3EGIA

Methyltransferase domain of human trimethylguanosine synthase tgs1 bound to m7gpppa (inactive form)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
200
structure length
195
Chain Sequence
PLGSRLFSRFDDGIKLDREGWFSVTPEKIAEHIAGRVSQSFKCDVVVDAFCGVGGNTIQFALTGMRVIAIDIDPVKIALARNNAEVYGIADKIEFICGDFLLLASFLKADVVFLSPPWATAETFDIRTMMSPDGFEIFRLSKKITNNIVYFLPRNADIDQVASLAGPGGQVEIEQNFLNNKLKTITAYFGDLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Trimethylguanosine synthase homolog
publication title Structure analysis of the conserved methyltransferase domain of human trimethylguanosine synthase TGS1.
pubmed doi rcsb
source organism Homo sapiens
total genus 66
structure length 195
sequence length 200
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.-:
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09445 Methyltransf_15 RNA cap guanine-N2 methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3egiA00
3FZGA 2P3OA 1RI3A 2CWWA 2NYUA 1M6EX 3THSA 3M6WA 5ICGA 2AN3A 1DUSA 2WA2A 2IDKA 2G8NA 1L3CA 3K6RA 5KYGA 4CXMA 2IGTA 3SX0A 2PX8A 2IH4A 3EVEA 2ONZA 3HA3A 3HCEA 4CKCA 1QAMA 2BR5A 3E7PA 4RTQA 5K0FA 2AR0A 3NW9A 2XYRA 3Q87B 5CVJA 1EQAA 1SUIA 2UYQA 4X60A 2PX2A 2ZLBA 5HIKA 1NW7A 2GAFA 3A7DA 4ER0A 3OE5A 3G7UA 1MHTA 1VP3A 2JHAA 1T43A 2AOTB 1BHJA 2OB1A 1H1DA 1P1BA 2C7OA 5EVJA 2FHPA 4RVHA 3GRRA 4H0NA 3T7RA 4QVGA 2YVLA 1P1CA 3T7TA 4OA5A 2DPMA 3GU3A 1XDUA 4Y30A 3SGLA 3KQOA 3V97A 3UA3A 2AOVA 4AZWA 4YUYA 4QDKA 1NW3A 2ZZNA 4EK9A 1R00A 4KDCA 1Q0SA 4P58A 1X1BA 4QPNA 4OA8A 2HNKA 5EMLA 5DSTA 3RIEA 3UA4A 2V7EA 3BWBA 5G02A 5F2OA 2YQZA 1BKYA 3KR1A 3KHKA 1NW8A 2PXAA 2BR3A 2R3SA 2XVMA 1KR5A 2ZIGA 2Z6QA 1SQFA 3I58A 4PIPA 3OZTA 5DTMA 2VDWA 1JG2A 3OU7A 4EKIA 3KPJA 5K0NA 1NW5A 2C7QA 5BW5A 3MQ2A 4GOND 3OU6A 2FRXA 3IYLW 3G8AA 4PYQA 2CMGA 2P7HA 5GWXA 3GNLA 3RODA 2ZBPA 3FPFA 3C6KA 3HVHA 3KPYA 5DM1A 2VDVE 2Y1XA 5C1IA 5FADA 1R8YA 4RTRA 4R6XA 2PSSA 3PB3A 5CM2Z 2BH2A 2OB2A 1G38A 3KPWA 4V0QA 3HVIA 3KPVA 4K6MA 4PYKA 3UJBA 3FTEA 4C06A 4RVDA 3FTCA 3BZBA 3A27A 3GRVA 4HG2A 1X19A 4DF3A 3CKKA 5E2AA 3EPPA 1M6YA 1ZHFA 5HOQA 3M33A 5HEKA 4YV2A 3ELDA 3LCVB 3TR6A 3FTDA 2AVDA 3HCBA 5LQNA 4FT2A 3BGIA 2OY0A 5DSXA 2AZTA 2I62A 3BKWA 4G56A 5DX1A 2AOTA 5LR6A 4U7PB 1EG2A 3LKZA 2QRVB 4PCAA 3A25A 2PJDA 5DPMA 5ERGB 5FWDA 1UFKA 3BXOA 2GB4A 3O7WA 2YX1A 3TKYA 4BP3A 1X1CA 3SXJA 3PX2A 3T0IA 3VSEA 2JJQA 5EMKA 2GH1A 1YFLA 1KXZA 3KQPA 1RI1A 3R6TA 3T7SA 2GS9A 5BP7A 5LQCA 3C3YA 3BWYA 3EGIA 1NBIA 5E9WA 2IP2A 4CTKA 3U81A 1I4WA 1AF7A 3G88A 3EVCA 5FQNA 5EKXA 4DA4A 9MHTA 2EJUA 4FR0A 2OYRA 2P7IA 4M37A 2C7PA 1G8SA 1XVAA 1QZZA 1XCJA 4YMHA 3PTAA 4Y2HA 3B7PA 4L7VA 5K0EA 3G5LA 3X0DA 2E5WA 2ZSUA 1JG1A 5DRYA 3WSTA 4DCGA 3MTIA 2ESRA 5K09A 3I5UA 3A26A 1KYZA 2PGXA 4RVGA 5ICFA 3TMAA 2NP6A 2P3QA 1NW6A 1G6Q1 2ZWAA 4IWNA 3CC8A 4YUVA 5KS2A 4GEKA 1ORIA 5MHTA 3DH0A 3DP7A 3P8ZA 1XJ5A 1JG4A 2IIPA 5E1BA 5FULA 4EQZA 3HEMA 3KQYA 4HH4A 3GRYA 3Q7EA 4RTNA 4PINA 3VC2A 5GIPE 2PKWA 4CTJA 1OR8A 2PT9A 2EX4A 2K4MA 5GM2A 2H00A 4R6WA 2P8JA 4GC9A 4IV0A 4UOEA 2ZCJA 3P2EA 3UFBA 2QYOA 4C04A 3UWPA 3CJRA 5LQAA 4PYNA 2A14A 4HTFB 4R8RA 3TOSA 4AX8A 1AQJA 3BKXA 4M36A 3HNRA 4FZVA 3JWJA 3B3FA 3FUWA 3NWBA 4ER7A 5C0OE 1JTEA 5GINE 5CD1A 4MHTA 1L3IA 3OPNA 4ER6A 3LBYA 5KQSA 3RW9A 3HCAA 3MGGA 5HILA 1JR4A 5DX0A 3OFJA 5K0LA 4BLVA 4CKBA 4QVKA 2JG3A 3FUTA 4YV0A 5DWQA 3K0BA 2IH2A 2JH9A 3BT7A 3KQSA 1FBNA 3KQVA 2P35A 2Y1WA 3LBFA 4YUWA 1SKMA 3LL7A 1RI4A 4R05A 3HTXA 1NV9A 4E2YA 2PX4A 4IV8A 4C4AA 3AJDA 3DXYA 2O57A 1ZKDA 4GOOD 1G55A 1R74A 3LECA 4OBWA 3SM3A 3VC1A 1X1AA 3M6XA 3PVCA 4EVIA 1WY7A 2P41A 2FK7A 5K0GA 4GQBA 4ZTBA 1DCTA 3KQWA 4GC5A 2PWPA 3IHTA 4AUKA 1RJGA 2G72A 2WA1A 5LQUA 2EJTA 2AOXA 4FP9A 5LQJA 1AQIA 5CUQA 4PCLA 3BGDA 4RSRA 1I1NA 2XBMA 2O0LA 3DMFA 1YZHA 4ER5A 4OQEA 5CVDA 3OZSA 5U4XA 3SR4A 3GJYA 3TRKA 2ORED 4M38A 3UJ7A 2ZBQA 2AN4A 4PONA 3B5IA 4RTOA 4BY9E 4F84A 1YB2A 1D2CA 2B78A 5K8VA 5B1SA 3FUXA 3GO4A 1U2ZA 5EHIA 3G8BA 1XXLA 2ZIFA 4X63A 3P9KA 3M70A 4PIMA 5FHQA 4DMGA 3JWHA 3QV2A 5JR3A 4HGZA 5EQJB 2R6ZA 5DLYA 2EG5A 4HTFA 5CCXA 4EMSA 5IKMA 3GGDA 2VDUE 3DLIA 5GP1A 3GCZA 2DULA 2ZW9A 3C0KA 4LG1A 5LQRA 1O9GA 2YTZA 3G89A 1F3LA 3DTNA 3LHDA 3R9XB 3AXTA 1QYRA 5CVEA 3DMGA 2BM8A 2VS1A 1WG8A 3MTEA 3HA5A 3L8DA 4C03A 3QOWA 2YXEA 3OZRA 5EMJA 2Z6UA 2AOUB 3EMDA 1VIDA 4HRAA 2H11A 3BUSA 4AZVA 4CWAA 4MTLA 1YZ3A 3FPHA 1BC5A 5E9QA 1O9HA 4RYLA 3OU2A 3DXXA 4LECA 3IV6A 5FWAA 1I9GA 3MB5A 3CBGA 5E2BA 5EIFA 1JTFA 3V8VA 2H1RA 1Z3CA 4E2ZA 2ADMA 3JWGA 1IM8A 3BWMA 1N7IA 3ERCA 3ER9A 2IBTA 5HZMA 3REOA 2CMHA 3KR9A 4OBXA 4DZRA 5FTWA 3NMUF 1VL5A 2PT6A 3MERA 2IPXA 2ZTHA 3ME5A 4IKPA 2ZVJA 4KIGA 1FP2A 4KW7A 1P91A 4PYMA 4E32A 1KPHA 1WXXA 3NJRA 3EVAA 4PGHA 3MCTA 3NWEA 1ZG3A 5T67A 2P3LA 3NDIA 4C07A 1F38A 3TQSA 3HP7A 2ZZKA 1FJXA 7MHTA 3CGGA 5FQOA 3P9IA 5GOZA 5T6BA 4OX9Y 4F85A 4FSDA 2B2CA 3NVKI 3MAGA 5M5BA 1WS6A 4RWZA 2PXXA 1NT2A 2PY6A 3KQQA 4PWYA 1JQ3A 2G70A 2NXNA 2PVCA 3CJQA 5FCDA 4CKEA 2IBSA 2KW5A 4QPPA 5LSAA 8MHTA 3TLJA 1SG9A 2Z6AA 2OO3A 5DRTA 2ZWVA 3DMHA 1FPQA 2ZFUA 3EVDA 3I64A 2AN5A 5K03A 2BM9A 1NV8A 1XTPA 3HVKA 3KKZA 3KQMA 3P2KA 3PT9A 4QTTB 2ZZMA 4MQ4A 