3A0RB

Crystal structure of histidine kinase thka (tm1359) in complex with response regulator protein trra (tm1360)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
116
structure length
116
Chain Sequence
MKRILVVDDEPNIRELLKEELQEEGYEIDTAENGEEALKKFFSGNYDLVILDIEMPGISGLEVAGEIRKKKKDAKIILLTAYSHYRSDMSSWAADEYVVKSFNFDELKEKVKKLLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor protein
publication title Structure of PAS-linked histidine kinase and the response regulator complex
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 20
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2009-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3a0rB00
2QSJA 3GWGA 2JVKA 3H1EA 3O2JA 4ETMA 4N0PA 5I4CA 3C3MA 3QX9A 4O1IA 4RV5A 3A0UA 1DBWA 2WY2D 2IPAB 2VK2A 2L2QA 4Z9BA 4HNSA 4JOQA 2QVCA 3DBIA 5HSGA 5TQ0B 3LUDA 1PHRA 3OM1A 4YV7A 3K4HA 3CTPA 5CNJA 1ABFA 5CNIA 1PUXA 4IMIB 1FSPA 1GUDA 5IC5A 5CHYA 3F7NA 4W5TA 3CFYA 2NT3A 5TPWB 3GT7A 3FFXA 1NXOA 4G0QA 5GOTA 4MS1A 1D1QA 3VNAA 1KMIY 3O74A 3OLXA 4MS3B 4IMJB 1GUBA 2F8TA 3BREA 4PYRA 3FFWA 1B00A 2IOYA 1M2FA 3TD9A 4ZJPA 1ISSA 3SAJA 3EAFA 1SXIA 3CRNA 4P98A 4MQEB 2GI4A 4DADA 4FE4A 1SRRA 3IP6A 6CHYA 4YO7A 2J48A 2H3HA 2IPNA 2WRZA 3I5AA 4IGAA 5IEBA 1DCFA 4JP1A 1BDIA 3MM4A 8ABPA 3MQ4A 1EHCA 3MMNA 4EVSA 2E4YA 4G0MA 3IP9A 1MB0A 5IX8A 1Z25A 4EUKA 3HUUA 4IF4A 3EDCA 3QLVA 3BBLA 4KFCA 3CKMA 1ZY2A 1JLKA 1AB5A 1Z13A 4Q6WA 4QPJC 5DTEA 4S04A 1A2OA 3H1FA 2OQRA 3KYIB 3OMXA 3QELA 1DRKA 1U0SY 5JNTA 1SXHA 2CHFA 3OLWA 1MVOA 3EJWA 4OG2A 3I42A 2PKXA 3F73A 3I45A 4HNQA 3N0RA 3N75A 4KVFA 2LBPA 1MAVA 1M2EA 4MLCA 2QVGA 4RK5A 3QEMA 4H60A 5DLEA 3SM9A 1GCGA 3H5TA 3SY8A 2NT4A 2IPLA 3HUTA 1QO0A 3BRQA 2PLNA 4MYRA 3EULA 5F64A 4IRXA 3RVRA 1CYEA 1H9CA 1KGSA 1APBA 2FEPA 2IDMA 3HV2A 3LOPA 1ZESA 1QP4A 2HQOA 1JFSA 3QLUA 4MR8B 4RWEA 4YS6A 1L5YA 3OMWA 3ILYA 2JK1A 6ABPA 1E6LA 1W25A 1OXBB 1QO0D 2FXIA 3OO0A 5E3JA 3OQNA 2JBAB 3BILA 3F6CA 5TQ2B 3HDVA 2NUBA 4HYEA 5D2CA 3URMA 3L49A 4EY3A 4LE1A 1P6QA 1DBPA 1RXEA 2E4UA 2PJUA 3HZHA 2R47A 5BRAA 4RY0A 4G0YA 4ML3A 3HDGA 1Z18A 3A10A 4GNRA 3DZDA 5FWXB 1DRJA 4WT7A 4MPTA 4YRZA 1FFSA 4LE2A 2ZWMA 4F3TA 1YIOA 5FBHA 5KI6A 4XASA 3GYBA 4RK0A 3MYYA 1PNRA 2E4ZA 1P6UA 1W9HA 5C5CA 5KQPA 1QMPA 2CD7A 2RDMA 2P9HA 3T8YA 4YR7A 2PUCA 1LK0A 4YWHA 1D5WA 2LP4Y 2WJAA 3KTOA 3TO5A 3W9SA 1E6KA 4ZMSA 3NNDA 2PUDA 2PUEA 3A3KA 4XLTA 3RVKA 5DKFA 1QNLA 4OATA 1ZHHA 3EQ2A 4DQDA 3D8UA 3N8IA 4ZPJA 3UKJA 1S8NA 4LX8A 2GBPA 4Z4HA 4NV3A 3R0JA 2X7XA 1QP7A 4TLMB 1ZGGA 5EWJB 2RGYA 2FN9A 4G0ZA 5HQJA 2JVIA 2FMKA 4E7OA 1KRWA 5JNSA 3KKEA 1RZRA 3NBMA 4N47A 3GL9A 2WJWA 5BRJA 1ZDMA 1JWLA 3HJFA 1ZGZA 2HQBA 4D6XA 4JA2A 3HK2A 3RVQA 4MS4B 4D74A 1DCKA 4OTZA 4N03A 3BRSA 1JFVA 3L6UA 2JCGA 3OQMA 3HXMA 3F6PA 3Q15C 4RY9A 1LJLA 1Z17A 2MSKA 4UHKA 2R25B 3G1WA 1JHZA 3OLZA 1RZRD 3JTEA 5TQ2A 1XWWA 3LKBA 4TN5A 2MSWA 2ZAYA 4Z4CA 3LUHA 2FQXA 3LUAA 2FSPA 1D2AA 2A9OA 4MRMB 4KQCA 4RU1A 1ZN2A 4XXHA 4F8JA 3H1GA 4W5QA 4KPYA 4O5AA 5FWYB 5FWXA 5T7BA 1QQBA 3LKVA 4YLEA 4N76A 5TPZA 3HM9A 1JX6A 4O1HA 3A0RB 3SQNA 2PE5A 1Y1LA 2YHAA 1EWTA 4Y9TA 4B09A 3CZCA 2FMHA 4EVRA 3B2NA 5EWMA 2MSLA 3RVNA 4ETNA 4OLBA 1USIA 2A9RA 3CNBA 3IP5A 3TX6A 1YS7A 3ROTA 2P4UA 3QEKA 1BAPA 3D02A 4OLAA 3HEBA 1YTUA 4Q6BA 3C3KA 4WXMA 2XDYA 5TPZD 2IPMA 2V0NA 1Z12A 1E2BA 5EWLB 1HEYA 3E61A 4MQFA 1GLGA 1PEAA 3S99A 4Q7EA 1P8AA 5EWJA 2KYRA 4KRFA 4Z9AA 3C3WA 4LDAA 1VKRA 1JYEA 4WUTA 1YVUA 5GQSA 2E4WA 4E7PA 4MS4A 2W42A 2GKGA 2DRIA 3JVDA 4TLLB 5TQ0A 2B4AA 2FW0A 1FFWA 3O1JC 4W5OA 4L85A 3HVRA 1NXXA 2Q5CA 4RK6A 4LE0A 4RKRA 3N6VA 3FDFA 4H3KB 5TPWA 3CG0A 4G0PA 1XHFA 1DG9A 1ZH4A 4KNYA 5BR1A 5FWYA 5IEJA 2RJOA 3EODA 5DGCA 4JB0A 1ZVVA 4MS3A 5T3YA 5IULC 4IILA 1LBIA 3GBVA 5JNUA 1RNLA 1USGA 3KLOA 4RZSA 5KQLA 1TVMA 4F12A 2F8SA 1BVHA 5JS2A 2FQYA 1XHEA 2A9PA 1F51E 1JBEA 4MQEA 4DN6A 1LJUA 1EAYA 3O1IC 3IP7A 2I6FA 1SD5A 3M9WA 4G86A 1ZAYA 3Q9SA 4Z4IA 2L19A 3Q41A 4NICA 1VPWA 2FN8A 5FBKA 3RVMA 3T6KA 1MIHA 1ABEA 4OBBA 2PAFA 4KZKA 4JASB 3LMKA 3LFTA 5JS1A 2PL9A 4M88A 4EYOA 3KHTA 5TQJA 3OO1A 1QQAA 3CS3A 1M5UA 3QLVC 1F4VA 4RDCA 1IIBA 4RSMA 4MS1B 4XARA 3KJXA 1BDHA 3H75A 5CNKA 3HS3A 1U8TA 1M5TA 3O21A 5PNTA 3C6QA 4Z4FA 1SXGA 4RKQA 4KV7A 1YMUA 4Z99A 4S05A 3NNNA 4NQRA 4EYGA 4LZLA 4RK1A 3RVSA 4YCSA 3N53A 3LTEA 1FQWA 4WXEA 2PUAA 2CWDA 3LUKA 5JNWA 1CEYA 1JYFA 3MA0A 4ZMRA 1ZH2A 2FVYA 3JY6A 3H5IA 3LUJA 4LRQA 3K9CA 1UDRA 2FLKA 4MR8A 1Z2EA 2VUIB 1DP4A 2QR3A 3N0WA 4FE7A 4G0OA 5CNMA 3P9YA 1JF8A 3HCWA 1A0OA 1RXIA 4KQ9A 1C4WA 4RXUA 3QLUC 3LUCA 3DGFC 2CHEA 2JBAA 1YK0A 1JH9A 4G0XA 2LPMA 5JNRA 2FMIA 1Z26A 4PE5B 2BGGA 1L5ZA 3QELB 3QLTA 2R48A 1TM2A 1NXTA 2JRLA 2QV0A 2QXYA 2FLWA 4H3HB 4MLDA 3SG0A 2R4QA 3GBPA 4HNRA 3H5WA 3Q7SA 2PMCA 1K66A 4WWHA 4P1ZA 3CLKA 2MYTA 2N9UA 2FTKE 3QEMB 4Z4EA 3RVJA 1Z2DA 2HPHA 3VNBA 4KK4A 1K68A 1NY5A 1C0EA 2PUFA 1RPJA 1DCMA 1NXVA 1E6MA 1PEYA 3O2QB 5KQMA 1PNTA 3UUGA 4PICA 3MIZA 1QP0A 4Z4GA 3G85A 2LIVA 3GA5A 3CZ5A 4MR9B 4LDZA 4XAQA 1EFAA 3OQOA 1J56A 4RXTA 3CG4A 3OM0A 2TMYA 3RVOA 4CBVA 3DLHA 2M98A 3FFTA 3H5VA 4FB4A 1D4ZA 3QK7A 3H6HA 2QW1A 3JPYA 4QYWA 2GX6A 1VLZA 1YK1A 