2NNLD

Binding of two substrate analogue molecules to dihydroflavonol-4-reductase alters the functional geometry of the catalytic site
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
324
structure length
324
Chain Sequence
b'ETVCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNVKKVKHLLDLPKAETHLTLWKADLADEGSFDEAIKGCTGVFHVATPMDFESKDPENEVIKPTIEGMLGIMKSCAAAKTVRRLVFTSSAGTVNIQEHQLPVYDESCWSDMEFCRAKKMTAWMYFVSKTLAEQAAWKYAKENNIDFITIIPTLVVGPFIMSSMPPSLITALSPITGNEAHYSIIRQGQFVHLDDLCNAHIYLFENPKAEGRYICSSHDCIILDLAKMLREKYPEYNIPTEFKGVDENLKSVCFSSKKLTDLGFEFKYSLEDMFTGAVDTCRAKGLLPPSH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroflavonol 4-reductase
publication title Binding of two substrate analogue molecules to dihydroflavonol-4-reductase alters the functional geometry of the catalytic site
rcsb
source organism Vitis vinifera
molecule tags Oxidoreductase
total genus 111
structure length 324
sequence length 324
chains with identical sequence F
ec nomenclature ec 1.1.1.219: Dihydroflavanol 4-reductase.
pdb deposition date 2006-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2nnlD00
4RORA 3WX0A 4ALJA 4CLOA 3VVCA 2VYVD 3KYCB 3AOEC 1I5RA 2IXBA 1HTBA 1P44A 1PJBA 3RIHA 1ENZA 2FR8A 4Q39A 3TF5A 9LDBA 3S2GA 4N18A 2AE1A 3LC1O 2PV7A 4A73A 4BNMA 1RWBA 4YCAA 2B4QA 4P22A 1K3TA 4BO8A 1NVMB 3C3XA 3V5NA 2EV9A 4R3NA 4XQ9A 1RM0A 3AI2A 1UP4A 1U1IA 1ZKMA 2ZK7A 4IDBA 3AW9A 4JXKA 4YQYA 3IKVA 4R01A 4KOAA 5EJ2A 5U4QA 4PLGA 1G6KA 1ISMA 3K8ZA 1HEUA 4G65A 4CQLA 3G49A 2PZKA 1PEDA 2DTDA 4JX8A 4GGPA 5CDSA 3GUCA 3R3SA 3L6OO 2JAPA 4BB6A 2Q46A 2EP7A 5G0WA 1WW8A 4WLFA 3VZPA 1SB9A 3GFGA 4U6QA 3E9MA 3WG9A 4RVDA 1Z75A 4XYGA 4CUKA 4R69A 4DBVO 1Q7GA 3VKUA 5ITWA 5DCYA 3UW3A 1MGOA 4EUEA 1U9JA 2VYND 3H4VA 3K73O 3B1JA 3WNQA 3IJPA 1E3SA 2G82A 3SXPA 3CPSA 5A1TA 4XQGA 3BIOA 4CQMA 4MVJE 5KKCA 1V3TA 4BNXA 2YUTA 4OAQA 4WCFC 4BO1A 4KWHA 3WLFA 3AK4A 4L4XA 4J4BA 4PLZA 3LYLA 4NFHA 1UJMA 3CIFA 3GAZA 1EDOA 4WLVA 1JLLA 4AJIA 4IDCA 4ILKA 4J4HA 2PGLA 4KMSA 2X86A 4A7PA 1X13A 4Z3KA 4JBGA 1W4ZA 3HDQA 4YRDA 2PKQP 1Z45A 4MP6A 1RYDA 4M87A 4PLHA 2CVQA 3KOUA 3AM3A 4J2OA 3AU8A 3BMQA 3FCOA 4K9DA 3TRIA 2ZCVA 5JS6A 1P1KA 1D3AA 4R1TA 1V35A 4JQCA 4Q9NA 2ZJ0A 1WPQA 4M86A 3AUSA 2PWZA 1IY8A 4K6FA 3O03A 4OKIA 5A9RA 3PQEA 4XDZA 4XRGA 4B79A 4IQ8A 4BOYA 1GFSA 5FWNA 2BI8A 4W7HA 1A71A 2ZKLA 3B70A 3D3EA 2HK8A 2Q4BA 1P0CA 3MJCA 1RYEA 1KC3A 5I7EA 2RHRA 1DAOA 3WSWA 3ETGA 2BKAA 2CD9A 3KETA 3QWAA 3D4NA 3DMTA 4EITA 3O9ZA 4RL6A 1SCUA 4MKZA 4YPOA 5TGDA 1EBFA 1O5IA 