3EGIA

Methyltransferase domain of human trimethylguanosine synthase tgs1 bound to m7gpppa (inactive form)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
200
structure length
195
Chain Sequence
PLGSRLFSRFDDGIKLDREGWFSVTPEKIAEHIAGRVSQSFKCDVVVDAFCGVGGNTIQFALTGMRVIAIDIDPVKIALARNNAEVYGIADKIEFICGDFLLLASFLKADVVFLSPPWATAETFDIRTMMSPDGFEIFRLSKKITNNIVYFLPRNADIDQVASLAGPGGQVEIEQNFLNNKLKTITAYFGDLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Trimethylguanosine synthase homolog
publication title Structure analysis of the conserved methyltransferase domain of human trimethylguanosine synthase TGS1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 66
structure length 195
sequence length 200
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.-:
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09445 Methyltransf_15 RNA cap guanine-N2 methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3egiA00
3LDUA 2BR5A 2C7PA 5D1HA 3HCBA 4RTLA 5K03A 3DXZA 4JXJA 5K0LA 5DM4A 3HVKA 4KDCA 3T7RA 3SX0A 5JUWA 1X1BA 4K6MA 3M70A 4PYOA 4E32A 2O0LA 4RV9A 3ELWA 1RI1A 4YV2A 1H1DA 1WS6A 1JQ3A 3GWZA 4QTUB 3WSTA 5BW5A 1O9GA 3GNLA 3VC1A 3LCCA 4BLVA 3G2MA 3IYLW 3NVMB 2P35A 4X63A 4FP9A 4IWNA 3P9NA 2WK1A 1EJ6A 5E2AA 4MTLA 3UBTA 1ORHA 5HIJA 3HVHA 1PRYA 1ZG3A 4V0QA 1JG2A 3EMDA 5DLYA 3HTXA 4ISCA 2AN3A 1UWVA 2UYOA 3G5LA 4YUXA 4CKEA 3EVEA 3KR9A 5E1OA 1L9KA 1M6YA 4HTFA 3FYCA 2PVCA 5E9QA 3R9XB 1G55A 3P2KA 2B9EA 2EJUA 4E30A 5B1SA 4AZWA 4POOA 3DLIA 5CVVA 3M6XA 3MAGA 3KU1A 4GOMD 1XTPA 2UYHA 2ORED 3EVAA 5ICFA 3O4FA 2OKCA 3VC2A 4E33A 5LSAA 4CXMA 2XBMA 3M6UA 1R6AA 1SUIA 2BR4A 4GF5A 5K8VA 3K6RA 2N47A 2CMGA 2P7HA 5CIYA 4MQ4A 2GS9A 2IBTA 1Y8CA 2OPBA 5EGSA 4ER0A 2YX1A 2IFTA 2AOXA 2ZWVA 3G7UA 3P71T 4RTQA 1L3CA 4HTFB 4X41A 3TLJA 2JJQA 1P1BA 1P39A 2HV9A 5DM1A 2UYCA 4P7JA 4G56A 4PYNA 2H00A 5EZQA 3GRRA 3UA4A 3HA7A 3KQTA 2HR1A 3R6TA 4RTNA 2AOUA 3O7WA 4GUAA 4IV0A 4DA4A 1D2GA 2H11A 2O06A 3AY0A 3C3YA 3KR1A 1VIDA 3KQQA 2P1DA 3MERA 3MTIA 5DM0A 3UZUA 3LBYA 2GB4A 5HIMA 3HNRA 4YMGA 3Q7EA 1I1NA 1JR4A 1YZ3A 2PX4A 3CKKA 3RIEA 1F38A 1QYRA 3TM5A 5ICCA 1Q0TA 2ZLBA 3KQMA 3L8DA 2AVNA 3H2BA 3KQWA 5GINE 1D2HA 5E1DA 2PX2A 4C07A 2PJDA 2DPMA 1AV6A 1IY9A 4KIFA 2ESRA 4GEKA 2OO3A 3FPGA 5HEKA 3UJ8A 4DF3A 2IPXA 4UOEA 5E9JA 2CMHA 3TM4A 3GRVA 4X60A 4X1OA 4A6DA 3BGVA 3PLAE 3GRZA 3E7PA 2R3SA 3NWEA 5K0CA 1QAQA 4KVZA 5EPEA 2PSSA 4XUDA 5LQKA 5HZMA 1MHTA 2FYTA 4EMSA 3G88A 1RI5A 2NXEA 4X61A 2GLUA 2EX4A 4RTKA 2I7CA 2ZFUA 2CL5A 1R74A 2ZSUA 5DTRA 4E2WA 2G72A 1P1CA 3EVGA 3LL7A 3NJRA 5HIKA 2AR0A 4R6XA 4PYJA 2ERCA 1JG4A 3TQSA 4CTJA 5LR6A 4RTMA 4KRGA 1EQAA 3E8SA 5E2BA 4BLWA 3ER8A 10MHA 3B3JA 4C08A 3KR0A 5GP1A 4EKGA 2YXLA 3GDHA 2B2CA 4F86A 2NNWB 2VS1A 4QPPA 1DUSA 3DR5A 2ZBPA 4AZTA 2YXEA 4FT2A 3FTCA 3CCFA 3KPWA 5EHGA 3P2IA 3DMHA 3FTDA 3ME5A 4MWZA 3SGLA 5ICEA 1KPGA 1X1DA 2G1PA 2AS0A 1QANA 5LQJA 5M5BA 2ZW9A 1NBHA 4QQNA 1DCTA 1NW7A 1RJGA 2P41A 2QRVA 5C1IA 2XVAA 4OQDA 2I6GA 3A7DA 4PIMA 5EMMA 2OYRA 1M0EA 4IV8A 4F85A 2CWWA 3LKDA 4KWCA 2H1RA 4FR0A 5EKUA 1VQ1A 3JWIA 3SSOA 4DCGA 4AZSA 2FPOA 3KQOA 4DM3A 1X19A 2PLWA 4YUVA 1N7IA 1RJFA 1DL5A 3KR2A 1FJXA 1G8AA 1QZZA 3EGEA 3FPFA 3PT9A 3HVIA 4RVGA 1AQIA 2K4MA 2JG3A 3OFKA 1O9HA 2VZ9A 1BOOA 3V8VA 2IDJA 3CJQA 1VBFA 2O05A 2YVLA 3C0KA 2QRVB 1XXLA 3UJ9A 3PTAA 3THRA 1KPIA 1HNNA 3THSA 3HA3A 4PINA 3B3FA 2YXDA 3VSEA 3DXYA 5LQCA 5CM2Z 4CTKA 2UZ4A 4DCMA 3MGGA 4HG2A 2B78A 3LKZA 5CD1A 1ORIA 3DP7A 4QPNA 4GOOD 2V74B 3ANXA 5DWQA 3NDJA 2ONYA 4HGYA 2OZVA 1WXWA 4FT4A 4OX9Y 3M6VA 2GH1A 2NP6A 5GIOE 1QAMA 1RI3A 3G2OA 5F2OA 4OQEA 4AZVA 5EEHA 4XUCA 1BKYA 1VPTA 2Z6AA 3P8ZA 2AVDA 1Z3CA 2BM9A 3NWBA 1VP9A 2P8JA 1X1AA 2ADMA 3FUVA 4WVLA 2C7OA 1VE3A 4C03A 4Y30A 4RVDA 3G8AA 3JWGA 5E8JA 2HTEA 2EFJA 1XDSA 2B3TA 1SQFA 2AOVA 3C6KA 3I5UA 2NYUA 3KQYA 3MCTA 4PYLA 5E1MA 4AX8A 2P7IA 4BY9E 3EVFA 2PGXA 3CJRA 5HFJA 4ATNA 5EOVA 5EG5A 4PCLA 2ZIGA 5GM1A 3UFBA 4AUKA 3PFGA 4FGZA 4CWAA 2PWYA 5EMKA 2BM8A 3A25A 3SXJA 3B5IA 3A4TA 4O29A 3FRHA 2PT9A 1L3BA 3EVDA 4ER5A 4OBXA 4PIPA 1JSZA 1ZGJA 3HA5A 2C7RA 1KYWA 4GOND 4DZRA 3TRKA 3FTFA 4IKPA 4M36A 3I58A 1KXZA 5FWAA 3CGGA 3X0DA 3OZSA 2VDUE 2YR0A 4F84A 3DULA 5T67A 3NDIA 3GJYA 2PY6A 4PGGA 2DULA 3ER9A 5LQNA 4RTSA 3BXOA 2AOTA 2ONZA 3EGIA 3EPPA 3GCZA 1TW3A 1BHJA 1QAOA 3G8BA 1JG3A 1O54A 1L1EA 2PWPA 3UJ6A 4PYKA 5DXJA 3C6MA 5DX0A 3GU3A 4U7PB 4BLUA 5KVAA 3HP7A 1YB2A 2E5WA 1WG8A 3KPJA 4QDJA 1FP1D 2HMYB 3PS9A 4QQKA 5DSXA 5E9WA 3T7SA 3AXSA 5FA8A 1UIRA 1L3IA 5E8RA 1NW6A 3OCJA 2ZIEA 2ZBRA 3OU2A 4RWZA 2HNKA 5E1BA 3UJDA 2AOUB 1KYZA 3UJAA 3QV2A 2PBFA 1D2CA 5EHIA 1X1CA 1EIZA 1RJEA 3E05A 1NW8A 1G60A 1SKMA 2JHPA 2AOTB 4XCXA 3FYDA 2P40A 4RX1A 5HIIA 3R24A 4P58A 1XCLA 4HSGA 5C0OE 4QVKA 5EMLA 1R00A 2Q41A 2ZZNA 2FK8A 3KHKA 3KPVA 2YTZA 1TPYA 3P9IA 1R8YA 3ID6C 2XYVA 3BGDA 4C06A 1VP3A 3A7EA 2WA1A 4PYQA 1EAMA 2Y1XA 2XYRA 3UWPA 1YFLA 3IHTA 3TFWA 3A27A 5EC8A 1KP9A 3REOA 4EVIA 5F2NA 5GWXA 5HOQA 5LQAA 5EVJA 3VYWA 5EIFA 5FQNA 2QE6A 5K05A 4B17A 3AWIA 5FTWA 3KKZA 4R6WA 2EG5A 3TPZA 1N2XA 3DXXA 1NW5A 2ZBQA 1FBNA 2CKDA 3HVJA 5FULA 2BR3A 2VDVE 3B3GA 1EJ0A 5DPMA 2PXAA 2G70A 1M6EX 5ERGB 3T0IA 