2UYGA

Crystallogaphic structure of the typeii 3-dehydroquinase from thermus thermophilus
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
141
structure length
141
Chain Sequence
b'MVLILNGPNLNLLGRREPEVYGRTTLEELEALCEAWGAELGLGVVFRQTNYEGQLIEWVQQAHQEGFLAIVLNPGALTHYSYALLDAIRAQPLPVVEVHLTNLHAREEFRRHSVTAPACRGIVSGFGPLSYKLALVYLAET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-DEHYDROQUINATE DEHYDRATASE
publication title Crystallogaphic Structure of the Typeii 3-Dehydroquinase from Thermus Thermophilus
rcsb
source organism Thermus thermophilus
molecule tags Lyase
total genus 46
structure length 141
sequence length 141
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01220 DHquinase_II Dehydroquinase class II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.9100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Dehydroquinase, class II 2uygA00
3KIPA 3N59A 4RHCA 4B6SA 4B6OA 1GU1A 4CKWB 2XD9A 2Y71A 4KIJA 5WRFA 4CKXA 3N87A 2XB9A 1UQRA 1GU0A 1GQOA 4V0SA 3N76A 4CKYA 4RC9A 3U80A 4CIYA 2C4VA 4CIVA 2WKSA 4CL0A 1H0RA 3N8KA 1H05A 4B6QA 1D0IA 4CKWA 4CIXA 2XB8A 3LWZA 3N7AA 4CIWA 2DHQA 1H0SA 1J2YA 2C57A 2BT4A 2XDAA 2Y77A 4L8LA 5B6PA 1GTZA 1V1JA 2C4WA 3N86A 4CKZA 2CJFA 2UYGA 2Y76A 4B6RA 3N8NA 4KI7A 4KIWA 4KIUA 4ZC1A 4B6PA
chains in the Genus database with same CATH superfamily
3W2IA 4H7PA 4YP5A 4C2AA 3EZLA 1RYMA 1ZVMA 5D6NA 5KS2A 3I1JA 4RPCA 4Q9IA 4BZQA 2GDZA 3GUZA 1IZZA 1F5SA 2PKXA 1BZYA 3QUAA 2W9XA 3HYSA 1PJ8A 4GXTA 2G0AA 3NBUA 3NIWA 4QNRA 3TMKA 2XIQA 1Y33E 2PT9A 2RGAA 5DTQA 3UM9A 4KAAA 1PR9A 1WDKA 4YCNA 1BXRB 3F7TA 1I5OA 1AZLA 1E1QD 1YVDA 3KWFA 5CITA 1JDTA 1X8JA 4CM3A 1SHZA 3CINA 3FSEA 1MX3A 1OW3B 2QQGA 1Z8DA 2VLIA 2Q1XA 1WF3A 1TAGA 3Q5GA 3I09A 4NIMA 3NT2A 1OF1A 3L6BA 2WTNA 4MUGA 1LRJA 3DOJA 1S9HA 2F67A 4MHTA 4TMZA 5DB4A 3Q5EA 5G40A 2MTBA 3QPWA 1GFWA 3AUTA 5ESRA 2GRAA 5EWMA 2WFAA 4IUBS 3E05A 4KGXA 4XJSA 3BOSA 2V59A 3UB2A 5J1TB 1X7DA 3H97A 2GRUA 2C1EA 2AV6A 1HE8B 3R5SA 3N5CA 4IL5A 5TPWA 3H8WA 5F21A 4TRMA 1V8PA 2XCQA 3P26A 3KAPA 3BWBA 3CURA 4K6MA 3EAGA 2I7VA 5CBKA 3LZCA 8ATCA 2ZE7A 3ZZNA 5CAEB 3P19A 3RSLA 1ZJ6A 2QKYA 4O4IB 1CJTC 2IY7A 2V6IA 3C8UA 1QRTA 2ZWAA 3GRPA 3O7WA 5IC6A 4CHTA 1ZOSA 1C5KA 2BHSA 4L9SA 3OG9A 3ROKA 4BZPA 2H1LA 3AKEA 2PT5A 4A27A 3KUCA 3THRA 5G0TA 1OFGA 2NUBA 3HKCB 1MW8X 3KFXA 3WISA 1XRLA 1J70A 4US0R 5REQB 3G1UA 4MA0A 3TDMA 3T5DA 3TIIA 3ZCTA 3ZCQA 5ADUS 3I01M 5LLDA 4YNBA 4QPJC 1CULC 2XAAA 1XDDA 5FEUA 4L15A 4HZUB 1D4FA 1XJCA 5TSDA 5AKLA 1ZNZA 2CF5A 5I9NA 5JDIA 3GJ3A 2Y66A 3I2JA 4UZSA 1GNRA 3FYTA 1T2DA 3N2YA 1GGEA 2NAPA 4MROA 5T3UA 3GZJA 5EMLA 4DM7A 3PYLA 1GNTA 4HGOA 3E8SA 1YH3A 2P5TB 3EXHC 1CR4A 3TRDA 1F4LA 1XEFA 3RSHA 1NC3A 4D9IA 1SEPA 3GG9A 4FYKA 4HB4A 2W71A 4OA8A 4EBFA 5BSHA 1JH8A 4LHEA 1Y8RA 1YIDA 1ZM2A 4MNTA 4PXSA 10MHA 3ETCA 1GCAA 3JAKA 2UZAA 4DLPA 5AWFC 3F4KA 3M4XA 4ZCQA 4I9UA 1ZNWA 4KE7A 2IPXA 1JPNA 2ZSEA 4Y2HA 4FJ0A 3Q9SA 2BEKA 5H3CA 5I9BA 1UC8A 2FRDA 4RFSB 1NF2A 2AEJA 1FLDA 4MAMA 2OCBA 1R4AA 3FUTA 1OZHA 3G9ZA 4O25A 4YRCA 3U9LA 1JP7A 4ATNA 2X9QA 2AE1A 5DI3A 3BL8A 1A7AA 5EN4A 4I3HA 4IGFA 4UDXX 2NO1A 2H65A 4G0PA 1DOAA 4R8KA 4JH0A 3QYJA 4M9XA 4EJMA 3IUYA 4AKTA 3RYHA 2AWOA 3LXUX 1BQEA 2GFIA 2GZDA 3HTXA 1OJ7A 1R8JA 3O6VA 4EA7A 2FF7A 5K6AA 3M5WA 2A9JA 4OQEA 2W8BA 4GEKA 1HDZA 4F1WA 2XTMA 3OJXA 4IOMA 4M0FA 3X1WA 2J8ZA 2CMKA 4ER6A 2JLUA 4KAFA 4MOWA 3DGFC 1IOLA 2IXGA 4JBNA 1XEAA 3VPHA 1C81A 3MFQA 4NCAA 1K9VF 2H06A 1ISHA 4TKVA 5C46F 3PDCA 2AW5A 4M54A 4G1FA 2JFQA 1B3BA 1SXJB 2ZW9A 1W34A 2AOXA 2YV3A 4G1UC 2QUIA 3UCXA 3VVBA 1GPBA 1HPLA 3KG2A 4I2NA 2NXWA 1FZQA 3P0FA 5JDCA 2I7DA 2AR0A 3TS1A 1X7WA 5F3RA 1HYQA 3HCNA 1TC2A 1UKEA 1QVZA 1GA1A 1SVOA 2R2GA 3WGKA 3OZSA 1ONPA 2FMXA 3N2KA 5HK8A 2XKJE 1GO2A 3OE1A 3WWOA 2CXUA 2MMGA 4IIJB 3ZWYA 3O26A 4ZARA 4BO6A 2AK3A 5IDYA 2GASA 3L41A 4BAUA 1YK1A 4JUIA 3BXXA 2PJUA 2B94A 3JX9A 2J48A 5D01A 2A92A 4QVIA 5F3WB 3GJ5A 4C88A 1P73A 3C7KA 3KLBA 5FOTA 1JHQA 1W0KD 1I3OA 1L5HA 2WT4A 3DAFA 2CVZA 1DDIA 3V48A 4E1VA 3GJ6A 1RI4A 2Q1WA 1ONNA 1RYFA 2FXVA 3EIHA 4JSYA 2GVZC 3G82C 1D9ZA 4QUKA 2O05A 2P11A 2AD1A 2D3WA 1RWMA 5M7EA 4L75A 1QOPB 3KV3O 2XOKD 5TY0A 3C70A 5ALKA 1SZJG 1VKRA 2BGNA 2CLDX 4JJ6A 1UAGA 3R9KA 5JFTA 2ZRDA 3KSBC 3KYJB 4WVFA 5ITZB 2WHPB 2Y2UA 4UQOA 1KJ8A 3IUEA 1IQPA 2J46A 5EMMA 3K9LA 2Z2ZA 3QPBA 4EFNA 3IIJA 1U0NA 2C57A 5JD3A 2REBA 4LDZA 5JC1A 4KR6A 3ZHYA 1L4MA 3G59A 4KQIA 1D1TA 4PCVA 5FUYA 1DU4A 3E22B 3E9QA 3QX7A 4LXGA 2OXEA 1ZESA 1E96A 4QLAA 4AK9A 4E33A 3ISVA 4RFLA 3HLKA 2Y99A 2YQ5A 4KK4A 1NYLA 1XXHB 3F4BA 2OXFA 1GVNB 4FGZA 4JJIA 4MIEA 3UMGA 1DBPA 2G72A 3A4IA 4XM0A 4EX6A 1UC5B 2H4YA 5LNK6 1Y5RA 2TMDA 4O59O 4TL8A 4DIFA 5A3RA 2D6FA 3FKJA 5F2OA 2JFYA 4C7OA 1U2DA 3HUFA 4IIBA 5F7JA 2CZCA 1NW6A 3SX2A 2FR1A 3CM0A 3COPA 1C30A 1AK2A 3IVAA 5EUMA 4PLCA 3AVTA 4E5YA 1T9DA 2XBMA 1B93A 2IYSA 3MUEA 4DSTA 1SUIA 2YMPA 4WCVA 5D3KA 3COYA 1E3WA 3KT8A 5HP4A 4EYKA 1B23P 4E07A 1LK7A 2AOUA 2Q4DA 2C5AA 2P35A 1F2DA 3LUKA 4GZ3A 5ERGB 5KSOA 1SA0A 2QN9A 5EJ6A 3G8YA 3NAMA 5TMBA 4GR4A 4FE4A 4RESA 2CVOA 2L17A 4Q9AA 2O2HA 5A0TA 1QV9A 2JIMA 1KYYA 3AERA 1SHKA 2DLDA 