3A0RB

Crystal structure of histidine kinase thka (tm1359) in complex with response regulator protein trra (tm1360)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
116
structure length
116
Chain Sequence
MKRILVVDDEPNIRELLKEELQEEGYEIDTAENGEEALKKFFSGNYDLVILDIEMPGISGLEVAGEIRKKKKDAKIILLTAYSHYRSDMSSWAADEYVVKSFNFDELKEKVKKLLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Sensor protein
publication title Structure of PAS-linked histidine kinase and the response regulator complex
pubmed doi rcsb
source organism Thermotoga maritima
total genus 20
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2009-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3a0rB00
4YO7A 5HSGA 3MYYA 1GCGA 5PNTA 5EWMA 4XARA 3T6KA 3OMXA 4G0PA 4MGEA 4D6YA 1PUXA 1CHNA 3GWGA 1FFGA 2FMFA 1RXEA 3HS3A 4G0MA 1E6MA 3KJXA 1GCAA 3A0RB 4KQCA 3P9YA 2MYPA 1A2OA 3QEMB 5TQ0A 2IKSA 4RS3A 4G97A 4Z4GA 4MRMB 3JPWA 3EJWA 4G86A 1BDHA 2VK2A 3MF4A 5IEJA 1F51E 1ZAYA 1OXKB 1PEAA 4KK3A 4H3HB 1DCFA 1JX6A 1Z2EA 3HDVA 4OBBA 2LUOA 2B4AA 2JBAB 3D8UA 1Y1LA 1ZVVA 1JFSA 4KV7A 1EWKA 4YLEA 2E4VA 1GLGA 1CYEA 3QLUA 2PMCA 5E3JA 3RQIA 1K68A 2PL9A 1DCKA 3N0XA 4MS3B 4O1HA 4D74A 3CG0A 1NXTA 1PNTA 3N0WA 4WXEA 4DADA 4YWHA 4QPJC 1QKKA 5JNTA 3N0RA 2P9HA 4YR7A 5FBKA 4RWEA 2ID7A 1D2AA 4MS4A 4WWHA 3LUGA 4TLLB 3HUTA 4MR8A 1JYEA 1A0OA 3OO1A 4LRQA 2RGYA 4L4UA 3H5OA 4LE1A 2KYRA 4F3TA 2YHAA 4H3KB 4EVSA 4IF4A 2QU7A 1JDNA 2NZUG 2FEPA 2OQRA 3H5WA 4ZJPA 2PKXA 1MB0A 1JFVA 4IMJB 1NXPA 1JL3A 2IDMA 5C5EA 1P8AA 4P98A 2HQRA 4UHJA 4ZMRA 1ZESA 3R0JA 3G1WA 3LMKA 3Q15C 4OLAA 4PZ0A 3T95A 2PUCA 4OTZA 1DJMA 2TMYA 4EYKA 2RJOA 3O2QB 4O1IA 2CD7A 1NTRA 1I3CA 2FQYA 3HXMA 2N9UA 3RVRA 2FXIA 1RNLA 4RXUA 4ETMA 5ABPA 3GL9A 4G0OA 4WZZA 2JCGA 3OLWA 1LBHA 3DBIA 1DBPA 2JRLA 3H6HA 1ABFA 3GT7A 5B3JA 4EY3A 4N03A 5JNWA 2WJWA 3F6CA 4RK6A 5JNRA 3E61A 2HSGA 2R48A 2R4QA 3JS5A 4XASA 1E2BA 3N53A 2FLKA 3JY6A 3Q9SA 5IUNC 1QQBA 3H5TA 2QXYA 3IPCA 3NHMA 3LUHA 3QLVA 5EWLA 1EWVA 2E4XA 3H5LA 4LZLA 3I09A 4G0QA 5EWJB 5B3JC 6ABPA 3DLBA 1YMVA 1Z18A 1Z17A 2O20A 3N6VA 3QX9A 1DBQA 2MYNA 2E4WA 3IP7A 3O2SB 4MS1B 4Z0NA 4N47A 3TB6A 1AB6A 4OATA 4KFCA 3LUFA 3Q7TA 3OM1A 2ID9A 1VPWA 3KLOA 4RSMA 3A0UA 3CRNA 1YVUA 3H6GA 3IDOA 2IPAB 5KC8A 1B00A 4MQEA 4W5NA 3QEKA 1PEYA 5C5CA 3LKBA 1U2QA 2FSPA 2ZWMA 4S05A 4Z4IA 5FWXA 4MLCA 1DBWA 1YTUA 1VRVA 3MMNA 4MPTA 2QVCA 4Z4CA 1M5UA 4TMYA 1MB3A 4Z9AA 3C3KA 3LUDA 3MIZA 3CFYA 4OLBA 3LOPA 4KZKA 4GPAA 4XAQA 1LK0A 3RVQA 4EUKA 3KLNA 3UUGA 1KGSA 1U8TA 4F8JA 3I5AA 4JB0A 4EYGA 4G0ZA 4RDCA 1JDPA 1DRKA 3HCWA 3JVIA 3SY8A 5JS2A 2PJUA 4Z99A 3QELA 3B2NA 1QP7A 4N0QA 3O1JC 3A10A 2IPMA 3KCNA 5DTEA 5KQMA 3H75A 3F73A 1ZITA 2JVIA 3O21A 3O75A 3RVSA 1YK0A 2VUIB 4M88A 3IPAA 1DG9A 1USGA 1LJLA 4MR9A 5HKOA 4MS1A 5TPWB 1KRXA 2QVGA 4RXMA 4UHKA 4Z4HA 3L6UA 2PUFA 1ZH4A 1DC8A 3KKEA 1Z12A 2HQOA 2FMKA 4NQRA 4Z4EA 1YS7A 3RVNA 4MR7A 5DGCA 3C97A 4XLTA 3RVOA 2I6FA 2GWRA 4IRXA 3TMYA 3LTEA 1C0EA 2NUBA 1P6UA 4DQDA 2QR3A 5KWSA 2FKAA 3H1GA 5TQ2B 3FFTA 1ZY2A 3GYBA 3ROFA 4ETIA 1L5ZA 1UDRA 2JVKA 1PNRA 4RK4A 3HM9A 5FWYB 3GA5A 2HJ9A 3MQ4A 5IUJC 1JF8A 4KREA 3CZCA 1QPZA 2MYUA 3BREA 1SXIA 4GNRA 4MQFB 3QEMA 1U0SY 1ZGZA 3H5IA 1XHFA 3LKVA 4YS6A 3FMVA 2QZJA 5GOTA 4F06A 1EWTA 4MRMA 2YHBA 3QX8A 4W5QA 3KHTA 4DN6A 3NNNA 3HUUA 3T38A 3VNBA 4ML3A 5I4CA 3JVDA 4B09A 1D1PA 4F11A 2BGGA 4ZMSA 4CBVA 3FDFA 4PYRA 5JNSA 2JBAA 1FSPA 4EYQA 3QLTA 2HPHA 1XHEA 2GBPA 3Q41A 1SRRA 4F12A 3DGEC 4KK4A 5HM6A 4P1ZA 5T3YA 4JA2A 4RY9A 5KQPA 2J48A 5T7BA 2FQXA 1ABEA 3RVMA 4MS3A 3EAFA 2WB4A 4KNYA 5KI6A 1XWWA 4NCAA 3KS9A 1YMUA 1FQWA 4W5TA 2GX6A 1FFSA 3CLKA 4G0YA 4RK0A 3FFWA 2PUAA 1M2EA 1M2FA 3JPYA 2R47A 4D6XA 1NY5A 3IP9A 2MSLA 3RVJA 2PLNA 1A04A 4RY0A 5KQLA 5BR1A 3EDCA 2FN9A 3HSYA 4YCSA 2CHEA 3CHYA 2R25B 3I45A 1TVMA 2FLWA 4JAVC 4LE2A 1JBEA 3H1EA 5CNMA 3DGFC 3VNAA 5BRJA 4HNSA 4XXHA 5GQSA 4YGXB 4EYOA 1U04A 3IP5A 3O74A 1ZGGA 4RK5A 5CHYA 4FB4A 2PAFA 3A3KA 2FW0A 3G85A 3O2JA 3OQNA 3W9SA 2F8TA 1K66A 1P2FA 1DP4A 1D5WA 3OLXA 1EAYA 3M9XA 5EWMB 1FFWA 6CHYA 1BDIA 4WT7A 5IULC 2FEWB 1ZH2A 3N8IA 5TQJA 4H60A 2VYCA 1YIOA 3HV2A 4E7OA 2JK1A 1W25A 1ZHHA 4RK7A 1S8NA 2IOYA 3UKJA 1JYFA 5TQ0B 4KVFA 3EQ2A 4ZYLA 4TLMB 3OM0A 2GKGA 1QNLA 2FTKE 2FQWA 3L49A 5F64A 3RVPA 4YV7A 1MVOA 1EHCA 4OG2A 3DZDA 2M1ZA 3LUKA 3K4HA 2QSJA 3C6QA 4WUTA 2L19A 3FFXA 3IP6A 2PL1A 3BILA 5DLEA 3GBPA 2W42A 1SD5A 4KMRA 1SXGA 1USIA 3GRCA 4EVRA 4IGAA 3KTOA 3UK0A 3ILYA 2H0AA 1C4WA 1J56A 3S99A 3HJFA 1ISRA 3RVLA 1AB5A 2HQBA 1RZRA 1TMYA 4ZPJA 5HQJA 2LBPA 2CWDA 4YRZA 3TO5A 3Q7SA 2M98A 2LP4Y 2H3HA 1JLKA 3CG4A 2LIVA 2AYXA 4MS4B 5IBQA 1URPA 3M6MD 4MR8B 5EWJA 1Z15A 1BA2A 4JOQA 2IYNA 3CTPA 3ROTA 3N75A 5TE9A 1Z25A 2CHFA 1DRJA 1SXHA 3CNBA 5IX8A 3ILHA 5CNJA 2FMHA 8ABPA 2LPMA 1F4VA 4PICA 1KMIY 1YS6A 1MIHA 3TX6A 5ED4A 2E4UA 2A9QA 3EULA 1P6QA 1TM2A 3H1FA 3OLVA 4Z9BA 3SG0A 1EFAA 3HDGA 2A9RA 1WETA 1Z16A 3SQNA 1PHRA 1TJYA 1ZDMA 3FGZA 4RY8A 2Q5CA 5CNIA 5TPZA 1IIBA 3C3MA 3EGCA 3KYIB 4G0XA 3LFTA 4LDZA 4LX8A 2ZAYA 4LE0A 4N0PA 1CEYA 4JP1A 1U2PA 4PEVA 1YK1A 3C3WA 4JB2A 4L85A 4QYMA 4Z4FA 3BBLA 1APBA 3OQOA 2PUGA 1VKRA 2PE5A 