3EGIA

Methyltransferase domain of human trimethylguanosine synthase tgs1 bound to m7gpppa (inactive form)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
200
structure length
195
Chain Sequence
b'PLGSRLFSRFDDGIKLDREGWFSVTPEKIAEHIAGRVSQSFKCDVVVDAFCGVGGNTIQFALTGMRVIAIDIDPVKIALARNNAEVYGIADKIEFICGDFLLLASFLKADVVFLSPPWATAETFDIRTMMSPDGFEIFRLSKKITNNIVYFLPRNADIDQVASLAGPGGQVEIEQNFLNNKLKTITAYFGDLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Trimethylguanosine synthase homolog
publication title Structure analysis of the conserved methyltransferase domain of human trimethylguanosine synthase TGS1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 66
structure length 195
sequence length 200
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.-:
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09445 Methyltransf_15 RNA cap guanine-N2 methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3egiA00
3FTFA 4IV8A 1R8YA 1KR5A 2B25A 3K0BA 1F38A 1X1CA 2PSSA 3R9XB 3MHTA 1P1BA 2B9EA 3TRKA 5F2NA 4QQKA 3PX2A 1INLA 5DSTA 3UJAA 3DLIA 4PCLA 3FTCA 5EMJA 3P2EA 3SXJA 5DTRA 3VYWA 3A7DA 3UJBA 2R6ZA 1KPHA 1M6EX 2BR3A 3HEMA 1KHHA 1XDZA 3LBFA 5FADA 9MHTA 1VIDA 1TW3A 3DH0A 3DMGA 3KHKA 4DCGA 3LECA 3OCJA 3FUWA 4EKGA 1JG2A 2AOUA 3I9FA 1BHJA 1RI1A 4AX8A 2FK7A 4YUVA 3EVDA 2OKCA 4GOMD 4EKIA 5K8VA 1QYRA 5FA8A 3KPJA 1UWVA 3LCCA 4FP9A 2OB1A 2P1DA 4P7KA 5CVUA 1KXZA 4HSGA 5HZMA 2EG5A 2Z6UA 5GM2A 5FQNA 4X60A 2OZVA 2PXXA 2AOUB 5EG5A 2PX4A 3EPPA 4PNEA 5HIKA 4PYLA 3RIEA 3CJRA 3NVMB 2GAFA 5FUBA 2PJDA 3GO4A 3HVIA 5KQRA 3LKDA 3UJCA 5EMKA 2HR1A 3GJYA 1X1AA 3OU2A 2OYRA 2BZGA 2JG3A 2O06A 3G8BA 2G70A 4ATNA 5CCXA 4OA5A 4GF5A 1PRYA 1SG9A 2B78A 2VZ9A 2IPXA 4OX9Y 2AN4A 2G8NA 3DXYA 1L3IA 2OB2A 3HA7A 1FP1D 3M4XA 2GA9A 2HNKA 4QVKA 2PXCA 3DMFA 1ORHA 2P35A 4UOEA 1X1DA 5CD1A 4RTKA 3MB5A 4GUAA 5GM1A 5FULA 1UIRA 3MGGA 1I1NA 3UBTA 1UFKA 4MQ4A 3KQWA 3C6KA 3EVFA 4C06A 4ER3A 4YUZA 1EG2A 2PT6A 3UFBA 3MAGA 3SGLA 2PWPA 1YFLA 1ORIA 4PIPA 4RTRA 3M70A 3NVKI 2ZBQA 5FHRA 3DUWA 3KR9A 3KQQA 5DM1A 5DLYA 3KPVA 2XVAA 4RVDA 2HV9A 5E2BA 2UYHA 2VS1A 5BW5A 2NXEA 5EIWA 2QRVB 1AV6A 2C7QA 1SKMA 5MHTA 1VBFA 4MHTA 3M6UA 4BP1A 3QV2A 3B89A 4CKEA 3ID6C 5BXYA 4A6DA 1G8AA 3FUUA 3G7UA 4DF3A 2IH4A 3C6MA 4X41A 4E2YA 4FT4A 5H02A 3OPNA 4GQBA 4RTNA 3O31A 1HMYA 2WA1A 2P8JA 2C7PA 4HH4A 3EVBA 3MCTA 3G5TA 4RYLA 4F85A 2H00A 1D2HA 2AVDA 1ZKDA 5EEGA 2PBFA 3U81A 3L8DA 3PTAA 1PJZA 2GH1A 8MHTA 2P3QA 3FTDA 3LDFA 3G2MA 3ELYA 2QM3A 3IYLW 4M7RA 3TOSA 3NDJA 4Z2YA 3SSMA 4PYJA 4YV1A 5K0BA 2ZCJA 3OE5A 1G60A 1G6Q1 5E2AA 3VSEA 5DX8A 1G8SA 3FTEA 2XYVA 1F3LA 3G2QA 3HCEA 4PYIA 1VQ1A 3PS9A 1N7JA 5E9WA 3FPHA 5FWDA 4C04A 4BLUA 2PWYA 3T7SA 2JJQA 3OU6A 1N7IA 2H1RA 1YUBA 2IFTA 2VDUE 3SR4A 1Z3CA 3SMQA 3C3YA 5K01A 5CM2Z 5KS2A 1BKYA 1RJDA 5EOVA 4PYOA 5EPEA 1XJ5A 2AR0A 2ZIEA 3R3HA 1WY7A 2EX4A 4WVLA 4E70A 3DR5A 3BGIA 3WSTA 1R74A 5LQCA 3PVCA 3GCZA 1EQAA 3T0IA 1P39A 1R18A 1I9GA 3G2PA 2HTEA 2ZIFA 4HTFA 3HVKA 4KW7A 3BUSA 3ELDA 3G5LA 3HCBA 4O29A 1U2ZA 3X0DA 4K6MA 2IIPA 2UYQA 2ONYA 4L7VA 3GNLA 4NECA 4X1OA 4Y2HA 3HCCA 4DM3A 2G71A 3DOUA 2NP6A 1M6YA 2Y1XA 5ICGA 3VC2A 2UYCA 3V8VA 1ZGAA 2PT9A 2ESRA 2AOTB 5GINE 4HTFB 2YTZA 3LSTA 4X61A 2FRXA 3FRHA 3GRVA 1SQFA 2PLWA 2HMYB 3FUXA 4X63A 1KYWA 1IY9A 1TPYA 5ERGB 5T67A 5BP7A 1NV9A 2QY6A 3HVJA 3KR2A 5DXAA 2ZTHA 2ZLBA 3G2OA 5DX1A 5GOZA 3KR0A 3JWHA 2ADMA 3EMDA 2WA2A 3EVCA 3NW9A 3P9NA 4OBXA 5EZSA 4PGGA 3NMUF 4P58A 1KP9A 4B17A 2YR0A 1XCLA 3EMBA 3HNRA 3MTEA 2UYOA 3KQMA 2OPBA 3ANXA 3LKZA 1VPTA 5E9JA 3OZRA 5HEKA 3LCUA 1JTFA 3BKXA 2Z6AA 4ISCA 5BW4A 5DM4A 2PVCA 4QTUB 3FUTA 2PXAA 4P7JA 5EVJA 2IGTA 1NBIA 3AJDA 5GP1A 5HIJA 4RTMA 2PV0A 3PFGA 3B7PA 4Y30A 1XVAA 4RTOA 1RI3A 3ORHA 3OE4A 2YXDA 3CBGA 3UWPA 3V97A 2PX5A 5DM2A 3CCFA 1XTPA 3FRIA 5ICEA 1R00A 3BGVA 3AXTA 3BZBA 3PB3A 4DKJA 2ZZMA 3TPZA 3TKYA 5C9ZA 4LWPA 1X19A 3EVAA 3NWEA 4OA8A 3UZUA 2C7RA 3AWIA 4C08A 1D2GA 5F2OA 2NNWB 3EVEA 10MHA 4HGYA 2IBSA 3BKWA 4FZVA 1YB2A 3SSNA 2KW5A 4BLVA 3O7WA 1RI5A 5T64A 4ZTBA 1XDSA 5HOQA 2JHCA 1JQDA 5LQAA 4KIGA 1ZQ9A 2EFJA 2YXEA 4GOND 2I62A 3SSOA 4AUKA 4F84A 5LQRA 5FCDA 2QRVA 1P1CA 4AZTA 4DCMA 3E23A 1RJGA 1Q0SA 2IP2A 1KPGA 1JSXA 5EMMA 5EHIA 3GRYA 2G1PA 3LHDA 4RX1A 5F2KA 5LSAA 4R8RA 3FYDA 5K05A 2ONZA 5K0CA 5DTMA 5K0FA 5E9QA 3BT7A 2QE6A 2ZFUA 2JHPA 3HM2A 5EC8A 2ORED 1O9HA 3UJ7A 4KVZA 2QYOA 5IH3A 2V7EA 5HILA 3KPWA 5D1NA 4KRGA 4QTTB 1N2XA 4RVHA 3I53A 4IV0A 1EAMA 3THRA 3GRZA 4M36A 5EZQA 3SX0A 2NXNA 3AY0A 1XXLA 3GRRA 3RW9A 3OZTA 4HRAA 4CTJA 2WK1A 3VC1A 4EMSA 1QZZA 5LQJA 4PINA 2CMGA 3MQ2A 5LR6A 4CXMA 2R3SA 4RTQA 1FBNA 1R6AA 3HCDA 3C3PA 1FJXA 2AZTA 4YV0A 1NW6A 4LECA 4AZWA 1QAMA 3KU1A 5KQSA 4ER0A 1L3BA 4RTPA 2FK8A 3HA5A 3KQPA 3TFWA 3B3FA 2Z6QA 2XVMA 4PWYA 4IWNA 2OY0A 1L1EA 3IHTA 4MIKA 4QQNA 3THSA 3TLJA 4PGHA 5K0LA 3TMAA 2AOVA 3TKAA 2P41A 5HIMA 4E2WA 4YUWA 2ZULA 3BWYA 4R6WA 1Y8CA 3EVGA 4R6XA 1SVUA 5ICCA 3LDUA 5D1HA 2EJUA 5JR3A 2OBFA 4RWZA 3TQSA 3DMHA 3LGAA 3PT9A 5DTQA 3IEIA 2CL5A 3K6RA 4A6EA 3FPJA 4QVGA 5E8JA 5DM0A 1NKVA 4YUYA 1NW8A 4R8SA 3UJ8A 1TW2A 3FZGA 4LG1A 4GC9A 3SVZA 2AN5A 2FCAA 3EGVA 2AOTA 3LX6A 2YX1A 3CC8A 