3A1TA 1JDBB 4HUQB 3QU5A 2OHXA 3IP6A 3ZZMA 4AM8A 1Q91A 1C9EA 4PYQA 1YB5A 3ICWA 4GBGA 1TYDE 2AJCA 1OTHA 3OFJA 2GEUA 3MF4A 4AO7A 4N48A 4HDRB 1Y7PA 3TPFA 4GGPA 1TUIA 3WSWA 4V3BA 2R7NA 1ZDMA 4YPFA 4DWOA 1J90A 4FSDA 3RD5A 1OBFO 1OZAA 4A8JC 4E03A 1R74A 3OZUA 1PWHA 3FLBA 3OMWA 1MAWA 3Q40A 1DV1A 2HDNB 1KEEB 3RSZA 3ZZTA 1VHTA 2EJBA 3HJBA 3KOOA 5MDHA 1T6BY 1N8NA 1UDWA 3MCZA 1KEKA 3KJXA 1IOVA 1BWSA 1TD9A 1MIOA 1YGYA 2XB4A 3BJMA 3EXFA 3WXMA 5IDQA 2JFFA 2CYCA 3EZGA 3PXGA 4DUYB 1LI4A 3ENKA 4IKOA 3C3CA 4CF3A 1JWLA 1KK0A 4KN9S 2DHEA 3Q7EA 2QSUA 4M21A 2PUCA 1H94A 3KOMA 3CH5A 2QAGA 3CLUC 3HXTA 3QX8A 1PK8A 5B2ZA 4H7IA 1RW4A 4CQMD 1BXGA 1XLTA 3HRIA 5IDXA 3GJ0A 1FPMA 2PH3A 3PP8A 2VLBA 2P90A 2Y6UA 2ZITA 5IVKA 4DDMA 3K73O 5REQA 3K9QO 3NUQA 1JUDA 5KVAA 1T4BA 5DEIA 1AQNA 1AGXA 3HY3A 5CTAA 4R69A 1ODKA 2ACKA 4I1SA 4QTYA 1J09A 1JKIA 3GEBA 1Z0FA 5KPJA 3LXRA 1TJNA 2CBZA 4JOBA 4QDKA 4P58A 3GELA 3LL4A 4BB0A 4Z4HA 1E18A 1XG5A 1QFYA 1PGOA 4KIJA 2YR0A 2PNJA 2O8VA 3IJEB 2IZ6A 1D07A 2XI4A 3FAKA 3L7OA 1Z74A 2CVPA 3PCXA 5DNAA 5B55A 2BM0A 1VLZA 1X92A 2APJA 2H5EA 1CU1A 2RAFA 3JZAA 4FGLA 4HB0A 3HHPA 3VR2A 5FPYA 5DTJA 2IP1A 3DL0A 4ZEWA 3G2LA 1E7RA 4LWPA 4EB3A 4OHWA 4ESEA 1FP7A 1QK3A 2JEZA 1MVOA 2Q1SA 1WSWA 1O89A 1VE7A 1B2RA 1PR2A 1C9KA 1EG2A 1T26A 3C15C 4BQQA 5K0ZA 2GYWA 4YUAA 4PANA 2O3JA 5F7OA 1RWWA 4LV6A 5PGMA 1QHXA 2PWBA 1MB2A 5FBRB 4CT5A 3QVGB 5CCBA 2OHJA 2P2GA 1AV7A 5CA0B 3A10A 1O0CA 1RIFA 1XK6A 3MCVA 3CLSC 2RHCA 3LPMA 1F2UB 5A4FS 3FE2A 3FDXA 5CD1A 3MTGA 4G1MB 2OCKA 3DEAA 1U8CB 1H9CA 3HJGA 2QPAA 5DE3A 1V3VA 4N5DA 4TTTS 3ZDRA 4BNYA 3PFFA 4DLLA 1QB7A 3MAJA 4JI7B 3O38A 4MVXA 1Y7IA 5JCOA 3PC4A 4YDRA 4P7BA 1HMYA 4YJHB 3G7SA 1YBMA 3KEMA 1OI3A 1OX5A 1PR5A 4U00A 4UOZA 1A4UA 3WRXA 2W6ID 1H0SA 2PBZA 1PYOA 1VI6A 4M76B 5JR3A 5CM8B 5AJUA 1XNRB 3KUDA 2BC9A 5CB8A 4EHNA 1UBTS 4Q1FA 1ZWLA 5C3MA 2AQHA 2XQFA 3A1FA 1JQLB 4GVPA 5CB4F 1JA0A 1KFJB 1ZN2A 3CW9A 3L0BA 5JJKA 1L7XA 3ROTA 4C0HA 4KMRA 4R0NA 2JZCA 1U9JA 2AJBA 4F2HA 3TF5A 1BVHA 4FN4A 1E1RA 2EVWX 1H8ED 4DIDA 1J9GA 4I46A 1I14A 5BVGA 1BHO1 4G4IA 3PJFA 5DCYA 2IEYA 1DRJA 5JADA 1JHMA 2C96A 2HV9A 2ZYUX 1RM3A 2R4TA 3WK5A 4NH0A 3HCDA 3HVUA 1PFGA 1RC0A 2OPBA 2CXQA 5DM1A 2HRBA 3N1UA 3DYIA 2P9HA 4IIJA 4L7VA 4DVJA 3NDBB 4JC5A 1ST2A 4NEQA 2OCDA 4M7RA 3PFNA 2QL6A 1PQYA 3PIDA 4RH1A 5U4QA 3DL7A 5HG0A 4Q66C 1JKFA 3DBVO 5CT5A 2QYHA 1OIXA 4YRMA 1ZN7A 4JIGA 4PSKA 3QXGA 3MAGA 3NVAA 4FR0A 4U9UA 4V3CA 4EF6A 5KYKA 4BLVA 3DDCA 4HEA6 1E2FA 3DW1X 3LOPA 1EFHA 3Q41A 1DJPA 1PK9A 3LT4A 4PVCA 3R6WA 5IU6A 1Z37A 4HB2A 5G4LA 1A8SA 1I4EB 5G0SA 4U63A 1JQAA 1CZLA 2GF0A 4LZAA 4V0OA 4B45A 5JPDA 5KJFA 5J23A 1VGRA 3OOSA 2XUKA 4CXMA 5CCXA 5A03A 4HDNB 4K9DA 9ABPA 4CUKA 4K9RA 3RVNA 3A1SA 1U7XA 5KQPA 3FBTA 3FHLA 2QZZA 4CU2A 1Y6RA 1M2JA 1E7SA 4F8YA 5CURA 3GGJA 1JHPA 1L4UA 2WTUA 4WE3A 3USES 4A8HA 2O8CA 1ZMOA 4HX5A 2BFCA 2GK6A 4J3FA 3AR9A 4N5IX 2L18A 4R1SA 4YONB 4HK4A 4MB6A 1W59A 4ZOCA 3NNNA 3GLHE 2D74A 4CE6A 4MK4A 3WYBA 2P7HA 3P96A 4N0QA 4MH0R 1LDNA 5DSZA 5CVCA 4BRZA 5E4JA 5IWAB 1KI6B 1Q6ZA 1V9CA 3PDIA 3WOVA 4CKEA 3AGQA 4DBLE 5JOQA 3F8WA 4S1TA 5J2TB 3OZXA 2WSSD 1OWNA 1MPXA 4XJVA 3VHXB 3DHVA 1LBSA 3GGGA 3PDWA 1SBNE 2HIMA 2C3UA 3NGLA 4Q01A 1GGNA 1RJ9B 1D2MA 1NFRA 1J2YA 1KYWA 2O5CA 3Q7QA 4D6XA 1TPYA 2NUPA 4DQUA 1OILA 4P3OA 5H81A 3NBFA 5FI3A 4GAEA 2PGXA 2AKYA 2GMWA 3OJOA 1NNSA 3ANYB 3D4NA 3N39C 3NDRA 4IH4A 2YQ4A 2BTQB 3EXEA 3FPEA 3UPDA 3OE5A 4OSOA 5E0KB 1MXHA 4XPZA 3E5HA 2IS2A 2FJUA 2QLLA 3FI0A 1YA6A 2JCXA 2EX0A 3HWWA 2VPPA 4RQTA 2OG2A 2L0XA 1I3NA 1OHHD 1N6KA 2VIIA 3L1IA 4JUAA 4PNZA 1AF7A 4B75A 1EX7A 5FPKA 4E3WA 3EN0A 2C9MA 3Q0TA 1N0VC 2HQRA 3QELB 4C04A 1QIDA 2I4MA 5EHQA 2NUAA 3HB0A 3I76A 4G0QA 1EGQA 4YV1A 3OLXA 1SVLA 5JS8A 1WTAA 3U16A 2X76A 1ZIXA 1LVUA 4MMYB 2IOFK 1IWBB 5IN5A 2B1JA 3IT0A 4KX3A 3VGPA 3L4KA 3G8CA 1NJGA 3ORFA 4L7QA 5HQ3B 3O9ZA 3LW7A 4JBLA 4YASA 1HDIA 4K6CA 2WNIA 5CNKA 3KSUA 5E6UB 3KSAC 3PUWA 3R40A 2PLFA 4JXKA 4B6OA 4PPYA 4QXPA 3VSDA 1YUMA 3OZRA 2E4WA 1UQTA 2P4SA 1JBQA 1E1CA 4YRIA 4H0FA 3DV0B 4L5JA 4XAQA 1IAVA 3F8SA 2O2EA 3AB7A 1QYCA 5CVTA 4I55A 3RWBA 5HJ2A 2I2FA 2HXSA 5I7OA 4PX9A 5EXPA 2FPGA 4M1ZA 3C5CA 1I2DA 4LHSA 4QM6A 2OGZA 5ITSA 2BUBA 3SYKA 2UZ1B 4CEHB 2QJOA 2RARA 1L4LA 2QNRA 3DVAB 4AYXA 5KHLB 5H70A 1Y9EA 1OLSA 3D6HA 2O5EA 4ALLA 1VMDA 4DL9A 1B6SA 4NE9A 4RE6A 2VWPA 1A9OA 4HDSB 4ZU1X 3SKXA 5FV4A 1V11B 3TM4A 5FBHA 4DJJA 5COQA 3IAFA 2ZANA 3LCJA 3IEVA 3A3OA 1H5UA 1KAMA 1XHEA 3BK2A 1QDEA 3S7TA 5C5CA 1P45A 3KYDB 3AUKA 4BCBA 1CQIA 1E7WA 2CMFA 2V0NA 1E9BA 3KE9A 4OYRA 3VNSA 5KCMA 3WYAA 2V1XA 2FGJA 3ES9A 4I08A 3GJ4A 3U39A 3E48A 1LFAA 3X0DA 2EQ5A 4AROA 3WAJA 1NMXA 4PIVA 3PC8A 3RO7A 1ZD3A 3TX6A 1UPUA 4RK5A 4PC2A 1Z82A 5SZHB 1VLQA 3W2GA 5ITVA 4K3VA 2LIVA 1YCDA 4F8JA 1M2EA 3DZIA 4EB6B 5I01A 3BDVA 1D7OA 2NZ2A 3K4HA 2HA2A 5BNIA 4AY2A 5BVHB 2QYOA 2AJ8A 3HP7A 4CBVA 1Y3HA 3VU9A 3QEAZ 3T4EA 4P7FA 2XQIA 5JYCA 2Q3LA 5A0VA 4E6PA 2VK8A 3MBOA 3MT7A 1UH5A 1ZK1A 4F2PA 3QVGA 2MINA 5CA0A 4BO7A 1P29A 4RA9B 1IFXA 1RMTA 1T1SA 2WC1A 4LF7B 2HU8A 4Z2YA 2I1WA 2CNNA 3C6YA 3N2EA 4X0EA 1M0SA 1AKYA 4LNUA 5AJHA 2H7YA 5E9WA 5KJCA 4MUNA 3B20A 1GD1O 