5IUKC 3DLBA 2ID9A 1U2PA 4KMRA 2A9QA 1NXSA 1Z16A 3H5LA 3RVLA 2GWRA 4MR7B 2HJ9A 4KREA 4D6YA 1NXWA 2M1ZA 4QYMA 4EYKA 3HO1A 1URPA 3IDOA 5IUNC 3KG2A 3GV0A 2L18A 5B3JA 1YMVA 4RXMA 2WB4A 4F06A 3IPCA 2PUGA 4Z0NA 2NZUG 3C97A 2HSGA 1A04A 4JB2A 3HSYA 3Q7RA 1DC8A 5HKOA 5JNVA 2L17A 3O1HB 1ZITA 4MGEA 5KC9A 4YGXB 1TJYA 5C5EA 1VRVA 3LUGA 2MYPA 4MRMA 3RH0A 4WZZA 3NHZA 3TMYA 1JDPA 2FKAA 3ILHA 3H5OA 2FEWB 1T34A 3GRCA 3NHMA 2MYNA 4PZ0A 3O75A 1OXKB 1D1PA 3MF4A 5TE9A 5BQ3A 4MAAA 3FGZA 3M6MD 4N0QA 3NNSA 1JL3A 3OLVA 4ZYLA 1GCAA 1NXPA 4L4UA 1I3CA 4TMYA 4N41A 7ABPA 4NCBA 4JAVC 2AYXA 2ID7A 2WMYA 4RK4A 1TMYA 2NZVG 5ABPA 2FMFA 3KYJB 2HQRA 3QX8A 5IBQA 3JPWA 4MR9A 3CHYA 3JVIA 2FQWA 4GPAA 5EWLA 2E4XA 4UHJA 3KCNA 3KS9A 4ETIA 5KC8A 3CU5A 4EVQA 1U2QA 2JVJA 4YP9A 2B1JA 3Q7TA 3JS5A 2E4VA 3KLNA 4XFKA 3UK0A 4EGSA 5HM6A 2QU7A 3O2SB 1QPZA 2H0AA 1DC7A 1FFGA 3FMVA 1NTRA 4F11A 5KWSA 2PL1A 3LUFA 4MR7A 4W5RA 1YS6A 1NATA 2YHBA 1DJMA 1AB6A 3N0XA 2O20A 1USKA 1R8JA 3T95A 3IPAA 3KSMA 2OENG 2VUHB 1QKKA 1JDNA 1WETA 1DZ3A 1JFTA 3DGEC 2IYNA 5EWMB 9ABPA 4NCAA 1BDJA 3RVPA 2FEKA 2JB9A 4EYQA 1MB3A 1EWKA 4QICA 3M9XA 4RY8A 3SNKA 5B3JC 2LUOA 3RQIA 1TLFA 1LBHA 3EQZA 3ROFA 2WWVD 1Z15A 5IUJC 1BA2A 2AYZA 5ED4A 5DCLA 3T38A 1DBQA 3E3MA 2RJNA 4MQFB 3H6GA 4RS3A 2VYCA 4KK3A 3TB6A 3OLYA 2MYUA 3I09A 2QZJA 5KQGA 4W5NA 4G97A 1U04A 1ISRA 1EWVA 3EGCA 4RK7A 1KRXA 4PEVA 2IKSA 1CHNA 1P2FA 2PUBA
chains in the Genus database with same CATH superfamily
4AJ4A 5SY9A 5L51A 4E51A 3LZDA 3ZGVA 4B6EA 1XCPA 5HQTA 5HZHA 4N0PA 1U2EA 3Q1KA 4K8RB 2OB1A 4GOJA 4NV1A 3QPCA 1NRXA 4M9XA 4BECA 1PZXA 5C9ZA 4J0JA 4DYHA 4IFTA 1Y8QB 5AW6A 5TSDA 1TRKA 3KETA 3VJKA 3L4BA 4US2R 5HTKA 4MUKA 1J8VA 5CPFA 3ST7A 5CB8A 5IC5A 3UG7A 5B58C 4XGNA 2XNDD 2VZ0A 2G70A 3GCGA 4M38A 4P80A 3SS9X 4YRPA 4UDXX 4YDHB 2RGWA 2HSWA 4MGZR 1LZLA 1M54A 1JE0A 1QYWA 3L6RA 1WCYA 2H57A 2YHSA 1HMPA 2PT9A 3FUTA 3PFIA 5LQKA 2R0QC 5ERYA 2Z5FA 4BKQA 5JY6A 2AUTA 3L04A 2XMRA 2ZUDA 1ETHA 3MZ0A 4QXPA 4BVJA 1BU5A 1CYDA 5C3UA 3PWKA 1W5FA 1XLTA 1E96A 2QUZA 1UC9A 4FE4A 3WKEA 3A3OA 1JJAA 3C5WP 4YRQA 2VF5X 4Q37A 4AJ2A 3SXPA 3UCEA 5ESRA 2R8RA 3J81A 1JT2A 2H5EA 4KCGA 4A0HA 1UJMA 2W6QA 4Q1EA 1H2WA 4R2IA 4WK4B 3VV2A 1W29A 2C7PA 4P3NA 4JDPA 1R6VA 4PLTA 4Q15A 3RIHA 1HOTA 4CIYA 3RT9A 1MB0A 2FGJA 4F3RA 3TLZA 2YOHA 4XX0B 4LHEA 4DLVA 2AMYA 1AX9A 4LOJA 1VPTA 3LYHA 2ZP1A 1Y1TA 1DJNA 5L53A 5I8PA 1HDGO 2X13A 1XKXA 3GD5A 1YE5A 3FTEA 4QGAA 3JVUA 1RJEA 2BMVA 4WLVA 1MVOA 2BM9A 2K2WA 4ND8B 3WISA 2PGLA 4PN3A 1T9GR 1NQVA 2Q9AA 3EISA 3L8DA 3LO5A 3N75A 4U63A 3LGAA 4OHRA 3RARA 3TLEA 3E1KA 1ADFA 3A1CA 2VDJA 4DQVA 2E1PA 4BNMA 3EY9A 4YJHA 1KMHA 2NAFA 3TBKA 1IY2A 1ISMA 3G79A 4FX2A 1O8BA 1QO0A 2DWCA 4PIVA 1J5XA 1FBTA 1XA0A 2BEJA 2PLWA 4FGUA 2OXRA 3SGLA 4JP3A 2WHPB 2E5LB 3OETA 5FQNA 1HYEA 2Q29A 2ANBA 4B32A 3HVJA 1SHTX 4H7EA 4IIHA 1NYLA 1DRWA 3OO0A 2SKEA 4XSGA 5HK9A 2X2OA 2AC4A 4MP6A 1P6QA 1T9ZA 2VC2B 3TMAA 4I50A 1W4ZA 2CHQA 3LVRE 2IA5A 3B38A 1MQSA 5K3SA 2WSMA 4G0YA 3L18A 3B13B 2K2QB 1WMEA 1V43A 2VPZA 3V80A 1COZA 1DTSA 4EB6A 1WPRA 1NWCA 1MT3A 1N57A 1GY8A 4X60A 3DB2A 4HAOA 1VE6A 2UVDA 4GXQA 1SBHA 1XRPA 4TMZA 3MYYA 3ZQJA 3IMFA 2Y93A 3CPEA 4RFLA 2Q8QA 3S2GA 2PX8A 3RFTA 3VV3A 1C1XA 5DTRA 2I4MA 3ZEIA 5K6RA 5KYUB 1NUHA 4UMEA 5F35A 1CJMA 3RODA 5G1OA 4D42A 4LF5B 4KVGA 4LIPD 4MA5A 3P96A 4CIDA 5C0OE 3FSRA 1P7PA 4K8OA 4AY5A 5BW8A 2PZAA 2PUEA 1K5PA 2N0SA 3A1NA 2QUAA 2NO1A 5M29A 4D4IA 3SZRA 3VOBA 4BX8A 4KACA 4Z8XA 2WIKA 5REQA 2IYTA 4E4RA 4N7BA 1S8NA 2EZ8A 4YQEA 5A04A 4XWKA 5JSQA 3V3KA 4GZ6A 4UNNA 4I6GA 3NHJA 1EK6A 1O94D 2DQSA 3PEVA 4TLDA 3I04A 1DARA 2ZRCA 4RQUA 5D6NA 2AG0A 4DQ0A 2JVIA 2FMKA 3BMCA 3BK1A 3BJZA 4JQOA 4L0CA 3I05A 3SWWA 5JH7B 1SBZA 2XADA 4YMTA 2V7WA 3MTAA 4NWIA 3ZHXA 1ZG3A 2IL1A 1VM6A 4OA5A 5BNFA 2ANCA 1IHDA 1CJUC 1H8EA 1YWGO 4FGLA 4MWGA 4ALLA 5HIAA 1R6UA 5I7FA 4MI3A 2BKUA 4FXOA 4RLQA 2HLHA 4KEAA 2BI7A 3U4MA 3BH6A 5FFFA 5FPSA 3GEMA 1IM5A 4JJ6A 3SJ7A 5J58A 1PG0A 3DP7A 4LYAA 3ZHYA 2R25B 3NIWA 4XUCA 4E5YA 4ZAZA 1N77A 2PJZA 1Z0JA 1XKTA 2F67A 1MN6A 2G8NA 2WQ6A 1GR0A 1KEPA 1XMXA 4R9SA 1XYVA 3HDJA 3ZEAA 2GQ0A 1B93A 3EGXA 5FUVA 1FVFA 4IDPA 4WX2B 1ZN2A 2QE7A 2W8BA 3ZW7A 3N7AA 1ZRHA 3KCQA 4CM4A 1W49A 3IQIX 1HLFA 5T7BA 2C4TA 3LKVA 4FGKA 3UA4A 1G8GA 5A2GA 4MUBA 1KVRA 1CY6A 2ZRGA 3N58A 4LWPA 3AEKB 4Q9KA 3ZVLA 1X7DA 1C3OB 1RHQA 1V48A 3PXDA 1L8LA 1KAGA 2RCYA 3O8DA 3A9RA 1G9XA 1UUFA 3OUTA 1OI3A 3LE8A 4WDRA 4XSVA 5AKZA 3UMSA 5IXSA 1IN1A 3MJEA 2ATIA 2EJBA 4YRAA 2ZIFA 3ROTA 3NEPX 4Y2TA 3R0IA 2Q5EA 3CZAA 1IZ9A 4LJ8A 3OKFA 5LSAA 1Q0TA 3MWFA 2IYWA 4X6LA 3V8EA 4AL4A 1XAIA 1UOQA 2DH6A 2F00A 4ND6A 4COOA 1G5FA 4B3RB 2PNJA 3R5HA 1RE1A 1O6FA 2YZMA 3DW3X 3BWBA 1G5IA 4KSYA 4MQFA 3BN3A 3SYTA 1JWAB 2JEYA 4IY1A 3GIDA 4KXNA 4HAZA 4PR0A 1SKBA 1N6PA 3DE6X 3ZCTA 1P8AA 1E89A 1G5RA 1CC1S 2UYGA 3CZPA 3OT1A 3QMPA 1PJZA 5ICMA 4CKCA 3TIFA 4GZ5A 3UB4A 2ZSBA 2OT3B 2ZJZA 4DJTA 2RAFA 2QGZA 2GDZA 1W59A 3S6JA 2FR8C 1GTSA 3GLKA 3LP8A 3U44B 4FSHA 4E3WA 2HJHA 3VZPA 1VZ3A 2QUIA 3OEEA 2IF0A 2GZHA 4BZPA 3O1JC 4L5CA 2BR3A 5DTQA 4OFWA 1V11B 2ZBPA 4P35A 4AS1A 1G2PA 1PS9A 2H59A 1N7IA 1Q7BA 