3KQVA 3M6VA 1ZHFA 1JQEA 3CJQA 3EEYA 4HGZA 4RTJA 2XBMA 3UJDA 5DT2A 2BH2A 2YVLA 4XCXA 7MHTA 2O0LA 4KDCA 5EIFA 2IH2A 5CUQA 2F8LA 1NW3A 1KIAA 3KQOA 3GU3A 5K09A 2I9KA 1XDUA 3HCAA 4GEKA 4RSRA 4P7FA 1WG8A 2OO3A 5K0EA 4QPPA 3R6TA 1AQIA 3BGDA 3CJTA 3MTIA 4FSDA 5DWQA 5E1MA 4E32A 4DZRA 4BY9E 3DLCA 3KQTA 3P2IA 4ER6A 3E7PA 4POOA 1B42A 2AOXA 4MTLA 5CVDA 5LQUA 4C03A 3F4KA 3LPMA 2BM9A 3P9KA 4E2XA 5EQJB 2YQZA 5E1BA 2JHAA 3HTXA 1NE2A 5K0NA 4M37A 1DCTA 3P9CA 1FPQA 4PCAA 1SUIA 2IDJA 4GBED 4CKCA 5EEHA 4DQ0A 5KYGA 2NXJA 3UA4A 1SQGA 2GS9A 5C0OE 4EQZA 4EK9A 1Q0TA 3DULA 4MWZA 3FPEA 5GWXA 4JXJA 2BR4A 2GPYA 4U7TB 3LBYA 2ZBPA 1NT2A 1JSZA 1VP9A 2BM8A 3GIWA 3Q87B 3KPYA 5DXJA 3NJRA 3P97A 3A26A 3PX3A 3JWJA 1QAOA 1DL5A 3UJ6A 3EEOA 3JWGA 3GRUA 1O9GA 3CGGA 3NTVA 2AOWA 5KVAA 3M33A 4GOOD 2P3OA 5K0GA 1VP3A 2CKDA 3HP7A 1NW5A 3B3GA 3I64A 1D2CA 3UA3A 3LCVB 5P8WA 5IKMA 3G89A 1L3CA 1XCJA 1FP2A 2A14A 3R0QA 5DRTA 4PIMA 4RTLA 1O54A 1RJEA 4QDJA 3UJ9A 1AF7A 3T7RA 4AZSA 4C07A 4PYQA 4E30A 4ER7A 2E5WA 1OR8A 2EJTA 2FPOA 1R8XA 2P40A 2O57A 2ZSUA 4FR0A 4OQDA 1JTEA 3I58A 3TM5A 2ZWVA 5T6BA 3OU7A 2VP3A 1MJFA 1RI2A 5FTWA 4C05A 4XUDA 3P9IA 1X1BA 3IV6A 3KKZA 2JH9A 1YF3A 4DMGA 5FWAA 5HFJA 1SUSA 1NV8A 2ZIGA 2OXTA 1G38A 4U7PB 1IXKA 1DUSA 5K0JA 2P3LA 2XYRA 1BC5A 4P7GA 5LQKA 1I4WA 1RJFA 1MHTA 5EGSA 3FYCA 4RVGA 2YXLA 1WXXA 5E1DA 5HIIA 1QANA 3D2LA 2IBTA 5LQNA 2I6GA 2GLUA 3REOA 1YZ3A 4ER5A 1HNNA 3GXOA 2N47A 4BLWA 2O05A 3G88A 3CVOA 4XUEA 4RV9A 4YMGA 2AS0A 4GC5A 4WXHA 3A7EA 1T43A 2B2CA 3R24A 3M6XA 3MERA 3MCZA 3ME5A 1ZG3A 4FT2A 4CKBA 4OBWA 2Q41A 3PLAE 4IKPA 3EGEA 1ZGJA 2PKWA 4PYKA 4LWOA 2LD4A 4GOLD 3A27A 4HC4A 3DXZA 1V39A 5EKXA 2NYUA 5JUWA 5CCBA 2FHPA 3NWBA 3ER8A 1P91A 3TR6A 2O07A 1NW7A 5U4XA 2XYQA 2G72A 5EMLA 4F86A 4FGZA 2ZZNA 3HVHA 2VDVE 3Q7EA 4HG2A 3PFHA 4OQEA 4E33A 3P8ZA 3BWMA 2NXCA 5DSXA 5FHQA 3JWIA 3HA3A 3O4FA 3LL7A 3KQSA 5ICFA 2DULA 5C1IA 4YV2A 2ZZKA 3S68A 3I5UA 3OFJA 4E31A 3OZSA 2B3TA 1IM8A 3H2BA 5DRYA 4XUCA 2AN3A 3SM3A 2DPMA 2IDKA 3CKKA 3ELWA 5CVJA 5FA5A 5GIOE 5GIPE 4DA4A 1M0EA 2NP7A 1JR4A 4QPNA 3KPUA 3EVZA 3FPFA 3G8AA 4KIFA 4M38A 5CVEA 1RI4A 2V74B 4FS8A 2CMHA 4PYMA 4E2ZA 3GDHA 5EKUA 4CTKA 5DPMA 4QDKA 5E8RA 4BP3A 1EJ6A 2C7OA 4PONA 3T7TA 2JH8A 2ZW9A 1G55A 1KYZA 1VL5A 5B1SA 4C4AA 2ZWAA 3DP7A 3TM4A 4RTSA 1YZHA 4H0NA 3ER9A 2P7IA 5DX0A 4R05A 3KQYA 2PX8A 1AQJA 2CWWA 5E1OA 3FPGA 2IH5A 3P2KA 1NBHA 2Y1WA 3C0KA 1WXWA 2ERCA 3B5IA 3GWZA 5FQOA 1JQ3A 1VE3A 5G02A 4PYNA 2BR5A 5CVVA 2AVNA 4KDRA 1QAQA 5M5BA 3ELUA 3E05A 1H1DA 4CWAA 2PX2A 2K4MA 3A25A 4KWCA 5K03A 3E8SA 1EIZA 3AXSA 1JG1A 1KPIA 1VLMA 3HCFA 3M6WA 3B3JA 1YFJA 3BWCA 2VDWA 2YUIA 4FSXA 3FUVA 1JG3A 3QOXA 3ERCA 2FYTA 3DXXA 1WS6A 4AZVA 3GGDA 2PY6A 1BOOA 1JG4A 4V0RA 4V0QA 3EGIA 4YUXA 2PGXA 3BXOA 3QOWA 4RVFA 4YMHA 2HWKA 4EVIA 3OFKA 5CIYA 2H11A 2UZ4A 1L9KA 2I7CA 2ZVJA 3P71T 5EHGA 3NDIA 2P7HA 2ZBRA 3DTNA 1EJ0A 4G56A 2GB4A 3LDGA 3A4TA 1WZNA 3BWBA 3RODA 3KR1A
chains in the Genus database with same CATH superfamily
5DNEA 5CMLA 4AY3A 3F5DA 4IV8A 2JVKA 4MJLA 3U37A 4DA9A 1GDTA 1KZ9A 2DTXA 1FUKA 3S5UA 1PDOA 4TYNA 4MRVA 2AXPA 3CLTC 3WL5A 3AM1A 2YHIB 3TTUA 1TVMA 5EHNA 1QHEA 1VBNA 1OFGA 3V33A 1EA7A 4P08A 3SKXA 5ALKA 3V2IA 2B1GA 5I7OA 2GZ3A 3ICEA 1DCMA 1Z82A 1G291 3EWIA 4FC7A 4IGAA 5HPYB 1K3FA 4QYIA 621PA 2W8ZA 5FOWA 1E1LA 4G8DA 4MMXB 1A77A 4DCGA 2BHNA 2DU8A 1TT7A 5AOCA 4GU5A 4U7WA 4QX6A 5CNIA 1P75A 4YPVA 5F4ZA 1PS8A 4IMIB 2VDLB 4YK7A 3ZE6A 2CJWB 2LZ0A 3Q2OA 3F9IA 1RXUA 5KWVA 1S96A 1MTZA 3VPXA 3G79A 3I76A 4KFRA 5CU7A 1C3EA 2O3RA 3QUAA 5DGHA 2HHAA 1UJNA 2QZPA 3I6QA 3RE1A 1KDOA 3AGQA 5EESA 1XRQA 3M6LA 5T8KA 5IZCC 1U2DC 1AZLA 1XE3A 2GK6A 3K9FC 3QG5A 1KAMA 2W6ID 3K9HA 4HP8A 2ZIXB 2VJAA 3W3AA 3FCOA 3V1MA 4BV8A 5EIXA 4YAJA 3QEMB 1RQLA 2XMSA 3GPDG 3L0SA 2BBOA 5LYYA 1J8DA 2WHEA 2PZ8A 4B71A 4GZ6A 4K9SA 1VPLA 4FWIB 1VCIA 5DP1A 2V6BA 4ZAWA 1Q21A 2G8NA 4JUIA 1LBIA 3M4XA 5EIAA 5UKDA 3A58B 3WY9A 2OQ2A 1TAQA 1E61A 1UWKA 4BX0A 5CA1B 1Z17A 3LW8A 4NOMA 4WUVA 5EJFA 1MJ5A 3HVUA 3K8OE 1SC3A 3NATA 2FZWA 3N5KA 3AUTA 3CTPA 2CC2A 4R3UC 2H16A 3EIUA 4WZBE 1SOUA 2PWPA 2BEUB 2NVUA 4ALIA 1YFLA 2ZBQA 1W35A 4UXIA 3D1VA 1B8VA 1JLMA 3AB7A 4L8GA 4PSCA 3A11A 2C3MA 3CFYA 5E2BA 4AP5A 1U9YA 4BN4A 4FEEA 4OP3A 1AV6A 1S2DA 4G63A 5B1IA 3ZEAA 1N2OA 3PDHA 4CHGA 5K6TA 1SG6A 4D0GA 3K09C 3PPWA 3QHQA 1JLKA 1GPDG 4ARZB 2FQ1A 3QXSA 3SEFA 3V9AA 4X41A 3I3OA 3OEHD 4ZOEA 1B23P 1KBOA 1TTHA 4JC5A 3O31A 4PY2A 3ZNPA 1ZNYA 4RGYA 4P34A 4BNYA 3K0CA 3AKYA 4XQGA 3L82B 4H08A 3ZU6A 5KWIA 1JI0A 1OTYA 3UH1A 3VR5D 2JI8A 1CDDA 4JNCA 1R9NA 4LRWA 4PNZA 4LW8A 4F4DA 5AW8A 1EESA 2AVDA 5AVYA 3DPIA 3EQ8A 3IHKA 2XCRB 6Q21A 4YFYA 4M6WB 1Z34A 3FH0A 4BPBA 4FK8A 4EB6B 1TM4E 4UM9D 5EMNA 3D43A 4YQEA 2W11A 1UADA 1P2TA 1A4XA 3E03A 3G2QA 2OG1A 4ZIRA 4RHUA 4GW3A 1N7JA 3ND9A 3D8HA 1H2XA 2VRCA 3PQ6A 2BBWA 2VDUE 2VJYA 5HCUA 2IEZA 1L4MA 2QUBA 3WMFA 3HJBA 1T8SA 1YJAA 2HMSA 4GGPA 3GQBA 4X9XA 5REQB 1WY7A 4E70A 1G5RA 2WE8A 4PZ0A 1L5MA 4ABYA 4FXPA 1L7VC 4JYBA 4AQYB 4JI6B 3PF8A 4DS3A 3AFIA 2XX3A 1W4BA 2QYSA 2W2NA 4JJFA 3O0DA 4P3KA 1L5RA 2R4UA 2ZRMA 4Q82A 1LNQA 1MW8X 4FGWA 2JIRA 3SZUA 3RHFA 3K9BA 3MTQA 4K6MA 2FFJA 5B6IA 