2UYGA

Crystallogaphic structure of the typeii 3-dehydroquinase from thermus thermophilus
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
141
structure length
141
Chain Sequence
MVLILNGPNLNLLGRREPEVYGRTTLEELEALCEAWGAELGLGVVFRQTNYEGQLIEWVQQAHQEGFLAIVLNPGALTHYSYALLDAIRAQPLPVVEVHLTNLHAREEFRRHSVTAPACRGIVSGFGPLSYKLALVYLAET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-DEHYDROQUINATE DEHYDRATASE
publication title Crystallogaphic Structure of the Typeii 3-Dehydroquinase from Thermus Thermophilus
rcsb
source organism Thermus thermophilus
molecule tags Lyase
total genus 46
structure length 141
sequence length 141
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01220 DHquinase_II Dehydroquinase class II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.9100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Dehydroquinase, class II 2uygA00
4KI7A 4ZC1A 4CIWA 2WKSA 1H0RA 2Y77A 2C4WA 3N86A 4CIVA 1GQOA 1UQRA 4B6RA 3N8KA 2CJFA 4B6SA 4V0SA 2UYGA 3U80A 4CIXA 4CL0A 4CKYA 1D0IA 1GTZA 3LWZA 3N59A 2XB9A 3N8NA 1J2YA 2XB8A 4KIWA 1H0SA 5WRFA 3KIPA 5B6PA 2C4VA 1GU1A 2Y71A 4KIJA 3N7AA 1GU0A 4B6OA 4CKXA 3N87A 4B6QA 4CKWB 4B6PA 4RC9A 2BT4A 2DHQA 2Y76A 4CKWA 4RHCA 2C57A 4L8LA 1H05A 2XD9A 4KIUA 4CIYA 3N76A 4CKZA 2XDAA 1V1JA
chains in the Genus database with same CATH superfamily
4HMOA 4QC2A 3KBBA 4FSHA 2W00A 1Y0BA 5K3EA 4I5GA 4JT9A 5DPMA 1VLZA 2FLVA 1DG9A 2W8ZA 2AQIA 3CHYA 2JIMA 3ZU2A 4QU8A 3NHSA 1GUDA 1ZG3A 4B44A 2WYWA 4QNRA 3HP1A 5CDHA 2FX5A 3TZHA 1P4SA 3MT7A 4I1YA 6Q21A 3JZAA 3NDIA 4LJLA 4NBNA 4RLQA 4YFVA 3DV9A 3F6EX 4BMDA 2DEUA 1ZISA 1NDQA 1Q0HA 4TTQA 4X1IB 4DDTA 1JS1X 3QEBZ 4ZT4A 1A2QA 5KTPA 4RY0A 2GGSA 1N5MA 3PSAA 2ZSFA 5LDGA 5TPWB 1N77A 1PYGA 2VHJA 4RV4A 2IEIA 1UP7A 1ZD4A 3RASA 1K3FA 2EKLA 3WP1B 4IL5A 3RHSA 1ESDA 2Z04A 3ILHA 4KOEC 3JWGA 4EB6B 4ND4A 2WM9B 2EJUA 1SRQA 1DDGA 1OX5A 2QIOA 3CRW1 2AIRA 3D2LA 3QH4A 4IQGA 5IVDA 4DXDA 3CGWA 2QRNA 3CNOA 4GHWA 4IIGA 3BGVA 5I48A 3ORRA 3G9UA 3B3QA 3E5HA 4ZI5A 1QPBA 1GUFA 1XEFA 2EGGA 4RTRA 1FMFA 4KIGA 5KTKA 4ZRDA 2VUUA 1FDRA 1IAVA 4B4KA 2IS4A 5A7GA 4GU5A 1RI2A 2HGSA 2EU8A 2I1LA 3QXJA 3LC7O 4Q3DA 3WG9A 4IDBA 1OIXA 1ZHHA 2OZLB 1VBNA 1BXGA 2AH5A 3CSUA 4B9AA 3OQVA 4ROTA 1U6IA 3ZQKA 3L7NA 2QQ5A 4QG3A 2J41A 3IJEB 1UDBA 4JQCA 4JLAA 1OYVA 3I9V6 4KO1S 1FTYA 3IDSA 4OV6B 3KC2A 1JFRA 3PTZA 5EC8A 2HYDA 1O6BA 3KYJB 3TNDA 3PFFA 5IVHA 1WU7A 4ZN6A 4UC0A 5BWNA 4KWIA 2I4MA 2VFAA 1I1HA 2AB0A 2WZDA 9MHTA 3LW8A 5TS3A 4XXHA 4YCMA 3LPAA 2PT7A 1LKZA 1MUUA 4JI8B 5L53A 1QK5A 3PRHA 2XUPA 4P08A 1W0KD 4KCGA 3UXMA 2XNDD 4CKWB 4LRSB 3ESYA 3VPCA 2LKDA 3H8VA 3F6BX 4U0KA 3AHFA 3OG9A 4LISA 3CB4A 3MWEA 4PO9A 1DFHA 3TQTA 1UZNA 2XMSA 3LC0A 4AU1A 4IDPA 4B87A 1U65A 1NZJA 2O50A 1JAHA 1PG5A 3BSYA 2C2ZA 3WXMA 5LJIA 1V5GA 1LBSA 3E9CA 5KCZA 3A4IA 3LE8A 1VPWA 1A9SA 3GWZA 5KQRA 1MDBA 1KNQA 3I6ZA 1XCJA 4L8WB 4V0MA 5LZ2A 3MINA 3PGKA 1K6MA 2XMPA 2JKYA 4MH0R 2F3PA 3VR2A 2XY4A 3AR7A 1BC5A 4NYMQ 2CZCA 2EFGA 2AFIB 4WK0B 5E6UB 3LVQE 2AW3A 3OE7A 3PWSA 4BJ3A 3OTIA 1WF6A 2ZITA 1AD2A 4ZVPA 3C87A 2ZRAA 1OLXB 3EX7C 3SXJA 3QQ5A 4D8VA 4TV8B 5MGNA 1UXGA 3K72B 3A9UA 1BGXT 3T7JA 3WYFA 1XALA 5JJBA 5E38A 1P19A 1XNGA 5LQDA 1CV2A 3QWBA 1M2VB 5REQA 3GLUA 2P3QA 4ZQCB 2CV2A 1Z6ZA 1NF3A 1R0ZA 1XK6A 2ZIXA 2VSFA 4WHMA 3WO1A 2Z6AA 1KQ3A 1ECJA 3KVRA 3O8QA 4KO4S 2NTJA 5BN4B 3VPBA 1FDVA 3DMTC 1TVMA 5D1HA 3W6UA 2QD2A 4HGYA 2HXYA 4W7IA 1W75A 1HDGO 3FSGD 1JIVA 1T4GA 3ZWWA 5KJ6A 2WHEA 5CA0A 2FPRA 4J9UE 1JWBB 2GS9A 3BSFA 4GBMA 3B7GA 2B8EA 2IF0A 4ZCQA 4YUVA 1E1LA 3GUCA 3RTEA 3B6EA 2BKLA 1TMKA 2HBRA 2WB4A 3FAKA 1DVRA 1BZYA 4REQA 4OCZA 4KTVE 4V0QA 5FOTA 1YGYA 3VZDA 3IO3A 2NV2B 2ZJBA 5BNZA 3EPJA 2EG9A 4AYTA 3QPWA 4INAA 5KYWB 2QUBA 2GAOA 2QUZA 4YJHB 2RGUA 1WXHA 2HZBA 4PFSA 5D3MB 1XLUA 3QU2A 3A9RA 5I5EA 2VJKA 3NEJA 1PV2A 4HH1A 5CGQB 1PR2A 2B69A 4G07A 5G0WA 2XXAB 2ZBEA 4B81A 3H5RA 3EMKA 4A0FA 4W5OA 1ECBA 4FCWA 4TYPA 3ETNA 3EBOA 3E58A 3MEQA 4DPKA 1U80A 2ZJ2A 1C41A 3KYBA 2DP4E 4DV0B 1VQ1A 1YCFA 2G3YA 1RQ7A 3O4HA 4WBNB 1NQ5A 1NZFA 3ZG6A 4B3XA 3CE9A 4QRHA 1Q3KA 2NXNA 5F23A 2X58A 4QYWA 3TLXA 5JZOA 1DX6A 4U00A 3TLAA 1IBCA 4F9GA 1U2GC 2WHPB 2ATXA 3NXKA 1MB9A 2LP4Y 3WO0A 1BG6A 1KDTA 1OX6A 2OHXA 4WI1A 4D0SA 2NMVA 3AQ4A 1CUEA 1N8NA 1V11A 4MWDA 2I71A 3IHTA 1XZFA 1OIVA 4V0OA 4MYTA 4KV7A 1LVUA 2YMMA 1DQRA 2DQ4A 3MT9A 4OIFA 3WK5A 4EFKA 4YUYA 5B7GA 3AVPA 1L8OA 1HDXA 5GV8A 4ZCTA 3AWDA 4D5EA 2YW9A 1IY0A 2DKFA 3RW9A 2PA0A 2CYBA 2CHUA 1ZDMA 1J8FA 4I99A 2D1TA 2X76A 1H4TA 1WSBA 3G2IA 3QY0A 1NSFA 3DO5A 3SEQA 3OCJA 1SKUA 3PFHA 3QX8A 4MVXA 5EKDA 4IIFA 5TPZA 5IWAB 4LWZA 4U2CA 3UJAA 1TDJA 1I30A 1J8DA 3B5JA 1VL2A 1RQ2A 1SBNE 3BXHA 3AL0C 1RLIA 3AEKB 1PK7A 1IL0A 2E6KA 4IG4A 3V1MA 5AW9A 4EZBA 3M5WA 4F2GA 3KHTA 3ZE0B 3TE6A 1DIHA 2X1VA 4N9WA 3WGZA 4I6JA 1D9XA 2Q4BA 4M89A 3RHFA 4BE7B 4NOLA 1N33B 2GN9A 4IAOA 2IDKA 3DBRB 5EIFA 3RBAA 4DCOA 3GJ8A 4QHSA 2TYSB 4IX1A 4UW9A 3WLSA 4L0MA 2J9ZB 2ONKA 16PKA 1KI2A 2V74B 3GVPA 3S8YA 1M54A 3RUDA 1SXQA 1P5JA 3VPSA 3SZOA 1NV9A 4UPVA 4RF5A 1V3QE 4UBLA 3CNEA 4ZAVA 2NUTA 4X44A 1Z2EA 1ZJJA 3L7JA 4Z0HO 5JCOC 5IABA 1IXKA 1WB9A 