3LG2A

A ykr043c/ fructose-1,6-bisphosphate product complex following ligand soaking
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
269
structure length
269
Chain Sequence
SLTPRCIIVRHGQTEWSKSGQYTGLTDLPLTPYGEGQMLRTGESVFRNNQFLNPDNITYIFTSPRLRARQTVDLVLKPLSDEQRAKIRVVVDDDLREWEYGDYEGMLTREIIELRKSRGLDKERPWNIWRDGCENGETTQQIGLRLSRAIARIQNLHRKHQSEGRASDIMVFAHGHALRYFAAIWFGLGVQKKCETIEEIQNVKSYDDDTVPYVKLESYRHLVDNPCFLLDAGGIGVLSYAHHNIDEPALELAGPFVSPPEEESQHGDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Uncharacterized protein YKR043C
publication title Structure and activity of the metal-independent fructose-1,6-bisphosphatase YK23 from Saccharomyces cerevisiae.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 89
structure length 269
sequence length 269
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.37: Sedoheptulose-bisphosphatase.
pdb deposition date 2010-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 3lg2A01
1C80A 3BIFA 5CX4A 1YFKA 2H52A 3HJGA 1DKNA 1SKAA 3EOZA 4PGMA 3R7AA 2GFIA 4MA4A 4D4KA 1SK8A 1SK9A 1H2FA 2IKQA 5HTKA 2RFLA 3MBKA 2P9YA 4PZAA 4EO9A 1TIPA 2WNIA 4FDTA 3IT3A 2BIFA 2P9ZA 2OWDA 3LL4A 1C7ZA 2ENUA 4GPIB 2AXNA 3D6AA 3K4PA 2HIAA 2PA0A 2WU0A 4QIHA 1ND5A 1T8PA 4IJ6A 1NT4A 3DB1A 2DWOA 1IHPA 2P6OA 5CU7A 3GW8A 3QPWA 1ND6A 1QFXA 1YJXA 2OWEA 4FDUA 4ARVA 2HHJA 1DKOA 1CVIA 5HR5A 5PGMA 3D4IA 1RIIA 3NTLA 3OI7A 2EOAA 2H4XA 4E3WA 3IT2A 3E9DA 4AROA 1BIFA 2I1VB 2P2YA 5AJVB 4TSRA 4ODIA 4EMBA 3K4QA 5AJXA 1FZTA 4ARUA 2P75A 3E9CA 3FDZB 4D4LA 2P79A 1UJBA 1QWOA 3F2IA 2ENWA 3ZHCA 1V37A 2P77A 3GP5A 3MXOA 1DKQA 4GPZA 3PGMA 4D4JA 1E58A 2A9JA 1RPTA 3KKKA 1RPAA 3D8HA 1XQ9A 2DWPA 2EKZA 4ARSA 4D4MA 1H2EA 1K6MA 5AJWA 1E59A 1SKBA 2YN0A 1UJCA 3IT1A 1V7QA 1DKLA 3O0TA 1BQ3A 3QPVA 1BQ4A 2P2ZA 1DKPA 1DKMA 2P9FA 3C7TA 3FJYA 2P78A 2HPAA 4JODA 5AJZA 3LG2A 3NFYA 2H4ZA 3IT0A 3QPUA 1C81A 2P30A 3DCYA 2QNIA 2WNHA 3FDZA 4JOCA 4PZ9A 4JOBA 5CDHA 2H0QA 2EKBA 5AJYA 3F3KA 3GP3A 1QHFA 2A6PA 1EBBA 1FBTA 2F90A 4HBZA 4IJ5A 2P6MA 3E9EA 3LNTA 5AK0A 3EZNA 2YN2A
chains in the Genus database with same CATH superfamily
4N1AA 3WWZA 4D6PA 2WDPA 2OFXA 1HMYA 1VTKA 3AHDA 1Z5VA 3N2KA 1HDYA 2V7VA 1YGPA 1AGNA 2HHCA 2VT7A 2Y05A 4GUDA 5THKA 4DZRA 1FP4B 1SKAA 2GH1A 3BE6A 2DZDA 3LP8A 1QE5A 4J0EA 4QDTA 2F1KA 4IOKA 1ZJ4A 3HLYA 3S3TA 1AUQA 2E3JA 3PL1A 1W48A 1S2LA 3R8CA 1QIIA 1C3XA 1W0KA 3CC8A 3OIYA 5FPYA 1OV6A 5BR8B 2VPXA 2BFCA 3H7IA 4JI6B 3ZZ0A 1WXFA 1FTWA 2WFMA 1TA0A 3CRQA 3O75A 4HI0E 4WFJA 4RTPA 1NBAA 4INOA 5F4ZA 4ZARA 4A8HA 3ER8A 1HT2E 2HQRA 2YYSA 3VNQA 1TZBA 2H5EA 1MXHA 2PBLA 3ABOB 4PFKA 3KSZO 4EENA 1JEYA 3EUFA 5KDLA 4OKSA 1QQ6A 3TSZA 4AF6A 5DLYA 4J1NA 3D0OA 2QMZA 3QF7A 4A8JC 5JBQA 3SHWA 3ZD8A 3FBGA 4EH1A 1K2VN 1TZCA 1U81A 3PDJA 2GK4A 3LT5A 4HP8A 5DYYA 3K8QA 5L45A 3GWZA 3GL9A 3ROPA 1OFHA 2P8JA 4EW3A 3RADC 3GV0A 4QDKA 3PUXA 4IGEA 3CQ9A 1OZFA 5ANRB 4AF8A 2IBSA 4MB0A 5CYFA 5M3BA 5ED4A 4YXWA 4DMFA 2VZ0A 4IX9A 1YD7A 3H2YA 4EHFA 5JSUA 1PFKA 1QO9A 2P9GA 3OFSA 4I2NA 4JFAA 1E1RA 3A58B 3G0IA 3EF1A 4HQNA 4DDUA 1PJQA 4ZJYA 1P5ZB 1ML4A 1VHDA 1U0TA 4OHYA 2EGUA 3CU5A 3ESCA 4HVAA 2RI1A 2QN6A 1Q2UA 4CT4B 2IIBA 4RTQA 3G9UA 3OE1A 4B3HA 3FYUC 1ZD3A 3LRTA 2QTCA 1MAVA 2O48X 2Y9MB 3A3YA 3VI4B 2IXEA 2BFBB 5C7IO 1GLVA 2XIQA 1MV8A 4BC0A 2OCPA 4MKXA 4KB5A 4D4JA 3BQMB 4XFDA 1YC2A 4LI3X 4DV3B 3DOUA 1XU9A 5DMXA 4Z9YA 1H8ED 2H11A 5JO9A 1Q77A 4BNLA 5HIKA 1E60A 3AXTA 3O3NB 2PO5A 4R01A 4H17A 3CNEA 2DXIA 4S1TA 1M2OA 3Q0EA 4C76A 1I8TA 2VZLA 1RJGA 3NASA 2FQQA 4LF7B 1UJCA 4DOMA 5JSHA 4FLEA 4KQFA 1UOEA 3AKDA 4XPIA 1U5CA 3FX2A 1QK3A 5EYPB 4J2OA 2PNJA 1OGJA 3RK4A 2H51A 2FMXA 2VDKB 4P8RA 3IIIA 4LHSA 5TT0A 1Z73A 2V8BA 4ND4A 2G1UA 1BVRA 1MX3A 2GZ3A 3AKYA 3BQ9A 1N8NA 2XTJA 2R3SA 4FT2A 4KBGA 3S8MA 2ISQA 1B23P 5BMVB 4MPTA 1XK6A 5DCWA 4DV0B 2WE8A 4J3FA 4R9RA 4A03A 3ZHXA 4YMTA 2I9PA 2Q27A 3U26A 3OT1A 5CDGA 1A9YA 2QE7D 3L1IA 2ZI5A 3TQIA 1E69A 2VP4A 1CDOA 1DXQA 3MWLA 1WX1A 3RG8A 3ICWA 3EPRA 4L8VA 2G9QA 1NU8A 2BGTA 1G5TA 1H6AA 3ZDFA 2R7AA 1ODTC 1Z35A 4HLQB 1LUAA 5B3AA 1NP3A 3G2HA 3W3AD 1T4BA 3QX8A 1C9EA 2BMDA 4LS3A 2H5JA 1XK7A 1ZRMA 4ZQCB 4EUEA 3L04A 4Q9DA 3S1SA 4BNJA 3RS7A 3N0WA 5KI6A 1R3DA 2ADOA 3Q3VA 1NVFA 2XOXA 2XKJE 3SQXA 3AETA 3EOAI 1E8MA 4Q3CA 4EFLA 2O59A 2BGNA 4JLWA 1W47A 2JZCA 1Q15A 2BFWA 2Q3BA 2X6TA 4JJEA 1CUYA 1AKMA 1OX4A 5E7QA 5TS3A 3SSOA 5LOVA 1C7ZA 3B8EA 2CV0A 5EP4A 3VJLA 2UDPA 4AXBA 2X3FA 3L49A 3QVMA 1Z3CA 1P4RA 4L22A 3BFKA 3K5PA 4U9UA 4W1PA 4E7PA 4B73A 5CEJA 1RWBA 2BMFA 3LHIA 3LKZA 2P11A 2LPMA 2KJQA 2X5KO 1G8FA 1G5QA 1I24A 2O8DA 1KFCB 1A82A 1VDZA 1HYEA 2JGDB 4NEGA 4O1MA 4TV8B 1YQWA 3A4VA 3HDQA 1UPFA 5BN5B 2Q9CA 2OWEA 2DFTA 4S12A 5H68A 3QA3E 1WSWA 4Z4CA 3O95A 1IMJA 1B6SA 1UIRA 2XCSB 1FZQA 4RYDA 5AVQA 3R20A 4UTZA 4FCWA 1JFLA 1K4MA 9GPBA 1FFCA 3AGPA 1MX5A 3QUBA 2CDAA 3ZNQA 2XZLA 1IY9A 2I55A 1L5GB 2RGEA 3DKIA 4EMBA 3V4ZA 1ONNA 5C7OO 1SUDA 3KYBA 5GOZA 3ZNNA 3WLMA 2M6SA 2BGRA 1M9NA 4KQWA 4PCVA 3SFTA 1ZL2A 3WADA 2F3QA 3DFIA 4ZVKA 3U7JA 4LJ9A 1TU4A 3LX4A 2GA8A 3SSNA 2B83A 4IXMA 2C5FA 1LPOA 2MIIA 2V6FA 3RVSA 1DZ3A 1XKQA 2IP1A 1M76A 2B4TO 3P94A 1FFHA 4IXDA 4FEEA 3SZUA 