFA 5AJTA 2Q6OA 3RJTA 2NTEA 5I9IA 5I4IA 1XZNA 3IVXA 3GP3A 3BCHA 4TOIA 3SQMA 4D81A 5B2EA 4RDHA 3R7BA 3ANMA 2NUPB 3VPCA 2NP7A 3AUTA 3NALA 3MINB 5AH0A 5HFNA 4UD2A 4D4GA 5BOVA 2ZBPA 5ETJA 5AW1A 1T0BA 1KO4A 1WXQA 1QB7A 2FWMX 2HK8A 2OHJA 3ESDA 3GNSA 4GX1A 5AP9A 1RQLA 4M7RA 3PIIA 3T34A 2W5UA 3OT1B 1IBSA 3K1YA 4NU0A 4OLHA 3ND8A 3LNTA 1NT2A 1VECA 1Q16A 3L02A 3OD1A 1MZPA 1TJNA 2CXNA 3AJEA 4TTIA 4FB4A 1KZHA 2DOKA 1QXSA 3M6LA 4FUQA 3TZCA 2WSYB 5ISMA 2OQRA 4RZUA 2FWBA 4WXRA 3B1ZA 3B89A 1FFEA 2W2QA 5DO9A 2VF2A 2FMTA 1YVDA 1RZVA 2L17A 2X8BA 3GAMA 1T8RA 3D02A 3JQPA 3K94A 4LYJA 4RK5A 2HHCA 2Q29A 1CKEA 1H22A 2F6RA 3HYSA 3IKJA 4H7KA 4F8EA 3O83A 4A9AA 2OESA 3W34A 5E0KB 4D8UA 1G6KA 4AROA 4BNTA 1VYHA 4KO8A 1ONOA 1H1TA 3AYXB 4GLBA 1D2EA 5HCIA 5FBVB 2DUJA 5BOSB 3TSZA 3VYVA 4A0RA 2UUAB 1L3BA 1L7MA 1QGUA 3LO8A 4OGLA 1G20E 2HZ7A 3FMVA 3K32A 4HH1A 4MW9A 4IH9A 2G06A 2M1ZA 3OI7A 2ECFA 3OOEA 5IH3A 5K3BA 3ZWYA 4ZYTA 4MHSA 3K5WA 2UXBB 1OAOA 4FSXA 1XF9A 3KSZO 4DUZB 1L7QA 1YS2X 4TWBA 3SDZA 3BE6A 3HUTA 4PNHA 2VJLA 4JJFA 4AZWA 2QXUA 3L4KA 4OIMA 4C7BA 3R0VA 2YQZA 4TQUS 4QX6A 1NX9A 3UQZA 5LA6F 1N1GA 3U56A 2W6NA 1RT9A 3QXHA 3A1DA 4G4SO 1XMOB 1P5HA 2LE0A 1HZJA 4EB6B 1JHDA 1JFVA 4W8HA 2XNJA 3NAMA 4ROSA 1WVMA 1ULZA 3I5UA 4TKVB 3EZ6A 2XVXA 1PQ4A 1F38A 1BCSB 1JILA 3DMTA 5F78A 3IL2A 1VLVA 1J8FA 3I3OA 4Q34A 4D45A 4V2UA 2CCJA 2WFLB 3L84A 4PYQA 3I2FA 5AVKA 2Q7OE 3WVNA 1UC4B 2CXTA 3W2GA 4G0MA 4HGRA 1W88B 4PZ0A 3UA3A 5I3ZA 3EEQA 3KQTA 3VMFA 4RK4A 1I8TA 4C2BA 3FUVA 1UJBA 1XYGA 1EK1A 1JHXA 2GCEA 3EISA 2GJ9A 1Y1TA 3P45A 5C81A 3GLFE 4KR2A 3KYJB 1KQPA 3ND6A 4M1WA 1JTFA 2HK9A 3GGSA 2BR3A 1K4KA 3FVWA 2EL7A 2XUDA 3UH0A 5KU1A 3V4LA 1E5QA 4FBGA 1T0JB 4HQKA 1LPBB 4R1OA 1RACA 2VXCA 1HDCA 2ZTUA 4R6WA 4B43A 4F6LA 4OGGA 3EZGA 4RELA 2W37A 4NYIQ 5K0NA 3O8RA 2R62A 3DUFB 1N6IA 3MFQA 1ZGGA 4IIDA 4YUXA 1AKRA 4EO9A 3OTGA 1YB7A 1NQTA 2CN1A 5JAHA 1SHZA 2J9ZB 4R9UC 4R2WA 3NGLA 1FDUA 5TDHA 5FOWA 3H1PA 2IEDA 4HTFB 2PT5A 2WAYA 5CPBA 2ZIXB 3PC8A 4EHFA 1OFTA 1WCIA 2CCGA 3BHNA 2QG6A 4LXHA 3AEUA 1DOZA 3FSRA 3EEYA 1DAEA 1ORWA 4WOPA 2ZB3A 3EZ2A 3FSGD 3CZRA 3I01A 4CEIA 5FADA 1YTUA 3BWCA 4IH4A 4MPPA 1IOWA 3HFJA 2XY4A 2HA0A 1TYCA 2AA3A 2YNMA 4G97A 4PCAA 1JMVA 2AJ8A 2I8CA 1W75A 2CHFA 3F67A 3DE2X 2IPLA 1E9EA 4GU5A 1M34A 4U63A 3G2PA 3S2ZA 2NWQA 1RRPA 3KDSE 3VKWA 2QRQA 2QJFA 4KQ9A 3STTA 1KEVA 3G02A 5CVTA 2YBDA 3GFPA 1YJ5A 4O2LA 2AKYA 4XCQA 1H05A 1OB2A 4IOKA 3UK0A 2WJ3A 4YFVA 4R1QA 1SC1A 1CRLA 1ZQ9A 4XR9A 4G36A 1V11A 5K2OA 3QHPA 3HY3A 4IIJA 3VOTA 2KHZA 5FYQA 4C9BA 2ATEA 2D0IA 4GGOA 4O4JB 3IYLW 3KOWA 4OATA 3T0IA 3IT1A 1ULBA 3ZLTA 5IDXA 2NM0A 3VPGA 1RIIA 4JSTA 2JG3A 3EJWA 2C83A 4EG1A 1YZNA 3FHLA 3ONWA 3AUSA 4FYPA 1LA2A 4KWEA 2BJWA 5LQDA 1V37A 1JHRA 1Z5PA 1D2NA 5JECA 3QY0A 5AHRA 1P1JA 4D8XA 4OQMA 4BQRA 3W5AA 5J1SB 3FYDA 4PYMA 3WLTA 2PUVA 1PV2A 2DPMA 2Z9BA 3AT1A 3EQ7A 4V03A 2VZ9A 4KU4A 3K92A 3LLMA 4BS9A 4IJQA 1CZKA 1VJ0A 2JIBA 4TV8B 3RSZA 2C7PA 1TD1A 2P4QA 3KHTA 1NXSA 2CLHB 4E3WA 2APJA 3UFXA 3FTPA 2VSQA 2HGSA 1Y1RA 2AMFA 4ZWNA 3EXG2 4Q7QA 1FMLA 2J3HA 3UCXA 3M9WA 4FX2A 5J4YA 2DCUA 2P2GA 3DOHA 4HPXB 1JEQB 2QOEA 1QK5A 1TVEA 2CUNA 3GCZA 3UICA 4DXAA 4RADA 4NOLA 2FPRA 2GJ8A 3OE1A 3UHJA 1II0A 1JE0A 1USIA 4FW8A 5KQRA 4COKA 4QBIA 1ZAKA 3C16C 5DLYA 2Y1EA 2REQA 2G70A 1K7YA 1Y5IA 4WK4B 1VMIA 2FMFA 1LDYA 1KXJA 1XYVA 2HWWA 1VE1A 1Z63A 3TGPA 4W5HA 2X42A 5H4HA 4ILEA 5IM4F 1QRTA 3HRKA 1JSXA 1QHIA 2I0FA 2VG8A 4P53A 4ZPJA 5JS8A 1JR6A 1Z4MA 1VYVA 3LM8A 5EPUA 2BE9A 4J2TA 2XMBA 4LOLA 1V7PC 1V8DA 3PTLA 3E0QA 4UM9D 4MKXA 1LK7A 1RRFA 3DTNA 3EGXA 5EEHA 4JFAA 2YJ5A 4H6VA 5FRDA 2GFIA 1YI0A 1R12A 2WFMA 2WSSD 2YN4A 2VP9A 2ZG6A 4IOMA 1UJ6A 4W6ZA 4NXMB 4AAYA 3TECE 5BN4A 2XV1A 3EUEA 5EINA 3EVDA 1NC1A 3VBCA 4RULA 4B45A 4RBNA 1WPXA 5HE8A 3UK2A 1H4SA 1XCJA 3FCSB 1Y3FE 3AFMA 4MWTA 5CMLA 3A14A 1TYAE 4AJ2A 4FKBA 2Z5GA 4BPRA 1Y1SA 2LW7A 2GMWA 3W9YA 4UPEA 5JI2E 1KYVA 1DE0A 3IP8A 1G2OA 5LPNA 1Z2DA 4C43A 3OJWA 4JLAA 3HU1A 4MLCA 2HREA 3BWMA 5B1IA 4S2UA 4ETMA 1SBTA 1X6VA 2ZULA 1J2JA 2HU8A 4N8SA 3WGMA 4DUGA 3KZCA 4MWBA 1TRHA 3FZQA 3REQB 2OVFA 2FPOA 1XAIA 3A0UA 3ID6C 4QBKA 4B2PA 1HF3A 3CM0A 3QSGA 4M83A 2Y0CA 3OOJA 4F7WA 6REQB 4S35A 1A2KC 3AHFA 4NP6A 5EKTA 1JH9A 1A9XA 3DLBA 1FQJA 4BFLA 4A03A 4C6HA 4QYSA 4EDHA 4AQYB 3NATA 3EF3A 3L7YA 3ZJYA 1E1CB 3ZDBA 4ND7A 4LJRA 1Q0ZA 1UFQA 1JFLA 2V6MA 2Z2YA 3A9RA 4R5MA 5GJVC 1MR3F 2JI9A 3EZ9A 5LA6B 3MUFA 3G2KA 2CV1A 3D6TB 1GGNA 3QYAA 4ZT3A 1ZGBA 1B16A 3WRVA 1MAWA 5FYDA 4EBBA 4PFSA 2I9PA 1VTKA 4CT5A 4DSZA 4LQ4A 2EAUA 1TF5A 5U4QA 3AVOA 2HRBA 1F1JA 2O8BB 2P0EA 1YUBA 2YFHA 2QPLA 4JVMA 4U02A 1OFUA 1F0KA 4JUAA 3B2QA 2LIPA 3UBTA 3EGDA 4H4CA 4D43A 4CUJA 1JW9B 1I3KA 1TM4E 2DE0X 4NYMQ 4DC1A 3OCWA 4P5EA 1TPZA 2XNSA 2CT8A 3HPQA 5CH8A 4PRKA 2KPOA 3L7CA 1PWYE 5FBKA 4B75A 4WY5A 2Y9MB 3K9LA 2XVMA 1EM8B 3H9CA 2A86A 1YFLA 1Q1EA 4RZ3A 1VYTA 5MN6A 1MEEA 2B1QA 3RKRA 5I4KA 3F5SA 1EM6A 2RKWA 2G72A 3K8YA 3NJ8A 4G86A 4MRMA 3IOBA 4BQIA 3OPNA 