4KTTE 4X1OA 1G8FA 1MVLA 3HCCA 1DP4A 4Q37A 5IJZA 3U6KA 5KC9A 1DB3A 4KWTA 3UXMA 2ESRA 1D03A 3S1LA 4COKA 3BTUA 4I3GA 4MR7A 5IU6A 4DUZB 4G24A 3FRHA 1YJQA 3PCTA 3PWKA 2YWFA 5ERGB 1D2EA 4F71A 1YI1A 3CWQA 3DO8A 3KKPA 3ZJUA 3AERA 1U5CA 3KR2A 3DTVD 1HKUA 2F62A 2O0MA 4KE7A 2OR3A 1R4MA 3ETGA 3RC7A 1Q3HA 2I6XA 3P9NA 4OBXA 4OHPA 1PJAA 1G9SA 1SUDA 3U4IA 3F9RA 3FGNA 4WKCA 1ZVQA 1H5QA 2HN9A 3OQIB 3EMBA 3UJHA 1I1QB 2V55B 3ROQA 5TR9A 1KO7A 2H3EA 1UR5A 2YXBA 1JJVA 5CCEA 3I6IA 5KX5B 5D87A 5KJEA 1FNBA 1A9SA 3T7CA 2Z6AA 3QPAA 2GCPA 3RVQA 4PIVA 2FE1A 1TO6A 2ISCA 4WZAA 2C8LA 2JGLA 1S4MA 3V1NA 1KOLA 4ITUA 3VKUA 5K8CA 1C9MA 3VTKA 1LU9A 3PFGA 3L8HA 4TWIA 3ZXYA 3H2ZA 4YJHA 2QB5A 4LJYA 2YXDA 4Y1GA 2ZRHA 3P0RA 2NU8B 3EPJA 4NBUA 1LW7A 2ODBA 3L5KA 3QWBA 2W93A 4RKQA 1S2NA 3QSGA 1A98A 1W88A 4UASA 1TK2A 4QAQA 4YIHA 4HGNA 1E3TA 3ZX4A 5C9ZA 1XP8A 1SPXA 4JLAA 2ZSAA 2YNMD 1X7HA 4ENVA 4AXBA 1SRRA 2F3RA 1PG0A 2UZ1A 3EOBI 3IEXA 3WOHA 4W5QA 3HBNA 3K5PA 3AR2A 1EVEA 3MUFA 2GNOA 4PO3X 3R0IA 4ZTBA 4BAUA 5IS2A 1J8YF 1OILA 5LZ5A 4N7BA 5KU7A 4WBXC 1GZ7A 1FVHA 2FX3A 3R09A 1J5EB 1CDZA 4TKMA 1CC1S 5ESWA 2AT1A 3GD7A 5GGYA 1Q0LA 1XXHB 2EJCA 4AKEA 3INRA 3WWZA 3H17A 1SKYE 1XVTA 2PUHA 5AM5A 3PPXA 2J9FA 3OKPA 3ZY4A 2QN8A 1RJGA 4R1UA 1E98A 4CQLB 2PH7A 1WY5A 3Q6IA 4KGDA 2AJDA 3ZKWA 4JJ8A 3B6ZA 3GBVA 3THXA 1QLJA 5K0CA 1RXCA 4AYXA 2Y67A 2WWIA 3WLKX 3T1OA 1J06A 2X19A 4PZLA 2W70A 1TMYA 2J5BA 3EHEA 2XF8A 3DDUA 3IT1A 4KO8A 4AZ0B 1S01A 2J0VA 2NO5A 1EP3B 3FF4A 3Q0TA 4ND5A 2NYAA 4XRRA 2XCSB 2FZKA 4M36A 5EZQA 3UY4A 1EUZA 3AY0A 3J7TA 3M4NA 1V5IA 1SXPA 5KNCH 3GLIA 3NEJA 2PZKA 2WG2A 2MR5A 3EXIA 4RTQA 1SU7A 1HA3A 5ADUS 2Y27A 1GZ3A 2QN6A 3N2GA 4HVTA 2N3ZA 2VXYA 3KKMA 4JV5B 4YV0A 1NW6A 5KQSA 1MC8A 1AQLA 3CE6A 1MRSA 4KQGA 3IV7A 3K94A 4JFRA 4QGAA 2Q7OE 2E4ZA 4XH9B 1TMKA 1PR5A 1GXSB 4GP6A 4PWYA 1E18A 1T9GR 3PXEA 4ODIA 4AF6A 4PSAA 3GJXC 1DIRA 1A7KA 3DPSA 2GRUA 1JAXA 2AOVA 4PLGA 3GFSA 1T34A 4ASUD 2D0IA 5LQMA 1Z0AA 1DRWA 3JQCA 4YREA 3FLMA 2J0UB 3A4NA 5D7NA 4ZTUB 4JI7B 1X3LA 5CCXA 1EA5A 4YROA 4UUOA 1R50A 5E95A 4J75A 3GLHB 5JR3A 5K0SA 3FAKA 3V4FA 4I55B 3VAZA 3DVAB 3EQ9A 2BFCB 4KXVA 3RRXA 3W4IA 4B3BA 3AUFA 4HNUA 2CL5A 5B3JC 2PL5A 3MQ4A 4BLQA 1OGJA 1CTQA 4Y6QA 4QKQA 3K4QA 1Z5NA 5G4KA 4D5GA 2A9JA 4LG1A 1M2EA 3IQFA 4B35A 1NXOA 1J2RA 4RTJA 4UREA 4Q4JB 1GUFA 1AXGA 1E63A 1JR3D 1QRRA 2CL7X 4HEA6 4ND6A 4I50F 5BO5A 3LT2A 5AW4A 1ESZA 4GLLA 2IXBA 2RI6A 3QX8A 1PFUA 4HK4A 4N3GA 4MYTA 1J1UA 5FLEX 3GU3A 4V02A 5K9ZA 1IHYA 2V6MA 1BEEA 3PLNA 3AFGA 1SB9A 3NHBA 4IXDA 3EDQA 1FRVA 3F6SA 3T7JA 3QWFA 2F6RA 2DC1A 2HMVA 2YASA 3QYFA 3IMFA 2O3UA 1HH4A 3LC1O 3BWEA 5AVKA 2R87A 1T6ZA 2XCTB 4BB9A 1Y3AA 1ZM3A 4TRMA 3E7PA 3DDCA 2IYVA 2BTOA 1XEAA 1WB9A 4POOA 1B42A 2PUWA 5LKRA 1UZAA 2HDHA 2EQAA 2WZCA 2XA9A 4J0DA 4E1AA 1YZKA 2G0TA 3S8YA 1J99A 4LQDA 4Y2PA 4MVJA 4M0CA 3NBUA 2X6RA 4B0PA 4IEFB 3AM5A 4EJSC 3QTLA 5BVHB 4J1SA 5KYGA 1F2UB 1HY3A 1FDRA 4C0SA 4TRJA 1PR6A 2IY8A 1MMFB 4EY3A 4YONB 4C4SA 5BRAA 4HNRA 3CNBA 4PN3A 1EBUA 1VFNA 2VBFA 3DBLB 3KAJA 5JRDS 4B74A 1L4HA 2FWNA 4POAA 4F3KA 1K7CA 3IPLA 2ROQA 5KOHB 3NTVA 2AOWA 4B6JA 2CHUA 4NP6A 1R10A 5BQ5A 4EZIA 5KMGA 4AJ4A 5IKOA 2RHWA 3DONA 4BFVA 4NAHA 2BC9A 3UA3A 4X44A 1P9NA 1ZCAA 5JW6A 4MHTA 1JW9B 5DRTA 3T7IA 1IVYA 1FP2A 2Y1DA 1I36A 3AKDA 2JLRA 2GN0A 3C6XA 1QVWA 2WB4A 4NICA 3ABQB 4UAVA 4UW9A 4DQLA 2QLLA 16PKA 1RI2A 1Z26A 5FTWA 5H7XA 3HHPA 3RARA 3I1JA 3ZBQA 4ZCTA 2WKQA 2OHHA 1OZAA 1BMQA 2AI1A 2QQFA 3AG6A 1C8VB 3GEIA 3H4MA 4BGEA 4LZJA 3T5TA 3RAPR 5LQDA 4D5EA 1NV8A 3NHRA 4RF4A 4ZJPA 1B4DA 1E9VA 2Z2JA 4LJAA 2Q4RA 5CH3A 3P2MA 1DJLA 3MIIA 5DT9A 4BFYA 2P3LA 4OQZA 5CAEA 2F3SA 1ID8A 3S2SA 4PPNA 1P7ZA 3SHVA 3ZHOA 4BMOB 2DUWA 3T35A 4B3TB 1VGQA 4PSVA 3QU4A 1E1QA 3QM1A 1K8RA 1NC1A 2Q9AA 1O8CA 3STXA 1NATA 3NNNA 4NCKA 5C37A 3OQNA 4F46A 1TYEB 2I6GA 3PQEA 3SX2A 5BPHA 3O5AA 3OOEA 5G40A 1NPTO 2ZPTX 3E9EA 3ZD8A 3CVOA 5LKAA 2VNJA 4A8JC 3BCHA 1EKXA 4WXHA 2B94A 2F59A 2FSSA 1QHNA 2R84A 4WKOA 5CNJA 3RLFA 1ZJ5A 1B16A 1VE1A 2A1TR 2OG2A 3KOMA 4BB5A 4L6CA 2XF2A 3DQQA 3BFVA 5I9IA 4CMJA 4UVGA 1WW3A 4C14A 1NXQA 4J49A 3GLGE 4MQBA 1Q1GA 2H1IA 4WKPA 3RS3A 3T6KA 4Y6PA 3TQCA 5CB4A 1F7UA 3DKPA 2XEXA 4DA6A 3IKTA 1Q1BA 5AVWA 2B69A 3NWBA 4XCQA 1Z68A 4MKRA 4ACAA 4BNJA 3JQGA 1LPNA 3H65A 1GRQA 1XAHA 2JFNA 4H3KB 2ZE6A 5C4IA 3K2BA 4WK6A 5JSZA 2IS2A 3B48A 1JHXA 3PJDA 1RWKA 3HVHA 2LV8A 4ADSG 3JYQA 1E4VA 4LQ4A 3AVTA 3LY8A 4INAA 4D3SA 2PYDA 2ZREA 3AF2A 3TLMA 1HGXA 2VR1A 4UNRA 4ITVA 5ICFA 3O4FA 5HKKD 1G64A 3PNOA 3A31A 1FDSA 4KQIA 1VIMA 3L5OA 4NU8X 1U3DA 2ZJZA 3SM3A 1RFGE 2W6MA 4EGAA 2B82A 3PXBA 4R2JA 1DIBA 2CNDA 5THXA 1CVIA 3JTMA 4Q1FA 1RWMA 4JA0A 2GPTA 2I6FA 4M38A 4U2GA 3S1SA 3UPTA 4F7WA 4YNBA 3T0GA 3BXFA 3TUIC 3ELBA 3U4MA 4ZA2A 5KYVA 3EUAA 4LHYA 3VR3A 4LVCA 1USIA 4YMLA 3TYXA 4QXRA 4BMSA 5B1SA 3JRXA 3LPCA 1SK8A 4BVHA 2J07A 5A2GA 3ZH9B 3WVNA 3G0OA 3TM4A 4DKXA 4IIJA 4IJUA 3NVAA 4OU4A 4X1IB 1PZMA 4M2LA 2ZI5A 3IUYA 1URPA 4QL3A 3VPFA 3U7RA 4DM4A 5BYAA 4BC1A 5A5DA 2N0SA 1GFZA 1VHTA 3Q12A 4K9PA 4MUFA 5FQOA 5LOVF 1E9SA 3IT2A 2AJCA 3K9QO 2F7SA 3MGCA 4S24A 3EB9A 3SBXA 1BGXT 1TIKA 2B1QA 3FDXA 3A1UA 1NONA 1ZSYA 1C0EA 1GSHA 