3AWIA 2GLUA 4KWCA 4ATNA 5D1HA 5DT2A 3CJTA 2UYHA 2HR1A 2AOUA 5E1OA 2NNWB 1NKVA 5ICCA 1SUSA 5HIMA 3DUWA 4R8SA 3LDUA 5HIIA 3HA7A 2ZULA 1HMYA 1XDSA 4QQKA 4DM3A 5EPEA 1JQEA 3PLAE 2HMYB 3TM5A 1RJFA 4HGYA 3FPEA 4RTMA 5CVVA 1O54A 3SVZA 3VYWA 1R6AA 3G2MA 2YUIA 2BR4A 3LCUA 4MIKA 2PBFA 3G2QA 3P9CA 2I9KA 4RV9A 4RTLA 1INLA 2PXCA 1ZGAA 4E70A 1VP9A 2ONYA 1Q0TA 5BW4A 3LX6A 1VLMA 2OKCA 2JH8A 2OZVA 5DTRA 4FSXA 4DCMA 1FP1D 2FK8A 3GWZA 3A7EA 3SSNA 4RVFA 3G2OA 3JWIA 4DKJA 4GOMD 1R18A 3FYCA 1JSXA 3C6MA 4KRGA 1KIAA 2P40A 3B3JA 3KQTA 5DM4A 1L9KA 1WZNA 3SMQA 5EZSA 4PYIA 2QM3A 4WXHA 5H02A 4KIFA 3P9NA 2F8LA 4AZTA 4BLWA 5KVAA 2QY6A 5FHRA 2Q41A 1QANA 3LSTA 2HWKA 2OPBA 1XDZA 3CCFA 3FPJA 3UJ6A 3ID6C 5CIYA 1RJDA 5IH3A 3P2IA 3UZUA 1X1DA 2VP3A 1ORHA 5HFJA 4AZSA 3NTVA 1VQ1A 2EFJA 1SQGA 2FYTA 3E05A 2NXCA 3LDGA 2GPYA 4HC4A 4QTUB 5EGSA 3F4KA 1D2HA 3P97A 1YF3A 4GF5A 3HM2A 5HIJA 2UYOA 4JXJA 3AXSA 4EKGA 3R3HA 4V0RA 1B42A 2QE6A 1NBHA 3R24A 1JSZA 3S68A 4A6EA 2UZ4A 2PX5A 3B89A 1KPGA 4BP1A 1P39A 3TFWA 5F2NA 3HCCA 2AVNA 2NXEA 3ORHA 2B9EA 3THRA 3TPZA 3NDJA 3ANXA 3DXZA 4LWOA 2IDJA 4MWZA 2V74B 3KU1A 1QAOA 3B3GA 3EEYA 5P8WA 2WK1A 3SSOA 3E8SA 4YV1A 5DX8A 4E31A 4F86A 4PNEA 2VZ9A 2I6GA 3KR0A 5E8JA 5FA5A 5CCBA 4XUCA 1R8XA 2I7CA 3AY0A 3EMBA 1IY9A 5DTQA 5GIOE 5E1MA 1EJ0A 2PV0A 2AS0A 3IEIA 3EVGA 1EJ6A 3D2LA 3LCCA 3UJDA 1AV6A 2CL5A 4GUAA 5C9ZA 1M0EA 3M6UA 3HCDA 4PYJA 3UJCA 1G60A 2GA9A 3EVFA 1BOOA 3FUVA 3UJ8A 5EC8A 1RI2A 3DLCA 3UBTA 2N47A 2XYVA 3O31A 3OCJA 3OFKA 5CVUA 5K05A 3ELWA 5K0JA 3FPGA 3GXOA 3C3PA 5K0CA 1ZQ9A 3M4XA 3UJ9A 1UIRA 4P7KA 3DULA 1L1EA 1DL5A 4POOA 3DOUA 5EMMA 5DM2A 4PYOA 1Y8CA 5EHGA 1EIZA 1VE3A 3GRZA 4ER3A 1TW2A 1L3BA 1HNNA 2BZGA 3O4FA 4X61A 3R0QA 3TKAA 3ELUA 4XUEA 3BWCA 3MCZA 4RX1A 3EVBA 3I53A 1KYWA 1JG3A 3CVOA 3H2BA 4LWPA 4YUZA 2UYCA 4P7JA 5EEGA 2O05A 4KVZA 3PFHA 3HVJA 4B17A 4E2WA 2O06A 4X41A 2PLWA 5DXJA 3PFGA 2JHPA 5E1DA 4GBED 5F2KA 4C05A 5K01A 2G71A 2XVAA 3LGAA 4E30A 3EVZA 3LDFA 2C7RA 2YR0A 3MHTA 3QOXA 1EAMA 1UWVA 1RI5A 3NVMB 5E8RA 3EEOA 2XYQA 4E2XA 3BGVA 4RTKA 4FS8A 3G2PA 2OXTA 2G1PA 5GM1A 5EEHA 2AOWA 3FRHA 1V39A 2LD4A 2CKDA 1SVUA 4XUDA 4RTJA 4YMGA 3A4TA 1KPIA 3I9FA 1PJZA 2HV9A 5EZQA 3GRUA 2B3TA 2ERCA 4FT4A 4BLUA 1D2GA 4O29A 5EOVA 4U7TB 5BXYA 4E33A 2HTEA 4RTSA 4A6DA 5FA8A 2FPOA 4QDJA 5EKUA 3SSMA 3UJAA 5KQRA 4KDRA 3KR2A 1TW3A 2OBFA 3GDHA 2ZBRA 3EGVA 4C08A 2NP7A 4GOLD 3LKDA 4HSGA 4PGGA 2PWYA 1XCLA 3PS9A 1YUBA 5DM0A 3FYDA 1WXWA 5FUBA 5ICEA 4XCXA 2B25A 1YFJA 5E9JA 5EIWA 5JUWA 1KP9A 1N7JA 3TM4A 1ZGJA 2O07A 2P1DA 4Z2YA 4FGZA 4DQ0A 3LPMA 5DXAA 4P7GA 1N2XA 1G8AA 2ZIEA 1TPYA 1VPTA 1QAQA 4WVLA 1NE2A 3ELYA 5EG5A 5T64A 3E23A 4YUXA 5LQKA 10MHA 2IH5A 3OE4A 3FTFA 1VBFA 3G5TA 4RTPA 2YXDA 1PRYA 2IFTA 3M6VA 4ISCA 4M7RA 1KHHA 3P71T 1RJEA 1MJFA 3FUUA 4X1OA 5K0BA 4PYLA 4P7FA 2QRVA 3EGEA 4OQDA 1JQDA 3FRIA 4NECA 5D1NA 3ER8A 3PX3A 2FCAA 2NXJA 3DR5A 3HCFA 2JHCA 3KPUA 1IXKA 3GIWA 4QQNA 2YXLA
chains in the Genus database with same CATH superfamily
2E4ZA 4RETA 4XOUA 4AJPA 2NTJA 2Y4NA 3VTAA 2ANBA 3ZVKA 1UCFA 1UJBA 3I62A 2V1XA 1EVLA 5CTAA 2ZUEA 1FVXA 2XWQA 5KTOA 5JZMA 2PJUA 1EVEA 5IF3A 5JXWA 5E7QA 3RRNA 4NF2A 2AA3A 5K0FA 2GEBA 2HSJA 3A4LA 1FXWA 3KLNA 4M76B 4XVRA 5CT6A 5LXTB 2FSFA 1XZPA 1EQAA 2OG1A 4CL3A 1WCIB 2FQWA 1KYVA 1S7CA 4E21A 4HNAA 3AFHA 4YCAA 1W4AA 2GESA 1WABA 1PJCA 2PUTA 3C7TA 4RKWA 3RBVA 3SKYA 2B2NA 4AJLA 5J47A 5AMXA 2EBHX 4X90A 1EVQA 2BP7A 2BZ1A 2YOFA 3UMVA 3VU8A 4H0NA 3K1AB 4OK3A 1M74A 4BKPA 2QU8A 1RBMA 1KWGA 3A6HA 5DCLA 4DV1B 1MR3F 4B3MB 3B6IA 3JQDA 3HU1A 4PIVA 2VLIA 3IVAA 2W0SA 1CE8A 4AJJA 5EJ9A 3KZOA 3TIXB 5AUPB 1MO4A 2PAFA 1T4DA 1Z15A 4I1SA 4ICIA 3KKNA 3KR1A 2PXAA 2HBQA 2HJWA 2GZ1A 3FROA 1KR5A 1H0SA 1OZ0A 1VCOA 3D64A 4OJMX 3B1KA 4XSHA 4ZOLF 4C14A 4CFYA 2YZMA 3CRMA 3ZWCA 5EJ7A 4EKIA 4BJHB 2ZRMA 3EUEA 3MSXA 3TSCA 4FZ5A 4KOAA 1QGAA 1TM7E 2H4JA 3DDZX 4JJFA 4PYQA 2V0CA 3RS9A 3OPMA 3WGIA 5D51S 4WK6A 2I29A 1GQSA 2F2TA 3C4QA 1DLIA 4X71A 1THTA 1X7XA 3C6KA 3ICPA 5IM5A 3T4EA 3BERA 3ECSA 5BSKA 3LHFA 3M81A 2R7LA 3IP8A 2BH2A 3KB8A 3HDHA 4PZDA 3DKKA 2FPPA 3FNHA 2D00A 1YL5A 1OWNA 1ZMXA 3ICWA 4LGVA 1A5SB 4S3MA 2RHJA 3V4LA 1RLOA 4M21A 5DO9A 4KPYA 2BFCB 3WWZA 4BZXA 4RAQA 1QNFA 1GPMA 1M1NA 3KZKA 1C7IA 4IXWA 5FP0A 1ZIXA 4Q37A 1NR5A 4QEZA 3V8EA 5IAJA 1E8NA 3AY3A 2E7ZA 3BGIA 3UMRA 2FWAA 2IV2X 3EC2A 5LMUB 3PE6A 1ZS9A 2DUJA 2NPFA 4OFZA 1BCRB 1KO4A 4WJZA 4UOQA 4OREX 5JHGB 4MQMA 1BVHA 3QV1A 1UFKA 5HGJA 3N6XA 2OUIA 3BILA 5KO2A 5EYPB 3MWEB 4KXXA 3I3SR 4NEGA 2L42A 4UE6A 3LAWA 4U00A 4K9MA 4Q48A 5F1OA 2BYTA 1E6LA 1T24A 5TSDA 3P4UA 4KNVA 1HE3A 3ADKA 3LK7A 5BP7A 3X1DA 1GM5A 1IONA 1Z0DA 2XR1A 1BWPA 3B6KA 3KSBC 5JJKA 2WFZA 4OQFA 1EVZA 2BMWA 3PIDA 4HAXA 1OAAA 5EKXA 4D6YA 5BW8A 1XAGA 4Z49A 2GJSA 4D97A 2DUWA 5FR2A 3WXBA 4NEHB 1JLHA 4RSHA 4M37A 1OTXA 1DG3A 2ZRDA 1MVLA 2XA9A 1IQUA 1ORDA 3AFGA 4Y2HA 4KPGA 5JNRA 2WU8A 4IXTA 3RC7A 3UXEA 3D43A 1WPXA 2VPZA 1GA6A 2POQX 5EP1A 2ZZMA 5C53B 3BIFA 1VE6A 2AEEA 2I55A 2PZFA 4L08A 2JGIA 1W59A 5AP9A 1OCEA 3H99A 3PA6A 4JLBA 4ZIRB 2WJ6A 5LP1A 4AL4A 1D04A 5E1BA 2PKQO 1UQUA 2HREA 4NU8X 2CFOA 3HXMA 3VC2A 4GPD1 3WHKA 2Z8YA 4CTJA 2IVZA 5D85A 2XZTA 