2EWVA 1E6EA 1VL1A 4HQOA 3CXRA 1VPEA 3BJRA 4GWLA 2Y76A 4DMGA 2XDQA 1YS2X 4O4LF 1P9NA 1T2VA 4ZICA 2HJVA 1NM5A 1Z6XA 2IE0A 4BFLA 2I91A 4J4HA 1I9GA 3H9CA 2UKDA 3AH8A 4JC8A 4HNUA 2COEA 3BWCA 3PFHA 4Y2QA 3EDOA 3QKSB 2FK7A 2ZIGA 3A25A 3RK1A 4B8ZA 5GONB 1LEHA 4UFNA 4F0JA 2FOLA 4LMAA 5EJEA 1Q3HA 1LNSA 3JVDA 2CL0X 3BK7A 4GKBA 1BSVA 4IV5A 5DCLA 4BNJA 2DQKA 4H3VA 1ZPDA 1F6BA 4LYJA 4MVJM 4B6QA 1SWWA 3LRXA 3UICA 3V4RA 4QTUB 2EBHX 5G3ZA 4XM2A 2OZEA 1VIMA 1Y1LA 1E2MA 5H9VA 3NQ41 2DXIA 2YS7A 1YBHA 3AETA 1UZAA 4IJQA 1NQVA 4OJQA 1NQOA 1Z5ZA 1AQJA 3U1BA 3GT3A 3PRKE 4O4JF 2GBLC 5EXEA 4EL0A 1RCTE 3RANA 4WDQA 2VP0A 2MR5A 1SXQA 4LGYA 2GCPA 2ZJOA 1RXSA 1GHTA 1YRLA 4FU0A 3MCUA 4J9UE 5BMOA 1EFVA 2PS9A 2PE5A 4F6LA 1DAHA 3Q2OA 1TTPB 2FLVA 4ZFNA 3L8HA 1QH0A 4Q3EA 3PFCA 5B3AA 5JALA 1OB2A 4MP3A 3DNFA 2A94A 2CHVA 5ES4B 1IL0A 2V4MA 2WIKA 1EWTA 4HBGA 4DCMA 4ZI3A 3T5PA 4ES6A 5EWJB 4I36A 4LPSA 5SZJA 4GYJA 4BNNA 4D41A 1N6PA 4X8OA 2IDKA 2QUAA 5T4EA 3KPUA 3T5BA 2NLOA 2F90A 4UXIA 4DT1A 1JG3A 4WKOA 3SYNA 3JQPA 2VEDA 4NZZA 4R1TA 1T2FA 1KJYA 3QJGA 5EJMA 4CCSA 4TX1A 7AT1A 5AVQA 5KNDD 4W7IA 2E4YA 4NMLA 3K9BA 4NPHA 4R5MA 1SCAA 5GVSA 5IKPA 1ZNYA 1ORWA 5LPNA 2RK6A 3NLLA 5TVGA 3UJHA 3VR0A 2H4ZA 2OAQ1 1KO5A 4YAOA 2VDVE 4LHYA 5HF9A 4II7A 4AIIA 1Y8CA 3D4BA 4WEQA 1FNBA 4WN9B 2HNBA 5DJ5A 4DSOA 4J1TA 3ZEIA 3ERCA 2IYVA 4PS0A 1JHRA 2F3PA 4PU0A 3CQ9A 3DOHA 1T13A 5DOZA 2H3EA 3OA2A 2IV3A 1G98A 3C3WA 3NPAA 1CFZA 3GZTB 3KP1A 4PGGA 4YCBA 5J2TA 3CC8A 3U7FB 4HVCA 1EFUA 2JHAA 1RYZA 4DUPA 2R11A 3KZVA 4CLRB 2C7VA 1FSZA 3E61A 4UDYX 2V7UA 1N5OX 2HRZA 4J75A 4RJTA 1P2VA 2ZSBA 1JSRA 3AVQA 2ATXA 3DWGA 4LJSA 4DN6A 1OBVA 2FGKA 4UTVA 5H02A 4LI0A 5D51S 3UJBA 3WK6A 4WFKA 3JU3A 4AJ2A 1BMDA 4E7PA 5JEEA 4JBIA 3L7BA 2AZMA 3KSZO 2PH5A 4RSRA 4TKMA 2Q2NA 2GCOB 3KK0A 1P4GA 4KC0A 4ED9A 3KKOA 3GJ8A 4GBJA 4A2PA 3W34A 4DR3B 1HLGA 2CKMA 2H07A 3K20A 1TQ6A 1B8OA 1UOQA 2P2YA 1PK7A 1V1RB 1V7QA 2QVGA 2CK3D 1FMCA 1X1BA 2JNWA 3EW7A 3K8OE 3MXTA 4ROSA 1EGHA 3UMFA 3TW6A 3UIEA 2WMOB 5FUVA 5I48A 2O8FB 4E70A 8GPBA 5KU7A 5GGYA 3QTTA 1P7ZA 3OZDA 1VIYA 3ETEA 2X0EA 1E4EA 3IBFA 5IT4A 3FA2A 1TM4E 1UDRA 2PWPA 1QKKA 1WCIB 2FZVA 2Q5IA 3QVJA 4E51A 5B36A 4DUGA 5FWNA 4G1VA 5IK2D 1FQOA 1PJSA 1U0RA 5FXMA 1A9TA 4R2HA 4RETA 3ZBQA 1SUAA 1FRQA 3WRWA 3G1WA 1YJBA 3EEIA 4L6AA 1YO6A 5EIXA 5FBLB 5LQMA 1XX6A 2A2ZA 2BBWA 4TSKA 4ZO7A 1TTQB 4QG3A 4BWVA 2WT8A 3DDSA 5BOSA 3FBGA 2F1OA 4YMWA 4R2MA 4GSLA 2OV2A 3S8MA 2BEUB 2F43B 3EGXB 2I3BA 3UFXA 4KSCA 4JYCA 1TMGE 1UM9A 2PLAA 2WHQA 2X3UA 3A2LA 3LX8A 3M34A 3QEJA 5KKNB 3GLIA 4PRZA 4MSUA 3LY9A 1YIAA 1NAHA 2FPSA 5JHHB 5CFLA 4OLAA 1RAAA 2TMGA 4GMHA 5K0NA 2JFUA 4KNVA 4U7FA 4OHOA 3N8KA 4BNDA 1U0TA 5JFGA 1R5NA 1VBKA 4GRAA 1QYVA 4D43A 1BMQA 5MFPA 1A72A 3CR3C 3DQZA 3CR8A 4FOPA 5CPFA 1NQ5A 4O2BF 2RIRA 4AY5A 1QUFA 3ADKA 4P34A 5DN6A 4DV4B 3NEAA 3JQAA 3ZI7A 1EE2A 3T7IA 5K8TA 5ALWA 3VAZA 2QAIA 4E5PA 5GPBA 3ILHA 3C3KA 4LG1A 3UMCA 2OLKA 3E3NA 5EEHA 3N0VA 1A8IA 1YTUA 3DC2A 4MV4A 4BKOA 2YN0A 3LA8A 2GARA 3NV7A 1E2IA 1TO6A 5K99A 1G3RA 1J25A 2A4MA 1N33B 2QN1A 5CUQA 4TLAA 1IY1A 4JP1A 1P7PA 3EE6A 4ITUA 2FFBA 4XCXA 4F97A 3H4IA 2OBFA 3ED1A 4Y9UA 3ZK8A 1P4SA 3RYIA 2NNWB 5DT2A 2VBCA 1G7CA 2PL1A 4OH7A 4M1WA 2FFRA 4ZKDA 4CGZA 3F1LA 3DMTC 1DKUA 2JI4A 1IN7A 3ENWA 3OZGA 4HQRA 5A6SA 5CH8A 3TKLA 4QASA 4U7PB 3BERA 1FW8A 3T3GA 1BYUA 1M10A 4ARIA 4JJ4A 1S2OA 2R47A 5DWQA 3QMVA 4EITA 4QZVA 2B9VA 2JATA 3CVWA 4QXQA 1TTHA 3KB2A 4FMDF 4L2IA 1ULAA 4OXNA 1X9GA 5JC8A 5JISA 3WAKA 2EL9A 4GGMX 1MA0A 1AK1A 5G1OA 5BRAA 5HE8A 2ADFA 3K1YA 4ZDIA 2CF6A 3M8KA 4G0YA 4O33A 3S7ZA 3X3HA 4EKDA 2NV6A 4NZ9A 2YN4A 2FZLA 1IEVA 1ZNXA 3GA7A 4YRQA 3E2MA 3SFTA 2VYND 4JJEA 4AJ4A 3ZE0B 2QROA 5FL7A 2G0NA 3CW2A 1J8YF 3K5PA 3QEOA 1DBSA 2QW1A 3BMQB 3OEYA 3PJEA 4P4LA 4RCZA 5KC9A 4RMIA 2Y93A 2VH1A 1JSXA 4MYHA 4EB0A 1JFTA 4M1KA 5BV1A 1XCLA 1E20A 2X4IA 2BZGA 3K0HA 2PYDA 4LXTA 4RY9A 5GWXA 4PCAA 4NPAA 4YRPA 4I1YA 4AMUA 4CG1A 1P1FA 4EENA 5TEVA 1SPBS 3AONB 1EK5A 3H5NA 1UINA 3L82B 2IQIA 3ABRB 4PFKA 1AZTA 1ZXBA 2FG6C 3KHSA 1SB8A 2BFEA 3A3KA 4I6EA 5CLJA 3BGWA 3DOIA 2RB5A 3O90A 4F4CA 1OWPA 4GPEA 3HYCA 2QLTA 1KI9A 1RWPA 3HS3A 2HRQA 3WLAA 5BYAA 4UU0A 3GJZA 3K4QA 4ZHQB 2PD6A 3FVTA 1PVDA 4IHJB 5DVZA 3C39A 1G5FA 3DBRB 1P77A 3RWMB 5AW2A 2B69A 1N2HA 2FP4A 2PUVA 1I1HA 4UEWA 5HM6A 3SVLA 2DX7A 1AXGA 1G16A 3C2QA 4WNYA 1EIZA 4AX8A 1C50A 4KP7A 2IWRA 1U63A 1OAOC 1DC5A 2QVBA 1CP2A 3IC5A 3L0SA 4Z0HO 3SX0A 4ZYTA 5D6OA 1ZD2P 2G1KA 2WK1A 5I47A 4N3BA 3MGCA 3DDHA 4RTJA 4BE4A 1JLHA 3RS5A 3WE7A 5K0GA 4KMSA 1C3XA 3FWYA 3F7MA 4DV3B 1XDZA 5ELMA 5K0EA 1MIHA 1IK6A 2BFWA 2G76A 2CHUA 1Q1AA 1P4JA 3DONA 3N28A 5JTUA 4RZXA 2QIOA 3DE2X 1GYPA 4UTPA 1XWWA 3F8TA 3DDZX 3UJ8A 3B70A 4P7GA 3B1ZA 3DAYA 1NULA 1DKMA 2RGBA 3GT0A 4OUDA 3RFVA 3WQQA 5GZ6A 2N46A 4NV3A 1AKWA 1N9GA 4JZYA 2Z9CA 1GUFA 3LSYA 2PT6A 5TR9A 4YRTA 5KU1A 3SYLA 1A9SA 1N32B 2WKRA 1QVRA 3BFJA 5FR2A 1GZUA 2OAEA 1PLKA 3L6UA 3U1TA 5MGBA 5JXWA 4F2WA 4W5OA 1BKDR 3MW8A 1CCWA 3KM0A 5FNZA 3T1TA 4MQMA 4MHOA 1A7UA 1P2BA 5TQ2A 3EFOB 5HTOA 1N0UA 2IHNA 1PO7A 2A88A 1Z39A 2HUNA 1V35A 2DPLA 1LWNA 4Z4IA 1XPRA 3D0QA 4BQIA 1DLJA 1FJ2A 4CNQA 