2ZCJA 3N1UA 4MA4A 4ZOCA 1WP4A 2DFKB 3V2IA 2GSDA 4CYMA 1GR0A 5CG1A 3IP5A 1MX3A 1RLIA 5EHZA 5IHXA 5JY1A 2R84A 2H18A 3JQ9C 3O38A 4WADA 2Q46A 5AJZA 3WIBA 5EMJA 2XCSB 2JCYA 4IOJA 4MO9A 4W5RA 1BRMA 3EAGA 2BTOA 1XTZA 1YB1A 5AM5A 3TOVA 2CMFA 1XZJA 3L1JA 4AJKA 3D6HA 3K9GA 2BGIA 3CUWA 5AM0A 5CDYA 4ERXA 3K71B 1TQ6A 1DELA 2WIDA 2P6RA 3WSTA 1AZSC 3KZKA 2ETVA 4TWZA 3BUSA 1GGVA 1L2TA 1C7IA 2TMGA 1KMQA 1KEEB 2RSLA 3UK7A 2VZEA 3C6YA 1WB4A 1ZP6A 4OKSA 3WBKA 2OGWA 1UXKA 2OKCA 3W6ZA 2XMDA 3EGWA 4E5YA 3ZWWA 4B87A 2HDHA 2ZT8A 3EXIB 1YE3A 2DB3A 3FYSA 1YVEI 1F4VA 2X1LA 2QT0A 2HXSA 4PZPA 4NJMA 4XM2A 2ZANA 4Z9XA 5C37A 2FH5B 3R9XB 3OKPA 3HA3A 4ODIA 5F77A 1Z2PX 3KQVA 5AW9A 2CEKA 5KYWB 1GTSA 3ZNQA 5CD1A 3WIDA 3B38A 4JIGA 1W87A 1NV8A 3FMIA 3KAQA 2ID4A 2EKLA 3C4JA 2TMYA 4MWSA 1ZKMA 2W2OA 4YJKA 4DV4B 1TM1E 3E3OA 1C2TA 4OMCA 4QTYA 2PZ8A 4H1TA 3CZ5A 2XHEA 1QKKA 3C3MA 5DGCA 3RUFA 4Q5IA 1D6MA 1E79D 2W42A 3LH5A 3HDVA 1XZCA 4L0DA 1GUDA 2WF5A 4JQCA 2SCUB 3ZE0B 3IX7A 5KC9A 5L3QB 2ZE6A 1Z68A 2OLEA 3AI7A 3VPBA 3ZWCA 5DH9A 4AKTA 1LI5A 2I2BA 3E5HA 2WHPB 4GRDA 4TRJA 3GYGA 3PQ8A 1C9MA 4HS4A 4II7A 4D2IA 2V7PA 5IW8A 1VSBA 5AKIA 4B0OA 4XYEA 1BVYF 3HZRA 3DBLA 2OQVA 2XCUA 1BS1A 1BKDR 4EF4A 3R5FA 4CXMA 3G8DA 2H2FA 1KDOA 2HN9A 3ZDEA 4MYCA 2QPTA 3R74A 1RC1A 3OF2A 1XDSA 3GRCA 4P3OA 1I0LA 1U65A 3I5MA 1OV4A 4FOOA 5KTOA 2REBA 3G9XA 5D7NA 1YS9A 1TMKA 4RK0A 2Q1XA 1V1RA 4DLZA 3AESA 5FUWA 1DP4A 4KC0A 1CHNA 2WV9A 1ZK4A 3E22A 5JXIA 1MW8X 1T3LA 2AMVA 1PFVA 3CONA 3RYTC 1JDNA 2CXXA 4NV0A 4P2GA 1Z35A 3IBYA 3IEUA 3BFVA 3BRSA 4Q37A 4PGAA 1QPBA 3LSYA 2BFFA 2WZCA 5FPTA 4KUGA 1P75A 5FTWA 1JG7A 2ZM6B 4YRJA 4C0QC 5EFZA 3VZBA 1CE8B 2B20A 5CX4A 4D9EA 1P1BA 1AQJA 2P4SA 3R9IA 2D4AA 2K6GA 2QAJA 5BVGA 2OAP1 2FMHA 1SKAA 4B3XA 1XEWY 1AKMA 1WD7A 2XIQA 3G5TA 4RYLA 4D7AA 4DZTA 1NVAA 5KDDA 1E3EA 1JI0A 1Q3TA 3OO1A 1XVUA 3D3EA 4ZZ2A 2FKNA 5KTNA 4AKHA 1TT5A 3WDLA 3COWA 1DAHA 1B14A 1ISGA 5LIPA 2Y1XA 5SZJA 3SYRA 4CEHA 3KR0A 1M1YE 4XI9A 1VMDA 2FSSA 3I37X 5CHYA 1D9ZA 3VH1A 1GITA 1QF7A 1XD8A 3QK7A 4HDNA 4N40A 4PYLA 4R9RA 3U81A 3HWSA 4WCDA 2RAPA 4RM3A 3A6LA 4FX5A 2ZSAA 1PGQA 3MPUA 2VK1A 4P86A 2VAMA 2C9ZA 1V4VA 3HCRA 5AI8A 2C2WA 2WMYA 4Q9DA 2QAGB 2X0KA 2C9OA 1YMUA 2EZUA 3A70A 3WB0A 1K27A 3WL3A 3HYRA 4MV9A 4TWRA 3BMNA 2A9QA 4EMUA 3N7AA 2XQIA 1XU9A 2JK1A 2VT7A 1Z0DA 1D6NA 2PWYA 4RYDA 2J09A 2Z6VA 1OX4B 3CR8A 1JYEA 2QDKA 3EVZA 3JTMA 2YCLA 4CTKA 5AM2A 3BXFA 3AUYA 2J9GA 4C14A 1D4OA 3FPLA 3PHCA 3ZGNA 1SBZA 1RLMA 3CCFA 3IMGA 1K7SN 1ORDA 1X7GA 1R3DA 4WOCA 5B12A 4EEZA 1R15A 3JAWB 5HCUA 5EXDA 4XUDA 4URWR 1KDYA 3SJUA 3VOSA 2BF4A 3PLAE 3T94A 2B3DA 2OFXA 4RSHA 3ENZA 3NHYA 1I51A 1KEPA 2BUBA 3NNSA 1Z07A 1U94A 4QXRA 3K2BA 5EUCA 3GJQA 5H16A 4H3VA 2Q50A 1LX6A 4GM0A 1XVVA 3ABZA 2JHFA 4HQ6A 5JNLA 3HFRA 4BN0A 1CDDA 4REQA 4YX9A 1EP1B 4J0CA 4KPUB 1A4XA 4CL2A 1N2XA 1JVSA 4BKOA 1JEYA 1UK8A 3V42A 5I7OA 3CNBA 4LHSA 4O5OA 4DGSA 1CZNA 1GVHA 1BVHA 2ASEA 5SICE 1CRPA 1I7NA 5U1PA 1IZZA 3TXAA 4R1SA 2WM9B 1OIXA 1YDMA 2FPMA 2OORC 2YW9A 1BXKA 3TRHA 3R6LA 5KNBD 3VSEA 2COKA 1ODCA 1QFXA 4JLMA 1MMFB 5MFZA 2W00A 3UW1A 2WPDA 2O07A 5AFSA 4AMVA 4EVIA 4JXZA 1RWPA 2HGZA 1ATIA 1LZKA 3VTKA 4BB0A 3AC0A 4DXDA 5C35A 1NHGA 4EHAA 5I4CA 1HM5A 3B1YA 5LP6C 3NC0C 1N6PA 1TUIA 4JLPA 3OHPA 4FP9A 3VHRA 3C1UA 2B7LA 3CG0A 4L4ZA 2B61A 2RI1A 4E5UA 3TFOA 2YY6A 2BKLA 3CKKA 3VDRA 3B12A 1GL7A 2QSZA 1U2ZA 1UIRA 3N0WA 3PDJA 4EJ6A 1V3TA 1VKJA 2G5TA 4KQ2A 5J2UF 3ZVKA 4IUYA 4CIAA 1B42A 4OHBA 5DHAA 5ICSA 1LSSA 2PAFA 5AI9A 3EXFB 3P9ZA 4M38A 1L5OA 4MPTA 4ZREA 3VZCA 2RC5A 3SBXA 1AB6A 1RYDA 3BGSA 5LQCA 4GYJA 1QRRA 4O4HF 4Q01A 2OCYC 4W5JA 4BWGA 4CMGA 1E2FA 3GD7A 3HACA 3KJZA 5F1PA 2YWRA 2WD7B 1KYIA 1XAGA 2R4TA 4FDLA 4MULA 3U4MA 4Q1BA 1TJPB 3HE3A 2MYNA 3BZUA 5CW1A 1VSVA 4MUIA 1N0UA 4QA9A 3IEMA 2PKCA 3QKWA 2BZSA 2P9QA 2BV3A 4KSBA 4N6NA 2C7VA 1N6LA 4GBGA 3C5CA 4M89A 1TL7C 3T5MA 2C9CA 1JRLA 3G6WA 4LRSB 1SHKA 2QVXX 3PKIA 3OIVA 1GPDG 3LGXA 5LUBA 3GVXA 3A6PC 2L0XA 4WLFA 5TS2A 1TECE 1R4NB 5DHRA 1MN6A 1NBAA 1X14A 1FDWA 2V3WA 4AUMA 1CJBA 2DTDA 4W5QA 1XTIA 2VHUA 3R0QA 4M9ZA 4UPDA 5ECDA 5LLTA 2QV7A 1Z2AA 1CPYA 5FD8A 1LXCA 4GE0A 3IVRA 1J9EA 1IN8A 2OHFA 2BHTA 4MVWA 3H19A 1Z4LA 3TJMA 3BD9A 3PD7A 1MW9X 3TQHA 3X1XA 1F8XA 3P5BA 4A1FA 2PLFA 4ZP1A 5HKOA 4X1IB 3V8BA 3PJFA 2RIPA 2OAEA 4UU1A 1V3VA 2O59A 1M2FA 4KCGA 3B6JA 2F64A 1EXVA 1CCWA 1T29A 2Y1DA 3VM6A 3V2GA 4L8VA 1VGVA 1DTSA 2C7GA 3LJKA 4Q1CA 1ODJA 4MJXA 1E2NA 4IM7A 4JI1B 4LIPD 3TOXA 3W8NA 2C9MA 4BGIA 5LNK1 1U7ZA 3H9JA 4ID9A 1DFHA 1E9AA 1W2HA 1WCXA 4HN9A 4TMZA 2X2EA 2IBMA 1XVIA 2JFBA 1SPBS 5FTLA 3T9EA 1AV7A 4P0QB 1HDEA 2GJKA 2VNSA 2ZEJA 2HSJA 4KXYA 2NXJA 2I4IA 2DY0A 1DSSG 2IXFA 3KCQA 4YXWD 4HOYA 1XZBA 4OXXA 2HNKA 3X1ZA 4GPEA 2DU8A 1BA2A 1CY0A 2XX3A 2FPXA 1Y3DE 1JPUA 1FXWF 2PV0A 5FA8A 2QM3A 1G4UR 4FEYA 5HZHA 1PVVA 5E8JA 1Y9AA 3S8MA 3GI1A 3I0NA 2KX7A 2MYTA 3KOXA 1B6GA 1N7GA 1CR4A 1PWHA 2Z08A 4QTTB 3UWSA 4BMCA 3SC3A 5BSTA 3RU3A 3CPEA 3TX6A 4DY4A 1DEAA 