4ER7A 5IKMA 1R8XA 4QVGA 5K0EA 1ZGAA 2ZZMA 3M4XA 5LQUA 5K0FA 3G2QA 1NT2A 4FZVA 4R8RA 5BP7A 5K09A 3GRYA 2OXTA 4BP3A 4KW7A 2P3LA 5JR3A 5G02A 3BT7A 2AZTA 4PYMA 2QYOA 3DMGA 2IH5A 1SUSA 2IIPA 5U4XA 3ELDA 5CVUA 4YUWA 5EMJA 1YFJA 4E2ZA 4ER3A 2Z6QA 1NW3A 1T43A 3HCAA 3GGDA 2JHCA 3FUTA 3NTVA 4U7TB 3A26A 4OBWA 3SR4A 3IV6A 2LD4A 5EIWA 2PT6A 3ORHA 3P9KA 2GAFA 5EQJB 4XUEA 3D2LA 3EVZA 2ZWAA 5KQSA 4R05A 4PCAA 2AN4A 1SVUA 1JTFA 1XDUA 5FADA 5FHQA 1RJDA 2C7QA 4CKCA 2AN5A 2FHPA 3LCVB 1WXXA 2IH2A 1JG1A 1F3LA 4KIGA 1BC5A 3S68A 5DSTA 3U81A 1YUBA 1SG9A 4DQ0A 5CCBA 4PGHA 3FPEA 3FPJA 3UJCA 5K0JA 3DOUA 3BGIA 4P7KA 2XYQA 3TKYA 7MHTA 4LECA 5CVEA 5EKXA 2NP7A 4MHTA 4P7FA 3NMUF 3FZGA 3DUWA 1KIAA 2IBSA 5F2KA 2PV0A 1P91A 3KPYA 5DTMA 4YMHA 4HC4A 2Z6UA 2O57A 5GOZA 1OR8A 4LG1A 2ZULA 5GM2A 4YUYA 3HCDA 1RI2A 1VL5A 3GO4A 4M37A 3I53A 3LGAA 3EEYA 3NVKI 1XJ5A 1NKVA 2ZIFA 3AXTA 3CJTA 3LPMA 1NE2A 3LCUA 3Q87B 3QOXA 2PX5A 3P97A 4YV0A 2OB1A 3KQSA 3BWYA 3SM3A 1ZKDA 3BWBA 3LHDA 2XVMA 3C3PA 4GC9A 4CKBA 4LWOA 1AF7A 2Y1WA 5K01A 1B42A 4Y2HA 5IH3A 4PYIA 3KQPA 1AQJA 3PVCA 3B89A 2YUIA 5BXYA 1YF3A 3BZBA 2ZCJA 3IEIA 3OZTA 1I4WA 2KW5A 4P7GA 3GIWA 4RVFA 3FTEA 1NV8A 1NV9A 5DXAA 2WA2A 4C4AA 4Z2YA 3FPHA 3JWHA 1KR5A 4RTJA 2P3QA 3CVOA 3MHTA 2NXNA 3FUWA 5D1NA 2VP3A 1IM8A 3MB5A 3CBGA 8MHTA 2G71A 3OFJA 3HCCA 4ZTBA 2IH4A 5ICGA 4GC5A 1XCJA 2A14A 1R18A 2ZTHA 3NW9A 4PNEA 1FP2A 4FSXA 2PXXA 2PXCA 3PX2A 5DTQA 4EQZA 4OA5A 3LX6A 2QM3A 3DMFA 3I64A 4RTRA 1FPQA 2GA9A 3EEOA 1TW2A 4A6EA 2OBFA 2BZGA 2JH9A 2ZZKA 1G8SA 3R3HA 4QDKA 5K0BA 5LQRA 1JSXA 1RI4A 4M38A 5FWDA 3PFHA 1YZHA 3K0BA 5FQOA 5C9ZA 2IP2A 2O07A 2JHAA 5FCDA 3JWJA 3OZRA 5DX8A 3RW9A 3UA3A 5CUQA 5DT2A 4E31A 4YV1A 1JTEA 3OU7A 3R0QA 4HH4A 5EZSA 2IGTA 1JQEA 4R8SA 3FUXA 3RODA 2NXCA 1N7JA 1VLMA 3M6WA 4GBED 2IDKA 4PONA 5FHRA 3LDFA 3LSTA 4RYLA 3T7TA 1G38A 4M7RA 4RSRA 1XDZA 4RTOA 3PX3A 1WZNA 3OPNA 3V97A 4E2YA 1ZQ9A 3UJBA 3P2EA 5EEGA 3G2PA 2I9KA 3MQ2A 2OY0A 3EMBA 3KPUA 5DRYA 2I62A 4PWYA 5FUBA 5T6BA 3TMAA 3TOSA 1MJFA 3BKWA 3UJ7A 3GRUA 5HILA 1V39A 1KHHA 4H0NA 4V0RA 4FS8A 4RVHA 5DM2A 3CC8A 4C05A 1PJZA 5DX1A 2YQZA 3G5TA 1NBIA 4EK9A 3TKAA 2FK7A 4YUZA 5KS2A 3HM2A 3SSNA 3KQVA 2ZVJA 2FRXA 5DRTA 5BW4A 2PKWA 2B25A 4WXHA 2G8NA 3BWMA 3DLCA 3E23A 2OB2A 4HRAA 3I9FA 3LBFA 4GQBA 4E2XA 1U2ZA 2R6ZA 2HWKA 4HGZA 4EKIA 3PB3A 3EVBA 2PX8A 9MHTA 1IXKA 5CVJA 3LECA 3M33A 3BKXA 3EVCA 3OU6A 5KQRA 3TR6A 5KYGA 4KDRA 3OE5A 5P8WA 2BH2A 3EGVA 3OE4A 2AOWA 4E70A 4DKJA 3HEMA 5CVDA 5T64A 3B7PA 1EG2A 4OA8A 4ER6A 1KPHA 3FUUA 2EJTA 4MIKA 4NECA 3G89A 4FSDA 2NXJA 5H02A 3ERCA 3DTNA 4LWPA 3SMQA 5MHTA 3MTEA 3HCFA 3BWCA 2QY6A 3ELYA 2FCAA 4RTPA 5K0GA 1INLA 1XVAA 3SVZA 4QTTB 2F8LA 3O31A 3BUSA 3DH0A 3P9CA 1G6Q1 3HCEA 4DMGA 5FA5A 1Q0SA 2UYQA 5CCXA 2P3OA 1ZHFA 1I9GA 1JQDA 3QOWA 3AJDA 3MCZA 2V7EA 4BP1A 4C04A 1WY7A 1HMYA 2VDWA 2JH8A 2GPYA 3ELUA 4L7VA 5K0NA 1UFKA 3LDGA 3SSMA 3GXOA 5GIPE 4GOLD 3F4KA 1SQGA 3FRIA
chains in the Genus database with same CATH superfamily
2HMTA 4YHBA 1M1NA 2V45A 4Z0NA 3V2GA 1NJ1A 1RYYA 3RF6A 1A71A 3NAZA 3H4VA 5CBPB 4HY3A 1BJKA 4B3XA 2DT5A 2ATCA 3BBLA 4FKMA 1YD7A 2B5VA 3M70A 3U0BA 2H59A 2J87A 4Y9RA 2MR5A 4X6XA 1KDPA 4TTJA 4B4OA 1C0PA 3N8HA 1J9EA 3U62A 1OAAA 3GWZA 3RT7A 3WSTA 4WOBA 1Z6QA 2VO1A 4R2JA 2RJNA 4BNLA 2CK3A 2FN7A 4KE9A 2NVBA 4IIXA 2QEQA 4PZUA 1K66A 1H4VB 1MHPA 3P9NA 1ZNZA 4MTLA 3U56A 4K2AA 3UUGA 4D3ZA 3OJLA 4XRRA 5B58T 3NHWA 1G9TA 3C41J 1FFSA 1RAIA 2VYNA 5ADVA 3OZ7A 4OL9A 4GPAA 1VGQA 1E0KA 2WABA 1TQ8A 2Y6VA 5LL6P 4F0JA 5B58C 2FXVA 1OXMA 3NHMA 4MWDA 4NESA 3LLMA 3KP1A 1BDJA 3ZTYA 1E9DA 1JJIA 3QA3E 3WNQA 2X2OA 4V1CB 2J08A 4EVSA 3UK2A 3KOZA 2Z3WA 3M6XA 4GOMD 4RQTA 2JFZA 3MHPA 5FA6A 3U31A 2F3RA 1MW8X 4BGUA 3PJFA 3RARA 4ZCIA 2R751 5HUQA 2DBVO 3IVMA 4NVRA 5IUNC 4C7MA 4JCCA 2IYOA 2N47A 2O3TA 3QJGA 4KPYA 3LUAA 4PPNA 4AURA 3F6PA 5EWMB 1UJMA 1PV2A 4OLHA 4Y9TA 2XE4A 5IUJC 1BN6A 4OL0A 4M88A 4PSDA 1P0CA 1VHQA 4ENTA 1GR1A 3NI2A 4YMWA 4C0AC 2XNDA 4HPXB 2FUG6 1RWPA 3ZW7A 3S40A 3NALA 4UE6A 2HR1A 5EZQA 1U1EA 3GRRA 5FD8A 3R6TA 4I14A 3K4HA 3IT0A 4D8TA 3NYRA 8AT1A 1DAMA 3CR3C 3E3OA 3VI3B 3TLBA 1V5FA 3KQQA 5KPDA 1VHWA 1ZIOA 3DO5A 3F71A 2HXYA 3QF7A 3Q8LA 3F3KA 3PLRA 2WOJA 3ZNPA 2W2PA 2WY2D 1ZU4A 1JG7A 3H65A 3O8BA 2HBYA 4B35A 3BSFA 4YAGA 2YWDA 1V5GA 4HEJA 1NF8A 1BKDR 3EJWA 3FE2A 3PUVA 4MV3A 2WU3A 1DXOA 2ZR0A 4J7UA 5E1DA 2IZ7A 4BXOB 2FX2A 3ELBA 3NCTA 4RHUA 2J67A 3CPHA 4MJ3A 3KTAA 3UJ8A 4UOEA 4DF3A 3H9EO 5JYBA 2AKEA 2HQOA 4P3KA 1UJ2A 3RUEA 1JLKA 1WDKA 4BBJA 4O4IF 5A02A 4N6GA 1XQ9A 2XXBA 4LQ4A 1KJZA 4C0KA 2C42A 2PKQP 1ZH6A 5CB4A 5K0CA 1AUVA 3DDSA 3WL4A 3DWIA 2HMSA 4IRMA 4KAFA 4ZVOA 4D0GA 3PF9A 4X61A 4E6EA 3PIIA 3K5WA 5T8KC 4EMSA 3WLPA 1DT3A 2FP4A 2I7CA 3AH8A 4Z0HO 1JXAA 3QQPA 2A0KA 5H70A 3C48A 3B20A 3M1YA 1QWOA 1DC4A 1WB6A 3S8EA 2W71A 5JSZB 3AIKA 3R5KA 1U04A 1LF0A 4ALNA 1QH8A 3DKRA 1WTCA 2M6KA 5GP1A 1E18A 2J3LA 4GHWA 1NRJB 3H0EA 3E81A 4A5SA 4D9JA 4L4ZA 4DG5A 3PQ6A 1BGXT 1WSAA 2YHIB 5E9AA 4NBKA 2QS9A 3I4FA 2JFPA 1TRHA 3IP9A 3KB8A 5IDWA 5JSQA 5ULLA 3SGLA 3PHCA 2V54A 3DBVO 2HFKA 3AHDA 4R8LA 3K1TA 4B3DA 1OFVA 3NP7A 4J2OA 2YIMA 2PL3A 3UHFA 4EZIA 2ZJ5A 1UM8A 4KFTA 