5A9SB 1FP7A 2BRUC 3O1LA 1BO6A 1Y6JA 1KR5A 1RPAA 3RVNA 4D99A 4LVCA 2ECQA 1VCNA 3ZX4A 3IAM6 1N7JA 3H2IA 3OESA 1QG2A 3K31A 3KLPX 4G63A 4EABA 2ECKA 3LP5A 1MG5A 4EX6A 1EE1A 5LZ4A 1NMYA 4JY7A 3T7SA 2C8JA 3AINA 3DLIA 3R2JA 4J0JA 4R6WA 2MINA 3FW1A 2CZCA 2ZROA 4M86A 3ZV5A 3RT7A 2ZRGA 3ANTA 3V80A 3SHTA 3WOHA 4F6RA 1YUBA 5AVXA 2PJUA 3PHCA 5HDQA 1YZHA 3RT9A 1NL3A 4JA0A 1U28A 5JC8A 1W7AA 3KOMA 3QPUA 5CH5A 4UD6A 1GVHA 1VPLA 4RKWA 5I3CA 1F2VA 1MJHA 2OV4A 3ZWOA 2VP0A 3KQKA 1ZGBA 2RGDA 4WADA 2H1VA 1RYZA 1VCMA 1B0PA 5CT4A 1UPTA 3ZTTA 3ZWDA 3ADCA 3AVPA 4FGUA 3HSSA 2NUPB 1CF2O 1L7OA 3CISA 1TVKB 3RVOA 4TRRA 4Z3KA 1NLFA 2VF8A 3LV8A 1D8AA 2ZJOA 5TR9A 3V8RA 3S8EA 5B4TA 2OZKA 2WHYA 4U5XA 1ECJA 2HQBA 5AHRA 1Z5ZA 4FXOA 5TXGA 4DILA 5IN4A 4YRCA 1AZLA 1X42A 4DR5B 2C9DA 1YDWA 3UAWA 1GUFA 3UBTA 3IEXA 2QTZA 4YMUA 3GLHB 1M3SA 3HJCA 4PRZA 5ALUA 1WG8A 3U5ZB 1Z7WA 3AXSA 5IJZA 1WCIB 3G9TA 1YOVA 1ZUD1 3FWHA 1CY6A 1IHXA 3OIUA 5IM4F 1E4EA 5AJHA 3FHJA 2APJA 2BJWA 2R8YA 5FQNA 1O95C 2FHSA 1JLLB 5JHGB 2FGKA 2I1QA 1FP1D 2ADMA 4CJXA 2FX5A 3NRBA 4EJSB 1OFIA 2ZUDA 4GPEA 3SZRA 1EEHA 1HQCA 1QGUA 3RWMB 4W5TA 3LXRA 5CTJA 5HF8A 3OBBA 1PWYE 2ACWA 4U3JB 2JDIA 1U6JA 3R6TA 2OO7A 3ZGLA 4ENSA 1A8UA 1WSDA 1NXSA 2AOUB 1B3RA 3AHGA 3C8ZA 1W4CA 3EEYA 4IUBS 3M9LA 5ALFA 4IOLA 1KZ7B 2CKDA 5F5XA 5KQLA 4X3OA 2H1SA 3W2TA 4BNXA 2CFOA 2VOEA 4DNQA 1K8XB 1ESNA 2SICE 4WXHA 1GIAA 1GSOA 2XNKA 3H5VA 4RVDA 4WCFB 2ZTSA 1K3UB 4PZ0A 3IIJA 2WZBA 3Q3JB 5J4HA 2QMUA 4LPSA 1UJNA 1OYYA 2YV3A 2WQZA 2RCYA 2D59A 3B2NA 3GHHA 3FGOA 2Z5VA 4TVBA 2HN9A 1D6NA 2C84A 3N8DA 4RD2A 1DU4A 3DLAA 1K75A 1NT2A 1SOUA 3CWZA 3K1ZA 4ZJZA 5HF5A 2V3CC 4EITA 5HR5A 5AUQA 3UJ3X 1BDBA 5AIBA 3FPLA 3IQGX 2HXGA 3OUZA 1KNXA 4B44A 1LQ2A 5ILQA 4H59A 4YUWA 1X8LA 1G66A 2O57A 2W2QA 5EWJA 2B1IA 2GEDA 3H8WA 5F2EA 4ARUA 3I2HA 1E1DA 3ZVMA 1RABA 1USIA 4M8KA 2P6PA 4H1WA 1TKRA 3L05A 1T5BA 2CK3A 2OP1A 3LMKA 4WCDA 5BNIA 4FSDA 3RFFA 3BJEA 3CH4B 1U0OC 2AJBA 3MMSA 1Q7RA 1KFJB 2GDJA 3D6MA 5GPBA 1V8DA 3D2LA 1VCHA 3W34A 4CPDA 1GPJA 4B2PA 4PY2A 2HDWA 3EFEA 1BMTA 1E9RA 4HQLA 4KAAA 5HIAA 3AL3A 5IKPA 2UYGA 1XAIA 4NMWA 1JHDA 3IQHX 3WJ7A 3FB1A 4ENRA 2O07A 1U2DC 3UAVA 4FX2A 3U6BA 3LU1A 3PA8A 2V1UA 4NCAA 5E2BA 1QRTA 5F2KA 5TC4A 2PA3A 3L1KA 1QVAA 1M5TA 3FRHA 2F1RA 3IXMA 4F1KA 3DEFA 4B74A 3Q8WA 3BFVA 2FHPA 2QUIA 2XWSA 1KOLA 2GD1O 3H1AA 5CH3A 4YT8A 3IKLA 3TH5A 1YHZA 4Z9FA 3WZMA 4Y6LA 3SAJA 5HQ3A 2WWFA 3GUYA 1H1LA 1XCOA 2QPOA 3F1LA 3M6IA 4URXR 3W4JA 4BFZA 2YZNA 3TL3A 1E79A 1SCAA 1RZ3A 3N9IA 1I0LA 4K7JA 4X20A 2EFYA 2C20A 1EJ6A 2WNHA 5KU1A 3QUTA 2AX3A 5CYPA 4AI6A 1CU1A 2J6IA 4UUMA 2NSYA 3K73O 1V9SA 1ZK0A 2G17A 4GPD1 2IH4A 1AKEA 3K7EA 2BJHA 3A6ZA 2XRFA 4B83A 4QTTB 3IX7A 3JWJA 4WXEA 1W36C 3W5VA 4EGQA 2UYHA 5HNKA 2Z6AA 1E2MA 4W99A 2H08A 1YVUA 3D3EA 1N5JA 1PNQA 4GDMA 4C3UA 2NP6A 2AMLA 1FJHA 5K8LA 4D4IA 3O3MB 1XL1A 5LMUB 4PRYA 2W6OA 4BL5A 3P0FA 1ELOA 1OLOA 3B1XA 1UMCA 1J8MF 3FIUA 3NZEA 1N7HA 4RX1A 1YE3A 2RHMA 2VYVD 2IIVA 3G0BA 2GVDC 3CTMA 3I83A 3LQRA 5TDHA 3SQWA 2JAHA 4GOKA 3CXRA 1BA3A 1P45A 4DS3A 3RTCA 2E4YA 1UT6A 3UV3A 4BVJA 2D0IA 4Q3NA 3OLZA 2X0IA 2R44A 4KEAA 1KYVA 1OT3A 1XUOA 4E5KA 4N9QA 3ZU5A 2OYRA 1W2GA 2I4TA 2XVZA 1KMCA 4DGSA 3O91A 4DQUA 4EQ6B 1KEEA 2DHRA 4GPIB 3RRZA 5D85A 3ZDBA 1WKCA 1XZEA 2G72A 2D7JA 2FYTA 5GONB 3QPAA 4I4TB 5BYBA 4BUJA 3KQPA 3N70A 3LVFO 3W4KA 2C0PA 3VNUA 2PL3A 4OX9Y 821PA 4I5DA 4NE9A 1KAHA 1BDIA 2AFHA 1NDUA 1U7UA 1XDBA 3L1JA 4I3HA 3OX2A 3C6QA 3SY8A 4Q3BA 2PGLA 2DTEA 2PKQP 2W8BA 4URVR 3NXSA 4AZWA 1TZKA 3DSRA 3R3UA 4CMHA 2QLLA 3FB4A 1UF9A 3LBFA 5CTAA 2MSDB 4I19A 4TV8F 1P73A 2IS6A 3D54D 4IIYA 1EU1A 3C39A 2IPXA 3HEAA 2FFBA 4KQ9A 1EDOA 2B30A 1G42A 2A30A 2PGJA 2Y2UA 4MVJH 1JP7A 5KTPA 2H7XA 1B16A 1D2EA 2BDEA 1UJBA 4F71A 5ADWA 1QVVA 3AM5A 3OQ1A 2D3WA 3EDCA 1JYSA 1J2TA 2BKLA 2FMHA 4ND1A 3T06B 2AN1A 3DKVA 4IMJB 1DAEA 1VPVA 2JAQA 1ESEA 4YH1A 5G1PA 4BP9A 1XIVA 1KYXA 1DO0A 2C2WA 1W6RA 3LK6A 1U2SA 4HEHA 5DM60 5FFFA 1A9OA 3RD5A 1BVYF 5B7GA 1TQ6A 2Q1SA 4Z7OB 5BUZA 2Q7XA 3H5IA 4NBTA 4HDRA 5E1OA 3RW9A 2CVHA 4J0IA 5HHTA 1RYEA 2OGZA 2YY5A 1AGYA 1MB0A 2ZJ1A 3KETA 5KWEA 1SHTX 2IYRA 3LWDA 3TLYA 4E4YA 4H35A 3UH0A 3DE4X 4C7XA 2V4UA 1M6VB 1Z33A 2ZYSA 1KQFA 1G4UR 2HH9A 2WJIA 3LUDA 4TV9B 4PNEA 4UPDA 4B7CA 3AF2A 4KI7A 1MRNA 1EBUA 3K0KA 3JTMA 2GR9A 4RNDB 3DGFC 1Z16A 4HUQB 3NFYA 4QYMA 3VZQA 2QTFA 2IOHA 3PE6A 4MQFB 3EC2A 2HWXA 4JEHA 4RFVA 2FW1A 4RHEA 4XKJA 3GLIB 3I5XA 1R5JA 4Y6SA 3ZHYA 3M1LA 1S96A 4HX5A 2CL0X 2Z30A 3O4RA 1M2HA 1THZA 4UPVA 2Q45A 4MJXA 5KQPA 2WA2A 3VDRA 4JXJA 2WAYA 1EAYA 3NM4A 1ZNWA 3UJ9A 1E5TA 2WDZA 5DNVA 1OLXB 1AQLA 2JCVA 5LJIA 1ZAYA 1HDOA 3R7BA 3ZWNA 4O3FA 3AVWA 3LSYA 5K0EA 4B3RB 1RQXA 2QSUA 2TECE 5DN9A 2G0TA 1GCAA 1UP4A 3LUAA 1L7MA 5CLGA 4YRTA 5AW8A 1MFZA 1G3MA 4BQSA 4C0WA 1K86A 1BD3A 1VJCA 3QE0A 1HFWA 5E6UB 1WXGA 1JPVA 1PJAA 3CO0S 3L8FA 1EVQA 3EBPA 1LRKA 3D6JA 4J49A 1AK2A 2PMEA 4EPYA 1BJRE 8ATCA 1T2AA 2GBCA 2WYIA 3DAYA 4NU8X 5NLLA 2B20A 3B3FA 5AKYA 1O6GA 3R7WA 3TPFA 4ER3A 1L5YA 3UJPA 1G8PA 1HG1A 2XY4A 2X6RA 3UICA 2ZIXA 3I1IA 5CIQA 4A26A 4B7UA 5IBCA 1JXAA 1R4NB 3DPIA 3E9RA 4HWTA 4HMQA 1HLPA 3G1UA 3TEFA 4ENVA 7ABPA 