3A1UA 3TIIA 4M7PA 5BWOA 4E14A 2EQ5A 4IDPA 1SC9A 3CR3C 1EFDN 1RP1A 1Y8QA 1KPGA 4GI1A 4YPFA 4MYRA 4D9IA 1FJ2A 3IAHA 3NHUA 2XGGA 3CBGA 1D8AA 4UVHA 4YP5A 4NL4H 3CH7A 1OX6A 2ZUUA 5GOTA 5IDQA 1UC5B 1PG0A 1EXWA 1VHWA 2JDID 4PG5A 3ABIA 4PFKA 2XCRB 4N6OA 5A6SA 1ORHA 2PA3A 2J4CA 4HDMA 3WGIA 5B7QA 2AN5A 2AOUA 2EW1A 1PQWA 1XRPA 5KQGA 2PQMA 3IMEA 2O8CB 3A9VA 3ITDA 3LP5A 3W8RA 3V7FA 1XWWA 1YJAA 3O9VA 1SA0B 2EF1A 3FPSA 1NBEA 1QHSA 2IF2A 1JX6A 3CTPA 2YS7A 5CU7A 3RHZA 5JJBA 1QIKA 4JGBA 4W5NA 2VZLA 3FF1A 1ADYA 4IV8A 3TZKA 1BOOA 1T8TA 3MUEA 5JS2A 5F9FA 2WOOA 4UBLA 4FLFA 4XD7A 3QEMB 5EJFA 5CFZA 2AVNA 4KIFA 5DWQA 3L4BC 4LX0A 2ZYWX 5AIAA 4IIJF 3IAUA 2JJ1A 2P78A 1IQUA 3EGCA 3PIDA 4ZI5A 1T25A 3UMRA 3C7KA 1W44A 2Z2ZA 2YFYA 2REOA 2C96A 4FZVA 8GPBA 2FZ4A 2OXFA 5FI5A 1GTJ1 2JH9A 1NYQA 1WP9A 4XYGA 3ZCUA 4F85A 1ZHOA 1KYZA 1E92A 2E49A 3SR3A 1Y3IA 2EW2A 5K3FB 3M6UA 2A78A 2UKDA 3PQ6A 3TZHA 3LUPA 3UNXA 1QX3A 4NG4A 4QQ8A 5FIUA 2CJFA 3QF4B 5FPKA 2X14A 3QX3A 5ALQA 2P90A 5CB6A 1EE9A 3GLSA 2CF5A 1ZMRA 4G5HA 4P81A 3HGQA 4Q1AA 3VNAA 1R00A 1WSAA 4CMHA 3LX8A 1LWNA 3PVSA 5CEEA 4E7OA 1KYTA 4PS0A 1SIBE 3DKKA 2YW2A 5AVTA 4PTYA 1X8KA 1Z6XA 2EFDB 3L5KA 2N3ZA 1V5EA 4JB0A 4G1MB 1XZAA 2JAOA 4IV5A 5TPZD 1K06A 2FW8A 2QSJA 4JR1A 4U7TB 1XXHB 1WV0A 4OHRA 3ORYA 5D01A 3RPEA 5BNFA 4BKPA 4JB8A 4D26A 4TZ0A 2GLUA 3P2EA 3RRJA 1JA1A 2GK4A 3M1AA 3PICA 3W5SA 3C8DA 1PZXA 4DLYA 4ZYYA 4RTJA 1UAAA 4X71A 1Q2UA 3IE2A 2X8JB 4CCSA 4Z7NB 3L6OO 5JRJA 3AEKA 2IEAA 4QPDA 3VR6H 2GAAA 1MA0A 1MXHA 2ODTX 3SF0A 2GH1A 3P26A 2G7MC 2A8YA 4GX0A 5JAUA 4XWKA 3O8OA 4YT5A 4JL5A 2R48A 1QAOA 4EBFA 3IUQA 1M2JA 1I7DA 3RADC 3ET5A 1T91A 2JLWA 4BZZA 5AKEA 4WA7A 1CY6A 3HBMA 1JALA 1D7OA 4FDVA 5DULA 1AKYA 1FRVA 3TB6A 2G07A 5AI6A 1RBYA 1ZJZA 2A9RA 4JBNA 5J2UB 5AKHA 3KZXA 2Z5LA 4ZAWA 2JLBA 3A31A 1X92A 2FN3A 2FPUA 3DJYA 2P68A 2H5EA 4RK6A 2J67A 1PZMA 2QVBA 5ALKA 4XWOA 1RFGE 1NONA 2GHTA 3BMCA 5EQJB 5C1PA 4G4JA 3ND5A 3DQPA 2CVOA 1N4DA 1P2SA 4O4HB 2X2FA 1WZEA 3PGKA 5FQNA 4AY4A 2D7DA 4N41A 2C2ZA 2E48A 1KEWA 3A1WA 3OLZA 3U0BA 2O3QA 3G17A 4MW0A 4AK9A 4DJEC 1RPAA 1J9ZA 5BUSA 1MJFA 3IUPA 4W1RA 2ISCA 4Y2SA 3MTEA 1P5RA 3UKDA 3WGQA 4UTOA 3UJ6A 2EKPA 3LU1A 2C42A 3UT0A 1QGZA 1XYYA 2QR3A 3GLGA 3SZLA 4TWJA 1D5WA 3WHIA 3F90A 1GZHB 4K9LA 2C5LA 4QU8A 2ZSEA 3K70C 1ID1A 2CXHA 4PAQA 4R7TA 2IPXA 3GFGA 3B2EA 2CLEB 3ME5A 4WOBA 1JVNA 1XEWX 4E13A 4F72A 3K30A 4BPBA 3G5AA 1EFLA 3CW2A 4GKVA 3GB9A 2WZQA 2H07A 3NU1A 1CEQA 1E2GA 3H6HA 1LJLA 2ZRCA 3R0IA 3RI3A 1IXSB 1YDHA 1XRMA 3IP1A 5DZSA 5K0ZA 2NOAA 3GUYA 4JKOA 4WW0A 4M0LA 3DW1X 1JU9A 5FDFA 1Y7PA 2YBEA 3ANNA 3GRRA 4OUDB 1V1MB 4WBXC 4IS3A 1UPXA 2G0NA 3NXSA 1VMAA 1MTOA 1X9HA 2OB1A 2QTAA 4MDFA 4V39A 3RSLA 1EGMB 4F71A 3RBZA 1NQAO 4GOJA 1M2VA 4G67A 1EK2A 1H9AA 4W5WA 2RD2A 3VVLA 2XZLA 3ZV7A 2HPHA 4ZD6A 2XB2A 4MMZB 2WK1A 3CPJB 1L6RA 2VT2A 4NXNB 3QFHA 1AUVA 3JQAA 2E4AA 5FLYA 5HA5A 1FMJA 4CGYA 3Q4GA 2PUDA 1MVOA 6ABPA 2ORVA 2VXYA 4IGEA 4IR7A 1XZGA 3FCEA 3IAS6 3N9IA 3PPWA 4ZXPA 2WU1A 3NYWA 3V33A 2O7QA 4WXHA 1U0OC 2PH7A 1HT0A 3A06A 1FS6A 3O6VA 4NCXA 4ALKA 4EG4A 2P1RA 3I2HA 2R6R1 4ED9A 2HLHA 4LV6A 5A5VA 3DKPA 3GPDG 3DCNA 3OQNA 5C46F 3K5HA 4OJYA 3S29A 2DQSA 4OGFA 3IMCA 5LJLA 5L9AA 1RCFA 1P1RA 3EUFA 3C24A 2P9GA 3HJRA 2EJVA 2QLFA 5T6BA 1SCQA 2JI6A 4LE2A 4TM7A 3FNEA 2YZ2A 1ISMA 1A9ZA 1E9RA 3KEFA 4NS4A 4NV3A 4S0ZA 4YPVA 3FF4A 4JP3A 2QTFA 4UU7A 3S28A 1VLHA 4B6PA 4JBYA 2I6SA 3CNHA 1ZD9A 2G76A 5DOZA 3OZCA 4MVXA 1M3SA 2FR8A 1ZRNA 4OK3A 1WMDA 1XZKA 3AEUB 5JMWA 5H8WA 2OSBA 1EVYA 1UDWA 2R44A 1DKUA 1HYHA 3IUEA 4Q05A 3VJKA 2DP4E 3KKQA 3QELA 3TUZC 5FWDA 3PX7A 4YCAA 2BFNA 4CEIB 2O8FB 3JWEA 4QBGB 4RAOA 1UKVY 4L78A 5ALJA 4RDXA 4HQNA 4ICIA 2W6CX 1J8MF 3I58A 3NBAA 4Q3KA 1VMEA 3BHMA 4IDFA 3LQRA 1M34B 2ZWOA 4CQJA 2B34A 1WY7A 3WMEA 2Y9PB 4YAJA 1NKVA 3BC1A 3DXXA 1SKMA 3VISA 2IYVA 2HJ9A 3Q11A 1EXDA 5FI1B 3RYCA 5ED0A 3IOMA 4WEOA 5F4ZA 5MGBA 1VIDA 1JI3A 1EFPB 2ONKA 2W7TA 3RT1A 4MAFA 1HH4A 3U7RA 3R7WA 1YS4A 1N7JA 4PYJA 5K2MA 1JAZA 1V11B 2YJZA 3FWNA 4AC9A 1JECA 4FFSA 3WRYA 4IIJB 3B7WA 2BFDB 1RKQA 1L8XA 5ICFA 4UVEA 1O94C 3C3PA 4U3JB 4MA5A 5BQ3A 2MMCA 1DB3A 4MV4A 4QGBA 3UV7A 3DB2A 1DRUA 2H29A 4ALNA 4FC6A 3F2VA 1DGQA 3L0YA 3TW0A 3QM1A 5DF1A 2YWEA 4L51A 2O2EA 4LYDA 4QKQA 1QFMA 2R1ZA 1FRZA 3R3HA 4XYLA 3A04A 1I1HA 2R8EA 3PDIB 2OE2A 1UADA 4RMIA 3QVKA 2OHVA 2JGDA 3C3KA 3EVAA 2I33A 3WGNA 5ITWA 1LDBA 3VPHA 1NDHA 1QANA 2J5BA 2PYZA 3QP9A 1U7XA 2GCOA 3I04M 4QHSA 4D9JA 3STHA 3SZRA 3THXB 5LDHA 1M1ZA 1IQ0A 2JAHA 2BZ0A 4ERNA 3I9V1 4YJHB 4MVJH 1FXSA 1T6XA 4NU8X 1JEDA 3UFXB 3VSCA 1OWOA 2WG1A 3DW3X 1U1CA 3VZQA 3NTQA 2W6ZA 5L7WA 3GX1A 4G8JA 2EHJA 3MLBA 2QE6A 4RWEA 3ZGLA 4WNAA 3ZHQA 5IXSA 4JVOA 1UQRA 3DTYA 2J3KA 2RHDA 3G0CA 2Q1YA 3A11A 1NSYA 1PWZA 1GUAA 3FI0A 3A3KA 1EX6A 2REQB 1CEEA 1GQSA 2AN4A 2JFWA 2QRGA 3ZV3A 3VC2A 5AUOB 3KQNA 1G8GA 1TC2A 2WV7A 5ELXA 1FMTA 2ID8A 2HMWA 1M1NA 2PKRA 2WF9A 1ENOA 1WWKA 5IJ9A 4P2BA 4BKQA 3B1JA 1EFUA 1NA5A 3B5IA 3BRQA 1U7OA 3U2QA 