5IABA 2LRHA 1ADYA 1KC3A 2PZMA 2YJ6A 3HABA 2Y0PA 5IBCA 4BMOB 2YIMA 4LDZA 1JA1A 2WT9A 1XGKA 1S3SA 2I34A 3HNRA 3UATA 2BELA 1I9CA 1D6NA 3EXG1 4DMUB 1UJ2A 3H0CA 2L2QA 2KI5A 2MMCA 1BXGA 2Y76A 1R37A 5IM4F 3OPNA 4FHCA 3NTXA 4Z1MD 1ISMA 1G2PA 3MJTA 1QRDA 4UUBA 4YJGA 3WLFA 1W88B 2AYZA 1R10A 1U2GA 2IX3A 1QIJA 1V43A 4IICA 3L1UA 1E0DA 3MWLA 1ECGA 2HD4A 1E1KA 4EGFA 1IBCA 3H5IA 1KEUA 1P6XA 1MABA 2XMCA 3LL7A 1O4VA 3E0QA 4E2YA 1G1AA 2E21A 5EP2A 1MIOB 3QVGA 4KACA 2GEDA 5EMHA 1PT5A 5HZHA 3R3SA 2OV6A 1X8XA 4II2A 4Q01A 3MGBA 1T5IA 1AQUA 3RUPA 4CF6A 4LHVA 2P41A 3FYHA 3B1YA 3AJRA 4P32A 3K70C 4OXKA 3HBMA 2C98A 4INAA 5EFZA 1DCTA 3MIIA 4LJRA 2QVZX 4G07A 3D31A 1IG3A 2K7ZA 1RXYA 1P0IA 1PDWA 1MENA 4FP9A 1YXMA 4MQFA 2D2IA 2OV3A 1ZBQA 3D5QA 4F3NA 3A6LA 4PQEA 4S0ZA 1LKZA 3IB3A 2EGUA 1YR7A 2BM0A 4RSRA 2XOKA 3MF4A 1LBQA 2ERXA 1YZHA 3PFWO 4MYCA 4D43A 2KYRA 2Z04A 3C1TA 1YASA 3N59A 3QXGA 2CXOA 3B36A 3DZBA 4QYSA 3TDNA 4BE9A 5CB8A 4P81A 4FS3A 4Q4HB 3SC3A 4DIKA 2UZ1B 2YMLA 5MDHA 2H08A 3DD1A 4XIGS 4PBTA 5CH3A 1YB2A 4BRZA 3PUIA 3NBQA 4WA7A 4IHJB 5JZSA 1V1MB 5EE1A 3P9KA 2PGOA 4EF4A 1GWNA 4ZI7F 1TZCA 2WPDD 5EJ8A 1VFNA 1VI2A 3VZQA 2PGIA 4YT2A 4D7AA 3UMMA 1GUDA 2O5RA 5BSWA 3JQAA 1PNTA 1J2EA 3IULA 3FNQA 5CFRA 5DHFA 1KYXA 5KYYA 2GAIA 2OO5C 5JMTA 2GZHA 4X7BA 3R9XB 2KE5A 3LUAA 4LDNA 4BRSA 3DMGA 2CZQA 4CW7A 2I7DA 5JROA 2JIZD 1RKBA 1YC2A 4ME6A 3EIEA 1FFWA 3NWJA 1GNTA 1FCJA 3C43A 5FNVA 1G4HA 3OJWA 3OU2A 4C6TA 1H4SA 1HQDA 3PNMA 1I9GA 1IXZA 1ADGA 1Y8RB 2XTMA 3K4PA 2H1WA 3OZUA 4UHHA 3GLGA 4B3SB 1YDGA 5EIFA 3HFGA 5IXYA 3V8VA 3IAM6 2GCPA 4NI5A 3RUDA 2BONA 2GF2A 3FBWA 3V4FA 1H9CA 3LX5A 4K81B 2BBOA 5AM3A 2V96A 1FLVA 3KR9A 4P3PA 4EM6A 5B57C 4MR7B 4WK2B 1ENZA 3MINB 3KBOA 1AGYA 1UDCA 3AY6A 5JAUA 1Z88A 1ICIA 4K6HA 1F9EA 3K0HA 1E5DA 1ESEA 2FKNA 3BG5A 4GX0A 4OQNA 3GDFA 5ETJA 5C7LO 7MHTA 1WLYA 4ABTA 4OX9Y 1AD2A 1TO1E 2FEXA 2I3BA 1GPBA 2ZBDA 4KBGA 5LYJA 3ZZ1A 4IJMA 4J6EA 5HVNA 3IUPA 2PY6A 2WOOA 1YRBA 3KQQA 4FEEA 4IIGA 4P82A 1OXVA 1GDHA 2QMEA 2HC9A 1MJGA 2OMEA 1YCGA 2PL5A 3FFWA 3HEAA 4A0QA 1AUXA 1XTUA 4Y98A 4E7OA 4US2R 4NU0A 1QP0A 1G9SA 4NZZA 3PSAA 1O95A 2WF7A 3LWBA 2V7WA 3O4GA 3STYA 1LTKA 1S6YA 4MGHA 3ZK8A 2R8PA 4UOZA 1TIBA 3I8XA 3EVDA 1LZKA 3WV5A 3MJHA 4LYGA 3ZDYB 1TM5E 5H4HA 3U40A 1O57A 3KSUA 4GX5A 4JYPA 4LHEA 1CB7A 1OKKA 2XUJA 2IEDA 4C5CA 2G07A 3QE0A 3MGAA 4W5QA 2EEPA 3D4IA 2JIQA 2F3RA 3IDAA 4R2KA 3TL6A 5ICCA 1FLNA 4G8JA 3V3TA 1TD1A 4LDRA 4R8SA 2ZKLA 1DVRA 1N4DA 1OLSB 2H4ZA 3QBJA 5KX5F 1JQEA 4WXRA 4KR9A 1KE1A 3U3XA 5AM1A 2QEQA 1DPFA 1N5OX 4R9UC 2PFSA 4IAOA 2M6LA 1ICEA 4EA8A 2Q0HA 3CWZA 3FD8A 3HFJA 1DJQA 3Q7TA 3KE9A 4LJLA 1ZWLA 1L7VC 4P22A 5HTOA 2A88A 4BJ1A 2GK6A 3W4JA 5JNUA 1XKXA 1IM2A 5JZVA 2G9RA 1U3UA 4NOLA 4EY3A 2R00A 3CH7A 1GNPA 2CZCA 4OJTA 3H4IA 1T2NA 1ZVJA 1N34B 3PHLA 5FH9A 4AK9A 1EK6A 2VYNA 5KOYA 3N74A 5CA1F 3ZXIA 2DHDA 1ENYA 4MKFA 5TXGA 3DMTC 3PHCA 2RGBA 4PRYA 2HKIA 4TYYA 3HJTA 4GBMA 3MCUA 4BIIA 4EFKA 3EBLA 1ATIA 2JBHA 4AMGA 3BK1A 2ZR7A 3WAJA 1Z0IA 5TC4A 4L51A 1KIAA 1X7YB 1P9NA 4ZYZA 1T9GR 3IVCA 4A03A 3ZBTA 2B5VA 4BNWA 2WZDA 3IMCA 3WL3A 5DTJA 3LKVA 2JD2A 4QE3A 3WA7A 4DXDA 3HN6A 1IN5A 3KZMA 4IIJF 4B6RA 1B8VA 4HMOA 3L93A 1YCFA 2QRKA 3F3MA 4LQLA 3SE0A 5BRJA 1I6LA 2F3PA 1C81A 1DU4A 1FRQA 3W8FA 3U1VA 4HC4A 3LTNC 4NCJA 2G6BA 3SEFA 3ZX5A 1WDWB 4XCVA 3SYKA 4R54A 4B35A 1GAQA 3HPRA 5TLSA 1RPZA 3TGWA 3H0EA 1OC4A 3T4UA 4BO7A 4E07A 4KAAA 2HZ7A 3KKKA 4ESOA 2OQRA 4HDSB 1P39A 5F2NA 3PF9A 4BN5A 4DRXA 2VKTA 1PZXA 1O6BA 3I1YA 3RSSA 1V3VA 3KXKA 1DEXA 3ORRA 1THMA 3U7EB 3M0EA 4O4HA 2C96A 4LHWA 1CR4A 2WK1A 4D9CA 1JZSA 1ECFA 2LE0A 4WV3A 5JFTA 3GPIA 2F17A 1L7AA 5J4KA 3R0XA 3EMBA 2XJ4A 4GMFA 1LPPA 1R7RA 1C4XA 2BEWB 2JANA 4QJ5A 1FXUA 1W0KA 2CHEA 3C3WA 4PGAA 1IOLA 4XTRA 3DOJA 3VYRB 1NDQA 4HXYA 3U60B 4P3OA 5TGTA 4IILA 2VOEA 3VR3D 1LBTA 3LK6A 1ZUWA 1P4AA 2RG7A 4J7AA 4KN8A 4R8KA 3FUVA 1Z6PA 3NI2A 3OFND 1XZLA 3TQHA 1B6TA 4C3UA 1UJ6A 2R751 3H5VA 4CG1A 2BFMA 2XYVA 3O31A 4Z4GA 3L0BA 2XQFA 5K0JA 5BSMA 1MIHA 3SF8A 1TM3E 1PFUA 3SEAA 2WIBA 1PR0A 3FYTA 4LOLA 3EZFA 3KUDA 4IGEA 3VX3A 3WYNA 4DYHA 2HA0A 3B53X 4U0KA 2HIHA 1Z0AA 1H2RS 3CWQA 1U1EA 2XKBA 1ZVMA 1HNNA 1Y1LA 3LOUA 3S8EA 1X38A 2O7NA 1GU1A 1XMXA 1J90A 2VG8A 3AM3A 1EWRA 3D1JA 2BEUB 1E79D 3PFHA 3PWTA 2WSMA 2OHHA 2ID4A 2PLWA 2OHXA 1DJLA 3HG7A 3L82B 4GBED 2NU8A 5K01A 5KNBA 2ZT8A 3L0OA 2V65A 2G71A 3QLEA 4DSOA 3QLVA 5KI6A 5JS7A 4M8IA 3DFKA 3DOOA 4JP8A 3IOCA 1KY4A 3J81A 1K5GA 3KP1A 2JFBA 5CFLA 4OXQA 1CULC 1HK7A 2XUIA 3C6ZA 3RS5A 2FQYA 1LWNA 1GUYA 1WSBA 1ZN9A 1P77A 5GM1A 2W6ZA 4CKYA 4AP6A 3Q8WA 2J87A 3ROGA 3MMZA 2XGOA 2H5JA 3V7NA 3WBKA 1IBMB 1FFHA 1QOQB 3MJVA 2DE0X 3GJTA 4Q5IA 3OOWA 4XUDA 3SHOA 1GIAA 3DEFA 2R97A 1T1GA 2JFGA 3RADC 1RHKA 3VPBA 1IHOA 1KYYA 2A9KA 3NFYA 1L0BA 4FVTA 4LOAA 2CJPA 4FSHA 5E9AA 1DJMA 2O4CA 4ZO8A 5KSWB 3FA2A 3IAM1 4WESA 5EOVA 3ETHA 3F6RA 4FCCA 4D0LB 2MSKA 1E64A 3UH0A 3UT5A 1NMQA 2R1VB 1RYBA 2C07A 5F7OA 4BKMA 2GN6A 1BS2A 3AETA 2CNOA 4IJ5A 1UBTS 2FSGA 1UPTA 5KQRA 2Q0XA 1OTYA 1TT5A 1X9GA 4ETMA 2ZBRA 3JARA 4C7KA 1UOEA 3P0RA 3HB1A 2YZKA 4XH9B 2WNIA 3D3WB 3W34A 2GJ4A 3FYDA 4IIXA 4K3VA 1F2DA 2DUMA 2Q8NA 1EVKA 1GGVA 