4NBWA 5AQ1A 1CDOA 1ISGA 3JD4A 3ZDFA 3Q0EA 4YJDA 3DQPA 1F12A 3DBLA 2O3QA 1O89A 2OBNA 1LDYA 1KC1A 4CUJA 3ENNA 2X0JA 3KEQA 1E1NA 2W2KB 5L51A 1FMCA 1NM5A 1B8PA 4IMRA 3D7LA 3EGOA 4IQGA 4PLVA 3O38A 1DFGA 3BHJA 4FPXA 1E3WA 2Y93A 1Z73A 1ZNQO 3IDSA 5IDQA 4ALMA 3L77A 1H6CA 1CQIA 5L45A 4RLSA 1HE5A 2JFHA 1SNYA 1MC4A 1MUUA 4DIFA 1UZMA 3PK0A 4ZGWA 1ZO8A 1K0UA 1J5PA 2O7QA 3UKOA 4MPDA 2JD0A 4WEQA 4ZU3A 4YRBA 1E1MA 4GSKA 5G0TA 3OJFA 4JLWA 3T4EA 5DCWA 3DBRA 4RLHA 5EESA 4WK6A 5TJHA 4YB8A 4BNZA 1P31A 3OQBA 5A9SB 2ZQZA 1U3WA 5A05A 4B4OA 3VH3A 4CM7A 4QECA 1YONA 2O3TA 4UVIA 2E82A 1EMDA 2GERA 3E5RA 3K6JA 4CV2A 4NMHA 3UCFA 4A0SA 2OP0A 4E30A 1U7TA 4TVBA 1NASA 2C54A 2V6BA 3TZKA 4BNFA 2PR2A 3RKUA 5B4VA 1CYDA 1VSUA 1HE2A 1VJ1A 4DQVA 5JY6A 3OFSA 1ADCA 2NU6A 4PZEA 2QHXA 1U4OA 3VTZA 2AW5A 5DZSA 3WMXA 5J23A 3C85A 1PL6A 1C0LA 1T4BA 1BHSA 1YBAA 4ONEA 3WGIA 3H2ZA 4RPJA 4BNYA 3RI3A 2PGJA 4BO0A 1K89A 4RPHA 1I3KA 1PGOA 1E1LA 1KBZA 2E37A 4OJNA 2JD1A 4MIYA 3AJRA 1T25A 4L74A 1S7CA 1BG6A 1E5QA 1PWXA 1P77A 2HCTA 4YDRA 2JFFA 3HFGA 5L3ZA 1TVEA 1B16A 3OH8A 3PDUA 3VC7A 2JCYA 4TRJA 3W6ZA 3EVTA 1EDZA 2DBQA 4PLPA 5CDUA 3ZV3A 2AG8A 4OMUA 3BTOA 3QJ5A 1X7DA 4XIYA 3WQSB 3D4OA 3AOEA 4DC0A 4XIJA 1BVUA 4LRTB 4FSHA 3DMYA 1NWCA 5KCZA 5L40A 3DXFA 1IPFA 4DL9A 2A4KA 1HRDA 2VNSA 4IGEA 1GDHA 1NQOA 5BT9A 1Y7TA 3HDHA 2AE2A 2DTXA 3ROMA 4RF5A 3BMCB 1EVJA 3EAGA 1B0AA 3RQSA 3LF2A 3WYCA 1U3UA 2VZ0A 1U5AA 2Y68A 3H9EO 1V8BA 1Q0LA 2HO5A 4GH5A 4O0LA 1JQBA 4WASA 4XX0A 4W99A 1DHRA 4I9UA 4QO8A 1ENOA 1N2SA 4GSLA 4OQYA 2VCYA 3KZVA 4PG8A 4WLEA 1YQGA 3GNTA 1UXKA 4XYBA 5THQA 3SC4A 1RM3A 4XGKA 4D3FA 5CG2A 3GA0A 4O1MA 3ICCA 1UDCA 4R5HA 4W4TA 4CMCA 4EI2A 1J0XO 5DOVA 5T6BA 3LLSA 4J0EA 1SC6A 5KOIA 1K6JA 3PFFA 4WE3A 2GF2A 1PS8A 4NDNE 1U2GA 2HDHA 3GNSA 4JJFA 4FJ1A 2GCGA 3JQCA 4J7UA 3DC2A 4XRRA 4BB5A 4C7JA 4RZIA 4HFNA 1GUZA 3RUIA 2AEJA 2ZTUA 3TZ6A 3WOHA 1IULA 3LT4A 3HNPA 5CPFA 3W1VA 1Q2XA 4DPKA 2EIHA 4XQCA 4WCFA 1G1AA 2DU8A 3I9OA 3IIEA 5BR7A 2A9FA 1AHIA 2CNBA 2NU7A 1LSJA 4AJPA 5BNTA 4CLOB 1PR9A 4PLFA 1MG0A 1A9YA 1R0SA 1VL6A 2Y1GA 3FR8A 4MIEA 4Z0PA 2NADA 1RPNA 4R41A 2VOJA 3LDHA 4HFMA 5EERA 1QYDA 5TX7A 4C7KA 4RVFA 4GBJA 3V2HA 4FBGA 5CEFA 3G3EA 2WD8A 3AWDA 1M6HA 2AG5A 2YJZA 2G76A 2XXJA 4UUNA 3BA1A 5G4KA 3F3SA 1XEAA 2WEKA 4CQLB 3GGGA 3PHIA 1JDJA 4KUGA 4CM9D 4DC1A 3ENKA 4M1QA 1XQ1A 2VHVA 4EEXA 2BFOA 1LRJA 2YDYA 3A9WA 4OXNA 3PJGA 3CE6A 3FBGA 4BQPA 3B6ZA 3GK3A 5HS6A 3GGOA 4PLYA 2IDZA 1R6DA 4J3FA 3E9NA 1U28A 1PQWA 2DFDA 5F1PA 5C7OO 1R4NB 1WWKA 2WD7A 5JAQA 2VHYA 1UXJA 1LLDA 