5JZOA 4L7VA 2OCXA 3PHLA 5KPJA 4GPTA 1NJGA 3DD5A 3RRNA 2PKXA 4DNQA 5EIAA 1W73A 3W5BA 3IRVA 2GVZC 1FYDA 4JJGA 2R8BA 1E8DA 3MXOA 4D9MA 1NP7A 1BROA 2GKGA 3PNKA 2PU5A 3T5TA 1PFKA 4BFYA 5DM70 3MBKA 3QQ5A 5NLLA 3SJCA 1BW9A 2AMYA 3GEHA 4EGFA 3OZSA 1IRXA 4TN5A 5IABA 5KTPA 3VKGA 1ACMA 5EE5B 1U1DA 1YAJA 1SOMA 1TK9A 2QQGA 3NP7A 4RABA 1CYEA 5AVWA 1ZNXA 5GZ1A 3ESQA 3SKXA 4DBVO 2C4TA 1E2LA 1U99A 2PY6A 3AG5A 3SLRA 2OXIA 1OQAA 4QDJA 1QMGA 2BM8A 3H5VA 3DAOA 5IF3A 1P2DA 4OP1A 2GR9A 2LVBA 2JLVA 1PDWA 4Q02A 3TE7A 4ZMRA 3F74A 4I5FA 5KSWB 2ZUVA 2A9FA 4D9BA 2NXEA 3CLKA 3HNRA 1PFWA 2D0OB 2FPGA 2I76A 2NO4A 3IKLA 4DMGA 4EAAA 1GL6A 2QRZA 5KNLA 3UYKA 2FF5A 2DETA 4W4TA 2WSIA 2Y2UA 1A9XB 1O8BA 2TECE 4OAQA 1OKKA 1Y37A 2J9RA 3AWIA 1QGOA 3ELUA 3JQRA 1LFDB 4GZ5A 4IVQA 4J2OA 3VU0A 2VAWA 4Z9FA 2QRVB 2WQ7A 1QP8A 1SQ6A 1KKUA 2RCYA 3ONEA 3WNCA 4IDNA 2CJPA 4PINA 1U5BA 3HNOA 8ADHA 1JEAA 2DHCA 3G5UA 5E95A 3UWOA 5AOAA 2X40A 3KR2A 2WUFA 3MWDB 2ON6A 2A58A 1G17A 5BUCA 4PC3A 3HJFA 1AVTA 1PCXA 4V02A 4ZXFA 1U6IA 3EGDB 1ZJYA 1I5RA 3DHWC 3G89A 3GEMA 5AVXA 1P0PA 2YINC 3AB3A 3G8YA 3U4AA 1NBMD 1F20A 1U7HA 1OZAA 5TQ2A 3CLRC 3GAAA 5GADl 2BAGA 3PS9A 4HNRA 1IXYA 2IKSA 3KL4A 5FPHA 4QOGA 1AKNA 3ESXA 2D5BA 1J0DA 3TLYA 2GF2A 3ENWA 1QX4A 3AP3A 1BWQA 5KQMA 4A8JC 1WD5A 4ZQCB 4O2BA 3ZZNA 3L4SO 2WJGA 2Q2NA 1G21A 2HPVA 4JQZA 1IJBA 1NASA 4JLWA 4X8OA 1E7MA 4Z9AA 2QY6A 3KPUA 3V48A 4CM1A 3MSXA 4L1KA 2VLIA 1S89A 1NLZA 2VK8A 3MXTA 3I9OA 4L28A 4PZCA 3UMBA 5K20A 2FU5C 1G3UA 4G8CA 4TPKA 4QT0A 3TTUA 5J5CA 4LHVA 5DTIA 3KTAB 1VDZA 2AWOA 1MQSA 4FYWA 4L0MA 3ZE1B 4N0DA 2Q9BA 2ACKA 2RMKA 3ZXUB 4AS1A 3RJ5A 4GBMA 4G8BA 1A95A 1DADA 4QU9A 4QNNA 5B1DA 3DE1X 3N76A 3WWPA 4DREA 2ZUWA 1SB8A 5CNIA 3NRBA 1O4VA 3PJDA 3F78A 4BNHA 2N1MA 3B78A 4WJZA 4BO2A 4PQGA 4RKQA 1ZGAA 2D3TA 1XSEA 2OQIA 4FGSA 4EA6A 1KSFX 1WTCA 4PSKA 3HBAA 3GL9A 4LK2A 3MB5A 3VR5H 3FPHA 4GBED 4N03A 3WLAA 3ZQJA 3KYCB 3A36A 2GQ0A 3RAEC 2HBZA 4Q03A 3CVUA 2RB5A 5LQKA 3GWGA 4NJMB 2W2KB 4X7PA 5B2FA 4IIFA 4MPDA 4ZVOA 2ZAGA 3FTQA 2FVYA 2H2WA 2CVZA 3H4MA 3QUSA 4QDOA 1BCRA 1RMTA 4RHXA 4H0CA 1XCPA 4QFDA 1DDIA 1FTQA 1C7FA 4K9PA 4EKEA 4MV8A 2G77B 3MGCA 5CM2Z 5F73A 1YOVA 2VTBB 3P9SA 1R74A 4K6CA 2ZIWB 4TMKA 1YRYE 3LC0A 3NEYA 4AG6A 3ZJUA 2ZYRA 5BOSA 1MORA 4DJDC 2WJWA 3BERA 3GRUA 1I24A 3VUEA 4Q9AA 3LIPA 2DRIA 1QVRA 1ZL0A 5LOVF 3EEIA 1VBNA 2VF7A 3ULKA 2ZTHA 4JKYA 1VGRA 3TNFA 5IT9A 3SS9X 4URUR 1YKGA 1QQ7A 2I62A 3D6VA 2BEUA 2PL3A 4BBAA 2C9BA 1Q0LA 1V43A 2WE8A 3ORHA 3ZGZA 5CP8A 1PJAA 5PGMA 4L7QA 3DE5X 5AHOA 1IN6A 2IQ5A 4N7BA 1JU3A 2YVKA 5AUNB 1SXJE 2QTRA 2R68A 3TD6A 1EEXB 1F0PA 4YYEA 1O5IA 3DBLB 2PYIA 5DNDA 1L1QA 4HC4A 3QLUC 2VHEA 1F51E 5CBPA 1XO1A 4MYSA 4YV7A 4R3UC 1WXFA 5A3SA 3E84A 4JLJA 3PPIA 4KUEA 3DE7X 2R00C 2O8CA 1IMOA 4Q4JA 1XA0A 4WLVA 4DIMA 5EVJA 2WU0A 1V1RB 3OMLA 4ZOAA 1J49A 2YZNA 3KKMA 1TYZA 3OT5A 2XUOA 3A9CA 4MI9A 4BIMA 4QBFA 3LT5A 1IHUA 2FPLA 3H1FA 3X2EA 2ZS8A 2GAFA 3E22B 5GMOA 4BQFA 1NU8A 4M8LA 4YY3B 1OAAA 2D54A 2FN8A 4QBTA 5JMTA 1BSVA 1NNSA 1BN7A 1RTTA 2AUMA 3BMXA 4CE6A 5KYYA 3U4CA 1CY2A 3V3KA 1LJUA 1GO2A 1NI3A 2BFFB 2V0NA 5CT5A 1JR3A 4BO3A 1VQ1A 2Q0XA 2QMYA 2ZUSA 4F3TA 4HGPA 2YN0A 4Y6SA 3MAJA 1SHUX 1MJ5A 2Y0PA 3RAGA 2J0SA 1IUPA 2QSUA 5BVGB 4DTCA 3TTVA 3EUWA 1IUOA 1GCOA 5G3ZA 1MKYA 1NC3A 2G17A 4AY5A 4DYVA 2IY9A 1Z7WA 3WK9A 5THXA 4DR4B 3NG1A 2FSPA 2QVYX 3GJTA 4FC7A 3P20A 4IJMA 4LMRA 5J1TB 4OB7A 3V1TC 1UANA 4MQ6A 4A2QA 4EHKA 1XIVA 3COZA 2TRSB 2UYGA 3PUWA 3U39A 5HZMA 2V4ZA 4B34A 3NTRA 5IAAA 2GD6A 2A14A 4CEHB 2FXIA 4OHWA 3MD9A 4HDNB 2VRNA 2ILVA 1OCEA 2MSDB 4ENUA 3QVMA 2LGJA 1GPLA 4RTOA 5FBQB 3PHGA 3TI7A 5CX1A 1C1XB 1Q95A 1ZC3A 4RF4A 3AONB 1KO7A 2YVQA 3C3EA 3T1TA 3AV3A 1NPDA 2IXBA 3CURA 5EUQB 1OH5A 1PU2A 2FV8A 2P4UA 3WY9A 2B4TO 1MQ9A 4H3HB 3ZBQA 4YP0A 3S40A 3KUDA 2QGNA 4JLVA 2CYAA 3OIUA 1TGVA 3LPDA 4DLLA 2Z8XA 4JI2B 1V5FA 2VP3A 1JDJA 3L82B 5AR1A 3EGEA 4YXWA 3T4UA 4IO1A 2MSCB 2J3JA 1T5HX 4R0NA 5CRIA 5DBHX 1LRKA 2OTCA 3K5PA 4INJA 3SS8A 2UZ1A 3GVPA 3GJRA 3JARA 1QKJA 1XJ5A 4UU0A 5JCOC 1G6HA 4XVHA 2P65A 1P1KA 4HVLA 4LHZA 5AK6A 5KDOA 1CJMA 4HNUA 4BCDA 1C8LA 3WA7A 1TJ3A 3DYIA 4YAWA 5E7MA 1Z12A 2GD0A 2VZ0A 3D1JA 4LGYA 4A0GA 3UGTA 5MN5A 2IBSA 2CHGA 4MQBA 1HGXA 1S3IA 1PFGA 2VK4A 1ZH4A 4L4XA 2HT1A 1XR3A 4FKMA 3HU5A 2JFVA 4F5WA 4FHCA 3JZFA 5JHGB 4RGYA 4Q3OA 3T7CA 3ZCXA 3U1TA 2PMBA 1XQVA 1UP6A 4E51A 1PD1A 1D5CA 4AD8A 5HVNA 5LZ8A 1ZIOA 4GMHA 3H2IA 1P6XA 3P32A 1GSOA 4R1NA 2W6ID 1H6BA 1YJCA 2W93A 1GKLA 1T26A 1ZIYA 2JDIA 4HUQA 4MWZA 3RYIB 1G7SA 1SB9A 3LCMA 2XIJA 1ZHHA 1CUFA 4MQUA 2P41A 4YP9A 2O2HA 2J9YB 1PUJA 1T6NA 4UCFA 1MRNA 3GNTA 1QIGA 4LXQA 3A3YA 4CV0A 2ZS7A 1QVVA 4HLUC 3PI7A 5LMUB 3K9HA 4IJKA 1PJCA 1VIMA 1GPBA 1E3JA 1EK0A 3LCRA 1U2SA 3C41J 2LBPA 4ZEVA 3OU6A 2Q6LA 4A6PA 4ZYVA 1ATZA 1EFVA 4XGNA 1V35A 3AILA 1PIWA 2D5LA 4JT9A 3Q7QA 3RJZA 3EE6A 5DXFA 3TZQA 2ZI7A 2H1IA 3R23A 1BRTA 1U0HC 2OFFA 3OTOB 1HA3A 2JIMA 2VNIA 4S1VA 4YC7A 1TAHA 3D5QA 1RDFA 3NXKA 4G0ZA 1H1LA 