1VM6A 1P4GA 1ZH6A 5HJEA 2IIPA 3TQIA 1G20E 2WZQA 3FNHA 5AW4A 2AKAB 5B3JA 4LF5B 5JS6A 4L3VA 1E6UA 5H82A 4TM7A 3OMLA 3U3ZA 1FLVA 3NBKA 1DSSG 4OHUA 3M5DA 1MGOA 2XSZD 2IYWA 4KVGA 4M0DA 2XGOA 3THOA 2JIPA 2GYUA 1GRVA 1OBHA 5GOTA 4W99A 2WINI 2HQBA 1UT8A 3P2EA 1QH8B 3EFOA 4PWYA 1KZ6A 4ZT7A 4NHOA 1OQAA 3CBGA 3C4VA 3R41A 2V1UA 1ULTA 1F5SA 1CJUC 1Q7RA 1T4MA 2QYTA 2VT7A 2ZR9A 3O74A 3UGJA 4CLRB 2HJSA 4P2BA 4B85A 4AUNA 2GPTA 3DPIA 2YN4A 3BIWA 1TUEA 3KWLA 2PBFA 1F8YA 1EPUA 4IVQA 1NX6A 1QV6A 3SZMA 2WYOA 1T3ZA 4EB3A 1Y4AE 2QTAA 3KNZA 1ISSA 4Y9RA 1RJ9B 2FW1A 5ALIA 2GZ3A 1RWWA 2WV9A 4UD6A 2P5YA 3DOIA 2EKDA 1NRIA 4CKYA 4YMGA 4FVTA 3SHTA 2IYAA 3TECE 2FR0A 3JAWB 3R5FA 4IIXA 4O5AA 1OYYA 4PIVA 3MAAC 4RXUA 4ZU6X 4TL7A 4U5XA 1HT2E 3T0GA 1XNRB 2QMOA 1J0CA 2G80A 5EWMB 1D4FA 1V35A 3I2GA 3LMKA 4J29A 3DONA 3FCEA 4PHHA 2GZ2A 2X19A 4HXGA 3GDHA 1T6BY 3W5IA 4BQSA 4B3FX 5JC8A 5JAPA 3IDAA 4WTOA 4XEHA 1G21E 3LQFA 2C4KA 3GBSA 3JQCA 1QS0A 2XYPA 3PKZA 4LTNA 1Y6ZA 4ZODA 2ZTVA 4KMOA 3I04M 4Q9KA 1PQYA 2YC4C 4D9HA 3T3EA 2Z5FA 2CSXA 2YVLA 1K7YA 4A27A 2PR7A 5JQGA 4C2TA 2Q6LA 3QFSA 5H3HA 4X24A 3QQPA 3T5CA 3RJMA 1V7PC 1RFGE 2AW5A 3TKYA 2Q28A 4TTAA 1EVKA 1AS2A 2FQQA 5HJ7A 3OTOB 4JIGA 4ETNA 1WMSA 3HI6A 3MTIA 3QLUA 2XUAA 1SCBA 2QD1A 4G56A 3S2FA 3LGXA 5H68A 5HEKA 3S2SA 4ZOLB 1JU4A 2P78A 1FRZA 3TAHA 3PLRA 4JT4A 2WWFA 3UZUA 2DJ5A 3ZGXA 5ALHA 1T1EA 2FNAA 3UFXB 1S9HA 4YRAA 3IT3A 5DOZA 1T0JB 4QGAA 1QNFA 5JXGA 4EK9A 1EZZA 2CJXA 1V4NA 3ABIA 5TX7A 4OQLA 3TDMA 4ZEVA 3DV0A 2BBWA 3A6ZA 2AUMA 2EDCA 2PXXA 3L8FA 4OGWA 1D0IA 1T9KA 2GWRA 3E9EA 4HGQA 4RHFA 2NU8A 2E5WA 4RTPA 3A1CA 2WM8A 5E4JA 5EIWA 4NOKA 3FRIA 1MO4A 2XHZA 4LRQA 4PAGA 1CVLA 1W5FA 4C43A 2F1IA 4HDQB 1YS9A 4YDRA 3THWA 1X7WA 2BH9A 3A27A 1OBFO 1RBYA 4I8DA 3PGMA 1Y42X 3SYRA 2QKYA 4KQ6A 2ZRNA 1YV9A 1HZZC 2RC6A 4KNYA 1ML3A 4KR7A 2UYQA 3G7UA 1C3LA 4PYQA 4AURA 2WJVA 1AUPA 4II2A 1V48A 2FSPA 3AF2A 1EXDA 2J32A 3DSRA 4OGKA 3M83A 1OVMA 1TJNA 1JLSA 3GPIA 3FBWA 4BP8A 2ZRBA 5A9SB 1UJ6A 2Z8YA 1YK1A 4NATA 5TS2A 1B41A 3LT0A 4P36A 821PA 1YS7A 2IPNA 4W4TA 1OLUA 1MAHA 1BD4A 5JJKA 3F1KA 2CNWA 1EA7A 1KMIY 2HWUA 5FF9A 1CEXA 1FVXA 4AS1A 4YUWA 1EAYA 1QTNA 2X40A 3PHCA 4XB2A 4BTVA 3FB1A 5K6AA 4PNZA 2Y0DA 1IPHA 5HQJA 5K2MA 2AE2A 3O93A 2RK6A 1KDYA 1YJ5A 2CYCA 1U3DA 1ORWA 2P9JA 3CIFA 3NAMA 3BKWA 3OZAA 3QVVA 3ZE9A 4C21A 1V1MA 1FLAA 2X9LA 5JYDA 1CVRA 1FU8A 2ZR7A 4MGEA 4EYKA 1DBSA 2JDIA 2BFAA 1S2DA 4HDNA 1E6KA 1WU8A 2ZB7A 4JL6A 4YS6A 3MUOA 3EZYA 2DHRA 3PX3A 2CJWA 1WVMA 4WE3A 3L05A 1MMFB 2CLHB 1Z36A 1H0SA 2ZULA 2FPMA 2JLVA 2YRFA 1MC1A 1QX4A 2BRUA 2AJTA 4OMFG 4OXIA 3V1NA 3IOYA 4MEBA 4R84A 5LMCA 3Q8MA 4FJ0A 1YRBA 3BH6A 4ZRNA 5EQJB 4IJ6A 1A7UA 1XL1A 2PU7A 4JYMA 4V03A 4XJTA 4DC9A 2UVPA 4J0CA 2IUFA 1W47A 2PCJA 4HNAB 3GH1A 1XVUA 1SA0B 3FPAA 2ZWMA 4RD6A 1D07A 4OP1A 2JHPA 3DMGA 1UC5B 5JH7B 5L3SA 3IOCA 4PYLA 4DCSA 1L5HA 3O8OA 4H3VA 3RVJA 4EMBA 1L5WA 5LSAA 1A50B 4F6RA 1QQ6A 4HNTA 1TM4E 4AECA 1ECPA 1FMCA 4DJFC 1TFRA 4P34A 1BE1A 3HUFA 4II7A 2IDJA 3D5EA 1RWXA 4ZQGA 1KVQA 4JASB 3CX8A 1QHHB 1SQ0A 3FCXA 2QJWA 3VYTB 5AI6A 1PK9A 1YRWA 2OLEA 2A5LA 2VYVD 3AX6A 3GNLA 3EF3A 1NG1A 2WG1A 4F3KA 1QFXA 2DFDA 2H65A 3KIPA 4TS3A 5D87A 4GT1A 4D7AA 3WGQA 2QM3A 3D8UA 3GDGA 1JHMA 1CDZA 4A8PA 2GWHA 4ZXFA 3Q7IA 5CBPA 2FLKA 2AFVA 2VWGA 3VC1A 4G0UA 5BYKA 4YDQA 1X77A 1PZGA 2V55B 4RTJA 2PGDA 2ZIZA 4FFMA 4V02A 3JZMA 2JHCA 4UOQA 5BMVA 2O7RA 3RTBA 4BEJA 5ADHA 5IT5A 1FMLA 3O1JC 2QLNA 5CLLA 5JSFA 1S89A 3EXHB 4Q9NA 4C5BA 3JS5A 4CTNA 1JYEA 5LXTB 5C34B 3B6JA 1AKRA 4PC7A 1RXYA 3BZWA 3HRHA 5LOVB 4GQIA 4TXHA 3RVPA 3TLYA 3HJGA 1S1MA 5CHEA 3DUWA 3FWPA 1JNYA 3H1TA 2LXNA 3SLGA 3VKUA 3AJDA 4JUAA 3EEBA 4PC6A 4H3HB 1QGOA 4WZAB 1YVRA 4CRWB 5E95A 3TF5A 3PD7A 3BULA 4U3JB 2CF6A 3P0JA 4RTLA 4P3XA 1T5IA 1GZ3A 4OXKA 1TUIA 1QIIA 2D5LA 3MB8A 5LB4A 4LOHA 4B6EA 2QJTA 5HKLA 1AIPA 2Y93A 1R6UA 1CNFA 5ER9A 3W5AA 2CFSA 3VJLA 2CUZA 3CEPB 1SQFA 1V45E 2EC5A 1P2DA 1Z73A 2Q62A 3BHMA 4EJSA 3RUHA 2J9YB 4E5SA 2V8OA 5IDXA 1JHVA 1SEPA 1DNPA 2IJGX 4WERA 1EG7A 1DWOA 3CUEF 5CCEA 4E2YA 2WJ3A 4MP6A 1LC0A 2FSFA 3EZ7A 2A14A 5KQMA 4OFBA 4RABA 5MF6A 2WVGA 3U4MA 4JFRA 1NGSA 1GU7A 1V6AA 2P9HA 4L6IA 3SZGA 3F8WA 3U80A 4DADA 4B35A 4DNXA 5IJ9B 2SCUB 4V38A 1H2BA 3T4EA 3JYLA 4F06A 1AMOA 1S8AA 1UEIA 3IL2A 5A7FA 5ILGA 2J9FA 2Q9BA 2R1VA 2CD9A 3NOQA 5BN5A 1FSZA 4AY4A 3R0VA 1CZOA 1XRQA 4B74A 4S0ZA 1LDNA 2Q0XA 3LRXA 3D81A 3EZLA 3K0CA 5ALTA 4B84A 1U98A 1T2VA 3UIEA 1HLDA 13PKA 1VG1A 3LT2A 1F1BA 1BNCA 4OQYA 3NYWA 5BXQC 4N7RA 3PVCA 3GV0A 1HYQA 2V6MA 1NF8A 4DR2B 3MRVA 3IAXA 1XZMA 2DWPA 4XA8A 1FPQA 2VT6A 1TYZA 4UU7A 1XZNA 2DUWA 4YRKA 4QGBA 3NC0C 2I8CA 4RPHA 2AC7A 2VRWA 3I52A 3JARA 3E05A 1ILEA 2P9GA 3D7RA 2WIJA 2CLDX 3NC4A 3M1IA 5TGZA 1XPOA 4M0CA 4KDCA 3GYGA 2VJBA 2YZKA 3ESZA 4BL5A 1MX9A 1ODIA 1XP5A 3ZWNA 4RADA 1C9KA 4Q3BA 5HZMA 5FRDA 721PA 2BM1A 3MOIA 2GK7A 2C5LA 2GEUA 1PFKA 4U9IS 4WMLA 1UUFA 4PE5B 1BMFA 1RVV1 4GXNA 4M7PA 4WUTA 1GQQA 3GDFA 1GTSA 3KEMA 1S2GA 2GBCA 2WIDA 4GD3Q 3BEOA 2BUBA 4LYGA 4P3PA 3WWPA 1ZHFA 2AEFA 1M2GA 4HGPA 1SNYA 1XRSB 4ZZ3A 1YS4A 1E3JA 1Y4ZA 3QX9A 2GLUA 4LDJA 4NE9A 3W1EA 3CKYA 4QWMA 5TQJA 2E9SA 3FPBA 