5SY9A 4EI8A 2WF6A 1JTEA 4LJKA 4V0NA 4GIBA 4RIEA 5F4BA 2KJQA 2IPNA 3GROA 1NKSA 4XIGS 3MQ2A 2G9NA 4UTXA 2OFWA 1ID8A 3BULA 4CTKA 3EEBA 2B36A 3QSGA 4K1LA 1PNRA 3EDQA 2QTGA 3GH3A 3GP3A 4WHMA 3VJKA 1KP9A 2W6OA 3I2YX 4MJ3A 5AJWA 1SC4A 5ESXA 1KH2A 3W5VA 1NLFA 1U8EA 4H27A 3KYCB 3D64A 3OC6A 4FFMA 4E5VA 1PUIA 1URPA 3MGGA 3X1ZA 5I51A 5IZCC 5DNEA 1QYRA 1O97C 3CUYA 2Q8PA 2PA0A 3KZ1E 4RTRA 1KFBB 2IYQA 2JAUA 1UXGA 1AZWA 1TZ2A 2DTDA 3H1GA 3NP7A 1RIIA 3CH6A 2CN1A 4H1HA 1V25A 2A4KA 4HDQB 2NU6B 4IRMA 3UBTA 3VTZA 1BFDA 1AB6A 2Q5QA 1QV7A 2X8LA 2IHYA 4Q4JB 5CGQB 3T7TA 1MJGM 1LD3A 1OC2A 4JJ8A 4BNXA 4BB9A 3UWMA 2WNHA 1ARZA 3FHCB 1D5WA 1OI7A 1HURA 1K5HA 4J6EA 4JI4B 1E58A 4XYLA 1VKOA 1UBGA 3LKVA 2JLAA 3MN1A 1X14A 4FYHA 4DLYA 5A4DA 2NXEA 2Z1NA 2GEFA 4BMPB 2A84A 2BL4A 3SJBA 1KVQA 3GVHA 3C3EA 2BHNA 3QUSA 4E21A 3U4MA 2PKEA 1RJFA 3A4LA 3F5FA 2IP4A 3O5AA 2Z8XA 1Y9JA 2QMHA 3HBLA 3WMXA 5GJCA 3CR7A 4GL4A 3YASA 1J1ZA 4RLFA 3RIYA 2E4VA 1CDDA 2D5AA 4F8EA 621PA 4UBLA 1M5UA 4CI9A 5IJ0B 3DMGA 3JTMA 3WSVA 2DH5A 2FW0A 2CZQA 1DG1G 1OUMA 5JU6A 4BYGA 4EHHA 3D5EA 4N0PA 4NI5A 3BQNB 1P3Y1 3N8NA 5DNYB 1K2WA 1II8A 2ENWA 3COSA 5L7TA 4R1LA 3UBMA 5AIAA 4I66A 3AYXB 3NTOA 3RABA 1NN1A 1G8SA 3CX3A 3EUAA 1P7WA 1RJEA 1E2GA 2YHIB 4OJMX 4OIMA 3LQ1A 4CW7A 2G1PA 4DQLA 2WIAA 1B73A 3EZ6A 1U6JA 2GTIA 4I19A 3SLKA 5L3ZA 3ADCA 3ORQA 4HB3A 1HTWA 2ZYIA 3OBIA 4C03A 1MH9A 4GSYA 5LP6C 5LLTA 1NVVQ 1V95A 4MGZR 4MUEA 4ID3A 4WXEA 2BFOA 2QMQA 1A8HA 2ZSJA 1WQ3A 1C0KA 4G8CA 4M1MA 5DOVA 3AEUB 4W5HA 4A0FA 2FFQA 4LRSB 1MAHA 5HXAA 4MJ7A 3M83A 3WO0A 4Y9DA 5AM5A 3RGWS 4P4UA 2M6SA 3DWEX 5B53A 4DVGA 4XARA 1N3BA 2IE8A 1OCEA 3C8DA 4RXTA 3TAXA 1X74A 2Q5FA 2GSDA 5JAQA 2HPAA 2X8AA 5TQ0B 1IUKA 4B85A 1M67A 4U7GA 2HK7A 1G17A 3KQMA 1Z5NA 3AFIA 4NOMA 3TLKA 3WQSB 4DS3A 4DYVA 4ZO9A 3OM1A 2PXCA 1QORA 4G0OA 3VR1A 2B6HA 2EWWA 2EAUA 1GUDA 3OQIB 3FPKA 4LX0A 3I0MA 5FQOA 3DS8A 3G0IA 3ZHRA 5KNCA 1RPJA 5KWEA 3N9IA 1I1QB 2CEKA 1DT3A 1Z4MA 4QYMA 1M1XB 2ZJZA 3IQFA 1NLZA 3HACA 1HRKA 2YYYA 1E3JA 2XA9A 4C43A 3N3AC 1EZ4A 1MOPA 4IV8A 2OM6A 3F46A 3U3RA 3I5UA 1DBWA 1U0GA 1B0AA 1O2DA 2OCYC 1LRLA 3V2GA 4CCWA 1VMIA 2PL5A 1B3RA 3DKRA 3ZHVA 1B1CA 3D5TA 3GRFA 3B3AA 1GRVA 2QV0A 3BL6A 2AI1A 3N7TA 2M6KA 1KFCB 2NUTB 3FMGA 4HLUA 4IVPA 4OQNA 4BJ1A 2X5NA 2ZRNA 2ZRJA 4LDAA 4WNAA 2C2MA 3R7BA 2JG3A 4MPDA 3K70B 2YJ4A 2NT4A 3MMNA 1WLSA 1XDWA 4FD3A 2BP7B 4YWHA 5T6MA 4WCFB 1M5RA 3PLAE 3IBYA 2CHGA 4KWCA 1KC3A 2BMDA 2SCUB 4U6QA 1E3SA 3V7FA 5JJIA 5BQFA 2BF7A 3HNOA 3CVOA 4IEEA 4LJYA 4B9AA 4KVFA 2ZDGA 1AE1A 4Z1OA 2O7SA 4ZPJA 2OMEA 4NG4A 2OXIA 5KOJA 2QZSA 3ESCA 2G25A 4ZHQA 3C3MA 4KDCA 4CQNA 4D42A 4G4JA 1IVNA 1G8PA 2Q5LA 2ZWVA 1Z5OA 3DBRA 5FULA 1A2BA 4X95A 2QSYA 3QMMA 3S1SA 1TB4A 4GQIA 1MRNA 4AWAA 5J1SB 1MHTA 4B3MB 1CS0A 2ZI4A 1L3IA 3GD7A 2G71A 1OROA 4B9EA 1G3MA 2FW6A 4EZEA 5F9HA 3ESBA 3E03A 3A1EA 1KI2A 4EI7A 4HPXB 4R8LA 3A32A 4PWZA 3K0SA 3OPYB 4POAA 2XCIA 1FP4A 4B35A 2ZJ8A 5AVRA 2ZM5A 4CEJA 1EBUA 1JT9A 3REOA 3RS9A 2ATCA 3MZ0A 4B76A 4N39A 1AGYA 4AP9A 7YASA 3E9DA 2H7CA 1A9YA 3DUFB 3HR8A 2G4LA 4NKRA 1CF4A 2B4AA 1WDWB 2DSTA 2XSZA 4G97A 3OJFA 1JIUA 5FFFA 3QXCA 4O2AF 4LF9B 1KJNA 3LOUA 2F7SA 2QXTA 4E5UA 4Z0NA 1PR1A 1DJMA 2JLYA 1VSTA 2FPKA 4TV8A 4OQDA 1NAIA 2XRMA 2WJGA 1JEOA 3WGHA 1L4NA 4CLOA 1VIDA 3ESRA 4BCCA 2C4UA 2Q5HA 1A1SA 3T9FA 4KSYA 3W2HA 1WPXA 4LQ4A 4ZRMA 4QWMA 3FNQA 2DUMA 5L8VA 2AMYA 4XJXA 2F8SA 4OHFA 1U5CA 5I7FA 1YZQA 3GL9A 3T3OA 2NO0A 4TTRA 3NDIA 2HCJB 4RIGA 2XUAA 2G1UA 4HS9A 5T4BA 2J87A 1OH7A 1D1SA 5IP5A 2HA7A 3NHAA 2JFPA 2Q8QA 4NARA 2R6AA 4A3SA 4BN0A 1I0IA 2GYUA 4P3KA 2ZDQA 5KINB 4GEGA 3AMVA 1Y1TA 4JLOA 4QYSA 3WMWA 2GPSA 3QG1A 4QKQA 2GN0A 2HJGA 2HTEA 1CVLA 4C5AA 1RC1A 2ISCA 1HI9A 3QKRA 2NAFA 3W6UA 4GL2A 1IBRA 3QVMA 3G2KA 4MKGA 4OQZA 4Q6WA 3T54A 1XJ5A 2HMVA 4D9BA 5ICEA 1U3TA 4Z4EA 4HTFA 3K35A 1OYVA 3B6IA 1KYIA 2NZUG 2XTZA 3E84A 4MKFA 3EJWA 1ZMBA 3MQ4A 2W0MA 2VTVA 1Q57A 2IJGX 1FYFA 3CUVA 1YC2A 4LZLA 5AI8A 3JVVA 2O0JA 4IVNA 1VB3A 5EHIA 1UXIA 2B7BA 1G55A 3DDNA 1JI0A 2ZRLA 3K6RA 4JX9A 4GKKB 1SGWA 1VSUA 2D2EA 2XNDA 2Y1KA 5AFSA 3S28A 1CEQA 3KBBA 4WZAE 1FYEA 1CLEA 4CKBB 3Q1KA 1HE2A 4HNAB 3CLTD 3JD2A 4XQGA 4TWIA 3UWKA 1Q0ZA 3KDAA 1QS0B 2PR2A 1ABEA 3PWZA 3C4QA 1SJ9A 2FWJA 1GPUA 2G36A 5C9ZA 3HGQA 3PXEA 2NYRA 1C2TA 3R3YA 2QYTA 1U02A 3HN6A 5JDIC 3EF3A 4ENRA 3U6KA 1Q7TA 1V71A 4MWTA 3TK1A 2J5KA 3CIOA 1V6CA 9LDBA 1KF0A 1N6LA 1V6AA 1Z2OX 3TGPA 4II2A 5KBYA 1FC0A 4YMLA 5JBIA 3P7MA 1YJQA 4MI9A 2YVLA 1AKVA 4TMVA 4HDOB 4XIJA 4DMUB 3U60B 3ZDZB 1Z0DA 2VJYA 1DPFA 1V8OA 2W6JD 2WMYA 4YO8A 3RUAA 3WWYA 1ZITA 1Z62A 4ND5A 2UAGA 4G0WA 2Z3WA 5A71A 3MOGA 4FZVA 1DFIA 5LZ5A 4R0MA 3MT8A 2MSNA 2Z3ZA 5KJ6A 3EZNA 2KQUA 2QE7D 2VDUE 3NT5A 3OURA 2BF4A 5AW5A 1IN1A 2ZBDA 2ZRQA 3DBOB 1TTTA 1DHRA 3CMCO 3GMSA 1XTRA 9MHTA 1KI7A 1WA5A 2GBCA 3N5KA 3OKCA 5J2UF 1DC4A 2XWBF 4GLLA 3SIXA 3UK7A 1J20A 2YWGA 1W0JA 3DTVD 4NEHB 1PLLA 3KKPA 1DUVG 3CX7A 1MUUA 5ITWA 3AEUA 2Z95A 1YXMA 2ZIVB 1G20A 1KGSA 2H16A 3ENNA 3I2FA 1FXWF 1P5JA 1C8BA 1PX0A 1NWCA 5FOVA 4BVEA 2EP7A 4BB6A 3U3XA 1B8NA 5CRIA 5DLDA 3OM8A 1UF9A 5K6AC 4P0PB 3UMRA 2YWRA 3SFVA 2WTBA 1G8GA 2ZE6A 4RVOA 1BRMA 4PM4A 