1QQAA 5BRAA 1Z26A 1NXWA 3EODA 1NATA 7ABPA 3HEBA 4RV5A 5KC9A 3E3MA 4NCBA 1QP4A 5D2CA 1JHZA 4QYWA 2NT3A 1QMPA 4WXMA 4E7PA 4Q6BA 3M9WA 3HK2A 1NXOA 1VLZA 1NXXA 1W9HA 2NZVG 4XFKA 2B1JA 3HO1A 4Q7EA 3CKMA 4KPYA 1DCMA 5TPWA 4HYEA 4EVQA 1H9CA 3NBMA 2IPNA 1QO0A 3F7NA 3T8YA 3QLUC 2IPLA 4MLDA 1RPJA 2RDMA 4HNRA 1OXBB 4NICA 2WJAA 1GUDA 1Z13A 1Z2DA 2FEKA 3I42A 4Q6WA 4TN5A 5EWLB 5KQGA 3URMA 2GI4A 4W5OA 1RZRD 3MM4A 4N76A 1GUBA 1D4ZA 2X7XA 5DKFA 2QV0A 3GV0A 3D02A 3H5VA 4W5RA 1JH9A 1TLFA 3KG2A 1R8JA 3OMWA 5IUKC 1LJUA 4JASB 2JVJA 2E4ZA 4FE7A 1M5TA 2NT4A 4RKRA 1ZN2A 2WMYA 3EQZA 4RK1A 5TQ2A 3GBVA 2L18A 5JS1A 1NXSA 4MQEB 3KYJB 2E4YA 1E6KA 2XDYA 1L5YA 3Q7RA 4NV3A 5FWYA 4IILA 5FWXB 2V0NA 4LDAA 3CU5A 1DC7A 2F8SA 3BRSA 5DCLA 2PUBA 4MQFA 2WRZA 5BQ3A 2L17A 2MSWA 3CS3A 5TPZD 3O1HB 5IEBA 4S04A 3LUAA 5IC5A 2WWVD 4PE5B 1JWLA 2QW1A 3MA0A 5FBHA 3NNDA 3HZHA 1QP0A 1KRWA 4QICA 1USKA 2P4UA 2FN8A 5JNUA 2JB9A 4RXTA 3HVRA 3RVKA 3K9CA 3QELB 3TD9A 3LUJA 3OO0A 2A9PA 4EGSA 9ABPA 4RKQA 4YP9A 1BDJA 1MAVA 3OQMA 2PUDA 1BVHA 1DZ3A 1RXIA 2OENG 3LUCA 1D1QA 1E6LA 2WY2D 2L2QA 1JFTA 3QK7A 3JTEA 4MR9B 2FMIA 3BRQA 3F6PA 2VUHB 2PUEA 5CNKA 3KSMA 4KQ9A 4FE4A 2A9OA 3SAJA 4RZSA 1ISSA 3NHZA 3DLHA 4HNQA 3O1IC 3CZ5A 4ETNA 1QO0D 2DRIA 1T34A 4MAAA 3RH0A 3OLZA 2MYTA 4RU1A 4MR7B 4Y9TA 3QLVC 2RJNA 4IMIB 1NXVA 4KRFA 3OLYA 1LBIA 3NNSA 4O5AA 3SNKA 2AYZA 1HEYA 4N41A 1BAPA 2FVYA 4MYRA 3SM9A 5JNVA 2MSKA
chains in the Genus database with same CATH superfamily
4N9QA 1OLSA 1W2WB 3KSDO 3EMBA 4CE6A 3JZMA 2YQZA 4WOPA 5GADl 5HQ3B 4KTTE 3AM1A 3E18A 2QLBA 1UZMA 3SDBA 1U0NA 4L8VA 3OE1A 2ZR7A 3D4LA 2HA7A 1ZW6A 2PSJA 3ABRB 4MQUA 3LGXA 4FDLA 3ZHXA 3WLQA 5AOCA 1IHDA 4Q9JA 3LXMA 3LL7A 1D6JA 1HFJA 3I23A 4MRMB 4NENA 3NS7A 5CDUA 2EATA 3FNQA 1YVEI 1BDHA 2F1RA 2G5CA 4E5KA 4I9HA 2ENUA 1F51E 1W73A 3AEZA 3QVKA 1SBIA 4X91A 1XF1A 1ISIA 1CUAA 4ARSA 4QHSA 4DWOA 1XKLA 3A4NA 2VH1A 1R15A 4O4HA 5CW1A 4KV7A 4YLEA 2E4VA 1WX1A 2Y92A 5BWBA 2OLJA 4UBIA 3LO8A 1VHTA 5IXJA 4ZD6A 1OJ7A 2C96A 1ABBA 4RLHA 3TPFA 4YPOA 4F2GA 1OAKA 3MGCA 5TB5A 3ZS9A 2H2AA 3DS8A 4D74A 1EM6A 1UM8A 3VV2A 2YNMA 4QVKA 4UUMA 1PNTA 3GMIA 3HYLA 2F1HA 3MN1A 4ZRNA 3WGUA 5AW8A 1T0JB 2DWPA 1RZUA 2CL6X 2FK8A 2O3QA 2O4CA 3GUCA 4PX5A 1ZRNA 2CXTA 3B36A 3CNQS 4Q4JA 5CJ2A 3L84A 1AK9A 4GW3A 1HPLA 4D8WA 3RYIB 9LDBA 4A6DA 1W7AA 3ELUA 3BCUA 3GQVA 3E82A 3Q5EA 4N65A 1W88A 1OW3B 2RKBA 2DQSA 4YHHB 3O82A 3CZPA 2P69A 2ZB7A 5JMWA 1JDNA 4C20A 3EF3A 2XH8A 4GQIA 3QPAA 4I1UA 2FWMX 3FMIA 1FNDA 4EHAA 5SY9A 1GSIA 3V46A 1I2AA 2GLXA 2V6FA 4AZ0B 1DGQA 4RACA 4XGQA 1RQ7A 3ZS8A 4C7OA 2DHQA 1L5FA 2G6BA 3QPUA 3NYWA 4L57A 2BISA 3AUUA 4P4LA 2RH5A 2R8OA 1IMJA 2J4DA 4ZAZA 3A04A 3UMFA 4EHKA 4OJKA 2C83A 4TKVB 4YRTA 3OU2A 4BFWA 4A8TA 1J0XO 3IV7A 3TXYA 5B1YA 3O4GA 3HXMA 2NW6A 2QRUA 2KSQA 2VHEA 4LHVA 3L1KA 4LZOA 2R6HA 5DLYA 5A9SA 5KTSA 3NDPA 4ZGGA 2PZAA 2ZULA 2QTTA 4Q4HB 3OLWA 1DC4A 1D4AA 1LBQA 2Z9CA 3DVSX 2PT6A 4N3CA 2BLLA 4NV1A 4D4JA 5KZMB 4GHWA 3UT5A 2DJIA 2EKDA 2VXYA 2PG3A 4ZI5A 1UPXA 1V8PA 2QR5A 1BS1A 5K3OA 4ARCA 3QTLA 1E2HA 3DHNA 4JJIA 1PV2A 1DKPA 2FUCA 3JASA 1UKEA 4D79A 4F1JA 1Y9DA 1CK4A 4C08A 4H7PA 4ZV4A 2FLKA 2GBCA 3EC7A 3F3KA 2F4NA 3K1ZA 1Y7LA 3ESRA 1XMXA 3IVCA 2FY8A 3DBRA 3KUUA 4Z8YA 3P9RA 4DMCA 4DJAA 1A7KA 1YRYE 2CDAA 2R1ZA 1GKLA 4MV5A 3R7SA 3LUHA 1XLWA 2NADA 3IMEA 4BFVA 1ZMOA 1U8CB 4EEXA 3KAKA 1HKUA 4WCDA 2UUCB 3Q9UA 2XB2A 5DHUA 3VVBA 2X8LA 4Q7KA 1SHTX 1YQWA 2G08A 5DI9A 5IAEA 1A95A 3LCVB 1ILEA 4NF2A 3ZLBA 3AUJB 4Z1OA 4MS1B 1XAHA 1DBQA 2PUTA 3Q3GE 2B7CA 1XXHA 4G65A 1RXCA 1M2OB 2DY0A 2QTZA 2YRWA 2KMLA 2O06A 3KLOA 5EP3A 5BO5A 2AGVA 1JDJA 2ZRNA 3OI7A 1YVUA 3QWFA 1YAJA 5CLJA 3DL4A 3TTXA 4XI9A 2V54A 4GQAA 3H1PA 2G77B 3EWIA 4MA4A 3C39A 3H99A 4G24A 3ZR4B 4XYLA 1PLJA 2H2GA 1A77A 2QL7A 2V7VA 1NBHA 1STOA 2HA5A 2I03A 1DBWA 2QRVA 4HEJA 3PIIA 4IWYA 4PC3A 4JXZA 4LYJA 1VL8A 1L7QA 3ZDXB 4AS3A 4K7JA 1MB3A 4LXGA 4UQPA 3RSCA 4DMGA 3KFLA 5KSWB 3SOZA 3SIWA 2L42A 1XMVA 2RGCA 3FWHA 4UCQA 2E18A 3ZCPA 4B6OA 4UOEA 3U61B 4QXPA 1OI4A 3Q8LA 2DH6A 3BL5A 3IEVA 4RTSA 1J0EA 4EJSB 1EG2A 2PZBA 4MVJA 1WEHA 2DQYA 3I76A 4LNUB 5JS2A 1R8SA 4YUVA 1UFKA 2XGGA 2A14A 3O0TA 1MOSA 1UDBA 1CRZA 2V6BA 3M5CA 4UDYX 3ROMA 4UJ5A 1OC2A 2IPMA 3KCNA 3SFVA 1W34A 2VPTA 2D5BA 5JFGA 2QUHA 1EHIA 3DZCA 4EYSA 2VUIB 1TEVA 2G1PA 4H1UA 3DO6A 4J07A 1UBHS 1Z08A 3BTUA 4OBXA 4MQMA 2IOQA 5DDIP 1KDTA 4NH0A 3U1VA 5F5NA 4YP7A 1W2HA 3H5NA 1KRXA 3FBTA 5CFQA 1TJ3A 2RK3A 3W6OA 1MC4A 1TJNA 3AV0B 3E05A 1EDEA 2NLOA 1N9KA 4NX2A 1BJTA 1Z5WA 4JB3A 3K31A 1NBMA 4MUYA 4RKEA 1JQLB 4URZR 4XGIA 3T3GA 5KOIA 2Q5IA 1CQZA 5L40A 3SC2B 4XUEA 2A1TS 3OPQA 5ELLA 4E6EA 2D7DA 1MT0A 4R7GA 2O19A 4NPAA 1FBNA 2JAXA 3WHKA 3L40A 3F6SA 3I3SR 1E9BA 4X24A 5FWDA 3H1GA 1DIGA 1R66A 5IHPA 1SQGA 2PZ8A 1JXOA 3EQ8A 4CMEA 2ZTMA 2N1MA 4N6GA 1UDRA 3AESA 3R6TA 1HDXA 1Y9EA 3P96A 3ZW9A 3T3HA 2AXPA 5FXMA 3GRPA 4I3FA 2YX1A 3MQ4A 4G07A 1JF8A 3OEHA 2RBEA 1XZDA 3DZJA 3QIVA 1I4TD 1I6MA 4XVCA 2HRRA 4NI5A 1U0SY 1ONPA 3LRTA 4R41A 1G7TA 4IHJF 3RK1A 2VNHA 1LW6E 3IBGA 1KP2A 2PZEA 4QJ5A 5H3CA 1GDTA 3ZX5A 3KLPX 5LOVF 3NNNA 4OOFA 2EFYA 1XD9A 1JYSA 2QLJA 4C0KA 