4JYPA 3PITA 4XYMA 4BJ6A 3H6KA 4RGVA 4LXGA 3I64A 3WXBA 3KVNA 4NFYA 4PO3X 2X4LA 1X38A 1N2OA 1S9HA 3ETDA 2DWOA 2I4LA 1AHIA 3K8QA 3PNOA 3TL3A 3ZE8A 4GICA 2X86A 2ZIZA 3IBTA 1R9GA 3K6JA 2Q5CA 3UO8B 4DC9A 3FMPB 4C5AA 3IAM6 4N5DA 3W8DA 5EIWA 5ADWA 1FIUA 4TM8A 4EHLA 1SBCA 3B9PA 3PUJA 4MUBA 2IZ6A 4BTEA 4F96A 5JUWA 5LQAA 4Z3OA 1RI3A 5AJXA 5DYWA 5J4KA 2JASA 4S1TA 4LECA 1ZUWA 5TPZA 1YI8A 1ODLA 1CF4A 4XB1A 1CJTC 3Q6NA 1GPAA 3W4KA 2WP0A 4YCBA 2X9QA 1QV6A 2DHEA 4IQFA 2VQ6A 1X8LA 3CS3A 1ZX1A 5F5NA 5IFLA 2JZOA 1WQ1R 1R8JA 3UHAA 3COVA 4DDUA 3C45A 4Q18A 1RAIA 2XCLA 1Y81A 2G1PA 4KLNA 3RGWS 1D1PA 3PQEA 4UCWA 1QIHA 4CM5A 2X76A 3FJOA 3RREA 2HBYA 2V59A 3O2QB 5G0VA 4XJTA 1H3EA 1OPXA 1CSEE 3AK4A 3TKLA 5LOVB 2O52A 1K5PA 5KOIA 3H5TA 1WLSA 3BSYA 1H2EA 3GJXC 4P9NA 3QI7A 1EUDB 3KQWA 1VPLA 2PBRA 4GXNA 4P58A 4B6JA 1SC4A 2A2ZA 2Y0BA 1PV4A 3D1VA 3F6PA 3H7AA 4QL3A 3HK2A 2D8MA 1YD7A 3M49A 5CCBA 4BVJA 4AIRA 1U0GA 3CW8X 4MUYA 5TR9A 5BWMA 2D00A 2Z43A 4FBLA 2AR7A 2GJ4A 3ZE6A 3OFKA 3F73A 2V54A 4OG2A 5BVHA 1II9A 3DTVD 1MRZA 1THZA 2EJUA 2CZCA 2HD4A 1OI2A 2R66A 3CGGA 1MRSA 2PAAA 1DBRA 5FBZA 4D9GA 2HUNA 3KXIA 3UV3A 3VC1A 4F11A 3I1FA 2GJAA 1G7RA 1WPRA 3I9FA 2IYYA 3QFRA 4FGLA 4UBIA 3HFGA 1JBKA 1WJGA 3CEJA 3LSTA 1BEEA 3TF5A 4Y98A 2P9BA 3SQNA 1ECCA 4Z0NA 3ZBTA 2CB0A 4HB3A 1YJBA 1G5QA 2LPMA 1JUDA 3EW7A 4RM2A 3U7IA 4CUKA 4P82A 4EG5A 5JCZA 4HEHA 5KDLA 4EQ6A 1NATA 3LP6A 5CDHA 3PUVA 4BX8A 2CWWA 1KDTA 2QD5A 3G7UA 4JUDX 4OQNA 4ND5A 3V1UA 2VTDA 2QSYA 4G63A 4XJSA 1X1TA 2UVDA 3AXTA 5G0WA 4NDZA 1FFSA 5TGDA 3LXUX 1ZH6A 2QN6A 2IV3A 2HIAA 2AFHE 3O8CA 2AZ4A 3TJRA 4C7OA 1NKTA 4QYTA 3NM6B 3BJRA 4C6RA 1IJFA 1L5FA 3A4LA 4QUJA 1ZNZA 4GIBA 1A9RA 3OLQA 1OJ7A 1X77A 2GBPA 3PX3A 4MZDA 2X77A 4OYRA 4X20A 3UJHA 3DL0A 3OIFA 3A6ZA 3SLGA 3R3ZA 4FVTA 2ARKA 1U7WA 3QE2A 1Y8QB 4R54A 1NRJB 3NYQA 4C0BA 2X41A 5CBKA 2DWPA 5LP1A 4MJLA 4QGSA 5ICGA 4WLOA 3HVHA 5HQJA 4QG3A 5F76A 3EYWA 3WLSA 4JP8A 3LX5A 1N6OA 4NZZA 4A7PA 2OBBA 4F3NA 2ODEA 1Z4NA 3DDWA 4FNOA 4IQ0A 4B73A 1E0SA 4X3PA 3ICWA 4MCHA 4CM4A 3FFBA 3AVXA 3BSSA 2VPTA 1RABA 4NNOA 4RCVA 5A6SB 4L75A 4HDMB 5C5DA 4Q82A 2AOUB 2FVXA 3D6NB 3URKA 1PNTA 2QTTA 1T1GA 2W22A 1Z5ZA 5KWEA 4XLTA 1GPH1 1V3QE 4QGFA 2C2MA 4LX8A 1MA3A 5J4LA 3K70D 2PMDA 3KTOA 4OI0A 3Q0IA 4CL0A 3R5XA 2PS9A 3RSCA 1GV1A 3HU2A 4N5LA 5DYTA 3L8FA 1J00A 4Q3LA 5G1NA 3LQKA 3ZI7A 2G9QA 5JJCA 3KB2A 1ZM7A 1P0QA 2VO1A 1GLGA 2BZGA 1F8FA 2M2IA 5DI9A 4M0DA 2VUSA 3ETEA 2J0EA 4QYXA 2P11A 4RHUA 4GXQA 4Y2HA 4E2FA 3VZDA 2PXCA 3I23A 2F9LA 2P3OA 4JA2A 5ENDA 3IUSA 5CVEA 3W1WA 1T24A 1EWVA 3N2NA 4KQEA 3FTFA 2XWBF 1Q22A 4QD3A 5C5IA 2FOIA 2PXHA 3GLQA 3RBAA 2E4ZA 5DCWA 2SKDA 5LBTA 5DN9A 1SVOA 3WYNA 1QYVA 3R8FA 2P7HA 1K75A 4FLEA 4Q1EA 5K3SA 3RIMA 1Z82A 1N9GB 4I1YA 2C0QA 4G5YA 1NLMA 2YRFA 5I48A 4FZJA 3ICOA 4BGUA 1SVMA 5A71A 3HHPA 2C0CA 4H1VA 2QP3A 3P4YA 1X42A 3MN1A 2XRMA 1LTKA 3WDSA 4DDWA 1Q0UA 3N2IA 2F3TA 4MLZA 3A1TA 2A94A 4AWAA 4CG1A 3S8EA 1K86A 1K0FA 2VSNA 2GCIA 1GZ7A 3IE1A 2XVYA 3R7FA 5KTKA 3B13B 1ZIDA 3BJZA 1W47A 3SR0A 4YT8A 4FFPA 5AW8A 4L08A 4K6MA 4ETWA 3B3QA 2ZWAA 3AEKB 3M6AA 5AJWA 1P29A 1QQ5A 1KI3A 2XKBA 1UL1X 4I4TA 3NTLA 1YK0A 1ZCBA 1EBFA 2B8WA 3OPQA 1VHJA 5H3LA 4RAQA 4F45A 4UDOA 1SQ5A 3SQWA 4YT2A 1Q7CA 2FOLA 5LL6P 3O8OB 2ATCA 5FOUA 5H1YA 3K09C 4H16A 2DCMA 4WZAA 1HPLA 3JWHA 3M5CA 2E89A 2F1OA 4PHCA 1K98A 2B25A 2BMVA 3H9EO 4YECA 1V2GA 4Q4HA 1E7SA 1Q14A 3LBNA 2OOSA 2ORED 4EUNA 2JJQA 1QYIA 4LISA 3ADBA 1NJFA 3K9NA 2IT1A 3OFJA 3PLNA 4M53A 2B82A 2WFAA 4AXBA 4Z7OB 1DKMA 4EZEA 2R7KA 1KQFA 1MCZA 2ZSJA 1U80A 4DIKA 3ZQUA 2ZOSA 3T6KA 8ABPA 3E58A 7GPBA 4FYYA 3FMFA 3BMCB 4ANFA 5HKKD 3NT5A 2LR0A 5DT9A 3OZDA 2ZXUA 2F8SA 1W29A 4MITA 4DIUA 1LSUA 1E6EA 1GAXA 3F47A 4ZVLA 4FOLA 5LFAA 2Q5HA 3KXKA 4XX1A 5IJAA 4Z3KA 1QUEA 5B1EA 2AUNA 2CHUA 3CC8A 3S7TA 5ABPA 7ABPA 4KFCA 5CLGA 3ZY6A 4BNYA 1KH1A 4TVSA 4F91B 3Q3HA 2BYTA 3GLGB 3ZNPA 4IINA 2JD0A 3FRIA 2IS6A 1WG8A 1YA4A 2PD4A 1VP9A 3B3JA 4YMHA 2O2JA 3OD5A 3RAJA 3KZVA 1Z0SA 4XSGA 5C51B 4AW9A 4MARA 2GUWA 1KI6A 1N9KA 3CU5A 2WB2A 4J0GA 1GAJA 3TL6A 4A15A 1W34A 4JLNA 4BN4A 4U4AA 2VDLB 2ZBFA 5GY7A 4OEHA 4B2LA 2UZ4A 2QEQA 1LV8A 3VDXA 2VYNA 5GIPE 4UBJA 2VF4X 4LC9A 3LQYA 2ZE7A 3L0PA 2WWXA 3CX3A 4C6SA 2VJYA 2JBWA 3Q6MA 2IYLD 3I8OA 1SIWA 4YACA 4GMGA 1RE0A 3T7JA 3VYTB 1O94D 2QXTA 4D6YA 4D4JA 3GCDA 4U0JA 5FLKA 4BHTA 4XCXA 3U37A 3F98A 4BNGA 2QNRA 2IH4A 4OYHA 4RTNA 3ROGA 2NQ8A 2BDUA 3TR5A 3W0LB 1EFRA 4KXMA 2PIDA 4UQLA 2CLOB 2Y1KA 3COPA 3K72B 5ALFA 4E11A 2EWWA 1Z25A 2VCYA 3O21A 2QS9A 1M2VB 1ZPDA 2H1CA 4YWHA 4KO2S 3U5TA 1I80A 3NWJA 1UEJA 3SSMA 1L5MA 3AL2A 4RSRA 4KQXA 4CLEA 3QKRA 4A23A 4UFPA 1T4DA 3JQAB 4J16A 3RUEA 2Q7XA 4IWYA 4DUYB 1E94E 3CF4A 3QNWA 3DT9A 3WV5A 5KMGA 4LMPA 2O05A 2GK6A 2V8OA 4MQ5A 1XV5A 1JHYA 1ZUHA 2WU4A 3DVLA 3FNIA 4GT1A 4US1R 3T95A 4C5CA 4DPKA 4FYJA 1BEZA 3FCAA 3IR7A 2QTVA 1G1MA 3AGPA 3L8HA 3PA8A 4O2BF 4P7BA 3UJ8A 2XZTA 5FB3A 3J7AC 4XSVA 4JL6A 1P74A 4EL0A 4LBYA 3DWIA 4EYKA 4ESEA 4LJ8A 4US0R 