4X6UA 5DHPA 3I32A 2UYHA 4NMHA 1OXBB 2PNFA 3I1IA 1SN7A 1T2NA 4KXNA 1Q1NA 3EPKA 3R5HA 1RI3A 1FVFA 2AF4C 1AC5A 2PRJA 1SCKA 5SZKB 1RHRA 2VRCD 4LOIA 2N47A 3FDZB 3TD2A 3P52A 3SJZA 1S2LA 4ZI7F 4U3JB 5JDCC 4GKAA 4OFXA 4P53A 3PEEA 2VI5A 1N8TA 2NSHA 3ANSA 4RGVA 2Q29A 2XVXA 5ALOA 3WMEA 3W1WA 4JJ7A 2HB6A 3RSCA 2YRWA 2PY6A 4Q93A 4RU1A 1DC3A 1DXQA 3GRKA 3IPAA 3JS5A 4QBGB 4YV0A 1LF0A 1TI7A 3KFLA 4KO4S 4NFSA 1MAUA 3TX2A 4PLZA 3VJLA 4JI8B 1BN6A 4KBGA 4HJXA 2R8YA 2MYTA 1V47A 3AEKB 1CV2A 3TG2A 2P6RA 1G5HA 5AKHA 3PQCA 3UC9A 2XF2A 5DBFA 5HKOA 1NP3A 1YZVA 3CA8A 3A3YA 1F51E 4AQ7A 3ZDEA 2Q3BA 4CIDA 2ZUUA 5E6RA 2BGJA 5ECYA 1BO6A 2JF0A 4MS1A 3TVTA 4QU8A 3DZFA 3ADPA 2PVCA 3I52A 1CDOA 4OGGA 4XGNA 2V0GA 1JXAA 1OBCA 1XROA 2GKSA 4HXEB 1KK1A 1YZHA 7REQA 3NDJA 4L4XA 1Y81A 2B5OA 2PV7A 2X58A 2GN2A 3GFOA 3ABQB 3LWBA 3L4EA 1DFHA 3P9IA 3WGNA 4LQDA 3VV3A 4MO2A 2NO5A 4GP6A 2CCGA 2XYQA 4HN9A 1ECGA 1EFDN 1Z5GA 3B8HA 3KLOA 1FFXB 2ZBRA 1RM4A 3DVRX 4OK5A 2A5JA 4TZTA 4ZCMA 4JU8A 5EJGA 3OZTA 2XKAA 1VSQA 4KIUA 3MD9A 4YCSA 2DOKA 1T9AA 1XLWA 3KD3A 3NEYA 1FQWA 1YBFA 4OHXA 4J7CA 4GOND 1WBDA 2WFLB 4BKQA 4XKJA 1Z7GA 2XCOA 1V9SA 3LV8A 2O2GA 2DCUA 3GN2A 3PL1A 4FFBA 3NRBA 4BWGA 5EHXA 1XMSA 4V2IA 4ZHSA 1IN8A 1E32A 2O48X 3GWZA 3R3VA 4IHQA 4EKGA 3HJHA 4M9QA 4YT8A 2IPLA 1A71A 1DIAA 1NASA 3O9VA 5LUBA 4KLRA 2J4CA 3NORA 4QBKA 1NLMA 2R00A 1EU1A 5TDHA 4EMBA 2X1MA 4P86A 3FNHA 1E77A 2FWNA 1YNOA 3G8AA 2QVCA 5BN4B 3VZRA 1U2DC 4HVAA 9GPBA 2J7PD 3I62A 3DHWC 1K6JA 1G5QA 2PZLA 2W2KA 2XUPA 4DCOA 1RAHA 3UHAA 4ETMA 2BD0A 1DARA 2YYZA 2GF2A 1COZA 3D6AA 4WUVA 2CNDA 1JFVA 1XDBA 2BHLA 1Z13A 4BNTA 1CY7A 1CQZA 1RAGA 2Y05A 4B8YA 4NESA 5FWXA 4NFYA 2CLSA 2QJRA 1GGKA 5HS6A 3HO1A 4CKYA 5CBPA 3ZQUA 4WOBA 4E1BA 3HJCA 1M7HA 2XAUA 4OMCA 3VVCA 2EFGA 1L7DA 5T41A 5A02A 2Y0BA 3CRZA 3PC2A 3LBFA 2QLBA 2NNLD 1FTSA 3RNLA 3A4YA 2XITA 3J81A 1NN0A 3I9OA 5TGZA 1DXYA 2H8GA 2DE0X 5DXFA 5HE9A 5BPHA 3V34A 5K3FA 2WMDA 1YFLA 3I2IA 5HM8A 2GT1A 1NW8A 3ETDA 3LDFA 4GLJA 4M9ZA 4OLJA 3WIVA 3VKHA 2OORA 4N7JA 3S8EA 3VR5A 3G0CA 4QLBA 1FBNA 4Y18A 5KQRA 4FHZA 4YAJA 2PG3A 3TB4A 3GPIA 5KHAA 2WZQA 4YJGB 3ORHA 4IHAA 3P32A 5IRCD 1RSZA 1PVVA 4BQPA 3DVLA 4NZYA 4QNMA 1GT91 2RE8A 3PXDA 1XRPA 2RGRA 3CX6A 2CXOA 5BMVB 4E4RA 3FWHA 2QN6A 4M1QA 1VI2A 5FUBA 3L4SO 5IUKC 4D0LB 2DBYA 1PFUA 4WSOA 4PTLA 4R31A 2QAGC 4OMFG 5IXSA 1NVDA 1AS0A 4M7WA 3RB8A 1NMYA 4DYDA 3BE4A 4P83A 3SC4A 1XD9A 4KODA 3JQ6A 4JOSA 1BEZA 3QY0A 4O08A 4D9JA 4Z1MD 5ER6A 4EKNB 2OGSA 1U2RA 2J3HA 5BR7A 1WF6A 2IUSA 3I8SA 2MSDB 3E9CA 2ZZMA 4FQ8A 3R4VA 5F1OA 1CR0A 2H85A 4MV5A 2BTOA 4BNIA 1KBQA 4HS4A 4ISBA 2OQVA 3G49A 1JQKA 1NMQA 1TQ8A 3RVSA 1P2SA 3OY2A 1W36C 1T1JA 5E7IA 4PYRA 1XYGA 4HHEA 3RVDA 2JFXA 3MSXA 4J0JA 4MITA 2AW3A 3GGSA 1GXSA 1Y1QA 3FYCA 4NYIR 1XZMA 3S99A 2PX0A 6GPBA 4XWKA 4H1TA 4BS9A 4FT4A 4GMXA 2OSVA 3ZXSA 1NVWQ 3PQ2A 4FVTA 2ID7A 3N86A 1MOSA 2HDWA 1N9ZA 2UZIR 4MVJE 1GP2A 1VXOA 5DW0A 4GQBA 3AJAA 3MMXA 2BE7A 3EIXA 2JHCA 2B35A 2ZVJA 4HMOA 4DC9A 2JIZD 2MJLA 5CHYA 1AQYA 4FCTA 1WW8A 4NAHA 3VZPA 1XAGA 4UBKA 5G53C 4ZIRA 3IE2A 1BHSA 2VP6A 2WSIA 4K2HA 3VTKA 5KNCD 3F7NA 4OAQA 1DLIA 5J59A 3HLYA 3B85A 2J7KA 4Q4HB 3RHZA 1OLUB 2J09A 2ZCJA 2NM0A 4MGHA 2I6FA 3SFZA 2HREA 4AP5A 4BRSA 3U44B 5DK4A 3KUXA 3LLSA 1GG5A 5DO9A 3PWKA 5C7OO 1TM3E 5JNRA 1UPTA 3VYWA 4IVRA 2OG1A 1UEJA 2QRPA 3A31A 2Q28A 1MB0A 4NPCA 4YIHA 5JCOC 4U9IS 4B7UA 3QK7A 2Y2VA 1IY2A 1N2CB 1GLGA 5KYNA 3SS9X 3WRXC 2NGRA 2P4QA 8OHMA 2CSUA 4J3NA 3QE9Y 2FQQA 1ML3A 1O0SA 4OFBA 5KYWB 2V8OA 4S04A 3IAM6 1KK2A 3M6IA 3WMFA 4Q4AA 2FPIB 2VHUA 2FR8A 2SICE 2W2OA 4RCVA 4QOGA 3X1YA 3PV0A 4CQMB 1G21E 2HU7A 3ISTA 4BE9A 3SHVA 4LY3A 2GCGA 3O8OA 3ZQKA 3ISJA 4ALMA 2YHSA 1GADO 3PE3A 4KAXA 4B3RB 1W88B 1MENA 3EBOA 4QDJA 1XQ1A 1N0IA 4TTSA 2FMUA 1P4RA 1PT7A 1W85B 3HBFA 5ICFA 4MO9A 1L5SA 3SXUB 3WB0A 3GPDG 1U7DA 5CB4A 1HOTA 4MIKA 2VSNA 2H29A 1T36A 4MCAA 1WPRA 3NU1A 3SDBA 5LN1A 1T5OA 4Z9FA 3FOFC 4V03A 4G5OA 2ZRFA 2XA2A 3MD0A 1NBEA 3MWLA 2HEIA 5TT1A 4A36A 3GOQA 2JHFA 3T34A 5BN3B 1DBVO 3STUA 3SQMA 4LRWA 3GOHA 3V32A 1A5ZA 2OT3B 1JNXX 3GT4A 4NBWA 4B2YA 5T7BA 4B3TB 4JI2B 1P1HA 1Z4QA 1ZD8A 4FSXA 3HPRA 3G0HA 5FBKA 2IYZA 1I6WA 3ZPXA 1AKQA 1LVHA 2GDJA 3DE0X 4Z9XA 4GMGA 2CE7A 1XA3A 5DHAA 2XZDA 3N6RA 2NX2A 2ZWIA 4JASB 1CHNA 1R0RE 1ZQ9A 1NHGA 4P4NA 4QRDA 4B3XA 1DADA 5AKGA 4M53A 2QX6A 2IRWA 1QHNA 3OPYI 1HT2E 1OWMA 4UDNA 3UUGA 4IINA 5HZMA 3BFPA 5LNK1 2ZRMA 1ZJZA 4KEAA 2AB0A 1WEHA 1FDIA 2O7NA 3KPJA 3AU9A 5K51A 4UAGA 4B2PA 2FQYA 3FJ1A 2BGLA 2X4GA 2BGTA 1ZJ4A 1FFXA 3OOHA 4FXOA 5JWOA 4PRYA 3GFGA 5B1HA 4A91A 2AUTA 4OAPA 1L4GA 2GK7A 1KMIY 5JNSA 3W5DA 3E8MA 2W22A 2YVUA 2B8EA 5L51A 3BB3A 2OV4A 1ZIOA 1T0BA 1HYEA 1Z4KA 3MRVA 4Q1DA 4X6XA 3TZLA 4MPPA 2WFLA 1QRUA 1JSZA 4WLEA 3LIPA 5CX4A 1F8GA 3UKOA 3MRSA 3CKKA 3IE0A 5AK4A 2FFAA 4R2WA 4MVJD 3TCKA 4A92A 2H9IA 1HYBA 2O2JA 2ZK7A 3D3JA 3R5KA 4CTOA 4ZDJA 4LC9A 1K66A 4GI2A 1EUQA 4GOJA 3H9JA 3K2EA 4W1RA 1UT5A 3K4PA 1U1IA 4OIFA 5ALLA 1G9SA 2ZB2A 1J0BA 1W2HA 2GFHA 1PNOA 1SIOA 1OX6A 2BMEA 2IPOA 2Q0HA 2VFAA 3FKQA 4BBZA 1WXQA 2W42A 1DXHA 1H5QA 4JEMA 3R24A 2VT6A 4P0TA 1BHJA 2C4VA 3EZXA 4BP9A 2E4ZA 4P81A 2R68A 