1IK6A 4DBLC 3L02A 2H48A 3WTBA 3UUFA 4OH1A 2R00A 4U0JA 5EZYA 4PQEA 2NYVA 1O9GA 5AIBA 1A76A 4JQSA 1E7WA 3OZCA 3DEFA 1CS4C 2GDJA 4LJ5A 1B8UA 1H1DA 3TZLA 1Y9JA 1R0KA 2HIGA 5KX5B 2FN4A 4WEOA 1ES9A 1ESMA 2DFLA 3CPSA 4TLMB 4URFA 1XZQA 2CSUA 3IPYA 5AJZA 1AUXA 1JIKA 1YWGO 2MIIA 2P11A 3D6VA 3I72A 1G7CA 1ULZA 4RFSB 1KOGA 1U8EA 4FEYA 4ARCA 3UB2A 4MEJA 4TS1A 1JVNA 2OCDA 1ZR2A 1EXNA 2ZB2A 3EODA 2JIQA 2OAP1 4QVGA 2RHHA 3O4GA 1JN0A 2IZZA 3VH1A 4TKUA 2G71A 1NJSA 3KQNA 1X39A 3TSCA 3H11B 1O1YA 2XB4A 2ZRJA 1M5UA 1R4MA 2X41A 3N8KA 3PXCX 2AOWA 4FYXA 1DFIA 3E23A 2G09A 4NP6A 4TQ9A 2VPPA 4X94A 1H8HA 3TSZA 2FPKA 3CUWA 4U7JA 1W4LA 4MKRA 4D0NA 4BB0A 3UC5A 3VI4B 5I3CA 4CEJA 1SUAA 1P7ZA 3R0JA 3S3TA 5J2UB 3NHKA 3QNWA 1HRDA 2X3UA 4GX1A 2PKQP 4RZQA 3EK2A 3EZ2A 2R86A 5I8WA 1N4DA 3OOHA 1N5RA 3E2MA 3EG9B 1FW8A 3F3SA 5KEIA 3FPJA 3PITA 1M3SA 5JSQA 5KYNA 2OR3A 1YJBA 2VDPB 3EQ2A 2FDXA 1RM5A 1TU3A 1YDGA 2NLOA 5EXDA 2CDRA 2IUTA 3PNLA 4JITA 1M2JA 1NP6A 5B3AA 3HDHA 5ALPA 1TW2A 2R6ZA 4PSUA 1DINA 3OM1A 2ZT7A 4DNFA 1N5LA 3D3WB 3GBVA 5JV5A 4KGVA 1FZQA 4JJKA 5LMZA 3HL4A 4Q3CA 4IH1A 4ZVOA 3UJ9A 1ZFNA 4QUJA 3Q2IA 4YP9A 1L4NA 1DV2A 1AQUA 1SU4A 2PDAA 1MN6A 3QLUC 4CV1A 1EFUA 3ZBUA 4PGMA 3KK0A 4A2PA 2XWSA 4C4ZA 4LGYA 1AK9A 5L3QA 3NHRA 4F0JA 3CLRC 5CA1A 3QVLA 5AW0A 2Y4OA 3LUFA 1J0AA 1YFZA 4MW6A 3UK1A 3GLIA 2HHAA 2R47A 3RFFA 1TZMA 2RHCA 4CHGA 5A06A 1IHDA 5KJEA 3EDMA 6GPBA 1VFNA 1JG3A 3IMFA 1QRRA 2QAJA 1N6OA 2BUCA 1DJQA 1WP4A 1MRZA 2Y1OA 3PK0A 1LC3A 1CQPA 2DRIA 4I1IA 4IHJB 4KOAA 5BSWA 2ONCA 1T0HB 4B31A 1NJ1A 4R0NA 4AZ0B 4IKOA 4BLSA 1KYYA 2H59A 4DM7A 3GFSA 1WQ1R 3OZFA 4I36A 5EUMA 5IZ4A 4YASA 3DMYA 4CMHA 1OCEA 1N1DA 2SHKA 3N7TA 5JZSA 1RYNA 1FL9A 1XELA 2H5EA 2V6IA 3WWDA 1T5TA 5F1OA 5CXQA 1UJNA 2WQ6A 4HDMA 1PR5A 1Z8FA 4EX6A 1CT9A 3EOAI 4YROA 1LRLA 1O89A 1VSQA 4LXXA 1RPNA 2JLRA 4V3BA 3Q5GA 4BMZA 4V0KA 4Y9UA 1QXSA 3M49A 5ALLA 1JL3A 3SJAA 1P2FA 4M38A 3A58B 3AHDA 4E2XA 1PWYE 1UQRA 1G5QA 1UMDA 5BV7A 5ITZA 3D6HA 2OHGA 2XTMA 2H5LA 1GNSA 5JDIC 4WDRA 4BUJA 4Z7OB 4MP3A 2QAGA 4I4LA 4MRRA 1PGJA 4A82A 5M5BA 4NBRA 4IUCS 2WTAA 3K8YA 1U1FA 4J3JA 1CJVC 2PKCA 3B5IA 1X7GA 3ANXA 1JDNA 5LMNB 2HMAA 2E89A 4FD2A 2XVXA 3F2VA 2XJ4A 2P9ZA 5K6AC 3F3YA 2ARKA 4ZV4A 1HFEL 1HOTA 2H51A 3A9WA 2V54A 3QBVA 3QXGA 4Q4JA 4DY6A 4BLVA 1LI7A 1GUZA 5AVXA 1QPGA 1DXYA 3B12A 3PNVA 5A3VA 3E84A 3DLTA 3OBIA 4JKYA 4XZ3A 1NRJB 3ZCRA 2QL9A 4IX9A 3QKTA 1U8CB 2OGTA 2PD4A 3I2HA 5EGNA 4ZTUB 1S8NA 2QLMA 3R8FA 1LDEA 3ZD6A 4OUKX 3UK7A 3PEUA 2Q3MA 3ZNQA 4LDRA 3O9MA 5LR6A 1WMDA 3J81k 1SVKA 2HRRA 3DLBA 2ETXA 1R6DA 1E8NA 2D3WA 3SGLA 5IXSA 5TPZD 2CXUA 2C88A 3NKLA 3WWEA 5EGSA 1MAWA 2R5NA 3DULA 1D7AA 2HXSA 1H69A 3I2FA 3MLEA 1HTTA 5GVSA 1X13A 1YZTA 2A3RA 5EJ6A 4G67A 1H93A 3B38A 4MLDA 2BMDA 4LPKA 1B14A 4QFBA 4YQYA 4AXXA 4LA4A 2EYQA 2WKSA 2GN0A 4QT4A 1A9OA 2HIMA 2RC5A 3WKDA 4BKOA 4D97A 4KG7A 2GAFA 3KUKA 4LKRA 1HSOA 4PIMA 1DKRA 4RKRA 5ES4B 2SKDA 3FFXA 1R8JA 2ZIVB 2QPLA 3LT4A 4MI3A 3JYQA 3B1KA 3IFSA 1WDMA 4JENA 4LHEA 3U4CA 4E5YA 4RA6A 1AH2A 3OY2A 1ZQ1A 2SECE 3U0BA 1L7RA 2PWYA 1W8DA 2GEBA 2Q8NA 3PWZA 3QX7A 1KQPA 2ILTA 2GVDC 1WG8A 3GFBA 3TTSA 1WS6A 1NJGA 3SQMA 4X71A 2BONA 1HSZA 1GL3A 2XMGA 5E4FA 3S1AB 1TM3E 4EHBA 3NP9A 2P6PA 5JTUA 3NHZA 5JFGA 3NVAA 1MRSA 4FYJA 4EY3A 1QR6A 3OJLA 1DE0A 2AG5A 4OF4A 2ORVA 4BFWA 3KZ1E 3Q3VA 1R0BA 4DWWA 1JI3A 1Q1AA 3W1VA 3AHEA 4L3OA 3BE5A 2V4MA 5ALRA 2EVWX 2ZSKA 1ZGHA 3F1LA 4K88A 4PIPA 3HKEA 3LHIA 4RKWA 4DIMA 1X3SA 1V3UA 3VSBA 4KR2A 2DUNA 2B1JA 2FPIA 4RK7A 2GBFA 4DLZA 3C1OA 3LLSA 3FVTA 4JAVC 1T91A 1IXZA 2QR3A 3R4VA 4GEKA 2GR9A 4XPIA 3NJRA 4ZAGA 4ZYXA 5K3FB 3R9XB 1KFJB 2XCRB 4DR7B 5LBTA 3ZJVA 5KQLA 1WZEA 2LV8A 1E1NA 1CRLA 1JV2B 1JJBA 1SHJA 3OMWA 1S2NA 4H6PA 4NH4A 3GLFB 3BICA 3Q11A 1D6NA 5JNVA 1GXSA 4JS0A 3TOZA 5CP8A 3SDBA 3ROPA 2YZMA 1ZXLA 1F2DA 1V3VA 3EJ6A 3PIRA 5IZCC 4TL9A 4UNRA 1NP7A 3BKXA 1HQCA 1R0LA 1X6VA 4O2BB 4RZIA 4UE3S 1GAXA 1NW7A 2QTWB 3EQ6A 4X7MA 4ERNA 5LP6F 3LUDA 3WJ1A 4BAGA 3GH3A 4G6ZA 1D6JA 2QE7A 5CDFA 4BV2A 1CK4A 2F9LA 4JD5A 5C7LO 1PV4A 4IIJF 3DXFA 3RTAA 5F9FA 5IT4A 2TMGA 5FTLA 3O47A 4AWXA 1BFDA 1UAAA 3IMGA 2ZSIA 4NESA 4G3XA 3EASA 1Q0PA 4GLLA 2FEXA 3SKVA 3BCHA 3WB9A 5K8UA 1JH9A 3J7AC 1H94A 4NEQA 1YUBA 2QD5A 3CZ9A 3ICQB 1YA4A 3GRAA 4ZV7A 5JZ9A 4BVLA 1WWKA 4P7KA 1U0FA 5HJ2A 1EDDA 3MXOA 5DNCA 3DMPA 3B1ZA 2I99A 3EGDB 5CFPA 2Q0HA 2ZEJA 1HGXA 2FW7A 1IZYA 2VG8A 5FI3A 4WQMA 5KHOC 2FPWA 1YMQA 5L4LA 4LF7B 2QMZA 4XDHA 4HB4A 2YBEA 2I4TA 2XB9A 4HNVA 2OCBA 4TVBA 2P2GA 5AW7A 1KEZA 1QG0A 3CJTA 3HS3A 2YZ7A 4OU5A 2KB0A 3RT9A 3U5TA 3WK9A 1I51A 1KYWA 3VOTA 3BPSA 2BM8A 3WDSA 2DCMA 2RAVA 4KXNA 1SUIA 2PFSA 4YCAA 5DX0A 1AY0A 4Y18A 1PDWA 3L0OA 1EHCA 4YX9A 3GAFA 3IKLA 4YPVA 1C7QA 1PEAA 1MCZA 3EW9A 2OM2A 2C59A 2ZYIA 3NBXX 3O73A 1LV8A 4KYIB 1Y3HA 1E2LA 3GPDG 4A6DA 1EZ4A 5CVEA 2OE2A 3H6GA 4CG1A 4AG5A 3ZC3A 4ITUA 1Y33E 4H3KB 2FY8A 3G23A 4RS3A 5LUAA 4LF8B 4ZZ0A 3Q87B 4JN6B 1Z88A 3GZNA 4WRRA 2FSGA 3RODA 3STXA 1AZTA 1X2EA 3IP7A 2ZDGA 1HA3A 4G4IA 2ZI7A 5DM2A 4DC1A 2CC2A 1ZGGA 4HOYA 4KIFA 2I6TA 2PX2A 3T7TA 4F21A 5JUWA 4AKIA 3EULA 2JFHA 4PTLA 4DN6A 2XTJA 4RL4A 2REQA 3O1LA 1TVCA 1UCFA 3F4LA 4OBXA 