2YWXA 4KFCA 1FMJA 1VGRA 4TTJA 2IIQA 2G76A 2L42A 3TTXA 3KSAC 1N77A 4H6VA 4K2AA 5FPSA 2IWHA 5HJ2A 4IDOA 4QPDA 4WY2A 1QFZA 2OXTA 4XOIA 3J7TA 4MYRA 3KLMX 4B8YA 5CYGA 3RAFC 4G41A 1B2RA 2D6FA 4N65A 4XSVA 4EDFA 2UUOA 3AR3A 4MULA 3W5JA 2XPCA 5IWAB 3CX3A 2A9VA 1ND6A 3ECAA 1Y7LA 4DIOA 1U0BB 1RM3A 4JJ6A 1II9A 1S89A 1ORWA 3OLQA 2ZE7A 1K5HA 3O8LA 1PX0A 4WLEA 5AI8A 1CUIA 2BUAA 4EZEA 2ANBA 4YS6A 4B6RA 3HADA 2HYIC 4K9KA 4BRSA 1VZ3A 2XDAA 3BH6A 2GLUA 5TQ2B 1TCUA 2EATA 2HT6A 2R4TA 5IU6A 1L5WA 3Q1KA 4DCJA 2Q3FA 1U2EA 5T41A 4OQMA 2PSHA 3PLNA 3TGWA 3U3MA 4LIPD 2PQ6A 3R1IA 2ZI6A 1PLJA 1F0KA 2LVBA 4EW6A 4M1SA 2XCUA 4I4CA 3R09A 4ZZ1A 5AVTA 1VA5A 2FDCA 3GCGA 4E51A 4BLQA 3E7XA 3HB9A 3D0RA 1TJ4A 3IULA 4H7FA 5FUVA 4R2IA 4XUCA 5FUWA 5I7WA 4QRDA 1H2YA 2D7CA 5EXPA 1HQDA 1OT5A 2GRUA 5AJWA 1V2GA 2H7YA 3G9XA 4JMLA 3C4QA 2B69A 1ZA2A 2REBA 2EFJA 2PZFA 3U09A 1VKZA 1CR0A 1M1YB 5KNBH 1A9QA 4Y9DA 3SC2A 4H0FA 4PAWA 1HA3A 1BXGA 1W59A 2AZ4A 1O8CA 1A88A 4FHEA 2PSJA 2GXSA 2H1HA 1ABBA 2IYVA 3QG5A 4LOKA 4LWQA 3S1LA 3VUEA 2FZVA 2JKVA 2PRJA 4AMVA 1H4QA 4W7IA 1L4FA 1NQOA 4RZ3A 3A0RB 5JS1A 1AXEA 3P1JA 2WT9A 3DBRB 3K70B 2WKWA 3O84A 1KKUA 4PFQA 5EIHA 1Y4AE 3VR2D 4W5NA 1TD1A 3QNUA 1V5FA 4FMBB 5A3VA 2HMAA 4QTXA 1Y3HA 1GV1A 4A4DA 1GG8A 2WYWA 5IF9A 4Q4LA 3SP1A 1JTEA 3F46A 1ZM9A 2GF9A 4A73A 4MPPA 2ORVA 3WGGA 1C8VB 3DVAA 4TT8A 1H4VB 2OC9A 3WSTA 3LYLA 2JD0A 4LCEA 4YJKA 5DLPA 2RGCA 4B6SA 2GO7A 2WWWA 2RKWA 5EMHA 1QO0D 1VSTA 4GX1A 3WP1B 1YCGA 5KMGA 2B98A 3H7AA 3IVAA 1H2FA 3RHFA 4JJAA 4DEYA 3CSDA 4EA9A 3IHLA 3HP1A 5K3SA 4CDMA 1GGKA 1SIUA 2Q3DA 2CEKA 3HSKA 3SDZA 3T5BA 4GOND 5JH7A 1KI4A 1G4AE 2BZ0A 2O8CB 4GXNA 3ZBTA 2AN9A 4YP5A 1DBSA 3IAFA 3ZHOA 4DBVO 3UJNA 3B1KA 1ZUHA 3EMBA 3LFHA 3DAGA 3NP9A 3ZBQA 2X1LA 4WKOA 1L3BA 4MS3B 5K3FB 3KDSE 5KNDD 4QDOA 4RS4A 1JHPA 1YT5A 3QKRB 1Q14A 2YV5A 5I7FA 1U5BB 4CW7A 2EKDA 1FUUA 1AK1A 1QE3A 1D1QA 1PSZA 1UADA 3A2LA 1XV5A 2W0MA 3LDHA 3LUHA 3MGCA 1LLCA 4I1UA 3ABRB 3LDFA 5A5FA 1TU3A 4US2R 2FDRA 3PRHA 4LX8A 4XPZA 4Y6OA 3II6X 4S24A 5DHFA 1UR5A 2R2AA 4I4TF 4M8NE 1Z06A 4YQFA 3PIRA 1I30A 1MOZA 2C5BA 4G81A 5FAXA 1XA3A 3WA6A 4RD1A 4RVNA 5BXQC 2H92A 4BVBA 3GFQA 1UC5B 4HRVA 5B3KA 2ZYTX 4E6PA 5AVRA 1MEEA 4MTCA 4ZI7A 2I3BA 5A4FS 1BSVA 2PJZA 3AVQA 3ED5A 2ZYVX 2N42A 3OF2A 4NDAA 2C9MA 4PSAA 3SSMA 3HVIA 2WTXA 2DWQA 3VOBA 3CJRA 5JNWA 2X8JB 4JI2B 3LZ6A 5H1YA 2I1WA 3G5MA 4ZZ2A 3UANA 4CKBB 3PDWA 4YPVA 5AW2A 1UBLS 2HRZA 3NX4A 1SZCA 4NU6A 4E2FA 1K8ZB 4HNTA 4F7DA 4UHDA 4BB6A 3MRTA 4PQFA 4CEHA 1CZLA 4UU1A 1IHOA 1U0EA 1AV7A 3DP7A 1VJ1A 1CE8A 1SXGA 2YL2A 1NVDA 3PEUA 5JFTA 3L82B 3ZU6A 3I9V6 4ZYZA 4KL8S 1DPFA 3EYWA 3PF9A 3UMJA 2GSDA 2WSBA 1Q0RA 2ZJAA 2YN0A 3N0TA 3FSJX 3COPA 4DANA 1W46A 1NBHA 2O1WA 3CSUA 2EIXA 1LQUA 1W73A 2JRLA 3CLTD 3EF0A 4FFOA 4CMIA 1Y3FE 4INJA 2XNDD 1EZZA 3B1YA 4OYYA 3F9RA 3WYEA 3LPLA 2CFRA 1MZVA 2IYNA 1GVNB 4PLVA 5BSMA 4D9IA 3EWAA 3MCTA 4DYVA 2QRZA 1WL8A 2XUAA 2FPGA 4JWTA 2XWQA 3HI4A 3LBYA 4ZV4A 3ZCRA 1CY4A 3GA7A 4IMIB 1UBRS 3QXXA 1XZBA 4TV9F 3WNQA 4Z4FA 4CQJA 1OD6A 1SBTA 3EC1A 1RPZA 2OO5A 3CWCA 3OUUA 5SZIA 4ITVA 4UHCA 3WQBA 4AY6A 1BGWA 2PFSA 1XTIA 2JATA 4YY3B 3ASVA 3JVDA 4NV3A 2GKSA 3U3RA 4Q12A 1TK9A 4MHOA 4RUKA 3EY9A 4MW5A 2A6PA 4KITB 5JW6A 4KQ6A 3GPLA 3UMMA 2C0QA 4RLQA 1H4SA 5CLLA 2WVAA 2BTEA 1IH8A 3DP9A 1CNFA 5EJMA 4P3XA 4PTLA 5IZ4A 4V0KA 1G8GA 3MLEA 4IINA 5I7UA 1MAWA 2YNMC 1QCYA 2X5JO 3Q85A 3GYBA 3EC7A 3OZEA 4R5MA 5DPMA 1R8YA 4NCIA 5LB4A 5C37A 2AQHA 3SG0A 4FEAA 2PUEA 3HO1A 2C95A 1S9HA 2IYOA 2VJMA 1E4VA 1PZFA 3FVWA 3W90A 1B8PA 3HUUA 1JJAA 4P4UA 1U1IA 5IK2D 5ALQA 2VKTA 2YMLA 4BMSA 1TK2A 2ZBPA 3N28A 4EJ6A 4Y2VA 1PL7A 3WKDA 3AV0B 3C48A 3GR6A 3OHMA 4DBLC 4XIGS 2ZE8A 1VXRA 1YIDA 3D5TA 3L0CA 3NVMB 4HG2A 4H7EA 4JJ7A 3DBLB 4P5DA 4XTCS 4MRPA 2F1OA 4MKGA 4RDIA 1M34B 1NW8A 3KQNA 3BTUA 2ZJ2A 1YK0A 2FTKE 1SRRA 4C3ZA 4YRGA 3KR0A 5JCXA 2OXCA 2OCIA 4Z1OA 3T5PA 4CNBA 2HUPA 3OHSX 4TSFD 5AHWA 1PJCA 1X7DA 3OJOA 4RV4A 5A0VA 3ETEA 1KO5A 3OE7D 3K0AB 5CU7A 1JIKA 1EWKA 2PKCA 3C15C 3EQ6A 2NU8B 4QPJC 4D9FA 5KDDA 1LDYA 1Z15A 1FRNA 2GJAA 1T8SA 3WBJA 3F74A 3SLKA 4A2PA 3E9MA 5CA1B 2PV0A 4J0QA 1PJSA 4P4SA 3EEIA 4Y9UA 1ICIA 5A06A 4ZJUA 3HWSA 3WGKA 3NM6B 3FCYA 5EQFA 4QJ4A 1HNZB 2IEYA 2E21A 1A7KA 3L8CA 1ZIOA 3LXUX 4R3UC 1FYVA 5CW2A 2VHCA 3ZE6A 3OEYA 4NCXA 4FYXA 1ZLXA 1XJQA 4L15A 3DBOB 1PSDA 1VA4A 2VAXA 4JLVA 5DYGA 1BFUA 4TLCA 1E2KA 4TN5A 1EFRD 5K0JA 3KFVA 4ALKA 1XTQA 4RM3A 4TWJA 5TQ0A 4EF4A 5BN1A 1WULS 1G7SA 1JU3A 3UUWA 1NZJA 4R71A 3QTBA 1ZI9A 2O2CA 5LUBA 2A0XA 4C06A 5FOSA 4QD3A 4D8VA 4H0CA 1TVEA 3ZX5A 2QUZA 1DBVO 1ULHA 2W43A 3FCUB 4ZRNA 4DIUA 3UMGA 2JAXA 2IEAA 3DTVB 3KZMA 2EBHX 3GFPA 3H8SA 4EI7A 1ZOLA 4PZDA 3I2IA 1HDRA 3CEPB 4ZFNA 3CZAA 4KKVA 1FFXB 4IYRA 4QL3A 5FBVB 1XMVA 2XVXA 4B6FA 2YXNA 3IERA 3GRCA 5JS8A 4QUEA 4I0WB 2XB6A 4D3FA 4RPLA 3HCDA 3D3WB 4NZOA 1PZGA 3CX6A 1DZIA 3PLRA 2WP8J 5AJZA 3RYFA 4A0SA 1NKSA 4Q4CA 1GR0A 1IONA 2XE4A 4IJUA 1ZOIA 3IMKA 3ESQA 4D26A 4KIGA 2XB9A 2JLCA 3COYA 3RLFA 3QYFA 4YREA 5L53A 5HFAA 2JLUA 4FW9A 2C07A 3N2KB 1FTSA 1Z7YA 3SX4A 1YS4A 2VP9A 3MS7A 1UIMA 5A3QA 3A1DA 5C7LO 3MCUA 1ESCA 5HSGA 2WWRA 1W5SA 3PZRA 1SU8A 2ZU6A 5KAPA 