3AZQA 3E9QA 2J3EA 2FSIA 2P2DA 2ZB8A 3BTVA 1NHWA 4JFAA 2FZEA 4P32A 4C0WA 5LXTB 4M86A 1NPDA 3M6WA 2WNIA 1P62B 1D4FA 1MXFA 1RQXA 2X0IA 1X9HA 3BA6A 3UG7A 3MMSA 1GV1A 2AFIE 1J8FA 2WAAA 3P2YA 1YASA 2OFWA 3DZKA 2GI4A 1U6KA 1VL1A 1YR8A 2JLCA 2ZANA 2BPOA 3EXHC 5KVSA 1MT3A 5KSPA 2UUAB 3QOWA 4PPFA 1SPBS 1CIVA 3ZH2A 4Z1MA 1TECE 4XD7A 4FQ5A 4HN9A 3GEHA 5JFOA 4RSGA 3W9UA 3TSYA 4QDOA 2WYHA 1AHHA 1RVV1 1M1ZA 3KNZA 1U0OC 4HAVA 3UJ3X 2FTKE 3OFVA 3SYMA 1F5SA 1CIPA 1JDJA 4HDMA 5ALWA 2G25A 5C81A 1K4YA 1O97D 2O4CA 1OYVA 1HQDA 5KHAA 3W3AH 2CK3D 1T2DA 2A9KA 5FV7A 2AYYA 3G9XA 4X20B 4XARA 4B5KA 3WBBA 4LGYA 1RLJA 3C48A 4BVEA 4RMHA 4X65B 5ITZA 1T2CA 4P2GA 2X0EA 4IIFA 2BZSA 2GTHA 4MXDA 3V4LA 4IDDA 1C1DA 1CU1A 1NN1A 5FADA 2J7KA 2JIMA 3PQ4A 3QYAA 4KQKA 1A2QA 1EE2A 1GAQA 5KNBA 2XB8A 1QPBA 3DE4X 3V8EA 3EVDA 4WUTA 4FU0A 2H7XA 3PQ3A 3LH5A 4GLOA 1UWVA 1MT0A 3OM8A 4KYUA 5TQ0A 4WLOA 3SIWA 3UWKA 3JQAB 1R0YA 2O3TA 1PGOA 4X60A 4HQ6A 2PX4A 5J4HA 1R4NB 1T8WA 4B5LA 4GOKA 1FFXA 1VKNA 4RJKA 4EAAA 2G5CA 3UJCA 4JI1B 3AK4A 1MIOA 2VL7A 4MS4B 4B3CA 2PPVA 1PJCA 3FJOA 3NETA 3I30X 4GF5A 4IFIA 2J87A 4I6JA 3NAMA 4Q1EA 1JLSA 2ATIA 4RVCA 3U1TA 2VZ9A 4KQ1A 3R74A 5JAQA 3W2IA 4QXAA 1Y3CE 1ODFA 3DXYA 221PA 3TCXB 2HK8A 1LSJA 3GJ4A 1THZA 1EWKA 3DMFA 1CG6A 1HC7A 5DNUA 1N0UA 5CT6A 4JVSB 3TZLA 2OAGA 1OTHA 4HLUA 3OP1A 1UFKA 2WJIA 3IAEA 5F76A 1W76A 3VSBA 4C6SA 1S4QA 3DE0X 1IEVA 4MS3A 3W7VA 4DJJA 2RFLA 1MPXA 3PXDA 5AOAA 4WMLA 2YXNA 1OFTA 1CBUA 5DHPA 3G17A 1RTTA 4KQHA 3D6MA 1CY1A 4RVDA 2JNWA 2G80A 3O8OA 2RGDA 3GN2A 1OX4B 3AUKA 4ZVPA 3VZRA 4EI8A 5F52A 4H4CA 2I7TA 4II2A 1M6VB 3HBJA 5EZ6B 1NAIA 4LF8B 1RMYA 3OX3A 5JZOA 3WV5A 4KYIB 1H42A 4JAVC 1DJMA 1K4KA 4GZ3A 3OPNA 4ROTA 1XRPA 4B32A 2X5KO 2NV6A 3LM8A 4DNQA 1NVTA 5K3SA 5B30A 4FYHA 4HH4A 4HRVA 4EBFA 1TU3A 3FCYA 4HWSA 4PSDA 4DABA 2CUTA 4MRRA 1C7QA 4TTPA 3S2YA 1TTPB 1MVNA 1QJCA 5EEGA 3WRWA 1AKNA 2OBXA 4QATA 4BLPA 3MFYA 2OCPA 3QVMA 1SVWA 2GFIA 1LPAB 1G8JA 1G6OA 4DIEA 2V3VA 2P0EA 1U0EA 5IKXA 3D6NB 4I3FA 5HX7A 3OE5A 2OTCA 5E2AA 1II9A 3T9FA 1QJ4A 2HFKA 1DAIA 1YL7A 4IOMA 1VJGA 2GZAA 1JA9A 3IA7A 4B6RA 1C41A 3BXHA 5TT0A 5FR2A 4DZZA 3L8EA 3E1KA 5AP9A 3MPUA 3RJTA 3WGHA 1FUUA 1N6NA 4J16A 2H1RA 1MG0A 4A3SA 2AZ4A 1W4LA 3RKRA 3KOYA 3K5IA 1BKYA 4TRRA 2CJYA 1NQUA 2W43A 1NF3A 3B6IA 4MEBA 4R98A 4KR9A 4N7MA 3OAAA 4WVLA 1LK5A 1IUNA 2XRYA 2ID9A 3GLQA 1MO4A 4QE3A 2GASA 1T36B 5FDFA 4BNXA 4N0PA 3BK1A 4HZUB 3GCZA 1H8ED 2FFQA 1HOTA 1HURA 3MS7A 3H5TA 4UU7A 3G2PA 3HXTA 5JS6A 1D4OA 3EBPA 2D1YA 3HVKA 3X43A 4PM4A 1K8ZB 1V6SA 2QVCA 3G5LA 3KTAA 3N58A 5DK6A 4X95A 1K08A 2IIPA 1WXGA 1H2AS 2VJLA 1RIIA 3OJFA 4L7VA 5LNK6 2O19A 2N9UA 2OHXA 1TEVA 3C1AA 3DOUA 1WETA 1M6YA 3I4LA 2V03A 2JAXA 2CHEA 2HJGA 4FD3A 3N76A 2B37A 4H60A 4MQ6A 4V0LA 4WN9A 3THWA 1MGPA 1QFJA 2VP2A 2BEWB 3DDOA 4E12A 2PWBA 2FRXA 4K81B 3LQRA 4MIEA 4OQNA 2HMYB 2J0EA 4UQOA 4WKNA 5AIAA 4FWBA 5F1PA 3W4JA 5K7SA 3UAWA 2HPHA 3K2IA 2ZTHA 3ONNA 1L4FA 2AJBA 3JWHA 2ADMA 3IUEA 4TUYF 1HG0A 2F00A 3RG2A 3VYTB 4KH1A 3ILXA 1M2NA 1T6BY 3QWHA 2HLDA 4O4JF 4RMNA 2OPBA 4MOWA 4MWCA 4DAOA 1V71A 2WJAA 1UC4B 5E6UB 1WDTA 4YP0A 4FKMA 4RE6A 4AJEA 2WU1A 2CNLA 1ZZGA 2QAGC 3BZWA 3FNRA 1G0NA 1BWRA 2ICAA 3VPSA 4C3ZA 1HE1C 1MA3A 4TT3D 3RYFB 2PV0A 5EFOA 4RTOA 1WPXA 3ETDA 2P9QA 1DKOA 3RS8A 4TMVA 4QRDA 3CBGA 1O7JA 2GT1A 4G23A 4X66B 2FLVA 2JFOA 2PG3A 4L9AA 3QVWA 3WJ1A 4B9EA 2NO7A 2VT6A 4UMVA 1JAHA 3DKIA 3I01A 4IQGA 2PGJA 4N3AA 4X93A 3RWOA 1EVLA 1IN8A 4D56A 5DDIP 4H1WA 3BJIC 1A9XA 3HNPA 2EW1A 4F1KA 4FFRA 3SQDA 5D6OA 3MFQA 1M34B 1JHVA 4PC7A 3BDIA 3C5VA 1XP5A 4PC6A 3CF6R 4XD2A 1SCQA 4JLPA 3ZIUA 2ZVQX 5E6RB 4LVOA 4MKXA 1AKYA 3QF4B 4MV5A 4U6NA 4R0MA 2VATA 2J46A 4DUPA 2BGWA 2P2NA 4WA7A 1VECA 4Q4AB 1OXKB 1GGEA 4MMZB 1L7QA 2GWRA 1TIBA 4JOCA 4DREA 1KQFA 1CP3A 4DLNA 2I29A 4QUKA 3L6DA 3BMQB 2GVNA 4BHTA 4M98A 5A62A 4RX1A 3LW7A 3WLLA 3E3AA 4KIJA 3RGWS 3ZHBA 2YJNA 1UBMS 3FYDA 4JEHA 1TZCA 5CIWA 3M4JA 1TMOA 3EOAI 5K05A 1CJBA 1K06A 2ZYSA 5KSZA 2Q2WA 1A1VA 2QE6A 3UM9A 1E3DA 2CZCA 3DT6A 4DLLA 3CX3A 4J94A 2I7DA 2Z9CA 4LK2A 4MQFB 1WR8A 2QVZX 2RCYA 3MJHA 5CXSA 1UPXA 2XMDA 1BXKA 1HUQA 1ZRMA 3KPWA 2Q2QA 3QELA 4NU6A 1CF4A 1SCKA 4L0DA 3ESYA 3W1EA 3RTGA 4Y2JA 4EY6A 4CMIA 1H4TA 2F9FA 1FFHA 1XA3A 1NX6A 2QI9C 3OZTA 2OM6A 4PO8A 1TO2E 4TV8A 2RGRA 3WLIA 1VKJA 1KEKA 2EKPA 2IVFA 3AMVA 2J3IA 1KE2A 4RZSA 1FBNA 3V6MA 2JLBA 1E1CA 4KLCA 2BAGA 1BO6A 1HORA 2ZT6A 3KZ1E 4BWVA 1BE0A 2D3TA 2CXQA 3EFOA 4D92A 4DMLA 5KQGA 3HDJA 4X3CA 4DLAA 4AIRA 2PPLA 5BN5A 4EH1A 1N5LA 4WERA 3EWAA 2BL4A 1VDZA 4DLVA 5FBLB 5IEBA 2GSWA 1CZHA 3UMBA 1FRNA 2BONA 4HQNA 4D9FA 3ZV5A 1ST3A 5K0LA 3TMAA 2CT8A 2HWYA 3SZOA 1YTLA 4URHA 4H0FA 3SBDA 4UDOA 2B92A 3WYDA 5CFPA 2B6HA 2BFWA 4EPTA 4PX5A 1AZWA 3B1WA 3D8SA 3T5DA 4J4HA 4B85A 3IP8A 3JAKB 4LZOA 4ECEA 1DX9A 3WLNA 1BA3A 3N28A 3PJRA 3DBRA 1HDXA 4KX3A 1SMKA 4D42A 5ALMA 2V0GA 4ZCLA 4MVJH 3IELA 2R6GA 3ENWA 2WFMA 4GKVA 5HCIA 1Y9ZA 1AO0A 5KREA 3DFKA 2CD9A 2I54A 4IFEA 3PGMA 3E9YA 1YB5A 3L1HA 5H3CA 4LXHA 1JEQA 1YR6A 2Z08A 1A9PA 2VHTA 4LRSB 3RIMA 3TG2A 4YASA 2MCFA 3AESA 2IGBA 4R31A 1UEJA 2VBIA 2ZSFA 1II8A 3RVRA 1B26A 1FMJA 1X7YB 4LK3A 2IIQA 4N0EA 4QGHA 4OFZA 