4WXHA 4XOUA 3TQFA 1RC1A 4AB1A 1J06A 2E0IA 2OV2A 3HNPA 4K6GA 3GU3A 3LU1A 4MUBA 3S55A 4EYQA 2W70A 4PHHA 3THRA 1R5NA 5FAXA 5LU9A 4E3ZA 4X1OA 2KJQA 3GFPA 3LOQA 4EJ2A 4PRKA 1Z88A 4EOGA 5L6LB 1SUDA 4L6AA 2H00A 4NHEA 4RY9A 4OQLA 2WIKA 5UKDA 4C0HA 4MS3A 1UK9A 2WD8A 4J1SA 6YASA 1Z6ZA 3GLRA 1IZ8A 1WVMA 4F6CA 3G2KA 1OWLA 4GEGA 1VXRA 1VBMA 2V4MA 3QKSA 1QH8B 1ZI9A 3MWFA 3ROEA 1ZINA 3QKRB 3RU9A 4CM9A 3I2YX 4EPRA 3K20A 2CLKB 4QDUA 3ET4A 1AG9A 2XNDA 3WJ1A 4D57A 1PZGA 1UMBA 5ALQA 1QFYA 5BRJA 1X7YA 4GT1A 5I4KA 1VCIA 3BQNB 4WE3A 2WDPA 2IGTA 5F1OA 4OLJA 2PXAA 2R60A 5C37A 1L4YA 4G2TA 4S1OA 4O4IF 2OUKA 4XGRA 4PG6A 4EBFA 1NVEA 2FW0A 2ZRMA 1JR6A 1S89A 1EA7A 2DKFA 1ML3A 3OVMA 3EZ2A 4R6WA 3W78A 2I6SA 1DP4A 4ZHQA 1TEZA 6CHYA 4DMHA 1ITZA 1HL7A 4ESVA 5ALIA 3LDHA 1G18A 1PW5A 3A1WA 4XYMA 4X1KA 3AWIA 2J7PA 2O2CA 3P97A 2CVZA 2CXNA 4RK7A 2IOYA 3CKYA 3ICCA 4FMDF 4UNSA 5EZSA 3UMJA 1FRVA 4UU1A 1T3ZA 3PYMA 4RABA 5AVOA 1LZLA 3IVMA 3ON5A 1KKLA 3R5JA 4QGHA 1CC1S 5CGZA 4Q01A 5F64A 3RVPA 3TMAA 3VU3A 2IU4A 3I4LA 1BRTA 1FS5A 3UQYS 2FPWA 3K0FB 4EA6A 3UTCA 1NI5A 1W47A 4NNPA 3HVHA 1H05A 3QNMA 3RT1A 4P83A 4FYWA 5WRFA 3TUZC 4MEJA 4K5QA 4U8GA 2G40A 1B16A 4FU0A 2B6HA 3G23A 4Q1CA 5JECA 1XBTA 4H31A 4A91A 3GGGA 2BFDB 2MMCA 1JEQB 2GD2A 4OHRA 5ICEA 1SXQA 2C8KA 2R84A 1UJNA 3EVAA 2OAP1 2QE6A 5LA6A 2I62A 1CEQA 5I7AA 4HAOA 4YRDA 3SBEA 4CKBB 2DT8A 3QHPA 3EEOA 3CT4A 1PU2A 3QOFA 4YJ2B 1BU5A 2JFFA 2NUPA 1OROA 1THTA 1ZXBA 2BGMA 1Z15A 3BD8A 4IYRA 3B6ZA 4MICA 2EJCA 2O8FB 3CTPA 4FHEA 1XD2B 3NYQA 2EL9A 2X9GA 2DFDA 2ZJ5A 2BRUA 2Z5VA 3LPAA 4EY6A 1K6XA 3AU9A 4OXQA 3GEDA 3MB5A 4JC4A 4HH1A 3NFYA 2JHPA 1FU8A 1HOXA 4K8OA 5HIAA 2WV9A 3A1FA 3C98A 5IJ9B 4NBRA 1YS6A 4LPSA 1U2ZA 2QLFA 1Y80A 1BX1A 3EULA 3SG0A 5K1ZA 4CF4A 5CX4A 5AKZA 4DLPA 4HT3B 3TINA 5JY1A 2F9FA 3AK4A 1ZO8A 3GLGE 3WK5A 1IH8A 1UXJA 3GAMA 3GRZA 5ICGA 4LF4B 5AYVA 3IOCA 3BD6A 2VTBB 1VXOA 2XWPA 3H1TA 3HYRA 3HBMA 4V3BA 2AF3C 4MRRA 5AOBA 3SC3A 4Y0NA 2FFRA 5LQRA 1NUQA 3QPBA 3VKHA 3REOA 3ZDAA 4ND5A 5EKTA 4Z4FA 3L7OA 2P6NA 1J49A 4U2DA 5JYBA 3PFWO 5M29A 2WC1A 2AXQA 1EM8A 2XKJE 2C4KA 4OYLA 1XF9A 2ATEA 1JR3D 5DU2A 3RWBA 4KX3A 2EOAA 3HLTA 3SDSA 4LISA 5JO0A 3QVMA 4WNIA 3U5TA 4N5NA 4B3RB 3PQEA 4G4IA 4IRMA 4WKGA 2WKRA 4M9UA 1XTUA 3Q6IA 1NG1A 3I9V6 3M2PA 1XYYA 4Q93A 1BFKA 3CKMA 4LBVA 4U5QA 5C8YB 3NJ4A 2X0FA 1CNFA 4CI0B 2JIOA 3KD2A 4HUJA 1H9CA 2YYSA 3DWEX 4PCLA 1T35A 3C24A 1R0BA 4LOAA 4KZPA 1VA4A 4DV1B 1ULHA 3KZOA 4JI8B 1BWRA 2RSLA 1IBRA 1OXBB 5LQDA 5LP6C 1CZRA 1R0ZA 1DINA 2ZBUA 1OGJA 3K4QA 4EZIA 3DBHA 1M1XB 4D3XA 4BO3A 1RI1A 4QYXA 1EESA 3NCTA 2P2YA 1FX0B 5CLLA 4OJNA 3CVXA 2O0HA 5AI5A 3PXCX 3V1UA 1BQEA 1K5GA 2BC9A 3AF6A 1WDKA 3UVEA 3V8NA 4BB5A 2RHHA 2NT4A 2FSVC 3HNRA 2XGSA 4DZRA 3HXQA 1RBZA 1R0CA 3D8RA 4LGMA 3G2PA 2WYUA 3EPJA 4D98A 2XTAA 2O14A 1NXSA 5HPYB 1WMBA 1ZX1A 1UQRA 4ND3A 4X6UA 2JJ2A 2QMHA 2DPGA 4KNVA 2Y27A 1H0HA 4QU9A 2G9NA 5HW0A 4HAXA 1SKYB 1D2EA 3BCRA 3W06A 1P7CA 1E4YA 2WUFA 2Q0QA 2QIPA 3QM1A 4UQLA 3IHTA 2MOKA 1RI2A 4YCJA 3M3PA 1KZ6A 1SUWA 3WKBA 3ZTWA 5BQ3A 2F1JA 3BICA 1NUHA 1H23A 5C1BA 1CE8B 1CUWA 4O29A 4R83A 1LPNA 4XOIA 5BW5A 4RZUA 1CETA 3ZVNA 1MZVA 4TT3D 3VC7A 1DMRA 3ADPA 2HHAA 3GX1A 1TGVA 3ZV5A 4E2WA 3MAAC 4IUDS 3FIUA 3K9HA 4TTIA 4Y1RA 1H0RA 1NW6A 2GZ3A 2Q8QA 1YDWA 3W9UA 2CNDA 3LTNC 2GHQA 4RFSB 4RIIA 3DBLA 1W4BA 3I30X 3REQA 2BFBA 3S2SA 4ZMBA 2Q5OA 1QOQB 1G60A 1I1NA 4MNTA 3TD9A 5JBIA 4C0JA 3F9RA 4UQOA 3HXLA 3UCFA 4YT8A 2ZOSA 1X1BA 4J7CA 2E7ZA 3IKTA 3WSTA 4NESA 1FXUA 1MPXA 2BJHA 3NIFB 4FYHA 4I5DA 3FG9A 2BM9A 1RZVA 4UXHA 1P0CA 4G1EB 4J0FA 2HM7A 2C58A 2VNAA 2XD4A 4HPWA 3OTOB 1PK7A 2PU5A 5CLGA 4TLDA 4WTOA 5TT0A 3I61A 2LD4A 1MA0A 4OHWA 3VKUA 1X1CA 3BHIA 4ANFA 3G13A 4AIIA 3W8RA 1KYZA 1G7SA 2A5LA 1QO0D 1T34A 3GZNA 3ZNNA 2IX3A 2NXCA 4ZALA 3AVTA 4XIFA 2VZLA 4HGPA 2HGZA 1GTG1 5IC4A 4RETA 4UM7A 4TTAA 2O7VA 1BQ3A 2AYZA 1AUPA 2HLDA 2BE7A 1ZGHA 1NRWA 2ZPTX 4R31A 4OHZA 1M83A 1U90A 4EI2A 2J6HA 5C1IA 1YR7A 2Q29A 2V0CA 3U4IA 2P41A 2RGWA 3RRBA 1KQOA 2I3GA 1E6EA 4X63A 3H4VA 3UZUA 3WWCA 2RBGA 4L9AA 2XJ9A 2WWTA 3SZ3A 4FP9A 2FPOA 4F96A 3LJKA 1OREA 1YR8A 4IRUB 1GPLA 3K1JA 5E9WA 3X2SA 1YZVA 3WZMA 3IUPA 4WFKA 1G98A 3VGPA 4KQCA 3TR0A 4AMZA 3KSZO 3IEMA 1QFSA 1BG6A 3P9CA 1N1EA 1YKGA 2JHAA 3AFGA 2WIAA 2QA5A 1S1MA 1E0SA 2YOFA 4UMVA 1KQFA 1QHGA 2ZE8A 5AUQA 3LIIA 4NAUA 4Q37A 4UASA 3ZE7A 2OSVA 5LBTA 4AMGA 3JQ6A 1CZHA 1YB5A 3BHMA 1F0YA 1GPDG 1SUBA 2CLDX 2ZIGA 2WWFA 4HGZA 2B4AA 4J1NA 2RK6A 5DT2A 3PQ7A 3ANMA 2GJAA 3BCSA 3KDAA 4RMJA 5ITZB 1EWKA 2PVPA 3DFIA 4HQFA 1ODJA 4L8FA 5I45A 1JFRA 1XZKA 4V02A 3JCZA 5E6SB 1UQUA 2G36A 1PRYA 4TLCA 2FPGB 1XZEA 4JVMA 4QQ8A 4RJ2A 2NUAA 2DR0A 1MOZA 4O1HA 4ALMA 1WE2A 3HLKA 3LYLA 3Q7IA 4JJ4A 4MTLA 5AI4A 2ATIA 3CRW1 3N0WA 4PLWA 1EUQA 5F3WB 1SCUA 4QSHA 4Q4CA 5HNKA 1AHPA 2CY0A 5JNTA 2P9HA 1SN7A 1O95A 2YWBA 4EDFA 5CVDA 2PAAA 4Q9KA 1NOKA 3RHSA 2BIFA 2X76A 1XZBA 3UMCA 2BP7A 4P3XA 4BNHA 1KXZA 3ZLTA 5EFZA 4YLGA 2Q0SA 2H7CA 2ZI5A 3FNBA 3QKUA 3X1YA 3G0CA 1MBZA 5JZVA 2DBVO 4LF8B 2R00A 2ECPA 2HNKA 4OSPA 1E32A 3BIOA 3HHEA 3LVFO 1P5FA 4OREX 4C7VA 4LGCA 5JIBA 1VB3A 1R5OA 2H51A 3NEJA 2B4QA 