3LXXA 4AY2A 3FZYA 1GPYA 2NOAA 3GFOA 1WUHS 1TOAA 5KSZA 4UE3S 1S3GA 2EDAA 1JE1A 1F14A 1M33A 3SM3A 4LWOA 5JZBA 1U1CA 2BFCB 3TKYA 4KE7A 4DRXA 3A1TA 3OWHA 1DWUA 1TM1E 2FK8A 2HV9A 1FZTA 4DARA 1DLIA 4MARA 3O9ZA 5IUJC 3PHGA 2QRKA 3R7AA 3U44A 1JEYB 5LQKA 4FN5A 1TJPB 5TV2A 1RRPA 2JGLA 2ODPA 4OBWA 3DE3X 5CH8A 4CQMB 2V7GA 1SC6A 1DQZA 1XN4A 3OKFA 1SD2A 1M8FA 4M53A 4DRYA 3STYA 1ZN8A 3TJMA 4CMBA 2Q29A 4WAUA 3GPDG 1GWNA 2QR2A 1T3LA 2CUNA 2BAGA 2WUWE 1YDFA 3CF4A 1DOZA 3Q87B 4FGSA 4R2JA 4RDCA 5JHHB 5B6PA 3VGJA 3QXSA 1POXA 1XFDA 4L28A 2FGJA 1J8YF 1UKYA 4YAKA 1DAHA 1P2GA 5A7FA 3OEWA 4B87A 5CLFA 5HUJA 4BJ5A 3TGLA 4UXIA 1QYRA 2HDNB 1L4LA 1JYEA 3V2UA 4Q34A 2B5VA 3L4EA 1ZA1A 5C80A 1BHJA 3TUJC 4IDHA 4JUBA 4ECEA 2B8EA 2RH4A 1F1BA 3ILSA 5TF4A 3TG8A 2Q4OA 5JVDA 3CN7A 4GWLA 4CU2A 1IM2A 3A1SA 1SG9A 4QSHA 4EG3A 2OY0A 1ZESA 1T5TA 2ZREA 2ATXA 2NU7B 4HQ6A 2Z1MA 3HBJA 1G98A 2CZQA 1T5DX 4GLOA 3RSHA 1VCIA 4KMOA 1JVSA 2ZRJA 3AJ8A 3MWEA 4GMKA 3BCHA 5EEGA 3WBFA 1XZHA 1N2HA 2JGMA 3VI3B 2KE5A 3PRJA 3H5OA 4G0ZA 2I6TA 1YULA 1DPGA 4N0QA 1WZEA 2HA0A 3MTEA 3HLKA 3KAKA 4C0LA 4GKJB 4FD3A 4WNIA 2PUWA 3ZE0B 1P9OA 1G18A 1Z0DA 2DRIA 3P9QA 1E9DA 1RZUA 3HGQA 5EZYA 4XPIB 3DTYA 2FKNA 5B53A 3LBIA 5F1KA 1KWKA 2YWRA 3HABA 4GBGA 3FY4A 3KWLA 421PA 3LT4A 3PPXA 2FSSA 3LC7O 1PT8A 5K0SA 1R0YA 3PA6A 3S2UA 4KNVA 3QK7A 4ZCSA 1MO6A 1GZHB 3G13A 4MUMA 1I3CA 3ERCA 1NI3A 4BV2A 3HMQA 2ZT8A 1AJEA 1Z8DA 3W7AA 4A1FA 3CVYA 2SCUA 5E2IA 5T4FA 3IKVA 5SYNA 4X6LA 1WDWB 4ZYUA 3DEZA 3ETHA 5F51A 2O5EA 221PA 1KSGA 2QVCA 4MRNA 5CCDA 3H05A 2I7XA 2E4ZA 1DDGA 3VYRB 1JDSA 2XXAA 4IX1A 3H17A 3ETDA 1SKYB 2AIRA 3IL2A 4BNZA 2W6NA 4E1BA 4WT7A 2CF6A 2A9KA 1JR4A 2WSLA 1H5NA 4MEBA 3ED1A 3KXDA 5JCOC 4KXYA 2XIJA 1BH6A 1EBBA 3VJMA 3WFZA 5LIRA 2QU7A 1CEEA 1TM7E 2GYUA 1NV9A 2JFNA 4LNUB 2C4NA 4WOBA 2RGGA 3RIHA 4LPKA 2DG2A 2X42A 2IU4A 2VF7A 4LXUA 4NMLA 1BKDR 3H65A 2X8BA 4NQRA 3MRXA 5CDTA 3AF5A 1DMRA 3E9NA 3V97A 3JQDA 2C4WA 2QRGA 4J16A 3TLMA 2ISSD 4WASA 1OX4B 2YY6A 1IOWA 1Y48E 5LOVB 1MAHA 1RC8A 1N75A 3CZQA 3LLUA 4DNFA 1USGA 5IARA 3W5UA 4ZDWA 1J00A 4PPGA 1PL8A 3NKLA 4G0NA 2R6CA 3REOA 4MMYB 1JDVA 1VRCA 5DASA 4NCKA 3THXA 2WHEA 1IFXA 4LZZA 2CXRA 5GOTA 4K6MA 2QMOA 4QBIA 2O7NA 5FOVA 5BORA 1LA2A 4CLOA 4C7OA 2DCMA 2YIDA 4DHWA 2O8DB 2QTNA 4PFSA 1QORA 3JD2A 3VM6A 5M2QA 2BMEA 3NR2A 4IQ0A 3GLFB 2DT8A 1TJ3A 4TXJA 2NO1A 3NV7A 4ZT4A 2J5BA 1H3NA 4MIOA 3D5EA 3K8ZA 3QJGA 3BL6A 2Z8ZA 3LO5A 4HMOA 4G85A 3F7TA 3JQ9C 3RM3A 3EK2A 3BRQA 2DFVA 2IHTA 3ER9A 5FAKA 4QYIA 1NYQA 5D3ZA 4Z1MD 3ZVKA 2V8OA 1I2MA 2B9EA 2LR0A 1A7JA 4FCCA 4QXMA 3X1WA 4MIEA 1US8A 5IYZF 2Q6KA 5AD1A 1SCJA 1VE5A 2RHCA 1SFRA 2DKNA 5TJ9A 1TTPB 5B6JA 3NDBB 5TQVA 2EL9A 4L76A 2V7XA 4QE3A 2FSVC 3ZHUA 5CA1F 2CN1A 2IVZA 1KGDA 2P0AA 1C4XA 4PBRA 5L7WA 1YKFA 3E58A 3E9CA 3BS4A 2VQSA 5DH9A 4QFBA 1HPLA 4Z3OA 1FUKA 4C7KA 4TTVA 3Q3IA 2IPMA 1FXSA 2FZLA 1G63A 5EMMA 1Z74A 3PBKA 4YNBA 4D92A 5J23A 4WACA 4X1YB 3RT1A 3EFHA 3VR6D 3L6EA 4JQZA 4KZKA 1X9IA 3AP1A 4IWYA 3TPCA 3T7IA 2E5LB 2WUFA 1MDBA 1Z7BA 2G8LA 5EWLA 3ISTA 3CVXA 4YMIA 3BJIC 1V8FA 4TT3A 4A0QA 1J97A 3O1JC 4IXWA 4C2UA 3GPIA 1VLJA 2FR8A 2ODNA 4DJAA 1GPUA 2OCBA 2Z08A 1E9VA 2WWTA 2BGUA 2C2XA 3SNKA 1VE9A 4AMUA 4F4FA 5CNIA 4UQLA 2DHQA 4AQDA 1YIAA 2P2ZA 4JI3B 3LOQA 3I0MA 1IRXA 3AUYA 3A3NA 4CV3A 3NORA 4LXXA 5KEIA 3GOHA 5I9SA 2SHKA 1ZITA 2I4IA 1REQA 4KSYA 4XFKA 1W5EA 3FUVA 4QECA 3ZIAD 4FM9A 1SPXA 4TMTA 1Y4SA 2BEVA 1TU0A 1G1MA 1NNUA 4X41A 1K5PA 3ZLUA 3F6CA 4W8GA 1GPAA 1NSYA 2GLTA 2Z2JA 4B82A 1DI0A 1NWHA 3M33A 4DEXA 5JPDA 3ZU2A 4ESHA 1BE1A 1JKIA 3N2NA 3O0DA 3T4EA 3TECE 2UUBB 4ATNA 4Q9NA 2Q4RA 3QEJA 4R81A 4TTTS 1YOVB 4E2XA 3HB0A 1BMFA 4QO7A 4MVJA 2JFZA 1E4EB 3G9QA 2VRCD 2ASEA 4GVPA 4XCXA 1AT1A 2D1YA 4A5OA 4B3IA 4LE1A 3TAHA 4E32A 2P1RA 4LDPA 2RIPA 2IDJA 4CEIA 1C3LA 5F73A 2DQYA 1EVLA 4I1SA 1QGUB 4LXGA 1OPXA 4N39A 4L4RA 5J5AA 3ZS8A 2WMYA 2I2BA 4KE9A 2PE5A 3EXFA 4CFSA 4V1CA 3U39A 1R0SA 4YJFA 2XA1A 2AE2A 3LT1A 5F35A 1C2TA 4PX5A 1XAJA 2PUHA 3AFOA 2PUTA 5C35A 3O2QB 2VP5A 1G8KA 2NXJA 3Q5GA 5FR1A 1AH2A 4MLCA 2EFGA 3ILHA 3S7TA 1E64A 1F38A 3FF4A 2DFDA 1RE1A 3HU5A 3KLOA 4FDTA 5EE3A 1F12A 2ZBVA 3DXFA 3QVSA 2PNFA 2QUBA 4PTZA 1KBZA 5HG0A 3OWXA 1JAYA 4BFSA 4BMPB 1OIVA 2FK7A 2ZFUA 4OP2A 4QGAA 5LBIA 1BRTA 3JXEA 1EVYA 2HB6A 1RQGA 2K2WA 1TCVA 1QMPA 2Z83A 4F56A 1H3EA 3OM8A 1RVDA 4QOGA 1SCBA 4Q3EA 1M72A 4IEFB 1AK9A 1JGTA 2AYYA 2D8MA 2DPGA 4IJ6A 5EXTA 3VSAA 1G38A 2Y4OA 2QG6A 1WMDA 3ICVA 1P7WA 2AWOA 2CT8A 1V3VA 4QEDA 1TUGA 2HNAA 3RFCA 3KSBC 2NVUA 1PS0A 4S04A 1HKHA 3CRNA 3R0ZA 1M1NA 3ZZUA 3TQOA 5B1YA 5JD6A 2WABA 2JI7A 3JPWA 3LWNA 4TWBA 5BWBA 2EOAA 1NXWA 1JSZA 8OHMA 3PV0A 4QFMA 2G8NA 3K6JA 1RM5A 1I5RA 1UBEA 4RMIA 2HPZA 3H8JA 2BGMA 3GIDA 3VDQA 3QU5A 5FLEX 3A3KA 1P62B 4N7BA 1G5PA 1KY4A 1JL3A 4P81A 4EX7A 4DZTA 3FSGD 3ML1A 1ZIXA 2DLDA 2GM3A 3O1IC 1U3DA 4ESVA 1U1DA 5ALHA 3OKPA 3A25A 2X9NA 4FFWA 1A9XB 2P5SA 1JSLA 4O0LA 3W6PA 5K3OA 3GJSA 3QXGA 2GRJA 1ZNXA 3PGMA 4MWEA 4U6NA 4D02A 1YQUA 3U17A 4BN5A 1B43A 1AB6A 3H99A 1HFEL 3DMTA 4G8CA 4HNAB 1E96A 4ENTA 1RS0A 1G9XA 1K0FA 5K2OA 4IVNA 1P0CA 5HQ3B 5JANA 2I80A 1XTVA 1YAJA 1M5UA 5C8DA 3DYIA 3EFOB 1OAKA 3F47A 