4E5NA 1Q50A 4YRQA 4X7BA 3PNQA 3WOHA 3P9XA 3AV0B 4UNNA 3RSOA 5A5EA 3HMKA 1FPQA 2O0KA 3AFOA 1LBIA 1D2CA 2WNIA 3CLHA 3WTBA 2WG2A 3HN7A 3Q8MA 1MHPA 3IODA 4LCEA 2Z95A 4S1PA 2CVPA 5KOHB 2JAUA 5BN5A 3HEAA 1NFFA 1T13A 1CQZA 1X94A 4KXUA 5H3CA 1BD3A 3UHPA 2RAUA 1YOBA 4ME6A 2GZ1A 1XLVA 3QELB 4PE5B 2C5FA 1Y4SA 4DSOA 1P72A 1VRWA 2FZ5A 1QQTA 2QW8A 2ONJA 5C7IO 2FPKA 1DIBA 1BWRA 1E1QA 2BFAA 4ZDKA 1TQHA 3E82A 1NBMA 4HRAA 1ZN9A 1KYWA 5FR1A 4EKDA 2Z57A 1RLOA 3DR5A 1QZ3A 3W2EA 2QUIA 2BEKA 2RHWA 4HYEA 3EYAA 4BDSA 5B7GA 2RGUA 3E9NA 3ZHVA 3VU9A 2HA4A 5K8CA 3VNUA 4AJEA 4PN3A 5IAOA 1OYYA 1EFCA 1T3ZA 1L8QA 2Q6KA 3VR6A 4NX2A 3T0GA 4OI4A 2PKQO 2EKZA 4ADSG 3KD3A 1KI7A 1L5RA 1OZGA 4Q3CA 1O03A 5HP4A 3R7WB 1VRVA 4IXMA 1P19A 3REFA 5I7VA 3L7OA 1OTXA 1KARA 3NETA 4YXFA 5GZ6A 2OZEA 3HA7A 3FZGA 4OQEA 4PRZA 4BVAA 1KH3A 5EJGA 5DCUA 3NC4A 4F7DA 3W6OA 1H3FA 1XMQB 2DHQA 2Y1FA 4F84A 1E1RD 3L43A 2JFGA 3USZA 4EGJA 1ACJA 2OMKA 3HR7A 3KTDA 4X61A 1UWKA 1WVGA 2OXCA 3MJTA 2HSDA 3IAAA 4Q9IA 3HDGA 2W4MA 4MZXA 4UEKA 3EZNA 4AU1A 4HBGA 1RKVA 1L5WA 4ZO4A 1M0WA 1G9TA 1TLFA 3OQPA 3BM5A 3LLVA 1BC5A 1TT7A 1YQWA 2YJGA 1JAYA 4B2IA 1SVKA 1JAXA 1IULA 1NXQA 1VPDA 1ENYA 3W9UA 1N8TA 1Z75A 1TZCA 3RFUA 3K0FA 4ZAXA 4G0QA 3SOPA 5FP0A 2AG5A 3SZUA 4V38A 5LQJA 2D5CA 1AH2A 3ESYA 2UUPA 1LDNA 2FQXA 2YDXA 3FDXA 1CY7A 3MT7A 1QGYA 1ZUNB 3PU6A 4RKWA 2JZCA 4F04A 2ZK7A 2YHBA 4H4DA 4HNVA 2GXAA 2CDAA 4YRLA 3CLRD 1V1JA 3K8OE 5JU6A 4DUPA 4WNAB 1ABFA 2FHPA 1K89A 2G9VA 5DBOA 1WQ4A 5IASA 5K5EA 3KCNA 4NCHA 1EMDA 1YSCA 1DKNA 4JZKA 4UC0A 4EHIA 3QTLA 5F12A 2FUG1 1ZFNA 4LSWA 1E98A 5KKCA 1J0BA 5ALGA 3RBVA 5B4TA 5LDDC 4QZVA 1XL0A 3GCWA 3MYRA 1M1NB 1DINA 5DYIA 3RU7A 3IPXA 2FLVA 4DAOA 4KWIA 2VZ8A 5DX8A 3FAZA 1KOJA 3SQOA 2WJPA 3C8MA 1BHJA 2BSXA 3LUDA 3GK3A 4NSNA 1I1OA 5AK4A 4CI0B 1NQXA 3ILXA 4WVLA 3HXPA 3G0HA 4BNNA 1GKIA 3FOAA 3IUBA 1KZ6A 3PGLA 4KMSA 2H54A 2X9GA 3GT0A 3RFXA 3SHQA 2ZCVA 4BQOA 4ND6A 2QBYA 3D0OA 3GRKA 4RHFA 4RUKA 2PL1A 1GTZA 3G13A 1XNRB 4BX3A 5IAJA 1KWKA 4ARUA 1V96A 3R3XA 4UNQA 1BW9B 4XQEA 3NO4A 5AM1A 3R76A 5JROA 3FRJA 3PNPA 4HFMA 4U2EA 3LPNA 4POAA 1N2HA 4JYMA 4K86A 4Q9HA 2H2IA 5EJIA 1INLA 3T3OA 3BGDA 3AVYA 5IRCD 3IBFA 5FTNA 1MTZA 1NR5A 2WKWA 1IUNA 3ZU6A 1ZOPA 4GYYA 2QL5A 4YP7A 3T4XA 1TCVA 2IXDA 1LI4A 3DLTA 2HDNB 4FHEA 4YRPA 4DCMA 3ZTTA 2ZUTA 1RMYA 3AP2A 1KFCB 4MGEA 2QRNA 4LYEA 2DR2A 3M7IA 4UEJA 1L1FA 1P33A 2DFTA 2FEPA 3GEPA 3RABA 1A72A 2FPGB 4X00A 3PXGA 4NZPA 2CNDA 2ZI5A 4O2AA 1Z16A 4CLRA 4OHXA 1SG0A 3DKVA 4AKGA 1MO6A 4KPFC 2XQJA 1Z3CA 4D6PA 3R3SA 5BYKA 3ZCSA 1NW3A 4R9SA 2YL2A 2VP2A 4PLPA 2OA0A 1NJ8A 1XVTA 4C88A 4PC1A 3KE8A 1IXZA 4NIMA 4Z99A 4G0NA 5JBQA 1U5BB 3LA6A 4JFRA 4R7ZA 2JJ2A 4TTVA 4AX4A 4IGKA 3SJ7A 3IR5A 3T52A 1TCUA 4PBTA 5BWNA 4MV3A 1SY7A 1QMPA 3PCXA 4HDQB 4DMCA 2UUBB 1F2UA 5JT1A 2XOKD 4KB5A 3PCRB 1VKHA 4FDMA 1PS0A 4OKIA 2HADA 3TAXA 4BY9E 1D6JA 2BGMA 3FVRA 3KKEA 4K03A 1SEVA 4RFLA 4XUGB 1Z6YA 1ZVQA 1Q1QA 4QJIA 1FDTA 3MGAA 3GUZA 1QS0B 3LKDA 3C1OA 5JO9A 1YKSA 1A8UA 1C9DB 4N7JA 3E81A 5AW4A 3L18A 2J3DA 2YUIA 3FKJA 3K2QA 3N2KB 1NY5A 2FWNA 1TKBA 1W25A 1AC5A 3HM2A 3MOSA 4KQJA 4L5BA 5TQ2B 5L6LB 4EHDA 3EFHA 2FMKA 4L9RA 4HN4B 1YR9A 3C7CB 3I9MA 4M87A 5DTRA 4GLLA 4YJ2A 1RMQA 1X7ZA 4J0KA 2QM0A 3QBVA 4O2BB 1XTUA 3JQQA 3CGWA 4YNBA 4ZPXA 3E53A 1G21B 1V4BA 2XWPA 1HI9A 4IHKA 4DM7A 1ZD4A 4M76B 1EA5A 2YWBA 2LCQA 3SQLA 4AF7A 3PQ3A 3Q7PA 2HFJA 1JIUA 2VTEA 4GMDA 3GV0A 4OAOA 4WK2B 1JHUA 4FOPA 5F7ZA 4NATA 1JDVA 5D1NA 1FMCA 2QQ5A 1ES9A 2FDRA 1J70A 2FRXA 1RSZA 2ZIAA 1ZN8A 2H57A 1F8UA 2ZREA 3C8UA 2HO4A 3TLCA 3WBJA 3HXMA 1QPZA 4R1LA 2B5WA 3AU8A 3FKSA 3N87A 4CMEC 5JMOA 4DR3B 2XMZA 3PGA1 3PR3A 2BW0A 4KKXB 3V4FA 4C20A 1PJSA 1SUFA 2E6KA 2II6A 5CDUA 5JFOA 1U8XX 4DMHA 1K1EA 1LW6E 5DRTA 1YMVA 2UDPA 1EJBA 4F3KA 4EGQA 1C2YA 3KJGA 3P0RA 3LYAA 4ER6A 3PZBA 3ZU4A 2P2CA 1K7XB 3VPAA 3M33A 5KREA 1VJ5A 1F6DA 3VTFA 1K92A 2O54A 4QO8A 5I51A 5C7YA 1X2BA 4B7AA 4DT1A 2BF7A 3DCJA 4L3VA 1E3MA 1KO1A 3C74A 4DC0A 2XRZA 1F8YA 1PR0A 1BCRB 1K97A 3QF7A 1ZA2A 2BFCA 1HSZA 4GX2A 3OKFA 4TXHA 2AJTA 3KEMA 4ZKEA 4NF2A 2AX4A 3NBUA 4ZVPA 4EI8A 4F2WA 4A5SA 2DH5A 4M1KA 4HWOA 4IVNA 1V16A 1J99A 3NWBA 3RUIA 3EMDA 3M6IA 4R2XA 4WV3A 2F55A 2OVBA 3T5BA 2A7QA 4TMYA 5K9ZA 1YXMA 1VGQA 4XA8A 2P1DA 5KTYA 4HJRA 5DM0A 1I6WA 1RW4A 3L1UA 2EIXA 2ZBQA 3NHKA 4IIEA 4Z4CA 2OGZA 2Q5EA 1FQOA 3O8LA 4EATA 5BO5A 3DBHA 4TLCA 4ZI7A 2JFNA 5JCJD 3WRXA 3EWNA 2BP7A 1R0ZA 2IZ5A 3U4IA 3S0JA 1GUYA 5B5SA 1X9GA 2CLDX 2OBMA 1NJ2A 4GOXA 2BEUB 2BTQA 4DIEA 5TT1A 4G0XA 1QYCA 2JLAA 1QE5A 1OIVA 2WVAA 1E3TA 4ZVSA 3V7NA 1C9YA 1G63A 5HRCA 3R75A 1PSDA 1P1FA 2WT4A 4PVCA 4X6UA 1HDGO 5JXGA 2K4MA 4HRXA 5GVSA 2VPPA 7YASA 3HCAA 4Z0TA 4BP1A 3NONA 4C0HA 3KQUA 5FFMA 4MLDA 5CBPB 1Z6AA 3DNMA 3SN6A 1ECFA 1GPJA 3RTEA 3ZU5A 3USCS 5DIZA 3C7TA 1XI2A 4HNHA 2WMDA 3JQEA 2A0FA 1QCYA 2QYHA 4NEQA 4RZHA 3BRWA 3G5MA 4TKLA 4G81A 5DNWA 3MB8A 3CVXA 3UJBA 4IRMA 3T7IA 1YI1A 3JQDA 1OD6A 4CCYA 3AW9A 2RG7A 3IB6A 1NX6A 1XTJA 2P9EA 