2ONJA 3URKA 5AJZA 1SKYB 2FZEA 2W6PA 3OOYA 3O7MA 3BEOA 5BQXA 1ZP6A 5LIRA 3WRVA 1E3MA 3AG6A 3EXAA 1ODIA 1SKQA 3TSCA 4IQ4A 3VKUA 1A4XA 4GMFA 4YRRA 3TQRA 4TTIA 4C22A 1TW2A 1NMSA 2HF7A 4G0XA 4JUCA 4R68A 4TRNA 4NABA 1TUBB 3K5HA 3FNIA 1ZM7A 2W8ZA 2PMBA 2V6FA 4NZNA 1Y3DE 2O8EA 3CE9A 3ABSB 4CLXA 1Z17A 3CCFA 2WIGA 4NG5A 3KQWA 5K2MA 2VHEA 3ZD9A 3JYLA 3I4CA 3VR4D 4B3JA 3P9PA 1KNQA 2VPIA 2A9PA 4IWXA 4KQGA 3IA7A 2JEOA 2X0NA 4KO8A 3AFGA 4DMKA 4YY3B 3O1IC 3OPQA 4UMVA 2HSZA 2ZATA 4OGKA 3BEDA 5AMXA 1CQJA 5FUMA 2UUCB 2DBQA 4AS1A 4QARA 4Q4LA 2EKQA 1YF3A 4WLOA 3W6ZA 4BFWA 4D3FA 4C7XA 3FPFA 1QUEA 2QTFA 3FZYA 2FOIA 2XOKA 2C78A 5B6PA 2C7RA 2QR3A 4YP1A 1JECA 2JIDA 3IS3A 3W04A 2J85A 3HY4A 4K3UA 1XKTA 1Z4OA 4KIFA 3T8YA 3M3DA 4F38A 4FWBA 3TRKA 1ZM3A 1R6TA 2RG1A 1SCUA 2D7JA 3ROEA 4IRUB 3AM5A 4B7AA 4RTQA 1FLNA 3KNZA 4OFZA 4TMFA 1J1IA 4QT0A 3UW3A 2X4DA 1L4EA 4Q3AA 1NV8A 4TLBA 2R96A 3RARA 1I0ZA 3SF8B 4ZOQI 3DAHA 1LB1B 3JATA 2BR4A 1MC8A 4FGWA 4DA6A 4ZVQA 2PDAA 4O3MA 3N3BC 2VJKA 3V00A 5BSRA 2H92A 4GNRA 3SC2A 2NWQA 4ID9A 3SM9A 1RXVA 3UEOA 2OCPA 3IPRA 2V96A 4P33A 4OLBA 2QZ4A 2DRIA 4Z4FA 2I8CA 2OV8A 2LUOA 4FHCA 1Z6TA 2WWFA 3HFSA 1AVTA 3GPBA 4I50F 1NA5A 3RK0A 2A0FA 3ZEAA 3ZWWA 2JLBA 3BIOA 3DUWA 2ZIXA 4ER5A 1UKAA 3PC8C 2A9FA 4E46A 1KDOA 3PKZA 1EXWA 3D6NB 1E2LA 3AVOA 2WU0A 4OKSA 4ZT5A 1O4WA 1XL0A 3M5PA 5YASA 2FDRA 4I9GA 2O1EA 1Q92A 1X9IA 1CRQA 2IYYA 1W94A 3BORA 1K86A 4PBRA 4XI9A 4JEUA 5CJPA 5E3IA 4ND3A 4E4TA 5JNLA 2ECKA 4FMCB 3F9CA 3PRJA 3DHYA 3MT9A 4DV2B 5LJIA 1SOWA 4HCJA 4IDGA 4LJ4A 1IXYA 4O02B 1WSBA 3H65A 4AZ0A 1R5JA 4GLBA 4V1CA 2OXRA 4DR4B 3DF7A 5IBCA 2Q4EA 4HN4B 1WHSA 3VDNB 2BIFA 4BQSA 1OOEA 1P1KA 2L69A 3FKSA 3SP1A 3H0KA 3U44A 1FDSA 3EVTA 2V03A 4N5HX 2Z56A 2Y4OA 3FZEA 4D8WA 3BXHA 4JLNA 3V1TC 3ZCPA 2NVWA 4L74A 1YONA 3HA5A 1NM5C 1Z7WA 1XMOB 1HFKA 1N7JA 2JIPA 4HFRA 3VPSA 2EP8A 3WL8A 3I5MA 3HXMA 3N0WA 2CB0A 1A5AB 7ABPA 4D1YA 2GCNA 4O4LA 3EY9A 2O6LA 2PMWB 2QA5A 4WJZA 2ZR7A 3DCIA 4YQYA 5BSUA 4NNPA 5J4YA 3GDHA 1Q83A 5JZSA 1GIAA 5EIFA 1W6RA 2AYXA 1Y4ZA 1SG0A 2NQTA 3P2JA 3MWEB 4GX2A 4XDYA 4E11A 4MLDA 3I1FA 2D1YA 3L18A 4JLVA 1NJ2A 3L8FA 3U3JA 1H6BA 1NP6A 2JFHA 5LDHA 3LGXA 5BYKA 3JQBA 1ACLA 3C14C 2A1UA 1NIPA 1KSJA 1Z8FA 3W2EA 4MCIA 3DZKA 1S9DA 4HF7A 4GKJB 1X9HA 2ZKIA 4I14A 1V8FA 4ZXPA 5HRUA 1YBAA 1DC6A 1SEVA 2GTPA 2I7CA 3BA1A 3QZUA 1RJGA 3G79A 4O4JA 2WAYA 2WWRA 4LGMA 2Q5CA 1JR2A 3ZXYA 3ZH9B 1I4WA 1K68A 2VSXA 1ADGA 3HFRA 2XPCA 2GA9A 3ZUGA 2EFHB 1OPRA 2BMAA 2VDPB 4EG1A 4EDHA 2FMKA 3GLHB 1GTRA 2PLWA 4GVXA 5LQRA 4XLTA 1MKYA 2LWIA 2OOSA 4J90A 3PE4A 5SICE 1EIWA 1G6OA 4NCHA 2QIPA 5C4GB 1FNDA 1R0CA 3WK7A 2XMPA 3ZW9A 4XRRA 1ZCZA 3H5AA 3O8DA 4JL5A 1WETA 1INLA 1Z38A 4HAIA 2B1IA 4P5PA 3C5EA 4YRZA 3C3YA 4G1EB 2NZWA 1WSAA 1ZU5A 5AM1A 3V1KA 1EKXA 1XPUA 4EJFA 1YVPA 3KLNA 4YAEA 4E7OA 2ZR8A 5JZOA 1ESCA 2AFIE 3BF7A 3Q8XB 4N8SA 4E32A 2D62A 2YV2A 3PZRA 4Q48A 1XWFA 3HLTA 3EARA 4W1QA 4TQUS 4IIFA 4FDVA 521PA 1MTOA 4H4CA 3CBGA 3MXOA 1HXHA 2R86A 2IKSA 3M6UA 2YICA 3TXYA 1K7FB 3ELWA 2AEEA 1XCJA 4MDYA 4KXUA 3GJ7A 5J5VA 1CWUA 1YR7A 4RD3A 1ZSVA 4YAWA 3KT6A 3T7DA 1F2TB 1KOGA 5B64A 1C4OA 5FUXA 1K7XB 1XELA 3UUFA 3WBBA 3ZVMA 2CLHB 4BMDA 4I8XA 1NBME 4G8JA 1T3GA 5AVJA 4LF6B 1BVUA 4OP2A 4DGQA 4LKOA 3D8RA 3G0BA 4XB6B 4FQ5A 5HK9A 5IANA 4PYJA 1VYTA 2WU3A 4FYPA 4V24A 4RTPA 2XKBA 5EZYF 3DZ8A 1K88A 4LJ8A 4RF3A 3WGQA 1JIJA 3EOZA 3L92A 4XOUA 4LYAA 5EA2A 3MWYW 3WGZA 3UTCA 3ENQA 4RUKA 1RI2A 3BB4A 4FYVA 3DOFA 4P3PA 1SHJA 4MWOA 2FX2A 5EP4A 4F1JA 5H82A 4MEBA 3GRZA 2ZBUA 2AL7A 2FMIA 3GAZA 3K1TA 1Z4PX 3OO0A 4OHMA 3ZHBA 1RYDA 3T9CA 1W4RA 1NQAO 1W52X 4MW0A 1SHUX 1CJSA 3DXZA 3TLAA 4DPLA 4CF6A 3RUDA 2CSXA 4PQFA 3E15A 2FRVA 4A6DA 1EUYA 2E55A 3AOEA 2C5BA 3HVJA 3DEYX 3OJWA 4INJA 5EIWA 4IDBA 1Y5NA 4JSRA 3I39X 2WZDA 5LZ2A 4MEAA 1PG5A 2JARA 1BN7A 3B3QA 3D81A 2GVNA 3EG9A 3OECA 4HDAA 4HWGA 5LDDC 4DTIA 4EKIA 4L22A 1QHGA 1IM2A 2C31A 2VATA 3EXIB 4QDTA 4V2UA 1CRWG 4GHWA 5THXA 4CM4B 4DLAA 1QZZA 3BD8A 1LY1A 4DEVA 4Q19A 3I5YA 4QREA 4TV9B 2TMKA 4TYPA 2QV7A 5F98A 4LMBA 1UBHS 1OU0A 4YV7A 3CN7A 4LOLA 3U9TA 5E1OA 4EIWA 1BAPA 4ZK2A 4BNVA 1EQ2A 3EGOA 4UEJA 1SY7A 2GKGA 4LSMA 4TLLB 3K94A 2G09A 3N2ZB 3LS2A 5CT4A 2EZ9A 1IXSB 1EGVB 1X7XA 2HL6A 5E1DA 2WHEA 4Z7NB 3DHEA 5JSUA 3F0TA 2J6CA 3OETA 2JJ1D 4X7BA 1FYXA 2BH9A 1W87A 3CNLA 1YZNA 2B2NA 2GPJA 2QN2A 1UJ2A 1D0SA 2G40A 1E9EA 3OP4A 4NY1A 4LKRA 4G4SO 5ES3A 4ZV9A 3SF8A 2HQSA 2OQ2A 1YACA 4G26A 4OCZA 3S2IA 5JCPA 2AOWA 4P6VF 5KAPA 4H7JA 3BGVA 3PNLA 5FYDA 4E30A 3E9NA 4G63A 4LXQA 4ZP1A 1BE8A 2FF5A 3JSAA 3ON5A 2Z2JA 4FI3F 5K8LA 3ER9A 4ESVA 4QXRA 3UMMA 1NBIA 2XEDA 3K96A 3RU3A 2OESA 5FTKA 3WVNA 3TZCA 4ZALA 4O2BA 2GI4A 2WJPA 3DZBA 3O0DA 4OATA 3VC7A 3Q11A 4JWTA 2VJAA 1OMOA 1SRQA 1ID1A 2XD4A 4NFLA 4ETIA 3IQDB 4WLUA 5I9LA 2Q99A 1X8LA 1GPH1 1SAYA 2ZBGA 2B6NA 2QL5A 3ZY6A 4DSNA 1XEXA 2J9XB 1LLFA 4ZA2A 3E9MA 3X1DA 4BFVA 4BMCA 1KEVA 2AOVA 1ZKMA 4ZQHA 5H80A 1LBEA 2GHTA 5CA1B 2QUJA 4N5MA 1K92A 2QL7A 5CYGA 4ARUA 2JA2A 1OTYA 2IXBA 4V02A 4CFZA 4U39A 2LP4Y 3AB3A 4LVUA 2ZXFA 3HV0A 3MB8A 3RJTA 4LJ7A 4KQ2A 1GRRA 2VHYA 1DRWA 1XZGA 4BNUA 4L4YA 3TEJA 1OH5A 3LUPA 4Y2XA 1Z0ZA 1EZ1A 