2XMQA 4URZR 3GRRA 3WSWA 4DCUA 1RM4A 4BNTA 2NW6A 1WVMA 1O9BA 3DM5A 2YN2A 3I6YA 3OJOA 1MJ5A 4DA8A 5KIAA 2C2WA 2CCGA 1USWA 1CFZA 3CEMA 1LZKA 4P54A 2HW8A 3A2LA 4BAZA 3OT4A 1GAWA 1NQXA 4MS3A 1QNFA 4RIEA 3OTOB 2IEGA 2VYVA 1USGA 3IFSA 1E2QA 1R8SA 1AS3A 3ANXA 2RG7A 4IIJF 2Z8YA 5JIBA 3OC0A 3C3EA 3RYCB 3QKSB 4OX9Y 5KAPA 4PG8A 3MG9A 5IM4F 1QC5A 1EIWA 1LJUA 2GNOA 1DLIA 4B6PA 3K96A 3AFNA 4QAQA 2E9SA 3ONWA 3NKFA 1XJ5A 3N5KA 1E2MA 1PTKA 4BLOA 5IJWA 2AWOA 2L19A 5EYPA 4A0GA 1V5GA 2OQVA 3TPFA 1WV1A 3U16A 4HTFA 1TRHA 5FOTA 1MOZA 4JELA 1KEVA 2QKYA 3KZOA 1OZ0A 4ER6A 5CD1A 4ZMBA 1E1CA 3UG6A 3DT9A 4S1PA 5KNDH 2VP3A 2O8CB 2Z3ZA 4RJKA 2C3PA 3RYFB 2QRVA 3DQPA 1A8UA 3JYLA 5F1KA 4Z4FA 3VR3A 1XN1A 2RH4A 4UTXA 5BVHB 4DREA 1GPBA 4LJLA 3UWSA 1SB8A 3DKRA 2XUOA 3IKJA 2PO7A 1JNXX 2V9ZA 4OGFA 4RJLA 4LXUA 2JGLA 4YCSA 3GLVA 3ZDZB 4LF7B 3Q3CA 4HFMA 2PLAA 1F12A 2ZRIA 3EGWA 1CKEA 1T6NA 2ONKA 3Q7EA 4ZYZA 2VQ6A 5FL3A 3ECSA 2IHBA 3LT4A 4C78A 5EKUA 4DZTA 5FPKA 1E3QA 1Q22A 1FSSA 1TVKA 5FUMA 3T94A 4TXMA 1U7OA 4C4XA 5K7SA 2OGZA 3TLAA 6NULA 4NE9A 1RKQA 4RA9A 3FHJA 3NC0C 3QLUC 5DXFA 5CM2Z 4UJ5A 2AC7A 2JIOA 1WOYA 2EG5A 1RAHA 3R1IA 1SCAA 1XTPA 3N86A 4G0XA 4XJXA 5GPBA 3TZLA 3ZE1B 2WWYA 3IIIA 3DOJA 4EQ6B 4A0SA 5E8RA 5IFKA 1ILEA 4BP3A 1XZQA 4Y2PA 1QTRA 2BISA 4YDQA 2Y76A 3CMMA 3VJLA 2Z0MA 3FI9A 1LBTA 3Q7PA 1IMJA 1UKVY 3IAM1 1JXAA 3M5CA 2DPYA 2P65A 4GVXA 4U2FA 4JI1B 4CG1A 4DAOA 1O96B 1Z5WA 4D56A 2FTKE 1UZAA 2QD5A 1QVZA 2XECA 3B3QA 1F6BA 2V1XA 3I2HA 1C1YA 3OZAA 2ATVA 3GRAA 2TMKA 4N5HX 3VPHA 5C4IA 2EL9A 4DTIA 2C9OA 4RFSA 3RSHA 4D9BA 2XCRB 5HIIA 4HRYA 5A1JA 2IY8A 2P3OA 1CB7A 3UMFA 3QHQA 1FDWA 3D2LA 1R2QA 1HDZA 3SZMA 4EA8A 2OYRA 5JW6A 3QYFA 3PF9A 5CFMA 4GM4A 3T3HA 1SUFA 4HDSB 1CG6A 4OY3A 3RS9A 4QE3A 4M89A 4HZIA 1K6EA 5T6MA 3UJCA 4A92A 2WM3A 1ZFNA 1PX0A 3FYUB 5LJIA 4A8PA 1KQFA 1VLZA 1J22A 1NLFA 2FPRA 1BYIA 3I9LA 3OOEA 2B36A 1U2PA 3RD5A 1EBUA 4HCJA 4AMZA 4G5YA 4ZAFA 1E58A 1FFEA 1GL3A 1X2BA 4R8VA 1B6GA 2VHZA 2A9VA 4JUAA 1LQTA 2GPWA 4D6YA 1BHQ1 3NASA 4LMPA 2XUHA 3GLTA 3JQPA 1JKMA 5DEOA 3H2JA 2G6TA 2O0KA 1BJKA 3UZUA 3SSMA 2FWNA 3B7PA 1C9YA 4N4AA 5BN5A 2L18A 4OXYA 1WUTA 5IK2A 4XB1A 4ER3A 3SHWA 1FF9A 2BJWA 4I14A 4HLQB 3ETEA 3HSYA 3N2EA 1JDZA 1BEUB 1WQ3A 2JEZA 3C7DB 3DEFA 3P0RA 4PWZA 1OFUX 3EXIA 4LOKA 1JR4A 2P68A 3PNQA 2C92A 5GIPE 1TK3A 1SCKA 1KYVA 2AJBA 1OPXA 3H7IA 4M9ZA 1VE3A 3SYRA 2FKAA 3JATA 6ADHA 4FDUA 2RI0A 1M6HA 2HMYB 5AKLA 4PNZA 4XE5A 4U8HA 3AWDA 2VDOB 5AI9A 3CN7A 1O5TA 1IJBA 1OR8A 1RM5A 1B41A 1UDBA 1WDLA 2C58A 4DW8A 5JECA 1GWNA 3U5ZB 4OHYA 1GRCA 3M6MD 1PFUA 4BMSA 3NNSA 4D92A 1MAAA 3OLVA 4HAUA 3PT5A 1E3WA 2ECOA 2HR1A 3L7LA 3FCEA 4LNAA 2W7TA 3TRKA 1KQGA 1QRAA 1T1SA 5J1SB 3THWA 1WBBA 2O7NA 2YCBA 4G0NA 5AJXA 4OEHA 1NX6A 5LLDA 4IFEA 1QOPB 1OASA 3CHYA 2F9LA 4JL5A 1REQA 4G3XA 4UHJA 4NONA 2FJ0A 4KQHA 1SQ6A 2YYAA 5E4TA 5LCXA 2IIBA 4IVQA 3WLKX 4C7XA 5A4KA 5JALA 1Y7PA 2CL7X 3V1KA 4FJ2A 2DG2A 5ESXA 5KPJA 3TLBA 1SUSA 3ND7A 5JISA 3QNWA 1WQ1R 2WT9A 4PGMA 4EB0A 1A4XA 2XYVA 5KOYA 4DCMA 3SYNA 5TS3A 1AKQA 2PJDA 4FYVA 2RC5A 5IDXA 4JQZA 5IS2A 5IFLA 5A5DA 2JCYA 4MR7A 3SJZA 1XI2A 3G0HA 2NUPA 3AFGA 3AW8A 3BC1A 5G40A 3FOFC 1DMSA 5LJLA 5IASA 1SC4A 2E7ZA 3MWYW 2X0JA 4QXMA 3DONA 1BN7A 2YMLA 1Z4QA 3NCHA 2FHSA 3AR9A 1V4NA 3PUVA 4TV9B 1X15A 3PKIA 1DZ3A 5AI5A 1NJ5A 1RLOA 2IYNA 3JD3A 2HM7A 4JKOA 1BC5A 1TMOA 1KC3A 2QTAA 2PSSA 2Z1DA 3WAKA 4Q1CA 1QYDA 1XB2A 2A8YA 1G3UA 3IAS1 4GVLA 1SZPA 5GP1A 2Q21A 3AV0B 2HJGA 1XCBA 1M7GA 3JD2A 1BXGA 3U3RA 4BGIA 1XTZA 2AOTA 3DZ8A 4I55B 4O2BF 1BA2A 1FJ2A 2R6AA 3W8EA 3AR8A 4A6PA 3HA3A 4ZHSA 2AKYA 2RGEA 3PHCA 5LLTA 2VQEB 2CLEB 4AJHA 4MAFA 4IXMA 3S5UA 1JQAA 1O08A 4ZCMA 2C7VA 1N2CA 2WTNA 3OLYA 4EKEA 5EJ7A 3R76A 1W19A 3L05A 5LA6A 1VCNA 3D8TA 2NXCA 4TM7A 1KRXA 2YDYA 4E70A 1FJGB 1JEYA 1V96A 1G60A 5AR1A 4NZNA 4F0JA 1KZ4A 3AKDA 5E2BA 3ABQB 1B74A 3P97A 4MW5A 4QEKA 3MWDB 3ZWKA 5AW2A 4I9HA 1WABA 3C3MA 1A8IA 2X23A 3F9RA 3VA7A 4N8SA 1F38A 1N1MA 3GJSA 4ALJA 3NTUA 2JJ2A 2NG1A 4HNSA 1UXHA 2GD1O 3NHRA 1XEWY 3A27A 4G1CA 4J0CA 5A4DA 5CFRA 4BFYA 2CL6X 1LSSA 3HA5A 5CNJA 2XNHA 2B20A 3SSAA 4DBZA 2J9ZB 1YBVA 1I3MA 1SFRA 3HNOA 1KIAA 4N6GA 3GT7A 5EFOA 1Z74A 1KTIA 1PLKA 4YI5A 3WQRA 3FOWA 3S1SA 4XLZA 2QF7A 3ETGA 4R2HA 2X15A 2EKPA 2HLDA 2DBYA 2CFOA 1YV9A 2WF5A 2R6GA 4QVGA 5C4GB 4I9GA 1MV8A 4BEJA 4LWZA 2R79A 4QUEA 4DEVA 2GLTA 1JB1A 2HYDA 2ZUEA 1F7UA 1H2BA 2JGRA 3KDAA 1SXIA 1EH5A 3PENA 2GI4A 2HTEA 2F1RA 3RHTA 1F4PA 1H2HA 1RCUA 4P4TA 2WYOA 2J9XB 3M1IA 4NCIA 4OSOA 3I5AA 1QHGA 1HT1E 2WMDA 1NBMA 5H1YA 3BMOA 4PS0A 4IJVA 4E4YA 8ABPA 5EE0A 3DT8A 4GMDA 1UMKA 2C83A 4WZ6A 1ZA2A 2J3HA 4KYTA 4Q7LA 3B12A 3OPXA 4IOKA 1DB3A 3U80A 4WZBA 4PO3X 3ZU5A 1T5HX 4EUKA 4QUDA 3AFIA 3EDCA 1PP4A 1FB5A 1L7VC 3HLKA 1WTAA 3LPDA 3Q7QA 3QXGA 4GOND 1AKEA 1ZY2A 1ZSNA 2FVXA 3PCRB 5FBLB 2FI1A 4AUEA 3OMXA 4B7AA 1AUXA 5JNTA 2BFCA 1VECA 2BFFB 2CHFA 2E6KA 2HDWA 2JGMA 3DO6A 3EJWA 4OG2A 4EHHA 4V1CA 1S3IA 2AI3A 4Q3DA 2E85A 1IB0A 2WYUA 4MKIA 3OIGA 3EQ7A 3RNLA 4CEJB 3PKJA 4F5WA 4R9VA 2BD0A 3HB9A 2RHGB 4L9RA 3ED5A 1C9JA 1TJNA 3ZZ1A 4KR6A 4AX4A 4EJSA 1IQ0A 2BTQB 4ZT4A 2Q2QA 1NVDA 