3FOZA 5B58T 3UUFA 1XB2A 1NI5A 4HXYA 4S1OA 2DX7A 2L2QA 4ARBA 3IIJA 1YKFA 1FYEA 4WKCA 4W1SA 1M2EA 5CLLA 2B1GA 1JLSA 3ETHA 1WR8A 4BE7B 1QGAA 2O8EA 3BDAA 3LWDA 2P6MA 4B1FA 5ICCA 3NW9A 2XXBA 2YV3A 1ZVKA 1BE8A 2QLTA 3DBOB 3I6YA 4GZLA 1OREA 2VATA 3TSYA 1VJDA 2E9SA 3GDHA 4HMOA 3W7AA 2VDJA 3NWPA 3QG1A 4J7UA 1VC2A 4KTVE 4Q7KA 3MRVA 4B4DA 3U3ZA 3NH6A 2AG6A 3NWEA 3K2EA 3EVCA 4YB8A 1TU3A 4UHHA 2ZAIA 1QHXA 1UBGA 1JLMA 5AI4A 2NXNA 2Y27A 1TB4A 1AM4D 4G8DA 4ZQHA 3ABSB 3IA2A 1N5IA 3FHJA 3PHJA 4BXOA 1JU4A 3I12A 3DTVA 3GBVA 1AZWA 3OEYA 2OILA 2YV2A 4IZIA 2NO7A 4BNDA 1Y5RA 1E3DA 1W4LA 2QTWB 1JYSA 4FOTA 4Z4HA 4WUTA 4V3BA 5IPFA 1KU6A 3P5SA 4AJ9A 3HGTA 5CX1B 2WAXA 1MVNA 3EIFA 3PV0A 1OXTA 3P0JA 3FHTA 3H9GA 4PVDA 2QI9C 4WKNA 2WQ6A 2G28A 3HKBB 1JKMA 1CDOA 2O7SA 3FRHA 4J9UE 4L5CA 2Y71A 4QQFA 1J1IA 3MMPA 5CD9A 3RFTA 5I9MA 1DFGA 4AS3A 2FPPA 2QTNA 1VCNA 4AT1A 5KHOC 5M34A 3HKEA 3ZWXA 4TUYA 4YUVA 1KAEA 4NK4A 2WIAA 1A1SA 4UW9A 2Q99A 2I2DA 5FXMA 3T9DA 1I4WA 2JW5A 1I10A 2D1YA 2UZ1B 4XYBA 3VI4B 3U62A 1VG0B 2WNHA 4WASA 2JAWA 1M5TA 3FBTA 3KPWA 3RM3A 3BVPA 2CNWA 3IEXA 1AV6A 4MI6A 3CLVA 3AVQA 1UBKS 2PQ2A 2XQKA 1IHXA 1QQAA 1RXIA 2HHHB 3B85A 4TL9A 4A8HA 3COJA 1N32B 1ZJ5A 1HE2A 2D2FA 3Q7RA 1SU7A 4L3WA 4XB6B 3UANA 3ER6A 3I5XA 3GGPA 2Y66A 3VR5A 1G41A 3Q5DA 4MOWA 1GGMA 4WERA 2I2AA 4LZJA 5HDQA 3IELA 2X0EA 1J1ZA 2J8ZA 1TU4A 1H8ED 4HAYA 3AL0C 5F5LA 2ORIA 2DSNA 4HATA 4N82A 4QXPA 3W4JA 3GLIA 3F8TA 3CUKA 3DZGA 5KIAA 4OH7A 1DARA 3IJEB 1ICEA 1WSWA 3Q7EA 5JG7A 1QFZA 1U9CA 2LTAA 1ORIA 1V47A 2CFCA 1GZ4A 1V7QA 4JI6B 2X0DA 2NT4A 2RH5A 2WABA 5FUVA 5AYVA 3VYWA 3ASYA 3AH8A 2D13A 2POCA 2QZPA 4JK3A 4Q9JA 4G4SP 4K1LA 3IPCA 3FPCA 3B3GA 1RYHA 3DMYA 4AICA 1OA0A 4NMWA 1R6TA 4NHOA 2WIJA 3LMKA 3C48A 4YVFA 1L7NA 1LH0A 3PE6A 1SBYA 2GBCA 3CZAA 3F7OA 4I6JA 1F4PA 1EFVB 2BJHA 4Y9DA 2WUVA 2VJAA 5ALDA 4IRUB 4O6VA 3VVCA 2JHPA 2JEYA 5JWOA 1PKXA 4J94A 4OMUA 4P92A 4BZWA 3EAFA 4YRTA 3U7QA 3ZNNA 4DM3A 2O1XA 3P8ZA 4A8JA 3QFCA 4RZQA 1XKQA 5SYNA 1AQLA 3I2JA 3KVRA 2EGUA 3BKWA 1IVYA 4NAHA 5JXJA 3P9KA 1WZUA 4LRWA 2ACWA 1J09A 1H2XA 1XNGA 3A2KA 4HFJA 3AEYA 3C3WA 1GXSA 3N8GA 2OL4A 4BASA 2DMRA 1KJ8A 3JPWA 4MR9A 5FI3A 4YMUA 4DCVA 1EHYA 3LQFA 1EVKA 4IIVA 4I9UA 1UXIA 4FWTA 4M55A 2JLRA 4FDTA 4ZAYA 5U4XA 3RRYA 3G2NA 4LF9B 3DV0A 3EC1A 1IHPA 4HB0A 2GBFA 3DAHA 3OE5A 4IHAA 4QEKA 2RGYA 3MK31 3QE4A 3LF2A 5JCXA 3Q8LA 5CYFA 3S1SA 1L6IA 2J33A 4QO7A 3SKYA 4LF5B 5ILGA 4C3OB 3ZWOA 1SCIA 4GI3A 1A9YA 1SD5A 2QL9A 2HXYA 2RGDA 3L1KA 3MUNA 1ZISA 4R98A 4KOEC 1PZEA 5E2BA 3VR3A 1Z4QA 5ESDA 2DFLA 1FW8A 3QNMA 3QVWA 4INAA 3CT6A 3ZE9A 3K35A 4BFUA 2OGUA 1RKUA 1DC3A 3CNEA 3CVJA 3T5AA 4I50A 3G0OA 3H1EA 5JSYA 4TMWA 1SCUA 2ENWA 3D4IA 3GROA 5K3CA 3UGKA 5CIYA 4HKTA 4RIFA 3TOCA 3I34X 1AZTA 1IRIA 2CNOA 3GGOA 4UUNA 5BXQC 1RPJA 1CDZA 2Y1OA 4L2IB 3W9BA 4GUDA 1X0VA 3NPAA 3WXMA 4EW6A 1HE5A 2DPLA 3DONA 4G1VA 2OV2A 1JSLA 4DQDA 5JC8A 1XQ9A 3EQ9A 4K40A 3BZBA 3QPCA 4PZ9A 4BGDA 1KVSA 2MOKA 4BLSA 4IY1A 2EHDA 2AC4A 2G1AA 2JVKA 4TLEA 1QFJA 4QNMA 2V7QD 2QLMA 1QE3A 2UVPB 3BGVA 3ISJA 2B21A 5BVHB 4I4CA 3ZHRA 4IYJA 4QUAA 5SY4A 1M2GA 1XLUA 3F5QA 3ZW9A 2ZGVA 3D7MA 4PPGA 2IUYA 5EZSA 3RT7A 2QVLA 5IMSA 3B3FA 2Q5OA 5F64A 3UPTA 1BKYA 3TRJA 2YWJA 4C7KA 5CEJA 2EX4A 3GYBA 1ZN2A 2G36A 1DC5A 1GRNA 1K6IA 3FROA 3TKAA 3K1AA 3LHIA 3TLXA 5JQWA 3TL2A 4EOGA 1JPNA 2NO5A 2NV6A 3DOUA 2C59A 4N4AA 3W7BA 1RQNA 1WAMA 2XQFA 3AM4A 3EWSA 1YDGA 2C03A 1Q0QA 3BIXA 1N5OX 2VTKA 3FB1A 4J75A 3I2KA 1THGA 4LNAA 4TYYA 1NYLA 3CUTA 2RG1A 1X80A 1OPRA 2FLWA 2ZJ1A 3JD0A 1WDLA 1YB4A 5DBIA 3U7GA 2SBTA 1QG0A 2IE8A 2JFFA 3CB2A 3EASA 4GI5A 1B0PA 1E9BA 1G9XA 2AN9A 1BVRA 4DABA 2XPCA 4C7OB 4RLQA 2VN8A 3BD6A 4Q47A 3D8TA 3H86A 4MUFA 1VI6A 2WA1A 4JWTA 2B4QA 1HFKA 3HDJA 3L8MA 2WHQA 3EZXA 2QMQA 1T4BA 4OJNA 3G2HA 3NHJA 5C1OA 1H0SA 1PR3A 3OE7A 3H1BA 2YUTA 1UKEA 2ESRA 4FHFA 4RTRA 4XFKA 3ICVA 3LS2A 1YRAA 5JIBA 2PZEA 3QEAZ 5ALOA 2P4EA 1B26A 1A9OA 1TKCA 3UAZA 3RIHA 3NGXA 2V1UA 1JJIA 1TFUA 1WOMA 4PAOA 1L7EA 1EGVB 4DZZA 1WM1A 2ODQA 2PGJA 1RXUA 4MWGA 2GBLC 1HSOA 1W48A 2ZT5A 5FJJA 1YJQA 4WBNF 2F8TA 1SUBA 3S4YA 8MHTA 4ARVA 2PMFA 4CM4B 3O9ZA 4IGAA 4GP6A 4LJ6A 4HN2A 1U11A 3RVNA 1VHLA 3H3XA 3LQ4A 2IHJA 3FR7A 2Y76A 1UJ2A 4DA8A 5JNVA 3MSCA 3SHFA 3TOSA 4BOYA 5M5BA 3EH1A 2V7GA 1SU6A 5CM8B 4N7MA 3H04A 3OWXA 3B6EA 2XODA 5FOXA 4DHWA 2NO6A 4AUKA 2L42A 4E21A 4ZTUB 1MBZA 3TXXA 4E5VA 4PGHA 4B33A 2PJZA 2P0YA 5JNUA 1O5TA 5F2EA 1TJ4A 4YAKA 1RPNA 5EMKA 3GY0A 3JY6A 4UKDA 2VBCA 5AVYA 2G9NA 3W2HA 1V45E 2VPZA 5I7EA 4CQNA 1GTRA 3JZAA 1XWIA 3PBKA 4H27A 4ZQBA 1IDN1 1OFHA 1Q3HA 4R31A 5KNDH 1POWA 3Q5GA 3R0JA 5REQB 1FLAA 1JQLB 3GNLA 2X23A 5JJ5A 1C3VA 1GTMA 4R0VA 1AF7A 4P32A 5JOQA 4GKAA 3QVGA 5D6OA 2H31A 4UFOA 4V2IA 1ZI6A 4JJKA 2OK7A 1B41A 3CLUC 3I4LA 3TLMA 2QXYA 5EESA 1XJQA 3GDOA 3O73A 2AV6A 4WLEA 4XE5A 4XFDA 5AXBA 5CB4A 2XXJA 2O3SA 5JPIA 3VSDA 1IQPA 3ABQB 1SC3A 2I55A 2QMHA 2POQX 1NW4A 2AG8A 3HYTA 3NAQA 4J07A 4AF6A 3IBGA 1H6DA 4P84A 3KSDO 3OETA 2O57A 