2WRZA 1ZOOA 4M0MA 4C87A 1QTQA 1LPAB 2PSEA 2UVDA 4BB5A 1ZUNA 4LEIA 3NFYA 4UM8B 1NVEA 3QBDA 3RIXA 3D1JA 1M0WA 3JWJA 5C51B 3H1TA 3ORYA 2D5LA 4Z99A 4DM4A 4OK3A 1CUSA 3R6GA 3WLIA 3ZV6A 4DY6A 1Y5IA 4E6EA 1P75A 2EXXA 1NDHA 3AGPA 4B32A 2I33A 1HL3A 2H1FA 3K1AA 4LXYA 4YFYA 5KOYA 1FF9A 2C8VA 3PUJA 4Q12A 5FA8A 2ZTUA 1H1LA 3T5TA 1ZCFA 1BDHA 3ZDAA 2GZRA 1AY0A 4MW1A 1DP4A 5AT1A 3GCGA 4DCJA 3H6KA 4PC6A 1H8HA 5IJXA 4CYMA 3ST7A 4DWVA 3RGGA 1TL7C 4KGZA 5KIAA 5E8RA 4YFVA 1R8QA 2Q0XA 4M36A 4GUAA 1QYIA 3TG8A 3QXSA 4TS1A 4FMBB 1QJCA 4EOGA 5JIBA 3F74A 5KSPA 5CFRA 4JZKA 1SNYA 1QM5A 2VP4A 3KL4A 1KAHA 3TI9A 4EDFA 4ITRC 2ETVA 3KZCA 1AO3A 4QFDA 3ZJ5A 1F7UA 4F5YA 2WJ4A 1G6Q1 5JS2A 3OJCA 3BHMA 4IXNA 4YACA 1E7MA 1RP7A 1YDWA 5AXCA 3WYNA 3MERA 3PQ3A 1S2NA 4QDOA 2NYAA 3VPCA 2RKOA 1J07A 3D0OA 4P82A 5CVVA 4IJ6A 3FCUB 3TSYA 2IBSA 2BM8A 1VG0B 2G8LA 3PR2B 1BKSB 4GUDA 4NOKA 3H18A 3FVQA 1I2ZA 2GLXA 2IHKA 4LK3A 4MUFA 4BVKA 1I10A 4ERXA 2G82A 4U2GA 1YR2A 4OP1A 2WJYA 4AG3A 2W2LA 2O50A 3QTLA 5ILQA 1EUCA 4RK4A 1RQ2A 2ZJ7A 2HK8A 1WY5A 2V7VA 4KFUA 4PW0A 2YJ3A 3R8XA 3CJQA 3W5IA 5LOVB 2QSZA 1N2EA 3I9FA 5LYJF 1GPWB 3OFND 3QQPA 4PE5B 1VPWA 4AJLA 3TECE 3N6VA 5B57C 2BE9A 3OIGA 1X1SA 4L8WB 2IZ7A 3O84A 4MPTA 4MKIA 5FCDA 2CMGA 2WD9A 2Y0DA 4GU5A 1VIVA 3CISA 3VJMA 4EYOA 1JPJA 5I4CA 3JZFA 4F45A 5GGXA 3PVSA 3LUJA 4M46A 3KKNA 3NWJA 4KXYA 1WXFA 1J00A 4ER3A 2I4TA 2WB4A 7MDHA 5AW6A 3CO0S 1L7BA 4US2R 2L42A 3PHGA 5K8VA 2E4XA 3HB7A 3PT9A 3B6ZA 1LLQA 1R6BX 2XXAB 4HG2A 1FSFA 2C9DA 1BS9A 2WKQA 1DIGA 2WD8A 1Z2EA 2ZE5A 1KQPA 1B8UA 1H1TA 3KALA 3MK31 4TMTA 5F9MA 3QBVA 3UA3A 4HWKA 1I7QB 4JJGA 4RXMA 3B89A 3I4LA 2YZMA 5TJHA 2YNMA 2OZLB 2ZTHA 3C48A 2OE2A 3PC7A 4MV6A 3M4ZA 5G0WA 3ZCVA 1F9AA 1HDEA 4JITA 2G9VA 1BVRA 1TM1E 3WGGA 3PIRA 5ICMA 1TIBA 4CR6A 1NRWA 1RYEA 3VZSA 1NSYA 1KTIA 4D4LA 4EVIA 2BKEA 2ORED 4OKIA 2R8EA 1NRXA 1UFQA 3PG5A 1Y63A 4GQAA 1EBBA 1W47A 1D2RA 2A7XA 1Z0SA 2FUNB 3CPSA 3FNEA 4J0QA 1PJLA 4K8OA 1R0SA 2HM7A 2P9ZA 3IHTA 4LZOA 2M6LA 4YDQA 2WW8A 3Q3VA 4N0EA 4TWBA 1V0JA 4NAUA 4RSHA 1IUNA 2CD7A 1LSSA 3RHTA 1PCXA 3DLTA 3MWDB 1ZL0A 4OBEA 1NRJB 3IT3A 4OSEA 2DBZA 5JBNA 2C29D 2D06A 2JIQA 1ELOA 3AEZA 1U1EA 3G85A 4OMUA 4TVOA 3A26A 1DKNA 2Y92A 3BSYA 5FYQA 4K9SA 3WY9A 3EIOA 3GXBA 4OMDA 4YAFA 4UUNA 3D1VA 5I7HA 1C80A 3QF7A 1ATZA 3PQDA 3OU6A 1T3TA 2A0YA 4DMHA 1JEQB 2OGUA 1H4SA 1TKAA 3IDAA 1FVXA 1F38A 5EWLB 1PU2A 4NJOA 1G6HA 2CLLB 2RGXA 3U4IA 4MWZA 5KYYB 4N6OA 5KNDA 3GFQA 2I29A 2R84A 3U5TA 3NIDB 5GV8A 1JU4A 1L7EA 4FUQA 3AHJA 1AQIA 4BNFA 2GXQA 5KNBA 1TCAA 1P7CA 2IYEA 2WPDD 1HYGA 4YH1A 5ILOA 2AZTA 1YRQA 3LPAA 2OVFA 3AL3A 4RJLA 1ISIA 1L7AA 5CTJA 3CPEA 3B7WA 3R3WA 1W1WA 3MJRA 4V0QA 2B61A 3K71B 1BHQ1 1ZINA 4PNPA 3Q10A 2FSVC 4QQRA 1G2IA 1CRZA 3SEQA 1OTXA 1TVMA 4BYMA 5HMMA 4IFIA 2R85A 4GX5A 4IUCS 4PBSA 1I51A 2P1DA 2P3QA 1MOQA 1QH1B 2GXSA 4D3DA 3OAAA 2J3JA 1HC7A 3E5MA 2AN9A 2A5YB 2AA3A 2PKWA 4Q9HA 2JCBA 4B3SB 3NRJA 2FSFA 3HSYA 2ODNA 4JT4A 1D09A 1TXGA 4N5LA 1L5RA 1S89A 3GYGA 4E22A 5JT1A 5INTA 1KEPA 3LJKA 1SXJE 2WJZB 1CYEA 5K05A 4QAJA 1CZNA 2C99A 3MS7A 4X7PA 4F4JA 5B58C 3E70C 4QUEA 1L8QA 5F5XA 4BDSA 3CX8A 3GU3A 4R3WA 3X2SA 4F9TA 3ACDA 5ALVA 5LQAA 1YZFA 5J2UB 1SXIA 2AFHE 2M2IA 1NG9A 3T38A 1CEYA 2WKPA 3BGDA 1OGJA 3KHUA 3DJFA 1O3YA 1GG8A 3K32A 4PICA 3IIMA 4ZOAA 3I8OA 3KYIB 5ALYA 4P08A 4RPKA 2YMQA 2X3FA 4JDUA 5EJ4A 2Z4TA 1LSOA 4F96A 4AS2A 3MJEA 3C98A 3KJZA 2GAAA 5AJXA 3RYTC 1A98A 1J7JA 3E0XA 4S1VA 1GZVA 4B0OA 4ZVKA 4PZPA 3VU8A 2Q0SA 2FXIA 2Q27A 3C41J 3S81A 2VDWB 1K7CA 3HKDA 3CV3A 4UQPA 3H86A 1XXLA 2WJWA 3LVRE 4MR9B 4CDNA 4G84A 1NJ8A 1XK7A 2AF3C 4G5GA 3VR4A 2PMCA 4B7ZA 3VR3A 4KVAA 4DCTA 3RRYA 2X7XA 3DEZA 3HV2A 2OHHA 4REMA 3ZH2A 5LMZA 1MO5A 1ZIYA 1SUBA 3FB1A 3WV4A 5BR8B 3CZAA 3DMNA 5K6TA 1N2JA 4IDFA 4OI1A 4KBYA 1YQWA 1ZZEA 1U81A 3B1FA 3BIJA 1G4HA 1P80A 4IQGA 1Z5PA 3WAGA 1XZHA 1M1NA 3SZGA 1I7DA 2E5LB 1EQAA 4DHEA 3MB5A 1TO1E 2UUAB 4DLXA 5EPUA 1BCSB 4Z2AA 4P7KA 4AWXA 1EVQA 2RH5A 3E0QA 3FHJA 2P91A 5JLAA 4X93A 1L7OA 3PUKA 1WZ2A 2RHLA 3F5DA 3FXAA 2XMRA 1J4AA 1MD9A 2BMFA 2GWRA 3KOXA 3BH6A 4ZQCB 2H2FA 3ITKA 3BT7A 1E89A 4FWIB 1JIVA 4XXHA 1XQYA 4P2GA 1AM4D 1XXHE 1JH9A 1YGPA 2V4UA 1T4CB 2QG9A 4LYFA 3WI7A 3DOEA 1LI5A 3FTCA 3KJIA 4G37A 4PCLA 1B41A 1LGYA 2P9TA 4N54A 1S4MA 4JUDX 4P0QB 3EPRA 3CEPB 1KZYC 3QVLA 2C2YA 3E23A 4QUHA 1YJAA 2WJJA 3PGKA 2SBTA 4F92B 1ZLYA 4QT4A 3Q9NA 3U5ZB 3HB1A 1E1NA 3LBAA 2FZWA 3VTFA 4ALNA 2ZS7A 5KQGA 3GLQA 3LVFO 1T35A 4PYNA 1PL7A 1TJ3A 1ZOIA 3IH5A 3PTLA 3M6XA 3K5IA 2MDTA 5C5EA 3BWVA 4FFVA 4YJ2F 3ETLA 4D9NA 1QC5B 2UUBB 1SK9A 3OT5A 5JSYA 1LSJA 1F60A 3FYSA 5HCIA 2UZ4A 1HNZB 4RKRA 4BKUA 4NXNB 2YJZA 4YAKA 3GH1A 3EGDB 3HO6A 2DUNA 3IP8A 2P5UA 3LBIA 4XFDA 2WAXA 4JP8A 4O5AA 4X91A 2DTEA 1XZNA 2ON6A 2ZT7A 3BMCB 3CT4A 4S24A 3DLCA 3AL2A 2C4MA 3F49S 3QPVA 2JI8A 4Y2PA 5EYPB 1JI3A 1HT3A 1Q1EA 1EFPB 4PAMA 2R48A 3VVLA 2XMBA 4ESHA 2VQ6A 1NW4A 5KVQA 4US1R 2W98A 4ARBA 5BP7A 1Y4SA 2O8BA 5FX2A 1IAQA 1W46A 2EKPA 1IY0A 2B2XA 2R6GA 4Q39A 5NLLA 5KDOA 3VPXA 1L5YA 4A73A 4XPIA 4CQJA 1UXKA 4O2AA 3E3LA 1DAFA 3QNWA 3BCUA 3WKBA 5BN5B 1F12A 1GCIA 1YDEA 2HA0A 4NEGA 5AOCA 2P4EA 2KYRA 3HZZA 3NHYA 