2DBVO 1NE7A 4BFUA 4LSMA 5DBFA 1JG7A 2GERA 1JLHA 3UOGA 5CMLA 3GGJA 3PX7A 2LDBA 5CFNA 2H2FA 2RKWA 4M76B 1GT91 1GU1A 4L57A 5DK4A 3DLIA 3ILYA 5G53C 1VBFA 1LK7A 1E6LA 2QUKA 3D3NA 4OI4A 2M6RA 3LIPA 1OZAA 4TRRA 5E3JA 1L5GB 2B3DA 1YHYA 4F3CA 2IU6A 3SC6A 1WDKA 3F7OA 4H2DA 4HHEA 1TTQB 1DBPA 2K5UA 4CXMA 4K2AA 2IH4A 2XXAA 3ZU3A 4EBFA 4RPIA 1WULS 4IO0A 1T3LA 4OHZA 1X7HA 3B1KA 1RMQA 1KEEA 3DOIA 3M6FA 4KR3A 2YZ7A 3GR6A 5CCXA 1DRJA 2XE7A 4DY4A 2AFHE 1AF7A 3ZKWB 4B4WA 1CVIA 2IJGX 5DPMA 3AP1A 3ESCA 2O8BB 4OF4A 5DFAA 3EA5A 4QODA 1MU0A 1H4QA 4MCIA 3V33A 5K8LA 4G5SA 4BNGA 4F3KA 3CIFA 4EQZA 1HLGA 1Q7CA 3IXLA 3HBNA 3TLYA 3Q3GE 4HH1A 2R84A 5E4JA 5GM1A 3A9WA 2GHRA 2LP4Y 4CM9A 4PHTA 3KTOA 4GZLA 4WCFC 2PSDA 1ADJA 3E9DA 1TJ4A 5CLQA 5JD3A 3HEAA 4Z7JA 2XNCA 3RUDA 5C1PA 2O54A 1WMSA 3QLJA 1MJNA 2EFDB 3HNRA 5AJTA 5P8WA 4QULA 1L2TA 2HRDA 3AU9A 2BFOA 3ESRA 3BFPA 3ZK9A 1CIJA 2VAXA 1E5VA 3EEFA 3LO8A 3N74A 4Z4HA 1LI7A 4TVBA 4H4CA 2X1MA 1VCMA 3E22A 1RLIA 1WV0A 4OP2A 2Q5QA 2LKDA 1PHPA 1L5MA 5EWJB 4D0RA 2QJFA 5AW7A 5L4SA 3QX3A 1N1GA 5CW2A 1GEGA 2FZGA 4KGVA 3IIJA 2CXOA 1J0BA 2OPHA 4FFBA 1RJGA 4EI2A 1OUMA 5KJ1A 1X0XA 2ZPTX 3EBPA 3ZGNA 3LYLA 4JROA 1C7JA 1X39A 1YXMA 2JCGA 2UYOA 4L3WA 3H2YA 4F3NA 2ZIXB 5KZMB 1EU1A 4RGQA 5C8YA 5H4HA 3F5SA 4J07A 4BBJA 1HDXA 2OL4A 3RGWS 3UUEA 3DXYA 1Y34E 1IDN1 1ATZA 3FZEA 3OA2A 3WIEA 3E8SA 3K9QO 5A03A 5C7IO 2TRSB 2ADOA 2ZREA 1LRJA 2YVLA 3PWTA 2WJ6A 2B98A 1C9EA 2XUJA 4B79A 2Z2JA 4HLUA 4YCCA 2GD2A 1XMVA 3D1JA 4HGPA 4I5FA 5ALWA 1PT9A 4GMFA 2H4WA 4L5JA 4TV8A 5K0EA 4X1YB 2JC3A 2NU9A 2QWXA 1BG6A 3Q3EA 1A2BA 3K70D 3IERA 2PE5A 1C50A 3QJGA 3CR8A 2IZ1A 1PKXA 4LC9A 4QTTB 2FMHA 5BOVA 4DR3B 3RJTA 3BX1A 4KXMA 1SK9A 3KKQA 2RC6A 2P5YA 1YVRA 4Z3OA 1QGUB 4V0QA 5K2MA 3ZR4B 4NOMA 1YTUA 3E70C 3U3OA 1ECJA 2PMWB 3I9OA 5KNDA 4CGZA 1RI3A 5HKLA 3DO5A 1DQPA 1O97C 2HRBA 4B3GA 2FGKA 3V97A 2DWUA 2HK8A 2XF2A 1DU4A 3CNOA 3MQFA 3VYRB 3EIQA 3C5HA 2VN8A 3VAAA 5IDVA 3ZNQA 3TN7A 3AR3A 3QUCA 1KDYA 5BQXA 4ZOLA 3NOQA 1NUTA 3OFJA 5KSPA 4KRFA 1YL5A 2O8VA 2V5AA 3RSSA 3L07A 1FFCA 1BKYA 3PK0A 5EQDA 5B7QA 3HG7A 4ZHQF 5LOVA 4NYIQ 4JP5A 2J4FA 4Y98A 3D31A 3WTCA 2YWHA 3FWPA 3KPUA 4P92A 3TF5A 2WHEA 4L6IA 1YACA 4GKVA 3TTSA 2JJYA 3VR6H 4EFDA 1NUSA 1XPOA 4QJ5A 1RWNA 2BPOA 3GN2A 5LXTF 2HWWA 1VMKA 2QJRA 3HCDA 2OGUA 3IUJA 2IPXA 3W1EA 4CODB 1QFYA 4CCSA 2E18A 1NFQA 2F7SA 2WR8A 3KEGA 4IRUB 4BB6A 1RABA 5H4GA 4ZAGA 2B25A 2HJRA 4PLPA 2NO7A 3I5YA 1EVYA 3BWXA 5C46F 3BIOA 5TMPA 1KZ6A 5IVKA 1NQTA 1KAMA 1E1QA 4INAA 5AM4A 2AOVA 3O03A 4PSUA 3RJMA 1TCUA 4DMRA 4JI0B 3LC2O 2KI5A 4Q48A 5BN4A 2WQZA 5A3QA 3QSYA 1TB4A 3H3XA 4A73A 3K8ZA 3PZBA 4JI6B 2AJCA 5A3JA 1R3UA 2R1VA 1XF9A 1VLHA 4RFSB 2YL2A 4RIGA 3C7CB 4OHWA 3KLOA 4IIJB 4WVFA 4UCXA 3WGKA 1TVMA 4GPIB 3GFQA 1NBOA 2PWAA 2ZJAA 1WG8A 4G8CA 3V42A 1MFZA 3DDWA 1R4NA 3C3YA 4C5CA 4KPEC 2UZ0A 1P9OA 4M0UA 3IR5A 4X3PA 4QOGA 1DSSG 3HFJA 4CMCA 1VPDA 1GTVA 4DB4A 3L1IA 4DL9A 2DERA 1AM4D 2J7PD 4NNJA 3V4RA 2WTBA 1F8FA 3IIMA 4PC1A 1BIFA 1RIFA 4K9MA 4NU6A 4D4LA 2WEKA 2WSBA 5F23A 2R68A 4OMFG 4UEOA 3OIFA 5F78A 4WLUA 1N8KA 2VS1A 1FOEB 1VKJA 4PLYA 4PBTA 3M81A 4JJZA 3SFVA 1G7CA 4B46A 2Z4SA 2GJ9A 1CRQA 1PVDA 3C1AA 3TOZA 4D98A 1ARZA 3D8BA 3FZQA 2P78A 2QLJA 3C1UA 1F2DA 1R37A 4XARA 5C35A 5FWDA 5L3QA 2GM4A 3LVFO 1WAMA 1AGXA 2JIZD 2KM1A 4PLGA 2HKIA 3C7TA 2ESRA 4PNEA 2OO5A 3R74A 1SU4A 5IDQA 2CW5A 4MVJM 3NNNA 5F73A 1I30A 2CSUA 2E1RA 2GZ2A 3R5SA 4RK1A 1ZIOA 4F6LA 4BKPA 1LI5A 2VCEA 4WXEA 1Z5VA 2QMYA 2IYXA 1R88A 4DRZA 1Y3FE 1GKYA 1D1TA 3IULA 4BKOA 1XZCA 3V4PB 4NMMA 1DQRA 4OYYA 4L8FA 2A94A 5AJUA 1TYZA 3RAJA 3SQMA 4CMIA 3T5AA 1F6DA 1SD2A 2Z8YM 1U8YA 3C70A 2XKKA 3FY4A 3M5DA 1YIAA 1JMKC 2HLNA 1RXIA 1D4OA 3WBKA 4F6CA 1U7HA 1Y5IA 2JIQA 1G3QA 1QGDA 4J94A 4B7ZA 4E6PA 2CNLA 6REQB 1ONBA 1XOIA 2F3SA 3KK0A 3E5MA 2OGWA 1BX0A 3HBLA 3OKAA 5K3AA 1OWLA 4Z2YA 3SLGA 3GI1A 4B45A 5KOJA 5B12A 2ZM6B 1L4LA 4KYIB 5HE8A 4F4JA 3WZLA 4U1RA 3RIMA 4YJFA 1EHYA 2CDRA 2JKYA 2W90A 3MTGA 4KWHA 2I33A 1SBQA 2W6ZA 2B7BA 4OMUA 4F7WA 4GVPA 2D0PB 2ABWA 5J2TF 3GVCA 1LY1A 4Z2AA 3Q7SA 4BJ1A 3NETA 3PVSA 3L5KA 3QEMB 2O7QA 4RCYA 2IOHA 4NS1A 1OHHA 3KU4A 1IY9A 3MTQA 1LGYA 1PT8A 3SKVA 4KK4A 2W5UA 1H3EA 3OM9A 1S2NA 3B51X 4RMIA 4G84A 3NBFA 2B9EA 3KUUA 1AIPA 1L4GA 2V6GA 2OHJA 1G8JA 2VDUE 1E2IA 2BRUC 3K16A 1QP0A 2R00C 3VR2A 3RROA 3VTKA 1IN7A 2EGUA 2I80A 1Y98A 5J40A 1EFAA 2QQ0A 1J56A 4D46A 1LPNA 4E09A 1K7CA 2V6BA 3DLHA 1IK6A 2QT1A 4KH1A 3H5VA 3JZDA 1D4ZA 2WVGA 1NFRA 1Q3TA 3QVGB 1TZKA 1SQ0A 2C2OA 3LLCA 4NJEB 2D0OB 3L6CA 7YASA 4OPMA 1D2NA 2DPXA 3K1TA 5IT4A 2OKGA 3D4IA 2AD5A 3KOZA 3VKFA 1U8UA 1XDDA 1Z0AA 1Z16A 2GRJA 4K6HA 1E9SA 4EF5A 2YIVX 2JLCA 2AJDA 3HKCA 1PR0A 4B8ZA 4O4LF 1M0WA 3CEPB 3EF3A 3UGKA 2ZQYA 5LZ4A 2F2TA 1XJCA 2AXEA 3EBLA 1SGWA 2FZ4A 3NX4A 4GD3Q 4KXUA 4MWSA 5JWOA 4LF4B 4E5PA 1XZ8A 1Z5OA 3RS7A 3U5TA 3EC1A 4D26A 1SG9A 3T06B 2CMHA 2E4AA 5IWCA 1CJBA 2XOEA 2SCUA 3R23A 1Q0UA 3WE7A 2NZJA 2NZUG 3E9EA 2C00A 1JHXA 3HFRA 3IT2A 3ITKA 3M34A 3OSUA 2EBFX 3PSHA 3UO8B 4DAEA 3C8UA 3VTFA 1LW6E 1NJ2A 4JQYA 4MGEA 1NG1A 1NVVQ 2C3UA 1T36A 3RU3A 4C43A 1N78A 2B8WA 1HA3A 3AB7A 2YWJA 1JILA 