4ENWA 4WKNA 4URHA 1CUHA 1YL6A 3TD6A 3ETGA 4KAJA 4POAA 1G0OA 2HRQA 4X20B 2CNWA 5FUYA 4ABTA 3SOZA 3RAJA 1U8ZA 5K8TA 3QYJA 1PUJA 3WYCA 1L1FA 3BMQA 1YH3A 4U2DA 2XQJA 4XM2A 2ZGVA 4WTOA 3S44A 3VR3D 4FYHA 4JLSA 5TPZD 2ZUBA 3FDZA 3ZR4B 1LSJA 1RP7A 3WGOA 5C81A 1XZJA 3NXKA 5L4LA 2OZLA 1KETA 3M6WA 1H66A 3S5JA 1F3OA 2ZJ5A 4KUGA 1WXDA 4JN6B 1UZLA 3D6NB 3QW4B 1W6UA 3WYAA 4BBJA 1UMCB 2BR5A 2VUHB 4YJ2A 1TEHA 3FGNA 4QGGA 3EVEA 4K40A 3P9CA 4BJ3A 3EVTA 4MS4B 3DOIA 1YS2X 5K51A 1SB9A 1ZK3A 4RD3A 4J94A 3PC8C 1ZY2A 3SR4A 3U7QA 5DW0A 3UT0A 2RHTA 1OASA 4Z4IA 4HAVA 5FUBA 2Q0QA 4NI5A 2VZEA 3CLUD 3OZVA 3TJRA 1NI5A 1KEEB 4DNPA 5L3QB 4U4AA 1CUBA 3W5SA 1I1QB 3BSFA 4YECA 4MQUA 2I4RA 3QKIA 1B1AA 1VMEA 4KIUA 3GRVA 4UMFA 3TK1A 3E8XA 4BPRA 1R8JA 2YFKA 5MN5A 5LOVF 1PIWA 1VPDA 5C4MA 3GBPA 1NXTA 5JV5A 5KNBA 4CF7A 1XG5A 4RMGA 4DLSA 4EPWA 2PH5A 4IEEA 2V7BA 1LY1A 2HW8A 1BXRA 4YCCA 4B47A 2DUMA 4V39A 4ZPXA 1U8FO 2G67A 3GJ0A 4QGSA 5ADUS 5IDXA 4FNAA 3NWEA 3V1KA 1CLUA 4A2QA 2B8JA 2QQFA 3O8BA 3RU9A 1QIDA 1ZCBA 1F3LA 2VNIA 4OJQA 5E95A 3M4XA 1M66A 1VE7A 2NG1A 5FWXA 1GZ4A 5J4YA 3OJWA 3WRYC 5AI0A 3DOJA 2Y1OA 2VDRB 2BKEA 1RHMA 3R0JA 4XASA 1M75A 1VLQA 1ECFA 2D5LA 3KUKA 3OZRA 3ZD7A 4TRJA 4AROA 3P20A 2JVKA 2A5GA 1FPMA 1GARA 2FW7A 4K0RA 4LNHA 3R4VA 4GT1A 2EW8A 4JNCA 3MMZA 4BKMA 3ZE1B 4K81B 3QKWA 4C5AA 3ADPA 3ZNPA 3O8RA 2GYVA 4MWBA 1SZDA 3AO0B 3COWA 1IRIA 3A1VA 4QM7A 1N6HA 3QBTA 5DLDA 1E5XA 3L01A 1D6SA 2W48A 1LFAA 1IOZA 4Y2GA 4GI2A 3RUIA 3FPKA 1Z6XA 3D8TA 2C04A 2P27A 4XW2A 3VRHA 4JZYA 1D5WA 2V55B 5I8PA 2MYPA 2X2OA 5A03A 1UBFA 4HQOA 3S27A 1G2PA 3FYCA 4JBWA 4ZAVA 4KV9A 3KUUA 5JNSA 4KPEC 2BUBA 3K70D 3PHBE 3OQOA 1JWAB 2BL4A 2YDYA 3DMYA 1ZIPA 4FYMA 1GPKA 3K05A 4TKLA 2CLIB 5BSTA 1M2EA 4YROA 4GBED 2A33A 4URYR 1Q20A 3IPCA 2PH1A 4IDFA 4UNIA 5HJEA 2VK2A 3U40A 5TIIA 1DKMA 2JI9A 2I2DA 4R1MA 3WDKA 1LDGA 4DDVA 2Z3VA 1YJ8A 1IQPA 3A27A 5KCMA 4GU5A 1ECGA 2W7TA 4HWOA 3H5TA 1QJ4A 2FWRA 4Q4JB 3DVQX 4HRXA 2J9YB 3WL3A 3BM5A 5AXBA 1H0HA 1I2AA 5H02A 3L8ZA 2ID4A 1UOPA 4BNUA 4NE2A 3GF4A 3W6ZA 3QRWA 2W6PA 4DYHA 4REMA 4LF8B 4AF7A 2GX6A 3N2GA 1EM8A 4EKIA 3RJ9A 3ZY5A 5A5GA 2BMWA 2JIMA 3SQMA 3UGQA 5MFPA 4R8RA 1J06A 1IUPA 4UNQA 1C41A 2J85A 3H1TA 1Q0SA 4Z0NA 1KO8A 2XZOA 1KA9H 2X9QA 1NY6A 1WW3A 1PD0A 5D01A 4GVLA 3T5TA 2VEDA 3ZQ4A 4N5IX 1XXLA 2IYSA 2H2WA 3OZXA 1U1GA 1T6YA 2J07A 1M2WA 1YFKA 1EHYA 1DBIA 1IZ7A 1CV2A 2FI1A 4X94A 3LDAA 1Z4PX 3GUUA 1WQ3A 3DHNA 4Q7LA 4K6FA 3KFLA 1R74A 1RFLA 1L5LA 1TJYA 3E27A 1QLJA 3H97A 2QMEA 4E5YA 2C4UA 2R25B 3D2AA 4G9BA 4HDQB 3EIWA 1P1CA 4BX0A 1WR8A 5ALTA 4ML3A 4WK4B 2J59A 4O4IA 5FA5A 4G97A 4QX6A 1XEAA 3T3HA 3KAJA 4NXMB 2P9ZA 2P1ZA 1PR9A 3NU1A 2ZANA 1KJ8A 1X1SA 3PLAE 5L40A 1A2BA 1XZNA 2FP4A 4CODB 5BY2A 5DKFA 2JD1A 3OZIA 1T8WA 2WKRA 3CF4G 3NS7A 2MTBA 2CDCA 2CDBA 2ZETA 4PLFA 3OEED 1NC1A 4B3TB 5L3RA 3HA3A 1K7FB 1DIBA 2B99A 4LJ8A 1VZ2A 2FZWA 2VHVA 4LJAA 4MDEA 3BMCA 4KYUA 4MO9A 2ETXA 4NOLA 4AO7A 3NYRA 2EZ8A 3I8XA 4XM1A 3UXYA 2F62A 1T1JA 4LF6B 5GTDA 1UFVA 1MV5A 4C0BA 3NWBA 3CLSD 3MS4A 1K0UA 4ER6A 4DCSA 4ZOCA 3RUDA 1RC0A 1GYRA 1CUFA 1H2AS 3JWGA 1T6BY 2V6IA 3HXQA 1I4DD 3MCWA 1N4AA 1J1ZA 2FOXA 3HL0A 5AVOA 4R68A 1VSUA 4LYHA 1X8KA 2NO4A 2ZE5A 4J90A 2HLDD 3WQHA 4B7ZA 2GESA 3ICOA 1N1MA 1RYMA 5D3KA 3RDPA 4QXRA 4NQZA 4ZVTA 3I64A 1SVWA 3ZXUB 4B31A 3D8NA 4J7CA 4GUAA 1TTTA 4CFYA 3A4NA 4CM9A 3LBNA 4RWZA 4P93A 4LJYA 1WUYA 5K4HA 4TWAA 2KBEA 1VLVA 4Z0TA 3WE7A 5D3QA 5H70A 3TFQA 3DNFA 1FDSA 1ECLA 4FSXA 4CM8B 4ZEWA 4PE5B 4N7MA 4HC4A 3R5HA 1DAGA 1UH5A 2ID8A 2P7HA 1JDNA 2GZAA 2TMDA 4EQZA 2BKUA 5KB3A 2I4LA 2PRSA 4L27A 1S02A 1P0FA 3ZHBA 2NVBA 4C05A 3IIEA 4UEKA 4IHKA 3IPRA 1JG4A 1OGYA 3DV9A 5HZMA 4MO2A 4YFVA 2ZBRA 1WA5A 2FSFA 1C9JA 5CJJA 3TL6A 3W8FA 1HZZC 3AHIA 4M8IA 3WFJA 3WNDA 3HDYA 1L1EA 3NIGB 1ZYUA 4ZT6A 3UJAA 2Q2OA 1KDOA 4OP3A 2RSLA 2ZSAA 3TIFA 1NJSA 1QIMA 4X65B 4MS1A 1D4ZA 4YRBA 3RC7A 2G63A 2LGJA 2XQGA 5ENZA 2VDJA 2X19A 2TMYA 1RWQA 1A9RA 2OG1A 1AURA 1U2RA 3TRJA 3R3YA 1DJPA 4NOKA 1H2XA 1OW3B 4RJKA 5C1OA 8AT1A 1LVUA 3LFUA 1T9DA 2P5YA 3QVTA 1M2VB 2GKGA 1UBMS 4R1PA 5G2OA 5JZ9A 4FTWA 2QGNA 5EN4A 3A3OA 1YS7A 2XWPA 4QGBA 5DM4A 1OI3A 2DLNA 4ZVNA 1BOFA 1VJDA 1YUMA 2VHTA 1LCIA 2QLTA 4HN2A 2WG0A 2BY4A 2O3QA 3UWOA 4Q3KA 1X70A 4DIDA 5C5DA 1N6KA 2XF8A 2RFLA 1BWPA 4JLNA 3OIGA 4HFJA 3E9YA 4COOA 1JJBA 5HIIA 4EEZA 3RC1A 1D0SA 5M34A 4MGEA 4GHWA 3H2KA 2EKLA 3Q11A 2OWDA 7REQA 1KVUA 1LC0A 1X3LA 5F21A 3HZZA 3PT9A 4BQPA 4C4OA 5BMOA 4P4TA 3Q7QA 3U4HA 3GARA 2WIDA 3KHSA 5JS7A 2A58A 5KYVA 4N3GA 1AU9A 5AK6A 5JEDA 3I1YA 4HTFA 3FPCA 4DV6B 2B94A 5T8KA 2H18A 4MAAA 3DE6X 2BEJA 4IL5A 2J4CA 5JFGA 1GFZA 2A5JA 3ROMA 1X7HA 5I7AA 1ODKA 4RY0A 1OIXA 1SCUA 3NOXA 4UUAA 5AW3A 2NX2A 4B6QA 1TJ5A 2DUWA 1GRQA 4MVJI 5AW0A 1J39A 2D06A 1UDBA 4W82A 4Z3DA 1AS2A 2EHJA 2Q1WA 4CTNA 2OESA 4ZI7B 5LNK1 2IE8A 3QBEA 4MNTA 3BWEA 2WYOA 4ZU6X 1KOJA 3RYIB 1KZ4A 2FPSA 1RLUA 2HRBA 2VHQA 4P86A 3D3NA 3M3PA 2EQAA 4Q3AA 3ZWYA 5CFZA 2WB4A 3FOFC 1R8QA 1TDJA 3C4JA 2O9JA 4KN8A 2H2IA 2QX6A 3UOAB 4V1CI 3EVNA 3H5RA 1CUJA 5CFLA 4BWGA 1VHTA 4FGWA 1NP6A 2X14A 3K4QA 4P53A 4BO3A 1E9EA 3LSTA 4C3OB 4GOMD 1R0ZA 1TLFA 4EL5A 4CEHB 4HLUA 2XTZA 1F8GA 