4JX8A 5FAKA 1QG6A 2AF4C 3OQIA 4CIBA 3H5IA 5MGNA 2YDYA 3CKMA 1NNI1 1Y48E 4DBLE 2ZM5A 1EFHA 1EIZA 6PFKA 2Z8YM 3F2IA 3UTCA 4ITUA 4TKUA 5KJFA 4M60A 4C21A 4RVCA 4BLUA 1ZJ4A 2HMVA 2HJRA 2HM7A 2MYPA 2J9FA 3EHDA 2X1HA 3ETJA 3MJRA 4YCDA 4JOSA 4F1KA 1ZR2A 1E9DA 3A26A 4BMSA 4HWGA 4E2WA 2IZOA 1TIKA 3IHWA 3HN6A 4WZAB 4EW2A 4I5IA 3K0CA 4G84A 4WNCA 1IEWA 2WIFA 3LY7A 3MRXA 2PXXA 4FR2A 3UAGA 4ZOEA 2OV4A 4AKEA 1G16A 2PUFA 5TY0A 2JH8A 4Y9UA 4CT4B 4KG7A 2NU7A 1TQ8A 4Q9NA 1M8PA 5BNZA 5AK3A 2IU0A 1Q3KA 2WYWA 2PBFA 4G23A 2H9IA 3LLSA 3QVTA 3AQIA 3B1VA 3WGJA 4RE6A 5IKMA 2XEDA 1SN7A 1KH2A 1TPYA 3ANSA 2EIHA 4FS8A 3W4IA 1N3IA 3FSEA 1SH7A 4MI3A 3CKYA 3UUWA 2PUEA 1KYXA 2FN9A 1CR6A 1UCFA 3HUFA 3ELYA 3NEJA 4MCIA 5F33A 5F1OA 5TEWA 1T9BA 4FK8A 4Q7EA 3WKEA 1GVNB 4N5HX 4K6FA 3I1YA 3KUXA 3L41A 4X3CA 2XB4A 3U3KA 2DWUA 4TYPA 9LDTA 2GGSA 4FEEA 2GB4A 3LKZA 3VQTA 1VG9B 1A8HA 2Q4EA 4X3OA 4XRRA 5HKAA 5F52A 1W36B 5K1ZA 1QG2A 3KT0A 2V0GA 5F9HA 5CB8A 2P2NA 3U4HA 3KJEA 3SOZA 3KS9A 3VDNB 2EV9A 2IGTA 4EQZA 1OXMA 1NI4A 2PL9A 4URYR 3MCUA 2GN1A 4Q4LA 1R7RA 5EMLA 2ZRGA 3IBSA 5F4BA 2HCJB 4HGOA 1EAYA 1JLKA 4N5MA 5CFOA 1M8FA 4ZMSA 2BISA 2D7JA 1MJNA 4O2AF 1KTVA 4R41A 3AFGA 1A7AA 2EEPA 2QA5A 4FYIA 4K81B 5TQ0A 4DRXA 4Y9SA 3AVWA 5L51A 1HBJA 1XZPA 3WYDA 1ZD8A 3F49S 4OHOA 1CS0A 2IYFA 4RY2A 4O25A 1KA9H 4BO5A 3SE0A 3NIGB 1ZM9A 1PQUA 3AKZA 3TX2A 4Y2VA 1Q91A 2ZI4A 1WZ2A 3K0HA 3MELA 3GFQA 2KLHA 4FWBA 3QIVA 1WHSA 4IZHA 2WYUA 3IQFA 5BPHA 3D8NA 1E2JA 1O96A 2QX8A 3EIQA 1VZ2A 1Q21A 1XXHE 2QD2A 1KS2A 1TXGA 2XOXA 2VFAA 3JATB 2R6GA 1ZOLA 2ZRIA 1G20A 4W7SA 2E2WA 4AJLA 1NYRA 3L77A 3KSRA 3OUTA 4ZHQF 1KZ9A 3CUVA 2A9OA 3FKQA 3OQHA 3B70A 4HEA1 3G2JA 4RVFA 4KHPB 2HWKA 3N75A 5F7JA 1Z5OA 1UH5A 1V39A 3SXUA 4ENTA 2V65A 3T15A 1GFSA 5HK9A 4YHHB 1H85A 5KMGB 2A30A 1VPVA 3FHOA 4HAUA 3RS8A 4HWRA 4ZFNA 1T1EA 3JVUA 2X8AA 4Y67A 3P9YA 2IYTA 3WLLA 2V03A 3AOEC 4CJXA 1ISRA 5EWJA 4Q7MB 5FT9A 5EHNA 1DS6A 4R8VA 5E3JA 1NOIA 3D2LA 3O3MB 3D6MA 4OU5A 1ZI9A 3AJ8A 4RLSA 4OQ4A 4BCCA 2FMXA 4DHEA 4DJFC 4BVFA 3FH0A 2CFTA 2FETA 2EWMA 4LXTA 3Q7SA 5DM2A 4L72A 4WIAA 2XE7A 5DT2A 5JE8A 3V55A 1JA9A 1G3RA 2WY2D 3WHPA 3THYB 4CG0A 2I3GA 2YJTD 3JQ7A 4POOA 5KHAA 1F7UA 3EPRA 1YHNA 5AXDA 3IP7A 1Z5UA 2FX2A 1DRKA 3USES 1Q7RA 2OFOA 3FFTA 4Y30A 1D09A 1V9SA 2CFIA 2WJ4A 4BFVA 4CLDA 3GLFA 2UYHA 2W0MA 4KV7A 1PR5A 4ZAZA 5KYKA 1R0RE 4Q00A 2GD1O 3RIYA 4B3TB 1QOZA 1UR5A 1VP3A 2R4QA 3M6XA 4F4CA 1EYZA 1MP0A 1F2TA 4D42A 4MVJF 1F14A 4TZTA 4E32A 4PZZA 1DO8A 2KQUA 4R2KA 3DV2A 4EO7A 1ECGA 1QHGA 3QUBA 3HJTA 1NQ5A 3CNOA 1TZMA 1UZLA 3S7ZA 3QLUA 3UWKA 3VU9B 4CMJA 4KXNA 1FXUA 1C9JA 1PT9A 3C14C 4PG7A 4C0KA 4C4TA 3QUQA 2ZTLA 3DTTA 4L76A 4W9NA 5B7NA 4F1WA 4P6VF 2VDOB 3L46A 2R00A 2YIMA 3Q3JB 2C4HA 4ZYXA 2PUGA 1V6CA 4F9TA 2PCLA 1OAKA 1RBQA 1IOVA 5BNWA 3SIXA 4I3FA 1ADFA 1N0WA 4DCPA 2I7DA 3NHMA 3DE0X 4LC0A 5FHQA 2VBGA 2GZMA 2ZAMA 1FVFA 5E2IA 4C03A 1DC7A 1SD2A 1K63A 1KJ9A 1UBJS 4KSYA 2IBTA 5JYCA 2QU7A 1R6UA 3K31A 1U90A 5F9MA 3WL8A 2G5PA 2I8AA 3B6MA 3M5PA 3BWBA 3Q9UA 5KEIA 1Y42X 4Z4FA 1CB0A 1PR4A 3O92A 1NQUA 2OZKA 2QGFA 3EOZA 1Z28A 4FJ1A 1TVKA 2X15A 1Z34A 2ZJAA 3Q15C 4LXXA 4JSRA 1ZKDA 4L27A 1X15A 4PO8A 5EGNA 2Z5VA 4BJ1A 1A8QA 2P77A 2RGCA 1KVRA 1PDOA 2XNKA 1ECBA 1E4OA 4PZDA 4CRWB 1H9BA 1OVMA 5EKSA 5IJZA 1B8VA 4LPSA 1CVIA 3G9UA 4BECA 2XE6A 3FNQA 3ELDA 1CUAA 1E0JA 2CE2X 3F46A 2IV2X 3TS1A 4XOIA 1TCBA 4XVQA 1F4LA 1CUGA 3HG7A 3OEHA 4DLWA 4Q4CA 3I09A 3K0FB 1WUKS 3EDMA 4N3AA 3RFCA 4N49A 2VWGA 3ZDQA 3QX8A 5G02A 2AKEA 2W58A 5FHRA 1V8FA 1QZZA 2VHCA 4EUKA 4C4OA 3QV1A 1FFXA 4KDEA 1VSTA 5C8VA 2BFWA 2IS1A 1EWKA 2RDMA 1V9LA 3T1VA 3OUZA 3BFXA 5THKA 4BZQA 3P71T 5GQSA 1JIXA 1MXFA 2QZSA 1PEYA 1DVRA 3R6TA 1W85A 3DGFC 3TRKA 3I52A 4D0LB 2PX2A 1YFJA 2EEZA 3BULA 4WEQA 3DEHA 3D2AA 1V8PA 1QH1A 1WRBA 2IEIA 3DGEC 1VKRA 4TYQA 5IH7A 1SNYA 3NDBB 1DRJA 3RTBA 1QORA 3JV7A 2H0RA 3SD7A 2J08A 5JCOA 2VNHA 3AHCA 3ZIUA 1E66A 2ANCA 1ZRHA 5SYMA 2XZOA 3IT0A 1HEIA 1S3GA 1U0EA 3KOUA 4OP3A 4E46A 1CXZA 3O84A 3TXYA 2LNDA 2LWIA 3FCUB 2UZ3A 4MVJP 4GPIB 5NULA 2QBYB 1U0BB 2KBFA 1Z5NA 4TKMA 2B78A 2D5IA 1OROA 5L4NA 1KFBB 2QX6A 4DR1B 3DWFA 2JI8A 1N6NA 1EUQA 3BD8A 4LYFA 2XW6A 2RHJA 1Z37A 3T7SA 2WICA 3N6VA 2PZJA 2X3UA 3NKVA 3VH2A 1EVZA 3AFNA 3TR0A 3N3BC 1P7WA 2NGRA 3HCEA 1XROA 2NN3C 4OXYA 2FTKE 3WKBA 4RIIA 1IOZA 3HXLA 2ZE5A 2IELA 4PX3A 4RD3A 1KK1A 4HLDA 5JSUA 5MHTA 1LVGA 3SY8A 5BR4A 2C84A 1VBFA 1G8PA 2BGKA 2YV5A 4H6PA 1C7ZA 3L0SA 3LK7A 3FUUA 3KQSA 5AQEA 4PYNA 5JD6A 2X1MA 2E7ZA 3NORA 1RU3A 4G24A 1MOZA 4ZVTA 3ZN2A 4R8RA 5AT1A 4F3YA 5G0TA 1PNOA 4H3SA 4NRDA 4OQPA 4O2AB 4P5DA 5LB2A 3FDJA 3I30X 2EF0A 3M1YA 2W2XA 4RZ2A 4HLUA 2J6CA 2DPGA 3AR4A 3HKCB 4YLEA 1E6KA 4MX8A 1YFZA 2FZVA 2JRLA 2B99A 3FVVA 4ZA2A 4P54A 5I7HA 1QJCA 1CUSA 1X7XA 1E7YA 3M4XA 3TYXA 2X22A 2H1VA 2Q2QA 3AR5A 4KFSA 4CIXA 4B47A 5CT9A 2C8JA 3WMXA 2ZI6A 3IC5A 4J49A 1CUEA 9GPBA 1B0UA 3BB4A 1F2UB 1IHYA 2C8KA 4LNHA 2DBVO 3GJ5A 1SRRA 2GJSA 4V1CB 4ZHQB 3GW8A 3FMGA 2F4VB 2A6PA