5ERYA 1RTKA 3OZFA 1HYGA 2I2BA 3VTZA 3OIDA 2WU3A 1X8XA 4N9WA 4PXAA 4UMDA 3NRBA 1FDTA 5KX5B 4ZOLA 3R3WA 1DJOA 2JAUA 3UFBA 2R6GA 3MILA 4PCUA 3FI0A 4K8RB 3ZBPA 3ZV7A 3O4RA 4EYKA 4EFLA 1K8ZB 2BFPA 2XTNA 2X2PA 3S7TA 4B4KA 2PXCA 4MYDA 3QE4A 5AKJA 1ODIA 4HBGA 2OCIA 4S2EA 2RHWA 4D2IA 1J9GA 3D81A 4KAJA 4XSGA 2AB0A 3AR3A 3LK7A 3BWVA 3CNNA 4QQFA 5M7EA 2HCFA 2SNIE 4NQZA 3YASA 2AFHA 4BO2A 5ER9A 3DBIA 1P1HA 5B6PA 5KNDH 1OBOA 3B3GA 3OICA 3H6HA 3ZCSA 3DDOA 4UTNA 5KVVA 1T4DA 5JCPA 1W5AA 2FUG6 1X2BA 5K01A 3WDSA 1FLVA 2D00A 1EDDA 3MW8A 1TFRA 2FWNA 2R4QA 2XNSA 2BR3A 1N9GA 4XIJA 5AHXA 5D86A 2IYLD 2Z2ZA 3Q9SA 3SYTA 3ENZA 4P80A 4BGVA 5J4VA 1X7GA 3IOYA 3ZBTA 4P22A 2ZITA 2NSHA 4LXHA 3EZ6A 1WW3A 2W6ZA 3NHMA 5EWLA 5CYOA 2GPJA 4IVRA 2JFVA 3TOCA 5JYCA 4F2PA 3I09A 3EPPA 2WICA 3BE8A 1LF0A 1W4ZA 2H11A 4XJTA 1KJWA 4KJZA 4BV9A 5KYKA 4J1TA 3W5HA 1O57A 2JFNA 1FL9A 3I32A 2DWOA 4J9VA 1KOJA 4N47A 4P3YA 2VTKA 2FHPA 2CC2A 4AJ1A 5F9FA 1Z7BA 3B9BA 3WYNA 1ZN7A 4TMFA 5JFOA 2AVNA 3DP7A 3WISA 3WLAA 1PQ4A 2I99A 3PXAA 4RSMA 2PS0A 4KBYA 1SBTA 4B48A 2EG5A 1J1UA 2HJRA 3ZEIA 2X9QA 1RU3A 1J2RA 2EF0A 2XHEA 2MINA 1GG2A 1G8AA 1U4SA 2HMYB 4HDMA 5GPBA 1U28A 1U2QA 2E2WA 1NDUA 1XTQA 3K1AA 2IQ5A 5FWXA 2Z1DA 3B9QA 4O4LB 3WZLA 3MMSA 1J2JA 4GECA 2HF9A 1TZJA 2GRAA 2QD4A 3AZPA 4NFLA 4G8CA 4PS0A 2HCRA 2NUTA 4ZFNA 1ND6A 1ZHFA 2HA4A 3LOPA 4KZKA 3RUAA 4C0SA 4XAQA 1EEXB 3IMFA 1CF2O 1T8SA 1Z4MA 1ZD3A 3AY0A 3GFOA 3AFMA 4K9RA 3EZLA 1RHQA 1P1KA 2WYVA 4DT1A 3KWFA 4JU9A 4WLNA 4D1YA 2GEKA 3D8TA 5IBRA 1CZKA 1ISGA 1M6VA 5IRCD 1KY2A 1T5HX 2RB4A 3SQWA 4BGDA 2BL4A 4RPHA 3B9PA 2ZTVA 3NORA 2OO5C 4RD3A 3F73A 2XJ4A 4IO1A 3K5WA 3O21A 4MUGA 3QW2A 3SYKA 1L5OA 2RGNA 10MHA 1PZXA 1HTWA 1KZ4A 1YR6A 2IVFA 4OJMX 1CJSA 1WDTA 2WSBA 2D2XA 4FINA 4ZYVA 2VJYA 1KYXA 4I8IA 4NJEB 5TT1A 3L7IA 5THQA 3FYUB 2A94A 2H63A 2V96A 3KB8A 4LMBA 2JH9A 3JQBA 3A3OA 3LT0A 3CCFA 3CF2A 2CFSA 3P19A 4AKHA 4L4XA 2FSIA 2PEYA 4G81A 1DC8A 2FF5A 1BKDR 4GOOD 4A3SA 4B3IA 2VQDA 3K32A 2HQOA 2FMKA 2Q3JA 1CUSA 2DTEA 4TZTA 2O8CB 1NA5A 3RSZA 3JQCA 4U9UA 2Y2UA 2CVOA 3C97A 3NIDB 1PG5A 5E4YA 1LU9A 1THZA 4Y9UA 3ZY5A 1YOBA 4DQDA 2OOKA 3U44A 1GDHA 2AJCA 3EDYA 4RHFA 3U4CA 2VDWB 4UAGA 3AERB 5HFNA 1AKMA 2Z6VA 1P7WA 2DCMA 3BSFA 4B9AA 4HVCA 3I62A 1U5AA 2O52A 3G8AA 4GOMD 4B3FX 1HNXB 2J9GA 2OCXA 2ZS9A 4BMZA 1E69A 1E9EA 5EJ4A 5HQ3A 3BXEA 1W0KA 1WXEA 4IGIA 3IKMB 1XLTC 3VUFA 4EGQA 1KZYC 2PANA 4L51A 3I2KA 2NU7B 1L5KA 3HB1A 2A0FA 3NWBA 4IHKA 4K40A 2DE0X 4RPIA 4BAZA 1I5OA 3CRMA 3R0IA 5AK4A 3VYTB 2QJTA 5AJTA 4AKEA 3ESXA 4XRGA 5K8TA 4YS6A 4MRMA 3ICWA 1MZPA 1MXFA 1UZNA 3QX8A 3DTYA 1TUBB 1PZHA 3INYA 2HOQA 5JCOA 2I7VA 1IN5A 2YVKA 5ALRA 4ZAVA 5DTMA 4B75A 1KEKA 1RMTA 3L8EA 1W49A 4QHYA 3KJNA 3G5UA 3WDLA 1XNRB 4G4SP 1Z0AA 3MQFA 2FPUA 2WQZA 4ZQBA 1RABA 2ZJ1A 4B87A 3LW8A 5ENVA 1VHJA 2RGXA 2XSZD 2OY0A 4LZWA 2ALJA 4AJ2A 2FWJA 5TC4A 1YF3A 4E51A 4PLZA 5J2UB 4K81B 3V4PB 1E2NA 4J9UE 3DT6A 2AR9A 1GYRA 2H16A 5BT9A 3FFWA 2QM8A 3FNGA 1GLNA 2YIDA 5CH5A 4BX3A 1JPUA 4B43A 1VHLA 3RYIA 2L69A 3IQDB 5IJXA 1AZSC 3OEWA 1UBNA 1IPHA 2AWOA 2PQ6A 3L8CA 1IDN1 1R0RE 1WB5A 2IYQA 4MZXA 3EA5A 3QWAA 2DEUA 1FMJA 2DTXA 4DNFA 3HFRA 1T9HA 4XXHA 1UDCA 2QAIA 3P2IA 4G2NA 4JT9A 5AM1A 3GJRA 1X1QA 4HX2A 3WE7A 4FB4A 4PPFA 5FPSA 1E7MA 1ZH0A 2BFNA 2IZ1A 5ULLA 2Z1MA 3RJMA 1X8KA 3MHPA 5KJEA 1W4LA 3DXYA 4UBMA 3EVFA 4HS9A 1Z06A 5FHRA 1K2VN 2JH8A 4TTSA 3F4BA 1BWPA 4JH0A 1SZJG 1XTZA 2A92A 2JW5A 4HF7A 5J9FA 1ZH2A 4H60A 3TFQA 1XNJA 3BH7A 3DAGA 1UPTA 4L9WA 1VMAA 2W9XA 4TKVA 2QRNA 1E2EA 3T9CA 4DIOA 1R6XA 1PR1A 4B76A 3TGLA 1CJVC 2YRXA 3JX9A 5CYFA 4AUMA 1JQKA 2ODAA 2ZWPA 1GT6A 1RYFA 1BS9A 3G2HA 3O7WA 3N5KA 2YMPA 4Q21A 5DK4A 4JI3B 4CR8A 5CA1A 5TDHA 1E99A 4AI6A 4Q4HA 3OT4A 4R69A 2CKMA 2F00A 4V3CA 2ABWA 1N2OA 5IDVA 3TLYA 3S4YA 2VWGA 1GZDA 3LHSA 1FUEA 3OE5A 2GF9A 4OAPA 5BUQA 1YI8A 2L19A 3JTMA 3F2IA 2QY6A 2JFUA 3FYDA 4Q02A 4CF6A 5B3LA 1T8PA 3GBPA 2VJAA 4YALA 3WLKX 1LX7A 4WK0B 5P21A 4JYPA 4POOA 4P82A 4TQ9A 1GTVA 1SUCA 1O87A 2EBHX 2I6QA 2IDZA 2YL2A 3EOBI 4JLKA 1TIKA 1IOZA 2EX1A 1B6RA 1NOJA 3GJ6A 3MLAA 3OPNA 4RUKA 1E9CA 4UCXA 4TSFA 2ODWA 3AR6A 3CX6A 1B4DA 3LPDA 1FLNA 1HZJA 1TVKB 2Q3CA 4X00A 3S2ZA 3TIFA 3VTKA 3PIDA 2V3CC 4N0DA 3W2GA 2G25A 4OI4A 2Z3VA 3SX0A 4BMDA 2HF8A 2XY4A 3OZXA 1P4JA 4AJPA 2HI0A 4EZEA 2Q99A 1D2RA 1SCDA 5CMLA 2ZZNA 1URPA 4YEDA 4OL0A 3JZAA 2GM9A 5D1HA 4Z3KA 5HF5A 5L45A 4GRAA 1M2OA 1H65A 1N9ZA 4RENA 3UUEA 3WADA 2WHXA 5FOUA 5IX8A 2GM4A 1RDFA 3I5XA 1BGVA 1KMIY 3PK0A 4FC6A 4KWCA 3KD3A 5ALNA 5DZSA 1V4NA 2NVUB 4EKNB 3KHKA 3PS9A 2JLXA 3WL6A 5AWFC 3TNLA 4PX2A 2YWXA 4PLHA 1JHRA 2WSSD 4Q5IA 5DNVA 5K8UA 2CF5A 4HFMA 3PV0A 4M9RA 4QOEA 2BTEA 2ZAYA 3T0GA 4OQEA 1BC5A 5HHTA 2BUAA 1RW4A 2EZ4A 1M5RA 5JEDA 1XE3A 4MVJM 1QQAA 5F3DA 4X1IB 4KVAA 1F1BA 1LDGA 3UH0A 1B15A 1X42A 3QOYA 4EJSA 1FB5A 2YINC 1DXHA 1P1IA 4LNUA 4MKRA 1VJTA 1O4WA 1ZUNB 3E3MA 5EUCA 1IQ0A 2ONJA 1ZA2A 3ZWPA 5KQGA 1F17A 1OLXB 4YBZA 3TOVA 4Q1VA 4YUYA 5LJIA 3P9XA 3H17A 1OWNA 4NMHA 3VNQA 5JI2E 4W5WA 1WMAA 3ZLVA 3CUEF 2IJGX 4Q1EA 4BECA 4KOEC 5TIIA 1YDFA 3MTJA 5LL6P 3AG6A 4KPYA 1A7JA 1K98A 1KO5A 1ZVQA 2Y0CA 5FL3A 3VPGA 