4QDJA 4TV9F 4RQTA 3N76A 2IXDA 1ZW6A 4U2KA 4KUHA 3BMQB 4EGJA 4ZIRA 1GIAA 3K3PA 4CN8A 5K0ZA 5B7QA 2HMUA 2I22A 5CB8A 1FS4A 2C4WA 4E11A 5I9SA 5KQSA 2HGZA 4G09A 1U3WA 2JAHA 4XGNA 4ZJYA 2VXBA 3AKDA 4NOJA 4LVCA 2WUGA 3EF1A 3AR4A 3QYPA 3IEMA 2HUNA 3GGJA 2JZNA 2BEJA 1AO3A 1JLLA 2VNJA 4ARSA 1VCIA 4PN3A 2PZAA 2QPTA 1KSFX 4Q01A 2NM0A 3LXMA 4D3XA 4OUDB 3LQ2A 2JAWA 1EIWA 1NNI1 4IEEA 5LM3A 2GERA 2PRZA 1I3MA 4OHCA 4JWKA 1XFAA 1ODCA 3C7DB 3HY4A 3PNYA 4KSBA 4O33A 5IVKA 2GTPA 4YPFA 3FAZA 2PANA 4ZK2A 1BCRB 1M6WA 4FMCF 1C9YA 2QVBA 3DDCA 2W2KA 2VF2A 2WZCA 4XTCS 1I4DD 4AKTA 1ZD5A 4GDFA 1QZTA 4FW9A 2O3TA 3JYOA 3I76A 5JYEA 5DLPA 1CX9B 2ET6A 3TRHA 2XCTB 1ZBDA 3CSDA 3HZZA 3K9HA 1U0RA 3FJYA 4W5HA 1XEWX 1EEHA 3KZXA 2P0YA 4MYSA 3B36A 3D4PA 3OCZA 1IN8A 1KWKA 4R9UC 1E59A 4XWGA 1ZOLA 5I45A 5A5GA 5DEOA 3K1JA 4G24A 4JBWA 1PFVA 1S3GA 3JQ7B 4DV2B 1EXVA 3H5IA 1O6ZA 2K87A 4IF6A 4UOEA 5HUJA 3H1BA 2FPPB 1PUIA 2GBLC 1PSZA 4MARA 4JR1A 4KFTA 1IOWA 1VE5A 2PBRA 4RVCA 1M2WA 2CVFA 1ZBQA 4JBGA 1W94A 1ZCAA 2ZJFA 5FBRB 3N75A 2I2FA 3Q6NA 4WVFA 2F59A 3LGSA 3RS8A 3HYNA 2NTYC 3K73O 4ZI2A 4JVSB 1F1JA 3IUBA 4FJ1A 1SVMA 3HLTA 4KNVA 4O4IA 2CDCA 3TL2A 5AKIA 3MOSA 1ZRMA 2ZAGA 1S4MA 3OECA 4CM4A 2WIGA 3D54D 4B7CA 4FZ3A 1AQIA 4GMHA 1CKEA 1U7OA 3QP9A 1SG0A 4W9NA 1O54A 1S4QA 2ZROA 1ZLXA 3IHKA 4F4JA 1SG9A 3BE8A 4WA7A 5G1OA 2AK2A 4I0WB 3GA5A 3ONWA 1CQIB 3SLRA 3TCXB 5JFOA 1HEIA 2WBLC 1U9IC 2IZ0A 2ZSBA 4PG6A 1TNDA 4G1BA 1PZHA 4M22A 2J9RA 2YYSA 4BNVA 1DG3A 2BEKA 3F96A 3N2KA 1U3CA 1STOA 4L1KA 2I33A 4JLBA 4Z54A 4PC3A 3VZBA 2C31A 5HTKA 5AHWA 3U4GA 1GR1A 1KGDA 4CEIB 3ASUA 3OU2A 4OQZA 4CDGA 1ZIPA 1XKQA 5B37A 1CQZA 1ODSA 2J9XB 2Z6VA 1WCV1 2B7LA 3AEXA 3Q7PA 4DQVA 4F97A 1QQTA 3DZCA 1Y4UA 3QLVC 5B2EA 3B6ZA 3D6NB 1WHSB 3P2JA 5E7QA 1ZSVA 3WX0A 1YF3A 3QOWA 2W43A 2KJQA 1TK2A 2O7SA 1PJSA 1QVAA 4EUKA 2VWPA 3F7TA 1XXHB 2R1TB 3LVBA 3M6IA 4AICA 1P0QA 2DBYA 4ZQBA 4RORA 3OQPA 3FTEA 1E8MA 4YP5A 1N78A 3WRYA 5IUNC 4LRWA 4JI4B 3C3BA 4AYWA 1W7AA 1RE1A 2K6GA 4YCBA 1H4QA 1OLXA 4K6FA 1RI4A 5EI5A 4CKZA 2CUNA 1NLYA 1Y3AA 2YJ4A 4JU9A 1WPGA 1E64A 2VZLA 2XIJA 4C3OB 1F12A 2V6FA 2WJAA 1L6RA 4GEGA 4UPDA 5FR1A 4YV1A 3ENNA 1TZ2A 5DNUA 4LV8B 4G9BA 2FVXA 5EY5B 4HH0A 2QAGC 4N6OA 2JHAA 1OFGA 2ZJ4A 4Q1FA 1YUMA 2Q7OE 1VKZA 5CW2A 2UZIR 1FUKA 3H4IA 4COOA 2FB9A 1A4UA 3GGDA 3MC1A 3VVCA 1QYWA 4NYJR 3RVNA 3QJ5A 1L7BA 1UK9A 5HA5A 5T4EA 1XCGB 3JTEA 1VI5A 2O2HA 5JHGB 2IPLA 4LVUA 5ARBA 5K99A 4AN4A 4X6LA 4HPWA 3FZGA 3A10A 2VAMA 4EQ6A 4BIMA 2WOOA 4J0EA 4EG6A 3BFPA 5IKPA 1M34E 3AI2A 3NWEA 3FKJA 3PV0A 3QEMB 1BQ3A 1I2DA 3ZI4A 5EJ7A 5KMGA 2VJLA 3H2YA 5IH3A 1OWPA 1ZH8A 4KX5A 4ZT6A 4OYLA 2RARA 5TQ2A 2HJWA 1Q7BA 4FE3A 3VU8A 3TMAA 3AV3A 3AZPA 1XRMA 3RK4A 2E0IA 1IWBB 1GFZA 2J3QA 2O8CA 4ZGBA 4KGDA 1W6RA 3KFLA 2QQFA 4AJ1A 1X92A 5HX7A 2J7KA 2YDXA 3VKHA 1F2VA 3PFGA 2UAGA 1G5TA 4BN0A 4J43A 2QP4A 4Q7JB 3ZXUB 1Y1PA 4TKLA 4EG4A 1N2ZA 2FVYA 3JZIA 3T7IA 1IY2A 4YJDA 4YMSA 1I3CA 2XRMA 5JJIA 1VLLA 4NV0A 1ISHA 1SR8A 5DCUA 4MB0A 3OEEA 4OLHA 1E79A 2YFQA 2BDTA 3T3IA 3IAEA 4G97A 1X8KA 3W9YA 1CY2A 3EA4A 1VL8A 1KR5A 4E6EA 3I39X 1TMYA 2LPMA 1J5XA 1XMSA 1GLNA 1TVKA 1KI7A 1OROA 5ALGA 3MCZA 2I6FA 1Y1QA 4R7ZA 4D81A 2XR1A 1SELA 1KVRA 3F6RA 4F86A 4FM9A 3REGA 2EXXA 2FX2A 4X20B 3IPCA 3DE3X 1BEEA 1AHHA 4FDAA 4LDNA 4L78A 4JBHA 2FZ4A 2G0NA 4PLYA 2VHWA 5CLHA 3LP8A 3NHAA 1PFGA 5EP2A 1P0IA 1VMIA 1TMOA 3IBYA 1RQRA 5BV1A 1CUDA 1N2XA 4R2KA 2JIRA 2BHSA 2J5XA 4IXWA 1UZAA 2HPAA 4JJ7A 5CT9A 2ZSEA 3OU7A 5CIQA 4DLBA 3CE6A 1EDBA 4OKIA 2DH6A 1WPRA 1IDOA 1D9ZA 3KZNA 3EVFA 1HE1C 3FZEA 5ALJA 3UTCA 4O8ZA 2WWIA 1DT5A 3KTFA 1QGAA 4MLCA 4I3HA 4B71A 1ZHOA 1U1EA 5E4TA 2LR0A 4KXWA 2ETVA 1ZVQA 2Y27A 3O2SB 4O2AF 1RXWA 2O8DB 5A4JA 2GASA 3MQ2A 3QEKA 4B2LA 1OPXA 1G5RA 1SJ9A 3BXXA 4TYNA 4G5OA 4IYRA 2G4CA 1DJNA 3AO0B 3LHDA 3MT0A 3RFUA 2FUEA 3TRJA 3AUYA 2IU4A 2H3EA 1NYRA 2J4CA 1I0IA 4RE5A 2IOHA 4GFDA 4UFPA 1OI4A 1C0LA 4E21A 1EHYA 3EC7A 3WQRA 1PDVA 3LXXA 2COKA 2NNWB 1RHJA 1HE8B 1HKUA 2XX3A 3C16C 2OMEA 3NM4A 1P9WA 2EJBA 3CH5A 5EZQA 5JATA 3LQQA 2YZNA 1Z4OA 1OFHA 1Z6QA 4ZT3A 2QG9A 4J03A 2XQGA 4JU8A 1NAIA 3KZKA 1R4NB 2ZB4A 1SC1A 3A3PA 3EBPA 4HQRA 5BOVA 3F46A 4L0QA 1SULA 3DEJA 4GR9A 4LK3A 4AMVA 3TBKA 1VYVA 2YWFA 2BZ0A 2AMJA 2O06A 3B8HA 4LHZA 4TVKA 3T1OA 1FK8A 2X4DA 4HBGA 4RK5A 1XHEA 5SYNA 3RI3A 4BWVA 1NVEA 3LVRE 1ZRNA 3KOOA 3IXMA 4QBIA 3DZIA 2H7VA 1YHZA 1DJOA 3L93A 1LLUA 4BXOA 1I2BA 3K2BA 4NJOA 2YJZA 5IASA 1F2UB 2ECFA 2C0PA 4MR8B 3BMCB 1FUUA 3BZUA 1F17A 2W2QA 3A2NA 1N5JA 1IY1A 1K08A 4KEAA 5AJXA 1G4UR 5JAUA 1VCNA 2QENA 4MO9A 4N76A 4OFZA 4QOGA 2P40A 1H8HD 4OIMA 5CDFE 3JALA 1XU4A 3TZQA 4C3ZA 1QYCA 2B7BA 1DOHA 2INGX 1MJ5A 1KH1A 4NCJA 4ZZ1A 2Z2JA 1UM8A 4X0EA 4JHXA 3Q9UA 2BH2A 2VP2A 3WOVA 4YV7A 4C4OA 3T9AA 5SZJA 4O3MA 3QIAA 3KKKA 1SQ6A 2WWXA 3N2GB 2Q5OA 3V4RA 1PG2A 2C54A 1UAYA 1RPAA 2MSLA 3T15A 3IKTA 2CXTA 1XZ8A 2H0QA 2BE7A 4ND3A 2F9FA 1X1SA 2KE5A 1ZC3A 3QTTA 4CM5A 4D8UA 5CT5A 1PAUA 2C8KA 4XFDA 1JKFA 2Y0BA 2HA7A 1MXFA 3IUEA 4MS1A 4OHVA 2JLCA 4RZSA 1SZJG 1WSAA 4CGYA 3U3JA 3M1AA 3OFNA 4IXMA 3O4IA 2B98A 1N34B 4JYAB 2HDHA 1P3DA 4HQKA 2OVFA 4LZPA 1K0UA 3C8ZA 3EHEA 4RZHA 2NPFA 3T9EA 