5JE8A 3PRJA 4N7RA 4AVYA 1E3EA 1DFIA 3ETDA 1ENPA 3ASUA 2VNAA 4NU5A 3RJ9A 3GMDA 4RVHA 2GZ1A 3VTFA 1DLJA 1NR1A 2V7PA 3IP3A 1TT7A 2EW8A 1IUKA 1R0LA 1L7DA 3EZYA 4CQMB 4I1IA 2C7VA 5FF9A 2OFPA 1MA0A 1XKQA 4OYRA 4E12A 1W73A 1NAHA 2QRLA 3RUFA 3WFIA 3BTSA 1I0ZA 1UAYA 5CHEA 2BRUA 4Z0HO 1T26A 1LRLA 3I5MA 1K6IA 1LSSA 3NDIA 1WDLA 1ZSNA 2BD0A 2WYWA 4JN6B 4NFYA 2Y66A 3D3WA 2DBZA 2CDBA 4YT5A 1ZIDA 2BFPA 5BSGA 2NV6A 2VUUA 4YACA 3HB4X 1LSOA 1P3DA 3JQ8A 4QQRA 4FS3A 3EC7A 3BMQB 5EINA 3UCEA 3HQ4O 2CZCA 5IJZA 5A04A 3ZWYA 4YAGA 2GZ3A 2G5CA 3FN4A 3Q3CA 1OC4A 5MGBA 2WE7A 1E0DA 3RC7A 3DZJA 1BW9A 1ZJZA 3H9UA 1QKIA 4U6SA 1NPYA 2O23A 3SVTA 3PJDA 3ZWWA 2W98A 3I23A 3VH1A 5FFFA 4BKPA 1YQDA 1C14A 2X8LA 1A4IA 1VL0A 1D1SA 4DIBA 4OGWA 2FOIA 3LT1A 4WEOA 2F00A 4XCVA 1WLYA 3WMWA 2V65A 3NT5A 3QSGA 1PJTA 1NYTA 1UDAA 4O6VA 5A3JA 1CEQA 1RKXA 1NNUA 3JYOA 3DHNA 3RSHA 4J0FA 2J8ZA 4EJ0A 1HDCA 1WMBA 3WSVA 3I9KA 4GVXA 5DN9A 3C1AA 1JA9A 1A4UA 3NKLA 4L73A 3ZHYA 5I7VA 1I3NA 1GQQA 4IJUA 3SLKA 1EQ2A 1OI7A 4FIZA 3ZU4A 2WJPA 3MCVA 4J90A 1LI4A 3AM5A 1X14A 3V1YA 3W6UA 3D5QA 2ZYGA 3L9WA 1NXQA 4MINA 4A5OA 1H2BA 4CQMD 4EUFA 4OOFA 3S55A 5ILOA 1E3JA 3HHPA 3TN7A 5G4LA 5ITVA 3L4BC 4DLLA 1HWYA 3QVOA 1GPDG 4LN1A 2POQX 3IC5A 1BGVA 4PIVA 4K26A 3WTCA 4B4VA 2DAPA 2X7HA 4AJ1A 2D3TA 1PJCA 1VJ0A 4ALKA 1HLPA 2ZIZA 1QP8A 2B35A 4B8WA 4IGFA 3ANNA 4I08A 4GL4A 3ZNOA 1BTOA 2R00C 4XB1A 5TF4A 4TRNA 2UYYA 1Y1PA 3GVPA 1XELA 4I9HA 1Z82A 4O59O 1VLLA 3ASVA 5IDYA 1LXCA 3DBRB 1HYGA 3IUPA 1GR0A 2W2LA 1VL8A 4NH4A 1CERA 4NR0A 4QT0A 3IMFA 4BNVA 3TDKA 1M76A 4YBZA 4XGIA 2D5AA 3QVXA 4IUYA 2IODA 3L6EA 3VPHA 5IZCC 5JAIA 3FNFA 4IIUA 5ADHA 2YHIA 4ROSA 4UEKA 1E7YA 2IZ0A 1DSSG 3M6IA 1KEPA 2BMAA 4FR5A 1QORA 4N5MA 3NTOA 1NVGA 3F9IA 1TLTA 1EUCA 4IIVA 4EEZA 1XR3A 3RBZA 1DC6A 1HDYA 1Y8QA 3LT2A 4R16A 4E6PA 3GQVA 2Q1UA 4XR9A 2GN9A 3F4BA 2QYSA 4NBUA 4BO3A 3ANLA 2Q45A 3WGQA 3DTTA 4IDDA 2NQTA 3RBXA 3QVTA 4RVUA 3WGHA 3PHGA 4X54A 4IY1A 1NHGA 3C1OA 1HDOA 2BFAA 1PJ3A 4JP3A 3L07A 5A4DA 3H2SA 2AQIA 1E7RA 1K5HA 4YT8A 4QFDA 3DR3A 2WMDA 3FNGA 5TS3A 4W7IA 4FGSA 2RH8A 4YAIA 2C20A 4HV4A 2EP5A 4DYDA 3AY6A 4FOOA 2DC1A 4HNGA 4J9VA 5T8KA 1DDOA 4BS9A 4YAKA 2WM3A 2P9EA 3KTDA 4GGOA 4D0SA 4QUKA 4UEOA 5CPBA 3U4DA 1PQUA 3BTUA 3HUDA 3ABIA 1IHXA 1ZMOA 3C7AA 3FPLA 2O3SA 2J6IA 4CUZA 1DRUA 1BSVA 1C1DA 4IBOA 3ANMA 4WKGA 4F3YA 3COSA 4B3IA 3RKRA 3MTGA 2NTNA 1OZAA 4H15A 2BFMA 4YQZA 4DA9A 2HRBA 3I9MA 4J7CA 3H5AA 4DBZA 5IAAA 5TQVA 3N58A 1VI2A 2R6JA 2PNFA 4YJGA 4ALIA 4CL8A 4CMAA 1BRMA 3HWRA 3DFZA 4IXTA 2Q99A 1B15A 3M1LA 5IN4A 