2NSDA 4UM5A 3GLSA 3P2MA 5F23A 4IXDA 5DKFA 3O2SB 2JLUA 3DWIA 4I08A 3GCWA 4FFWA 1GXSA 2BGWA 4WT7A 2WWYA 2QMQA 3SZLA 1R15A 2AEMA 1N9KA 4LSZA 4ZEMA 4CUZA 4ND2A 3OCVA 3OICA 3GQVA 2D62A 2E4UA 2XNDA 1VJRA 1P44A 1SB9A 3L8MA 3WLOA 2HJRA 2R2AA 3PNBA 1KYQA 1NXSA 4TRJA 3HJBA 4JJIA 2A6PA 2NUBA 4I7EA 4Q3OA 2JHCA 4H9GA 1S2LA 4Q3DA 1CVRA 2IYUA 2YXLA 4YJ3B 2XHEA 1SGWA 2GVZC 4JLVA 4K9DA 4JBHA 5EKSA 4HR7A 9LDTA 3THSA 3K96A 1FRVA 1OAKA 5E4JA 2GNAA 5IVHA 2R65A 3K6RA 4GZ6A 1VGRA 4WZBB 2PX8A 2VNKA 1N2JA 1G0OA 1NMXA 3EVEA 1PEKE 3F9RA 3L1HA 4RTQA 3AUTA 2C2MA 4L50A 3NEPX 3I04M 1ZLXA 2DTXA 1TVCA 2ID7A 3L2OB 5K4GA 2PX2A 4UQPA 4ZMBA 3H2HA 3WKCA 4IIUA 1E0AA 4TKZA 2J33A 4LBZA 3PGJA 2D59A 3D2CA 3ETDA 3K4QA 5E3IA 2GQ0A 3K9GA 5FFMA 4F3CA 1A27A 2BCJQ 3ZTYA 4AULA 5AW2A 4ES6A 1OVMA 4RKQA 3AR3A 4Z1OA 2GEKA 4JAVC 3OTHA 2AXPA 2LR0A 3P2JA 1NVGA 4MKIA 3ZCXA 1THGA 3NT4A 5CPFA 5FYDA 3ROQA 3RT7A 4B2LA 5HHTA 1JFRA 3GR6A 1QX4A 1TPZA 2CNWD 2J6BA 4OHBA 4N8EA 2HMVA 4PG6A 1Z4OA 4TT8A 2M32A 3SGLA 3ZKWA 1JHYA 4ACAA 4F45A 2O3QA 3A58B 5JCZA 1SKAA 1NW3A 4MKGA 3I2HA 1BHSA 3T38A 4RK7A 4NOJA 1LNZA 3GMIA 1LFDB 1S8FA 4H35A 4C43A 5DSTA 4B33A 3BWBA 5G02A 3QLUC 3UVEA 1YA4A 2BL4A 3E70C 3RE1A 4CMGA 2HDOA 1Z56C 3CG4A 4WBXC 3FIJA 1KU6A 3SHTA 2WHYA 2Z6QA 2WQZA 1M5RA 4BQRA 1D8TA 4DDWA 3LWZA 2VDWA 2EDAA 2BDEA 2VHTA 1EHYA 3JQ7A 3T54A 5K8UA 3RCBA 4F84A 1GQ2A 3G8AA 721PA 2X5NA 1HG1A 1PG5A 1CIVA 4Q1EA 5EZ6B 5HKLA 3HE3A 1DUVG 4CEJB 1QCDA 1BVYF 4EUKA 1H1LA 2ODBA 3T5AA 1CF4A 2GCOB 2J45A 2NO0A 3GVCA 3MWFA 4ZAYA 4ZCLA 1FFBA 3R40A 1ZI9A 1XYGA 1LQTA 1FJHA 3G7SA 4RS3A 3UJBA 4DSZA 4OP2A 2L69A 1HWYA 1LTQA 5CP8A 1N6IA 4OHOA 3TYXA 4QGBA 5FB3A 3M1YA 1L7DA 4LKRA 2P2DA 3SBXA 3ZWQA 4GPEA 1H85A 4LE1A 2CD7A 4YWHA 3PQ6A 3S1AB 1OLUB 3OPQA 4OHVA 2FV8A 3BD9A 3AMVA 4WDQA 1IZYA 1NYRA 3PDUA 1OA1A 3WVNA 3DDCA 5CXUA 1CP2A 1Z5ZA 2NSHA 2PH5A 3A25A 4G4SP 2HA2A 1MJNA 4KH0A 1O97C 4EGSA 5EUMA 4ZYWA 3RS0A 2PLNA 4I1RA 1PX2A 1S2NA 4N3AA 1PYOA 3D3JA 1C9JA 4J16C 1YGYA 5KSYA 3VZSA 3N39C 3QI7A 2H52A 5F3DA 4CCSA 5BT8A 2NVWA 2AMLA 4XFJA 3EGIA 3BFKA 3CLHA 4JKYA 4C7XA 3CUWA 3I30X 4CTKA 4JLJA 4NK4A 1TO6A 3VNVA 4RMJA 2Z9BA 3R5SA 4IHJA 1U0JA 1R66A 3DOCA 4M55A 4OYRA 2VHXA 1EINA 1C3VA 3K9NA 1I4TD 4PS1A 3JWPA 2D1QA 2XJ9A 3OZEA 2W83A 4YRIA 4NYJR 4QOFA 4FN4A 5FD8A 1UC9A 3D3NA 3WQQA 1GKKA 2X0EA 1RRPA 3W8DA 2X0IA 1SBZA 3HLTA 4UEQA 3KVRA 4YYZA 3HDJA 3T3IA 3VO1A 3GLVA 1N6HA 3HKDA 4OQLA 4MRNA 4YCJA 5LB4A 2ZWAA 3KC2A 4MV3A 4QXMA 4YUVA 3RB8A 5MHTA 3DH0A 3OAAD 2JIZA 4UEKA 1UXOA 2H3HA 3FPKA 1YBAA 3OQBA 4WADA 4HH4A 4ZJZA 5KVVA 3CF4G 4CU5A 1JNXX 1AKUA 3O83A 3WWYA 5EJ4A 4PLFA 4QJ4A 3E7FA 4PTYA 3RFFA 3FMVA 4GC9A 4LYAA 4NZYA 3RS4A 1GPNA 3L01A 4XYLA 4GLJA 2A14A 2MR6A 4MWOA 4B6SA 5CXXA 5JYCA 4HDCA 2OFPA 4FZVA 1OVGA 5B58C 1N33B 3KOZA 2JFHA 3OPXA 1KORA 2ODAA 3AJ8A 3AHCA 2PS1A 3G17A 4FYJA 4KYIB 4Q02A 2WE8A 2DWCA 3MTQA 2QE7D 4BNZA 2VJMB 3HKBB 2JG3A 1FSPA 5B3JC 1NUHA 1YJCA 4ZALA 4D3FA 2JH9A 5EWLB 1K63A 5FOQA 3L6UA 1FNNA 1VG0B 2QD3A 1AK2A 4R05A 2FFBA 2QROA 3ZJTA 2OD2A 8GPBA 2QR3A 4FMCF 4HVAA 3DXYA 4AKEA 3FPAA 3FZQA 1NE7A 3EQ8A 2RGYA 4RVSA 1BN7A 3LA8A 1RQRA 2CSXA 3O84A 2ID9A 3LNTA 3RWMB 2LDXA 3C2QA 3FHOA 2ZS8A 3WC4A 4EQ6B 1EWYA 4YAIA 1A4IA 3WGVA 3I8SA 1FY2A 1WHTB 3BSFA 3KQWA 4NVRA 2RE8A 2B7CA 2C42A 1IPFA 2VJAA 4PS0A 2F1HA 4MPDA 4KLRA 3FWKA 2R1ZA 2REQA 4MVCA 4IIBA 3RU7A 3SP1A 4OUKX 3GLFA 3B7GA 2VSXA 1IB6A 1J42A 3KOMA 2HCBA 4EKYA 2V1UA 5KC8A 3NOXA 2R1UA 3PKJA 4FYVA 3QMMA 1ZD8A 4I0WB 4EJ0A 2QRUA 2VHJA 1FNSA 4JS0A 1ZOLA 3H5WA 1P4GA 2RI1A 1ZI6A 4RZXA 3G8BA 2CE7A 2Q4DA 3HL0A 5CX1A 3BMNB 5SYAA 3C3MA 3ANSA 4RW0A 5EQJB 3ZE7A 1W36C 2JBAB 3F6CA 4R1MA 5EIBD 2G25A 1XFAA 5MGNA 4JI7B 1GP2A 1WUHS 2IKSA 2WUGA 3I2YX 4MQBA 4RD3A 3AVYA 2ZW9A 1GTJ1 1ISIA 4BFXA 4C0KA 2QMHA 3U4HA 3D8UA 4RQTA 1QYRA 1UBLS 2QUZA 4HNGA 2PUEA 4KB5A 4W5OA 2I3AA 4IGIA 4DIDA 4MI1A 4LGYA 4HBGA 1WXEA 3TLZA 4BVKA 2D0IA 4B3JA 3JYHA 1Y1PA 1K75A 2WUWE 4ZAWA 5K3CA 3Q15C 2H31A 4DUPA 1RYMA 2PMWB 1JDPA 2HU7A 5AVZA 3WRYC 1CEQA 4FGWA 3R8XA 5AVKA 1EG7A 3IV6A 3QKTA 1X7YA 1HYQA 1KO8A 4MS4B 5HMMA 4A8TA 4C7OB 1JI3A 4IIYA 2QTAA 3I39X 3KOXA 3RD5A 3IOEA 2GEFA 5DVZA 1XWIA 4WBNA 3ERCA 4Y7CA 3M34A 3ER9A 2WYHA 2X5OA 4ZJYA 4M0KA 3LLUA 1AO0A 1Z8FA 2VQDA 5KOHA 1R8QA 2JJMA 5JCJD 1P2VA 3CLUC 1YS7A 5JJIA 4PCUA 1E2UA 4R1NA 3P9QA 1HNWB 1U0GA 2PRZA 3QHPA 2VCEA 2B4RO 2ZJOA 4FU0A 3C3CA 4AF7A 2VBCA 2H8GA 3AUUA 1P18A 2GPWA 2ZEJA 2QNBA 2ZI7A 3I23A 2FOIA 4FOOA 4HFRA 5FQOA 3ADDA 1V95A 3RRMA 2R96A 1V5EA 1QWSA 1WVMA 4EHIA 3ROFA 3K7EA 2PXXA 3L7NA 1XXHB 1U0RA 3OURA 4EELA 4XGKA 1R27A 2XT6A 5HF9A 3R3VA 2PGJA 1H2AS 1QPGA 2W8BB 2WZQA 4C7BA 3ESDA 4MB6A 2DWQA 1RLJA 2BGTA 2GTHA 1IWPB 3ITEA 2AJBA 1HE1C 1KIFA 1GL7A 3U3JA 1H69A 3ZY4A 1FPQA 1Z2CA 3MEQA 3J7AC 2TSYB 4YCCA 1UXJA 2GFHA 3EOBI 1I32A 2BEWA 3V2UA 1PFKA 4W8GA 4R9VA 5DT2A 2LVBA 5E1OA 1KDOA 3GL9A 4ZVMA 1C4KA 3ZIAD 1O6CA 4F8EA 4BO3A 2VAPA 3AF1A 5LKAA 2YKGA 1G3UA 3ETLA 2ZYAA 3R3YA 2X2OA 2ZQYA 1XDSA 4NRDA 5HIIA 3OFNA 4B3DA 2X4DA 3PLAE 5IDYA 4MYHA 2X2EA 1CP3A 3II6X 4PX2A 1LU9A 2P5YA 2NU6A 5B1DA 4EHDA 1NZDA 1GY8A 2D5IA 2J4DA 2F1KA 3TX6A 4UD6A 4BKRA 5JH7F 1B00A 2WD7B 4I4LA 3P7MA 