1KMHB 1NBOA 3GQBB 1M6EX 1WZIA 1BX3A 2O48X 2QU7A 3DAGA 3HRKA 3LFHA 1KZ9A 4KH0A 3HNRA 4TL6A 1A8UA 4YA6A 2V7BA 4R98A 3UJ6A 8ATCA 3MXTA 3HWWA 5JANA 4FWIB 1M2OB 1AZWA 2WAOA 4YRFA 4FZVA 3GCDA 1D04A 2WMYA 4GSYA 4LVNA 4P7BA 3VR5H 4Z7QB 4ZOQI 3TMYA 2H8GA 3AG6A 3U4QB 2DQKA 1JPUA 1QP4A 2QVLA 2BFPA 1UKZA 3PHBE 4OJQA 4GLFA 1C1HA 1S3FA 3BJIC 1JYSA 3IT2A 4PSVA 5JAZA 3H4VA 3HVUA 4POAA 3NBFA 4I19A 4BUCA 4P7JA 2FV8A 2QTTA 5JZBA 4MYHA 4ID3A 1A98A 1A04A 3O0DA 3V4OA 4FWTA 2P6RA 1C30A 1P44A 2CHEA 4JL5A 4H7PA 4V0SA 2PUFA 4UBJA 1RPZA 3KD2A 2MSNA 4HQOA 2NXEA 3S8EA 2HF2A 3KQWA 4L15A 5H5JA 1MC5A 5B36A 4M36A 4WACA 2I1WA 4U9UA 1W8IA 4OK5A 3ZKWA 2BFBA 2Q5EA 5FWNA 3UMCA 2JFGA 1YJ8A 4R1SA 1YB1A 4YCCA 2IBSA 4YRNA 3I0NA 5EG5A 1AU9A 3MBOA 4ILEA 2IEAA 3UMMA 4L3WA 2HBYA 3CUYA 3EQ8A 3NOOA 3AVUA 3HKDB 3WB1A 3A11A 2DFVA 1KRWA 4J16A 5BXYA 3SG0A 4GW3A 2CMHA 4AI6A 1JQAA 1W1UA 2YBDA 1FFAA 4PGAA 2QI9C 3ZD7A 1UH5A 2D7DA 1PYOA 2I6SA 1A8SA 3OTQA 3NIDB 4BU1A 5EWJA 4YNBA 4LJKA 4WY8A 1JW9B 2BFEA 2DBVO 1H3FA 3ND6A 5HS6A 2BR4A 5AT1A 4N82A 3TJRA 4MGYR 4PGHA 3TH5A 2HSZA 1WXQA 4BNHA 5A2QA 3S4YA 3TAUA 3PA8A 4FGZA 3H19A 4GIBA 2XLCA 2E1RA 3ESBA 3T3PB 4C0JA 1K68A 2R7NA 2A3NA 1ZEJA 4XUDA 2EL9A 1JSZA 4RHEA 5DWDA 3M3DA 1J1UA 2IYEA 5IC5A 5I7EA 2PQMA 3H2JA 2W83A 3LUJA 5AI0A 2OPBA 4BJ1A 5FX2A 1DBRA 2EAUA 3B9BA 4XI9A 1FRNA 4XR4A 3UYLA 4ZGWA 1H0RA 2B9VA 3PF8A 1EJ6A 2CY0A 3ND5A 4KN8A 2JD2A 2QDKA 4WNAA 2C04A 3OZXA 2D0DA 1BS1A 5JWRA 3L9WA 3WLQA 4W9NC 3PNSA 2IGTA 4NL4H 4NG4A 1QIDA 3OTWA 1YHYA 3SOZA 4P22A 1EFTA 2QG4A 1XQ6A 1Z45A 4M0MA 3ON5A 5HFAA 2AEEA 1C1YA 1JIJA 1BROA 3VX4A 1MG5A 3HCCA 3T9BA 3VU1A 2GXSA 4MDFA 5FUVA 3BK7A 3TLGB 3ELWA 3EQ7A 1IHXA 3ILXA 1QH1B 2GYWA 2M9MA 1PNRA 1ISMA 4TZ0A 2D54A 4JGGA 4YECA 1YR8A 2WYHA 4Z8YA 1QGDA 4R6XA 2B5OA 2HN9A 1C9MA 4MI9A 2J30A 1CUIA 3AG5A 2UXCB 3GLGB 1XLTA 3BWMA 3S8MA 2PL1A 4EMUA 1IUNA 3MN1A 2BN4A 4CU5A 1G5HA 3EGEA 4NOMA 3SC3A 3BRQA 2IUYA 2CNLA 1JQDA 3ETEA 4JJAA 1TA9A 2ZI9A 3HJBA 4M0FA 2B21A 4Z4FA 5GGYA 2IP2A 2IYXA 4GE3A 2DTEA 1U3UA 1NUQA 2QAIA 2F1JA 1UBOS 4WGGA 2F4NA 4RJ2A 3GRVA 4X45A 5ICMA 4TZKA 4Q1AA 4W7SA 5T7BA 2X7JA 1FS6A 4GVLA 1INLA 3ESQA 1VLMA 5AKEA 5SZIA 4YCDA 3W7AA 5AESA 2QZ9A 2ZRQA 4CLOB 3KOXA 1OB5A 1XPUA 3U7QA 1R7RA 1NSYA 4AWAA 5J40A 4XEUA 3W2EA 5JU6A 4XM1A 2V5UA 4JWTA 2EFEB 3PQ8A 4FT2A 1YBFA 5AMXA 2P9QA 3I23A 1RMTA 3H6KA 4Q6BA 1TCCA 2ECQA 5IAKA 2M1XA 3V33A 1D6MA 5K3CA 3DYIA 5CA0F 4TTTS 4JP2A 3UGTA 1MHTA 4L5IA 3M3HA 2UYYA 1W19A 1K7CA 4Q4HA 2Q49A 1JHAA 4M46A 3UWPA 3DMNA 1Y48E 4EGQA 9ATCA 5B4TA 5JEDA 1IJFA 4LMRA 3CT6A 4R69A 4CF4A 3C7TA 1ZVVA 4QEDA 1MABB 2V3WA 2IBMA 3BZBA 3DP9A 3TGWA 1XCLA 4RWZA 3VSDA 1G6OA 2VATA 4Y6SA 3SHWA 4EUNA 2XNHA 2YTZA 3R5KA 4WDQA 5CDTA 2WF7A 4RIEA 3IDQA 1VRVA 4ND7A 2FZKA 3CH4B 3MJEA 1FUYB 5LFAA 3K7EA 4BAZA 4F04A 5KTMA 1EB9A 1X1RA 2QRJA 3T9CA 2PY6A 2OC9A 4DG9A 5K20A 1C14A 2HL6A 3V42A 2ZAYA 2BFNA 3B70A 1LRJA 4E3WA 3X1KA 3Q3CA 1QKKA 2X8JA 2Q45A 2QXUA 3SQDA 1IJBA 2XWQA 5FQOA 1F0YA 4ISCA 3NBUA 3I01M 4EF4A 6PFKA 5D3ZA 1HL7A 4TKVA 3GUZA 5CYOA 5G41A 4N12A 4S1OA 2YWEA 4L4RA 2UUAB 2GXUA 2VXCA 1DEHA 4HHEA 2ZBVA 4KWEA 2W11A 4LHYA 2E85A 4RZXA 4JYCA 5EN4A 1T3HA 5F76A 1DRVA 1Q77A 3L5OA 2WA1A 1YONA 4ZVVA 1TT5A 1Y3BE 1K6XA 1YB2A 1W35A 4FFBA 3UV3A 3QVMA 2KPOA 1XOIA 4Z3DA 3DZHA 1YE5A 4HDKB 3UQZA 4L85A 2I2BA 1NI3A 1PSDA 4A9AA 2HV8A 4BO3A 1XMVA 4MQFA 4DR6B 4E32A 3AERB 2BIFA 3PUWA 5DTMA 2BDEA 1FP4A 1K27A 3P0RA 4KE7A 2FWJA 2HMVA 4I55A 3J80A 2ODTX 5KNDA 2QYHA 3AUXA 3N86A 5H3CA 1L1RA 4R2MA 5EEGA 3E9RA 1JIXA 3OFKA 1JFFB 2V6JA 3JD0A 3Q3EA 3WDMA 1VXOA 1DB3A 4B1FA 4BQOA 1VA5A 1RWQA 3I0MA 4NE2A 5E9AA 1H9BA 4S1PA 4ND8B 2YXEA 2GILA 3G8YA 1VKRA 1JHYA 2RBGA 2HLHA 2NU9B 1N7IA 1H85A 1YZVA 3AIIA 5JSUA 5HYVA 3CVWA 1FP7A 4NARA 4GDMA 2VS1A 2XDYA 1J7KA 1O7JA 1WR8A 3KZCA 1P5HA 4I14A 4JA2A 3AKCA 3P2OA 1POWA 4UXHA 3H1AA 2ZK7A 1GT6A 3D0QA 2O2XA 1NPDA 1C3XA 1F48A 1KSHA 3KVVA 2G88A 1GGHA 4ACBA 1RMQA 4MINA 2OD9A 2X7HA 4KQXA 3VNAA 4EY4A 1DDOA 4YVFA 2XCSB 3RUIA 2QMEA 1PJQA 2R8ZA 4FYWA 4UNSA 3TB6A 2YJNA 3NTLA 3H16A 3EDOA 1O94A 1O97C 1YIAA 2ZRHA 121PA 1EVLA 4O0MA 2NAFA 3H4MA 4P5DA 1N2CA 4MKXA 4TLAA 4DDWA 1J4AA 5DFAA 4LNAA 3GP5A 3FH0A 1VCOA 2BC9A 4ODIA 3TJMA 1KJQA 2UZ3A 1BWSA 4LCJA 3DF9A 4QJBA 3H2BA 3ROGA 3WYDA 1TAQA 1ZK2A 2DHDA 3HSSA 2P4UA 2P68A 3PZRA 3GLRA 3RSHA 5BORA 1U31A 3JQFC 3V55A 3F8TA 2QEQA 2Y6UA 3T0FA 3AEUB 2HT6A 4P4UA 2ECPA 3RYHA 2G9VA 5BVHA 2O05A 1O4WA 1DKQA 4R2HA 1L5FA 4TTVA 4GPZA 2WJPA 2X8AA 2Z5LA 2VSOA 3VC2A 2B0CA 2NUAA 1HRKA 3AUKA 4KQHA 4M9RA 3TLZA 3ROEA 4ECEA 2JLAA 1YCHA 3OM9A 3GFFA 1GSHA 2GJAA 3QXSA 4C22A 3CUUA 2R6GA 3A3YA 2I65A 4M9XA 1J1IA 1YOVA 2IP1A 4DZZA 2PVCA 2YV5A 3V8BA 3GELA 3KUDA 2XECA 4FUQA 3L7OA 1Z35A 2PGIA 2WDPA 3G7NA 3HCOA 5AOVA 1KE2A 4MHTA 3IB3A 4RLHA 1YASA 1XDSA 1B00A 3EFBA 3K8QA 3M4JA 2OA0A 4CMBA 5A1JA 2FZ5A 2QZSA 3WKCA 3D7NA 3KSBC 6REQA 2R4UA 2YV3A 3HC7A 3UT5A 4W1QA 1M1NB 4QG7A 5DN6A 1GRQA 2ORED 1FFYA 1QOZA 1TM2A 3ZXYA 5F3WB 4CIBA 2RG7A 1N9GB 2DM6A 4RPGA 1NUHA 1FA9A 2H1LA 3G8CA 4XWYA 4XWAA 5AM5A 4KPFC 3ZJ5A 2DFKB 1JJ7A 1PZMA 5H81A 1E9FA 3F4KA 4GZLA 1ZRSA 3AF5A 4HZGA 2VSQA 4KI0A 1SUSA 3R75A 