2IYOA 3JQBC 1H9BA 3TL2A 4DLAA 1GEGA 1DJNA 1O95A 4NBTA 4DWVA 2YFQA 4U7WA 3GEDA 2SCUA 4Q3EA 2O3UA 3ZNQA 4DLBA 2EGHA 1FXSA 1VRWA 4NK5A 3W4KA 2O50A 3JQ6A 4Y67A 3MEQA 3U09A 2X58A 7ADHA 3MOGA 1U3VA 3QHAA 2UUOA 3JQAA 4RDHA 3G0OA 3F6YA 5U1PA 3NEPX 5K6AC 5A5EA 4ZQHA 5C37A 3ZGYA 3KVOA 4YT2A 4PLCA 3KB6A 4MVJG 3NYWA 3OQ6A 5TT0A 2AEFA 2C2XA 1ISJA 2O7SA 2P5YA 3ZU2A 4GKVA 5G0UA 1ZJYA 4CV3A 1Y9AA 3GVCA 5DBFA 3ZWBA 3TPCA 2FZEA 1XGKA 1I36A 1L7EA 3A4VA 1ZZEA 3KYDA 1FJHA 2X9NA 4WCFB 3QWFA 3TZHA 1GEEA 2PK3A 1OOEA 2PZJA 1NVTA 3LT0A 3HADA 1R37A 1UDBA 1KEVA 1LTHR 4G81A 4CM8A 3WGYA 3PDJA 2RH4A 5LDGA 4CMKA 1E92A 1YL5A 3I52A 4B4WA 1R4NA 5CEEA 3PZRA 5H81A 2X0NA 4WLNA 1T1SA 4B3JA 5F21A 4BGVA 1LSUA 5TRTA 3GDGA 4ZQFA 5FI5A 5CDTA 3C24A 2Q50A 1YKFA 3FTPA 1HZJA 2ZCUA 4INAA 1GTMA 2C82A 6ADHA 4YJHA 3GT0A 1KVQA 1NTOA 2NSDA 3I9NA 1P45A 3TZCA 5G4KB 1YB4A 4KTVE 4CMJA 2HLPA 1B26A 4TSKA 3DZGA 3RD5A 3JCZA 4E3ZA 5HS4A 5JDIC 3RASA 2P4QA 4GQAA 3OETA 4KQXA 2XOXA 4P8RA 1UAGA 3ETEA 3TOZA 4AJOA 2A35A 5B1YA 3X2FA 2E48A 4E0BA 1HDZA 2FPIA 4CMGA 4ZRMA 5JDCC 1UH5A 1ZSVA 3UCXA 1WZIA 1SOWA 5TT1A 1V0JA 2I66A 4PG6A 2WD7B 3JYPA 5AXBA 4E5MA 1PZFA 1GY8A 1PSDA 5JMPA 4Q3BA 5IDWA 2CVZA 4D43A 2G1UA 2E6UX 4WNIA 2G17A 4BGUA 4BKRA 4UUMA 1IYZA 2FHSA 2VRBA 4Q3NA 1F14A 3QWIA 1MXHA 4OKNA 3ZNNA 4YYZA 4MIOA 4WOJA 1UZLA 3D4PA 1P1HA 5L4SA 3GHYA 5KVQA 4CMEC 3VPSA 2VHWA 3PP8A 2GN4A 5A06A 1E3IA 2HK7A 1E7WA 3EK2A 3DAFA 3AI3A 1EQUA 1C0KA 4FB5A 4H16A 3D3WB 4AJJA 1RM4A 4NU6A 4CL3A 4E5YA 3W8FA 2H6EA 2GGSA 2IRWA 3PHLA 5CDGA 4YR9A 1SZJG 3IL2A 3JQ8B 3C1TA 2EEZA 3RUEA 1DIHA 1WDKA 1YL7A 3ZZNA 3JD0A 1ZH8A 4PGFA 4ND1A 3U0BA 4HWKA 2VUTA 1IOLA 3GG9A 4PFJA 3Q11A 2H9IA 1HE4A 1BW9B 1DBVO 3P2OA 5JYDA 4TRRA 4J1QA 1M2WA 1EK6A 4BO9A 1NFQA 3B1FA 3JQDA 1GV0A 1A9ZA 2RCYA 3I9LA 3ZH2A 4TZKA 5JO9A 3H9QA 3WJAA 1QYWA 1EVYA 3EUWA 3ORFA 4WLOA 1X0XA 3ZU3A 5IZCA 4NG5A 3GPIA 2FRDA 4IS2A 5T67A 1J49A 5CG1A 3KRTA 2EGGA 4XJSA 1PZGA 4HBGA 1GQYA 3V2UA 3FSRA 3RROA 2NTVA 4FGWA 4MKXA 4S1VA 3ZWNA 1H93A 5TIIA 1PJLA 2ZJ1A 4RF2A 3JYQA 4KZPA 4W6ZA 4EGFA 4L0QA 3PYLA 2DTEA 3BTVA 3INTA 4ZRNA 3K30A 4CM1A 1JU9A 2RIRA 3FD8A 1DPGA 3MJVA 2DPHA 2VZ8A 1OMOA 2VWQA 3G17A 3DZBA 1ZK2A 3KSUA 3SBOA 2JKVA 1PX0A 1C1XB 3F4LA 4BO4A 3RUDA 5BQFA 4R51A 3WQRA 1YBMA 2GSDA 4GX0A 2IZZA 4FD3A 5JSFA 2Q2WA 1ZSYA 2Y1FA 1MC5A 1X0VA 3NJ4A 2WSBA 3F5SA 1ZXBA 4FJ2A 1KERA 3I6QA 3K92A 3UF0A 1JKJA 2TMDA 4OSOA 1LQUA 1PS0A 1X1TA 4UEJA 1CF2O 2VWGA 2HJRA 2HU2A 1YH3A 3GH3A 3PWKA 3WGTA 4TKMA 2I3AA 1KEUA 4BVAA 3JYNA 3WDSA 1QLHA 1ZFNA 4B4UA 4CMBA 