3D54D 4MKFA 3LKZA 3ANNA 4GEGA 3IA2A 1P4AA 1X19A 1KK1A 3WYNA 5IVPA 1ZOOA 2I78A 1HOXA 3HL0A 2BKLA 3VI4B 1CF2O 2I4IA 3THYB 2C07A 2P9BA 3RUFA 3T0IA 3UJ8A 3U9TA 3ZWQA 4GYJA 4YAEA 3CKLA 2XBUA 1XEWX 4B3TB 3K5IA 3LC7O 5AMXA 1YSCA 4BYMA 4C29A 3PJEA 5IKPA 2GBLA 3I3OA 1JU3A 5FOUA 1CP3A 3R3WA 3OCYA 2H92A 1DEAA 1U7XA 2C5BA 2ID7A 2RHRA 4L4SA 4AMUA 1TMYA 1HBJA 2FPWA 4FP9A 5DOVA 4GO1A 3KFLA 1E9EA 3DUWA 4BRWA 1JWBB 3KQVA 1Y6RA 4O4IA 3W5BA 1N1DA 5FHRA 7AT1A 4BFLA 5KC8A 2PVSA 1I5OA 3JQ9A 3T0GA 1I9CA 1NBHA 1BGWA 4O1MA 5ECDA 2FJPA 2IGBA 4ZFNA 1OBOA 4OL0A 1OFUA 3KLNA 3UAOA 3CH5A 3C74A 3RFFA 5C80A 4QVIA 3AUAA 3UWMA 3WJ1A 2XY4A 2WQ7A 2H0AA 4X93A 2OCXA 4AF8A 2H08A 2DHCA 4CKZA 1B8OA 3CZ9A 2P2ZA 1MW9X 2RHBA 5MGBA 3QBDA 3EEIA 3WB1A 1US8A 3DBHA 4RFVA 1S1MA 2FMXA 3NWEA 2GN0A 3A9CA 3ZWCA 3K20A 3FYCA 3QHAA 4FOTA 4GKAA 4V38A 4C7OA 4HVTA 3CBQA 1TL7C 2FZ5A 4U2BA 4YJ3A 2VPQA 2ZVJA 1XVUA 3VQTA 2B99A 3A8TA 3EGDA 2GYVA 3DGEC 3DOHA 3CVOA 1Y8RB 3EFEA 3MAAC 4BBPA 1VL1A 3IV6A 3WHIA 1FXWA 2WWTA 1XZMA 3WYAA 3QFFA 1R4ZA 2X9QA 3QQPA 5JXWA 4PLZA 3MERA 4KHZA 5CCBA 3RASA 1D07A 3IVXA 2D1FA 3AONB 4LYGA 1INLA 1Z0IA 5ED4A 3N2KA 3G88A 4QYSA 4OQFA 4MUJA 4ARBA 5U4XA 3RI3A 4CM8A 1LLFA 4BQNA 3IB3A 3JWJA 3T3PB 4RVHA 4HDMA 3B7GA 1XPRA 4G97A 3CR3C 1U04A 4BZWA 4QBTA 1CJTC 2G17A 1GGFA 3BSFA 3X3HA 4XR4A 1QGED 1KKLA 3GT4A 5AXDA 1P2FA 4TS3A 4G41A 5ALZA 3FYSA 3HV0A 1WBJB 2I5PO 4W99A 2VAPA 2ZTHA 3NVAA 4LOAA 5KCMA 3Q5DA 1J8YF 3AOGA 2WLSA 2B2CA 1O0CA 5BMVF 3OPNA 4DBLE 3UICA 1OYOA 2IPAB 2O2HA 5EG5A 2XXBA 1PJRA 2I6SA 3IO3A 4O08A 1AKTA 3SX0A 4F8EA 2UZ1A 3VHQA 5FV7A 1DAPA 3OPYB 1KJ8A 3CTPA 1P7WA 1IL0A 5BUSA 2Z09A 3DMGA 3I6BA 4QO8A 2JD0A 3DV0B 4NBTA 2XBMA 5J4HA 1N6OA 4UTNA 1L8AA 5TPWB 1C3JA 2OD9A 3W1VA 4K9QA 3PHJA 5HS6A 4PW0A 4M9RA 5DMHA 2P0EA 4TVOA 1GNLA 1MB2A 3FOAA 3E1SA 3U7QB 4QTUB 3KAKA 3ZU6A 1XXHB 2QI9C 3CLTC 2PQ0A 2DHQA 5AVSA 3E53A 1IUKA 4RTJA 2XDWA 5E6RA 3RT7A 1A27A 1UODA 3AUFA 3COYA 4RD1A 1GCOA 3AZQA 4HGOA 4RL6A 2AOUA 5FOQA 3THXB 5LNK1 1RI5A 2C9CA 5KS2A 1JTVA 1IZ7A 1ZNWA 3BPSA 2CFIA 2FSHA 1JALA 4MQEB 2UZIR 3PGVA 4R41A 2UYHA 2HB6A 3HYNA 3ONEA 1UQRA 5JQGB 5LNK6 5C8VA 2ZUBA 4JC8A 1UEXC 3OZIA 5HFNA 3MQ4A 4KN6A 4DIUA 1DADA 4AKTA 5JFOA 2VUSA 5HBRA 2W6NA 2NP7A 2AVNA 2AD1A 2D6FA 1CRLA 5DCUA 2QN9A 2AEMA 2B4KA 2HDOA 4FYHA 3D1LA 3H16A 1ADYA 1YVEI 2I2CA 1JHQA 4JC5A 2G04A 3II6X 1DVRA 4JI7B 2FK8A 4EHAA 1KYYA 3F2VA 3PTAA 3QEBZ 2IUSA 5LDGA 1SXHA 5CT6A 1EGMB 2OD2A 5IK2D 1V26A 1UADA 3AVVA 2GJAA 3M1LA 5B6IA 1H42A 3QA9A 5ICFA 1SUWA 4CJXA 3CLSC 2NVUA 2D59A 2IH2A 5C8XA 1PR3A 1CUCA 4I4IA 1EEHA 1I2CA 4YCJA 5DASA 3SM9A 2QUHA 3WHKA 5B6PA 1TZJA 1MX3A 1Z7EA 4K6GA 1IBKB 3I9V1 1P1FA 5IZCA 4RO0A 1Z0DA 1Z35A 2IPLA 4F9EA 4J7XA 3VHXA 4DUPA 3KOXA 2B4RO 5C1OA 4CKWA 3UMBA 4P0PB 1CJVC 4IZHA 4N0EA 5KYNA 2P5SA 3AIKA 3NBYC 3D5TA 3V7NA 3I62A 4JN6B 1NBME 4L74A 3RIYA 3I5XA 1I14A 4WLNA 2IXFA 4MWEA 1OLSA 3H0KA 3IX7A 3D64A 3L43A 5FYDA 1Y82A 1ESEA 4EJFA 6ABPA 1W25A 5CGZA 2FXIA 4J0IA 4R2WA 1A7UA 1HYHA 1KVTA 1JSXA 1XA3A 2WF8A 1HF3A 1ST2A 1WUHS 3C3CA 4WZBE 3UAXA 3DTVB 1M1YB 3ZCQA 4QOSA 1MO3A 3OQ1A 4KE7A 1K5GA 3HZHA 3NBQA 4FBGA 3OHSX 4EEXA 4PYLA 1G3MA 2MWMA 3IP3A 3VOAA 4HYTA 2L0XA 1O2DA 2J6CA 1CZLA 2EQBA 2H4XA 4J4BA 3L0OA 3JAKB 3WWDA 4GNRA 5FWXB 1VRCA 4ZO8A 4JODA 1K88A 1UBFA 3B6KA 5A1TA 1FFSA 6AT1A 5EEGA 1D8AA 1L5WA 5B2ZA 3GYBA 4EFLA 2F8MA 2WNIA 1CZRA 4LY3A 3CUUA 5DVZA 4F56A 2I2BA 4IW3B 1SUBA 3I5UA 3WRXC 3HXTA 2QNBA 4Y6LA 2WZDA 3UAVA 2PUCA 3CRZA 3N3BC 4A3SA 4FHFA 2CD9A 5HR5A 2PQ2A 4IZ6A 4LI0A 1E9AA 1DAIA 1L9KA 1YJ5A 4KW7A 3ITDA 3UKOA 2N1BA 1EE1A 2GCNA 1W1IA 2GPAA 5FA8A 4K1LA 4S12A 4Y8VA 4C6TA 4DXDA 3SQWA 5CXXA 1W46A 2ZXEA 2HXGA 3JALA 3DVAB 2H0RA 3UJHA 4D0SA 3EQ2A 3RYHB 4UNQA 5DEIA 1U5CA 3AB8A 3ZTYA 2HRZA 1D4FA 1DFHA 4WY2A 4X8MA 3F78A 2DXIA 4XD2A 3LDHA 2ZITA 4P7GA 3TW8B 1UBRS 2RHTA 2NU6B 5A9SB 4R9UC 1ZCBA 2PKYX 4CR7A 5EHQA 3O4HA 4JYMA 4AICA 4B75A 4C0SA 2RG1A 3RTGA 4D6XA 2P9CA 3UTCA 4DILA 1UWCA 2BONA 4MS4B 1TYBE 3ZHRA 3QM1A 4OTZA 4UE3S 5FO1A 5T4HA 5BSMA 3OT5A 1EGHA 3L6UA 1YQQA 2CEAA 2OFFA 3WRYA 3TL3A 5B2FA 2XGMA 3SSOA 1ETUA 4XRGA 4KJXA 1GA4A 1FQOA 2A84A 5D3QA 1F2UB 1VBKA 4I6EA 3RBXA 5ICGA 3CTMA 3A4IA 1I7LA 3LUHA 1N7HA 4FW9A 4TLAA 1PBTA 2FUG6 1W88B 3ECCA 4H6XA 3HB4X 1ZCAA 3QXHA 1J2JA 1T8RA 3AHFA 3LPMA 2WBLC 4OBEA 3RV3A 4QLBA 1WXWA 3C3JA 2PS3A 1FX1A 4G24A 1FQKA 2R60A 2VZ9A 1ZL0A 5DMXA 4A8JA 3KYBA 4O1HA 3P52A 3WLJA 4BV2A 4CU2A 1CE8B 1M34A 3RS0A 1RWOA 3FI0A 2C1ZA 3QF4A 3PTLA 3H2KA 4V0LA 3KT6A 3NUGA 2H2HA 3ZTWA 5LD2B 3AFMA 1O87A 1XEXB 4GFDA 1IONA 4GMXA 3DTYA 5HWSA 1LKZA 3ENQA 1R27A 2CZCA 2X4IA 2XDYA 1IJEA 2GEKA 2GHQA 3WSTA 1SY7A 2Z83A 4OI1A 1X7ZA 2HOQA 3BE5A 3KM0A 4J1SA 4M0PA 5IN5A 3OU6A 2YXBA 5I7UA 3F6BX 4L22A 3PCXA 3UJ3X 4FJ0A 4MICA 1JG2A 5AVWA 1BCRB 2VZLA 2B21A 3MJVA 3PUYA 4F92B 2JKVA 5JDIC 3GDOA 4R1QA 1MOQA 4CTMA 5HJEA 2F4NA 4YAKA 4ZHQB 3MBIA 2R6CA 2D1YA 4IDEA 5MN5A 3A6JA 3KJFA 1VKRA 2Q6IA 3FROA 4G5RA 1ZH8A 2C4UA 4B7XA 4JEHA 3E27A 4YTEA 3W8RA 4TYNA 5JMOA 4K0KB 5LXTB 1QM5A 2WDPA 1DOAA 3CF4A 1I2ZA 2CMDA 2V98A 3LX5A 3WGZA 1Z38A 2P69A 1YRLA 5JFTA 1FRVA 4D4MA 2BIFA 2BV3A 