1VSVA 3OCCA 4KB5A 5F35A 4ZVKA 1E2NA 3TGPA 4JI0B 3NXKA 2OENG 2YWCA 3IUJA 4BLRA 3TG2A 2ZM6B 1GJRA 2P2ZA 1YONA 1YR8A 3KDAA 1RKQA 1YA6A 2IHBA 4BMNA 4KWCA 2H4WA 4CGZA 2OWEA 4KIWA 2WT4A 5F3WB 1HFWA 2B0CA 3F6BX 2NSDA 3R3XA 5IHXA 5KOIA 4PX9A 4OHKA 2P5YA 4BN5A 1A97A 5KTTA 4W5RA 4LC0A 3FPFA 3I28A 1SJ9A 4MVJH 1CUUA 1LV8A 3PDIA 1D5CA 4Q4DA 3SIRA 3GG2A 3QUQA 1NZFA 3E15A 2VK1A 4PAGA 2W43A 4TTRA 4G0VA 3BS4A 1DZIA 2C9MA 1R9MA 3WIBA 1FFEA 4IHJF 2CDNA 4P34A 5J4LA 1C1XB 1GARA 5JMTA 1G19A 3LC0A 1SXQA 1GCUA 4DCUA 3MXTA 4IIFA 2XSZA 1BD4A 3VYVA 1EGMB 2NAFA 2IW1A 1MRNA 1GRNA 3GVHA 3VNBA 1THTA 4WZAE 4Z4IA 3RIHA 2H8GA 5DHUA 1N2EA 2J9RA 3RFXA 1C7ZA 1O57A 2AB0A 2OZVA 1N2ZA 1F5NA 1WXWA 3HGTA 3S27A 3TLKA 2DR2A 4LF5B 2WBLC 1OMOA 3H9JA 3K0AB 3MJVA 2ZE6A 4V0OA 3KD2A 3ZQJA 1EUCB 1ULTA 2XUDA 2FP3A 4OQEA 1HL7A 3OESA 3A06A 1MQ8B 4RNCA 5EL0A 1JP7A 1Z3CA 2C2YA 1Z34A 1ULAA 2CFOA 3MAAC 3LT0A 3MUFA 3RLIA 2C9ZA 3Q6IA 2E7ZA 2R47A 2WAYA 4C0HA 2ZTSA 2G9ZA 1UP7A 4UBNA 2GCOB 3C6KA 3I5UA 2V8BA 3KQYA 4H1UA 1PBNA 3UH1A 3EVFA 3VR6D 1LPSA 3K9BA 3CJRA 2A9JA 4EDHA 4N5MA 1CIVA 2ZJFA 2RH4A 2LDBA 4AYWA 1WW2A 4CR8A 3SIWA 3GNQA 5ALOA 4CWAA 1J22A 1JQ5A 1KMIY 3FA2A 4JGIA 5A3RA 4DT1A 1CYEA 2EEZA 5JEDA 3MTAA 4GYJA 1T2VA 4F60A 5JD4A 4XASA 1DJOA 2IC5A 4QAQA 4CLDA 3TX2A 1P62B 2P6RA 3PUJA 2YC2C 1EFRA 1H8ED 1I2AA 1RYFA 2O48X 2UUCB 1KQOA 5ALQA 2DKNA 2LXNA 1I6MA 1GUYA 4OHZA 3MJSA 2JGRA 2NYVA 5AHRA 2R6GA 4QBFA 1K6EA 4IIGA 4OJMX 3ZK8A 1VPVA 4DQKA 1DBIA 1D0VA 1UMBA 3GCZA 4AG6A 4E14A 4ZHQB 3ZCTA 2LKDA 2F2TA 5CFZA 1TJ5A 5BOSB 1JYEA 4N7RA 4WIAA 3MXOA 2WG0A 5DX0A 1NBMD 2BCJQ 3EPHA 5J2UA 2ODTX 2PIDA 2I2BA 2R60A 3L6BA 2IEAA 4QDJA 3NEJA 3Q1LA 3SOZA 1N6HA 3R74A 1SA0B 4JLUA 4EOGA 2AUMA 4QG3A 2ZIEA 3BA1A 4RPKA 1R4NA 2NV0A 1D2CA 2IW3A 3HNPA 3HB9A 3C14C 7GPBA 3IURA 3R7LA 1SXIA 3CZCA 4ZKDA 4WNIA 5TT1A 3IMFA 4RX1A 2OZEA 2EGUA 3UT6A 2P9HA 2GEVA 2ZR8A 3AF4A 4M98A 2ABWA 4NOKA 4Q03A 3W78A 2O2HA 1AXGA 1EVLA 4KPGA 4Z1MD 4Q1VA 2V58A 4WT7A 4KGVA 2XCQA 1DEHA 2Q4RA 4AMGA 1BJTA 1E96A 2CL7X 4RF3A 4KGZA 1KQ3A 3OVMA 3NT5A 2F9MA 3OQHA 1UBEA 3GPCA 2WWWA 1SB9A 4KQMA 2P0YA 1EB8A 1PQYA 1VL6A 2PGNA 1C7QA 5EXEA 3FWYA 3RD5A 2MWMA 5K05A 4MV0A 1FDWA 4I9HA 4PPFA 1NG9A 4EZEA 1O08A 1SC9A 2R1TB 1NW5A 4FDAA 1P80A 1U0LA 2CKDA 5AVTA 5D5QA 2WJYA 4DV5B 1WB5A 1FXWA 4FE4A 1NXXA 1WXIA 4XJVA 4QYTA 2NPFA 3TI9A 1TMGE 4GG1A 4PLZA 3ESCA 3OZEA 3S29A 3U7HB 4LFAB 2XGJA 1YR3A 1XHEA 3BCRA 2OHXA 1N75A 4B44A 2B9VA 2JFUA 3H1FA 1MIOA 3TZKA 2IH2A 4OHWA 5DHRA 1CY4A 2DLDA 2QRLA 2FWNA 2QRGA 1XK7A 4XARA 2NX2A 3LQ2A 1JXOA 1A5BB 2Q3EA 4YY3B 4WWHA 3FYUA 1FFHA 4ZEMA 4I1PA 5CJ2A 1YFJA 3T3IA 3H1AA 3FXAA 3OQJA 5AHKA 3UHAA 5BNWA 1HA3A 2FVYA 1Q19A 2YHSA 3TQRA 3A26A 3GZ4A 3JD0A 3Q3GE 3I9KA 4JT9A 2WWRA 4AP9A 1UEXC 3CXUA 5DF1A 4AQ7A 2D00A 1M2KA 4JUCA 1SVUA 4RK1A 2HRCA 5A4DA 1Q50A 5JC1A 1KJYA 1Z5OA 1VG0B 3TXYA 1XZHA 1Y3IA 4AY6A 5I8PA 4CKXA 1EHYA 3U81A 1S2DA 1SIUA 1BCRB 1OGIA 2JIZA 2OFPA 4I2VA 3LVFO 3LXMA 4C7VA 3IT3A 3D7KA 4PN7A 5B2FA 4WW0A 3TLGA 2BE7A 2QX8A 3M6MD 3D5EA 4PICA 3AONB 3ROKA 2GEDA 4INOA 3ZKWB 1XPJA 2E9SA 1P91A 3UB3A 1ZN9A 1IN5A 4O2AF 3HBAA 2ZULA 7ABPA 4FHFA 4CW7A 3J7AC 3T4PA 3R8CA 4J0GA 3CV3A 1G41A 2VPWA 1ZN2A 3HE3A 4KAJA 3TZCA 3ONEA 3M3PA 1E2BA 4D25A 1D6MA 2XUAA 3KQSA 4FGLA 1D2RA 2X8JA 4JIGA 4MGEA 1P19A 5GVSA 4TTVA 1T4CA 1RR6A 1ZLYA 2X14A 3D6TB 4QDUA 3K0CA 2PUJA 3Q3VA 5J3JA 2WFMA 4RZQA 4AS1A 1ZP6A 4LKRA 3KAPA 5CLIA 3FVVA 3BZBA 1LW6E 1FQKA 1NUHA 5H3LA 4YDQA 3R41A 1PUJA 3V1KA 1V7ZA 4LBZA 4C4AA 1VI5A 4RPJA 2IYVA 2NXNA 3KX2A 4BTLA 2JCYA 3CH5A 3K15A 2XMGA 4BYMA 5B3LA 5IVPA 1QP8A 2LIVA 2EZUA 3KWJA 1U5BB 4K03A 4CDNA 1S2IA 1ZQ1A 3GAFA 3IIJA 4IIDA 4NBWA 3D3WB 2PXXA 4TQ9A 3GWGA 3VTKA 4NJMB 4OKSA 4Q5IA 2ZWMA 5AKYA 4MUYA 1ADFA 2QVGA 2Y1EA 3K0FA 3QENA 1C9KA 5CCEA 4MKXA 2OKGA 1SMKA 4YRSA 4DUPA 4UXHA 1HDEA 1R12A 3DD1A 4OQFA 5HKLA 4G0NA 5AT1A 3I52A 1P1FA 2C9BA 3BICA 2WIGA 2BGGA 4M38A 2EG9A 1M2HA 1T5IA 3A10A 3TAHA 4ZEVA 1OZGA 1TCCA 1PF7E 1DXQA 4BNVA 3KQLA 4K40A 3KZVA 4YONB 2II6A 3UA3A 4RJ2A 1UL1X 4E5NA 5JJ5A 3NTRA 1JTEA 2PX0A 1NLMA 3GFFA 2GAJA 4CGYA 2UU9B 1A2KC 1GV0A 4WK6A 3WRWA 2HB6A 2X86A 3AUFA 3IESA 4Q4AB 1YZGA 2DRIA 3GIDA 4CF3A 3AR6A 3E58A 1DHTA 4AJNA 3LC7O 4DFDA 2BUBA 4RTOA 1LPBB 1C7FA 1Q0PA 1GG2A 3JYHA 4YMTA 3P2EA 3G6KA 3D2CA 4N5NA 3GQBB 4Y1EA 1DC8A 2W6NA 4PWYA 1KWKA 3MGBA 3UJ7A 2PUBA 2MSEB 4N76A 3UMGA 3LK7A 4R9RA 3WGKA 1S89A 1SHUX 5AKGA 1K8YB 4U63A 4FFBB 5F2EA 3ROPA 2VTBB 1PJZA 3X43A 1NBMA 2JGDA 1IXYA 3QY9A 3R0IA 3W9BA 1GPNA 1HYBA 4CU2A 3K20A 4TV9B 1T2UA 1DARA 2DTDA 3DVQX 5CT9A 5E7QA 2ZXFA 1GGHA 5D00A 4TRJA 1K27A 3VKWA 3B6ZA 4IL5A 3A9UA 2Q3LA 5FWXB 5LZ9A 5CX4A 2I7TA 2VVTA 1VMEA 2YYSA 1IXKA 4FKBA 5AM0A 1KQNA 4QM7A 4DCCA 1HETA 1OA1A 1QIDA 4KTVE 3ZQ4A 1QHIA 5TJ9A 2ENWA 3BD8A 1ZNQO 1XYYA 2HF7A 3O8OA 4B79A 1PHPA 2Q46A 5AM4A 4HTAA 3K0HA 2AOWA 1T1JA 3AUSA 3ZVLA 3HEMA 3ABSB 3F1KA 1G8MA 1T1SA 2C7VA 2Z9DA 1L1RA 5D6NA 1C9JA 1L1FA 4IUBS 5SV2A 1T2NA 3IB3A 3H97A 1NFRA 1NJ6A 1EK0A 5TQ2B 2XMRA 3T5CA 5MHTA 3LGXA 2HA0A 5EQTA 2PZMA 4UTNA 4Q3BA 1Y6RA 1XXHE 3EIFA 4QOIA 4TL7A 4CMGA 1M8JA 4JSYA 4WOPA 1J97A 1VB3A 3A6ZA 2FJUA 4L27A 1DQNA 3PQ3A 1U11A 1KEVA 