2VZ0A 3M6LA 1MNAA 4GICA 5AVTA 1BDIA 5GJBA 2WICA 1WXXA 2L82A 4Q1EA 3SHOA 4ESVA 2HWXA 4MJXA 1OBCA 3KEQA 2V7UA 1ZNQO 3V9AA 3WLHA 1VTKA 4BY9E 1G55A 3FNFA 1QE0A 1J06A 1ADCA 1JEQB 4XAQA 1CQXA 1MOSA 4JYBA 2GJSA 4H27A 3KJFA 3GLIE 2NV6A 4TMXA 2WLSA 3D1JA 4PZYA 1JVBA 2VTBA 3BRWA 3P5SA 3EH1A 3LPCA 3NNNA 4KRYA 1TZBA 2O19A 3MS7A 3K2EA 3OT1B 4M60A 1RLOA 3NTVA 3NOXA 1IZ8A 4MZXA 3H9JA 4CEHA 3S2YA 4DDVA 1HLPA 2C82A 4A03A 3DBHB 4JHLA 3OM0A 4E5UA 2EF1A 3NHFA 3Q85A 2IYFA 3LWDA 3ZZTA 4IDCA 1W1IA 2GM3A 5B2ZA 1WP9A 5IEJA 2CHVA 2FI1A 3QBJA 5HRAA 3ELDA 5JQGF 4G5QA 4WZBB 5K8LA 4DSAA 4B79A 5EMLA 521PA 3VZRA 1QYXA 1A8HA 2OXIA 2EG5A 2OT3B 3M4NA 4WT7A 5HW0A 1ESZA 1NNUA 5C8YF 3KZMA 4RVSA 1ZCZA 1XQYA 2JVJA 3N87A 4EA7A 1OGIA 2BBTA 1MH1A 1W52X 1Y3DE 2G9RA 3CH6A 2NU6B 3LU1A 1K3TA 4DYVA 5SYAA 3U7JA 3DE0X 2R96A 3DKRA 3NRBA 4I2VA 4Y2QA 4B34A 4DJTA 4F60A 1SFRA 5IC6A 2I78A 3WGUA 3D02A 3MWJA 1OWNA 4HX2A 1Y5LA 2RHWA 4Y2XA 3NB0A 2FPSA 4WBSA 1ICEA 1R5JA 2EKPA 2B94A 2F9MA 4KE8A 4B7UA 3ZTTA 1IK4A 3AF1A 4UAVA 5C3MA 1VPEA 4CKCA 3D5TA 2WFZA 3W5UA 1OBOA 2PV0A 1AXGA 1GPYA 2D7JA 4MTCA 2F48A 4PS0A 5AVWA 3QF4A 1V8FA 2BHTA 3LFUA 4TVSA 5IANA 4W9MC 4I46A 4WFQA 3TINA 1R64A 1VMAA 4D4MA 3O82A 5K6RA 4N6NA 4JOBA 1CBUA 3FF1A 3GOHA 4A1OA 1PT5A 2DGDA 3TFOA 3OEYA 2HT1A 5EWLB 1MVLA 4OHMA 2P6OA 1R8SA 2OOKA 1IQ0A 1MB4A 1PV1A 2H2DA 1XKTA 2ALJA 2XYGA 2Z1MA 1K9SA 3G02A 4X8HA 2OV6A 3MRSA 1Z5NA 4NY1A 1E1CA 5ALOA 3IXQA 2IEDA 4TXLA 3CRMA 3EA0A 4ER7A 3ZE7A 3B89A 2YZGA 4B82A 1DQPA 2L42A 2C8VA 3UAXA 4QA9A 2J5RA 1QVWA 4BE4A 2YASA 5ADVA 3PJFA 1IBLB 4BS9A 4QUAA 4FX5A 1ZN7A 2JJ1A 3K8OE 1KE1A 1SO8A 1GNVA 2FWRA 5M29A 1QYIA 2XMDA 1KR2A 2YVUA 3E0QA 4MRAA 5EA2A 1SXIA 3OEED 4G5SA 4EMSA 4R83A 4MUHA 3BA6A 5JNLA 3OUUA 4XGRA 3S2UA 3QKSA 2AQKA 3E8XA 2GCGA 2QMUA 3HV0A 4F2PA 2XDQA 1OD6A 1QDEA 4WCVA 2GCOB 2J3IA 3LOUA 3P2IA 3LUBA 1LCIA 2WDZA 4NAHA 3O4VA 1MA3A 4CQMB 2WWYA 4J6EA 3CFYA 4UM9D 1BCSB 1L5QA 1GTMA 3WGLA 1JHQA 5JT1A 2C00A 2O2CA 1MOQA 2B5WA 3SHQA 1A2OA 4ND6A 2JGFA 3UW3A 1E98A 2FRVA 1NBEA 4TMZA 4PSDA 1D3AA 1KZYC 2Q5HA 3SM3A 3AESA 3UGKA 4KKVA 4AY2A 2RGDA 1ZKDA 2ZBUA 1W0JA 1DRWA 4JXKA 2F4VB 5CM2Z 3GJ7A 1TZCA 3AP3A 2HJHA 3H3JA 4O4JF 3FLMA 3QVOA 4PZAA 3SIWA 2CV1A 4M87A 2BKXA 4ZCIA 1QZZA 4JR2A 5E1BA 4YAFA 4QOSA 3DMHA 3HBNA 2R8BA 2C42A 3B1VA 1YDWA 5K5EA 3CVVA 1NNSA 5FV7A 2ZBGA 1NOIA 2OQ2A 3GFOA 5JNSA 1OIWA 1RAHA 1UK6A 1HWYA 1ZGJA 2B1QA 1WV0A 2YWXA 4NNPA 4HJRA 3RS2A 3OC0A 4BV8A 5I4CA 3L84A 1XK7A 3PNKA 5KS2A 4XWKA 4ABTA 3Q8WA 1Q74A 4AKSA 1P1FA 4P33A 3V2IA 2O8FA 3SQLA 1H6DA 2RH5A 3HVRA 2IELA 2R6FA 1H0HA 3BWCA 2XB2A 5BPFA 1BOFA 2IODA 3L5KA 1ABFA 1ZONA 2WVJA 1UIRA 1JFSA 5FXMA 2FK7A 3VC3A 4YJGB 2NNLD 3O94A 5BSVA 1MDFA 2JBHA 3FRHA 2VHYA 1TTPB 4OYYA 4LW8A 4B32A 5F4BA 5J9FA 3WMFA 1TTQB 3FDFA 1O5OA 1LLFA 4U2EA 5LIPA 3ZOKA 1XBTA 2ZB8A 1L6IA 4P84A 2DCUA 2O0HA 4QOIA 4DYDA 3MG9A 1IBRA 4NFSA 2HHCA 1I14A 1P1KA 4LRXA 5FBQB 4DQXA 3B3JA 1KFKB 1WTAA 3HV2A 1SIOA 5LBIA 5EJ8A 4BWYA 1KOJA 1RJWA 1JDZA 4ETWA 5BMVF 2R79A 3L1KA 3DZJA 1D4OA 2Y1WA 2BW0A 5ES3A 4KITB 5F5NA 1YVUA 3AOEA 4MVJA 3EOBI 2O2EA 1I7LA 5B1HA 2YWJA 4PZPA 1IZ9A 2Q27A 4NONA 1R3UA 3D1VA 3QEJA 4RELA 3ND9A 2D2XA 3IAS1 1ISGA 3SD7A 2ZG6A 3WL3A 1HDOA 3B1JA 4S2UA 4AUMA 1B43A 1HT1E 3MUFA 3FNRA 1YI8A 4WN3A 1OC4A 3SR3A 1FVHA 1MJGA 4LY0A 1BS2A 1Z0FA 3ZBPA 3HJAA 4QODA 1Q50A 1CR1A 1Y9EA 3DBLB 3R20A 4GAEA 1I24A 4LK2A 3CLHA 4G0NA 4OD0A 4EHFA 3DC2A 1VJ5A 2YUIA 2BR3A 1FP6A 3OCWA 1DEOA 5JYBA 4YIKA 4JX9A 1JEOA 4Q9LA 4AP6A 3RB8A 2X8WA 3PNBA 4HEA6 4PQFA 4F8YA 3H2SA 1GAQA 2IV2X 5E2BA 5F78A 1U3TA 3TE7A 4AZTA 4BASA 2FF5A 3LZDA 1E9EA 5C7IO 1I9GA 2Q3JA 2VVTA 2FUG6 3T8YA 1JDSA 4E94A 3U09A 2BCGY 3HJNA 4F5YA 4Y1RA 5A04A 2NSYA 1NVVR 2ZT8A 4FBMA 4MGIR 3SF0A 1P5FA 4EPTA 3HTXA 3HXLA 1JVSA 2PEZA 3UCXA 5GJCA 1NF2A 4FFWA 5KTTA 5AHOA 2BMEA 3V7UA 3VPHA 2AL7A 3BQNB 1PUXA 4MV1A 1LW7A 1SQSA 3EPRA 4R1LA 1GPLA 1B6RA 1ADJA 2K7ZA 3P9KA 3UHPA 2P75A 3FWNA 1JDPA 1TT7A 5ESXA 5C8XA 2JGLA 3DCJA 4NCHA 5YASA 2OYRA 4D56A 3JPYA 3DVRX 4F2DA 2DUMA 3B5EA 1GARA 4LOLA 3FVRA 3C5VA 3ZCTA 3T3DA 2O2SA 4D02A 1R6TA 4IZIA 2W2VA 4D0LB 1X1CA 3E8MA 2WUWE 3QBEA 2ZTHA 4G8BA 3GP3A 5ALDA 1A9YA 3E1SA 1O94C 2LD4A 2RGWA 1TF7A 5A4AA 3E0XA 3K0SA 1KFCB 3ADDA 4FWBA 3W8RA 1H2WA 4J7AA 3O8DA 3ZHQA 2G5CA 5HFJA 1TEZA 2Q29A 1BVRA 4BGEA 2J6BA 4EFNA 1KK2A 2VJCA 2AXPA 1KOFA 3I05A 3SE7A 3ZK8A 1ZP6A 2CZQA 1QH9A 4JBLA 4ARAA 5CFZA 2WFLA 3G5UA 4GKJB 4HCJA 4ARIA 2FJUA 2VDMB 1P5ZB 4Y30A 3U4AA 4QVIA 4IIVA 5CK5A 4IV0A 1L5NA 5K9ZA 2FN9A 3BOSA 3JQRA 3R7WB 2CGEA 1BN7A 5TV2A 4E1VA 2H3HA 5LZ9A 4I1VA 1QQAA 3KKZA 2D0IA 3ZCPA 3PXAA 2RHJA 3BWXA 4IIJB 5ED0A 1JFLA 5FL3A 4TQUS 3HH8A 3DFKA 1IG3A 4CV2A 4ISBA 3OQHA 4N3AA 2XUJA 1WVGA 1PVVA 1J7JA 5EZYF 4R3UC 1M72A 2EGUA 4WL0A 2QX6A 2Y05A 4KUGA 4IIYA 5CMLA 3QI2A 1JZSA 2ILVA 2IYYA 3GQVA 2JCSA 3NHPA 4G0QA 2G77B 1N57A 4J0HA 1II9A 4JJIA 4INPA 4JZYA 4G8DA 5JPDA 2P6MA 3RFTA 4BO2A 5IC4A 5BSEA 2GKGA 5HDBB 2JLYA 2O3QA 1R6AA 1DJLA 1YBMA 2RI0A 3UWDA 3PD1A 3AEQB 3D4LA 4YRPA 4Q4AB 1QC5A 2VRCD 4MQEA 1K8RA 1UXHA 2BDUA 3NM5A 3I09A 3RIYA 2A30A 1TGYA 2A84A 3AU9A 5F9HA 3H87A 1JDUA 1X74A 2GNPA 2OECA 3E53A 