3I58A 4J1TA 2B4AA 3IBFA 1HH4A 4S24A 5DYWA 2Z08A 2JI6A 1NURA 2QN7A 1DKOA 3MMPA 3N6VA 4B34A 5ELXA 1CZHA 4ONEA 1G63A 3PIRA 1XWFA 4JLUA 1E9FA 4C30A 3WLAA 2JLQA 4DIDA 1H8HD 2F62A 4EG6A 2COEA 2J9RA 4FHEA 2H1HA 4OHVA 1E0KA 2N3ZA 5AXCA 1I10A 4BVKA 5CDYA 3VR0A 1S3GA 5DGCA 1E3MA 4AZ3A 4WBNA 4TPKA 5JFGA 2Q3DA 1FMFA 4Q3NA 3LG2A 1LBIA 1BMFA 5AKEA 4CQLB 3FVQA 5JATA 4W5JA 2AUMA 2DHEA 2DFKB 1ZD8A 1OC2A 4I1UA 1C7QA 5AI8A 5TX7A 3ZGXA 3ELYA 3W3ZB 4FFWA 1OTXA 1A2KC 2BGMA 2Y3IA 9LDTA 1Q16A 2O7SA 4S0ZA 2B0JA 2D8AA 1JI3A 4JJFA 4L15A 3LQ1A 3KEFA 4LEIA 3SICE 4OHPA 3I9NA 3OCWA 2A30A 1WCIA 3LLMA 1G8FA 5AD1A 5JYEA 5BSWA 2YZGA 1ULUA 5T4BA 1U0HC 5K8UA 3KOOA 4RSHA 5ES3A 1OAAA 3UGTA 1JS1X 2PDAA 1Q3KA 4EUNA 4IICA 4I1OA 5A71A 5JS1A 4FSXA 3DFMA 2QJWA 4X3OA 1VP3A 3STUA 4DZRA 3FBTA 3VKGA 1RACA 3ZQ4A 1KI6B 2ZWVA 3QLVC 5K3CA 3PXGA 1IIBA 4RSMA 3QSGA 2JGKA 3C48A 3RVDA 3O21A 4GYYA 3SVTA 2W2KB 4I4NA 1RWBA 2XDQA 2YZNA 4MOWA 5C37A 2XDAA 4EYGA 2XB6A 2W83A 3CM0A 4Q9AA 3G7SA 1IOVA 1Z5UA 4OQLA 2FUCA 5GAJA 5H82A 3F49S 1H93A 5NULA 2WUGA 2O5VA 5GY7A 1Y8CA 2VQ3A 1KO5A 5SY6A 3UF0A 3QUAA 3MA0A 4AO8A 1E4EB 4KI7A 3F67A 3IKMB 4YLGA 3WLRA 2X1HA 1Z6TA 2ZUVA 3A9UA 3RW9A 5IH3A 1QZXA 1Z2EA 4ECAA 2I4OA 1FNBA 3G2IA 4G0OA 1U8CB 2FE1A 2H11A 5ER6A 2BTOA 4X65B 1GPUA 2NYRA 3W9BA 4RACA 1L7RA 1Z2CA 3EIOA 4ROSA 4CMEA 1XRQA 1YHZA 2JBAA 2NXWA 3LT1A 4L8LA 5G4KA 4BWVA 4ERXA 3EXAA 4EYEA 4OKNA 1AZWA 1TEVA 3L40A 2W6IA 4XOIA 3VOTA 1T24A 3WK7A 1DHRA 5FPPA 1XQYA 4LTDA 3M4NA 4XGRA 1UJ4A 5I47A 2AE1A 3ILXA 2ZBEA 4FMPA 1DG1G 5AICA 4RMHA 2VKQA 1VLMA 3C3BA 4X90A 5J2TB 2W4QA 3GBPA 1BHJA 3DC7A 2XMCA 2XHZA 3WYDA 1P39A 1ZKDA 2PMCA 4IUDS 2Q45A 4C4OA 4P1ZA 4EABA 2HU8A 1RFGE 3RUIA 2WAXA 2HPHA 1Y9DA 3VSBA 1FTGA 1XU9A 2IWRA 1ZJ4A 1XEFA 3PDHA 4WFQA 4Y2JA 3IEMA 1GJRA 3VR4D 4X66B 3TOVA 3ID6C 2JLSA 5D01A 4BCBA 3DMTC 1SPXA 3MGAA 4Z54A 3F96A 3GRFA 3V4VB 3ELWA 3OIVA 1MH1A 1H3NA 1QIGA 1EDEA 2C31A 3T3MB 4JYZA 5A4JA 3DYBA 2TS1A 3PSAA 3CLRD 1M6NA 1ZBDA 2BP7B 5CH8A 3B5JA 1NW8A 4UOQA 3SXJA 5BT8A 4MITA 5IF9A 2A5DA 2KLHA 1NKTA 2QW1A 4TT3D 5IP5A 5KVQA 2GX6A 4MIKA 5EPEA 4M86A 3BUSA 1V4BA 3IQFA 1GCUA 1U2RA 2ISQA 5CA0A 4CN9A 1PRYA 4ZVMA 4ZQBA 2PA0A 2QMOA 4O4LB 1Q1EA 3GVHA 1S01A 2FG7C 4TL7A 4UQLA 4LFAB 5A5VA 2FW6A 4Z9XA 3PTZA 2CFSA 3CX6A 3GT0A 4JS0A 1P9LA 3HO1A 1CY7A 5DM4A 1D03A 4I4LA 2VCYA 3R5JA 1DDGA 1IMOA 1RM3A 4F9TA 2CLHB 1QE5A 1KDPA 2PUGA 4R0MA 1ZJYA 2ST1A 4G4IA 2EIXA 5EP1A 1YR7A 2PX5A 4M54A 1VXOA 2WU3A 1A8QA 1QH9A 4IFBA 4MPJA 4WRRA 3WQHA 1I7DA 4TWAA 1S2OA 4YGXB 1KYTA 3EQ9A 3CISA 1VG8A 3JRWA 3PUHA 3ONFA 4FLEA 5BQPA 1KSJA 1KXJA 1UR5A 1K86A 1P0FA 2GM9A 3OQIB 1DAOA 3KTFA 4OQEA 5F9MA 3BMXA 4QQRA 5BV0A 5AOCA 1VDZA 3UFXB 5A02A 4PZ0A 3T9FA 4BL5A 5D7NA 1RQPA 2Y2UA 4ND7A 5AM1A 2GUWA 3H18A 4EJMA 3H9BA 1IY0A 1JL3A 5G02A 3U4IA 4L4UA 1KEZA 4X97A 2VSOA 3R8XA 1Q0RA 5AUPB 3CXUA 4ODIA 2LD4A 2VNKA 1WQ4A 1AXRA 2PWYA 4L50A 4UPVA 3SVLA 4QBHA 3NJ4A 2D74A 1F1JA 2JFGA 3O82A 1DI0A 5EWLA 4RH1A 3M49A 2A0KA 3FPKA 4WIAA 3V3TA 3COSA 5JASA 3KE9A 2WPDA 1JEQB 1HY3A 2QTCA 3OVMA 2WVAA 4L16A 2OD7A 4RVGA 5FPYA 3UMGA 1TMKA 3VZCA 3RK4A 4YK7A 4Y1EA 3IALA 1TKCA 3B1FA 5JMTA 1T8WA 1Z68A 3QFHA 1WZNA 5CDFE 1FE8A 1DBIA 1I4TD 1G6HA 1VB3A 1VMEA 2CLKB 3FMVA 1QWSA 3GG9A 3U2QA 1K7EB 4UZEA 4YHBA 1JA0A 3LUFA 4MUMA 1L5SA 4KODA 4PV7A 3Q3IA 1GOTA 3O8QB 1R5JA 4TRMA 3DZFA 4WXPA 3NAMA 1Y6ZA 4K9LA 2FJUA 1FFHA 5EIWA 4F60A 5CG2A 4P3OA 1XROA 3THRA 3IL2A 4ECEA 2XMZA 2BT4A 4BUJA 2DQKA 3T1YB 3T3IA 3EZGA 3AH8A 4ERNA 3M9XA 4H16A 2H29A 1PEDA 2BFNA 3G23A 3QY0A 4C3OB 3ROFA 4E07A 3BSYA 3M33A 3L4SO 5FNVF 1YDWA 1U3WA 1YJAA 4FYWA 2VXOA 5AYVA 1GKLA 4C0QC 1WMAA 4IHKA 1I5EA 3AI2A 3DCYA 5CRIA 3F5MA 4LSGA 2C84A 3HU1A 3PUJA 4EGJA 1R9JA 3RUHA 2QTWB 2QZJA 4H08A 4TS1A 3CZMA 1NMXA 4UBMA 4KBFA 3QFSA 2CGEA 1E3IA 1EWVA 5JSFA 1WIWA 2EJWA 2Y4NA 4M21A 2J3IA 3GLIB 2UXBB 2O0MA 2ON6A 4M6WB 1MW8X 2JLRA 3MGGA 2K7FA 5BWBA 4W7IA 5EMKA 3U7HB 5BMVB 1V8FA 1MG5A 3ZE7A 1N8SA 4DIBA 2VBCA 2X7HA 2FEOA 2R66A 4NS4A 4CZ2A 4KXXA 4LVNA 1R9NA 4IDNA 4KRYA 4CTNA 2PWBA 4QPDA 3OJWA 1EUCA 4EL0A 3ODPA 3ZCSA 5DNYB 3GFFA 5JBNA 3P5SA 3FF1A 4LKOA 4NAHA 1J8QA 2LKCA 1UFVA 2XMPA 3T34A 3ZV5A 1B0PA 2EARA 3CO0S 4P3KA 3CY6A 2G1PA 1JLSA 3GFPA 3NTVA 5KVSA 3M7IA 1ZXXA 2F43A 3OFVA 5MF6A 2FRVA 2J0UA 4EG5A 3UPTA 1YR9A 3WY9A 2FF5A 1ICEA 3CPHA 2EKLA 2QY6A 3H4TA 4I5IA 4FS3A 1Y5RA 1M2FA 2ODNA 2QQEA 3K1JA 2IZ5A 5G3ZA 5KNBH 4H27A 3T3NA 3BAFA 3IUNA 3AM4A 5BORA 2Q8PA 3A26A 3QOWA 4I50F 2O07A 3NONA 4GICA 2WT4A 3GG2A 1LS1A 3GXOA 1ZI8A 4IM7A 5CIYA 3X43A 4E5SA 3FYDA 2OO3A 4U0KA 4FHCA 1CBUA 1WXDA 2X2EA 4PPYA 2VHTA 4ZC8A 1RWKA 2PV7A 2QHXA 4WA8A 3MMNA 5FPQA 5ENZA 2XVAA 1ZVKA 1W36C 3QMWA 4DF3A 2QYSA 4BE7B 4G23A 1QB8A 2FX3A 2QL7A 4RGBA 4Y0AA 3IE1A 2OK7A 4OYRA 3A2KA 2GWHA 2OCAA 3CUVA 5AHXA 4D25A 4W8OA 1M8KA 2XT6A 4IHJB 2XIQA 4OU4A 4OO3A 1DFIA 1EQAA 3MJ4A 2VK1A 3MINA 3WBFA 5JSZA 3UPDA 4NMWA 5CW1A 2DLNA 1VPEA 1GQSA 2WA1A 1SU6A 4GEKA 3T3EA 4DV3B 4B43A 3KT8A 1T5DX 2ZUTA 1RYBA 3TSCA 5DNWA 3GNQA 4JVMA 4DARA 3OZVA 1L4EA 1YBHA 1ZD3A 4G5FA 2PGIA 2QG4A 3BIXA 4EJ2A 3AHDA 1FNNA 2P4SA 2E49A 2YFYA 3GLQA 4G09A 2VSNA 3SYKA 