4B6SA 4GZ5A 1LI4A 1Z83A 1II8A 2H4ZA 2PDAA 3CX4A 4X95A 3T8YA 1FJ2A 3MCTA 3WLMA 4C7JA 4KXMA 1E0JA 1Z13A 4FBGA 4ZVRA 5AVTA 1NHWA 2W6OA 1M6WA 1J9EA 1Y33E 2NZ8A 1U8FO 2PYZA 3Q8WA 1XTIA 2X86A 2YC4C 3WGNA 2WP0A 1RYDA 4WL0A 4YTEA 1E1NA 1N92A 4MLPA 3SC2A 3EXAA 1LRKA 4Q9NA 1IBKB 2VDQB 3LX4A 1D03A 3WGGA 4M6WB 3EFEA 2E4ZA 1I2MA 1Q0ZA 2EQBA 4RKRA 1YCDA 1QRRA 1XTBA 3NM6B 3UANA 1V5EA 2VJKA 3GBVA 3UY4A 3TLBA 3OFVA 3UG7A 3VR5H 1NN3A 2Z4SA 1GKUB 4EG5A 1B2LA 2WV7A 3ZD7A 1TTQB 4B7CA 3FVQA 2P7IA 1MJGA 2NWQA 2ZSHA 2OCYC 3R5TA 3JAWB 2OBLA 1L5YA 4NV3A 1WD5A 3PNYA 4IILA 4MITA 2FRVA 4P4SB 3HGTA 3JQ9A 4I5IA 5D5PA 1DC7A 3HR7A 1GRNA 1XXHE 3I4FA 1T91A 4I1VA 3PR2B 3EIUA 3HA7A 3GNLA 3VHLB 2CUTA 5JSYA 4MUKA 3O1HB 2BKUA 1FQOA 1NR7A 2A1UB 3G9XA 4K6KA 4AJJA 5B1EA 4RYLA 3GI1A 4MIKA 4PRLA 1EDOA 3FPLA 4ABTA 3PUVA 3BRWA 1PJBA 1RWPA 3ND6A 3R0XA 1V41E 2AW3A 1L5NA 4JBXA 4CM6A 4RWZA 5C7OO 4C5BA 2JB9A 2ACWA 1ZP6A 3GMDA 6REQB 1XQVA 2H2FA 3K9CA 3M33A 4HAWA 3PEVA 2AZTA 3C14C 2PY6A 3QELB 4PGFA 2PX0A 1KORA 3DMNA 4YREA 4QYTA 1XG5A 4DILA 2NZXA 1RJWA 3NZEA 5JZ9A 5AICA 3NVKI 3DMGA 1EINA 2QRJA 1XCGB 3KT3A 3ZLJA 1S02A 3LVRE 4I3GA 2QJRA 1JSCA 4OJQA 4E88A 3GH3A 4PVCA 4LW8A 4L07A 2AMFA 2QORA 4MVJE 4I4TA 1F8XA 4QXMA 3ZQKA 1UBJS 4N5LA 1CIVA 1KBQA 4GOKA 1QH8A 3KQQA 4RZSA 3QKRA 2HWKA 2PO7A 3A1SA 5CK4A 1E5LA 3TSWA 3CZ5A 2A7QA 2W98A 1ISPA 1YJ8A 3UXHA 2DR3A 1JR4A 3OCYA 3OQIB 2WUWE 5JZBA 2TYSB 3CEHA 4XTRA 5E4FA 1NXVA 2P77A 2Q07A 2VAWA 5DCUA 4C21A 2D0IA 2GCIA 4ZXPA 1RPZA 4M9XA 5EJ6A 3WC4A 1XGKA 2VAXA 3B3JA 4DLVA 1R7RA 3TZQA 2QG9A 4OO3A 4UOQA 2X2FA 1ADJA 3T1QA 2CD9A 2HMUA 4M87A 3U48A 5LXTB 1J20A 5DM60 1NBME 3FCSB 3W90A 1UXGA 4YP0A 1FP1D 1NW7A 2HSZA 1SIOA 4FQ5A 2W6ID 5CA0F 4QL3A 4G0MA 2A8YA 4KLCA 1YR2A 1WZNA 3KJXA 4PLCA 2HZBA 4XYBA 3P9YA 1NMEA 1W9MA 3I6YA 2OVFA 2E48A 5CFLA 3AIOA 3EJWA 3GGPA 1F12A 4AYXA 1PP4A 1VCMA 1TJ4A 3K0FA 1N57A 5E6RB 1X14A 3F3YA 1SHLA 3PC3A 2C94A 3D2AA 2WSYB 4BO6A 1SUIA 3ZYCA 5AM0A 4C6RA 1UEIA 1VHQA 2JBAB 2B4YA 4R9UC 1PJAA 1C30B 4LG1A 3LT1A 1QFJA 2B25A 2ZBRA 4YNBA 1KDZA 1G8KA 1E0AA 4KPFC 2ESRA 3G79A 1ODKA 1DQNA 3I2FA 3OQJA 3WWDA 2PMCA 1Z22A 3WDKA 1YE8A 4BQQA 5J1SB 2JEYA 1PCXA 1YRAA 3GROA 3NEYA 2BFDA 4AS1A 1VRCA 3NT4A 3P26A 1LQUA 4Q0MA 1Y9ZA 3EF1A 3M1IA 2BVNA 2ZI6A 4NMLA 4Q03A 1TAHA 1K88A 5GJWC 1E96A 4CFYA 4LMPA 3LRPA 4PQYA 2VDUE 2VF5X 3EUFA 4IW3B 1V3VA 1P81A 3LBHA 1WSAA 1NAIA 2GF2A 4PRYA 4JLAA 3VC3A 4CKBA 1N1GA 3RROA 3OOWA 4DBLE 4DIUA 4LF6B 4Y1FA 4YJ2A 4C4ZA 9ATCA 1V7ZA 1VKJA 5E9QA 4ABYA 1Y7HA 3FD8A 5LSAA 2OZLB 2O3SA 5ALJA 1XD2A 1RJFA 3T3MB 2YHAA 3GDOA 3R77A 3C5WP 2IHKA 1K63A 3KT0A 2XAUA 5F7OA 2C04A 1ETHA 4RVSA 1C3OB 1DO8A 1PEKE 1NW5A 3NIWA 5EE0A 1VLJA 4AJIA 2OV1A 4PYMA 3KLBA 5IJ9A 3JR3A 4YV0A 4ZI7F 3UM9A 2VWHA 1NXPA 3HUFA 1V11B 4HS4A 1B74A 1ZS9A 2PJDA 4IGKA 4V0SA 3WBBA 4FIDA 5JSQA 2BJWA 2HQRA 4MVCA 5EP1A 3A7EA 2JASA 2QQ0A 1AQNA 4MVYA 2VHZA 2E1RA 1JQ3A 4B6RA 1ULTA 1XZAA 1I2DA 4JDUA 2VTBA 4OLAA 4G9EA 1UINA 3UBMA 4KR2A 1TZMA 2GCOB 2P3SA 3EXG1 2JFXA 1VBFA 3AY7A 2HTEA 5HWSA 5IABA 5IT4A 4R8KA 1Y6FA 1KKMA 2HC9A 2ZATA 4Q4AB 4A1OA 5BR4A 4UATA 2VKQA 1HV8A 2ZWOA 4JYBA 4X8HA 4YA6A 4TL7A 4RVFA 2IIQA 2PGLA 1SGWA 3KE8A 3NFRA 4PHFA 1WCWA 3HA5A 1IBCA 1F9AA 1PT7A 3EN0A 2XIQA 3EZNA 4OGFA 2E82A 3HN2A 3PYLA 1TRHA 1U7HA 4M89A 4WEQA 3I6QA 1E98A 5IANA 1HLDA 4KACA 3VNUA 4C6TB 1X9HA 5H3LA 4JBGA 3RIMA 4E5YA 1SC9A 2JIDA 4GBMA 4LOLA 3MWYW 5C8YA 1JIUA 1COWD 4ESOA 1U98A 3B20A 2I6XA 4XWYA 1KVQA 4YCAA 2BSXA 2UVPB 1TZCA 2RGGA 1YB6A 4DJDC 4MJ7A 3DQQA 1UK8A 2C77A 2P27A 3KALA 3VR6D 3AKZA 3IT0A 1AXRA 3A14A 3DM5A 1VDZA 2GQ0A 2J9FB 4V1CI 2J3QA 2OK7A 1H6DA 5HG0A 4J0GA 2AJLI 2H5LA 1FYFA 1FX0A 4NBWA 1YMVA 3DTNA 3M5WA 1RVDA 3F6YA 3O2SB 1L5GB 5CLFA 1WF3A 3C7DB 5AVKA 1PT6A 2RHCA 4O2BB 4WOKA 4ZOQI 4NHOA 2QENA 4LFBB 2CXQA 1J2EA 1IMOA 3DPUA 5IKXA 1Z45A 3M0EA 4RHCA 5IJ0B 4ZP1A 1Z2NX 3U7JA 4GKKB 3LCCA 4LTNA 5DTQA 1NBEA 3CUWA 3H86A 3SI7A 4YAKA 2BFMA 2WTAA 2OXCA 1PR0A 3JQAD 3VM6A 1QE5A 2FNAA 1KY3A 1N5KA 5DIFA 2NQTA 3UUFA 3L8MA 4NU6A 1UT8A 2IP4A 1BROA 2V5AA 2CDBA 1CE8A 3CFYA 3IQIX 1P5RA 2ETXA 3MIZA 2FJUA 2VSQA 4JYZA 4EUKA 3HHPA 4O4HF 4H7IA 3OHPA 4EHIA 4ENWA 5LB2A 4E6PA 4KYVA 4B73A 4KC0A 2R86A 2AFVA 3GFGA 3T3DA 4RFSA 4EHHA 3HDYA 1J9ZA 2CXPA 3G0HA 2I2AA 1IQUA 4GG1A 4GZ6A 5CAEA 3I37X 5K5EA 1XMSA 4R1UA 5KDDA 4NU5A 4ZREA 3X3HA 2JGAA 1B8PA 5F98A 1N2CB 2IPOA 2RHJA 1AJEA 2JVIA 3JARB 3OU7A 4DRYA 1TM5E 2PYDA 3F8TA 2XCLA 4GBED 3IQGX 3NEPX 5BW6B 2Z6UA 1Z0IA 1H66A 1U11A 2MJLA 3MCAA 1PTJC 4P2BA 1J0BA 4WRRA 5ALFA 3WOVA 4EKYA 1SVNA 3IQFA 2XDQB 1SCNE 4Q19A 4ZKEA 3AR5A 3DOIA 4DIFA 3L6UA 4YRMA 5J5CA 4WINA 2VUTA 1HTBA 3K5HA 1L3IA 2AHOA 3G89A 4NOKA 3KCQA 1ZH4A 3U26A 2C0QA 1AVTA 5EPOA 4O0LA 2QZSA 3IPXA 3QVOA 1P3JA 3H11B 3ER6A 3QLEA 1YS7A 4QRHA 1O94C 2J5XA 4CKEB 1JZQA 3PNOA 1VB5A 4N18A 4QUEA 3TW4A 3UHJA 4BVAA 3U7QB 3RK4A 3WHPA 2ZUSA 2QYHA 1K9SA 4ZARA 3LG2A 3EW9A 5EXPA 1RRKA 2VF4X 1PFKA 2NV6A 4QDOA 5K3FB 1OV6A 3QF4A 3VR3A 1F8UA 4KQHA 1G3UA 3S7ZA 4CLDA 1T2VA 2GEDA 2N1BA 4F4FA 3GLFA 1QIGA 1EG7A 3C5EA 1KK1A 4OI2A 3RIGA 1J90A 1L5ZA 3L4SO 1DIAA 1TRKA 4EW6A 5LDHA 1CWUA 1JHOA 