4ZN6A 1PGQA 1M66A 3PPIA 1YJ8A 2QX7A 5COAA 2ZATA 1H6BA 2RAFA 3ZWOA 2PKQO 4TZTA 3AU9A 2VT2A 3AFMA 2OHXA 1NPTO 1N1EA 1GCOA 3QP9A 3ZW9A 2EERA 1UP7A 5IFLA 4LSWA 5KJCA 3JQFC 3MJTA 1HYEA 1PZHA 3K5PA 4RPLA 3PIDA 2YHIB 4C4OA 4GWGA 4CMHA 2ZB8A 5EL0A 5FYDA 4BNLA 1M67A 3DOCA 3DZIA 3SLGA 5CEJA 2FN7A 3GHHA 1H9AA 4JJIA 2BLLA 3JQBA 3QV1A 4OO3A 3U3XA 1V3UA 4YEDA 2YY7A 4IZIA 1T2CA 4GX5A 1Y8QB 1PJSA 2I65A 4OH1A 5B37A 1B3BA 4HNHA 3JD3A 4U0KA 2GLXA 4DUPA 4E4YA 1P0FA 4BNGA 4AJ4A 1DIGA 3WFJA 1GADO 3E5MA 5DNAA 1A27A 2EJWA 4XA8A 5GZ1A 5DBGA 3BHIA 3I4FA 1R4MA 3ZHZA 4OQZA 3C7DB 4J1NA 5K6AA 4YXFA 2X22A 4IS3A 1YGYA 4FFMA 2PD3A 5L7YA 1AGNA 4XYEA 3ADPA 1EBUA 4P4GA 4R54A 5KVSA 4CV1A 5KNLA 3PGXA 2DPGA 5F1OA 3OEYA 1EUZA 1O8CA 3B20A 4G5HA 3WB9A 1BVRA 4JBIA 3M2TA 3E82A 1QR6A 3INRA 4M8SA 4DQXA 2CF6A 3RUAA 5KJ6A 4L4SA 3JTMA 2EKLA 3BYZA 4XYMA 4EBFA 1O9BA 3AM4A 1NQ5A 3GR6A 1P1JA 1GAEO 1HXHA 4E13A 4E21A 4BNWA 1QLJA 1ONOA 2DFVA 1C1DB 3R1IA 1HL3A 4RPKA 1PS9A 1YO6A 4L75A 1LLUA 4E2WA 3DBHA 4BQRA 2W2LD 5L9AA 5EIOA 3HFSA 4L4RA 2AEMA 4LK3A 1XA0A 1KY4A 2GRAA 5JFOA 3D1LA 4WOKA 4QSMA 1LLCA 2V6GA 4YJGB 5IN5A 2YFHA 4BNIA 4BNKA 1EE9A 3DFUA 3DDNA 5HA5A 5ENDA 4FOSA 1ZXLA 3D64A 3LK7A 4GX2A 5AVOA 4FW8A 4P4NA 5KTKA 2CDAA 3PI7A 3V2GA 4MDHA 4O63O 4XEHA 1R15A 2BGLA 3VH2A 4PZCA 4D7AA 5JDIA 2PZLA 3DONA 1SEPA 1KS9A 2EKQA 4NBVA 1F0YA 4XGNA 5DP2A 4GLLA 3PZBA 4Y8VA 4FFOA 3H8VA 1P33A 1HSZA 1I3MA 2RBEA 4HXYA 2B4TO 5IDXA 5JDCA 3FWNA 1G0OA 3ZN2A 2IEBA 3JQAB 3DHYA 2JL1A 3S1LA 3NV9A 2VRCA 1LU9A 2IZ1A 4EJ6A 1ULUA 1DC5A 7MDHA 1N7GA 2AA3A 2UV8A 1YOVA 4BO5A 4CODB 5I7SA 3NT2A 3A06A 1LJ8A 3FPCA 3FR7A 4BO7A 3RU9A 3K96A 2Z95A 5C7IO 1B8UA 3TJRA 1UXHA 3HDJA 1UUFA 3TWOA 2BI7A 2EXXA 3IP1A 1GUYA 2PH5A 4IDFA 3O8QA 3KYDB 1DOHA 4UUOA 3PIIA 2NVWA 4AJ2A 4CMEA 1MP0A 2PA3A 1UXGA 5JC8A 4JBHA 1O6ZA 4GX1A 2WYVA 1E6UA 5HRUA 1Y81A 4BHTA 3W4JA 2B83A 1R0KA 1ADBA 2B5WA 2PFGA 3KV3O 3OJEA 4U5QA 4CM8B 2A94A 4WNCA 2EW2A 2HRZA 2NU9A 4TROA 3TFOA 3H3JA 4J1TA 4JIGA 1DRVA 1X7HA 1PJ4A 5A5FA 4E5PA 4F46A 1KOLA 2Y0DA 1DC3A 2JCXA 1PWZA 1I01A 1YDWA 3ON5A 5B12A 4CV0A 1E6WA 3W4IA 1H94A 4YJHB 3L6DA 4ZHSA 3JQGA 4Z9FA 5ICMA 1UR5A 4MOWA 3HE3A 1HDXA 1ID1A 1PGJA 1D4FA 2OOSA 2PH3A 4IDEA 2VWPA 4TMFA 4Z0TA 3RVDA 3S2EA 3ZWXA 3F1KA 4DREA 3VZQA 3EY4A 3U9LA 5KJ1A 2Y99A 3NDRA 2VTEA 3H9JA 1YJQA 4FCCA 3GEMA 1CJCA 2C7GA 3EHEA 4N5LA 1DO8A 5T64A 5KVVA 4DPMA 2WWRA 3QLJA 2GUGA 2YDXA 4M89A 5ER9A 2Q1WA 3JQAD 3B1KA 4BNHA 4EUHA 4XKJA 4LISA 2Q1SA 3KBOA 1N9GA 2CFCA 2TMGA 3F47A 4NFSA 1TEHA 1GU7A 3IQDB 5K9ZA 4FC6A 5IXSA 