3ZOKA 3HO6A 4D8WA 3ROPA 4D9NA 1H1TA 3FZYA 4URFA 4TKVA 1WU8A 2WKPA 3ZD7A 1SVUA 1QP4A 3T5MA 1U9CA 3DEHA 4H1WA 5ALHA 4JT9A 1IN5A 3I92A 3U3MA 2EFYA 1WDTA 4U9IS 3W34A 5DGTA 2JK1A 2Q3HA 1QTNA 2XRYA 4IQ8A 1MB9A 1JR3E 4RMNA 3T7RA 1O0BA 4YRJA 2P62A 4C88A 1Q2UA 3AKCA 2XE8A 1ZUIA 1KAHA 3HDVA 4LXXA 3NXSA 4NCXA 4L5YA 5D2CA 4D9HA 2HUNA 1IBLB 1MNQA 1SOAA 2A7QA 5F7OA 4HNTA 3TM5A 5BRAA 1ODFA 4GLFA 4Q4DA 3GRKA 3R4VA 1F8XA 4V02A 5ARCA 3G8BA 5T41A 1HSOA 3PC7A 1XLTC 2CNNA 3DZDA 3VVLA 3HU3A 1FUYB 3ORFA 3PD7A 2OCGA 5BN1A 3JQFC 1XD2A 1L4HA 1RFLA 4UNPA 4XB6B 3E5NA 4DWJA 5BSGA 5HUHA 3ZNNA 4RUKA 1P2SA 4EF6A 4LZJA 4Y9SA 2X19A 1XVIA 4QGSA 4HYQA 1P6UA 2UZ4A 4R83A 1QMPA 1ZVJA 3LCCA 4QRIA 1J1UA 1FIUA 3ZE2B 3R6GA 1GZSA 1ODTC 4Z51A 3NT5A 1SIWA 3VPXA 1L4BA 1YZUA 2Q6TA 3H9JA 3SC2B 4ZZ1A 4JU8A 1FNSA 4DA7A 3DFFA 1RKVA 3A3KA 2DF8A 3D59A 3IMGA 3LS2A 3RVKA 4UTRA 5TLSA 2WIFA 3D8UA 5C1DA 1K08A 4DABA 4M1MA 2JAHA 4B2IA 4EGAA 1M83A 2OSVA 4EEZA 1CR2A 1J06A 1CNFA 2OQIA 4TLMB 2QTVA 5JZBA 4BJHB 5TT1A 3JQGB 1T1RA 1WHTB 4G4SO 4ZREA 3BRWA 4NAVA 1IQPA 1RZRA 1SVWA 3OPVA 4YLYA 4X20B 4IYRA 1KH1A 1JWLA 1ZGZA 5LIPA 1OROA 4JA2A 1XTJA 2R62A 3OJXA 1UBKS 2VJNA 4HNUA 4XCQA 1LCIA 2PX3A 3FCAA 4M1OA 1T10A 5FP0A 2IWHA 1D1SA 2IHZA 3TLXA 4RHEA 1IOZA 1SHZA 3TQFA 5JE8A 1TQ2A 3WGUA 1JHRA 2FP3A 1GU7A 2DUJA 3JTEA 3N8DA 5B2EA 1CQIB 5DSTA 3L8EA 4AU1A 1EXDA 3O0DA 3W5IA 5H81A 5DHPA 3R5FA 5BOSA 1XLWA 2MSWA 1EM8B 1JQLB 2IZ6A 4N39A 4R2KA 4CPDA 3I2YX 5CH5A 4F04A 1AUOA 4X94A 3CF0A 2A9OA 1P33A 2R1ZA 3HDTA 4EY6A 3NXKA 1XFDA 2O2SA 1Z2PX 2EL7A 2N47A 3OPQA 4FN4A 4MP3A 4W82A 2BF7A 4AC9A 2H8KA 1XRJA 3PFBA 1D2RA 3B3JA 4YUVA 2GPTA 4NATA 1J1ZA 1T2VA 1Y1LA 3EPJA 1BXRA 1WSDA 2BGLA 2CXNA 4HY3A 5EPUA 5KAMA 1GU0A 1C3VA 1DJOA 1OWOA 4BO5A 1NKVA 3QVJA 4GDMA 1Z8HA 1NTOA 3TRIA 3IQHX 2A9RA 1MP0A 2HU2A 2WHYA 3DAFA 3K5HA 1XZPA 5FD8A 3QU4A 2P4UA 1QFJA 5DM0A 5DNUA 1E2GA 2ALJA 2ZRPA 1ILWA 1FA9A 2QZSA 4G65A 5GMOA 5LR6A 1YQ9A 3ZD6A 5C2JB 1H2YA 4I4TA 1Z4LA 4PRZA 3N9IA 2H7VA 4JT8A 4S0XA 1BE6A 1W48A 3LDGA 3KU1A 3OD1A 4DJ5X 1YJCA 4BV8A 3DR5A 3P9KA 2ZBRA 5LU9A 3SZUA 2XT9A 2BDTA 1JHYA 1GQYA 1UJNA 2I67A 1P4HA 1JQEA 1CUDA 4OJKA 2GCOA 4X54A 1E9RA 1ELOA 4GAEA 2CHUA 4RD6A 4V0MA 2AUNA 3LYUA 3NB0A 4GC9A 3TCXB 3WRVA 1N2JA 1JR3D 3EGIA 4DNPA 3TQIA 2O8FB 1ZK4A 1LVUA 3VMFA 2Z8XA 3W2FA 4KUHA 1E6UA 1K8XB 1QBGA 2XVXA 4LW8A 4R2LA 3TKLA 1DLJA 4US1R 4J03A 4F21A 1LWNA 3S2IA 1JV2B 4R0VA 2Q99A 3JVDA 2ZYRA 2IHKA 2C9ZA 5F33A 5CCDA 2DHRA 4L78A 1RLMA 3V1MA 1MCZA 3IPRA 3BJIC 1F4LA 3X2EA 1Z2AA 3KBOA 4ZK2A 4JLVA 2X8BA 1R64A 1EP2B 5DYYA 3AOEC 3TEJA 2HCRA 1O9GA 4W6QA 1Z37A 1DG9A 5KSYA 3AVWA 7ABPA 5L6MB 2DY1A 1GEEA 1M76A 2ONJA 3U7JA 4INPA 1IATA 3LCUA 4KQ6A 5E6UA 4BFZA 2NTJA 1ZVVA 5IAAA 2Y77A 3B5EA 3IV7A 4KSBA 3NUQA 4RZSA 5A6SA 2I2AA 5DJ5A 5E3IA 1SUDA 4JP8A 1BVHA 4PRYA 1GL9B 3L6OO 2COUA 2G4LA 1DUIA 2C96A 1GTL1 1YZQA 3Q8MA 1ULHA 2XYGA 4JI3B 3O3NB 2NMVA 3QF7A 4MRSA 2AZDA 1I32A 1F5SA 2QZZA 3QI7A 3QGMA 3RF7A 2XI4A 1V0JA 3BICA 5K0LA 4LFCB 3LYAA 3ZBQA 1GUAA 3K09C 1L7EA 3PRHA 1LBSA 4FCVA 4NJMB 4EATA 1LDNA 4MGHA 3JQAA 1X1RA 2ZB7A 3RRJA 5EJGA 4NICA 5AJHA 1Y6FA 2GRUA 2JFOA 5CFPA 5K99A 4YJ2F 2G0NA 5FAXA 1BWQA 5LB4A 4HWPA 1HE2A 4HQ6A 3ZZTA 4NPAA 1KS2A 4HT3B 3FIUA 1WW8A 4M88A 3HLYA 3FJYA 4PCLA 3WGHA 3ILVA 2JLZA 4IQ0A 4OLJA 4PN7A 1UMDA 5TQJA 3R7WB 1JEJA 1L7PA 3AR5A 1QIFA 2GSDA 4HYYA 1IEWA 3HS3A 2OVFA 2CB0A 2M1XA 4RVUA 5F4ZA 3ZE8A 1CQZA 1AKRA 1SC1A 1XDUA 2IXGA 2B4YA 4ZZIA 4J2HA 1U5BB 1H3FA 2WJPA 3MT7A 1M2NA 2HWUA 2YJ3A 4QLOA 1XJ0A 3L3BA 4YXWA 2Q3MA 5LP1A 1C41A 3EC2A 2WV7A 2ZTLA 3HR7A 4BMYA 2X6QA 3ZV7A 2VG8A 4TYYA 3IQEA 2G4CA 3ZE9A 3VR6D 2VSFA 4J3JA 3W5VA 1U3UA 2FLKA 2OOKA 3QG1A 5KX5B 1GZ4A 4Q47A 4KUGA 5B7GA 3CW9A 4LWQA 4KQ9A 4RXUA 3CNLA 1DEKA 1VL8A 2ZT8A 3DFIA 3BDVA 3L0DA 1D6MA 5A6VA 3V48A 2W22A 3QWAA 4ZZ3A 5L9AA 3GJYA 4REQB 1EUZA 3QELB 2AG5A 1LLCA 4DNOA 1NXTA 2P11A 1M2OA 2XUZA 4IPTA 2J59A 4W1RA 1H1LA 3RTCA 4B73A 3PGA1 5EJIA 3RO7A 4HQLA 2R4QA 1ZW6A 2Q1SA 3K8QA 3IEPA 1I8TA 4YROA 3RQSA 1RQRA 1VI2A 4GRIA 2M9MA 1KEKA 3EC7A 3HFGA 1WLSA 4BO6A 5DWVA 4D9MA 4E12A 1XG5A 3FNHA 3O8OB 5A06A 8LDHA 1OWPA 1XJQA 4UUQA 1U3DA 1YAHA 2AS0A 5EHIA 2ZI7A 3R6LA 4C1NA 1FS6A 3GFVA 1C30A 1EFKA 2AIRA 3D7MA 5HX7A 4X84A 4PICA 4Z4GA 3AVYA 1QJCA 2AZMA 4MR9B 5WRFA 1Y3CE 4PXAA 4BNNA 5B30A 5CFZA 3UQZA 2WDZA 5EZYA 3HMQA 3OTHA 3VDMA 3R20A 3OM0A 4IINA 2TMYA 3RVOA 7REQB 3MT0A 1NQAO 1YR2A 2ZRDA 1DUVG 4P5DA 4CTOA 4DSZA 4YH1A 5BPFA 1WD7A 1U5AA 1L0BA 1XAHA 4OQMA 3RS4A 4KFUA 1GV1A 2H0QA 5CVJA 5IG2A 3LK7A 2FR0A 5ALFA 5CT9A 4ABTA 3CMCO 2G83A 2I22A 2JKZA 3R7SA 1YB6A 3RSGA 1TQ8A 3F3YA 1YKGA 3EUEA 3P9XA 4TS9A 4QFMA 3AJAA 1T1GA 4POOA 1JI0A 3P0JA 1ZCFA 4BO7A 5DHFA 5EJMA 3GT3A 4IDOA 5TIIA 4AKGA 3SLRA 2OLKA 1R0BA 4JU9A 1JR2A 3ZWVA 1RZUA 4F8YA 2XRFA 2VP9A 5JTUA 3MIIA 3UAYA 2PRIA 1A9ZA 1L3IA 2YHIB 3KJGA 3MXTA 2W43A 1NJSA 2Y99A 4BU0A 5JCXA 3CEJA 4YNBA 4AY6A 2PAAA 5DI3A 2MYPA 3QMVA 3TM4A 1PX2A 3DH0A 4XVCA 4QPNA 1E2UA 3ILHA 5B1IA 1EFPA 2J6BA 2RARA 5SZIA 3H5OA 3JR3A 3GJRA 1LSOA 1OIWA 1SXJE 1ENPA 2O3UA 2XTAA 2UAGA 3F6RA 3IDFA 4QBIA 4XX1A 3OX4A 4B31A 2O8DA 1JECA 2XNSA 