4D0NA 3KXKA 1XDUA 1OFUA 1S3FA 4D9JA 4GSLA 4HUTA 3AY3A 4M9UA 2A57A 1GG2A 4EYOA 1T1RA 1COZA 3NBFA 5K0EA 3EXFB 1JMYA 4JLDA 2ZOSA 4MI6A 1W5TA 3L4BA 4INZA 1I51A 4BO2A 5KX5F 1ODKA 4LDZA 5D3ZA 2NPFA 3U48A 2DFPA 3CZ4A 4ZZ2A 4MTLA 3COVA 3BGOS 3ZZ1A 2HU5A 1C8KA 3LPMA 2BM9A 3P9KA 4HQKA 3WHIA 2CL6X 2JHAA 4X94A 4O4LB 1AK9A 1VGVA 2RK4A 5KOJB 4LZPA 4GX1A 1IOLA 1YC2A 4PQGA 4PXAA 3V7FA 2JDID 3ZWXA 2EZUA 1B41A 5KYKA 3QX3A 1QOPB 5A3QA 2Q1SA 2EQBA 3ZE8A 4TKVA 2C5SA 3EZLA 2OFPA 3U40A 1QU3A 5CXUA 5DE3A 2TECE 5ECWA 3JWJA 5HJ7A 4CNQA 3PKJA 4MPDA 1ZXXA 2C5HA 2F43B 2F9LA 3CGGA 4R7TA 3WAKA 5BSHA 5DF1A 4ZT2A 4EELA 2G08A 2V7UA 4EPRA 2J08A 2LIVA 4X8LA 3FPLA 4ZANA 3VV3A 3DEAA 3LCVB 4RH3A 5IKMA 3MD9A 5BN4B 3RU2A 3O91A 4RLHA 3WGTA 4EPYA 3ZI7A 3QMPA 3TG8A 4ALKA 2EZ8A 1T3HA 4ER7A 1D6MA 3IBCA 5ADHA 1ESDA 2QRNA 3ZHYA 4KEAA 2ZG6A 3KRTA 5PNTA 1MJFA 3EDCA 1EFVA 1PVOA 1EVQA 1UXOA 1WVIA 5AKJA 4R01A 4DM7A 4OMDA 1D6SA 1G6KA 3FHOA 3MWGA 2GHRA 2OC4A 2RARA 4GMDA 3LO5A 4M21A 3WHKA 3ZNQA 1KI3A 2EQ5A 4CDGA 4AS1A 3TOZA 1PVDA 4GBMA 3LF1A 4NTZA 2RGGA 3GLKA 3IQIX 1XXHE 4X8OA 5A06A 2JC3A 3LT0A 4MW1A 3HCRA 3R3JA 1WF3A 1CFJA 1T3ZA 4Y9SA 4BV2A 2QMZA 4QYTA 1I4WA 3KXIA 3QUBA 4TVBA 3H5VA 5CLGA 4C0KA 2NO4A 3A6HA 5EIBD 2VUUA 2G77B 3CS3A 1GGVA 3EA4A 1OXTA 1UDAA 1TK9A 2R5NA 1V43A 4UM7A 3DUFA 3OLWA 4UVDA 1YZ3A 3GLFB 3QVOA 1NBMA 2QJTA 2R8ZA 3HEBA 5KJFA 3I8XA 2HRZA 1E60A 4J1TA 4UNQA 3HVRA 1XYYA 4U0KA 2FFBA 4X5OA 5HJ5A 1QU2A 1Q77A 4S1PA 3M1YA 3ME5A 4CKBA 3ENNA 1A72A 4IDGA 3DCYA 4YAKA 1TJPB 2O7NA 3R3XA 4IKPA 4NZMA 5EHXA 1T9ZA 2W6CX 3U19A 4EHBA 4FONA 2ZI6A 5CH8A 3L8GA 1J70A 1ULSA 3OLXA 1PSWA 4ZP1A 4BS9A 3FWPA 1PDWA 3BF8A 1YHZA 1X6VA 4FGUA 2ZRFA 4FN4A 3FBTA 4UHJA 3F7NA 1LB1B 3TFOA 1WDKA 1HFWA 1NFRA 1T9GS 2BGNA 5JE8A 1RBQA 1WCWA 2H4JA 3KZVA 4HQOA 2WD7A 3LRXA 4K8RB 4MW5A 4O8CA 5BT8A 2VJBA 5FTMA 1LBTA 4FMPA 5J2TB 4B6PA 3PV0A 4W8HA 3RO7A 1V35A 5ENVA 2X14A 2BF4A 4QBIA 3V7WA 5HQ3A 3JVDA 4DLWA 3NEAA 1IQUA 1KVUA 2VP9A 3CVUA 5FNVB 2CDCA 3DOJA 3OKAA 5CVEA 3V2GA 2V74B 1PL8A 3QVSA 2WTEA 1SOWA 3GDHA 3IT3A 4J0IA 4US0R 4XEHA 2P67A 3GLHE 4IHKA 3HZHA 3MINA 4E3ZA 3IEVA 4QOFA 1SXJC 2PMBA 2VLIA 5E8RA 3AUSA 1RRMA 2G07A 4AROA 4Q48A 1NZFA 3AZPA 1XNQB 4DB2A 3HSKA 4WVFA 1JEDA 4QA9A 1TLTA 4I4CA 5FLYA 2JAOA 3RUEA 1D8AA 2YWBA 3VZBA 3VH1A 3FCSB 4AK9A 3AIIA 4U7JA 4LF6B 3TBFA 1WA5A 3X1DA 3TDMA 4ZVUA 4BKMA 4BEWA 1Z06A 2JIPA 2OGZA 1TM5E 3C5HA 3MTDA 4AJNA 3T94A 1Q7CA 3JARB 5EJ9A 3IOYA 1D1TA 3L18A 2VCYA 4KQCA 1LCIA 4XIJA 5MGBA 4W7SA 3ZLBA 5JATA 5JHHB 3ZDZB 1YC5A 1Y82A 1GAWA 4K03A 4MP8A 3QEKA 3H11A 1CDOA 3D6AA 2YUIA 4Q4HB 5C8XA 4MP3A 5JQWA 3ERCA 4AX4A 2ZBFA 3H9BA 2W4IA 5JCJA 1NZDA 1XVVA 1KSFX 3LHSA 4V0RA 5EUMA 3EGIA 4CM8B 5JWRA 3EPHA 4TTIA 1PLLA 4BP8A 1S7CA 1V1RA 4J43A 5KNBH 2YV2A 3KUDA 4D4HA 1ML4A 2JBWA 5CIYA 1YBFA 2X22A 1U2QA 4K87A 2IX9A 4NULA 4BATA 1YJCA 5C8YB 2NU7A 3RTBA 5K3FA 1AS2A 4MQEB 4F12A 2ISQA 3ZCTA 1PK8A 2XWQA 3IVMA 4L3VA 4XJXA 4RKRA 1UXKA 3WB1A 2WZQA 3VR4D 1J6UA 1X15A 2IUTA 3IDQA 1IZ0A 1RM4A 1WUJS 3CH4B 3LECA 3QLUA 1YE3A 4HMOA 4MJ7A 3C6BA 1EQUA 1UAGA 2HMWA 1P2UA 1BW9B 2GVDC 5IJ0B 4AN0A 3V3TA 2VZ0A 3V46A 3HDHA 1KERA 1VFPA 1M2FA 4LY9A 5KTKA 3MHTA 1RM5A 1TC2A 4P31A 2UXCB 2V98A 5DSTA 3T7DA 3ZR4B 1DDGA 4O1HA 2FW6A 4BDSA 4ECAA 2XAAA 4RD6A 1AHNA 4CCYB 1KPHA 1KOGA 3O8NA 2O5CA 4G1FA 2QAJA 3B53X 4NFYA 1YBHA 4MKFA 3C8ZA 3CNLA 4KI7A 4D3DA 1Z39A 3CRW1 3PGKA 5IF9A 2VT7A 2C20A 2B7CA 4M9XA 3I9OA 1LXCA 2BKXA 4EY4A 1WDWB 2PVPA 4OIMA 1C14A 2SBTA 3LOUA 4OXQA 2OB1A 3PGLA 3C3EA 5A3VA 1JEAA 3D1JA 3VTAA 1RLMA 1K86A 2X86A 5CYFA 1QH9A 4CT0A 5HIKA 1ZESA 3CUVA 4CDRA 3RIXA 1MAUA 3OT1B 3B8EA 4CGZA 1MD9A 1ZWLA 2EL7A 2VZ8A 1L4LA 1ZBQA 2UZAA 3B9RA 2A1TS 4GPD1 1KSGA 1KQPA 2G70A 2GO7A 3EQ6A 4RH0A 4H7FA 2R8OA 4TTJA 5G1OA 2RJ3A 2QG9A 4RGQA 5CJ2A 3JRWA 4O4IF 3FMPB 2WF7A 3QOFA 1JA1A 2WI8A 2HA2A 4OHWA 1D7AA 3DVQX 4FBMA 3HCPA 1EIWA 2ZJFA 1N2HA 1SC4A 1X1DA 3OTHA 3A2NA 1RBMA 1ZA2A 3KUKA 4GUAA 1GU7A 2ZRDA 5JSKA 3NRBA 2ZRKA 1LBQA 5JO9A 2PIDA 2V4ZA 1T25A 1KVTA 2VK8A 1W5EA 2GBIA 3ETNA 2XMQA 2Q8QA 4MVCA 4R2IA 1VPDA 1T1EA 1J42A 2BHLA 2INGX 3BA1A 3BZUA 5A4MS 5KYXA 3KQQA 5TGZA 3V8PA 1JJ7A 4A0SA 4N9QA 3V3KA 3ZE7A 3G23A 3ETHA 4J0FA 2WTUA 5BOSA 1GCIA 4F4HA 1O6BA 4L8WB 4CYMA 2ZIWB 1R0XA 2CE2X 1W52X 3QV2A 4PHHA 2QN2A 3NV9A 5F5LA 5C3UA 5IT5A 3FUUA 3G7UA 3C6MA 1XVIA 2GK4A 4UBLA 4HUQA 2BGLA 1TUGA 4FT4A 3IC5A 4BCBA 1UEXC 1H6BA 3KEMA 4GQBA 4K9QA 2ZUFA 2J0SA 1E9AA 2R1TA 4M22A 3QW4B 2PRKA 2OCKA 4LJSA 2B8NA 3LXXA 5CT9A 1BH6A 4A82A 4M76B 4HX2A 3UMVA 4Y0VA 3ZX5A 8OHMA 2QUHA 2C9YA 2HWUA 4PLCA 3O0TA 1AD2A 1TZBA 3H04A 3KYCA 2BISA 4HUJA 4NH0A 4R2WA 1XZNA 3KSZO 3LGXA 3QU7A 4S1VA 2PX0A 3ZVRA 1U80A 5TF0A 3UYKA 4ZRDA 1Y1TA 2PVSA 3SEQA 4GP9A 1VQ1A 1O2DA 4ZARA 1POXA 4C04A 4N76A 1T5LA 1Y98A 3AEQA 4ZI3A 2JJQA 1PJBA 1Q1AA 2C42A 3BFPA 1KI7A 3G9TA 5TSDA 2GDZA 4BO7A 5KS2A 2QJFA 4HPXB 4E14A 1DBQA 4NK5A 3ANNA 1EHCA 1KE1A 2GJ4A 3ETCA 2FN9A 5H82A 5JD3A 1DGQA 4YMVA 2XQGA 1U7PA 4HDNA 5H3LA 2JD0A 5L40A 5DW0A 4DSUA 3TXYA 2XCQA 4HS4A 3T5GA 4YCSA 4U3JB 3RAGA 3WB9A 4LDRA 5J59A 3U9LA 4DR4B 5C8VA 1ESEA 4HGPA 1DJNA 1N9KA 4IXTA 4YRFA 1KEEA 1QDLB 1UQTA 2GXSA 4O29A 1U2ZA 