3A1DA 1UJ6A 3GA0A 1AS2A 3Q12A 2CV2A 2H5EA 1JP7A 3SQXA 1NRJB 1E2MA 1KHHA 4JDPA 3R7LA 4TTQA 1DQRA 3RBVA 1CY2A 3V33A 1TQ6A 1FDOA 4JSRA 3S8EA 3A6JA 4XRRA 3LD9A 2XKAA 2G8LA 3GFQA 5LJLA 4A2QA 5CEFA 1Q0TA 1B7GO 1E5DA 1G0NA 5I5EA 3FGOA 4BRWA 1CP3A 4F4JA 3U6KA 2VUUA 1Y4DE 3MS4A 4ML3A 5I4CA 3QBJA 3RABA 1J2TA 1Z4LA 1NKTA 3T61A 5DI3B 2EGHA 1P91A 4CMIB 4UOZA 4KXXA 2IT1A 3A11A 3KVOA 1IUOA 5FL7D 3TDMA 4S3MA 2IHUA 3AINA 5E6SA 2FCRA 2CK3D 1YS2X 2NZYA 4QFCA 4ZJUA 2FPGA 4BJ1A 1VCNA 3CMMA 5H1YA 3ZHVA 4B3TB 3RS9A 3NPAA 1W93A 3GMSA 1SBHA 1Q1GA 2CW5A 2F7SA 1RBMA 1ZVJA 3OM8A 1I01A 1VMKA 1U3GA 3R5FA 1EDBA 3LZ6A 2ID8A 2FZKA 1NM5C 1UL1X 3M1AA 3N07A 2ZIVB 3NOVA 4IDNA 4UUPA 1UXIA 3HVJA 3UEOA 3RS7A 1TO1E 1QQ7A 1DKLA 4I6EA 4UHFA 3ZNQA 1K6IA 2JKYA 3NP7A 2JGMA 3JVEA 4ZCSA 4Y2XA 4LYGA 4BVEA 1ISMA 3OPVA 2YN2A 3LWDA 1ZOLA 5HZMA 1A2QA 1CR1A 2OC4A 3R24A 4EYOA 3W77A 3KE9A 4ZU1X 2GLTA 1TT5B 1UFRA 1DAMA 5KX5A 1JMVA 4TXMA 3D43A 3DKVA 2IS1A 3T7RA 1WZIA 2WKPA 5F7XA 1XFDA 3NTQA 4F72A 3WX0A 3JSXA 3DCYA 3WNDA 4ZDIA 4RQAA 1QK4A 3MSCA 3RGGA 5LMNB 1FBTA 1QPBA 4Z7OB 1ZM4A 4OA8A 2WWGA 3RTAA 4YT2A 4MVJF 2AMJA 3K0HA 4MB0A 3WMFA 4YRKA 1CB0A 2AQHA 3LYUA 3L49A 3R74A 1BIFA 2OXFA 1FXSA 2K7ZA 3TW8B 2AZXA 1ZD4A 3ZJTA 3I52A 4M54A 1DDIA 3N7UA 1T1GA 2AQ8A 2DSTA 3FTNA 2EX0A 4PIMA 4URVR 4WUTA 1KU0A 2X9NA 1AQLA 2J08A 4Y0VA 4PIPA 2I3ZA 3N6XA 3DOJA 4J43A 4KU4A 3AF1A 3WGJA 1SB8A 3ZWOA 2NIPA 1QIIA 3LBNA 1QGUB 2VAVA 1RC0A 4BNXA 2H2IA 2X0IA 3EY9A 4R8SA 3MG9A 2Z5LA 3F5SA 3SYMA 3W04A 3RVLA 4DSZA 4LZJA 1T4CB 1TMYA 2HUPA 2WQ7A 4ZPJA 1CS0B 2PA3A 2XUKA 1D6SA 1MRNA 3DNFA 1Z0DA 1AM4D 2PFGA 1FDIA 3FUXA 4AG6A 4C4TA 1T2UA 3PDIA 4RZ2A 2DH5A 3BULA 2HMSA 3Q3CA 3IHWA 3NEAA 3RV4A 2RCYA 2VC2B 2V4ZA 2ZE7A 2IZOA 3KHUA 4NDAA 4PZYA 2IFTA 4HFNA 4LVNA 4A23A 4IO0A 4L02A 2YJ5A 1Z25A 1AGYA 3GEMA 4ZCRA 5LKRA 4DUZB 1RWMA 4KFUA 3ZGXA 2HWXA 4BKUA 3PUWA 3S8MA 2ZTLA 1RI4A 1F7UA 4N49A 4XQGA 4YY3B 1DI0A 4YMGA 5FUVA 4DV6B 1Z0ZA 3H1FA 3HDGA 5KSOA 2PSDA 1WHSB 1U9ZA 3H05A 2JDID 4EA8A 3C3MA 3UCEA 5GTDA 4O4LA 4UU7A 2BEWB 1ES9A 4OHUA 3A3PA 5CM8B 3RWOA 4NY1A 4N12A 3RU7A 5T6BA 4OM7A 2BZSA 3EWNA 1F0NA 2AX3A 1JG7A 1YFLA 1PJ8A 1GEGA 3AF3A 4HPXB 4FMCB 1MENA 4QPDA 4IJKA 4J0KA 5JADA 1KMQA 3CH7A 3FPEA 3EXEB 2QRPA 4XA8A 3WQRA 1QP4A 3B2EA 3DOFA 4CETA 4RF5A 3DOOA 2R6AA 1IAQA 1UIRA 2ZUBA 1TADA 5K8VA 4R9RA 1SC3A 3JD0A 1NXOA 1HDEA 1UANA 1W9HA 3E0XA 1K8XB 2B1JA 1J8YF 2XMSA 3QUSA 3DSRA 5KYUB 4JR2A 1RKBA 3AB8A 4NJEA 4P7FA 3ES9A 3K5PA 5F2EA 4FILA 3FYUA 2SECE 3LHDA 4MCJA 4QJ4A 2F17A 1H5UA 1SFRA 2XADA 5E8JA 1E2FA 2FMTA 3O4VA 1I6LA 3QBTA 2AFHE 3FHJA 4WX2B 2IPLA 1PG0A 2N3ZA 3FB1A 3OECA 1DIHA 3QA3E 3AF2A 2QRZA 3JQPA 2B78A 3S44A 1L7NA 4LF7B 3SSOA 1QIFA 1KEZA 3DFKA 2X7XA 3JRNA 4NBTA 5B4UA 1NMQA 3FKJA 4JLVA 1AY0A 2O8CA 1DLIA 3D02A 4I5EA 2CLIB 4ZT2A 3C16C 1JA0A 1T8RA 3C5CA 3FR7A 1OH6A 2QRLA 1Y7TA 2FHSA 1U1FA 4ZHQF 1IEVA 5HR5A 1QG6A 1P1FA 4FGUA 3SXJA 4XWTA 4UM9D 2I6TA 2VDWA 4IPTA 3AERA 4P0TA 1P2UA 2R44A 3LVQE 3QLJA 4RJLA 1CRPA 1DT3A 1FDSA 1PL6A 1BCSB 5DK6A 2VPXA 4MWTA 3CIOA 2GXUA 3U0VA 3BWCA 2KWIA 3S29A 3UJAA 1SPXA 4AJ4A 3FTFA 1ZPDA 3DEAA 4CR6A 2WSMA 3WR5A 4ALIA 4LDAA 2NU7A 5D3MB 3COZA 4DLAA 3P9ZA 1JFLA 3K70C 4S1WA 5DM4A 3N0TA 2I2WA 1RRGA 2QGFA 4MEAA 2J4CA 1RAAA 1FSSA 2IYEA 3I64A 1YZFA 1GZ6A 5ALPA 5FBHA 1TUBA 3PI6A 1W94A 2FVXA 2GN4A 1XJCA 2X0KA 3IEPA 1R5JA 1XDUA 3K96A 4PX9A 4NEQA 4Y2SA 3M1YA 3QE3A 1DAOA 4FZRA 5DX8A 5G1PA 5LA6F 3D3KA 4EJ6A 1Z6YA 3BJRA 2G80A 1W36C 1OTHA 2OENG 3GARA 1HZZC 1P8JA 1YZTA 3ANLA 3LLSA 4D3YA 2VVTA 3JTEA 5DOZA 5J2UA 4P3PA 4K88A 1QDUA 2HW8A 3OZEA 3A2MA 1B0ZA 3A6EA 3OTHA 5CNKA 2ZRQA 4G5XA 4RV4A 2BWJA 4KQ9A 4YRJA 1B26A 2Z6AA 3NRCA 4WDQA 4ZEMA 2W93A 3O83A 4DMRA 1A4XA 2CZQA 2W6MA 3U7GA 1F06A 3WV5A 4HBZA 2VJMB 3O1IC 3WGOA 2XUDA 3B7GA 3C1AA 2DUWA 1P2BA 1GIAA 4CV0A 1YE5A 3NC0C 3QF7A 4J6EA 3M7IA 4DSOA 4P31A 3R9IA 4XD7A 1M2VB 4UDOA 1SKBA 2HFKA 4JUCA 4JUBA 1RFGE 4MA5A 4QDTA 3TRKA 4F1KA 3U9SA 1HUQA 1DKMA 4QT4A 4N41A 5A7HA 2FVYA 2ZVJA 2V7PA 4M1QA 4P58A 4AKGA 1DUVG 1M6EX 2FYTA 3PHIA 3ZQJA 4FYXA 4M1TA 4CL2A 2ZPAA 4OBWA 1ZK1A 2P4HX 5PNTA 4DA4A 3DE0X 4LV5B 3S40A 2OHXA 3HKCB 3OFSA 4G0PA 4II3A 4MIEA 4NBNA 3VPCA 4DQKA 3W5CA 4UVIA 3P5BA 3ENNA 3EUAA 4QBGB 3S5UA 4K3UA 4A0SA 4V1CB 3I34X 1Z56C 3D8HA 5AKYA 4V0MA 3HU2A 5LZ5A 1MGOA 1GU0A 2JA1A 2B1IA 3X1DA 5MFPA 3NG1A 4DLBA 4E4TA 4LI3X 4JZKA 4LHZA 3IXLA 5FOWA 5I9SA 4TT3A 3RREA 2VK2A 2FEMA 4LECA 3PJFA 2OBXA 1U2GC 4B6JA 2A9JA 3C6ZA 3O8CA 1ZAYA 3U09A 4LBZA 3SR4A 1PD1A 1Z3CA 4R8LA 3V2GA 5C7LO 1IOWA 5BWMA 4F4DA 1DB3A 2V1XA 1TAGA 4X97A 4ZCLA 4AS2A 5BV8A 1CTQA 1LSSA 4RPCA 4D0SA 1TQ2A 4NZYA 2Z98A 3UT0A 3UBTA 4N3AA 5CVUA 1O96B 2BKVA 2ZBPA 3CG0A 1TVKA 1ORWA 3FTCA 1Y5RA 1GSHA 3DB2A 1SKMA 3ECSA 3NT5A 4IKEA 3Q0IA 1QUEA 1H2FA 2PR2A 3L7AA 4BZPA 3NASA 5ICCA 1KDPA 2R5WA 2QPTA 2R7MA 3MAGA 1NSYA 3LUGA 4FEGA 2FFJA 2HYIC 1CEXA 2HLHA 1NMSA 2J0UB 2AEJA 4AC9A 4DBVO 4NXNB 2JJQA 2DMRA 3H5OA 2IZ5A 2E89A 3V4FA 3ZNPA 3FOBA 2WTNA 2CJWB 3HBAA 2P68A 3ME5A 3NGLA 4GYJA 4P5DA 1GEEA 4Q7JB 1HRKA 3SOPA 3I2GA 4AY6A 4R3UC 2NVUA 2B6NA 4M49A 4K9OA 2D0PB 2CJFA 1XJ0A 4ZICA 1ZRHA 3TRIA 