3CEAA 1PL8A 1PL7A 3K2EA 2GDZA 5C5IA 5ICSA 4JK3A 2Z1NA 2QRKA 3PHHA 2VN8A 2YQ5A 3HJAA 1I2CA 5JCJA 4I5GA 2D5CA 1U8FO 3IUSA 2HKIA 1FDTA 5ES3A 1LDNA 2PTGA 3QWHA 3UFXA 4S3MA 1HYHA 1OBFO 3NJ8A 4BO6A 3GUYA 3GN2A 2J5RA 3M2PA 2W4QA 3AFNA 4R4JA 1HKUA 3AOGA 2I76A 1B7GO 1CIVA 4Y6PA 4YT4A 5MDHA 3SEFA 4CPDA 5BSEA 1W6UA 3BMNA 3EYWA 1KVUA 4MVJH 1VKNA 4A10A 5JNLA 3PWZA 4ID9A 1HDGO 4OXYA 4XR4A 1GL3A 3Q2KA 3RC9A 1GUFA 1LRKA 1I2ZA 3DZFA 1C1XA 4I5FA 4RVSA 2NQ8A 4NBRA 2YHUA 4MO2A 2AMFA 2Z1MA 2I67A 2OXIA 1GZ3A 4FC7A 3UGKA 4IJWA 1PQPA 3JQFA 5DBIA 3UOGA 1LDGA 4QO7A 4HP8A 1XYGA 3GEGA 2YZ7A 1HE3A 3UN1A 2FSVA 1AXGA 2OGUA 1XU7A 2IYPA 4UVDA 3U49A 3KM0A 3L4SO 3E18A 1KETA 3P19A 3UVEA 1J6UA 4KTTE 3ZWAA 3RBVA 2B0JA 3WR5A 3FI9A 5AXAA 4DMMA 2OP1A 3I9JA 1XDWA 5JXWA 2G0TA 2XPCA 4A26A 5ER6A 3BHMA 1Z6ZA 4IDGA 1I3LA 3FBTA 3GAFA 4EZBA 1E7QA 3GGPA 1DRWA 3U4CA 4B7UA 4BMVA 2DKNA 2W90A 5HBRA 3KEOA 1DB3A 5DDIP 1HETA 2HK9A 2HAEA 3LU1A 4CMIA 2GPTA 3FNEA 3OIDA 4GMFA 5AXDA 2AQKA 3H5RA 3MOIA 3MZ0A 1I8TA 1WAMA 1C0IA 4LMPA 3WLEA 4URFA 3PWSA 1A7AA 1PGNA 3QW2A 1N92A 1YS4A 2Q3EA 2X0RA 4RF3A 3GRPA 1RJWA 2QRJA 3CTMA 3PFWO 2DUWA 1D8AA 3JD1A 3RWBA 2Q1TA 3MWDB 1PTJA 1Q0HA 4UVGA 3OEWA 3ZV5A 1U8XX 4CLRB 4BGIA 2DLDA 3VH4A 2DBVO 3ZWMA 3FHLA 3PQFA 2NACA 3E6AA 2GZ2A 3HZZA 1JKFA 4B3HA 3RFTA 1T2AA 2XF8A 3GG2A 4TWRA 2HMTA 4IJKA 5F1KA 3V1TC 4BKUA 3D0OA 1T2FA 3JSAA 3PJFA 3GZNA 5I9NA 3WICA 4DVJA 5BNIA 3KSZO 2ZTVA 5U9CA 1Q7BA 5JPIA 4D41A 2O2YA 4EDFA 1NP3A 1MV8A 5F5LA 2Y0CA 4XDYA 1X1EA 3VDQA 4MVJF 3U4HA 5JO0A 3GDFA 1I10A 3GNQA 4GMGA 4ZQEA 1HDRA 4F6LA 3I83A 3OIGA 4QFCA 2Y0EA 3VVBA 4DGSA 4KDFA 1WDMA 4PRLA 3KYBA 4ZQGA 1RM5A 1MB4A 4U0JA 4ZVVA 3WTBA 2QW8A 1R4MB 3JQEA 1N1GA 1ONPA 2IEDA 2YV3A 3ONFA 4JNKA 1B14A 1ZUD1 3C7CB 4R68A 4ALNA 1N8KA 3HDYA 4LMRA 2BH9A 1TXGA 3SX2A 1KY5A 2H5LA 1NWHA 2HUNA 1YDEA 2GN6A 4P38A 2OBYA 4E5NA 4HX5A 3FWZA 4RF4A 1H5QA 2HMSA 1SEVA 4O5OA 3NUGA 1QV7A 1ZK1A 5DOZA 1JW9B 2I99A 4IM7A 4J16A 3SC6A 1SBYA 5THKA 1TB4A 1W0CA 3QRWA 1BMDA 3R3JA 2OORA 1ZVMA 4JJGA 4ZD6A 5HM8A 2QQ5A 5ILGA 1AUPA 2JCVA 3F5QA 5A02A 1IPEA 3UICA 2EKPA 3BMOA 3PJEA 3A28A 5C3MA 3CZMA 5BNFA 2JHGA 1XHLA 3OIFA 5JBIA 1SAYA 1QYVA 2P5UA 3WWZA 3WXBA 3UH1A 1LNQA 4WGGA 1ISIA 3DBHB 3QQPA 3DB2A 1B3RA 3EDMA 4OSPA 4RDIA 4ZJUA 3E48A 1JTVA 1TA4A 2Q49A 4RJTA 1KVSA 4BKOA 2ZYAA 2P4HX 3FF4A 4DMLA 2FWMX 2X0IA 4IPTA 1IZ9A 1E77A 3F1LA 3QIVA 3DBVO 4DTIA 1SOVA 2PKRA 5AXCA 1E5LA 3KLMX 4LGVA 1O0SA 2J3JA 4WJZA 2J3KA 1YE3A 5L4LA 5KVCA 4R5MA 3OM9A 1ONNA 3PXXA 1Y5MA 4PLWA 1FK8A 1Y8RA 5JLAA 4B7XA 2UDPA 4W82A 