3NHYA 1GL6A 4QOFA 1YE8A 3TIXB 3WO0A 5HQ3B 1Y82A 3W5BA 3HJGA 2I91A 5DO9A 5HKKD 2W6MA 5LOVF 3IOMA 2XF2A 3P19A 3W4JA 3RH0A 4ZYZA 4HDKA 1Z29A 3RAGA 1R5BA 3AU8A 1GITA 4EYOA 3EULA 2VJAA 1ZM4A 1Q6YA 1DLJA 1Z0DA 4ENVA 3A70A 1C3VA 5BSVA 2HBRA 3W8DA 2GD6A 1QU3A 3H5LA 4RABA 1TRKA 2VZ0A 2FDRA 4AMYA 3QU5A 1KJQA 2R7MA 3KWFA 2OO5A 3COZA 4U6QA 5TF0A 2O0LA 4E5MA 4F12A 2ZWIA 2DP4E 4ZCQA 4ZYTA 1RRPA 1NJ8A 1ZNWA 3OEED 2G0AA 4CIAA 1X7XB 4NXNB 5CLGA 1XC7A 2WJ6A 4L16A 3NATA 4BNWA 1V8DA 1HFKA 2QA5A 2VT3A 1GT91 3N2NA 1XLTC 3K1ZA 4FP9A 3KS9A 3V42A 3R77A 4EMBA 4ZYVA 2R9VA 2RSLA 3DYIA 3N8NA 3GUUA 1MTOA 2KYRA 2M98A 2YZKA 2GNAA 1EI9A 3N5KA 4FDTA 1S0UA 1BE8A 1FVHA 5F64A 2ISSD 4UDYX 1E62A 5CA0F 5ILQA 4BVHA 2VPPA 3Q2IA 4LQCA 4ZU1X 1G55A 1T9DA 3P2KA 3Q88A 5L7TA 5LXTA 1Q0RA 2H2DA 4RGYA 1M6WA 1NXQA 2I66A 3EZGA 2AMJA 1G9XA 4IG9A 4CXMA 3HR7A 3E35A 3HDJA 1R6AA 3IAAA 4FGKA 2V0GA 2WRZA 4Q7JB 1JQLB 2CMGA 2GJKA 2N75A 3FCYA 9ATCA 4E12A 3L8GA 5HUJA 1G8FA 3D4BA 2JBAB 3IUSA 4NS4A 1FDTA 2YX1A 4P4GA 3ZGVA 2OHVA 1C80A 2FUG1 1NU8A 1XVUA 1YRYE 3QUSA 4G8JA 4V2UA 5IKXA 2BFDB 2PKCA 2XKBA 2CJWB 4RD1A 4YP0A 3WYNA 1PFWA 4P7JA 4JI3B 5EYPA 5J63A 2J7KA 3DDNA 4BO2A 4XGRA 5DNAA 1P44A 1PU2A 4LN1A 4R8VA 2WUWE 4MVYA 4LY9A 4XQCA 4Y6GB 5G4KA 4AZTA 5CNJA 2F7SA 4B85A 3QPBA 5EIXA 1G8PA 3DEYX 4R1OA 2JFOA 2VYQA 2ZJ4A 3DGFC 4KLRA 5CDHA 3LT5A 5KIAA 1NVBA 4TVKA 4P98A 3N74A 3DE6X 3N7AA 4X7PA 2A5DA 4C29A 4C07A 3ZWXA 1YQTA 3KZKA 1XD9A 5BN4A 2DBRA 1PDWA 3SAJA 1IY9A 4BFSA 1K3UB 2D0DA 2OO3A 3PZRA 4OMDA 1Y0BA 4M6WA 4U2CA 4W5JA 3VU0A 2AI1A 4A6DA 3EXHA 4ZOLB 3LNCA 4CM6A 1P6QA 2UUBB 1P9RA 3AJEA 1M10A 4QPJC 2SICE 3M3DA 3Q0EA 5HR5A 3RS7A 3L43A 4RY8A 4RZSA 3JALA 4TKMA 1SVIA 2ZG6A 3ZXUB 3LXXA 4DV4B 4CEIA 3WKEA 1U9YA 1JAZA 1E6KA 4X8HA 1T0BA 5FNZA 3O38A 1ISJA 2C0CA 2FSIA 3WR5A 3D7RA 1KH2A 4S0ZA 4ZHSA 5PNTA 1IJFA 2EP7A 3ZGNA 3H7AA 5DHPA 3IEKA 5ITZA 3OTQA 2BMFA 4BVLA 1U0TA 4WY5A 4KWHA 1G8JA 4EABA 2C3PA 5EHGA 3HP4A 4C76A 3VR5H 2D5AA 2FMTA 1X1DA 5A5VA 2J3JA 4MP3A 1Q7EA 3IP6A 1Q11A 3KD3A 4YJ2A 3E22A 3LT2A 2YWBA 3EIEA 2G6BA 2PEYA 5GV8A 5C1IA 1GKIA 1M83A 3M1LA 3DEIA 3RYTC 3AMVA 2XE7A 1Q2XA 1E1YA 2GCIA 2JPDA 3LKVA 4Q3NA 5BQOA 3WJ7A 4OAOA 1VSTA 2CNLA 2PD6A 2PUTA 4D02A 3KSBC 2BD0A 3WOHA 1JAIA 4CQJA 3PZBA 4YEDA 4DM3A 3JASA 3MJFA 2JEOA 4OJYA 1WMEA 4L28A 4CMEA 3KB2A 4FOLA 4IZIA 5K3EA 1NL3A 1XA0A 3B1ZA 4HAWA 1YK0A 1E3JA 5JTUA 2O05A 1KBZA 4ZQCB 1RCUA 5KYTA 4DWOA 3AF6A 3EUWA 4YGYA 1L5QA 4FQ7A 4CM8A 1ORVA 4Q4HB 2ZBUA 3DAHA 4CM7A 3VYSB 2V97A 4RVNA 3JQGB 4C4PA 4KUEA 4RA9B 3GEIA 1NR1A 1YKGA 3WICA 4LFBB 1ADJA 1T3HA 3K32A 3L7NA 3AUJB 2F00A 5GJVC 1V2GA 1K63A 1Z16A 4RLQA 4TLCA 3WIEA 2DPYA 3D59A 2XRFA 2XB2A 4G1EB 3NVAA 4J1QA 1X7YB 5IARA 3GFPA 3B8HA 4EMUA 5ES4B 3TH5A 5FX2A 2JRCA 1N36B 1AURA 2PL5A 3H6KA 4HGRA 4N0QA 2BT4A 3N07A 5D3MB 1HPLA 3F73A 4ZJZA 1P31A 3QF4B 7REQA 2ATIA 1QIIA 1YQUA 2QNIA 2WR8A 1ATZA 1K5PA 3C74A 4YR7A 2CLHB 1ZO8A 2EFJA 3QJ5A 3PQ4A 4IWYA 3ZE1B 1YQWA 4BFLA 1NQVA 3DNPA 1VOTA 1MAAA 3LUCA 3QUBA 4U7GA 3UKOA 2IHNA 1XYGA 2D1RA 4Q6BA 1YRAA 2PT7A 3FFXA 3H11A 2INGX 3LW7A 2PWYA 3KOUA 1UJ6A 3DTTA 3PYLA 2FTKE 4ASUD 4LCBA 4H2DA 4YMUA 3PGA1 3V8RA 4OO3A 4AROA 4CG0A 1U6IA 3IH5A 2OHJA 3HA5A 6REQA 5CXXA 3ZZ0A 5JWHA 2JLSA 3ESAA 3BE6A 4RK6A 4CKZA 4QXMA 2V7UA 3GJYA 4BMZA 5ADUS 2EHJA 5FAKA 5SYAA 3A3OA 3CWZA 3A3YA 1BHJA 2FCRA 3EZYA 5IJAA 1O96B 4PYKA 1P60A 2BMJA 4PQGA 4LBWA 1QDUA 3HY3A 3L8MA 4G09A 2QUJA 1NUTA 4BLUA 3HP7A 2FZLA 1GVHA 2ECPA 4F9GA 2XB6A 4HS4A 2WE8A 1LJUA 4U6NA 7AT1A 4F04A 3UJDA 1U2DC 1JIXA 2JC3A 3WLLA 1WXGA 2C9CA 2VJPA 1LTQA 3PHIA 4JSRA 1H65A 3AVTA 3BIWA 5C1OA 4L9RA 2NADA 5EAIA 1SKMA 3EY9A 1QHYA 2GD2A 3FCAA 3OQ1A 3E4DA 4YMVA 5EA2A 5ELLA 2XXAB 3DOCA 3PUYA 1TVKA 2BTQB 1AUQA 3CLHA 5ARDA 3O8CA 4CG2A 3A7EA 1D5WA 4HDNA 4YT8A 4MVJA 1R8SA 1I6KA 1NTOA 4NQRA 4KVFA 4BWFB 1CUXA 1QKIA 4EVIA 3HKCB 3HBNA 3TRHA 5EVJA 3VYWA 3VNSA 4B82A 4YJFA 1NZDA 3X2SA 2IYRA 3C3XA 1W59A 3UMJA 1JMVA 3B60A 5FPYA 3TN7A 1NJFA 1N2XA 4Z4FA 3O26A 4WFJA 1TM4E 4AO8A 1XJWA 1SC4A 4RA6A 1QCYA 4ZQBA 4N5DA 3E53A 3LLUA 5K0EA 1DKPA 2YJGA 1XLUA 3U7EB 3U61B 1BDIA 2AJLI 3TXXA 3CEAA 2IHUA 2WMOB 1ZJJA 3K70C 3GRYA 2OXTA 2C4UA 1T10A 3EA0A 4E1BA 1RW4A 4AJ9A 2G4LA 3DMGA 3PPXA 4TWIA 3ZC3A 3ONNA 1N6KA 3H19A 1NM5C 1GUAA 2HMWA 1CZHA 3U4QA 2J5RA 5IAEA 3DBLB 4Z86A 1WMAA 1PJSA 4DYDA 4ER3A 3FPBA 4HADA 4QGSA 1UFRA 4MGIR 2FWRA 1ZXBA 1E99A 3JQFA 3ZHZA 5EIWA 5EQJB 5ECGC 3UATA 4O0MA 2HXGA 1U9IC 2PFKA 3GD7A 4FEGA 3VNQA 1XDUA 2ODBA 1N5RA 4Z8XA 1XRNA 3DE0X 1D03A 1E4OA 4KO1S 5CVCA 1TU3A 3S2ZA 3WYBA 1PAUA 3K72B 4P22A 1MJGM 1W0KD 1UBKS 3DQPA 4HSEA 1E6CA 4D99A 4EA7A 4PQEA 1ENPA 2BLLA 4RIIA 2QJOA 1PFYA 1XF9A 5FNVB 1FQWA 3CO5A 4GW3A 4OHBA 1E2KA 2W6QA 3BGIA 1OILA 4TV8B 4Y98A 3PXAA 2HIHA 2Q3FA 4KO2S 3TDNA 3VRHA 3WTBA 3CM0A 3ZYZA 4B6QA 4EI2A 1NQAO 4BKUA 3AZQA 2D5LA 1ADCA 3NH9A 4UD2A 3DTVD 4I5IA 2NSJA 3Q98A 4GOJA 4KRYA 1JKMA 4YAEA 5DTMA 5JVDA 3RAEC 3FVRA 1OR8A 1GRQA 1T3ZA 1V1MA 1XD2B 1SU6A 4IG4A 4KU4A 4LG1A 2PWZA 2EFHB 2EVWX 3PWZA 1BE1A 4H7FA 4MWTA 4WK4B 3WX0A 1QORA 1GNQA 5EESA 5BSMA 2YNMC 1VIAA 3AXTA 3Q87B 3CEPB 1Z17A 4GPIB 5HP4A 3MWDB 3AETB 3RC1A 5HGXA 3CNLA 3BWBA 4MS3B 