4V0OA 4C0BA 1JDUA 1D9ZA 4TS3A 5ALKA 1M1XB 2O0KA 1G5IA 2HDWA 3P9CA 1HURA 3HUFA 3DYBA 4KBYA 4E70A 1CJVC 4HZUA 4JOQA 2IT1A 3BRQA 5A3QA 2W11A 1OX4B 1EM8A 2ISSD 1N0WA 3DE1X 1D4AA 3DO5A 1RQXA 4L4SA 3CRRA 4NBWA 5P21A 1EGHA 1QQTA 2I7TA 3ENWA 2V03A 5KYUA 5FPKA 1GNRA 3VNBA 3JXEA 1WB6A 3O8OB 4IFEA 5JQWA 1H6CA 1FVHA 3CLVA 4G5RA 3ZJ4A 3UCEA 3ZD7A 4GYYA 5JPCA 5JSFA 2HH9A 1JPJA 5DM4A 5CX4A 4OHYA 4ZCRA 1YMUA 2RHLA 2CL6X 4CRWB 1IK6A 4MYUA 1UZNA 3WIUA 1YRWA 3SJUA 3TQIA 3V8MA 2YWHA 3VHRA 3GAAA 5CLGA 2LKDA 2OPBA 3A1CA 3PP8A 1C30B 1JU4A 1VBKA 2ZBVA 3O4JA 4B6QA 1BS9A 3DBLB 1KNQA 1VQ1A 2VT7A 1E4YA 4TS1A 4M83A 4BB6A 2C1ZA 4U7HA 1SKYE 1FJGB 3F4KA 1Z6QA 1N1MA 4YJKA 1CV2A 1HRDA 2GZAA 2JIPA 3N53A 3N2KB 4KBFA 3VU0A 4ZI5A 4EKGA 1ZOPA 4UVIA 4CQLB 4C6RA 1V8ZA 2GD2A 2BN4A 3OP1A 1GOTA 3Q7IA 3TFWA 2J30A 8OHMA 1GT91 1MVNA 3N6RA 1KXJA 4YQYA 4KQJA 2NXEA 3T3OA 3VHXB 2YJ3A 3OJXA 1NVFA 1G21B 2C83A 1BYUA 2QLMA 5P8WA 2VSYA 3V1UA 4RH1A 3U19A 2CXTA 5JQGF 1YZTA 1RWOA 1Z63A 2D13A 2VZ9A 2JD0A 4G24A 1DWUA 5FA5A 5TEWA 1TEHA 3L6EA 1U7WA 4JYBA 1ZJJA 3N86A 4M89A 4D8WA 2REXB 5E1MA 1YQUA 3QE3A 3ZEIA 1P2FA 3ZH9B 4JV5B 5TPZA 1V48A 2Y6UA 4MW7A 1YB7A 2RGWA 3WOVA 3NC1C 1ES9A 2CMFA 2QX4A 4TM7A 5CTJA 3EHDA 4TTSA 2GSDA 1IVSA 4ZXPA 1UMBB 4OB6A 2LCIA 4KP7A 3GUHA 2I2CA 3IBFA 4PG7A 5DEIA 4DW8A 3IVRA 4RGVA 3PC7A 4XM2A 4JX8A 2W6ID 1T15A 2WDZA 3PVZA 4OTZA 1WCYA 3M4XA 4KX5A 4I6EA 2ZPAA 3CUTA 1C8BA 1VJDA 4HLUC 4QUBA 4BNDA 4F56A 5FEUA 5HOEA 3E22A 3E18A 1Q91A 4JEHA 3IP7A 5FPTA 4DUZB 4ARIA 3TR0A 2VQ3A 1XLTC 1E18A 1YHZA 2NUPA 3LS2A 1CYDA 1Q16A 3D2AA 3PXDA 4RM2A 3W6OA 1E2IA 1E5QA 1M8KA 1CQJB 1V5GA 2BFFB 2IYVA 2W6QA 3P2OA 4XUEA 5E95A 4ARSA 1D4OA 1Z82A 5IC4A 3H2BA 1KFCB 3AESB 1T9KA 3CURA 4MQUA 3ISTA 1JQAA 1ZITA 3QQPA 1JG6A 4GPTA 5GJVC 1X39A 3VOBA 5ALSA 5AOBA 1G8HA 2MYTA 4RY0A 4PHGA 1XUOA 2PCJA 1BMQA 4CL0A 3K3PA 3PC8C 1M6VB 4KL8S 4AKIA 4HGNA 4BTEA 3GH3A 5AKIA 3AHHA 1O9BA 1EUDB 3B1VA 2OENG 1HSOA 4JDUA 1YDWA 4HDKB 1UUFA 3QOFA 4JI6B 1P1FA 3UMSA 2E85A 2XWBF 2F43B 3LPAA 4V0ME 3L07A 5JI3E 2G1PA 3Q3GE 4L95C 2MSCB 4CQNA 3AL2A 2IOFA 3DZ8A 1IXRC 2DR0A 3ZLTA 4CDNA 4MP8A 2B99A 1DUIA 1W44A 1K4YA 4UJ5A 2QTWB 4LX8A 4UHJA 5DGDA 4XX0B 2PWBA 1SD5A 4MICA 5DMXA 4KE8A 4DSUA 5B5SA 1TFRA 2P9ZA 5I9NA 2FN9A 3CTMA 4EGJA 2OLJA 4GECA 3V7FA 1NXVA 5AI5A 1GJRA 3BB3A 1N3IA 2JDID 3CM0A 3OZWA 3UWMA 1NBWB 2EGHA 1QS0B 1UQTA 2PKXA 4AIRA 2GNPA 3FZYA 3QUBA 3KSRA 4BDTA 1AG9A 2OBFA 3VVLA 4DR7B 4CEJA 1G5FA 1U1DA 4HSGA 2IRWA 4I4NA 2GEVA 2GCGA 1T5DX 4Z99A 2QTMA 4B7XA 1QRAA 4EKDA 1ZW6A 1X8LA 2PFGA 1O8CA 2NIPA 4MB0A 1LQ2A 2O07A 4M86A 4LHSA 2IEYA 2CNNA 4QARA 5KREA 1GL3A 1TKCA 1TVKA 4V3BA 4B4UA 4WVLA 2VUUA 3EISA 2IH5A 1TIPA 3LPNA 1TVEA 3S81A 2VHVA 2P75A 4WNCA 1ZL0A 2H2HA 1RJEA 1AUOA 2XIQA 1KJNA 4MDHA 3S99A 3SXPA 3E81A 2Q6LA 1CKEA 2EZTA 1XCOA 3GQBA 5CEJA 4P7FA 1MCZA 1XZCA 3IIEA 4TV9A 1YTUA 4NH4A 1NDUA 4DC0A 2W6CX 4KZKA 2WHPB 2Q3LA 1XU9A 3EUFA 3IAFA 1EA5A 5C5CA 3V4RA 1E1LA 1ZIYA 3FZGA 2PGNA 1V71A 1RI3A 2X5XA 1NU8A 4OG2A 5BSUA 3IAS6 3IUYA 3PXBA 2HQRA 3SX0A 3KUKA 4GM4A 4UDXX 3UUFA 4OYYA 2Q5IA 4UBKA 5ARCA 2J6HA 3AUFA 1FTYA 1H9BA 2AR0A 1GFZA 3HB0A 1ODTC 5FI3A 4MINA 1KO5A 3RK0A 2YHBA 1P61B 2GAFA 2VDQB 2KJQA 2OAGA 3A7DA 4G5QA 5BNZA 2XRZA 4TZ6A 2R7NA 4DQKA 1A8HA 1DKNA 2G36A 2R8BA 2C7BA 4JUBA 5AHWA 4ARAA 2IHJA 2PSEA 4TVSA 1T43A 2PMBA 4KN5A 4Y2TA 3RAFC 1MV8A 2WFAA 1J25A 2KQUA 1XI2A 3KKQA 4DBZA 2YVLA 3KJZA 4S12A 3GEPA 2VAVA 2ZB4A 3DFIA 3HR8A 3RYFB 4Y30A 3R9KA 1POWA 2L0XA 3FNEA 2QMZA 1NP6A 3RS3A 2YN4A 1D2AA 1A95A 4QPNA 2V0GA 1IQ0A 3H2SA 1W5FA 5EHQA 2RG1A 1B26A 2GXSA 4DG5A 3IRUA 3RTDA 2R3SA 3ES9A 3DBRA 3QFSA 4HN2A 2G1KA 2JGNA 1DC4A 1SNYA 5BQ5A 4JIMA 3IP1A 1NW5A 1UBMS 5TDHA 5JXHA 5TJHA 4ZK2A 1J0XO 3WZMA 1Z4PX 2O8FA 3ZBPA 4TX1A 3ETGA 2P7HA 3JAWB 5KB3A 5DBGA 4RJTA 4PY2A 4HKTA 5LLTA 4F6RA 5K3BA 4NS4A 2VJMA 5BSRA 1UDRA 3HKBA 3PEUA 3AB8A 1JLSA 1VKOA 2QE7A 3WL7A 1OYOA 2CFCA 4RVDA 4YACA 2IUYA 1Y7HA 3DYVA 3L7YA 2CK3D 4Y1GA 4Y2YA 3X1JA 1GLGA 3EEIA 3GRVA 4BTVA 4PLWA 2LIVA 4CODB 4O4LF 3PJRA 4QULA 4KIUA 1NUAA 4YXFA 3RLFA 4M9UA 2RAFA 4DDMA 1TQHA 2D7CA 2LP4Y 1XF9A 4I5GA 1Z25A 3B38A 2EKPA 2W2NA 5ITVA 4PC3A 2CNBA 2JKVA 3E3LA 2AFIE 3EWIA 3FCUB 5DU2A 3GGPA 2QRVB 3BXFA 4N54A 1YQGA 2HCFA 2GHTA 3OF2A 2IUUA 3SHQA 1XMIA 1AHPA 1D2MA 2XKKA 4RZ2A 4FCWA 5A03A 3FI0A 2QN2A 3RBAA 5LU8A 4KUEA 1HL7A 3EYAA 3UAOA 3HP1A 4CCAA 4LVCA 4ODIA 3AEXA 3ZYCA 1KAHA 4FFRA 3C3YA 2OD9A 4GD3Q 3TW0A 5IT4A 1LNQA 2O2EA 4RFSA 1WMBA 3C8MA 3OIUA 2DHQA 4MW2A 4TMYA 2FX2A 4PF1A 1CRQA 2DKNA 2YYSA 1GTG1 3M89A 5KAMA 1OIXA 1X87A 5TGZA 1XZ8A 5GTDA 2P7IA 1YDMA 4J49A 4EARA 4Q4JB 1Q44A 1XA0A 4OQ4A 4XM0A 1CF9A 1ULUA 4ZVKA 1XTJA 2GASA 4FUQA 2J3EA 2V7QD 3Q3CA 4LXHA 4HPXB 2JASA 5BN4B 1KYZA 3PENA 4GICA 2FDXA 2GX6A 4ZVRA 1N9GA 4AS3A 4B3BA 1NGSA 4Y2JA 4MWCA 1VSTA 3IPXA 1W5SA 4TXLA 4YDQA 3ZLUA 5KNDD 3W0LB 1F6BA 4KXFB 2FFQA 3ZH2A 5B1YA 5FTKA 3I5YA 1I7NA 5BPFA 4KO3S 1NVUQ 3ZWXA 4K9QA 3CRNA 4RQAA 4MHOA 1GZUA 3TSYA 3ULKA 5TRTA 2PKWA 4JUCA 4RF3A 3P5BA 3L0DA 3D8BA 3OESA 3BA1A 4D9IA 3BE6A 4S2EA 4EVSA 2R8EA 3AB3A 1Z4QA 3AHFA 3IP9A 3JQRA 2JK1A 2NSYA 1Q77A 3Q3JB 2QXTA 4HBZA 1E4VA 4UKDA 4E13A 2EU8A 1JEEA 