3U17A 2UYQA 3F7OA 3G2IA 3VQTA 1FX0A 2QLFA 4Y2HA 5E3JA 4EUHA 2PSHA 3QYPA 5JARA 1NI4A 2Z1NA 2H0QA 3PUJA 4CTNA 3DMTC 1ZCZA 4BWYA 4CF4A 5JANA 1PGNA 3OQ6A 3CZMA 4XSGA 2UYCA 1SCJA 4JLNA 4NOJA 5BV1A 2JJ1D 1S7GA 2O7RA 2XNJA 1E3IA 2R65A 1FP4B 2PLWA 1Z6TA 1MJGA 2FRVA 1M72A 1XWWA 2QY6A 3HU3A 1FFAA 4C4YA 5KUTA 2E4VA 3GK3A 2Y4OA 5HMMA 4KPFC 1CZUA 5EJAA 3L6OO 1ONSA 3A28A 4XJTA 1OI2A 2YR0A 1MORA 4FI3F 3C8DA 1SULA 5EYPB 3DDNA 4EB0A 1I6MA 3MJFA 1T5BA 4H1VA 4LZWA 4G8BA 1P3JA 4LZNA 1U28C 1ILEA 3BKXA 1KMMA 1U8EA 3IQGX 4YX9A 1XEXA 2Z98A 1VJRA 3DOCA 2NUAA 4NMHA 1U7TA 4KFUA 1NBIA 2R8EA 4ZV9A 1V2GA 2NZ2A 2BCJQ 5BT9A 4WJLA 5MN5A 3QQPA 3AH8A 3GGSA 3GH3A 3OE4A 3ORHA 4TL6A 2IXAA 3N74A 2P2YA 2H1CA 2RHOA 2XLCA 4XVHA 1I5OA 1ATIA 3RYIB 3FRIA 3K96A 4ZQBA 3SR0A 4I4TF 1XTZA 2OYCA 1ZNWA 2QD5A 4FEYA 4TYPA 2VDRB 3LWZA 4B7ZA 4DKJA 2ZKIA 2J33A 3BJMA 3JVVA 4PZEA 5TARA 3AP2A 4TLAA 4AUNA 2YMMA 6REQB 3QMMA 4KUHA 3IOEA 1EHIA 4JVMA 5KWEA 1VBMA 3IP5A 4W7IA 4Z7NB 3ZCVA 1CETA 1R37A 4HGYA 1Y8RB 3GVPA 5COAA 1CSEE 1O5OA 3Q3CA 4O1IA 9ATCA 4DIMA 4H77A 4V0ME 4DUGA 1QNFA 1IZZA 2BKAA 5C7IO 1RKVA 4QSMA 1YCDA 4N5MA 1ADBA 3IXLA 5LQAA 1DWQA 3VOTA 4HEA1 1XCMA 2NWQA 3FDJA 1LH0A 3PRYA 1PL6A 4PW0A 4RO0A 3PENA 3VNSA 4BFCA 2PKEA 1KA9H 2QT9A 4Y2YA 3ICWA 2QTLA 2VTDA 5EMMA 4A73A 721PA 1GNLA 1HBJA 2FWIA 1T2AA 4W82A 2XUJA 2V4MA 4DCNA 5LSAA 3FX2A 4EG5A 5C35A 5IN5A 5MN6A 2Q3JA 1DC6A 3RUCA 4HX9A 5K0FA 1G7SA 4P36A 4A03A 2A0UA 4AP9A 2J7PA 5TS2A 3RK0A 1WU8A 2J6BA 1KC3A 1YI0A 3SLKA 1P31A 5F51A 5IJXA 5BQPA 1LBHA 3H3XA 4WA8A 1VG0B 1YCGA 4XB6B 3SZRA 3ZZUA 1GYPA 4UVHA 1UJ6A 1C4XA 3L0OA 3C6YA 1GCAA 2VVTA 3ZD9A 4RVHA 4NFLA 4CTMA 3QPCA 2P2CA 4AJ1A 3Q1KA 3RW9A 1XXLA 4RUKA 2HSZA 5IC5A 3VSCA 4FGLA 3MQ2A 4F4FA 2IIVA 1C0IA 4V0NA 5FUVA 3PQDA 1I4DD 2HJWA 3A4VA 1ZD2P 2RJOA 1BWQA 1W8DA 3GEGA 5C18A 1Y7PA 4LYDA 5A5VA 4JUCA 1RPAA 3C3AA 4ARSA 3GRPA 4IH9A 4UEOA 2Z6QA 4BTLA 1O77A 4KBYA 4MWEA 3VNVA 1K92A 5HMLA 1E92A 2RBGA 1AE1A 4NBRA 3GBSA 3QIVA 5IWCA 5AI5A 4LBYA 3AR5A 3QFFA 2LUOA 3GAZA 4QPCA 3G0CA 3RRMA 1P0MA 1XU7A 2QF7A 1EVJA 1Y8CA 3BWYA 4UBNA 3SF8A 1SVKA 3TNLA 1KDRA 2H1SA 3LDUA 5MDHA 2XIJA 1UZMA 3OBBA 4NDNE 2LXNA 2BELA 3PICA 4MR8A 3TD6A 3O4VA 3MTBA 1IN6A 1NUHA 4JN6B 3DKKA 4CLXA 2WKRA 2XODA 5LB2A 3UJ8A 4PZ9A 3S7TA 4OF4A 4YRGA 2ILTA 1G0OA 4GC9A 4N39A 3L3BA 1VM6A 4MYSA 4N5LA 5KKNB 3LX6A 3KQVA 4EECA 2C04A 3CJQA 3K6SB 3LVRE 3R8FA 4NENA 4DV6B 3QVKA 3EXEA 4XCXA 5DYTA 1CEEA 1MABA 3BULA 4QNRA 5CUQA 3FOWA 5EE1A 4RH1A 2B2XA 3LQ1A 4ILEA 2YJ6A 1PIWA 4CCWA 3IQZA 4Q18A 3QVUA 2M6RA 2DB3A 1XOIA 4AI6A 2MWMA 3ND8A 4I0WB 4QFBA 5K6AC 5BRNA 2JW5A 1YR7A 2WMYA 3L7YA 1QF9A 1EZ4A 2HWXA 4CQMD 2GEUA 4ER6A 4ESHA 5AICA 2PFKA 1XTIA 5K8JB 4FEGA 4QOIA 4C03A 2Q27A 4MCIA 2XAUA 3E70C 1E2UA 4FMCB 1PO7A 4QLOA 4CZ2A 2CLKB 1DV2A 2PMFA 4UATA 5BWLA 5DBEX 4PCAA 4F1WA 2G5GX 3D8TA 2WWWA 3BL6A 4W1RA 3AV3A 4MUBA 2ZRBA 1K6XA 2FMKA 1NOKA 3A9SA 4RLSA 5BSMA 2BR4A 4KHZA 4LMPA 3JD1A 1HZJA 4AVYA 4BKRA 1VP9A 2BM8A 5LLTA 1WL8A 3C2QA 3MYRA 1DWUA 2XDQA 3NJRA 3NUGA 3QI2A 4BMPB 4GR9A 4HAZA 4B3MB 3ZQKA 3THYB 1XELA 4PHCA 1W8IA 3DZHA 3QKUA 3GCXA 2XB4A 5G3ZA 4NNOA 4XWYA 4ZKEA 1N1EA 1NW5A 3NDPA 1QR6A 3GA7A 4YWHA 2I8AA 2HQBA 2E4UA 1G8YA 5DJ5A 5BXQC 1TZJA 4PIMA 2O8DA 3C14C 1CY6A 2NAFA 2VNAA 1KBQA 1YDFA 2ZRIA 2IHBA 3E2MA 3A36A 1S6YA 3PUHA 3DR3A 4LKOA 2KLHA 2LIPA 3FNBA 4IVPA 4QHSA 3WK4A 1Y33E 2PZMA 1V11A 4QFDA 3UK7A 2FW7A 1M34E 1X1BA 1JL3A 1H1LA 1PR1A 2YZ2A 3KKZA 4QYIB 2FA9A 3M3HA 4Z99A 2ZWIA 1COWA 2UVPA 4TL8A 1LDBA 4NYJR 2BFAA 5ILGA 2AE1A 1HLPA 8ABPA 3SG0A 1G38A 1DUSA 4K86A 1D3AA 4A91A 3KWFA 4J0HA 3QE3A 3EISA 4DRYA 2R8XA 3VDXA 2WQ7A 3RC3A 1GTVA 2PGAA 4QBKA 2QLJA 1KGSA 3AT1A 3UMSA 5KZMB 1Q0UA 1UJCA 4J0EA 4KACA 4N3CA 1L1RA 2QP9X 4EFDA 4O25A 1YB4A 4WN3A 1KARA 5EWMB 5JYEA 2B8TA 4MA4A 4EY8A 4OL9A 3O94A 2KI5A 2V8OA 3O2QB 1TZKA 3Q85A 1SC6A 1PT7A 4CU5A 1NKSA 1SOMA 1FU8A 2FV8A 4TSFD 3W34A 3GMDA 3JQRA 4I1OA 4TV9F 3ZI4A 3PEYA 3ML1A 1GQ2A 1DC3A 1TA9A 3JCZA 4DYHA 1NUAA 1GTG1 3N8KA 2J6HA 3F5FA 4ZMBA 4WZBA 1BX3A 3WG9A 5B12A 3ZDCA 2Z30A 5IDVA 2PKWA 4MUGA 1NI5A 3MT7A 3W4KA 5E7MA 1EFCA 4DLXA 3ADDA 2UZ3A 2WIAA 4M60A 1B8UA 1B93A 2I4RA 1NVFA 3CB2A 2PL9A 3MJEA 3UTCA 3UUGA 4NONA 4CM7A 1IN7A 4JMLA 1DQRA 3V48A 1S5PA 4FGZA 1B0ZA 2ZZNA 3GLTA 3IT0A 4U5XA 1FDVA 2ATCA 1G19A 3DC7A 3DZIA 3E5NA 1RXSA 4OQEA 1TI7A 4YI5A 3AHIA 4IZHA 3UK0A 4IZIA 5FHQA 2AF4C 2XECA 5AW7A 1K98A 3GJQA 2LGJA 2DULA 4QDZA 1F8GA 4E31A 4EG0A 1XYGA 3PQ5A 4L3WA 4Z54A 4J8PA 4XXHA 5FYDA 3FLBA 2I4TA 3KWMA 1H4VB 4H16A 2CFTA 1T3TA 3EVZA 2FSUA 1WCV1 1Y6RA 4Q15A 4R3WA 1Z4KA 5EKUA 1XRJA 2JJMA 2VQ3A 4JB8A 1V3QE 4RA6A 1O96A 2K6GA 4BP3A 4DZTA 1WSWA 4EGCB 5JDIA 2AC2A 4L9SA 3G1TA 2VZEA 4BMZA 5DLQC 1UMKA 4C4AA 2AFVA 1FUEA 1UMBB 4BQQA 2QE7A 1FYEA 3N8HA 2QRUA 3KQHA 2Q4DA 3NCHA 5JAPA 4TVSA 3AILA 4DVJA 2PT7A 2IH5A 3Q0EA 4QOSA 1KZ7B 4RJTA 1DHTA 1WXWA 2ERCA 2Q3LA 3L49A 4GFDA 4GOXA 4KN8A 4NESA 3KG2A 4PYNA 3RASA 3TL6A 3LUDA 1KTIA 2E6UX 2O5RA 1ZJWA 1RKUA 4QWMA 2JGAA 2OPHA 2GJ8A 1KAGA 4KOAA 3UTDA 4F4JA 5K4HA 5M5BA 1FQOA 4ID9A 2X8BA 3FJ1A 1EIZA 2H0RA 4TKZA 1JG1A 3OA2A 5C5CA 2GUGA 4O4LF 4ZIRB 5L3QA 1SVNA 3GUCA 3ZJYA 2HSJA 4LI0A 3QXGA 3VVMA 