1ODKA 3A6EA 2VDVE 2UV8A 1O4WA 4LKRA 4KC0A 5DM70 1U3TA 2PXAA 2W11A 3CB4A 1GA6A 1GNQA 3HYTA 1KO4A 4LCJA 3N7TA 3L1HA 1UDCA 3O84A 1YJXA 4XDHA 1EVEA 5CDHA 3DDSA 4B87A 2NZVG 4EUEA 2XB2A 3VU3A 3AYZB 3GPBA 4BO9A 3SP1A 2FQWA 5SICE 2JZCA 3FM9A 3IOMA 3DZCA 3KCNA 1E2HA 3LWZA 4NVRA 1NDUA 4BWYA 4A8HA 4R2JA 2C9MA 2WNSA 3EG5A 2ZZKA 3GPLA 1TA0A 3EVCA 1NNUA 4LGVA 4P0TA 2VPPA 4GQBA 4XFJA 4B3CA 4QDTA 5KNBA 1LD3A 4RCZA 3IEKA 4B3DA 1OLUA 2BFPA 4TKUB 4EMSA 1KARA 4RF2A 5BN3B 3W5AA 1NW6A 2YC2C 1JLRA 1BMQA 1MPTA 2Q46A 2Y1GA 3E23A 3JQBC 3OM8A 3IGFA 2NPFA 2Q1UA 1PJTA 1K8YB 2ZPUA 5JLAA 1GTRA 3A6KA 3BFVA 3LXMA 4HDCA 2HRQA 4KIGA 2C99A 5EAIA 3T95A 2XZTA 2VUHB 3VSAA 4RDHA 2I4NA 4B6FA 5KMGB 1DMRA 3H87A 3HP7A 3ZV6A 1G8AA 1TKBA 2R4UA 5JAMA 1PFWA 2AXPA 4JUDX 3UMJA 2VXYA 4ZU3A 3UB2A 1YGYA 2V7PA 3NAGA 3AIIA 4H6WA 4CCWA 1BCSA 5FNVB 1Z15A 4S1NA 1P45A 4KN9S 4DR4B 2QMHA 5IANA 4HG2A 5EP3A 1EZZA 1FDIA 2VYCA 1QV6A 2C8LA 4Q4LA 4JBLA 3BXGA 2E3JA 1Q11A 1ZOPA 4QOHA 1RS0A 4IOJA 5AUQA 2FR1A 3TCNA 3T4PA 3BS4A 2F1HA 1CY8A 3EFBA 4M1YA 2UUPA 2FR8A 5A7GA 2FPGA 2ZJYA 2WSSA 3OQ6A 1EKXA 5I4KA 3HADA 4O29A 2XGJA 2W00A 2PVCA 3QVWA 2ZVPX 2YQ4A 1MVNA 1G19A 3CUYA 3PYLA 3N2GA 4GBMA 2XD4A 3CC8A 4IG9A 4PFSA 4J2TA 2G8LA 1IJFA 3BZUA 4PLVA 3TD2A 2VHVA 4F85A 2OFWA 3OP4A 4WZAA 5KJEA 4CQJA 4A91A 2FDCA 2A5LA 2RK4A 2I66A 2EJCA 3H4IA 4D8VA 3LAWA 4L2IB 1JAXA 1N9GA 5BWNA 1T2EA 4YMLA 2FZWA 2NYVA 2WWHA 3EVTA 1KI4A 1PUXA 1RQLA 4IWYA 1L5HA 4OX9B 1DAEA 1NBWB 1OWMA 2NT3A 1TA4A 4M7OA 4WNAA 4DT1A 2CXQA 3AI7A 1G0NA 2YJ5A 2J9FA 2PRZA 1U9YA 4R31A 1XMOB 1J97A 5ILGA 3H9CA 3IR7A 1V9CA 4EHNA 3RPEA 2I3AA 1GGKA 4QATA 3KXIA 4HXFB 1E77A 1LPSA 3QEJA 4LISA 3B6MA 1B00A 2G1KA 1WY7A 2JH8A 5DP1A 4ZJPA 5JXHA 4A4DA 3E9ZA 1SHJA 3GMDA 4FIDA 4I50B 4K6CA 1PJ3A 2SBTA 2WKRA 3ACCA 3OAAD 1Q7RA 4N7RA 1HI9A 4X00A 3S1LA 1SRRA 3D43A 1T43A 3OFKA 1SXJD 2VHEA 1WEKA 2J48A 4GP7A 4IGAA 4GQAA 1OY1A 1LDBA 1E9DA 1N3LA 1QH1A 2QTFA 2VDQB 3P26A 4JBGA 4YP6A 2IV3A 3SNHA 5AVRA 2X6TA 3W5DA 4K9KA 2QL9A 2VR1A 1TVEA 3OQVA 3LX6A 5B1EA 1U0BB 1B3BA 3BWEA 3LVQE 1NFFA 1WNTA 1E8MA 1Z25A 2VNJA 3BSSA 3BD6A 5IH7A 3UTDA 1N0IA 4ZT3A 4MV3A 2H5JA 1V9LA 2WNHA 3BBLA 4XW2A 1NJ8A 5H59A 1ANKA 3RG2A 1OI2A 1CF4A 4EUHA 4YV2A 3H5AA 1DRKA 3U9SA 4EEKA 1USUA 2FW1A 3U4GA 1E8DA 3EZ9A 4AZSA 1ZP6A 2G5PA 3WDLA 1K75A 2KX7A 3PRYA 1ZD9A 3WNZA 3FHTA 2Z5VA 4M4SA 1OX6A 2OHFA 3N1UA 2FPXA 3UN1A 2O0JA 3IAUA 1KO1A 3ICCA 1KDRA 2RGNC 5DLEA 1TAGA 2AEEA 2ATXA 3KEOA 4JYBA 1U80A 4RPKA 1KSHA 4WMLA 5DTJA 4R7ZA 3BD8A 3QHPA 3VZDA 5EJFA 2VT7A 4YRMA 1NYTA 4TYQA 2VUTA 3SQDA 1JQ3A 3QIAA 1M2JA 4MW7A 4X9XA 2D2EA 2OSBA 4BO1A 1Q95A 3JSAA 1JFSA 3QLUA 2NTEA 3OEHA 2I2XB 1JQBA 3KP1A 2NV2B 1AY0A 2I3GA 4FU0A 2EJUA 1ACMA 1X87A 4C2BA 1NN1A 3STTA 1E0JA 9GPBA 5T6BA 1EBBA 3K3PA 1ZU5A 1W85B 3C4JA 2H4FA 1XBTA 3HU2A 3KD3A 1VP9A 4M8SA 1SPBS 1PGQA 2HIAA 3FNBA 1KZ1A 1P2DA 1NLYA 1P3Y1 3G2LA 1MRSA 3KDSE 4LYEA 2IS4A 2R47A 4L0QA 2W8BB 3K9FC 4DQKA 1P9RA 2EQAA 4MPRA 3PC8C 5AUOB 4C2TA 1FLVA 2QTBA 3DPUA 2CCKA 3BFJA 3JYHA 5CLHA 2A58A 2O06A 5D3ZA 3VU8A 3W5HA 5B4VA 4ND1A 1KNXA 2C88A 1RAFA 2W2OA 3K6JA 4MPTA 3TTTA 4YRZA 4IWXA 2P2YA 4TV8F 2A67A 4C08A 2ENWA 3PC6A 2JGDA 2P9ZA 3G3EA 3HWX1 3L0YA 2MINB 1L6IA 1GNSA 3E9YA 1YOVA 4GI7A 3WWYA 5CBPA 4BNDB 4NYMQ 5F3DA 3RHFA 4D5GA 2CD7A 5A0VA 2J9GA 3OURA 3KTAA 1I6LA 1Z22A 3HPQA 1SWWA 3VGPA 1N5KA 1K6IA 4ZMSA 1JBKA 1XZHA 3FHLA 5DKFA 1QNLA 2ZDHA 1QK3A 3BHJA 2W6JA 3WC4A 1N9KA 2GN8A 4BASA 5IHXA 4LYDA 1HTBA 3OECA 2BC9A 3UV3A 5CLLA 3A1DA 3E5HA 3TXAA 4WUVA 2B7CA 2PGJA 2CXRA 2DM6A 2W4IA 3R0JA 4NV3A 2CKDA 1I4OA 3IAM6 2Q8NA 4ZOLF 3AMVA 5FORA 2RGYA 5H5JA 1WX1A 5IJ0A 1PJCA 2EFHB 2P6RA 2W8ZA 2ZIGA 3NOXA 3I1JA 1QV9A 1LX7A 3DDHA 5LQJA 3FJ1A 4EB3A 3DE0X 1FSGA 2Z1MA 5CVCA 5G0SA 2GFIA 4EW1A 4BUZA 1WUKS 1KQNA 2QAGB 4C7JA 4YHHB 2WWWA 4UHDA 2FWJA 2W6PA 4JGIA 4EKIA 2C2ZA 2GXQA 5U9CA 2NO5A 1TJ5A 4UHKA 4XSHA 5CA0F 4ZQIA 2WU8A 1J0AA 1KORA 1AG9A 3IOBA 3LL4A 4KR0A 5DN6D 3HWSA 4Y6PA 4EKNB 2ZXFA 1O6CA 2ILVA 1P1CA 1Y9JA 3KZ1E 1MTZA 2PH5A 4C6HA 5DRTA 1W5TA 1WPXA 1H94A 2G9UA 2WOOA 2YIJA 1D2EA 1OWNA 3F71A 4HFJA 4W5QA 2LZ0A 1T0HB 3SE7A 5J1TB 3CSSA 2NXNA 4W9MC 5D85A 3ANYB 1SXPA 5DBHX 1SC9A 1N2HA 2FHPA 4B09A 4ISBA 4XWGA 4CR8A 2W2TA 2ZIEA 2G0TA 3O8LA 3PFHA 4P4GA 1EM6A 4YRLA 2YV4A 4EPXA 5EWMA 4V0OA 1ZL2A 4UBOA 4WK0B 5L3QB 1ZJWA 1TU3A 1YS7A 3EW7A 4X3CA 3Q5GA 2N1MA 2YWRA 2WG1A 2HIMA 3R41A 4OLAA 3HEBA 2Y1EA 3WHLA 5K5EA 3AG6A 5TPZD 1GUYA 1IBRA 1SOWA 2XB8A 4L27A 1AN9A 4PFKA 3DFKA 1VHDA 4A15A 3CN9A 2LE0A 3GLHE 3OWOA 2A0YA 3COJA 4WLOA 3OOSA 3U4CA 5CYPA 4RJJA 1VHWA 3KEMA 4TZKA 3WIOA 2HF2A 1PEAA 3KR2A 4HTFB 1Q77A 2BBTA 3DDCA 3HN7A 3ZWYA 1HV8A 2IX9A 2OECA 1RWWA 3UYLA 4F86A 1UBHS 1AQ6A 4GOLD 4EHLA 3CVXA 4PZ9A 5BSHA 3OE7D 3S44A 1MQ9A 2ACVA 1GLVA 4NTZA 5HJ5A 1LV8A 3BEOA 5DBGA 4F2GA 2Y1WA 2I7TA 4RVSA 1VI5A 2DP4E 1PYDA 1QAQA 1YR8A 4MYTA 4C4TA 4M53A 3W9UA 2GTIA 3WR5A 4OOFA 4N3AA 4BGDA 4LY9A 3QBVA 3D6MA 1FNMA 3O4JA 1N34B 3EAGA 2GTHA 3ANSA 2GA9A 2HJWA 2FW0A 1PQYA 4ZGBA 2AR7A 1C3XA 1NW5A 2PGOA 2X3YA 1Z4PX 3BVPA 2RGAA 3LJKA 1HQCA 4UCWA 5FI5A 4D0GA 2FG5A 4EG8A 5JSKA 2UXCB 1VHLA 1Z9BA 2Y9M