1LQTA 4TVOA 1QV6A 5JCXA 5IG2A 1XIVA 2I5PO 3N7UA 1AXEA 1YOVB 1DIAA 3LLVA 3JQ7A 4II2A 4DYVA 3BAZA 4FFLA 5GZ6A 3P5SA 2BGKA 4KUHA 1T2EA 2OL4A 1P1RA 3NRCA 4IXWA 5JYEA 4RPGA 4WPGA 1LLQA 1Y6JA 4HFJA 3H6KA 2VZ9A 2I6TA 3O8QB 4TKLA 5EQFA 2IE0A 1IL0A 4ND4A 4L8VA 4NZ9A 1XWFA 4U8GA 4J43A 2PY6A 4MP8A 2Y67A 5JW6A 1HZZA 1WNTA 1FDVA 3H7AA 4R1UA 1QMGA 2OMEA 4NIMA 1LUAA 2B5VA 5CFZA 1BDMA 4I5DA 3ZV4A 3TZQA 4JROA 2OUIA 4UUPA 3UAGA 4H7PA 1B8VA 1PR3A 3HSKA 3W8DA 3RFXA 2X9VA 1EFKA 1WZEA 3NDJA 4K1LA 2C07A 3GVIA 4NJMA 4EW6A 3GC6A 5EN4A 2DUUA 5L95A 3MJEA 4J9UE 4BO2A 3E9QA 2JD2A 1Z7BA 4AJEA 3JQGB 5I7FA 1EUDA 1DFHA 2GR9A 3DEYX 2CMDA 4HY3A 1V9LA 4KQWA 3VPXA 5JAZA 1K6XA 2WYUA 3OHSX 2D0IA 2YQ4A 4PLTA 3ZNPA 4J4TA 3MJ4A 1I33A 2PGDA 4PN3A 5EQDA 3L4BA 3FNHA 2I3GA 2GASA 2JHFA 1MFZA 1V6AA 4YWJA 3EVNA 4ALLA 1LA2A 3PQDA 3VPFA 1EFLA 3U4IA 3PTZA 4MVJA 2BELA 3KXDA 2P9CA 3AY3A 2O3RA 3NTQA 2V6MA 2UVDA 2P68A 1SO8A 3W8EA 1XCBA 2NVUB 4AJKA 1P9LA 4EJMA 2VRCD 3UXYA 2Z5LA 4D42A 1N9GB 4LSMA 2HMVA 5T5QA 2R00A 1JAYA 1KVRA 3UUWA 3ZV6A 3ITKA 2ZTLA 3CXRA 3RC1A 2NM0A 5L53A 1A5ZA 3ZW8A 4PCVA 2QYTA 2ZYDA 4NJOA 4AL4A 4M55A 2D59A 4CLXA 3I1JA 4FDAA 1E7MA 2Q4EA 1X7GA 3LQFA 3QE3A 4ND2A 4UREA 1GCUA 1R12A 1VM6A 4UVHA 4J91A 1WP4A 4CM4A 1T1RA 5H82A 2NLOA 3JYLA 4NI5A 3E03A 3PYXA 1F06A 3GPDG 1GZ4A 3WYEA 1ARZA 1XSEA 3MWEB 1ADFA 1J4AA 3VAZA 1CRWG 1YB1A 4YVFA 1DLIA 4E33A 1MFPA 3JV7A 4BV9A 1JN0A 5CP8A 3PYMA 1DAPA 4OXKA 1ZBQA 3BMNB 5JC1A 3RUHA 4Z3DA 2YW9A 4E31A 1VC2A 3CMCO 5DF1A 4D44A 3TSCA 1DJQA 1TI7A 2AHRA 3GDOA 3ZWCA 2EHDA 3OICA 4YJFA 3QWBA 4RQUA 1GQ2A 1H2HA 2QIOA 4LVUA 1XG5A 1SB8A 1GD1O 3IS3A 5KWEA 3U62A 3RFVA 2VHXA 3DO5A 5GZ3A 2X1HA 4MKRA 1DEHA 3OQ1A 3OSUA 5K0ZA 1ENYA 1NFFA 2DBRA 3LF1A 4IINA 4Z9YA 5GMOA 3DHEA 1GYPA 1EVZA 3P2YA 5I8WA 1T2DA 1Z7EA 4CM6A 1OAAA 2GO1A 2H63A 4OM8A 5H83A 2X5KO 5TSDA 4I9NA 2XXBA 4L76A 3AI1A 4P4LA 4GAEA 3SJ7A 5JAMA 4HFRA 2F1KA 3TQHA 4HADA 2C0CA 2X5OA 3DL2A 2VT3A 4N54A 1QG6A 4W9NC 2C59A 1JVBA 4BNTA 1UP6A 3CSDA 5G0VA 2D4AA 2WTBA 2ZQYA 3MTJA 1ZK0A 1D7OA 3RUCA 3VHRA 2GNAA 4PRKA 2Y1CA 3ONEA 4AICA 4Q3DA 1ZEMA 4UVEA 3PHJA 4CLRA 1HLDA 1V3VA 2X23A 2NNLD 1ZK4A 2FPGA 3LSYA 3TL3A 2BHLA 3ZU5A 4CMIB 5KIAA 2VYVA 2D1YA 5JCJD 4G2NA 2X9GA 1H6DA 1BXKA 1VKOA 2B4RO 3H9GA 5TC4A 1A72A 1XU9A 3DWFA 1B2LA 1EEHA 3ULKA 3WQQA 4JGBA 2BF7A 4R9SA 2QZZA 3EW7A 5IZ4A 2P9GA 2PLAA 1VPDA 4LVCA 1BXZA 1L1FA 4IDAA 4OHUA 3PLNA 2FZWA 3I6IA 5LC1A 3HN2A 4XJTA 2DM6A 2C5EA 4UAGA 1KYQA 1X15A 3M1AA 4IQ0A 3LC7O 1DC4A 4IJVA 2ZB3A 3NGXA 4J49A 1OC2A 1YB5A 4A03A 4OOEA 4GLOA 