5K0JA 4UHJA 3U7HB 2IU3A 3ECAA 2JATA 2R7NA 2QRHA 3C8ZA 1P2TA 3VR0A 4EAAA 1T10A 5CD1A 2JFZA 3SJCA 2J32A 1NIJA 3A05A 4OXNA 3S0JA 2IXTA 1GPMA 3FGPA 3O2QB 4D0NA 4QEKA 5SYMA 4D41A 1A8SA 2YFQA 4HAVA 1OPRA 5T6MA 1EYZA 1Y3IA 4WXPA 3OX3A 2ZBEA 4X1IA 1U80A 2I1QA 5EIXA 3QENA 2J7KA 1X3LA 3KXKA 4RIEA 4DAEA 4BO5A 3PHJA 5G40A 1BE0A 1ZUNA 1OBVA 3VZBA 4YJ3B 4CLRB 4DZZA 3COPA 2OHVA 1OLXA 5IJAA 1XEAA 1GPWB 2HU7A 1U7UA 2HK8A 4ZZ1A 1SCBA 4M22A 4WCVA 3UOWA 2GAJA 4RMNA 4XM2A 2AN4A 4DCPA 3AEYA 1S7GA 3B82A 3JS5A 5EINA 2GPYA 4H7JA 5A05A 1Z6GA 3EEBA 3JY6A 3NDIA 3DEJA 3GEGA 1GADO 4IOJA 4LSGA 4XYGA 4ZVMA 4BU0A 1QQBA 4INAA 2IE0A 3GEHA 1DPGA 4PGMA 4QEZA 4ZO7A 4RSRA 2G4CA 3CKLA 1G1MA 4M55A 5DNCA 1XKXA 1OTYA 1QTQA 1NT2A 3L9WA 1U02A 5H4GA 5EP4A 3RT7A 3TGWA 3FMGA 3JD2A 1K0UA 3INNA 3K2IA 4PSVA 4HLDA 2VYQA 3M34A 4RMIA 5EWJB 6ABPA 4M9SA 5ALVA 1Z17A 3ZE9A 3VKGA 1GQFA 4KRXA 1P4GA 4X65B 1SOVA 2PWZA 3FA2A 1XEFA 3QXGA 3Q7TA 3KQPA 2ID9A 1GHTA 3OFKA 4M6WA 1DAPA 1R9GA 2PL5A 1NBWB 1RXUA 3BMCB 3LP5A 2E21A 4DG5A 3L7NA 3VKFA 5A4FS 5J23A 3A9CA 3K3PA 1VMEA 4GX5A 1NJSA 1V2HE 3JAWA 3LKBA 1Z75A 1QRSA 4UPDA 4P4SA 2HMAA 2YDXA 1GJRA 5HE9A 3ETCA 4MPTA 3WFZA 1P31A 2NG1A 3UWMA 5DW3A 2NACA 3VJKA 2A1UA 4Q9AA 4EKDA 2IUSA 2Q62A 4RD2A 4LTMA 1ZI8A 1O89A 1FYDA 3TQIA 2B8EA 1VSQA 3K0AB 5ILQA 4XYEA 2WWRA 1WV1A 3U17A 2EJUA 5JZSA 1P33A 3A4VA 3F90A 1ORDA 3HN6A 3JVIA 3HCWA 3K1YA 6REQA 3AUKA 2RGBA 4L95C 3OPMA 3QELA 1QP7A 3NP9A 2AN3A 2OA0A 4WIAA 1OXVA 1XTKA 1XL0A 3DFZA 1I7SB 2ATVA 1YHZA 1Y42X 2XBUA 3PRHA 5CH8A 3H75A 1E8NA 2RGAA 1ZXLA 2D1FA 3BTSA 3PQ6A 4IIJB 1QAMA 2VJBA 1X7WB 9LDTA 3QU5A 3WRXC 1QTRA 5HX7A 3BGIA 3DF9A 4JV5B 5T8KC 4YMLA 1GPH1 2F3UA 4QGGA 2EKLA 4QQNA 4B47A 4XWKA 5HIKA 1U0RA 3X2EA 1QOPB 2PGOA 3DZIA 5K3DA 4DS3A 3PXUA 4D0LB 1RACA 8GPBA 5IG2A 3KQLA 4DR4B 4UHEA 3LLVA 1M0EA 2Y2VA 2X5XA 5IVKA 1MHTA 1PGPA 5C81A 5H9WA 1Z12A 2QVZX 3QXSA 4PPGA 1GM5A 3D54D 3OQIA 2Q0XA 3LBIA 4KGZA 5FPHA 3QXHA 4U2KA 1KDYA 2VTEA 1Y63A 4S1VA 3TNFA 5DGCA 2H52A 3G0OA 4UW9A 3RVOA 4IG9A 4ZOLF 3TKLA 1E4VA 1Y8RB 3KUKA 1ZSVA 3C85A 1JSRA 1ORTA 1QKIA 3ET5A 3ODPA 4OCZA 1IULA 2IU6A 1LS6A 1Y4SA 3NOQA 4YFYA 5EIHA 3EBOA 4CV1A 2IYAA 1JDSA 3N2GB 4OV6B 2X5NA 4KITB 5LXTA 4RTLA 1NVMB 3IDFA 3PNQA 1V1MB 2XCQA 2C2BA 4M9ZA 2XLCA 4PNEA 2ZBGA 2OFOA 2ZAMA 5IUJC 3CZCA 4D25A 3MOSA 3V32A 2VHCA 4UPVA 4Y98A 1KYIA 4R16A 1Q21A 2Z8YM 2JFOA 1I8TA 2GPTA 2WPNA 4IHJB 4MI9A 5EQJB 4OHPA 4ZVVA 1X1SA 2WTEA 4WNAB 4Q7QA 2QZJA 1K7EB 5IVPA 3AJAA 4QAJA 2BEJA 1BWQA 3NYRA 2OFFA 4EFKA 3BFVA 4W5QA 1E77A 4NG4A 5E6RA 1N7JA 3HFGA 2JEOA 2IOFK 2WTUA 4P3KA 5BV7A 1N78A 2PKCA 4M76B 5SICE 4D56A 3QMPA 2JBAA 3OIFA 1FSPA 4M1MA 1C30A 3SKXA 1JSZA 2O50A 1E4OA 2YIVX 3L7JA 3R7WB 3VBEA 3IOEA 2UZ0A 4MUFA 3WHLA 2DQZA 1BW9A 1V9LA 2XE6A 1ZIOA 3Q41A 2WHRA 4BQPA 2VS1A 4G85A 2GPBA 4E2YA 1T0BA 4HLUA 4JA2A 1BN7A 3ZWMA 5T7BA 1HE3A 3RC9A 5KHLB 4AY4A 3PZRA 4NCAA 5KI6A 5EJAA 1ZM2A 2Y1FA 4YQYA 4X8MA 3E2PA 4HMPA 4MW5A 1FQWA 1ZH6A 1ZOOA 1UBFA 3O9ZA 4NDZA 5LD2C 1QX4A 3NT2A 1DBIA 2AF4C 3D7RA 4P4NA 5ELMA 4EF4A 3OSUA 1WXHA 3PRKE 1N2EA 4D6XA 1YS1X 4GMKA 5KVQA 1OKKD 1VL5A 2XRFA 4IIBA 2OZLA 2Y4OA 2F67A 4RHUA 3HSYA 3NXKA 3OY2A 3RSSA 2HX1A 1KJYA 2A84A 2A78A 4ZCMA 3QJGA 2COEA 4YXFA 1JG2A 1YA4A 1C3OA 2ANBA 4BS9A 1X9IA 4DAOA 3ZBUA 1Z62A 3L0BA 1QIKA 3AI1A 3LYAA 1ZNYA 2GAAA 1V11A 5SZIA 2AC4A 2WWYA 4RZQA 3TOSA 3IUSA 2CMGA 4QPNA 4S12A 5DHQA 3OPXA 1NC3A 1DKOA 4PYJA 2YWHA 1F4LA 3P71T 5EGSA 3OAAD 4ZVSA 2IWHA 2YYYA 4LBYA 4BCBA 2PQ2A 2LRHA 3O47A 2GCOA 4DNOA 2HO4A 4J29A 1QNFA 1P75A 1T6BY 1HF3A 1IY0A 5TQ0B 2VHQA 4Z7JA 4P9NA 4QOJA 3R1IA 1G9XA 4FZJA 4JKOA 4Q4AA 3WO1A 4ZYLA 3OUUA 4ND7A 3WZ2A 5EJ9A 1QNLA 1CZNA 2FTKE 2FQWA 4LYHA 4PBRA 4R51A 4MEBA 1DWOA 4PONA 1XZHA 5B53A 3EOAI 1ZM9A 3FI9A 2B30A 3IIIA 5HS6A 4JJZA 4AJNA 2BPOA 3Q0TA 4GLLA 1DV1A 4ACAA 2NXNA 2W2LA 2JNWA 2GILA 3IHKA 2F8LA 3BDVA 4KMRA 5M3BA 4C6TA 1G5PA 2HPVA 4G84A 2QUJA 5JATA 3FLEA 1Y4ZA 3JQFC 1F7VA 4B7XA 1VE5A 4E2FA 1PEDA 4GI7A 2YYAA 4IXTA 2AFIB 3KSUA 3VVMA 4D99A 1LF5A 2XSZA 4PO3X 4DIKA 2FPMA 2CLOB 2CWDA 3AETB 2UVPA 4WZAB 4HSGA 2AQKA 1S2MA 2GPSA 3QGMA 1HE4A 4XH9B 3TM5A 3OZDA 1P0IA 3CCCA 4FDUA 1XTVA 3GNQA 5E4TA 2QN7A 4WV3A 1C9DB 4A2CA 2J9FA 2AYXA 1UBSB 1T1RA 2G0TA 4YECA 4ZCQA 5KCMA 1KS2A 5K7SA 3VR1A 2YMLA 1CFJA 3DHYA 3VI4B 5JSHA 4I9UA 3ZWVA 1IK4A 1ZEJA 3HH8A 2VHXA 4BJ6A 3NANA 1NQWA 5B55A 1IHUA 2R62A 4O2BA 3OJCA 4QULA 4W82A 2QL5A 3VH3A 3MD9A 2ZVQX 2EQAA 2PVCA 3TX6A 4EGCB 1T6XA 5K0LA 3L0PA 2A9QA 3PF8A 3EH2A 4NVRA 5IJ0A 1YR9A 3GUVA 1ST3A 4KOAA 1T36B 5F9MA 5EJGA 2IC5A 1XZFA 4BEWA 3EGCA 3KJFA 4XR4A 1RBQA 3QHQA 4EQ6B 1Q0HA 2GM3A 2J31A 1O6BA 1KVUA 2GN9A 3C48A 3IKJA 3QBDA 4IMPA 4UDXX 1WSBA 2CZGA 2NXEA 4X7MA 4Z0PA 1V7CA 5H5JA 3WL7A 1QK5A 4HGQA 1YK1A 2Q21A 5LMUB 2PBFA 1WO8A 4UM8B 3UMSA 3ZOZA 4XWOA 5A3QA 3Q8MA 4C04A 5ERXA 4ZQCB 2IYFA 3KFXA 4KG7A 3ZWAA 1YZUA 4U2BA 5LN1A 3EBLA 2GMWA 1UXOA 4D26A 4J7AA 1AQYA 3FB4A 4JLDA 4QG7A 4WJKB 4KAAA 2Q5EA 3P94A 3CVYA 4UCWA 1EQAA 4Z9FA 4HYYA 4F9FA 1A82A 4MKXA 3G5MA 1JJFA 1YJ5A 1G19A 2QVLA 4JGIA 4BAGA 5KNBH 3JARA 3PNSA 2OFWA 2OCPA 1LV7A 4ZYWA 5DHTA 3P9NA 2FSFA 3HRIA 3C5HA 