2YFYA 1Y8QB 1PYDA 3P9XA 1WHSA 3NHFA 2OLEA 3GROA 4EFLA 4JI4B 3VZBA 1JDBB 3SZOA 3QEJA 5K0LA 3GLIB 4BUZA 1XCBA 1VMIA 2B69A 4YJHA 5DWQA 4J7CA 1BGWA 4AJIA 3H11B 2P35A 4XFDA 5IZCA 2A57A 2Q3HA 4PZYA 4YA6A 2WEKA 1NV9A 4LYEA 1TK3A 3SJZA 4CMAA 3R5JA 2H06A 3P2YA 3QF4B 2A94A 2NV0A 1HOTA 4K05A 2ZDGA 3IBSA 1RM0A 1DS6A 4UM9D 3UHJA 3DDNA 4V1CB 2ORWA 4V2IA 1BVRA 1SVMA 2LTAA 3SICE 5FWYA 1TTPB 2QZJA 3COJA 5AW6A 5I4CA 3IDFA 4JHLA 1JHOA 2VXOA 5EJAA 3CVYA 1TM2A 5CBKA 1Y6GA 1E1DA 1L4MA 3QW2A 1RW4A 2O6LA 2REBA 5ALDA 2W2KB 4XQCA 5LQJA 1BCSB 4TYPA 1FU4A 1NQXA 3T6KA 1ZONA 1OXBB 4URWR 4BQNA 2R8XA 3AJ9A 3SS7X 1FTQA 4OI0A 4YT5A 2QRLA 5AKXA 3MYYA 4ZDWA 3GJYA 1ZGCA 3WR5A 3H2GA 1YA6A 3LI2A 1CHDA 4LCJA 3OUTA 1Q19A 2OECA 2ATCA 3ZIAA 4K0KB 4KRFA 1FMJA 4RL6A 3IMKA 1EJBA 3GO4A 3L5KA 2ZIFA 5CNJA 3M70A 3BMQB 4UZEA 4KXQA 2PH1A 3QV2A 1SXJB 1QLWA 2OR3A 1DQRA 4FBLA 4N65A 4AJKA 5CCXA 2RGNC 3GGDA 2XE8A 5ICSA 3ST7A 2JVKA 1OOEA 1A9SA 1PTKA 3EW9A 3IAS1 2EWMA 4M0DA 4DNOA 1Y37A 3K2QA 4ZCSA 3FJYA 4R9SA 5AVVA 3C87A 1H6DA 2Q0SA 2VS1A 1DBIA 1XRLA 2ATIA 3HA5A 3LC7O 4ZZ2A 3AF3A 3AVWA 2ZTMA 3S1SA 2D8MA 3FZNA 3QFHA 2VOJA 1LK7A 2A1IA 2Q4OA 4KMRA 4CWAA 5I5EA 4GKJB 1H2HA 4HAUA 5T57A 3INGA 2VTVA 3T7AA 2E89A 4EY5A 3NV7A 3HKCA 1KEKA 3G7NA 3ZIUA 3KB2A 2NMVA 1OU4A 4LISA 1DIAA 2QX8A 3UB4A 5JD5A 4DY4A 1ETHA 1VHTA 1JTFA 4TL6A 2H1RA 2W2LD 3BB1A 3O2NA 1K7FB 2O52A 2HL6A 1SPBS 2O0JA 1DIGA 1RRCA 1V5FA 1NURA 1BJTA 1COWA 2BFBA 2V6GA 4ZODA 1DAKA 4XJVA 4WPGA 3SY8A 3PTLA 4R3WA 1E3TA 2VJDA 4IO1A 1JHUA 4JBYA 3I12A 1AY0A 4L8GA 4YPOA 1Q3HA 2XF8A 5JS8A 5LU9A 1N25A 3WK6A 3I2FA 5HM8A 2GN0A 2F1IA 1F38A 1X2BA 3TQSA 4JI8B 3BSWA 5L3RA 1YIAA 4IHAA 5GOZA 2PUJA 2I2WA 3N2KA 2QP4A 3T1OA 3ZJYA 4UU1A 4D4MA 3W2TA 4CQLA 5CJPA 2C8LA 2ZXEA 3X1XA 3MWDB 5DW3A 4J3JA 2VSNA 3O4VA 4TVKA 2G70A 2DFKB 3EIFA 3UGJA 4OXXA 4LI3X 1NU6A 3KJFA 3OT4A 3ZW7A 1PJTA 2XWJI 4F3KA 2CV1A 2XNKA 3LQYA 4IHQA 5DI3B 3IQEA 4QSHA 4RWEA 1D4FA 1SULA 4B4KA 4H60A 3VR5H 2BBWA 2Q4BA 4EA6A 4L6IA 1M5TA 2ZFUA 3GLUA 1CUEA 4OPMA 3PQ5A 2JEOA 5E0OA 2PEYA 2Y93A 3KQMA 1FEZA 3P2KA 3T99A 3WYAA 1TFUA 2ILVA 3OD5A 1NVTA 2X0RA 3HBFA 4ATNA 2QVYX 4ZVLA 1UM9A 3RYTC 4MRPA 1JLKA 5I9MA 4QTYA 5C52B 3AM5A 1SUSA 5HIMA 3QIAA 1EFHA 1KKLA 3V1TC 1O94D 2ZULA 3NS7A 1Q7CA 4IIFA 4NZPA 1RCFA 4QQKA 2Y9PB 2VAMA 3KKMA 4XLZA 3FYSA 3HDTA 3S40A 3FKSD 3KQLA 3UYLA 3S0JA 1CRLA 4G0WA 3IJRA 3BB4A 1U8FO 2WI8A 4AP5A 5C5IA 2YUIA 2BR4A 5EE0A 3KLMX 1I7SB 2YDYA 5AK4A 4Z8YA 5LC1A 1EFTA 4R83A 1JIJA 1LK5A 3CPHA 4WZBE 8ATCA 5BR8B 2EARA 3CU5A 4US0R 4PQGA 2JJ1D 4LF4B 1SCJA 1WCXA 2AN1A 5JAQA 2QYTA 3QSGA 5T8KC 3SD7A 2J48A 4TYWA 3ZU3A 4LJ9A 2H2WA 3ND8A 5L4NA 2YWFA 3CZAA 4RVFA 3G2OA 2AFRA 4BZWA 3RAGA 5DGIA 3RVNA 4MV1A 4LSWA 2DEUA 1DAPA 1XBTA 4MVJH 2DU8A 1Q22A 2E4VA 4AC9A 2X58A 3F7MA 4AI6A 1T4CA 1T29A 1E6MA 2P40A 4X54A 2IELA 4JYAB 4BWYA 1Y82A 4FYWA 4YP0A 3UN1A 4HDKA 2VN8A 1SCIA 1XTTA 4ZYLA 1N2SA 1EK1A 4IJQA 4KK4A 4Y18A 5YASA 3HYRA 4K9SA 5D7BA 5ECYA 2HWKA 3GCXA 4NBTA 4DR3B 3CR7A 3ID6C 1QZXA 1Z13A 1H94A 2ZRCA 4UFOA 2Z0MA 5IH3A 2IJGX 2QTHA 1R2QA 4ZGWA 3E4CA 3KU4A 3OQIB 2ZAMA 1NNEA 4DILA 3RSCA 3CNBA 5FLEX 2GHQA 2W2PA 3AFOA 4B2PA 4CFSA 1NBHA 1F06A 2CEAA 2QXYA 2W90A 3NFRA 3Q7QA 4JGBA 3GYGA 5C8ZA 3QX8A 4JT9A 1NW9B 1DIRA 1PIWA 2AMVA 4DV6B 3SJAA 4R2JA 2FCRA 3RBXA 1DX6A 1TUBB 4UUMA 3BTSA 5H3HA 4DG9A 1QE0A 3EEYA 5KTTA 3DM5A 3E9CA 4A0SA 4K88A 5DLQC 5HIAA 4U6SA 1IZZA 2GHRA 1WNFA 4EENA 1JHRA 1MO5A 1HQYE 1R8XA 2I7CA 3G13A 4QJBA 3RREA 2HJHA 4WLUA 1T8TA 3BL8A 5TMEA 3PC4A 1NVXQ 4MQEB 4I9FA 1SA0B 3FMOB 1A1VA 1UMCB 4DYDA 3AOEC 4ZEXA 1LS1A 1JX6A 2VRBA 3NOOA 2PJRA 2G4VA 2HA5A 4YT4A 3G68A 3TGLA 1WZ2A 2RI6A 2QVBA 2GVDC 3QEAZ 4FINA 1IBRA 2JLYA 1RYDA 2AEFA 5IT0A 5K0CA 2PQ0A 3CUUA 1UT8A 5F35A 4S35A 3U3ZA 2R85A 2XNCA 1H4QA 3FMIA 3FBTA 4NENB 1ZGBA 1U2QA 1FE8A 1A1SA 1ILWA 3LRTA 2X2FA 4JP5A 4LW8A 4DHWA 1WBDA 3ZWAA 1E9CA 4AYXA 2CXNA 2XGJA 2IL1A 2UYCA 2C9BA 4XA8A 1JIVA 1BH6A 3BHIA 1QG6A 1XTRA 4JP3A 4QBKA 4BTLA 5KYNA 1ESZA 3DV9A 3FDZB 4B82A 3IE1A 5E1DA 3RSFA 1RAAA 4WFKA 2IHUA 3QP9A 4KFCA 1PWZA 3LGAA 4M46A 4E30A 2Z3WA 3EVZA 3RVSA 3LDFA 3NPAA 1Q1BA 4IJWA 2R47A 1NZJA 2PSHA 3F90A 1RI5A 5U9CA 4Q7LA 5AKLA 2DH5A 5BSEA 4EP1A 2BRUC 4XQGA 4BB0A 2BI4A 4WNAB 2UZ3A 3RYFA 3G79A 2VXBA 4JVNA 4B3HA 4Q3LA 5MGBA 4AM8A 3HM9A 1XEWY 2R44A 4P08A 5KTKA 4IS3A 4L8YA 3ENZA 3HCWA 3I37X 3FI9A 3QTTA 4AX4A 5CD9A 2P6RA 4O29A 5CLHA 3H17A 4W9NA 4FN5A 4Z86A 1LDNA 5BVHA 2IZZA 2G9UA 3E9ZA 1JXMA 1JHQA 1GUZA 1A5ZA 2D1RA 2BWJA 2XSZA 4Y2XA 3H5LA 3UJNA 1ZUHA 1TW3A 1SOWA 4KQHA 4C08A 4C3ZA 4L5BA 4HEJA 2J1LA 3ZZNA 3WB2A 3GGOA 2X13A 3ZJVA 1VHJA 3H1EA 2HOQA 1E9BA 4YIHA 4LOIA 2CJFA 1P8JA 2VRNA 3DAFA 3DTTA 4FWBA 4QATA 4LRYA 4FGZA 5FAXA 4IDCA 1IBKB 2CK3A 2B8EA 3LL4A 5ELXA 3QQ5A 10MHA 3ELYA 3E23A 5L3VA 3INTA 3K0AB 5CDFE 3G5TA 1V8OA 1I51A 3C70A 3KJHA 4TSKA 3M6VA 4ISCA 1YC5A 4DBVO 4M7RA 1KHHA 3CY6A 3TH5A 4OXIA 3WJ2A 4ALMA 4U8GA 2QRVA 5THXA 3UHFA 3GVPA 1B7GO 2PYIA 3L8EA 3ZUGA 3DR5A 2BUCA 1T6ZA 1WNTA 1VXRA 4JVOA 3OMWA 4TUYA 2QT9A 5AW1A 4J75A 3TAHA 2BE9A 3DP9A 5IBRA 2PG3A 4EY4A 2Z8ZA 3AEUA 4L5IA 1DARA 1BMTA 4L0MA 1L5WA 1GZSA 1F4VA 3L7JA 3I92A 3OA2A 4HX2A 5T41A 3RU3A 