1GN8A 2D4HA 3I30X 1EGHA 3L4BA 4IJMA 5P21A 3W77A 1G0NA 1HNWB 3TPCA 4WK6A 1GU1A 4TS9A 3W79A 1DT3A 1Z38A 3BTOA 4BTEA 3JAMA 3PTAA 2EYUA 2C4TA 2PVPA 4W5NA 4MP8A 2PS9A 2JIBA 1EK6A 3PFKA 2BHNA 2I7TA 3QPBA 1I6WA 3K5WA 4QTZA 3RE1A 4EEKA 3HVKA 3LBNA 1UMCA 1WPXA 3H83A 1TQ2A 3UY4A 1X80A 1OH7A 1H3NA 2G6TA 2QUHA 3RROA 4F11A 1KQOA 2GJ4A 3LV8A 4H1UA 5A4IS 2C7QA 4HL6A 2O2ZA 3HADA 4RX1A 5KNBH 1F0NA 2MR6A 3H3FA 3JQAB 4H16A 1U2TA 2QGNA 4PANA 2XMRA 4R7TA 3R9IA 3REOA 1AKQA 3BF8A 3MSXA 4S05A 2YV1A 3KOMA 4JI7B 3BEDA 1BMTA 3FWZA 1U3VA 2OBMA 3WKBA 3MJ4A 1E7RA 4TV9B 3ZY4A 1J42A 4BCBA 4YPOA 1SB9A 3PS9A 2IKQA 2C2XA 3AI3A 4OHFA 4P0TA 4MCHA 5T3UA 4DJAA 1Y5MA 1NXPA 3C74A 1RBZA 1H6BA 1ZJZA 2VR1A 1CRQA 1W30A 2ISSD 2PGNA 5BW8A 1JHZA 4ZEMA 3NYIA 5CA1F 4NJEA 2GESA 1YE3A 3OZUA 1HT0A 4KN9S 2MYUA 3IBFA 2BGWA 5FNZA 4H15A 2PUWA 5FQNA 2EFYA 1E1MA 2I1QA 3OE1A 3FYUB 1DC8A 1BDBA 1G2IA 1BHSA 1SZDA 2GN6A 3C1AA 3IERA 3PI6A 421PA 5CJJA 5KYXB 2A0UA 4NJMA 1WEHA 4YP0A 1R16A 1GGFA 1SKYB 1T29A 2H31A 4FD3A 3IUNA 3I61A 1R5BA 4B6JA 4PX2A 2XE7A 4PZ0A 1PHPA 4H7DA 8ADHA 4X65B 1UBNA 3L2OB 1FF9A 3GFQA 5I9BA 4FYPA 4O63O 4DMGA 1I4OA 2B20A 1P29A 2CHQA 3AF3A 3D59A 1XDWA 3QVGA 4AN0A 7GPBA 4BO6A 1ZK3A 1UPTA 2NO6A 2BGLA 1UBGA 4QGGA 4FLFA 4TLLB 3WQHA 2Q8PA 2QQGA 3KO8A 3HBJA 2J3EA 4NABA 3SYLA 4IZHA 3SQNA 1Y9AA 4DKXA 2MYNA 3RSOA 3V8NA 5DBOA 2Q4OA 4Q9AA 1GG2A 1YNOA 3PXDA 4MW4A 1QLJA 5LA6F 3TD6A 5A2GA 1S1CA 1RRFA 2RIPA 1W36C 1NFFA 4OJYA 1V6CA 3KT3A 1CLUA 1HG0A 3EOZA 1XMPA 2OXFA 5JS2A 1TLTA 3UG6A 4LYFA 2WJWA 2JEYA 3D64A 2FZCA 5K45A 2I4RA 5U4XA 3RYIB 3GFTA 2GXAA 3HDGA 5LQSA 2YYAA 5TGTA 1Y8QB 3EGXA 4QU0A 5T6BA 5H9WA 1NDUA 2HSJA 1D8AA 2GM9A 5M2QA 2XA1A 4G65A 3R0XA 4NNOA 1H5UA 4NCBA 3EDQA 4MX8A 4MRSA 2FLWA 2VPQA 2D5BA 3FMFA 4YAIA 1N6PA 7ADHA 1PIWA 4GBED 2Q3LA 5SZKB 5I9NA 1LFDB 1Z22A 1DIGA 1HFKA 4X9XA 5BY2A 3GEGA 4IIBA 3R7BA 3RVDA 1Z7YA 1TAGA 5I4BA 1RXIA 3LSTA 3A9TA 4F5ZA 4CHTA 3NOVA 2OLJA 1L5MA 3I3OA 2FWAA 3KP1A 4BE9A 5JBIA 3OE4A 3F3MA 1XIVA 3H5AA 3UK6A 1JGTA 4YFYA 3T1YB 3L1IA 2FEKA 2QV0A 2ZVDA 3B2EA 3WZMA 5KNDD 2HRQA 4YDHB 5JMOA 2BSQA 1VHLA 2E48A 4DMCA 3HWSA 5EIBC 4A36A 1GEGA 2HC9A 3FMIA 2JJ8A 3HVJA 3BXGA 3M4YA 3LL7A 4UDYX 4AW9A 4E88A 1VDZA 5BSFA 2A9RA 3U48A 1HE5A 2P8SA 3V4FA 3TCKA 4C6TA 2PSFA 1D4AA 1US8A 4LMBA 4N47A 5DHUA 4D8WA 1LI4A 4UTXA 1FIUA 2ZFUA 3L6CA 5SZHB 1OUMA 4NMHA 2PSHA 2HEIA 3RAEC 5DU2A 1H23A 2R7MA 1NXSA 1OREA 2RGAA 2VRBA 1CP3A 3FZNA 3VVLA 3ZPXA 2OB1A 1OR8A 3WI7A 5B58C 1YZYA 3AUSA 4F8EA 3PVZA 5ESRA 4DUZB 3OLVA 2XQIA 4F9EA 3DDSA 1RXVA 3BT7A 1AQJA 3ECCA 3SNHA 3E3AA 1BXKA 3GC6A 1UFOA 3IA2A 9GPBA 1A1VA 3SX2A 3FFTA 4G26A 1SCUB 1ZOPA 4RF2A 1E0JA 3HGMA 1FFWA 4AZ3B 2HQ1A 1IEQA 1O94D 3DFUA 1X7DA 1N7GA 1XZPA 2PL3A 5IM4F 1QGUA 3ZJTA 2XE6A 4QO8A 1P1JA 1K88A 2CXHA 4X64B 4DC0A 3FWYA 4KBGA 5FOQA 3A6DA 2BI7A 2ZYAA 3IGFA 2ZRCA 3QMMA 4ZEXA 3MD0A 3G9XA 1HYHA 4AMZA 5CLJA 4NNJA 2JFBA 4EIWA 2FR1A 2XRZA 1G4AE 2E49A 2HMSA 4LE2A 3WIEA 4G36A 1E2EA 4AMBA 2Y1KA 1DQSA 4IKEA 3TBFA 3EARA 2A35A 2FG6C 3F9RA 3R0ZA 2E6UX 3GUYA 3C6ZA 5IJAA 4MW1A 1RVDA 2DUUA 3B85A 3L8DA 1V5IA 4MDHA 5LN1A 3IEKA 5NLLA 3CXRA 4AB1A 1RI5A 3WLTA 3V4ZA 2OGSA 4K9LA 3T3OA 1R4NA 2UZ1A 5FLKA 1GM5A 3WNZA 2IK8A 4JXJA 1MFPA 2VQDA 5HP4A 1A9QA 3ZHOA 1NW8A 1A7AA 1KAOA 3EFEA 4XRRA 1NHWA 2GFIA 4QPZA 4BFCA 3GJSA 3DD1A 1A4IA 1V4VA 6ABPA 3N9IA 2B82A 1RDFA 3PUKA 2ZAIA 4YWHA 3TL6A 4RSHA 5JSHA 1CPYA 5FI0B 3RYFB 4ZCSA 1TJ4A 3ZVMA 1XRJA 1HTWA 1KH2A 2M2IA 2WJZB 2PYDA 3CLSD 1H5QA 4KBYA 3TYXA 1M2HA 1AQNA 3GA7A 4O4LA 2NU7A 5A4KA 4KR0A 5JY6A 2C1EA 5JD6A 1ZCJA 1FZTA 1J20A 4N0EA 3DOFA 4DR1B 3OPYI 1N7HA 4ZGGA 4M55A 2X0RA 4ZI7F 2VLBA 2UKDA 1I6LA 4LG1A 4OQEA 4P3NA 1H6CA 1XI2A 4WFJA 3V1YA 5IT9A 4OQFA 4G2TA 3DPSA 1U8UA 1G60A 4I66A 3T3GA 2PS0A 5FOXA 3GRPA 3WB2A 4CT5A 3EIOA 1L7AA 1GA1A 1OWLA 3ZVRA 3HYLA 4TRJA 4XX0B 3WISA 5HIAA 3FFAA 1RP1A 3HCBA 4GYYA 3GLQA 1TK9A 1AK2A 3L0DA 3ZGOA 5IUJC 5KTNA 2VNSA 1I3LA 4X8LA 5KOYA 5FUMA 3H2KA 5FWXA 1YDHA 3BMNA 4QVKA 3OF5A 1U5BA 5I7WA 4NDZA 2ZE7A 4N7MA 1TLFA 4O2AB 2B8JA 2ZXFA 4PAOA 2GRAA 4R2IA 3QBDA 4DLNA 4Y7DA 1RQPA 4V39A 1W88A 3L01A 2DBRA 4ZC1A 3PPIA 4EUSA 1HC7A 3HBLA 2ZI3A 2Z6UA 4DCTA 1W5TA 3AM3A 1PVOA 4NVRA 4GMFA 4P3OA 4XB1A 1T36B 2BTEA 2VCYA 3IAHA 3TQCA 5BSMA 2BFDA 1JXAA 3T4XA 2W4MA 4ZOBA 1WKBA 5DK4A 3CUTA 1JH8A 4CQJA 2C4MA 4K1LA 2ISQA 5G0SA 5HIJA 4D8TA 2PRSA 2WILA 1NLUA 1JDBB 1XAIA 3OJ0A 5DOVA 4DMKA 5IWCA 5HILA 1U4OA 1Z6TA 3AR3A 1QIMA 4IRXA 1Y8RA 2OV3A 3IAM1 1TA4A 4UUPA 3U3RA 3VAYA 1FFXA 1RP7A 5HPYB 4OP2A 3VNUA 4HPXB 4I81A 5ILQA 3TQFA 4JVMA 2DHQA 1G20B 3QVJA 1X8XA 1T6ZA 3CN9A 4ALIA 1AGYA 3TRFA 1HQDA 1ST2A 2CLSA 4XIFA 3CRQA 4XUEA 4DIBA 5BN3A 1XRLA 3KYDB 4D9KA 1U0SY 2H4YA 3DCYA 4ZDJA 3EPKA 5BQ3A 2CJFA 3INGA 5BYBA 3V7NA 3JYPA 1KARA 1QIKA 3GZJA 2VJDA 1WHTA 4U6QA 1ZOSA 3OFVA 2HFJA 4QRDA 3NH9A 4WADA 3TNLA 3KQUA 1WEKA 3KQYA 1CUSA 1XDGA 3CN7A 3ZDYB 5FOWA 1HM5A 3SC6A 4MKIA 5AFSA 2FFBA 3CUSA 3AUAA 3VM6A 3UMYA 2NQ2C 3PJEA 1WB5A 2PLWA 2XT6A 1VHWA 3UJDA 1JSRA 4DBVO 2CMFA 3HVHA 4D26A 2PUVA 1P17A 4N54A 4J0KA 2YHBA 5KVVA 4FSDA 4BN4A 1YT5A 4P7GA 3VA7A 1JIIA 2DFTA 2HK8A 4I1RA 3I2JA 2R85A 5CB0A 2HB6A 1W36D 