2RC5A 1CE8B 4IIHA 1IZ8A 5SY9A 4Q7MB 3EB9A 1M2GA 2CHEA 2GB4A 1O9HA 3OFNA 3A2KA 3M81A 1MPXA 1WUKS 1YB5A 3DHWC 1E58A 3JPYA 2JBAB 2PZMA 1PHRA 1R5BA 4MA0A 4PHTA 4JLUA 4JKIA 1MABA 3RYHB 2O8FB 4N18A 2IW1A 3TRKA 4RTSA 2IU6A 1QOQB 2FPGB 3R6WA 4EI9A 1QS0A 1GNQA 1DEKA 3GFTA 4ROTA 1PI3A 1P19A 5AXCA 3TIIA 2PGAA 3NVKI 3FPGA 4NENA 4R2WA 5FNVB 2KPOA 5JUWA 4HT3B 3FMFA 4RU1A 4NEHB 2PT9A 2PU5A 2B37A 2XTAA 3LUCA 3Q40A 4L75A 4F2WA 5JTUA 1ZJWA 4X95A 3DDSA 4TMVA 4Z0HO 121PA 2IA5A 1H42A 3SE7A 5AT1A 4MVJM 2IUYA 4I1OA 3WDLA 3QYAA 1SHZA 2G9ZA 1YJAA 3DCJA 3PHJA 1OB2A 1K5GA 5FORA 4D9EA 1TQ4A 1Q74A 2X7JA 3QWBA 1O89A 2A92A 3R0QA 4RPHA 5HIJA 4E7OA 1EUQA 4X6XA 3TUZC 3TUIC 3GNTA 3CVOA 5CXUA 5BYAA 1YZGA 4MGHA 2P9EA 3L0ZA 4RXTA 2PCLA 3NKVA 1KK3A 3OWOA 4CQMD 4L0MA 3OTGA 2L0XA 3LY9A 4BQRA 5JSFA 4FFBA 2YUTA 1U0SY 1LX7A 1B6TA 3FFTA 2PSDA 4AIRA 3UQYS 4IQ4A 2O3TA 5EE9A 2QG4A 3BBPA 3CPSA 2FUCA 1CCWA 3B3AA 4NJEA 2IV3A 3T3DA 3EVBA 1F4LA 2H1RA 2ZRDA 1GKYA 4OF4A 3HZOA 1G5RA 1FXUA 1PHPA 2H4WA 5DXFA 4A23A 5EHZA 3MMNA 4YXWD 2VTKA 1HLFA 3H5LA 1E1RD 2VAWA 1S8OA 5ES4B 5IZCA 3IAS6 2EP5A 2PWZA 3L4BA 9ATCA 1V26A 3KEOA 4KYTA 5IKEA 1G21E 1SVUA 5WRFA 4MX8A 1OI4A 1UXGA 2EXXA 1KVQA 3MA0A 3AKEA 5HQJA 1FTNA 3I73A 3MXTA 2VYNA 4ZVOA 1ZSVA 3PENA 4P98A 4X7PA 2V3WA 2WD7B 4A2WA 2BFFA 4E21A 3NQ41 3ES9A 1EE2A 3O9MA 2A9QA 5ALZA 1EG2A 1ZFNA 2PSSA 1V25A 4ND5A 4DXHA 1LS1A 1Y0BA 5KS2A 5G3ZA 1SVIA 2HAEA 3VAYA 3ZK9A 4ZOLA 5ALGA 2WILA 4RKEA 3LT0A 3N6RA 3N5CA 5KWVA 1XZGA 4O63O 3D0QA 4LJKA 2QL6A 4PZUA 4RMHA 5DM1A 1YI0A 1U94A 2QS9A 1DARA 2EFCB 4BQNA 1N5KA 3T54A 2BLNA 3OM9A 2VJLA 2QMYA 3OZGA 4PXAA 4Z2YA 3K8YA 4HH0A 3WL5A 4Z7NB 2M1XA 1Z8NA 2DYKA 4JL5A 4R83A 4FFSA 4N47A 3RRFA 3E3MA 1W87A 3V1YA 3BMOA 1M74A 1UKEA 2N46A 2RK4A 4MJ7A 3O93A 3W5BA 4OI4A 3SEZA 1ZH2A 3OOSA 1TKAA 4U2CA 1CR2A 1T6NA 3HNOA 1IE3A 2P77A 1IK4A 2CMKA 4AJOA 3PGKA 4BJ6A 3GXOA 1URPA 1L1QA 4OQXA 4FD2A 5ER6A 2W6JA 1NU6A 1N32B 1T25A 2A5FA 3SIRA 1YS9A 5D87A 4HNSA 2C42A 1VJ5A 4P6VF 1JFRA 2PX8A 1AKUA 3S29A 1F8YA 3LY5A 5MGBA 1I6KA 4ARSA 1B15A 3QUAA 2PX5A 3RYFB 5U9CA 4AYTA 2C83A 1JT2A 4Z4GA 2C78A 2Y6UA 1IHDA 3ZQ6A 5EWMA 4EAQA 1BX3A 1P9LA 4ESOA 1KSHA 2VDQB 5BV8A 5AW4A 3LX8A 4QHSA 4GR9A 5L3SB 1L8XA 2HT1A 3DAFA 2DUUA 3BEOA 1QB8A 1HDIA 1FDWA 4KV7A 4Q4DA 2BEKA 1L7BA 4OB7A 2V74B 3O38A 3SLGA 1ZI8A 3FBWA 1UKAA 1LJ8A 1JZSA 1H93A 4YMSA 1LGYA 3QELA 5E4YA 1BQEA 4ETNA 2BV3A 2TRSB 4R3NA 1SUIA 2POQX 3LNCA 3RSFA 1O6CA 4X1IA 1Y6RA 2Z9BA 4LXTA 5K03A 4EJ2A 1FUEA 2G25A 4DRXB 3ZE8A 1KVSA 1JQBA 3MWGA 2I0FA 3ZJ5A 2P6NA 4B2YA 4EY3A 1Y5IA 5IM5A 4X3PA 5JD5A 2ILTA 2O2DA 1NMSA 2VG8A 5GP1A 1LI7A 3PTAA 1T2UA 1VB3A 2J48A 1XZLA 1LSUA 3GY0A 1U28C 2HKIA 3H4VA 1KSJA 1WLYA 4ROSA 5ICSA 3GLIE 2YJZA 8MHTA 4CM6A 3SDSA 3ZVRA 4DUPA 1Q17A 1WPGA 1QHSA 3A6PC 1XLTA 3VU9A 4GPAA 1FP2A 1WOYA 3BD7A 3NBZC 5CNKA 4BFUA 1Q7TA 1NUSA 1OXMA 5CLHA 3TRDA 1X7XA 3V55A 1X1TA 4K9MA 1DJQA 3TQCA 3H1GA 4AU1A 1MG0A 1WJGA 4NCNA 5JH7F 2CJFA 3AIKA 1NAIA 4MUNA 5EZ6B 1GNPA 2C7GA 3I04A 3M4NA 3MJVA 3VHXA 3EWIA 3WDSA 2R65A 1EJ2A 1K6JA 3CVJA 3OCXA 3X1XA 4DCPA 2W2LA 3K5HA 3DEAA 4LZLA 5HFJA 4JHLA 4Z9XA 3IKTA 2PGNA 4BMOB 3NT4A 4WK2B 5DHPA 3T41A 3GG2A 3LQQA 1TC1A 3IMGA 5JVDB 4QLBA 5DBHX 3PPIA 5T5QA 4CM3A 1K27A 1Q83A 2JEYA 3ASUA 5M04A 1GZ3A 1WW8A 3IJEB 2ECPA 2FKAA 5DO9A 1V11B 2PZAA 2JFUA 4BATA 2XOEA 1V45E 1R6DA 5EE1A 3C3EA 3KYCA 1RJDA 3T7CA 2HEIA 3MWEB 1F60A 3MJSA 4FILA 1HSZA 4DV1B 2QZPA 4D79A 1BXZA 1NTRA 3GLRA 1JQEA 5B1HA 1TKCA 2OGTA 3MBIA 1RJWA 2PXCA 1HNNA 1ISMA 4ZI7F 1DFGA 2WAMA 1QZ3A 2OG2A 2YWCA 3E8MA 3VZRA 5CEEA 2G1PA 1L7EA 3DEHA 2O3UA 2D5BA 4JITA 1G6OA 5FTJA 1QYDA 1MJNA 2GJ4A 2W9XA 5FPTA 1C0IA 4H4CA 1GADO 2YN4A 3GVCA 3KWMA 3NP7A 2C98A 3G0CA 5AUPB 4TWIA 4ZANA 3T7TA 5JATA 2C5GA 2DE0X 4ZMSA 3FXAA 4GGMX 2GM5A 1O1YA 3C6ZA 3VNAA 3W2FA 3EVAA 3T9AA 1CUGA 1JDPA 1P81A 1R37A 4GXTA 4BX3A 4CN9A 5LMCA 2SCUB 4HAWA 1P6QA 2Z3WA 4MW1A 2C99A 5J9FA 3HQ4O 3VUFA 4TS3A 5ICCA 2Q0SA 3L0YA 1PR2A 4JJZA 4OBEA 3SS9X 5HRCA 3QEKA 3S7ZA 2I4NA 3H0CA 1YRBA 2C03A 3A32A 3I1JA 2G40A 5I4BA 3F9CA 3QOYA 4IMPA 2GJ9A 4K8OA 4BZPA 2SECE 1VKNA 1SXJA 2C8LA 3EA5A 3TINA 4US1R 3VR4D 4EGCB 3C7TA 2PR7A 4PSUA 1QCDA 3ADDA 4JVSB 1KMHA 2FOLA 1X15A 3A1WA 3GFGA 5EHNA 2COUA 1H2RS 3FWNA 3OTQA 1W2HA 4N3NA 3RBZA 1Y8CA 2H2GA 2IBTA 2OCXA 4JGIA 3CT6A 3KM0A 5EQDA 1PZMA 5C2JB 5CITA 5JAUA 1PLKA 4XAQA 2JDID 1UMBB 3NETA 4MP6A 4Z2AA 4BKQA 1RPNA 2ZG6A 3OPQA 5KTNA 4NBRA 4IDGA 4R2MA 3FNQA 1T10A 5EGSA 1F51E 1FBTA 1EDBA 3OX3A 9LDTA 1L9XA 3FBTA 5MFZA 3DLHA 1N78A 5U4QA 3KV1A 3LIPA 3EZNA 4H77A 4D74A 1OI7A 4KXLA 2GEKA 2NAPA 1FNNA 4JT4A 1NV8A 1R9MA 1W5AA 2YCLA 4TRNA 2Z58A 4Y2QA 2JJ8A 3AF0A 2CLHB 3LQ1A 2CUZA 4OATA 1GU0A 3V48A 5FJIA 5K6TA 5K8UA 1PJ4A 1TTQB 2R6AA 3ELBA 3MELA 5JTTA 4C7OB 4CLOB 2C5EA 1NR7A 5IUNC 4B81A 1SK8A 2H63A 1EFVA 2WI8A 3X1ZA 4ER7A 5FUMA 4DTCA 1DKUA 4UDXX 2FPRA 2QAGA 5F7ZA 4HRAA 3KD2A 4S0ZA 4TLMB 5SYMA 2H2DA 3G7NA 4BU1A 1JH8A 1NSFA 2M9MA 1ZGZA 2HCTA 4UE2A 1P1HA 1XBTA 3KVVA 1PFGA 3EWSA 3L8YA 5JALA 3VZSA 2R1ZA 2UU9B 5FBZA 4NS4A 2D5CA 3WLPA 3CEJA 4PEVA 1FK8A 4H4DA 2RD2A 1N9GB 5DBOA 1FBNA 1J56A 1RHJA 2OFOA 3EE6A 3I92A 4NSNA 1L4KA 1SVSA 