3ZGNA 4IQFA 3NOOA 1IHYA 5BVGB 5HIIA 4R54A 3L01A 3K5IA 1W0JA 2QOEA 1NUAA 4L73A 2XDQA 4LMRA 3WNZA 4BLWA 1G3RA 1P6XA 2VF7A 3NBMA 4DNQA 3V4RA 1DXQA 2UZ1B 1K8YB 1MD9A 3FVWA 1F5NA 2XQFA 3OJWA 4OHBA 5JTUA 5CCEA 2AWNA 3LDFA 4RQBA 1NYLA 1QYCA 3M6LA 2AD5A 2GI4A 2C3UA 4PLFA 2WJVA 1WCIB 4F3KA 5DNUA 3U3JA 121PA 1N5IA 3H11A 5DKFA 2JL1A 1UH5A 4CKEA 2CNWD 1UP4A 3U7QA 2WWIA 4C0QC 1N7IA 1CZOA 3AGQA 2FZ5A 3E9YA 3ENQA 1R6BX 5K3FA 4JASB 4G01B 4QWMA 5KYXB 4RORA 3E9DA 4OEHA 3TNDA 1VLQA 1ACJA 2OGSA 2WMYA 2XLBA 3K09C 1C3VA 4NZPA 1ESNA 5GVRA 3PEWA 2VYNA 2F4VB 5JS1A 3KEGA 2J33A 1Z0FA 2Y1XA 2YHSA 3PXBA 4QLOA 4PR3A 3MTEA 3VVLA 3ACCA 5DX0A 3BA6A 2WSSA 2UVQA 1NZJA 1Q2XA 3C7AA 4MVJG 3H3XA 1ELOA 2ZSDA 3OQ1A 1VCHA 5FFFA 3E8XA 1GQYA 1GPUA 2ZBVA 3EBPA 3HA3A 4FOSA 3U1BA 1AC5A 3U4QB 3OWHA 1O0CA 4NCNA 5A5DA 3EVDA 4RGYA 1A9YA 3NBFA 2YY6A 2W37A 4OI1A 4HWPA 1LRLA 1VLMA 2UZ3A 1E2PA 2CLEB 4B2YA 1SVKA 2G9VA 2D7JA 4B5LA 4B84A 1JA9A 4UBOA 1EFPB 5DI3A 3R20A 3U3ZA 1SKYE 1IBMB 1B14A 1G21B 1LDBA 3OO0A 4CMIA 1CULC 1X1DA 1AT1A 2A9PA 1JXQA 2J1LA 3QVVA 3HJRA 4GWGA 3U3RA 1AO3A 3FTPA 2UXCB 1VMDA 3FPBA 4F97A 4J7XA 1L1RA 3EXIB 3OJOA 4Q34A 3W5BA 5FTWA 1Q95A 2C7BA 2IU0A 3HJCA 2WPDD 4MR9B 1LSUA 3DKKA 1PJTA 3RO7A 2J3JA 3Q5GA 4AZTA 4R3NA 3MINB 3W8NA 3TWOA 2FWAA 4N7BA 2R65A 4MRPA 4CQLB 1BGXT 2EV9A 3GMTA 5C5DA 4LDNA 5JLJA 2XCRB 3SAJA 3ZCQA 2JZOA 4BVGA 3BORA 2YN4A 3B52X 2OBMA 5HE8A 1BOOA 3DDCA 3PE4A 4FFLA 5JRZA 4A8PA 1FQKA 2EW2A 1MOPA 4DLKA 1XAIA 4Y67A 1TW3A 4MR7B 4YASA 3IGFA 5KNCD 1FW8A 3AFIA 5HUQA 2W6JA 4KRFA 7MDHA 3SNKA 4BNMA 2VA9A 1H2YA 1E92A 2LCIA 4UHHA 3ZVKA 1BAPA 1YUMA 1TT5A 1X8JA 3STUA 1Q20A 1Y3HA 4H7EA 1VLHA 2IY8A 3B5IA 3H18A 4L0MA 4LQDA 4Z3OA 3AFOA 3GC6A 2AC7A 1U3DA 3BJIC 3QOXA 1ZN8A 3WWPA 1V4VA 4ZYXA 3E35A 4JI6B 3ZCTA 5BRNA 1W52X 5CPBA 1MP0A 4CDGA 4U7WA 2P75A 3IAUA 3K92A 3GWGA 3EG9B 1EI9A 1L6IA 3FWPA 2IPXA 4AMBA 2P9TA 1U9IC 2A7XA 1QDEA 4LF5B 1JTEA 3O95A 1QVZA 2EFJA 3BQMB 3L04A 2OTCA 5SV2A 3GLFE 1OFUA 4N3NA 5KB3A 3IVGA 1F38A 3TW8A 4KXUA 4FDVA 2R1TB 1O08A 3UAOA 5JJIA 4MW2A 1EAMA 4CM3A 1LFAA 4YC7A 5KYGA 4KK3A 1K7FB 3UH1A 4H3HB 3VZDA 2WI8A 4ZVQA 1FTNA 3ADOA 2C2KA 3M49A 2CKDA 1N5OX 2OBYA 3HJGA 1VYVA 3W4KA 1X0VA 2EWWA 5B7GA 2EFDB 2JFQA 4JJ7A 2NO6A 3ZK9A 1QGUA 1YMQA 3AVWA 5BSGA 2Q4OA 2VN8A 1XWIA 1DMSA 3IIJA 4N7RA 5B6IA 2G76A 4XWWA 1T4CA 5L51A 4F3YA 1FY2A 1CS0A 1K68A 4I4IA 2H9AA 1XIVA 3U7FB 2AOXA 3U3OA 1X2EA 2F3SA 5EOVA 4YWHA 5A0VA 2F3PA 4BJ3A 1J39A 4K9DA 1SG9A 4LRXA 3NHUA 3UIEA 2GXQA 1GA4A 1FU7A 3C8MA 3K0BA 1X1TA 1IL0A 3T3EA 4E5MA 1OLUB 2NVWA 4IOKA 3HZRA 1E59A 4ZAYA 1DG3A 4F3TA 3I1JA 2EZ9A 1J99A 2PRKA 3EWSA 2JIBA 4W1PA 4KMSA 4QVGA 3GGJA 2H1SA 2NZUG 3GAAA 2IH5A 1KEWA 4EA9A 5H4HA 1IY8A 1C7EA 3ENWA 4RSGA 3WVNA 1PUIA 2FJPA 5JT1A 1JILA 4R81A 2Z43A 2JHGA 3D7KA 4RTMA 4NBVA 2YVAA 4IJUA 3RGWS 4KYIB 2H4HA 3EIWA 4AJOA 1WHSA 3IDSA 4TYNA 2NP7A 1E4EB 3S81A 3AOEC 4RNDB 4R71A 3Q15C 4GU5A 3KPUA 2Y76A 2BEWA 3R6WA 5F1KA 5JH7B 5CT9A 3L8HA 1DJLA 4KQWA 4AZ3B 3L79A 5F2NA 3L8ZA 1I3MA 4CV2A 2YXDA 4H4CA 3HR4A 2FXIA 3OFJA 2RE8A 3FAKA 3IFSA 4ESHA 5AOVA 2BAGA 4J03A 4MWEA 4K6MA 4XFDA 3TQTA 4DV5B 1QG4A 2QRMA 4QNNA 2XMCA 1QDLB 3ENKA 2JCGA 3CNHA 4QOHA 4W1SA 3N2KB 3CO0S 3EXEA 3LRXA 3OX1A 3RBXA 2DB3A 1NRIA 4DVJA 3OT5A 1NVFA 3O8QB 4YDHB 3E9ZA 2Q3BA 1UIMA 4GX2A 3H16A 2ASEA 4JKIA 5CB4B 1QQTA 4FFBB 2ZDQA 1QO9A 2WJWA 5HBRA 5JNRA 1M1YB 4TXJA 4LK3A 1VM6A 3L7DA 3SJUA 1J5PA 2V7WA 4GPIB 2DLCX 2VDKB 3FR8A 4JYMA 5EKDA 3E70C 2FUKA 3BWXA 3PWKA 5GAJA 3VBCA 2JKVA 1WP9A 2N42A 4QATA 5DCWA 5CBKA 3HYSA 3V00A 3C6KA 4HUQB 5DRTA 4NONA 3L07A 3CW2A 3I04M 3AKEA 5CH3A 4JUAA 1EWVA 2E4XA 3EGXB 4ND2A 1Q3KA 3GZTB 621PA 1SUEA 1YVRA 3T4EA 3EH1A 1CD5A 1SPBS 1B0AA 1VZ3A 3KZ1E 5JO9A 4J4BA 1Z18A 1Y8AA 3GRKA 4HQOA 5IBPA 3IP7A 4TKLA 2E4WA 3ILVA 5FIUA 4IH9A 2H1CA 2FPSA 1AB6A 3HUDA 1AKQA 3FJ1A 1MW9X 3HM2A 3LC0A 2ATXA 1VFPA 3AY3A 3U0BA 2C2YA 3VR2D 3AIMA 4N8EA 3W3AD 1JDTA 3ESDA 3LHKA 2WB2A 2IA5A 3FMPB 5F21A 1J2UA 1ZIDA 1BCSA 2PS9A 1ADCA 1MF7A 3JWHA 4ENQA 4W5NA 1SULA 2BR4A 2V9ZA 4KUGA 4QRIA 4LOJA 2ZWMA 2ZZKA 3F7OA 3S1SA 4JKYA 4R0MA 4DR2B 5D3MA 4N01A 1B23P 4F5YA 2YWDA 3PGXA 3H2IA 2HT6A 4EIWA 5E1BA 2DFLA 4PCVA 5D6OA 2NPFA 1JU9A 4RL6A 4FSDA 4IV8A 1F1JA 2J0VA 1NU6A 4I6JA 2OORC 1E1DA 3SYRA 4J76A 4X94A 4EW2A 2C95A 1CRQA 1T4BA 3ZV3A 2C5AA 4IJVA 3O8LA 5IYZB 2VQSA 4RADA 4C2UA 4NE2A 5DGHA 4P7JA 3K35A 5LQNA 5FI0B 1JDPA 1Y6ZA 2IS6A 4JVOA 1JFFB 4ITVA 5E1MA 4AP6A 4Y2UA 4D3ZA 3A4IA 5DB4A 1DAFA 3MK31 3T5GA 1EGVB 3O75A 4JLUA 4TMTA 3SNHA 1PWHA 4KN5A 3WGZA 2I5PO 4HQLA 4KQ1A 1E2UA 2ZYUX 4QREA 1LJLA 4MULA 3DG9A 2OHIA 1EKXA 3IELA 2BZGA 4X7PA 2JLSA 2M32A 4KPGA 3UK1A 4E21A 4BKPA 3VHQA 7ABPA 1VE1A 3EA4A 4UHKA 4GLBA 4L72A 5TVKA 2HKIA 3WYFA 2XGMA 5AXBA 1XQ6A 1R4AA 5FHQA 2DETA 1PL0A 2PGAA 2VJMA 3ZKAA 2P0EA 2A57A 1U4NA 3ED1A 4D9CA 1L5HB 1N8SA 1M2VA 3K15A 2I2DA 4XCQA 5A4IS 1M2GA 1PF7E 1QB8A 3AP3A 5ALXA 3SR3A 4AUEA 1Q12A 4FQ7A 1GG5A 2J3DA 3TECE 4UU8A 4C1BA 3CEMA 5SZHB 1RLUA 2PEZA 3JYPA 3PSHA 4DC9A 1VL0A 4OQNA 2YJ4A 4PPNA 1H4SA 1X86B 4JZYA 3T12A 4W5HA 1XDBA 5IFKA 1SEPA 3SD7A 5JD3A 4K0KB 2ERCA 4NG5A 3HKCA 1PNRA 1KYQA