3NPMA 4Z4GA 3GJQA 3VYTB 1BAPA 3FYSA 4LY6A 5C5IA 2WG2A 3CEMA 3QVOA 4KRFA 4UUBA 4DRYA 5DULA 2QP4A 1PWHA 4JI7B 2OP1A 2AH5A 3A4MA 3UXHA 3FPAA 4R2HA 3PVCA 3TLYA 1WQ4A 2RCYA 2QQ0A 5BXYA 1S7GA 3I9V6 2BCEA 2P4HX 3UGTA 4CNBA 5JNTA 1PYDA 1RQGA 2VP5A 1NXWA 3B9PA 4A1OA 3UKDA 4BFVA 2V4UA 1KI6A 4PR3A 1UMDA 1JMKC 1LVHA 1Y8QB 3L0SA 1EGQA 5EWJB 2FFHA 4TYNA 1TEVA 5D1NA 4S0XA 1PGOA 4EIWA 1BHQ1 2G71A 3DHNA 4X91A 4LF4B 1Y6GA 1BG6A 2HIMA 2DF8A 1WVMA 3DVAB 4NQZA 1O5OA 3ZDFA 4BFZA 1SULA 1GDTA 4B7CA 4DDMA 1UAYA 4MVJG 2GZ3A 3CH6A 4YVFA 4BYGA 4KUGA 3M4ZA 1WOMA 2GA9A 4CJXA 1UOOA 2O7QA 3ZCQA 4URZR 1UKYA 1G8SA 5FAXA 2OESA 1OYYA 1CBUA 2J4CA 2DMRA 4G24A 1ZK2A 2JAOA 4UAGA 4W8HA 5CT6A 3DFZA 4EUEA 2F1KA 4LF8B 4ASUA 5DX8A 5F9FA 2GBLC 1RAGA 2A1TS 1MIHA 1QF9A 2XDWA 3GUHA 3PG5A 5ESDA 3W9UA 3JQCA 2WPDA 1KZ6A 2ZT6A 3OU7A 2PSEA 2Z4TA 5HMMA 4DBLC 2Q1YA 3U7QA 3AG5A 2NXCA 3PE6A 4J4HA 1XZPA 4IDGA 4O0LA 2HJVA 3QUAA 1VBMA 4Q16A 1G20A 5ALJA 3PGLA 5GVRA 2B4TO 1UDBA 3EIXA 1XNRB 2PRIA 3ZJUA 4KTTE 4YN3A 4RSRA 4G9BA 1BHO1 3RHZA 5IKEA 1WZNA 3EDRA 2Q4TA 3LBIA 1IHYA 1VJ0A 4S2UA 2OT3B 2DQSA 3BHMA 4IUDS 4Q02A 5EKDA 4OQLA 1TAUA 1MJFA 4NZNA 4MCAA 3MCAA 521PA 4CQMD 1JPUA 3HV0A 3LP6A 3R3SA 3ANMA 4JVLA 1JEYB 3OLQA 4TKLA 1XEXB 1L7RA 1Q91A 1CXZA 2GPTA 4A5OA 3G0OA 1X80A 4J07A 2ZBGA 1DTWA 4OHOA 3ROGA 1NKTA 1KY2A 2RHDA 1JEAA 4GEGA 5HOEA 5ALEA 2GO1A 2YMLA 4CM4A 1RJ9A 5BSHA 5IASA 4GDFA 5EJAA 4RFSB 1R16A 1D8TA 3BFKA 5K51A 3NU1A 4AB1A 1S8AA 4EKIA 1G1AA 3QJYA 4O4LB 5CVJA 4QGGA 4DBZA 4XWOA 4QLAA 5KX5A 2XNCA 1BXZA 1SKYB 2X22A 3ITDA 4R8MA 3WLIA 4CQLA 1E60A 2W2NA 4XLTA 2IYLD 1TQ2A 4HUQA 4Q3EA 2JGLA 4XLZA 5EHQA 1L4MA 4Y2PA 2AX3A 4UKDA 2CLOB 1RKUA 2ZJ0A 4UQOA 3S44A 4RFLA 3TNYA 3TW0A 4D5GA 4WBNF 1J0XO 3O1IC 3UJPA 4KEAA 3SKXA 3CRNA 1NJ5A 2ILVA 3CIOA 3ORYA 5HBGA 3SIXA 1QRUA 1H4SA 2NU9A 1X13A 3RG8A 3BGSA 3ACDA 4RMNA 5ELMA 2GD1O 4TRNA 2YIDA 3ROFA 4KZKA 3A1SA 1ISPA 3G79A 5HSGA 1LF5A 2P9JA 4IMRA 3RC3A 3RYFB 4HB0A 4EKEA 3JR7A 1M8GA 4HOYA 3COVA 4EHNA 3ANSA 2LE0A 5FOXA 3ASZA 1KYVA 1L8OA 2FWMX 2NTVA 2Z2YA 4IYRA 1ZHFA 1H85A 1WZIA 3ED5A 5ALYA 5K0SA 4G2TA 1PR2A 1RQNA 3CUYA 3MCZA 4LJKA 1LBTA 2RGCA 1E59A 4QYIB 2WJPA 4L7VA 4DZZA 4U2BA 4WXYB 1LRLA 3LDGA 2H9IA 3PEVA 4ZKEA 1FJGB 2VPYA 3PDCA 2HXSA 2PYIA 3PIRA 2AEFA 3M1AA 1FE8A 3HNOA 4GOLD 4PZZA 1WHTA 2R8ZA 3DAYA 2EZ8A 1NFQA 4ZVTA 3T94A 1AA6A 2X2EA 4I36A 3QNWA 3WHIA 3PUZA 2WM9B 1UBHS 4FBLA 2NTNA 1LS1A 2HPVA 4JGBA 1BH6A 2AD1A 1IL0A 1CUAA 5D2CA 3H86A 4BX2A 4H9GA 3S8YA 1MQSA 4LNHA 3NZEA 4N9WA 3FFWA 4XI9A 3GBVA 4RSMA 4GZMA 4BZQA 5EXDA 1TD9A 4EHIA 5AVYA 3CU5A 4KLZA 1XAHA 3UCEA 2FJPA 3JRXA 1F1JA 1Z45A 4CN8A 4MW6A 1B1CA 4Q4JB 4RKRA 4W5WA 3Q5GA 3HH8A 2ZJYA 2Z5GA 3L1VA 1C30B 4RHFA 4B4KA 4E5DA 2EF1A 3HTXA 1ZG3A 1CYDA 2GN2A 2GR9A 3BMOA 3GJ4A 1Z7EA 3KZCA 4IAOA 4IEFB 3MS7A 3ZGXA 2JI8A 4RIFA 1GV1A 1ZKMA 3DTVA 3E2PA 2GA8A 1BNCA 2QL9A 5JADA 1T9HA 2G76A 4Z9XA 2DR0A 5E4FA 1I4EB 3R5FA 1E9BA 1GPWB 1SZPA 5A2QA 3GVIA 3DVSX 5JAUA 1DZ3A 2ZUWA 2E21A 2QTMA 3H7IA 5BYJA 2HWXA 1F0PA 2HO4A 4GD3Q 3LK6A 2XBMA 3MPUA 2AE1A 1BVUA 4YUAA 5JG7A 4MA5A 2VDRB 3PKZA 2XF8A 3LPDA 3ZYCA 3VR5D 4WH0A 3A1CA 4BNKA 2O8EA 1KIFA 3BERA 2OPBA 1UXOA 3CW9A 4NZYA 1BU8A 4RQUA 3MGCA 4WRRA 3AU9A 4Q9HA 5ED0A 3TO5A 2D7JA 2WP0A 2ZWVA 1NDUA 2D06A 2FZEA 1DRUA 4EUNA 1K8XB 4BQIA 4GSYA 1UJBA 1VCNA 3NYWA 3TEJA 4KR9A 2HV9A 1PNRA 1USVA 2AZDA 4Q3DA 3X1ZA 5IDQA 4V02A 2O8DB 1Y1KE 2YFHA 4MUNA 1MA3A 4F9FA 2WNSA 3VVLA 2AOUA 4R0NA 2WVJA 4EEKA 4TYWA 4IV0A 1U2GC 2H11A 4N5LA 3FKSD 1NW4A 3LBYA 4J1TC 5AI6A 4CV3A 4ZCLA 3U5TA 2IITA 4CT5A 1NMQA 2CD7A 1XWIA 1L7OA 3FFAA 3NHSA 3RRNA 1TIKA 4IJVA 4QUKA 5K6TA 2QD1A 4ZXFA 2VKTA 2XVXA 1E1DA 5H59A 2RIRA 2BM1A 3RYHA 2WWIA 2J0UA 5AJHA 3RABA 4K6KA 4OD0A 5CLJA 1OROA 2PS1A 3CUSA 2AXNA 2RK4A 2FW0A 3WGYA 3ZG6A 3QPVA 2GM4A 2C1XA 2ZRPA 1I24A 3QWHA 2GAIA 3QU9A 4L8VA 1GPBA 3ZE6A 5FUWA 1NDHA 3KB1A 1QNFA 3B6IA 3PENA 4GRAA 3GCGA 4QTZA 4D8WA 1GSIA 5CPBA 1ZXLA 1G64A 4RTKA 1O5IA 4DY4A 1ZRSA 1MEOA 1RC1A 3NJRA 4OX9B 1W4AA 4NV0A 5HIKA 2WE7A 2CXXA 4L6CA 4UBLA 3SLGA 1N2CA 3TSOA 1KETA 1EQAA 1MOZA 3WG9A 1ZCAA 4BLWA 10MHA 4HYYA 1JR3A 5ELXA 4F86A 2FRVA 2GYYA 3WKAA 4CQMA 5IG2A 1IBCA 2W5UA 4M9CA 4D9BA 2I7DA 4WXEA 3V46A 3FTCA 2H08A 4XIFA 2BEUB 3CB4A 4UEKA 3DMHA 4LJLA 4OXNA 3V33A 4ZJUA 1KPGA 2ECKA 5JECA 3AJRA 1HMPA 3EEFA 4V0MA 2G5PA 4R84A 4M0FA 2WKQA 2OFOA 2RBGA 2A88A 4XOIA 1V1RB 2W93A 4I9GA 2OYRA 4O4IA 1BCSB 3MM4A 3ZCVA 2CWWA 2J9FB 3QRWA 5IXSA 2A9RA 1DIRA 1I51A 3FD8A 5AI0A 2I1WA 1VJ1A 3DMYA 4BX9A 2OGSA 4QXAA 2QVZX 3EYAA 1D04A 1RXIA 1TO2E 2M32A 1A7JA 3ZUPA 1IWOA 4AKEA 3M82A 4GM1A 1A96A 2XOKD 3C7AA 3LS2A 3RVPA 3SICE 1Z74A 3PHHA 3BMCB 2G1KA 2YW9A 3DZHA 4B31A 2C78A 4LCJA 2IDJA 4BBAA 5FUQA 4QJ5A 2A1UA 2CHVA 5JRDS 4J3JA 1LC0A 2ID9A 3BJMA 4KAAA 2P9EA 2Y2VA 1Z0IA 3U3MA 1CT9A 2R1VA 3HP1A 5JFGA 1GQQA 5CDFE 5D8DA 2FQYA 3NWJA 5KYXB 3OLXA 1PG0A 1R0CA 1YZKA 2MYTA 2CEAA 3TB4A 1UQUA 3KLOA 1YDMA 3AF3A 2H18A 4KO8A 3G7NA 4DHEA 4G3XA 1O03A 1VA5A 1CUHA 2RKBA 5NULA 3BXXA 4FT4A 4NHOA 1RMTA 3ZQUA 3VJRA 2GH1A 1Z6ZA 1YBVA 3KHTA 4NRDA 4BQSA 2NP6A 2QX7A 5A3VA 1G5TA 4KDEA 1BXRB 1QAMA 4I46A 4E7PA 4BO1A 2WTEA 1J7JA 1Q7GA 4AZVA 3WYAA 3SHTA 