2JH3A 1KRWA 2DX7A 1BOOA 1QRAA 1RBZA 2NSJA 1HDZA 1FY2A 1I3MA 3NAGA 2B4QA 1RJ9A 3P9QA 3QFTA 3KBBA 3WLTA 3KCNA 3I72A 4BRZA 3LQ2A 5H9VA 1E2IA 2H11A 3FTPA 3L01A 1JWBB 1V9CA 3K8YA 4IQ4A 1PE0A 1QV6A 1ONOA 3RAJA 3NM4A 4EHDA 4YRLA 4BUZA 2ZRCA 5FL7A 4RL6A 3VPGA 1ECLA 4IM7A 4OEHA 1WW2A 4QPJC 2Q4EA 3HKEA 1W30A 4Y3UA 2XDWA 3TIVA 4PG8A 5LBTA 2YNMC 4QZVA 3KQUA 4O3MA 3MMXA 3I6ZA 2XZLA 2HK7A 4UMDA 4UHEA 1CUBA 3ZWOA 2V3CC 4RVOA 3PDJA 5IAAA 4C7BA 3OIFA 4FHFA 2EX1A 2JGIA 1MF7A 2XUKA 2IHYA 4PPQA 1VHWA 1ZN7A 1GA1A 3I04M 1YU9A 4V0OA 3AERB 3NGMA 4DDUA 2B4KA 4ARVA 1JG2A 1YIDA 3WLQA 4HLCA 3ZY3A 3GQVA 2JZNA 3SMVA 2OKCA 1NP6A 2CZGA 1E99A 4MQMA 3C45A 3KPJA 5EXDA 5FA8A 2VHUA 3STTA 4P0TA 1ZEJA 5TPWB 4HSGA 1G18A 1C7EA 1TA4A 4RMIA 3T12A 1RMQA 4DCUA 4AG3A 2ZCUA 2CNWA 1L0BA 2H7VA 4WZAB 1V26A 3D3EA 1ZRHA 2AZXA 1JHYA 4BASA 1WB6A 4J0GA 3GLFE 1K0FA 1T3LA 1ZXBA 1IYZA 2ANBA 5HDQA 2RHJA 2O06A 4YT5A 4ATNA 1KO4A 4ZO8A 1JNYA 1X1TA 5DCLA 4FM9A 1HRDA 1W88B 2Q5CA 3MBOA 1XAJA 1SGWA 3H05A 3CUUA 5A4AA 2BHRA 2ASEA 4JLJA 1CK4A 4UOEA 3ET4A 4XFJA 5K8UA 3L4EA 2C3YA 4MPRA 4OGFA 4BO6A 5CCDA 1UIRA 1I1NA 5JV5A 2Q5IA 3B5JA 4NCNA 3F3YA 5J40A 4Z9AA 5J2TF 5BY2A 4CR7A 1FFYA 5LVAA 1O58A 3D8NA 1AJEA 4RZHA 2DF8A 1ORIA 5EE0A 5GADl 2X3YA 3K1YA 3VOSA 5FNVF 3LVQE 2BN4A 1L5QA 2YICA 4GR5A 4RIHA 3U7QA 4GPTA 4UAUA 5KNCD 4OI0A 1L7XA 1P0PA 1OI4A 2ES4A 1NUQA 2OESA 1I33A 2YUTA 4DRZA 4D8TA 3X44A 4NVRA 4RF3A 4KYTA 1AKMA 3FJYA 3ID6C 4KLRA 4QJ4A 3ZKWB 3ZWBA 2XIQA 4YY3B 1MB4A 2YHBA 3ZDQA 1GVNB 2J9XB 1KEPA 2BMAA 3MCAA 3B5EA 1PZFA 4Q00A 4Y2QA 3FSJX 2C2YA 3GFQA 3SFZA 4BPRA 2WT9A 1I94B 1J2YA 1JG7A 4ZFNA 1ODJA 1D2NA 1Y4DE 3E27A 3S4YA 3MCTA 1EK1A 4Q3NA 2JIZD 3G5TA 4HDKB 5AKZA 3W5IA 4C3OB 1D2HA 4BB0A 4B80A 3HDTA 1B2LA 4CM6A 1OPRA 2GH1A 1WPRA 3QPUA 4HRYA 3CYFA 1AT1A 3K9LA 3WQQA 4LBZA 4IG9A 3IUBA 2A5YB 3EXIB 3KWJA 4QELA 5IZCA 2CDBA 1BG6A 1U2DA 2SICE 3WAJA 3HCEA 3N2GB 4EJ6A 2TMKA 4HPWA 1PKEA 4ENSA 2ZDHA 1A5SB 2GPSA 2IDMA 3IEUA 1IEWA 1IIRA 4H7EA 3TQHA 3KT6A 4BLUA 2XTJA 1BVRA 2XKBA 1LC0A 3DWGA 1XZFA 2JAPA 4RF5A 3SR4A 3ROXA 5K01A 3UK6A 1KO5A 5EPEA 3BEOA 3OIGA 1Y34E 4DC9A 1XJ5A 3R3HA 4LOLA 3VJKA 4MEJA 3AONB 4YC7A 5C7YA 5C8YF 2WQ6A 3FOCA 2Q3BA 3BTSA 2QLMA 3E9CA 5FORA 1OMOA 2X7XA 1G59A 2ZTLA 3PNYA 4JZYA 1G5HA 1SWWA 1TKAA 5TQ2A 4TVKA 1F0KA 2R79A 1RWNA 2CXOA 2EFYA 2Q2NA 2JFPA 2CXRA 1J24A 3PNKA 4N49A 1MBZA 3WV4A 1IUPA 1QBKC 1JAYA 2WF5A 1EJ2A 1V96A 3GMSA 4RHXA 4Y9TA 5ER6A 1BQ4A 1Z6XA 5G4KB 1K9VF 3ZHQA 4IEEA 4Q7EA 5LZ8A 2YZNA 2A5LA 2EKQA 2SKDA 3A4MA 5GINE 4MV3A 3ESDA 4ZAVA 2O3SA 2OVFA 3GRVA 1AO3A 2FETA 3K09A 4MV0A 4QIHA 4TXJA 5BP7A 3CRZA 2PS3A 5IVKA 3Q5DA 4IKEA 2ZLBA 2Q7DA 5AKEA 3RBZA 5JH7A 1NSFA 1NMZA 2VF4X 3BXPA 3GDGA 3ZJTA 2A9VA 4H7PA 2JVJA 1XZHA 4TXHA 3KK0A 3FSGD 2Q9BA 1U7HA 1XFAA 4LYJA 1E9RA 3N2ZB 3Q8LA 4AJJA 2QRKA 2NG1A 3BL5A 3LY9A 1F06A 1T8UA 2QTAA 3EY9A 3I3SR 4IG4A 2HZ7A 2WHYA 3QWAA 1HI9A 1O0CA 2NZJA 1C8BA 5DNWA 5EVJA 1SIUA 4MCHA 4H18A 2V9ZA 4B34A 5GP1A 2X7HA 2FMXA 4HQLA 1GL6A 4Y30A 3D4BA 4Q6WA 5HSGA 2B7BA 3DLPX 1D1PA 5A1JA 3F73A 5HXAA 3SVTA 2QVXX 1R00A 1V5EA 2OLKA 3BZBA 4GEGA 4CUJA 2Y1KA 1DU4A 1Y6FA 2XD9A 2P6OA 3HUUA 3BDAA 5I4KA 4OUDA 4LWPA 3HY3A 2I2WA 1UOOA 3EYAA 3HK2A 1K5HA 5AM0A 2QRMA 2WD8A 2Z1MA 4IOJA 4PX2A 4B87A 3ZEIA 5KMGB 4Z4FA 3ICVA 3SN6A 4S1WA 2H1VA 4OKIA 2D5CA 3LF2A 1IBLB 2YMQA 4DCCA 1R6XA 3PEUA 3QBDA 3A1CA 2QWXA 2DPYA 1KRXA 2AG5A 4WECA 2OXCA 4TLEA 5K8IA 1ZQ9A 2E0IA 2H63A 3DQZA 2D74A 4R8VA 1I5EA 4AUKA 1IY1A 3ZHVA 3NYWA 3RYCA 5I7RA 1P6XA 4B4KA 4B81A 1Q0SA 1U2RA 1LLFA 3PUKA 1XMQB 2D1RA 3TSCA 4DG5A 1I3NA 5CPFA 5EJIA 4J3NA 3C5EA 3MF4A 3N0XA 5DN9A 1GKUB 1XVUA 2ZUDA 2D5IA 2IU4A 2KS6A 2QVBA 5CAEB 4CLOB 1GLVA 4Y6RA 2ONZA 5JSHA 2FEOA 2YWGA 1VJTA 2CYAA 4NYMQ 3VPHA 1KZHA 3HC7A 3VKHA 1IPFA 4GL4A 5A5GA 4AG5A 4P4TA 3IMCA 5F5XA 3RAEC 1DKQA 1X7WA 4NG4A 3ZUGA 2AMLA 2YY5A 5D1NA 5IG2A 3WKBA 1GZHB 5JZBA 1PQ4A 4H15A 3RIYA 2YBDA 3RD5A 2YFHA 2Z2YA 3ENVA 3KKKA 3BORA 3B1VA 1Q12A 4X7MA 2AK2A 1EP9A 2BUBA 3PQFA 4MJXA 3VC1A 1QZZA 4AZ3A 1AB6A 1W1WA 1XD2A 2AI3A 3GFVA 4OQQA 4CHTA 1R6AA 1SHUX 3EC2A 5KVCA 3EZNA 3PC7A 2FP3A 3CY6A 3DG9A 4C78A 5BWCA 3PP8A 1QC5A 2B30A 3LC7O 1IY2A 3GW8A 2P9JA 4HAWA 4HWKA 2QPOA 5IM4F 1L3BA 1CQZA 1JQJC 3LUFA 1M8FA 5KAPA 2H4YA 1HDGO 2QN9A 2PLRA 3JQGB 1L9XA 4TTAA 3LZCA 4DIUA 4IR7A 1VG9B 4RYDA 2VXOA 3RS7A 3CVJA 2ZBGA 2GA8A 4DQUA 5IASA 3WFIA 1UMDA 3OWOA 1ISPA 2OHFA 5DEOA 1EGVB 4HLNA 4NFHA 4LCJA 2ZJ4A 2D06A 3KB1A 1P81A 4YGXB 2R7MA 3BS4A 1ZGGA 3GOHA 2I1VB 1T9BA 1QZUA 1WP4A 4II7A 5H0IA 3MM4A 1NVWQ 3T1VA 3WKCA 4YRAA 2AKAB 1KEUA 3B36A 3R3VA 4O5OA 1LUAA 4KWIA 4V1CB 1NKVA 5HVNA 1U3FA 4YUYA 3HB9A 1X77A 1JDZA 4R8SA 3ZVKA 1RKXA 4JOQA 3LY5A 1C7ZA 3MWLA 5JNUA 4FX2A 3L7NA 5D5QA 1F20A 2WWRA 2C2XA 3EGVA 3IDSA 3ZI0A 3PR1A 4P0QB 3QUCA 5EWLB 3RNOA 1O97C 3WQBA 4FDLA 4D6XA 4Z51A 3OP4A 2EFCB 4LOJA 2O0LA 4IIJB 3T15A 4DV3B 1Y9AA 4BXOB 4MYUA 1MJNA 3IX7A 3SDSA 3RHSA 4RSRA 1R15A 2GBLC 4FMDB 4P7FA 1T24A 4HB4A 1WG8A 4G4JA 3R6TA 1AQIA 4O2RA 3KAQA 2Q28A 4FYKA 4X8MA 4AS2A 3HP4A 3EBLA 2YDXA 1VG1A 1K97A 2I2FA 3PC8C 4IDHA 4YCJA 3AGPA 1TFUA 3P20A 4MQ5A 3OZXA 5LQUA 1ZVVA 1V8OA 3FB1A 3F4KA 4MP6A 1EVKA 1IK4A 3MAJA 