2ID7A 3EIEA 2Z2ZA 5HK9A 1E7QA 2OUIA 4E13A 3UQZA 3CGGA 3HU1A 4FYIA 2BJVA 1L4MA 2GUGA 3BIOA 3KBBA 3RC8A 4Y1RA 2ZM6B 3QVLA 3DZJA 4MA5A 1UBUS 3PXBA 4MVCA 3R7FA 3RBXA 3ZUGA 1UP6A 2NZYA 1NN1A 4HDAA 3HCOA 1R6VA 4ADSG 1B7GO 2V9CA 4TVOA 1KI7A 3ZU3A 3OLWA 1LWNA 3DBHB 2C77A 3L8EA 3SC3A 4JT8A 1ULZA 4ME6A 4IH1A 5EWLB 5C8YA 3OLVA 3UKDA 1A2KC 2OB2A 1VL8A 4OQQA 5AKLA 2FZKA 4UTNA 5K2MA 2QEQA 2NZVG 1XCPA 4B33A 2XYPA 3PC2A 3WIVA 2V7QA 1XYYA 4J4BA 4MINA 3MG9A 5JLAA 3BBLA 3HO8A 3E5RA 4X92A 2H9IA 2PT5A 1E3QA 2G9VA 4L4UA 1TB4A 3TTUA 2AL7A 3KC2A 4G67A 3C0KA 1E2QA 2R7KA 4UTXA 1W35A 4C4XA 3OUTA 1I2DA 3DZ8A 3PVCA 1E63A 1Y34E 5JSKA 3O4HA 4X1KA 4XWWA 1Z0KA 3L0DA 2VUSA 4UAUA 3BDVA 1Z62A 2Q50A 3KX2A 4RVHA 4WNAA 1GAWA 3K3PA 2O52A 2Y27A 4MI6A 4EKDA 2O8FA 1OFGA 2DP4E 1XI2A 4V3CA 1RM0A 3U7EB 5IFKA 3IE0A 4YMWA 4RULA 1Y1SA 4TWZA 4F38A 3KR1A 1YA8A 4Q9KA 2VFAA 2VQ6A 4YCAA 1OWMA 1VMKA 3MNFA 4R31A 4C6TB 2J9RA 7MHTA 1QGOA 4PZ9A 1U7PA 3PKIA 1GP2A 1E92A 2OA0A 5DNCA 4F5YA 1UMDB 2ZIWB 2ERCA 5JARA 1EVKA 3HDHA 5CIYA 4Z7QB 5JDIC 4GGPA 1VIAA 1PKXA 2RMKA 1F2TA 4KMMA 4MJLA 4O2AA 1EB8A 5YASA 5BVGA 4V1CB 1N3BA 2ST1A 1SC9A 4YJFB 1T34A 4D46A 4Z54A 4XEUA 3G6WA 3UT6A 5HQTA 1Z75A 3LGXA 2ZI4A 1MA0A 1V4BA 1KMIY 3HKDA 1USUA 1DKNA 1II8A 2P40A 4ETIA 2WM2A 2QTMA 2Y0PA 2RGNA 1IZZA 3PI6A 3PR3A 1OVMA 3VR5H 1BAPA 1I2ZA 1XMJA 3VVMA 3H9QA 3V4FA 1Q7EA 3AH8A 5EJ7A 2Q3JA 1N5OX 3B5EA 4OHMA 2VYFA 5DX0A 5CCEA 2IOYA 5CCXA 1OH5A 1MMFB 1A1VA 3FRIA 5BR4A 4EY7A 4DQKA 3BHMA 4WI1A 2V5UA 2V7EA 3B1FA 1NA5A 3LQFA 2WQ7A 3QE2A 3EZLA 2UVDA 1YZ3A 5K5EA 4TXLA 3FTCA 4YFYA 5J5VA 2I6QA 3E3LA 4TVSA 3ONEA 3GMDA 2J5QA 4HDMA 3IQFA 2NLOA 4J1QA 5E0KB 1M1NB 1DC7A 2ZJ6A 3K20A 3PD1A 3CUYA 4DLRA 1U8EA 4Z49A 4R1SA 2A8YA 4A27A 4C4ZA 5L9AA 4BIIA 4ITUA 4F60A 3TAXA 4JLJA 3Q1LA 5JVDF 2H54A 5ICFA 1FVOA 1OF1A 1OA0A 4ID3A 1G19A 4ZGBA 4WXPA 2ZR0A 4OMUA 1RCTE 5AW6A 1DC4A 3GZ4A 3PVZA 3R76A 2GEVA 1T3HA 5CA0A 3QX3A 3WRVA 4LC9A 4OH7A 1ZK1A 2J8ZA 1C3OA 3K32A 3EF3A 4FPXA 5LYYA 3EIOA 2IYWA 3FD8A 2ZTLA 1LPMA 3WC4A 2R5FA 3INYA 2IX3A 4G9GA 2HLNA 1E7WA 4R9SA 3QVGA 1BCSB 3ZN2A 1Z4NA 2IXGA 3EZ7A 4LVNA 3DL4A 1EFUA 1V37A 2HRDA 1ZNYA 4UNSA 1UPBA 2EJUA 3IBYA 5E7JA 1E4OA 3N2IA 4F4HA 1G55A 1V5IA 1EWVA 1SVLA 2Q5HA 4I3FA 4IKPA 2HTEA 5EZYF 5THQA 4C2BA 1XRJA 1ZKMA 2ESRA 3OIDA 4XR9A 1RXYA 3ANLA 1SQ0A 3IBFA 3PB3A 3I12A 2XD9A 2OZEA 3V3TA 2NYVA 2ZRCA 4JLPA 2AC7A 5GQSA 4BB9A 1EH5A 1XN1A 1LNSA 4M54A 5G0VA 1U3TA 1EDDA 4TL6A 4DB4A 1FYXA 1RAHA 2FWJA 3BMQB 3R3ZA 4RPKA 2FG7C 4Y0NA 4ZI2A 5I3ZA 4KO3S 2VWQA 2O1XA 1CY1A 1T0PA 2BTQB 1LJLA 3WLRA 4P80A 2HJGA 3I4CA 1QCCA 3ESRA 3OCCA 1BVUA 2J0QA 4FHDA 1EFKA 1X1QA 1Y1QA 5BVHA 3PQFA 2WPDA 4AJ2A 1OU4A 4AJ9A 4F04A 5I8WA 1RRFA 1WMAA 2GOYA 2VHZA 3CG0A 3NBFA 4K3VA 2X4LA 3STWA 5EJEA 3NMUF 1JBEA 1NG1A 1U8YA 4HQFA 1TAGA 4YQYA 1J90A 4C20A 4LRUA 4HWRA 4YJ2B 4KG7A 5H5JA 3W8RA 4NAHA 5AOAA 1D2CA 3P9NA 3WGJA 1TJNA 2OEPA 1BOOA 1QM5A 3DZHA 4YA6A 1WO8A 4K9RA 2E6KA 4TZ6A 3AHCA 1CFZA 4IFEA 3LC2O 16PKA 4ND8B 1QGYA 2AFVA 2Q2VA 5DI3A 4XFJA 3WAKA 3BKXA 4AQ7A 3NHLA 1QHFA 1I33A 2O1SA 1A8SA 1YB4A 5FPQA 4I55A 4YVFA 2DUNA 3H2HA 3R77A 2X22A 4TSKA 5EJ9A 3M5PA 2UZ3A 1KEPA 1OXKB 2P1DA 1Z4IA 1IWOA 2WLTA 3D8BA 2C31A 3LYUA 1P5JA 4UM8B 1Z5NA 3WJ1A 1L7XA 1ETHA 5TJHA 4B71A 3U56A 2EWMA 3JZFA 3GGDA 3KCQA 4CF3A 4D4KA 1BS1A 2ONJA 2WJZB 1SU4A 1JA1A 3Q5EA 5TMDA 4RJJA 4X63A 5KX5B 1E8DA 1N2GA 3FKJA 3MPOA 1YB1A 1P7PA 2BFDB 3KAQA 3PUIA 4WPGA 4YRQA 3U7FB 1VG0B 1S3SA 3TX6A 2V4MA 2HHLA 4PG6A 2GEBA 1UXKA 1NXVA 4UU8A 4N5DA 3LL4A 4JJ4A 2OD7A 4W6ZA 3T9FA 2DY1A 4ND7A 5DXAA 5FWXB 3RC2A 4QATA 3T6KA 1RYDA 3AVTA 4L5YA 1F6WA 3MFQA 2Y1FA 1Y33E 5T3UA 4JDUA 3EJWA 1QP7A 3CT4A 3L77A 4KQCA 4NP6A 1VBMA 4BQIA 4UVGA 1AGPA 5HXAA 2GAIA 4RA6B 3KDPA 2WK1A 4PF1A 3MQ2A 1XPOA 2WHXA 4IDDA 3N0VA 3DTNA 1J0CA 3VZBA 4B3JA 4D44A 5E1DA 1ONBA 3B8HA 5I6DA 4URUR 1JLKA 2QAJA 2HTFA 2QV7A 4G5RA 4QASA 4UZSA 2I6XA 4XJTA 3BJZA 2MSWA 1WDTA 3VYUB 3DYBA 4S05A 4GZ5A 3UFXA 1ZXXA 5A4JA 3NDIA 4C0SA 4IV8A 1HL7A 2F43A 3FJOA 4KIJA 3MOGA 3RKSA 1HE1C 2BCEA 4DV7B 4D4LA 2CLEB 4GL4A 1UOQA 1JHMA 1P91A 2PKQO 4L5CA 5ARDA 2R96A 2PDAA 1V9LA 3L5OA 2WG2A 4OHZA 3WLNA 4B75A 1XZCA 1BTOA 4HVCA 3B7WA 4F46A 3D59A 4S2UA 3OQHA 4EM6A 1WKVA 1UAAA 3BWMA 3K9GA 1U4OA 2WY2D 2QRPA 4L16A 1E3MA 3DQQA 1NNI1 1XLVA 3GGGA 3ETNA 1UC4B 3H11A 1SCNE 3WAJA 1ZD1A 1UKBA 3PHLA 3IHTA 1QR6A 2HUNA 2F55A 1NUQA 1SNYA 2A94A 4B9EA 3WKEA 1KEKA 3DKKA 1S1MA 3ET5A 3JRNA 2TMGA 1YBMA 3VPGA 4ZVMA 4RDXA 2ORYA 3EDOA 3HCNA 1O87A 1UQTA 2NU6A 4X0EA 4HQKA 2FQWA 3AOGA 1J4AA 1H5QA 1BQ3A 1LPSA 1PVDA 4UVEA 1JTFA 1ORRA 3RRBA 1VPWA 4WA7A 4WWHA 4RETA 3WGLA 3TDKA 3FKSA 4FIDA 2ACVA 2G7ZA 2HMTA 1EXDA 4XQGA 3N2GB 1TA4A 2FFAA 3FVTA 3UCXA 3OCZA 4L2IA 1EM8B 2FEMA 1QE0A 5EL0A 4D0SA 2ZUSA 3GC6A 1EWRA 2C4TA 1J07A 2KX7A 3IT0A 4H3SA 1YDEA 4P36A 2GXAA 4DBLE 4J9UE 2C4VA 5C4GB 1OBHA 3KQOA 4FMCB 1AB5A 3QWFA 1JDJA 2I62A 4II7A 1DIGA 1JQDA 2V5AA 4C0AC 2A2ZA 1J25A 4PU0A 1O6FA 1YZLA 1Y4ZA 2I67A 1AX9A 2DF8A 2CUKA 4II2A 3VVCA 1R66A 3CEAA 4MVJF 2ZI9A 3CH7A 3HPQA 5HFNA 5AM3A 4IJ5A 1KYYA 1YZTA 2PUCA 2C54A 1T2NA 1NI4A 4KYVA 4MCHA 2OTCA 5ITWA 3LC1O 3TXAA 3I04M 1VSQA 4ZAXA 4V0QA 