4Q48A 3Q12A 3NWBA 5EWLB 4D4IA 3EDCA 1H9CA 3RLFA 3M81A 4WOCA 5KU7A 1I4DD 3JWGA 2VPIA 3PHLA 2FZ5A 4QPZA 5K0ZA 4DQUA 3OJOA 4JYPA 3MTJA 1M74A 3EIOA 4OSPA 4IHJA 1AZWA 2YWRA 1IIBA 1AS2A 1PT9A 3EZ7A 4G4SO 4RZUA 2JK1A 3ASYA 3DYVA 4TXNA 3FJYA 2J32A 3LVQE 3UC9A 1YCGA 2TMYA 3O2NA 2IE8A 3IELA 3T5DA 3G85A 3PU6A 4NDNE 1IN8A 2CVQA 2POCA 1BROA 1JSZA 1ZGJA 3PDWA 3ZHXA 3ZWVA 1FUUA 4LXGA 4IKPA 1S8NA 2DFVA 1S2NA 3I6MA 3N2ZB 3N7UA 4X6LA 4PTYA 2YWJA 3PPVA 1IWPB 3BYZA 3ZJYA 3NDIA 1LSUA 4TUYB 1PEYA 4UNSA 3MFYA 3NIBA 1F6BA 3Q8WA 1X7HA 2ZJOA 2HRBA 5HG0A 4E5YA 1VYUA 1WDWB 1RADA 1ZITA 2HFJA 1YVPA 3L1KA 4KPEC 3MBIA 3RSZA 1N1DA 1UBRS 3Q7SA 4RLHA 5IW8A 4BBPA 4TT8A 1I2BA 2ZVQX 3W3AH 3ZIDA 2BFAA 4FJ0A 4HWOA 2DX7A 4RJTA 1HZJA 4ND3A 3V2IA 3T7SA 3K5IA 3I2IA 3LY9A 1QLJA 1L3IA 3VR5A 4RKFA 4ARUA 2Q99A 1SUBA 1WKVA 4S1OA 3Q40A 3QSYA 1Y42X 1YU9A 2F1OA 3CURA 1CX9B 2O8CB 2IYEA 5FR2A 4QUHA 4EWLA 1I3KA 3R7BA 3IQDB 1MDFA 1XCLA 3MJ4A 1FYWA 3ZW8A 4QVKA 5IYZF 5IJZA 3GLHE 5K2OA 4YK7A 4EG1A 1RQPA 1CRWG 2OAP1 1IZ8A 5A6SA 1A4XA 3QKRB 2EDAA 3H2YA 1SELA 3FKSA 2H1IA 1Z83A 1SU4A 1ULZA 4O4HA 3BRSA 1UKCA 4IVNA 1FDOA 1IOVA 1QFMA 2XT9A 2BGRA 1WTAA 1R2QA 1EM6A 2QTHA 1HYEA 3FKJA 1IZYA 2P2CA 1FXUA 2GHIA 1E3SA 1JI0A 2RBKA 1AK1A 3FM9A 3JS5A 4Y8VA 4XOUA 3T1HB 2CV2A 1RKBA 3PC7A 1OT3A 2ZI3A 3LGSA 4R6WA 1V16A 4WASA 3ZZ1A 3G1TA 4A7PA 1Z5ZA 4MKFA 5AK0A 5C1PA 3COJA 1BS2A 3QVJA 1GZ5A 1NN0A 2BR3A 5G3ZA 2JLZA 4AWBA 4C14A 4Z2AA 4ARSA 3JAKA 3T0IA 4ER7A 5LZ2A 1IBKB 5ALLA 1P2BA 2QRPA 2O9JA 4KMMA 5HF6A 2O2EA 1A2QA 1PFGA 5K0FA 5BR8B 4C6TB 1TLFA 2B4KA 4BP3A 1UPAA 2FFJA 2YOGA 3LUGA 1RXYA 3RVJA 2BP7A 4NBSA 1F4LA 3VHRA 5ECYA 2R8EA 3WWCA 2XIJA 1PT5A 3LO5A 4DREA 1BDHA 2NUPB 2RB4A 2C94A 1UT8A 1W8DA 1ZRHA 3G1UA 3OEHA 5CVUA 3K70B 4C2AA 4U2FA 4XE5A 3ZI7A 2VSFA 3L6DA 3LVBA 4HDAA 1Z63A 3NNNA 1YAJA 3W6PA 4EGJA 5JYDA 2F43A 2FPPB 1ZIYA 4RC9A 1JTFA 5FADA 3L7DA 4G84A 5DSZA 1DX9A 2MJLA 5FFMA 1AM4D 1ZVVA 2NACA 2W9XA 3IDZA 1J24A 3KZXA 2PH5A 1MB3A 3LFUA 4GR5A 3N6VA 4FEEA 3PC8A 3S68A 3I76A 4PHFA 1PLJA 3WLHA 4B47A 1L6IA 4ANFA 5DM70 3CLSC 5FKJA 1SVLA 2FSVC 3DMPA 3ECSA 1XCBA 3H6GA 2CD9A 1KIAA 2E6UX 3FNHA 4E03A 4CM5A 5LN1A 4YMHA 4JUFA 1YS2X 3OFVA 2JCVA 3NTOA 1XLWA 3V1LA 2IU3A 2YJ5A 3AQ4A 4K9SA 4ND8B 1SQSA 1U8FO 2DJIA 3B9QA 4YFYA 3QU7A 5JXHA 5KJ1A 5ISMA 4DB4A 1VL5A 1TZBA 4FLMA 2RGXA 1N9ZA 1TTTA 4QYXA 2XGSA 3VKFA 5KDDA 1XZGA 2DAPA 2J3DA 3K9GA 4I5GA 5J47A 1DC5A 1ZYUA 1FMLA 1GZVA 4P81A 3R5XA 5TS3A 4DR2B 3ZY6A 3I9V1 3WHPA 3BGOS 4A03A 1HT0A 1AQJA 2DH5A 3OD1A 4MQFA 1G21E 1QYWA 3SZGA 3HKEA 4MUEA 4BFXA 1JHXA 3QIVA 1K3FA 4FI3C 1QQ5A 1ZA2A 4KQ6A 1FF9A 5CNKA 4A8TA 4DLKA 1YB1A 9LDTA 3M34A 2ATEA 1XQ6A 5F5LA 4ZT6A 4Z2YA 4G5XA 3FCSB 4NCJA 1T8TA 4XPIA 3VR4H 3MHTA 4NJOA 1BFDA 1RTKA 4MEJA 5IAOA 1GADO 2R85A 2IH4A 2A30A 4ZTBA 1UBLS 2OPHA 3X1MA 4TTAA 1DQYA 2QB5A 1F06A 2JVKA 3FB1A 3EHEA 4XX0B 1IZ9A 1GKUB 2CW5A 2CCGA 2IHVA 2OAGA 3K6KA 1TTHA 5C7IO 1ZFNA 3DMFA 3NQ41 1T2AA 4DWWA 4D98A 3JW8A 2VHVA 3VZSA 1GAJA 4GMGA 1KZ9A 4JLSA 3DEJA 1CUIA 1VI2A 1SH7A 1XCOA 2IPNA 3U80A 1CS0B 4E1VA 1G5RA 2PEZA 3GFBA 3ICOA 4ZK6A 3HB0A 1N9GA 2BGMA 4LDPA 3AKDA 3IEUA 2W4MA 1N6IA 1P5FA 2CMFA 1T4GA 4HDRB 5KSOA 1J8YF 1DG3A 2IGTA 5EZSA 3U9SA 5A4JA 2VNIA 2VAVA 1C3OB 1N7JA 2REBA 5K6AA 4X1IA 4E5VA 4ZIRB 4P92A 4KBYA 5EXXA 5K3OA 1OV4A 4ETMA 3EEBA 4G0YA 5TVGA 2YBDA 4EA9A 1J6UA 1LSJA 4GL2A 3X1YA 3RSFA 5HE9A 4FYXA 4QU0A 5BN1A 4F92B 2I9KA 1CZKA 4MKRA 3KOMA 1B0AA 5IHPA 1USGA 5HFAA 1HXHA 3QYPA 4ZCRA 1LSSA 3PXCX 5HILA 1WUKS 4C7KA 4TZ6A 1EDOA 1YQDA 3TWOA 2JFVA 1OJ7A 2DHDA 4M60A 4EUHA 5E0OA 3TKAA 4TS9A 1FSSA 2HC9A 1CY0A 2H48A 4YUZA 5JZOA 5KNBH 1FU8A 1JLRA 2PRSA 4GWGA 2EWWA 5ALHA 1L5SA 3PF8A 4FK8A 2JFHA 3REQB 3F96A 1QR2A 3BHNA 3RWBA 2UZ0A 4IMPA 1NE7A 2V5UA 4EF6A 5B5SA 4P31A 2ZYSA 4OSOA 4DG9A 4TXHA 2FVXA 3KAQA 3KKOA 1SZJG 1W5BA 3VO8A 3ZZNA 5A3QA 2NUAB 2FSFA 1QTRA 2ZUEA 2PH3A 4HYQA 2Y4OA 3QGMA 3NTXA 2O0KA 3M8KA 4HCJA 5IJ9B 5DYNA 1DMRA 5IANA 3EVCA 4MQBA 4J03A 2G82A 4RDXA 2ZU6A 5EJ2A 2DSNA 1WXDA 1E2UA 2OXRA 1RHUA 2WD7A 3ND7A 1TMYA 2FMXA 4LWQA 2QRNA 2JLQA 3TDKA 4KK3A 1JEEA 1KPHA 1TA0A 3VKHA 2EJTA 4PLHA 2UDPA 3RNLA 1MQAA 5CDUA 5KZMB 3GP8A 3DE1X 3A9CA 3PIDA 3UUFA 1YRBA 1Z12A 2IIVA 3BSYA 4W1QA 4CCWA 1IRXA 5B4UA 1KSFX 1GAEO 4IGFA 4JI6B 4WKOA 3ELYA 1IXZA 5K45A 3N53A 5I7RA 2X9GA 3RGWS 2ERYA 1BN7A 2F90A 3EIUA 5D86A 3CCCA 5IZCC 4B74A 4XWTA 3GGCA 4QHTA 1Y6FA 1C9DB 4KR7A 4ESEA 1DAGA 3K8QA 5EHXA 3GPBA 4C7OA 1EX7A 3H2JA 3HJNA 4G4SP 4OB7A 4F1KA 3ADOA 4FLEA 2VDPB 3WGJA 4EMTA 1HMYA 4OK6A 1WQ1R 5JJLA 1Z39A 2HHJA 1MORA 3ZUGA 3C6BA 1E7RA 4NOJA 1SQGA 5HHTA 5H83A 3J81k 4ZEXA 3T3HA 3OKCA 2E37A 1PZNA 4X20A 2FWIA 1QYCA 3KTOA 2Q9BA 5J2TF 2ZS7A 3IP1A 2WTNA 3AOEC 3IA2A 3NBZC 4JR1A 3M5WA 5DM4A 4EGFA 2B92A 3VH3A 5FH9A 3I34X 1U9ZA 3RF7A 1LWOA 2H2WA 3NEPX 5BUSA 1J0EA 2B8JA 3WZMA 5EJ6A 1R4ZA 3G3EA 5K6AC 3QBDA 1XYVA 1LTHR 1EXDA 2O6HA 3NGMA 3N87A 3S3TA 2PM8A 4F4JA 1V47A 1IEWA 2IEZA 3PP8A 2DHEA 4ZCSA 1QYXA 4IX9A 3PXDA 1E2GA 2DUUA 3OZUA 3Q9NA 2BEWA 1I2DA 2YFQA 4MRNA 4K26A 2QDXA 3UBTA 2NO4A 4TYYA 2O8FA 2QWXA 3BFXA 3HN7A 4LHZA 4QJIA 1KJIA 2AN3A 4GXRA 1F51E 2P5TB 3QXGA 2VEOA 1N8SA 3G2JA 3H5OA 1M67A 