3ANYB 2XHEA 3VDRA 4LF9B 2FWIA 2GT1A 5LC1A 2BFCA 1P7CA 1PUJA 4XB6B 3ENZA 3UB3A 4X66B 4ND5A 2PNFA 4BYGA 3K09C 4JUBA 1O95A 1QO9A 3O91A 2RHDA 2Z8YM 4RK4A 1YQTA 4P38A 4INOA 5KQGA 4R3WA 4L4SA 3BMOA 2DSNA 3VR6H 3TIIA 2V03A 3AETA 1L5VA 3ZZNA 1ADFA 1PT8A 4UD2A 1P4JA 3VI3B 3VPFA 3DDZX 5IUKC 3QKRA 1B0ZA 1R9JA 2I7CA 2AEMA 2J9GA 2W2OA 4LJ9A 4TVOA 2H1VA 4QQKA 4M49A 4S1TA 5JC1A 2W98A 3ONNA 3CEJA 3TQRA 1U63A 1SRRA 5A4FS 1ORDA 4OX9Y 5B1SA 3PUYA 3SR4A 1NPTO 2BVNA 2C96A 2VA8A 4FTWA 1TZJA 3NC1C 4CM3A 1W0JD 1TKBA 1ULAA 3FUUA 5AHXA 5BSGA 2ZSAA 1RAAA 1COWA 4K9QA 4X8OA 4WCFA 3HA7A 5F2KA 5IDYA 2W2TA 2OCLA 4W6QA 1HNNA 1CE8A 1MIOA 2OV2A 3ZCXA 4QYXA 5EIBD 1OBVA 3HDYA 3NBMA 4D9EA 3NEPX 3KEGA 5I9TA 1BH2A 1WW3A 1QCCA 1KC3A 1BXRA 2HJVA 2IPXA 3RLFA 4BO8A 3U3XA 2PR2A 4R0VA 2O14A 4L8YA 4MSUA 5I3ZA 5BNTA 4BNZA 1SVNA 1OH6A 5EPUA 1ZH2A 2NPIA 1U2ZA 3OESA 3TLGA 1K4YA 2BZGA 2EP5A 5D51S 1SCIA 4FI3C 1AZSC 1E7QA 1SU6A 2AG6A 4HQNA 1J0DA 2V8BA 3WIBA 1NBMA 3OP4A 3C4JA 3P0HA 2A58A 5B7PA 2POCA 4GM1A 1NVDA 4GUDA 4M83A 1CY1A 3HR7A 1MC4A 1UEXC 1OI3A 3SS8A 4LFAB 4OHWA 1S3SA 2B34A 1FC0A 2IA5A 3Q2OA 4Y2PA 2EQBA 1JKJA 2P6NA 5JXJA 2OCGA 4B4UA 2IXFA 2G1UA 3N3AC 3FPEA 4LSWA 4G5YA 4HDCA 3C1UA 4GZ6A 2VDQB 4M1TA 3C5EA 4KQGA 1J33A 2VUIB 3G2PA 2I0FA 5ENVA 1G9SA 1KIMA 4BNNA 3WLAA 1KOLA 4C30A 2FFHA 4J4TA 1SD1A 1ECGA 4ZO7A 1CQWA 3DQZA 4EJMA 2CEKA 5EKUA 2MR5A 5DM0A 4C7MA 4E1AA 3GGPA 4TV8F 4KAAA 5AKYA 5JVDA 3M33A 3TLEA 2FCAA 3N8GA 2J8ZA 3KL2A 3RVRA 4FN4A 3T1NA 4QUKA 1XLVA 1DCTA 1QRDA 3KSRA 4MVJD 1BXGB 2F8LA 2R751 1Z4KA 4K81B 1UT5A 3EMDA 3QUCA 2OV4A 4XTRA 5EZSA 2O4CA 1R12A 2BD0A 1XNJA 2H8KA 3MJFA 3OIFA 2H4WA 4N5DA 3DO6A 4CMCA 4CCYA 4MI1A 5ANRB 3TLCA 4LE1A 1A7JA 1L4MA 3OOWA 1CUWA 5BURA 1AGXA 1SKBA 4MQ6A 4EKIA 2P8JA 2QOEA 2C98A 5J4VA 5B12A 5M7EA 3C48A 1PFQA 3L6DA 1BMDA 2HTFA 1LB1B 4Y2UA 5CX1A 3U6KA 2GI4A 5DCLA 4TUYA 1XEAA 3ABQB 1JF8A 1JPNA 1VKNA 2Z43A 1OT3A 2QM7A 3AM5A 2VHXA 2V6BA 1NF9A 1MTZA 3GRRA 4FQ7A 5A4DA 2EW8A 4FLEA 1CR2A 1I4TD 1UZLA 2CKMA 1Z29A 4RIHA 4LXTA 2OD7A 3BXFA 5G02A 3EMVA 4CMIA 3KQOA 1EA5A 4LHWA 2Q5QA 4YP6A 2P3SA 2W58A 2O5RA 3MWEB 3SAJA 3W04A 2H7YA 3ZJYA 1EKXA 1NJ6A 4M0EA 3MELA 3L6BA 4WBNF 2WNIA 3ZE6A 4DZTA 1DKMA 2RI1A 4O4HA 4UBKA 2I9PA 1L5YA 1U0JA 5D7BA 3NBZC 5IM5A 5IAAA 3MINB 1RXSA 3Q40A 5DGCA 5DI9A 3DWIA 2RK4A 3LM8A 4MR9A 1S5PA 4CMEC 4KYUA 2Y8EA 3EDCA 1HETA 2VT2A 1SBQA 1OXSC 1YH3A 3FN4A 3M3PA 3R3WA 4LSZA 3UJHA 2BT4A 2VYNA 5HQTA 1UPFA 4YGYA 2DFNA 3LRPA 3W3ZB 2X7XA 1YQ9A 2WTNA 5AVJA 1OXVA 1X1AA 2BF4A 4U7GA 3WMXA 5C8ZA 4Z9FA 4RKEA 2OKGA 1VYTA 1A8PA 1KXJA 1ODFA 2NXWA 2ZIXB 1P9RA 3L7BA 2N42A 3JZDA 4H4CA 4MW7A 1JAXA 3AR8A 3O8QB 3TBHA 1YIOA 5TT0A 3DWEX 2ZWAA 2D4AA 4BO9A 6AT1A 2DXIA 4HFMA 1JFFA 1IHPA 2X3YA 4B3MB 2FGKA 1P9NA 1CDEA 5CA0B 1LDYA 3K6JA 2CXXA 2O8EA 1UOPA 4XVHA 2A6PA 2VJAA 4EFMA 2ENUA 4N9QA 3WJ2A 5LD2C 2PCLA 1VA4A 3L6RA 4REQB 2QBYA 3NHJA 2HH9A 2EFCB 2P41A 4P98A 3DVQX 3IAFA 5F52A 3LX4A 4YCLA 3THSA 3FZQA 1T6NA 4BBJA 1NI4A 2BM0A 4FW8A 5FFFA 5M34A 1KBQA 3RS5A 3MF4A 1MU0A 1EFAA 2YYYA 3NM6B 4JY7A 4X1YA 5DEIA 2EKZA 1A9RA 3EVDA 4J1TA 4YAEA 2EP8A 4PGFA 3P4XA 1AV7A 1E5DA 1VPVA 1QMGA 3CZPA 2O7QA 2PKEA 1RQGA 3UF0A 2ICAA 1P4AA 2IYLD 1M83A 3TM5A 3U3MA 3ZXSA 1NI5A 3FCAA 3GCWA 2QLFA 2C4VA 4TKMA 1N8SA 1RMYA 5HR5A 5KWJA 1FX1A 1NKSA 1PW7A 2AI3A 2PUTA 3UJCA 4AIIA 3M6XA 2KBFA 1RWOA 3HP4A 1ECLA 1SBCA 3CR3C 3W1WA 5HZGA 5KU7A 5HM6A 1NLMA 1YQUA 4LXHA 1E5XA 2J33A 4BVEA 4CCAA 3OIVA 3T7SA 4LI0A 2XA2A 3WKEA 1IQUA 2OBXA 3QUTA 4LVOA 1EE1A 1FQWA 1PQUA 4EI7A 2JFPA 4ZANA 1V11B 1J22A 1T4DA 2XV1A 4GPD1 4F4FA 2HLNA 5FYDA 5NULA 4B4VA 2QTVA 1KBZA 2RH4A 3M6MD 5ALMA 1ILWA 4BKMA 4CDRA 3QE0A 5DSTA 1O57A 1V16A 1QTRA 3FOBA 3QE9Y 1N6HA 5ILOA 5AJHA 2P30A 1P62B 3P4YA 4I1UA 1K89A 2AQHA 2VJPA 2XCUA 1GRRA 2HK6A 3KPUA 5KNCH 1E4EA 2NZUG 5JG7A 1U2QA 4L4XA 4Q39A 4LYYA 5E3HA 3VOSA 1NM5C 3L3BA 4S12A 3ZDXB 2XMCA 4DMHA 3RUFA 1ZUNA 2IXBA 5K0TA 1YC5A 1EP2B 3RIMA 3U7HB 1AQYA 1UBRS 3BWEA 2GMWA 1LS1A 3LKVA 1FQKA 2I6QA 2GZ1A 1PNTA 3H5WA 3KR1A 4D6PA 2N3ZA 4H7JA 3MYYA 2WJGA 2REXB 3AR2A 2NO7A 4IIEA 1M5TA 2XQFA 5J43A 3OZVA 3OHMA 4KE6A 1ICIA 1LQ2A 1T9ZA 1S02A 1OJ7A 1P31A 2KI5A 4R1MA 4XWTA 4EY6A 4ZYLA 4AKHA 4QU9A 2QR2A 2CLIB 3DDOA 4HO1X 1YQQA 2DTDA 3A1UA 5K1ZA 4X93A 2B99A 4G4SP 4PLTA 5TF0A 1KIAA 1JXOA 1BDMA 1L0BA 1FSFA 4KNWA 4FYIA 4O5OA 3A2KA 2A5JA 3K9WA 1YGPA 1H6AA 4QTXA 4CDNA 2NUTB 3JVUA 1UP4A 5BNIA 3SNKA 3KOYA 1IEXA 3FBTA 2QA5A 3N05A 2GPNA 2RHTA 3BK2A 1FDWA 1E1RA 3ELBA 5IYZB 1FTWA 4G63A 5AOCA 3DZGA 1UBTS 2J85A 3ZGVA 2LRHA 1OAKA 3GF4A 3NPAA 1XTTA 3JWJA 5E1MA 5G0TA 4MV4A 2OOSA 4B3SB 2XT9A 1D1TA 2FPLA 4BO5A 5EYPA 3FUWA 4F91B 3LYUA 3PC3A 4FDUA 1N5KA 1RIIA 1HF3A 1JRLA 1QB7A 3I9FA 4WXRA 3TW0A 2AT1A 3U62A 2ZE6A 3HU3A 4Y9SA 4C4TA 1GKLA 5T41A 3L0IB 2PXHA 2FEAA 3QVUA 2POQX 2B4AA 1UWVA 2Q5CA 3DYBA 4ZOLF 1VE6A 4UEJA 3AHIA 1QHIA 2VDVE 1P1CA 3EFOB 2Q9CA 4M9QA 2OBYA 1PCXA 5H4HA 4CLHA 2X77A 4H31A 2D0PB 4YRQA 4EG1A 3N59A 1JHDA 2VHEA 1VPLA 1PR3A 1O95C 3CZCA 5LWQA 1UBFA 1KEWA 1J00A 3HB9A 3COYA 3LBYA 3LP6A 3H04A 3RABA 3ZJUA 5DGIA 2H00A 1HORA 3JAKA 1EINA 3PF9A 1V8DA 3I8SA 5EFZA 1G17A 2A7QA 3HCFA 3K9FC 4N5MA