4QWWA 2DFNA 1HEYA 2QDKA 1DSSG 1JQ5A 1L5ZA 1P39A 2OO5C 4UUQA 2RJ3A 2HJHA 1E32A 1I36A 2PRIA 4H1TA 5AKGA 5C7YA 5AM4A 3KOUA 1Q1BA 4WFKA 1FFDA 2YJ6A 5AM2A 3AP3A 3AM4A 1E1MA 2FP4B 1HMPA 2O0JA 3I1FA 3CUSA 3LCCA 2XNSA 4UULA 1DIAA 4WBNB 2CF5A 3C70A 3FSRA 4JC4A 4RAOA 4D97A 3NI2A 3GUZA 3ESBA 3JW8A 2I5PO 4PNZA 3AEQA 1ZBDA 5DF1A 5JNTA 3OA0A 4G01B 4BEBA 4X1OA 3CPEA 4YTEA 1HBJA 3TNLA 1EI9A 2WKSA 3BMCB 1KK1A 3KEFA 1YCFA 3CBQA 2J0UA 3NNNA 3GP8A 1ISHA 1C30A 4AECA 1M2KA 2Y1XA 3WBBA 4HNQA 3H9JA 2QD4A 4GMXA 5JJBA 5KC8A 4L5JA 1V8BA 3NALA 3DWIA 1ND5A 3NW9A 4IS3A 1M83A 3RR2A 3DHVA 2XJ9A 3GZNA 1YU6A 2O6HA 3X1DA 4D4HA 5A5VA 1KZGB 1QFSA 3BIXA 3MJFA 4XVCA 1Z34A 3LH5A 3UA3A 4L5IA 2RAFA 3INTA 2IW3A 4N40A 1Z63A 1HDGO 1EGHA 4FDUA 3GXBA 1FMLA 5LVAA 2DOKA 1FTYA 2W93A 4Z51A 1J2UA 3B1ZA 5A9RA 2M6RA 2V0NA 4KZPA 2B1JA 1GZVA 3B48A 1MR3F 3UW3A 4GQIA 5FI5A 1Z39A 4F2DA 4MLDA 4XYGA 4ZALA 4KDCA 2XMPA 3F8TA 1HYBA 4X44A 4YRPA 2CXSA 4OXKA 5E38A 1BVHA 1KIMA 1IBRA 1ZU5A 1SKMA 3OEHA 2WWVD 2I2CA 1W96A 2G4VA 4C08A 3MTDA 4DB2A 3PIDA 4CKEA 2ZB7A 3MXOA 2J9FB 1Y8AA 1JPJA 1TPYA 2MOKA 1SC3A 3OKAA 1WB6A 3PU6A 1WMSA 1XRQA 3LWBA 4WMLA 2Q49A 4P5PA 1VKOA 4ZT2A 1K3FA 1SQFA 2FSIA 4GQAA 3FFXA 4DR7B 5FO0A 4RAQA 5HW0A 5JJ5A 3AIIA 5ALVA 3DEJA 1MB4A 2I2WA 3LCUA 4GSYA 5BW6B 4M49A 2LTAA 4BLSA 1RXWA 5IUKC 5HS4A 1SBQA 1XVIA 4KQKA 3LO8A 1N5MA 4N82A 1AIPA 4IFBA 1JG1A 2J4DA 5TPWA 3VC1A 1NFFA 1ODLA 4PYQA 4OKNA 3N07A 1EP3B 3GEHA 2ZM5A 2CMFA 1Z0SA 5CGZA 4LRWA 3H3FA 3DOCA 1QU2A 1IEQA 1QHYA 2XVAA 4BUZA 5KYXA 3E2MA 1XEWX 4MS1B 3AUKA 1YHNA 2VK4A 3DQPA 4GM4A 4RD0A 5T64A 4BNGA 1NUHA 4C89A 5KSYA 1W44A 3R5SA 1JSCA 1Q21A 1PDOA 1RXUA 4JR2A 3GRUA 2IZ6A 2I4OA 2RG7A 3NBKA 4MR8A 4DLWA 3G8DA 1PTKA 3KB8A 2J9GA 3KELA 1Z4LA 4OEHA 3ADKA 4I4IA 1PQWA 1XTRA 2CMDA 2HFKA 4LWZA 4YJ2F 1L7QA 4YRLA 3ZTWA 1U2TA 4GNKA 1XMPA 3GLHE 3QITA 5J2UA 1DQNA 2P6MA 4DUGD 1P44A 2ZPUA 3FZEA 4HZUA 3IMFA 2ZXUA 2C82A 3C41J 1PTJA 4F45A 5KYUA 4AMYA 2YV2A 1Q16A 2PANA 4TL7A 1HDXA 2AT1A 2NYUA 3PXAA 3IAEA 2VT2A 4I9FA 4PAMA 3CW9A 4LQDA 3RF6A 1P6UA 3CEHA 1QB7A 3M3DA 3K6KA 4MA4A 4H6XA 1KXZA 4FGKA 2GPBA 1ZGAA 2W6ID 2X2FA 3HH8A 3A28A 3QKUA 2B0CA 4UM5A 1QHHA 2V54A 2YIJA 3Q4GA 2O8EB 2Z2YA 5BWOA 3KR9A 2NTJA 3PYMA 5CB8A 3MS2A 3IGFA 4XOUA 1SCUB 5KVAA 4P54A 2AVDA 3AVYA 1PJZA 5G4KA 2OAEA 5U1PA 4OCZA 4UVDA 1WRBA 3P0EA 3TNYA 5FFNA 3C3JA 4YAGA 1VE3A 3QFSA 3TB6A 2FWPA 4PZCA 4WESA 3JR7A 2ZBGA 2ZTHA 2VRWA 3NPMA 5A4MS 5CBPB 3ZGOA 1U9IA 1NKTA 3JARB 5IDYA 3MTBA 4DNXA 1A7AA 1KP9A 1SUWA 3O3CA 2XTNA 3T4UA 2XH8A 3X1YA 3DM5A 2F8MA 3WSWA 3F5DA 1EHCA 4O5AA 3EGWA 3FI0A 1ZPDA 3D6FA 2DM6A 5DK6A 4AKTA 4XWAA 3TZEA 2IHVA 2CBXA 4RSRA 4E33A 1UWVA 2DCUA 1CZUA 4I6JA 1PUIA 1Z88A 3Q98A 3RSZA 7MDHA 3K0FA 4WY8A 1NFRA 2I2AA 3HYRA 3EULA 3FSEA 4M8SA 1UWLA 2D4AA 2HK6A 4K1LA 4EG1A 1E3EA 1NWCA 1EP9A 1MABB 1ZSNA 2I1LA 3ZEAA 4JBYA 2YXDA 4BFWA 4NZZA 1VIVA 1NVUQ 5DCYA 5DM70 2DU8A 1XHFA 1C7IA 2H7CA 3MWJA 1PEDA 1ABFA 2IXDA 2RH8A 3DXZA 3Q7EA 2HIGA 1FU7A 3TW4A 4DVJA 2FPKA 4P2BA 2HYDA 3MB5A 2DB3A 3O4JA 2QZZA 4MYDA 4NENB 1FJ2A 3RHSA 3ZHSA 4BO2A 4M7RA 4R41A 5C5CA 1U2GA 5J2TA 3THRA 3MSXA 3PGA1 1IXZA 2QXTA 3HZRA 4XIYA 1CUCA 2DH5A 2VHUA 3A37A 4FR5A 3T7AA 3UAOA 1R4ZA 1EK5A 1Y4DE 4TYQA 1V7QA 2NW6A 1AG9A 1YUNA 3V4SA 1YTLA 3SOPA 3AWIA 3L6RA 3TTSA 3V7NA 1AF4A 1M1ZA 1QIJA 3C5VA 5EVCA 1JQAA 2BFOA 1Y5NA 3IJPA 1VJRA 3K09C 3PUVA 4FP9A 4XUDA 4CG1A 2OQRA 3LPCA 5GJVC 4AXXA 3E15A 5TSDA 4N12A 4GYWA 5ARBA 2B4YA 5FPPA 1MQ9A 4H4EA 1GL3A 1YCHA 2EKPA 2G0NA 1DQYA 1YNOA 4FFBB 1COWA 8ABPA 1T4CA 2W2NA 4JC5A 3C16C 4R40A 3RYTC 3ZYZA 3M34A 4IJKA 2BI7A 1ZOSA 1YCDA 3JQAA 4BV9A 2CL5A 3JZIA 4IRMA 4NJEB 4HBZA 2VA9A 4IOJA 2AG6A 2J32A 2YZ2A 4FI3F 4M7OA 1Q7CA 2BM9A 2WE7A 5F7JA 2JJ2A 1C9DB 1NXXA 3BFXA 1A2QA 1JF8A 3VOAA 1RLTA 4GZ3A 5THXA 2R79A 4MKIA 4DG8A 2GLXA 1APBA 3OJCA 2WZQA 2QX8A 2ZJ3A 4KRXA 2R9VA 3W2GA 3H5WA 3WHLA 2L2QA 3L7OA 2KHZA 2X2PA 3I2GA 1Y3AA 2G28A 2QQEA 1BH2A 2Q5IA 4GRAA 4I7EA 1N2XA 1P3DA 3MD9A 3A26A 4QT4A 4OFZA 1C8KA 2OZVA 4O4IF 1OZ0A 2JAPA 3QUQA 3UW1A 3PUJA 3WYGA 3ESYA 5DNDA 1ORHA 2D0DA 1A5AB 2ZOSA 3OQIA 4DC0A 2KS6A 3HXMA 3K96A 1GL6A 1NVXQ 1SC1A 1VJTA 1NVKA 1WEKA 4MV7A 1ZD9A 7GPBA 2F8TA 4UAJA 2UYQA 2AOXA 5C0OE 4ZI3A 1F9AA 4HDNA 4J16C 4ZOLB 3A1CA 4GC5A 4XWOA 4M1MA 1G9TA 4UTOA 5A0TA 4DDTA 1RZRA 2CDRA 2XMCA 2WA1A 2OQIA 2VSFA 2FFQA 4EF5A 3JQGA 2QDXA 3D31A 4FKBA 3SEQA 3AVVA 4LRSB 3JRWA 2OCLA 1FSPA 5BQ5A 2XOKA 3LAWA 3BMOB 4RH1A 2JGAA 1Y1LA 1RP1A 4RELA 5FD8A 2BEWA 1WBDA 1EFPA 3AP2A 3HRKA 4WE3A 4JLDA 1Z5UA 1E5DA 5F3WB 1W88A 5JMWA 3C1UA 4PO9A 2ZIZA 2NV6A 1SVKA 1JSXA 1W94A 2WHRA 2ZU0C 3ANXA 4LHEA 3LQKA 3ROTA 4D80A 4EO4A 4EYOA 1NNLA 2J08A 4RCVA 3PEVA 2EFEB 1AQUA 1PW7A 1YS6A 3LUBA 3RTAA 3ZJUA 3L3BA 1T13A 3ME5A 2PL9A 2VYCA 3SYNA 1RW4A 4D9NA 3TCXB 1QONA 1SUCA 1QU3A 3EGOA 2AXQA 3RREA 5GV8A 4HVLA 4HZIA 3GLKA 3VKWA 4ILKA 4TUYA 3K71B 1CUDA 4KHZA 2ZRNA 1YJQA 5HM8A 2F4NA 4ITRC 2E6UX 1HF3A 1X7WB 2Q07A 1A72A 3A2NA 5EWMB 3ZI7A 4EB6B 3FHOA 3KFXA 1UPXA 4ICIA 1HT3A 2YXLA 4C78A 2JJQA 4E1VA 3VYVA 4ZQEA 1B26A 2H59A 3PDUA 4KP7A 2H3EA 3AEXA 1AQIA 4V2UA 2FEWB 4ZT3A 3AEUA 4AULA 5LP6A 3K2QA 4JX9A 5MN6A 1S01A 3K9NA 3NC4A