2DFKB 2HDOA 4QELA 1IUOA 1XZ8A 3ZH9B 2G6TA 1F4PA 5D3ZA 4H3KB 4JOBA 4KODA 4IVPA 5H3HA 2D7DA 4TLMB 3A28A 4MGHA 4BMOB 4Q05A 1K1EA 3NM6B 4FYYA 3VC2A 4F4UA 4WBSA 1DSSG 1HE1C 2DH6A 3ZBQA 1B93A 2Y1GA 1QIGA 3QKIA 4B7AA 3VKUA 4QG7A 5AFSA 2XRZA 3R0XA 2Q2QA 1TGVA 2P4QA 3HB7A 1TK2A 4KQKA 2GJ8A 3QOYA 2XQIA 3OQNA 1P0PA 2WFZA 4CKEB 2QRKA 3VNUA 3AUUA 1KFKB 1NBAA 2W8BA 2AC7A 1P39A 3DA8A 3AWDA 3ESYA 3LQQA 4DV3B 3EXEB 3EY4A 2A9PA 5EJ4A 2C5BA 2VXBA 4RDCA 2HTFA 2KM1A 3HMKA 2ZJ3A 1T5LA 1YJAA 1HDCA 2E3JA 4FINA 4GUAA 4ZT5A 1XQXA 4KQ9A 1SKYE 3AUXA 3DDWA 2EJCA 4WKCA 2FPWA 1N92A 5IMBA 5CA0A 2BONA 4N8DA 4YMGA 1CK4A 3JVIA 4B7ZA 1MTZA 5AXDA 1QVAA 4E21A 4D92A 4B43A 1IN4A 4NFYA 3GN2A 4I55B 5H3CA 2LTAA 3OQIB 4YDSA 3ROQA 2QPAA 3W0LB 3ZBUA 2D2FA 2IP4A 1WUJS 4P33A 2BHRA 4ZOCA 3A1NA 2HJRA 4TTPA 4XXHA 1NP6A 1C81A 4HQ0A 2I6QA 3C4QA 3C3EA 4MQEA 4GEKA 4FIDA 4LGYA 2J5KA 5HEKA 3VVCA 5CT8A 3ZN2A 2B2XA 1HWYA 1YQGA 2IZZA 1E20A 2W2OA 2EBHX 4DLRA 1H1TA 4ZT2A 1EFLA 3DF9A 3GLSA 1U9CA 2R3SA 4RPLA 4K0KB 1E8NA 1M8FA 4IYJA 2FYTA 2WJAA 4PYRA 1KR2A 4RKWA 2FOLA 3RSLA 2WIKA 2ZFUA 3JTMA 1Q2UA 1R64A 1Z88A 4HNGA 5LLTA 4AU1A 4HNHA 2ERCA 2PVPA 4CTJA 3H5RA 3QBEA 2NTEA 4KRGA 3GCXA 4A0RA 3NHBA 1MW9X 4Z7OB 1Y3HA 1P4AA 3FZYA 3GDHA 1H0KA 3LUKA 1IWBB 2OCDA 5SY6A 4DEYA 3MSXA 5A4KA 2R5FA 1KBOA 2O2CA 2XITA 4QUGA 4A16A 3AJAA 3F4BA 1WUIS 1SCAA 3OZGA 4YMSA 4EA8A 2VJQA 3ETDA 4KYTA 4YJHA 5KOHB 2JAPA 3HZRA 4XGQA 4K88A 3TLZA 1LU9A 3E5MA 3TOZA 5JCJA 4ABTA 1BWQA 1OWMA 3GFVA 2VUIB 5ALFA 3MFQA 1F20A 1UBOS 1OLOA 1NW7A 1OX6A 4QX6A 2IU0A 4WLNA 1ZIPA 2H0RA 4LOJA 1M5UA 4COOA 2PGAA 5C18A 4YBRA 5C1DA 3HSSA 4IUYA 5EINA 2RARA 3F74A 4QATA 4WUTA 4ARVA 1NVXQ 4FXOA 4GU5A 3SSOA 1QP7A 2QT0A 3EPJA 3K2EA 5AKKA 2PGJA 1X19A 4ARBA 4M0DA 2AFVA 3TCXB 1V1JA 3IXMA 3ZVMA 4HZIA 3PCRB 2ZRJA 2ONCA 4TS1A 3GVXA 3WWZA 5IJ0A 1V3VA 3SZUA 1P7PA 1QE5A 2C1ZA 1SK8A 1QHHA 2I3AA 3M2TA 2R66A 1T5TA 4OQXA 4ENPA 5C4IA 1F2TA 1DAEA 1HG0A 2BFBA 2R8BA 2Y0PA 3CJQA 4MW2A 5HE8A 5CDSA 2X0NA 3CE9A 3ZJVA 4G8CA 5A1JA 3H5AA 3VO2A 1JFTA 1NR5A 2JFYA 3OECA 4QQ8A 4AJ4A 2JI4A 4BFUA 2Y27A 2YXDA 3JQ8B 3L5OA 5CLQA 2DCUA 2XAAA 3VVBA 1TMOA 4MVJI 2GJ4A 4IO1A 3S81A 4OP3A 1FUEA 5EN4A 1OXBB 4EHAA 1RZRD 1OX4A 4PZCA 3NANA 4GYKA 2G3YA 3ZWBA 3CS3A 1YDHA 4J4BA 2OO5C 4Y9UA 1YV9A 3JYPA 4Y2QA 4IZOA 1M1NB 4IF4A 1NRWA 1OBCA 3CZAA 1I7QB 5DHAA 2VXYA 1B0ZA 3R7NA 4DNPA 3DMTC 2V7GA 4BE4A 2O3JA 4X3PA 1N6LA 5ILGA 5GMOA 2JAHA 2Z2IA 1T2EA 2P5SA 4IJWA 3CN7A 4X85A 1A50B 1ZAYA 2B3TA 1ECPA 2ZYIA 2ZYAA 2BOVA 4AKSA 1A82A 2P7IA 2PQ6A 4ZZIA 1DFIA 5BR4A 3IXQA 3N9IA 3G6WA 1ZUD1 1CEXA 1E9AA 4MOWA 2JS7A 2FSUA 3CSUA 3ILHA 4FGZA 2APJA 5F9MA 3GD5A 3JU3A 1DBWA 3T0GA 1YBFA 4G4GA 2CE2X 4FB4A 3R3UA 3GLQA 1KZ4A 4Y9SA 4ER5A 2SHKA 2MINA 2WDZA 4R68A 1U63A 3E0XA 3LXRA 3F8WA 2JI6A 3PNLA 4BNFA 5I01A 3AVXA 3HUTA 2JAXA 3ZTWA 1YNSA 1O3YA 1RC8A 1H2YA 1LY1A 5AI4A 3B8EA 2X5OA 3CGGA 3GZTB 4UNNA 5TQVA 3ICEA 1PVDA 3WGTA 3AZPA 3PNSA 2BTOA 4KO3S 4DC9A 3LBNA 4P82A 1NVVR 4NPHA 1PZHA 2YUTA 4RHEA 4AYXA 3JWPA 3BXOA 2A92A 4L72A 3AI2A 2ONZA 2I55A 1UWCA 2JW5A 4OCZA 3GEEA 3WMXA 4EO7A 4QICA 5KAMA 4DGSA 1FP7A 2C3MA 4XSGA 4PE5B 2RHMA 2BW0A 2QQGA 3L8ZA 1E8MA 4URWR 5LOVB 4DRXA 1CNMA 1CETA 2HMYB 3P9RA 1D07A 1JX6A 2WTXA 2Y1CA 3CG0A 3O21A 3DFUA 4MWCA 5CFQA 3GLRA 2HNKA 5FUMA 3NASA 1RJEA 2CZGA 4KN8A 4PAWA 1QZ3A 3WJ1A 3ZHSA 5L53A 4RM3A 4TYPA 1N6PA 1T9GS 3K9NA 3LUJA 5DKFA 3OZAA 1B2LA 4MPDA 5DYIA 4ZI5A 2JRLA 2KB0A 2PFSA 1P8AA 2AKYA 1W5TA 3G9UA 1BS9A 1T36A 1NC3A 2C29D 2CXNA 2H5JA 2SECE 3GH3A 5DLEA 4E0BA 5IDYA 1RXVA 2WA1A 2VPTA 1PWYE 3DFIA 2HEIA 4FHZA 3T06B 2XUPA 1U0BB 3UWPA 3R76A 3TFWA 1OU4A 5EC8A 1MOPA 1BIFA 2PCLA 3LYAA 4GKVA 2W83A 5AQ1A 3I30X 3ENKA 1UFQA 1TC1A 2HNBA 5FTWA 3KKZA 1E4EA 1THZA 4MSUA 4DCOA 2WFLA 2ZJBA 4BPBA 1L7BA 1YO6A 3L7OA 3PSHA 5CB4B 4QNRA 1SUEA 1K7CA 2HZ7A 1QZTA 3H1GA 1CLUA 2QF7A 2H57A 2O5RA 4G9EA 5DN6A 2FP4B 2NT4A 3ABRB 1OIVA 3GXBA 2V4ZA 1ZONA 3NOVA 4JWTA 4KR0A 5FT9A 4R16A 4UMDA 4DILA 4E13A 4IHKA 1JLSA 4FYWA 5TGTA 1KJ8A 3VR4D 2IUTA 4HQNA 4PYMA 4GSLA 4UNQA 5TEWA 4C21A 1H66A 5ITSA 5A6VA 1H5QA 1X74A 2BFCA 4HBGA 5KYYB 3TXAA 1A27A 1W30A 2PQ2A 3WI7A 3KKEA 3V4RA 1T2CA 4LF9B 3OQBA 3PHGA 1QUFA 3N7TA 3HACA 1K4MA 3NTVA 5CEEA 5THQA 1N6RA 3H8VA 5AXAA 4NDAA 3A1EA 4NCHA 3IV6A 1JDNA 4MNTA 1Y5MA 3RE1A 4EYKA 5BSWA 3WHKA 5IM4F 1CUVA 1NJGA 4TMFA 3GGPA 4IDNA 1DS6A 1C9EA 3IDQA 1OKKD 1QIFA 3AHFA 3UAVA 3WSWA 5JNSA 3GR6A 5DCLA 3RS8A 2OR3A 3BAZA 4BMCA 3C3WA 13PKA 3AESA 4WN3A 2EGHA 1NYRA 4NJEA 1OH8A 1WXXA 3QOFA 5JD3A 4AN0A 2X6RA 4RPGA 2R0QC 3WXMA 1MR3F 3T6KA 2BI8A 4QUEA 3UM9A 5FBRB 4LECA 5CVEA 2VNJA 3PHBE 5EKXA 4U6SA 2HRQA 2EATA 3UF0A 3PDIB 3IUNA 1DIGA 1JNYA 4K9LA 3D5TA 3K35A 2WU1A 1GEGA 1SC6A 3L7AA 2WSSD 2Q9CA 5BSUA 3N6XA 4XWKA 1EXVA 4ND5A 3HCDA 4YUYA 1HOTA 4QDZA 1XMQB 1EVJA 4XUGB 4DADA 3NVKI 4GGMX 1ZJZA 3PFNA 4MP6A 5CU7A 3W2FA 4DCSA 1G3RA 1HQYE 4IFIA 4UEJA 3KCQA 5DP2A 3UMMA 1RJWA 1RBYA 3W3AA 2WHPA 3BWYA 3KOXA 4R83A 4UPDA 4JLBA 1ENOA 4KO4S 5ALPA 3SM3A 4QAJA 2VJDA 2Y1WA 5KNBD 2P77A 3N3BC 3NV9A 1S3FA 1DAFA 3QX7A 4YCNA 3YASA 2XA2A 2ZSDA 3ZHBA 2R7NA 4KQEA 3MRTA 1DIOB 3ANTA 4TX1A 1ZK4A 3SZLA 3KQPA 4O2RA 4E22A 5LP6F 3KZ1E 