5E1BA 2WYVA 3ZCQA 5F9HA 4B2PA 1GWNA 1GZ5A 4JOBA 4RPJA 3FKSD 1OAKA 1RYEA 5BSTA 1Y1LA 4CIXA 1YVRA 2OBNA 5JO0A 1JDTA 3Q2KA 4EPVA 1RYHA 4WWHA 5ITWA 5DI9A 4KMRA 2WTXA 4Q1VA 3GIWA 3KOZA 1P1IA 2V7QD 3KPYA 4C20A 2VN8A 2XNSA 3AI2A 3MJSA 3VPAA 2X0NA 1GPBA 2VA9A 1S1CA 3NQ41 4Z9XA 2P78A 5KPDA 1NRXA 2O8FB 4ZVRA 1L5LA 1EYZA 2PAFA 1KHTA 3CKMA 4DR3B 2EYQA 4WY8A 4BFTA 1FUYB 3GFPA 5IJWA 4O2BB 2G28A 4BNZA 4EHNA 2FP4A 3WWOA 4EFLA 1BU8A 4HDMB 5HE9A 7REQA 4RACA 4URZR 1ND5A 2W6PA 1AMOA 2G1JA 1AF7A 5GZ3A 4C07A 1ZVMA 1I80A 1WE2A 3RPEA 4UVEA 1AUOA 4P92A 1EZZA 1H6CA 2G5TA 3B1YA 2Q1TA 5B3JA 3IB6A 1N8NA 2BMWA 2FU5C 4WESA 3GUZA 1ECGA 1IHOA 5TDHA 1I2BA 3RG8A 2I34A 1QFZA 1R6VA 1SUSA 1C1DB 2FPGB 2VJDA 2JCXA 2YW2A 3DYIA 4OB8A 2OXTA 4A92A 1VMIA 4F97A 2P4HX 3QE4A 4TMKA 1U3CA 3STYA 2E7ZA 3OX4A 2WR8A 4N18A 1MHTA 2NU6B 5CB6A 1F8XA 1E79A 4JQOA 5TQ0B 2CGEA 3VYUB 5E1DA 1B15A 3D3WA 3VVCA 1YR9A 2MT9A 4EX7A 1V0JA 5LQNA 3HR4A 3C6QA 4GNRA 1Q14A 5J4VA 2IOHA 4MSUA 1OSNA 4L4UA 1EK2A 4RDIA 5AHRA 5MGNA 1MX1A 5EKSA 3A9VA 4K2HA 2MINA 1Y8QA 3SHTA 2GM9A 1MIOB 1N3LA 1XFDA 2GZHA 4FFDA 3OQMA 1JFTA 1S3IA 2FPIA 3BIXA 3RDPA 2QTNA 2GYYA 1JDSA 3AV0B 4EJSA 4U63A 2G6BA 1XT6A 3BB4A 3OLCX 1B0AA 4Y2VA 2I2BA 2MTBA 1HLFA 2HU2A 4I1RA 3RSQA 4S1TA 4EF5A 1CY8A 1N32B 1PWEA 1ZN9A 3GJZA 4LDNA 4E33A 4EGSA 2VSOA 2L42A 2NYVA 3ZK8A 2H1WA 4N0MA 2EGUA 3D7KA 4MS3B 1Z0DA 2CZQA 1QYVA 2NT3A 2AN3A 4XCVA 1PSZA 3SZGA 1L7BA 4EFNA 4DQDA 1M0EA 2GN6A 1PFYA 5H68A 2A35A 3QLEA 3OZVA 1GTRA 1J2UA 1A9QA 1N9GA 2VBGA 5CDUA 3FNQA 5JS2A 3JYLA 1NYLA 2XTZA 4GPZA 4E2ZA 1RRCA 2IYFA 2QR5A 5F1KA 5DPMA 4JBHA 1XAIA 4YCMA 3NM5A 1OU4A 2P5UA 3F5SA 3FTQA 5EHZA 2HM7A 5JZ9A 4IXWA 1KWGA 2JHFA 2NZUG 4G4SP 2BFFA 3N07A 4W5RA 3TBKA 1HEYA 1IATA 1U8FO 2DRIA 4E5SA 1W1UA 3R5FA 4D8UA 5LL6P 3F2VA 1E3EA 1ZD3A 4JH0A 2ZAYA 1YZFA 2QAIA 4HPJB 3M49A 4GKJB 1Q0QA 4BAZA 3GGJA 1H0HA 1PTKA 3E18A 1DRKA 5FOVA 4GHWA 4PYRA 3WL8A 1A5ZA 4QUHA 5AWFC 2YHUA 4GO1A 5IX8A 3G2LA 3AY7A 3H5AA 1U1DA 1MC4A 4A8JA 3COYA 1VLMA 3HCFA 2FZCA 1GILA 3MWDA 4G26A 4IJVA 3UMGA 3OG9A 5D3QA 5JJ5A 3AF1A 2VPQA 1C30A 2F48A 3QOXA 3LDHA 4MGYR 2YZMA 4RD0A 3CBQA 4KQXA 1W5FA 1IB0A 5LA6A 1ZU5A 2EXXA 3KC2A 1P2DA 3ROEA 5J58A 4V0QA 2ZSBA 5J2UF 2BBSA 1Q57A 2FOLA 3L0ZA 2K2QB 3IRVA 1MG5A 1L8LA 2REXB 3ETLA 4X7BA 2ERYA 5EXSA 2ZVJA 3OZ7A 4RQAA 2E4WA 4CG3A 3WLHA 4RPLA 2PNJA 3V34A 2EAUA 3M3PA 4HTAA 5K2MA 1Z45A 4BE7B 4XPIA 3MUEA 3D0KA 3IBGA 1U8AA 1FJ2A 5JJIA 4PX3A 3AX6A 3KTAB 4ILKA 4HXFB 3C3MA 5KKAA 3LGSA 1RM0A 3BF7A 1QQ6A 3HB0A 4WKGA 2P2SA 2WLSA 1KZ1A 1F38A 3LLCA 4WZ6A 2JKVA 4MW2A 4Z9BA 2E3JA 1XEWY 2G0NA 2PSSA 3BMNA 2B9EA 2FN8A 2O5EA 3AEXA 5IANA 1T91A 1WM1A 1XZBA 4RHYA 5AR1A 2QD1A 4DDTA 3IE2A 2Q8PA 1T2FA 1ODTC 3AP1A 2R6ZA 1TZ2A 2XEDA 3M9WA 1II0A 3E35A 2XGMA 5C5EA 1L2TA 2PZAA 3TO5A 4RVUA 4MVJM 4ZVOA 1P4AA 2JFQA 2X0DA 4P6VF 1YULA 1CUUA 2WUEA 3LO8A 1FTWA 3G9ZA 4QGGA 2FK7A 2KBEA 5K8VA 2H2HA 1XL1A 4Z2AA 4F2DA 4XIIA 3GA0A 4QM6A 2XVZA 5KOIA 4OJMX 3ZY5A 3FOAA 3E2IA 2QSYA 1JGTA 1K2VN 5AKXA 3CX8A 3QEMA 2YRFA 4G5HA 5AJUA 4Z7JA 1UP6A 5ESXA 3A10A 5CURA 4E5YA 3K31A 5CX1B 3T3GA 1HPLA 1J23A 2COUA 4PYLA 3AFNA 2WOJA 4CVNA 4K0KB 2OSVA 3HVIA 2QL5A 1QYDA 5CFNA 1NQTA 4X97A 4RHFA 1U5AA 4Q34A 1E2HA 5CA1A 3GD5A 3HO8A 1PS9A 3IEKA 1PDVA 1PRYA 2QTRA 4ZI7A 1SG9A 2QMYA 2JEYA 1JXQA 3FBWA 4G0XA 2GKSA 5TIIA 2PUJA 2K7FA 4JQSA 4PO9A 2BEUA 3EXHA 3GARA 4EQ6A 2XBMA 3E0QA 1GHTA 3HLYA 5EJ5A 4NHOA 1UBNA 4IF6A 1QTNA 5CT4A 1Q1ZA 3AVYA 3ZLVA 3Q9NA 4ALMA 1QCZA 3TZHA 2PCJA 5KTRA 5AKHA 1UH5A 3KVRA 5U1PA 1FYFA 1VKRA 3V80A 1DPGA 1I9CA 2DPGA 1CJSA 4ARUA 4P98A 4YJFB 1YWGO 2QRGA 4ZRNA 1M1YA 2JK0A 4D8XA 4B8YA 1ZLXA 3CSSA 3KBOA 4K2AA 3KPVA 4M1TA 2VTKA 4OLJA 4QFCA 4UDYX 5FUYA 2VJCA 1C9DB 2VS1A 2JJYA 4RELA 4TZKA 1M5RA 3ITKA 1P9LA 4LJ7A 1LC3A 2COKA 3AHEA 4OHKA 2HKIA 4MWTA 4IJMA 1O6ZA 4I2VA 5DYYA 4A6DA 2IYOA 2VRNA 4KODA 2WAOA 2PMWB 1HFKA 3CZPA 3KD3A 4M6WA 2FG7C 2GN9A 2ZYHA 5GONA 3PRKE 3FFBA 1HMYA 4EB6A 2HV8A 3WB2A 2A33A 2I6SA 5JYDA 3OFND 1L7MA 4OQFA 3VR2A 4C5AA 3IIIA 3GV0A 4BO9A 3QEBZ 5L7WA 3QELB 1PP4A 4QG7A 1W5BA 4BKPA 1PJZA 1NJ8A 1KQOA 3FFTA 1ZK2A 1NGSA 3LUBA 1VSBA 4FBGA 1FJGB 1SKUA 3L7LA 3G2MA 3S3TA 1PQUA 1HE2A 4OUKX 4TV8B 1J09A 1C3XA 1PWZA 2A3NA 2NXWA 3EF1A 4MVJD 3WNQA 5ICSA 1E1CB 4RFLA 2TS1A 2PUEA 5BR7A 3PS9A 3U4QA 3EFOB 5BWNA 2HD4A 1DWOA 3T7SA 2QZJA 4FB4A 2ECQA 3OCYA 5BN5B 5JDCC 3PDUA 2YDYA 4P3OA 3SMQA 3UHPA 4L4YA 2AK3A 5E3IA 3TOXA 2B4AA 1DPFA 1U0RA 4RK0A 4CIWA 3HPRA 3I42A 4DG8A 1W36D 4J7AA 2EX4A 2OV2A 2V7VA 5FP0A 2P68A 3BGIA 1V7CA 4H4EA 4MUYA 4WHMA 4C3UA 4KR0A 3MMZA 4UTOA 2C9DA 2F17A 3T0IA 1JHUA 3E7FA 1T4MA 5CM9C 3N0TA 1PLKA 1D2AA 5LJIA 4FKZA 5E4JA 4BC0A 2D62A 2FMIA 4RLFA 2HMUA 3RRYA 1E5DA 4E88A 2HX1A 4IDPA 4LZLA 1IAQA 2VSXA 1XZPA 2GZSA 1I32A 2FEMA 3K0AB 3V8VA 5TPZA 1JEQB 3HFSA 2NW6A 5LWQA 2NUPA 1R0SA 4EGJA 1HR0B 5DYWA 2Q21A 1Y5MA 1NULA 4IPTA 4MEAA 1SELA 4R1TA 1MX3A 1T5IA 5SY6A 3NTUA 4WCDA 1DDOA 3OWXA 2SCUB 3ZXXA 4F5DA 4X1YA 3HPQA 4YP7A 3CVXA 4R9VA 5FEUA 1E1QD 1JS1X 4RANA 1UZNA 1XCLA 3DAPA 3HNRA 4BZPA 2QN3A 2IZZA 4CG2A 2VYNA 3FZNA 3Q4GA 2L0XA 3NV7A 2GOYA 2IYPA 5MFZA 5AKGA 2CBGA 3MCVA 5LD2B 1LQ2A 1WQ4A 5HEKA 1LRLA 1U7UA