4RE5A 3UAXA 4NABA 3R6LA 5HPYB 1SXIA 3PKIA 1G3RA 2BR5A 1IY1A 1NJGA 1QAMA 4NJMA 5I7SA 1D1SA 4GYWA 4K40A 4M1EA 4O0MA 4QYIB 3UMFA 4Q16A 3VDXA 1RZRA 2QVLA 2QDXA 3QVSA 1FTNA 3PL5A 1KMNA 4YIKA 1I14A 3DQPA 5AOAA 1GAXA 1MHTA 5EUCA 5FOXA 2JHAA 2AOTB 1BHJA 3LUFA 3NBUA 2B8TA 4KE6A 2C7OA 3QWBA 3SOZA 5KTMA 5KYWA 1TUGA 1Z18A 4HYTA 2EYQA 4TTPA 5LP6C 3VUEA 1TZ2A 1Q6YA 5KQLA 1J97A 4D9BA 3QUSA 2WF8A 3FBGA 3GU3A 2BGGA 2UUAB 3DE5X 4MP6A 3WLIA 4G86A 4AZWA 4B81A 1EVYA 4JBWA 2FEAA 3EDRA 4XLLA 1OAOC 2QAJA 4LBWA 4LJ8A 5AH0A 3VDQA 3UA4A 4RA6A 4CNBA 3HUUA 3RM3A 3UV7A 1HZZC 3DPSA 2AB0A 1UMDA 3OVMA 1Q15A 1HETA 1MFZA 2OM2A 1N2CB 2HJSA 5C35A 4N03A 1OFUA 3LRXA 4GIBA 1DT3A 4JLDA 4OLBA 5BN5A 2C58A 4MS1B 3PTZA 4Q3NA 1UL1X 3HXKA 2YZ7A 5TARA 1OV6A 1OUMA 1N7HA 3MQ2A 4UHCA 2X5KO 3I5MA 1FFSA 1PGNA 4EZBA 4FW8A 2IUFA 3GNLA 1DQYA 4Y3UA 2VDVE 3TBKA 2PA0A 4BE7B 4RZUA 3GLIA 2JA2A 2RFLA 1XXHE 1QV9A 4WOBA 3VR6D 5M2QA 1Q57A 3O9MA 5EFOA 1RTKA 3VYTB 1YR2A 5HE9A 5EN4A 3VGJA 4KUHA 2R7MA 3NKFA 1X19A 1E3JA 2PNFA 2YHIB 3AH8A 1OI7A 1BMFD 1JQBA 3KJIA 3M2TA 1WMFA 2R86A 1Y3IA 1PQUA 3A6EA 4HX5A 5AUQA 3D4NA 4QGHA 2YRFA 4H77A 5IJAA 4V1CA 1U1IA 3UPUA 2RCYA 2WJZB 1CPYA 3HC7A 4JBGA 4Q4DA 3SDZA 3ZHCA 5KNCA 4FEGA 2VF2A 1NQVA 1YZQA 1EBUA 4JDPA 1E58A 2V8BA 3KAJA 1EG2A 2HADA 1K98A 1DEAA 2W6PA 1I3KA 2YVKA 1BCSA 1FB5A 2FUKA 4FFSA 4YASA 4BO1A 4C76A 2VYVA 1W6UA 2FN3A 4WKGA 2FPXA 1TYZA 2CLMB 4BJ5A 3KFLA 2RHHA 4J4TA 5F12A 3V4ZA 4FFBB 3A1FA 3IP5A 3V32A 2IHZA 4ZHQF 3BFPA 4RY8A 4BZQA 5GONA 2R00C 2WF6A 4M9RA 1FTWA 4CI9A 4TL7A 1QH9A 1Z8DA 3NANA 1T34A 1R8SA 4PAOA 9MHTA 3BN3A 1XMQB 2P2CA 2VPWA 2H63A 3KOWA 3NNSA 2P0AA 3K05A 1A9XB 1IOZA 2SCUB 4TMWA 4JCOA 5EWJA 1QZZA 4LYFA 1I2ZA 3RARA 5ADHA 5CEEA 1UFRA 5IS2A 3PQCA 3WYCA 2ESRA 3N87A 1CUWA 4BAZA 4ZYTA 2ZYTX 5J43A 1NLFA 2Q6TA 3RU2A 4BKOA 5DF1A 1UZMA 1KDPA 1IPHA 3BPSA 3GJXC 1QG0A 1G20A 2C88A 2C2KA 1UT6A 5KS2A 4GEKA 4F60A 2PH3A 1XZJA 3ANLA 3NAZA 2FSHA 2I2FA 5AM5A 5CYPA 3O8DA 4YH1A 4C9BA 4U02A 4TL8A 1EVJA 1VIMA 1W6RA 4XOIA 4PPNA 3VSAA 4ESEA 3W3AD 4R6WA 2XXBA 5T5QA 16PKA 1R9GA 1E2LA 4C04A 1ZH0A 2G04A 1RYFA 2DETA 3JVUA 4DVJA 1SIOA 2B21A 3MT9A 5IARA 5C7OO 2XYGA 1I0LA 1QF9A 2QLBA 2I71A 2O20A 4KWEA 2JFNA 3KZNA 4MROA 2AI1A 4XJSA 4UVHA 2E4AA 2ZJ5A 2GPTA 3PWSA 1GLVA 3A1NA 3GCGA 1Z4KA 2XTJA 4OM7A 2ZBUA 1NKTA 1XKLA 4U7FA 1SXQA 3BT7A 1B2LA 2F7SA 4ZZ3A 5CA0F 1MGOA 1RYZA 4MCJA 2NAPA 1OT3A 2YOGA 1G21E 2IU3A 4C4AA 3ABRB 1WW8A 3AJDA 2O57A 4M1YA 4LQ4A 1FNDA 2FMUA 2YHUA 5AVRA 1B3RA 3VI3B 2HW8A 2OQIA 4EVIA 1U7TA 5JS1A 3S2IA 1P9WA 1PT6A 1JU3A 5IF9A 3SK0A 1JHAA 4RABA 1GU7A 4U4AA 3E3AA 4MV7A 2VHQA 4DS3A 4FM9A 1JEYA 1ONSA 2A0FA 3I4FA 1SCUA 4OV6B 3R0IA 3VSDA 3W8NA 2C4KA 2Z9CA 1P4RA 3RASA 4CEIA 1M3SA 3DMNA 2VZLA 3DVSX 2E4XA 4A9AA 4J76A 5AJXA 1SVKA 4LXXA 1AKWA 2WUFA 5AKYA 3G23A 3M82A 3GK3A 5ECDA 4R5MA 2NW6A 1AN0A 1AB5A 1LDGA 1T8WA 3IOMA 2JI8A 3OLVA 2XMRA 2VF8A 5FTJA 2W9XA 5SZHB 3A6JA 3FIUA 1DO8A 2B78A 4O4IB 3CIFA 5H1YA 4L5CA 1EH5A 5B1SA 5BRNA 1P0FA 4YAJA 5EHIA 2OZPA 3BRWD 2DF8A 3DBIA 5GGYA 4DMGA 5GVSA 4NDAA 4D8YA 3ZHZA 1B0ZA 3M7IA 1HFWA 1T2UA 4I2VA 3TVDA 4LCEA 4EG6A 4YALA 2OGTA 4HTFA 4B40A 1HDXA 3IP3A 3T1NA 2HN9A 3QLVC 1UAAA 3IUEA 2BBTA 4PAMA 4CM8B 3EF3A 4XDZA 1XJCA 2ECQA 4Y2RA 4X1YA 2PL9A 1WMSA 2BOVA 3OJCA 5ERXA 4ZGBA 2H1SA 2PVSA 4MAMA 1Z8HA 3TBHA 4EAQA 1P7WA 1AUQA 1EM6A 1H2FA 3FR8A 3FY4A 3ODGA 2BM8A 4NYIR 1OTHA 2JJ1A 3SQMA 4AWBA 4Z9FA 5IK2D 2HHHB 4JQCA 2BAGA 2VHEA 4TZKA 3R75A 2HLHA 4J3FA 4URVR 1KDRA 3AI3A 3X1WA 4OJQA 5KYXA 1KI1A 2ON6A 3Q0EA 4DOMA 3UF0A 1GV1A 1Y6JA 1Z4LA 3MBKA 2OZLB 3JRNA 3LIPA 4N0EA 2H65A 4UUOA 4C89A 5C1DA 4KWTA 1L5MA 2A1TR 5GPBA 2VWHA 3JWGA 5F3RA 3MA0A 4Q9KA 1ONPA 3D02A 3TNYA 4CLOB 1CRWG 3CPJB 3VR4H 4DZRA 1M7HA 4U6QA 3DBVO 4MVJM 2HT6A 5BQPA 4X7MA 1OXUA 4B6GA 4HZIA 4JQSA 3ZVNA 3PFBA 5KNLA 1HTWA 1P0MA 3UB2A 3ZWBA 5AICA 5D6OA 3RSGA 1PWXA 2O5EA 4LF7B 1E62A 1XDDA 3S55A 1C41A 1J24A 4UDNA 1ISPA 3P9IA 1R64A 2FI1A 3RSHA 1CX9B 3H2KA 2XD9A 4JIGA 2J3JA 3G8DA 2VTEA 4BV3A 3ESBA 4J1TC 5B1EA 2AUMA 4MOWA 4X00A 3Q1LA 4CKEA 2IBSA 2DG2A 1GGEA 3OQJA 2HO4A 1UPXA 3M3DA 3EQZA 4ZOLA 5LSAA 2AW5A 3TLJA 4BU0A 2J5BA 2UZIR 2YIVX 3DMHA 2FJUA 3OUZA 1JHMA 4YDRA 3FHTA 5DWVA 3E2PA 1ESNA 3C39A 1YVEI 5EE3A 4LNUA 5K03A 3HVKA 4FCVA 4ZYXA 3OBIA 5B64A 3WL6A 3HFRA 5A2QA 3FSGA 4DKXA 2JFPA 2GLUA 5C2JB 1B0PA 5EMNA 4FYKA 3WA6A 4MEBA 3EPLA 4MAAA 4OI1A 4YROA 1ZRSA 3MMNA 3ZE6A 1M1YB 4CV2A 2JLWA 4TQ9A 4U6NA 4Q39A 5DK4A 3H83A 2D7JA 2F48A 1I4LD 3ZDDA 3MIZA 4HGYA 1QGYA 3TIGA 2CLFB 2BC9A 2ID8A 1JFFB 3I9LA 5AI4A 3WQSB 2KLBA 1X92A 3EARA 3G2MA 1N77A 4K9PA 1RWWA 2PRJA 1OFGA 2CCGA 2XVXA 3BGSA 2VP9A 3SFVA 4NENA 1XJWA 2PBFA 3PGVA 3GY0A 4EUHA 2DSNA 3LP8A 4B75A 1V11B 4UTZA 2MWMA 5CH8A 1UQRA 3KJNA 5FR1A 4BP8A 3OEYA 1IYZA 5A4KA 1R3DA 2OKCA 1E2QA 3UK7A 1QHHB 3D7KA 1SHKA 4O2AB 4C4OA 3VNUA 4ZQBA 5KU1A 3CSSA 2HXYA 3A1DA 3FDZA 4CN8A 1SPXA 1UT5A 2NAFA 5KWEA 1IVNA 3K70B 1CZUA 2G09A 3QNWA 2Z57A 4LYYA 3E0XA 3ZHTA 3U16A 1QP4A 4N76A 3C5VA 2QD2A 4YVFA 3MM4A 1G5TA 1L9KA 1WP9A 3HXLA 5CNKA 4GBJA 1BU5A 4YMIA 1T3LA 1FPMA 1HLFA 2WVHA 2JJ2D 4J4HA 3WLRA 3EJWA 4C0LA 3WMGA 2P4HX 1OH7A 1U5AA 4B7UA 5D3QA 4DJTA 3KOUA 4PTLA 