3ODGA 4FILA 4EG6A 1ACMA 3PUXA 1C4WA 3E5RA 3FH0A 5B1SA 4R0VA 1T3SA 2CVFA 4KXXA 1EFRD 4QJ4A 4CUJA 3LVQE 2ZJ5A 4NYJQ 4BIIA 5JV5A 3LXXA 3BDAA 1H05A 3OLZA 1GUBA 4EKEA 4QU0A 1W48A 1L4YA 1XZAA 4PZ0A 4MW4A 2PLNA 1JU9A 3BFVA 4AVYA 4P36A 4FT2A 3WB9A 1CY0A 2DBVO 1QNFA 4C21A 1O03A 4FBMA 2ID8A 2VJMB 1Z0IA 1RACA 4Q1AA 4TMWA 3EWSA 4JJKA 1KS2A 1QE0A 1SPXA 4PYMA 3QMPA 1FLVA 4F9FA 3X1MA 1APBA 3FJOA 2AN1A 1CS4C 4DXHA 4CKCB 2JVIA 4OHYA 1M72A 1AGRA 1JBEA 3BFKA 4PRLA 3RF6A 5H5JA 4CDRA 2JFGA 4XVUA 3OLWA 1HM5A 5KYUA 1MO2A 1QIKA 3CH4B 4HI0E 4ZDWA 3I83A 4EP1A 2YIJA 2PWYA 3AFHA 4MULA 2WUFA 1Z2DA 3BJIC 3M6VA 4MINA 5CK4A 3C8MA 3JASA 1GARA 1ZICA 3G8BA 1ADBA 4FOSA 2OQIA 3T12A 4Y7CA 2F55A 4AD8A 2VF2A 4FLEA 2QMEA 2W00A 2WTXA 2V58A 4H7FA 3NX4A 1KMQA 3TKAA 4ME6A 1MRZA 4C3ZA 1JEQA 5LQNA 3DFZA 4G0ZA 4R01A 4R2IA 2W7TA 3N59A 3L0PA 3HJFA 1TVKA 1RLUA 3K5WA 3MBKA 3PZBA 1NOJA 1G4AE 1I2MA 2GPAA 3NB0A 2Z6QA 1ORTA 1YHZA 3KKQA 3QI7A 2Y4NA 1J2EA 5KVVA 4BVGA 2P5YA 4IJWA 1FVOA 2X23A 2Q3JA 2H08A 1AU9A 1OLOA 5ALQA 3ZIDA 1HFEL 1K7YA 3QOWA 3WLHA 3CLUD 2ZFUA 5LU8A 1MB3A 1I80A 1UP7A 1UBUS 4R16A 4E5DA 4UM7A 3C74A 2BELA 4EM6A 4PAWA 1DO2A 4RABA 4YQEA 4ZT6A 2BN4A 3HDVA 3RC9A 3QG5A 4AURA 2EX1A 4F46A 4U2FA 4ZJZA 4MUIA 5C53B 1TNDA 2OWEA 2C83A 2IFTA 1FA9A 3IKTA 2NTNA 3EGVA 3OSZA 4EWLA 3CLRC 4R8RA 4BU0A 4XD7A 5KUTA 1KWKA 4JBWA 3VR6D 1IONA 3PB3A 1KAQA 1YHNA 1LBHA 3QEKA 5AICA 3H2JA 3KE8A 2F8TA 3H1FA 4WXMA 2CJXA 3LHDA 2C95A 3UKJA 4CMBA 5C8ZA 4WFJA 2ABWA 3K92A 2QUBA 3I6IA 3KTAB 4PR3A 3CJRA 1R3DA 3D6FA 2IZ1A 4QNNA 3K72B 4REQB 3KQLA 4HRVA 4EEKA 1SU8A 1BQ4A 2J67A 3HU5A 4OV6B 5A9SB 1U5BA 3ZWQA 4NOJA 1FXWA 1U8AA 4R7ZA 3OCVA 3HB5X 4GS5A 2G9RA 1EM8B 3A37A 3M49A 4C7KA 4FYWA 3ZE1B 2FY8A 1JAIA 1U8ZA 4MAAA 3WK8A 2AX3A 2D4HA 2TMYA 5FHQA 3D4PA 3H5RA 3KEFA 1FJXA 3IAEA 3OZEA 5ECGC 2YZ2A 1MQAA 2EZ4A 3CLSD 1JFRA 2IPMA 3O4JA 2PZAA 5AW0A 1GEGA 3GA0A 3ZXUB 4EARA 4B79A 5CT9A 4KRFA 2IELA 5JWRA 2Q45A 1SU4A 1B6RA 3ZGOA 3JVUA 4IMJB 3DPUA 1A9XB 4V38A 3WDSA 1XNHA 1K98A 3RVBA 3EZFA 4L3OA 4DYHA 1UP6A 4PO8A 3TNFA 3DNPA 3VGJA 2QUZA 3LBHA 4CT0A 1PJCA 4CIBA 4LSZA 1KE1A 2W2TA 3INNA 1EA7A 3UT5A 2V7EA 4JI1B 2E6UX 4ZI7A 2B1RA 1O5IA 1PN3A 2WOJA 1X7ZB 3CU5A 4RPHA 3I0NA 4RADA 1K8XB 1G7RA 4E5SA 3K6JA 5JNWA 1Y48E 1JV2B 1BCSA 1R6XA 3GDFA 4HGNA 2WFZA 4FC7A 1YS9A 2VR1A 2XUDA 4QX6A 2VN8A 3VNAA 3ZQ6A 2VH5R 2J07A 4F86A 1BWRA 2BOVA 4J0DA 4QUIA 3VDMA 5HX7A 4WLNA 1PV4A 1EINA 3PDHA 1Y1KE 2C0CA 1V2GA 4YCJA 1FS6A 4CMEA 4FS3A 2GNAA 1BA2A 1MV5A 1F3OA 1N34B 2VP5A 3HCAA 5DYNA 1MEEA 1T4CA 1EFKA 1GL7A 3EXG1 3IB6A 3QNUA 4FN5A 2GUWA 4MJLA 1GRNA 1MABB 4WCFC 4A2QA 3G0OA 5BV0A 4RWEA 4D8YA 5FLYA 1PDVA 2Y0PA 5ECDA 3EWNA 3RTEA 4N0MA 4HRAA 4D5GA 1NUTA 3TQCA 5B1DA 3DV2A 4PC7A 4TT8A 3DTVB 4PYKA 1S1MA 4CM9D 5FTNA 1Q7GA 3GP5A 2GKOA 3LM8A 2RD2A 3O8RA 4JLMA 2DFKB 3I05A 3QXHA 4R1PA 3AF6A 3L8MA 2R0QC 3TOZA 2IBMA 4OHBA 3RSQA 4Y9RA 5LLSA 2BAGA 2REXB 3PQ4A 4R9SA 5IVPA 2POQX 2AFRA 4IKEA 4D8UA 3CWQA 5F77A 3PRYA 5HIKA 5JBQA 1L8LA 4KGDA 3TNYA 4B71A 3GWGA 3NNDA 3DE3X 2G7ZA 2PSDA 2VPXA 4O4IF 1YMVA 4EA6A 4C5CA 1RHQA 3MOSA 1BIFA 3A4TA 2GK3A 5IJ9A 1DEOA 2XV1A 4UASA 4H60A 5E2BA 4PZYA 1T1RA 2XTNA 5KOHA 5EYPA 1SUSA 4AAYA 1HR0B 2NZYA 2R00C 1XSEA 3C4JA 3HDQA 4M55A 4RZ2A 4IFBA 4MQ4A 5EOVA 5BNFA 4WKNA 3W7VA 1JE0A 1CKEA 2PWZA 1E3TA 4JQZA 4TVSA 2PX6A 1T3LA 2GB4A 4RJKA 4Q82A 4EYEA 5CFQA 3D8TA 3WZ2A 4Z3OA 4DR1B 4QOSA 4BFYA 4ENWA 3OLVA 5H3LA 2WG1A 2H51A 1EP3B 4DXAA 2CDNA 4J0FA 4HH0A 4L3WA 5EIEA 1UEIA 3VI4B 3IJRA 1SO8A 1X13A 2XIJA 5L53A 1P5HA 5M04A 1V3QE 4OHKA 3GRVA 1E4YA 4ZAXA 5J40A 5E6SB 2O2IA 3TAHA 1T2UA 1AH2A 2H57A 4TKLA 1T9GR 2QRKA 4COKA 5IHXA 2CWDA 5AW8A 2CFTA 1T4GA 1O96A 1SVWA 4OJNA 2IYAA 3M6MD 4RAQA 4X1IB 4JT8A 6CHYA 3CTMA 5DYGA 2I8LA 4DC0A 4BO0A 1QYXA 2GR9A 4EY6A 1JHVA 3N8HA 3F6RA 5AESA 1H2ZA 1E5DA 1Z7EA 3FOAA 4M7OA 3CRQA 1YSCA 2QTWB 1SG9A 3U4GA 2HFJA 2Z5GA 1T9ZA 1XVUA 4B46A 1HLDA 1ULZA 2FR0A 1PJ3A 4BGVA 4X20A 3PITA 3PUHA 5C34B 4EUFA 4TQ9A 4NNJA 5KJ1A 2QR5A 1UDXA 2BZ0A 2XB8A 3RVRA 5JRJA 1CJCA 4U2DA 2FJPA 4BMSA 5MFZA 1T2EA 3WGVA 4OQPA 3KDPA 4TKUB 1QGOA 1UJBA 3B6KA 2PH1A 1UR5A 3UB3A 1OFVA 1R27A 2GD6A 2R6DA 5AVOA 5L4LA 4S3MA 5DBOA 3WDKA 2KX7A 4J94A 4CMGA 2IOQA 2F17A 3E27A 5TPZD 1TW3A 2LGJA 3MMZA 5DLPA 4BBAA 3I45A 4DQDA 1SUFA 1VHLA 2HRCA 2VYVD 5BSWA 3D4LA 5HFNA 3FR8A 4ZQEA 2D59A 2C82A 4KLNA 3RAPR 3UAXA 3THYB 2C4NA 1LJ8A 5L3QA 3ZTYA 5IFLA 4KLCA 4YLGA 1DWQA 2VF4X 2FH5B 2JW5A 2XX3A 3E2IA 3HCRA 4S0ZA 3K8QA 4ARSA 3OQOA 2QUHA 3SZ3A 1AHNA 1C3VA 2JJ2D 1QDUA 2C9YA 4AXXA 1KC1A 3IDSA 2PRSA 1ZEJA 3INTA 3LAWA 3WWCA 3U09A 2P65A 1M8KA 3M1AA 3GK3A 1D2EA 1QR6A 2B1GA 4F60A 1S3IA 1QPGA 3FDFA 2GCEA 2QUKA 1G3UA 3TWOA 1Y98A 1YZ3A 1D8TA 2CXTA 4HC4A 4MVJG 2MSCB 2WWWA 1VA4A 3TGWA 1AOXA 3DWFA 4IJKA 4X8MA 1QHHB 2XADA 3IXLA 5C8YA 3ZE2B 4D9MA 2F48A 3RVPA 4JYZA 4DR5B 3FRIA 1IG0A 3DT6A 3KQQA 2HTFA 4EEXA 3G5AA 4LI3X 5KMGB 4PHGA 1XD2A 2YH2A 3BXPA 3LBYA 4RY0A 4JJFA 1ZA1A 2CKDA 2XECA 5CXXA 4B4UA 2EL7A 3D8HA 3L84A 4MR7B 1XCGB 3FMIA 3O2QB 4KWTA 1DVRA 1XA0A 4PLFA 4XIYA 4YVFA 4IYJA 1GL6A 2ZAMA 1KAOA 3B1VA 3P1JA 3CXUA 1YT5A 4X45A 3SSAA 1DTWA 2ZBQA 2VDRB 3TKYA 1P2TA 4HNQA