2OO7A 1MB4A 2WTAA 1KH1A 4H16A 4PPGA 1PWXA 1NVGA 3UT5A 3FTPA 1EP9A 3GEPA 4R71A 3GIWA 4YASA 3V8MA 1C1HA 1ECFA 1LGYA 2O2DA 4IXWA 4NK4A 3KYCB 4DYVA 2DTXA 3A6FA 2WM2A 3STHA 5KNDH 3NHKA 3CBGA 4GPBA 5EP1A 3VZPA 8MHTA 1U7WA 3MSCA 3TQSA 5ICGA 2NU6B 3HJBA 2Q3BA 4U4AA 5DTQA 4ZAFA 4R69A 5CAEB 1UBJS 1ZMTA 4UHFA 4OKIA 1JSLA 3O4RA 1ABBA 4J6FA 4JBIA 3LY8A 4DT1B 4EYSA 5CD9A 1ZD2P 5GONB 1ZW1A 1LX6A 3B9BA 3IMCA 2ZAMA 3D81A 3DOIA 1JALA 5LXTF 1P8JA 3VSCA 2V3VA 3KKPA 4RD6A 2XT6A 1O94A 3CPJB 5FQOA 1Z4PX 2O07A 1OH6A 3JWJA 5ITWA 3EZLA 1YS7A 1M6VA 4Z54A 3BXGA 3WXBA 4QZVA 5FV4A 4HMOA 1DQRA 1SCDA 4Q00A 1A1SA 4PZAA 5JTTA 4MRMA 1GZ7A 3NC1C 2CMDA 3BDIA 4PONA 3OZIA 3VSBA 4Q1CA 3NTLA 5IT0A 1D1QA 2PUVA 4K3VA 2X5JO 4Y6LA 2RGGA 3TAXA 4YXFA 2DETA 3THXA 3RVNA 1R4AA 5CBKA 1U7XA 2ZYRA 5KCMA 3S1AA 2PS9A 2OY0A 1JIQA 1QHNA 1LV7A 4INJA 3W5DA 5DYGA 4M0MA 4C03A 1U80A 2IIQA 3GRUA 3AY6A 4V0RA 5C5EA 1R4NB 2CDBA 3IE2A 3C5WP 1VPEA 1J5XA 4EK9A 4DVGA 9GPBA 3OA0A 2ODQA 2AR9A 1MVOA 3PL1A 4U3JA 4DGQA 3RRZA 3AM4A 3OHMA 4WXHA 1GG8A 1E6MA 1B0PA 3H42B 3E23A 3IS3A 2A5FA 5C3MA 3DJYA 4HRAA 3UMBA 1KC1A 4C01A 4ENUA 3GBSA 4YAKA 3VKGA 3U4HA 1HE2A 3MTDA 2EJVA 1KI8A 3EVBA 4HDMB 2WHYA 1U28A 2WYIA 1EFCA 2M2IA 4WBXC 4GICA 2YHAA 3HLKA 4MRRA 4Q47A 3CLTD 5JQGB 5KQRA 4KXLA 3VI4B 1GLGA 1PFKA 2CY0A 4GI3A 1YNOA 2C9YA 2VIIA 1RIIA 2GWRA 3LZCA 4Q6WA 5CFMA 1SVOA 4KXWA 3WGNA 3CN9A 1UM9A 1U8CB 4Z5XA 5JFOA 1FZQA 3HVRA 4NECA 1GNVA 3TQHA 2QAIA 2EIHA 3DBHA 2YBEA 4LWPA 3ICVA 3MOIA 3TVTA 3ZCPA 1TC2A 4TS4A 4AQDA 2VRNA 1MIOB 4LNUA 3T4EA 3GLFA 3E7DA 5LPNA 1RYDA 4TXJA 3V9AA 1HDIA 3GV0A 4UHCA 3COPA 5DNWA 3E8MA 4CM9D 1U81A 1IU9A 4PRKA 1NOJA 3P9CA 4HO1X 4ESOA 4YCJA 1AGNA 1QOZA 1WPRA 1ECBA 1E94E 3NBYC 1Y8AA 2FPUA 2UZ1A 4WKBA 3VR4A 1WAMA 3AJDA 5IDXA 1X3LA 4LCEA 4OAQA 4C04A 4UBIA 1FLAA 1JT2A 3K1AA 2G4VA 3H87A 3IAS6 2EFCB 4K9OA 1Z4IA 2FZVA 3I3OA 3KEOA 3O9VA 1ABEA 4NYJR 3E9YA 1E9VA 1WPXA 4C89A 1XPOA 4HDSA 1II0A 5B2EA 1A9OA 1CUGA 1E4VA 1FS5A 3C8DA 1KQPA 2BHTA 4MX8A 5FR1A 3WLKX 3NETA 2ANBA 4AM8A 4WBNA 2WIAA 1ZWLA 2HK8A 1C41A 1VE6A 3QI7A 4HAXA 5C5CA 3VDMA 5DCUA 1JHMA 3PFBA 2ZEJA 3TLGB 1YGYA 4TSFD 2QAJA 1G59A 2UVQA 3GZNB 2C99A 3LCCA 1IB6A 2XRYA 1MOQA 2FMHA 3NO4A 5EZ5A 3RYIA 5HRAA 2WQ6A 2L19A 3FY4A 2FFBA 1WM1A 3Q7QA 1UDAA 1OC2A 2BMWA 4FD3A 3RCBA 1IM2A 1PJ8A 4X1YB 1KJ9A 3ZGZA 2I4IA 2E4WA 3ESBA 3WLOA 1DRJA 2GEKA 3FIUA 3DF7A 4G6ZA 1R9JA 3G5LA 4M1SA 4RD2A 4ZQEA 3UXEA 4Z1OA 2O1XA 2XQFA 3T34A 4ZO6A 3WQSB 2WTMA 2FUEA 2IPOA 3CNNA 2WWTA 2X8JB 1SXJD 2Q6TA 1XTSA 3IUBA 4DBLE 3Q3JB 1T4CB 3D31A 3R7SA 3DLIA 3EXIA 3SNHA 4CVNA 2VHYA 4TMXA 4QQFA 2PBZA 2UYHA 3AK4A 3H2IA 2IXAA 4OI2A 2XDAA 3L49A 3A14A 4UAUA 4FMDB 4CV1A 3QY0A 3K6RA 1B74A 1OI4A 2EDCA 1IN6A 3OJCA 3UV7A 3WYGA 4EJMA 2O5CA 5KNBA 4PZLA 1Z18A 4W7IA 3U26A 4JELA 4CLXA 3LZ6A 2HF8A 5HK8A 1KEUA 1ODCA 1MFZA 1GGFA 1HE4A 1YS9A 2FETA 3N05A 3O2JA 3D8SA 3EXFB 3AINA 4EB6B 5DNDA 1U9JA 2V7XA 4LK3A 3S0JA 4LHWA 1RHJA 5A9SA 4II2A 4RM2A 1KO7A 2W6PA 3LF1A 2PLNA 4FUTA 3B2EA 3HA7A 3O4VA 4IXTA 3UOAB 2WYWA 1YSCA 1X39A 2BEVA 4MUFA 1ESZA 4UJ5A 4X9XA 2C88A 2IZ6A 2W6JD 5F4BA 3K0FB 4BQNA 3JD1A 1JE1A 1Y3FE 3T54A 3RRBA 3QEJA 4X95A 2WUVA 1DC6A 5HCUA 3TJMA 2BM0A 1YCFA 2R1UA 2IBMA 2QRUA 3ONWA 3VHLB 1X0XA 3G17A 1U0EA 1H2AS 3LIPA 3UBMA 1GXSB 3U3DA 5BSFA 2C9DA 2WVGA 3UWOA 2NU7A 1E2IA 4X3OA 4XZ3A 5JXGA 1M2FA 4CIWA 1U7DA 3UMSA 2VJNA 2PJDA 4TLDA 4DXDA 1WXQA 2P9TA 3PQ2A 3O92A 5I7SA 1DEKA 2ZI7A 3NDRA 4RF5A 3T7JA 3UGQA 2VLBA 3N0XA 5B12A 4IINA 4C0LA 2G83A 1KY3A 5K2MA 1T6BY 1Z75A 2R4UA 4A92A 5HJ5A 1JU4A 4LRSB 1X9GA 2A0FA 4KR6A 4WEOA 2P2GA 1T3TA 3L4BC 4M8NE 5E6SB 1RI5A 1YVUA 3ZD8A 4YMLA 5DDIP 1GQOA 4JJKA 3MRVA 3AB7A 2A33A 2GK4A 3CUEF 2EAUA 2FSHA 4R6XA 2YJZA 1HLPA 1OXSC 3AR7A 2CBXA 4OXIA 2JGDB 2C9OA 4J16A 2IHZA 2EZ4A 4MKIA 5ARCA 1Q84A 1QIKA 2PQ0A 3T1QA 2BFOA 2VNKA 3KR0A 2IQ5A 3FIJA 1D4FA 2B2CA 1ZC4A 4N6NA 1Y63A 3O94A 4FBGA 4TGLA 3KYDA 4B4UA 1P4JA 5D51S 2X76A 1DADA 1V3QE 1W25A 2PZLA 4KYVA 3ZWCA 5KJFA 1ILWA 1RE1A 2QROA 3ZBTA 5CHEA 4NTZA 3DLHA 4YPOA 3DV2A 2IYYA 2FRDA 2QIPA 2ZW9A 3FBTA 4JLMA 3BGWA 2IXTA 3C87A 1DPFA 5FPQA 3A4YA 3O8OB 3F47A 1N2SA 4A8JA 5JCOC 1DAOA 3Q4GA 2M6LA 5DWDA 3R6WA 2QR2A 1MC5A 2O5VA 4NFLA 4G5RA 1YL6A 2PLRA 4QTYA 4LHXA 1A5ZA 1FVXA 1DL5A 1PG2A 1TYCA 2X5XA 2HX1A 1G8AA 2X9VA 3IXLA 4R9UC 2QUIA 1ZOSA 4UVHA 5JT1A 4D4KA 3P0IA 3RT1A 2W98A 1JEJA 2Z2XA 2V7VA 5EJ8A 1SXPA 2RONA 4H6XA 2NYRA 2WTUA 4G89A 1PV4A 4OJTA 4YLGA 4DEVA 1CQJA 4M1EA 2XMPA 5CFPA 3JXEA 4A0SA 1M2GA 2Z9BA 4OLBA 1EVIA 3K30A 4XWWA 2OVBA 1XEWY 2OE2A 1WLYA 1BFKA 4RMJA 3UV3A 2ZI4A 4NBVA 4DCMA 4HG2A 2V7WA 3MTGA 4CEJB 3HN6A 3KTDA 2PZBA 2IXDA 1FNBA 1PSWA 2J3IA 3OFND 1YRLA 4CM9A 5JY6A 4HDKB 5DWQA 1CHDA 3NDJA 4B0OA 4JT2A 5LYYA 3I5XA 1AH2A 3F97A 3AVQA 4MEBA 4F2HA 4CF4A 3H3XA 2OCAA 3LHSA 4IHAA 2ZUTA 4JJZA 1A8UA 1K08A 3GMIA 4Z7NB 1BKYA 2DFTA 2VCHA 3IQWA 1MBZA 3DL0A 4MVCA 1Y5NA 1JV2B 1KIMA 5K3CA 5I4IA 2ORIA 4X1KA 1EWTA 3TX6A 1VE3A 4YRIA 1WO8A 1TUIA 3GJTA 1XHFA 3F7TA 5I7OA 1J2JA 1G7TA 2RGNA 1L5NA 1F14A 2NYUA 4LYGA 4I9NA 4PO8A 4QOHA 2QKYA 4ZRDA 4L3WA 1NVDA 1NOKA 2RI1A 1LFDB 2Y66A 1AN0A 4QXPA 3GFTA 3P4UA 4RY2A 4RANA 2JZNA 4A23A 2WNIA 1DKMA