3RHFA 3QVWA 1RJDA 1WL8A 3SE7A 5BWCA 3BCUA 3L0IB 5KJ6A 4JSYA 3NTVA 4HUTA 3MBIA 2NU9A 5ED0A 4PHFA 1L5SA 3EDYA 6AT1A 6YASA 5AJVB 3D5TA 3DE2X 2O2YA 3ZU5A 1YQEA 3BYZA 1Z7YA 1EUYA 1G8MA 1IK4A 2Q9UA 4A6EA 2G0TA 5LP6F 1O1YA 2O3RA 4AO6A 1NFFA 2PX5A 2EFEB 3LC0A 2SBTA 3TRJA 5KWIA 1QB7A 1ULBA 3FPLA 4BP1A 4DDHA 2QMUA 3ZV7A 3F0TA 1IVYA 2C92A 3A0RB 3ORHA 4OP1A 1XN1A 3WMFA 2DUUA 2IDJA 4P35A 3RIYA 1VCIA 4HWOA 1RWBA 2GZDA 2FW8A 2EL7A 4H18A 1D1TA 4U5XA 3FOFC 2ZAGA 2V97A 1R6UA 3U9TA 4HQKA 2UVDA 2IHKA 1WZEA 4EG4A 5FUMA 2EQ5A 1RS0A 2P91A 4UUPA 1NG9A 1EJ0A 5IM4A 3LYAA 4IF6A 3W90A 5BNWA 2L18A 2ZSFA 5KJFA 3VVBA 3JYNA 4TXMA 4EUEA 2HQBA 4CR7A 1MKYA 3G0OA 4JB8A 4P0QB 1MAWA 1L4KA 5CLIA 4YC7A 3I73A 4LGMA 3HZZA 3KSDO 5J58A 2G63A 1EFLA 1NYLA 1U04A 3ESQA 1VL6A 3BIXA 1F12A 1G9TA 1KQOA 4TRNA 1FYEA 3UJ9A 1OYVA 4POOA 2V98A 1NN0A 2QZ4A 1A9OA 2K5UA 3HO8A 4NJEB 3H4MA 3FE2A 1VMEA 4NCHA 5HS6A 4CE6A 5JE8A 1AS3A 4HRXA 2XQKA 1B14A 2NZXA 1B43A 1WM1A 3LKBA 1OJLA 2E4YA 3IFSA 4M87A 4RX1A 4YUZA 4B4DA 3KVYA 5KWJA 2LCQA 4BV9A 2WM9B 3L43A 3ORSA 1AQNA 1E2EA 4P84A 1ZUNB 4HSEA 1T8RA 1Y5MA 4QYIA 4C05A 4KXUA 1AMOA 2JLCA 4FK8A 3L8GA 1PJ2A 1QFMA 3SKVA 4QKQA 3CINA 1PQYA 4ZZIA 2VPPA 1LRKA 1V26A 1VG1A 1VPEA 4WKNA 1G0NA 3NVMB 1DXHA 2IF0A 4S1PA 3A6FA 3WTBA 4F4DA 4CG2A 2HJ9A 4G5HA 1ZXBA 3CT6A 2PO5A 4AKSA 4ZI7A 1CSEE 1RXEA 5FBHA 5JPIA 1HEUA 4LF5B 4J91A 2D2FA 1JI0A 4NDNE 5T4BA 4B80A 4GLBA 1GUBA 3ZDZB 2LD4A 2FTKE 4GW3A 1JPVA 3PR2B 2CKDA 2VQ6A 4PBSA 1Z7BA 2GMWA 4RPJA 4EPRA 3I9FA 2W2XA 5EZQA 4I4IA 1FSFA 5BNIA 3LGSA 1MOZA 1N2CA 1VL0A 4QNMA 1ADFA 3GI1A 3VH3A 2QR5A 4RS4A 4ZT5A 2PGLA 3ABSB 3CLRD 3D59A 3WGHA 4GPAA 3NV9A 3AERB 3HJRA 3NTOA 1NJ1A 3QX7A 5CB6A 5KJCA 1FC0A 2FPOA 4H7KA 2IXDA 2I4IA 2XGSA 4BNVA 2Q3BA 4BCBA 2NLOA 5FT9A 3TX2A 3DHVA 3GA7A 1M72A 4YRCA 1SY7A 2PMCA 2PT7A 1P1KA 4WCVA 4ZYVA 3KR2A 2IZ7A 3EGVA 4OUDA 3FM9A 5KYWB 1QOPB 3KXDA 2V4MA 1EZ1A 5ALMA 1NXXA 3FAZA 3ILSA 2P69A 4C5BA 5C8XA 4D6PA 4YUAA 2PLFA 4E1BA 1N6OA 3A4IA 3NUZA 4XM1A 1WKVA 5E9JA 5B1IA 4DXAA 3VYSB 1BA3A 3VR6A 4Z2YA 2DT5A 5JD3A 4CN9A 3D7MA 3DCYA 4I1IA 3IBGA 5DYTA 1P6UA 1UDWA 3PRYA 3RJTA 3SZGA 1BMFA 5T64A 1CNMA 1XVTA 2J9RA 4G0UA 1XZKA 4QUGA 2XV1A 4YJFA 4RTPA 1Y4DE 3COSA 3D6AA 1QGED 5F1PA 3ZHYA 4LEIA 3ZU4A 4W1RA 4RPGA 4PYLA 3R7DA 1QH0A 3ZWOA 3HRKA 3V9AA 4OQDA 3ZGXA 4P6VF 3MTGA 1IATA 5IVKA 2JFYA 3T5GA 4B8WA 1UPFA 1IXKA 1P9OA 1SC4A 4GPZA 4HO1X 4W4TA 5HJ7A 4C7OA 1SUCA 2XBLA 1GA4A 2NYUA 3V33A 2C8VA 4N8DA 4PRKA 4NV1A 4OI4A 2AFIA 3D0RA 2RIRA 2IGTA 3IUQA 4AMUA 1XWFA 2COEA 1KF0A 2ONZA 3HA3A 1SXJE 3F6BX 4OIFA 2ZJ1A 2PNJA 4EEKA 1JBEA 4I9NA 5KNBH 3L7KA 5D3MB 4YRMA 2WPNA 4Q7MB 5AT1A 3ZY6A 2QNRA 4K6OA 4RVOA 1A9XA 2F8SA 3O9ZA 5DHTA 5KX5A 5LOVF 1FXSA 3DO6A 3P4XA 1XRQA 1ZK0A 3WLSA 5BV2P 1QYWA 3JV7A 3OOJA 3T7IA 5LDDC 5IAGA 5KVQA 2OA0A 4BEBA 4H7IA 1RWXA 3QYPA 1PSDA 2J9FB 1YKSA 3EA4A 3T7RA 3AVVA 1IMJA 5B4UA 2WU1A 3ANTA 3EN0A 1Y33E 3NT2A 1M1UA 1XDUA 2X8AA 4HFJA 3DV2A 4D5GA 4ZQGA 5KIAA 3IO3A 2A9OA 4QQRA 4PZLA 1Y9EA 1YHNA 5COQA 2ZSBA 4QGGA 5AXDA 1XU4A 2JEYA 4GPBA 4HDRA 1T0JB 2XADA 4NEQA 3PI6A 1DEHA 1XTSA 2P9QA 4X1IB 2ZIUB 1HKHA 4F4HA 5CA1A 4BB9A 3PUHA 2VT2A 1JLLA 1DTWB 2ZRJA 4TYMA 5AK6A 3VVMA 1E1CA 1QFZA 2CLEB 2NT3A 1NFQA 3DLPX 4TVOA 2H1FA 1X7HA 3L41A 1VGQA 2OV2A 3OT1A 1SHLA 1F2TB 3LUPA 4KXYA 3BCRA 3IYLW 4OY3A 4QOIA 3B82A 5ES3A 4C2UA 5JTTA 1EHIA 2ZAIA 2VRCA 3DKIA 4H1TA 5GWXA 3UAWA 4O2RA 1GAEO 2ZQ5A 3LVFO 4JI3B 4OU5A 4PLTA 5GJCA 5JVDF 1VI6A 3WYGA 4IIJA 4YCSA 5BOSA 4F21A 3RFXA 1CEXA 1QLJA 2WJJA 3UOWA 3UIEA 2C2GA 4DV0B 2CV0A 2A9QA 4JLMA 5HOQA 4QO7A 1GNLA 5HEKA 4AJOA 5HF5A 2R25B 4JBXA 4UHDA 3RFCA 3HCBA 3ESAA 1H8EA 1SBIA 1YOVB 1Z0UA 4P80A 5BNFA 5KWVA 3ANNA 2XOEA 4IMJB 3PD1A 5GMOA 4N48A 4WZAB 4PG4A 1HOXA 1OBOA 4F5ZA 2UVQA 2C9ZA 4QM7A 3SC6A 4P0PB 1RVV1 2CWDA 2FZGA 2GB4A 3LOQA 1EDDA 3CEHA 2ZROA 4H6XA 2O54A 4JI5B 4WWHA 5FBWB 3UAVA 3V8RA 4LHYA 2JJQA 3RUEA 4BQIA 3Q5GA 2GH1A 2VUSA 3KQPA 1AK1A 1VE5A 1YRLA 2GS9A 4CKBB 4EI7A 2A0KA 1YUMA 2QPAA 5EQTA 1TMYA 4OCZA 1B6GA 1FLDA 3T1HB 1GAJA 4Y2PA 1H22A 3G88A 2QTVB 4HDQB 1QE5A 5K6AC 2VQFB 4Y9TA 4I1VA 3PPIA 1PBTA 3L0SA 5DBEX 5I4IA 1RR6A 1FX0A 1SM4A 1QJCA 2D5BA 2VF4X 3E48A 3JQFC 4TV8F 1OFHA 2UUCB 1Y80A 1J06A 1HLDA 1N6PA 3UWSA 2BKLA 1C3EA 3G5LA 5IRCD 1N5JA 4HH3C 4CFZA 2ZSIA 1CJSA 3HU5A 3EXIA 1G98A 2A9RA 4QXPA 4EW6A 3RFVA 1M2WA 1JH9A 2IHYA 5I6DA 3SM9A 3QTBA 3TR5A 1XHFA 4MMZB 1NZFA 2ZU6A 4FKMA 4HFMA 4UC0A 2GKGA 3ILXA 1GRNA 4ILKA 4S1OA 3ZXUB 5ITSA 3AR9A 2J0UB 1CC1S 2R7AA 3E9DA 2QQFA 1DFHA 2FE1A 2QL5A 2ZWPA 1CJBA 1SIUA 3ZWMA 4BQPA 4YPFA 1N3LA 4B87A 4RTNA 3TW4A 2OZLA 5GIPE 5ECGC 1JIIA 1NVAA 4G0VA 2DHRA 4KXWA 3AI7A 1ESMA 4F0JA 3I5AA 1VMAA 3EGWA 4L22A 4AMVA 1E96A 3KZCA 4RZHA 3UWPA 3B3AA 5D5PA 2C95A 2AXEA 3JWJA 3A2KA 3B3FA 3FUWA 1EUZA 2FZ4A 4YWJA 2ZDHA 5C0OE 1T8PA 1QMGA 1HE5A 2GN9A 5J2TF 2I3ZA 3D54D 3GLRA 5CITA 3OFJA 1ZGGA 1VIAA 1YT5A 1J99A 2Y0EA 3JR7A 2JLRA 3DDWA 3K0BA 4L15A 4NCKA 1QQ5A 2HUNA 3NXSA 1SR8A 2H59A 2RKBA 3PU6A 2RHWA 5DHSA 3VAZA 2OCYC 3VO9A 4Z4CA 3DHNA 1O8BA 2J5QA 2PX4A 1SQ0A 3ET4A 3LUHA 5HBRA 3SM3A 4OK6A 4AQDA 2P9FA 4LTMA 3N7AA 4OBWA 4D5EA 1TKAA 1RMYA 5EUBA 2HI0A 1T1EA 4IQ0A 4OB7A