4LW8A 2VHZA 4YTEA 4BMNA 2OO5A 4GWKA 1ZMTA 3PEFA 3QVSA 1YQXA 3D5TA 3JQ9C 4PVCA 4D46A 1BXGA 4RVGA 3NX4A 3L9XA 3VOSA 1NFRA 4BKQA 3G1UA 3FTNA 1LBEA 5HWSA 4ND3A 1EVIA 2Y1DA 4MP3A 3GZNB 2HMUA 4BV8A 1QSGA 4MVJI 1ISFA 5DP1A 4PG4A 3OA0A 4JP2A 3T4XA 2VYNA 4BNJA 3JD2A 4CR6A 2FY8A 3A14A 1F8FA 1KEWA 3DOJA 2CF5A 4CLHA 4J2HA 5I8ZA 3ONDA 2UUPA 9LDTA 1E3LA 3KSDO 4NHEA 2EF1A 3BXXA 4FFNA 2C2YA 4XWYA 3T7EA 3AUAA 2HQ1A 1GPJA 4KDEA 4NK4A 4R1NA 4AG3A 1VE9A 4K6CA 3DAPA 3ZWPA 1NAIA 3VZSA 4BNUA 4D79A 3WIEA 3WGOA 5KJFA 2EJVA 4PZDA 1G0NA 1U4SA 2CVOA 3KYCA 3P7MA 4YRAA 4Y6RA 1C3VA 1I30A 1QXSA 1ZCJA 4I8XA 3GVXA 2JFGA 2O48X 1TT5B 2CDCA 1NHWA 3ROQA 3STHA 2YV2A 3R0IA 4XZ3A 3H65A 1JKIA 2CSUA 3OJ0A 4ZA2A 4NNJA 4KP7A 3ZHXA 4B8ZA 1W8DA 2VTDA 3CH6A 3NGLA 5BSHA 4OL9A 4A2CA 5DULA 1R16A 3G79A 5IF3A 3C8MA 1EZ4A 4F6CA 4XQEA 4AFNA 2EG9A 4FQ8A 4MJLA 1CETA 1I24A 1MXFA 3O26A 3Q1LA 4CR7A 3KHUA 2VOEA 3BMOB 1FDSA 5AYVA 4BMSA 4DIOA 1CQJA 3GRKA 4CJXA 5I9MA 5T8KC 2J5QA 4Y6SA 4KUEA 3RCBA 5CDYA 2V6FA 1LC0A 5LCXA 4ZQBA 4R3WA 4E32A 5A9TA 4K28A 3E1KA 2DT5A 3T7CA 4WLUA 4CLEA 4DQUA 2UAGA 1DHTA 3OBBA 4QTZA 1LDMA 2X6TA 5EMHA 4DPLA 3HB5X 2C29D 1EK5A 1P1FA 4FN4A 3TOXA 1VJTA 1PJ2A 1M6WA 3IKTA 4RQTA 2ILTA 1CWUA 1ZW1A 2AXQA 4I5EA 4XYLA 1F8GA 5LDHA 3LVFO 2DVMA 2NUAA 4UULA 4BGEA 4R1SA 2FPPA 3H3FA 1E1KA 1QYXA 1Y8RB 5TNXA 1KVTA 3DZKA 3CKYA 1HSOA 4QX6A 5F5NA 3GLQA 1E6EA 1UZNA 3OMLA 1YBVA 1ZK3A 4ITUA 3JQ7B 1WMAA 1HT0A 5DCUA 1P1IA 3AY7A 3RC2A 4GKBA 4A27A 3NAQA 2E49A 4N5NA 3OJOA 4RV9A 4CM5A 2HJSA 3Q9UA 4D3SA 3GOHA 4CR8A 4DRYA 1U5CA 5FI3A 4E2YA 3ROPA 1Y9EA 3I3OA 2OZPA 5IXYA 1ORRA 5F3RA 4NPCA 4Z9XA 4GPD1 3OF2A 2GN8A 2Q2QA 5C7LO 4WUVA 1UXIA 3V8BA 1JWBB 4J6FA 3GVHA 1DXYA 5A03A 4RZHA 2B69A 2J3IA 3WBBA 2NVUA 5I9LA 4OIMA 3ITDA 4CM3A 2QG4A 3ROKA 5CAEA 2BGMA 3TNLA 3GZ4A 3R6DA 4XB2A 5DT9A 4NJMB 4KWIA 3CZRA 3V1UA 3BZUA 4LRSB 5COBA 3VDRA 4XD2A 2J3HA 1GYQA 1U7HA 4AJNA 5EPOA 3OA2A 3TFQA 1DIBA 4BIIA 2Y1OA 3HN7A 3WIDA 5L4NA 1Q1NA 1NX6A 1FDWA 3LZ6A 1S6YA 2LDXA 4IMPA 4Q3AA 2JAHA 4HKTA 4II3A 3VPGA 4FJ0A 4ZICA 3PGJA 2HMWA 2ZB4A 2D2IA 1YL6A 1VSVA 2VUSA 4FFRA 3ZHBA 1MLDA 5COQA 3QY9A 1ML3A 2W2KA 2NVBA 4MVJP 2IXAA 3RAJA 3VKVA 1NQTA 2J5KA 4Y9DA 3CMMA 3WGZA 5TLSA 1PJQA 3ZI0A 1H0KA 3U5TA 4RCVA 2FR0A 1I2BA 4NQZA 4W9NA 2AQ8A 3KUXA 3X2EA 2NU8A 4AJLA 2E4AA 4QXMA 1U3TA 2O3JA 1AHHA 2Q2VA 4M49A 3RJ5A 1P74A 5FEUA 4YA6A 3LC2O 3CUKA 8ADHA 3OECA 2NTJA 4L9RA 3S2FA 4PG5A 2XAAA 1LDBA 3ZCXA 5L7WA 4WECA 4CM4B 4PVDA 1WXDA 4YAJA 4J7XA 2LDBA 5TJ9A 1IHYA 5G0SA 3DBLB 1PZEA 4ND5A 3PLRA 4WCDA 4D45A 2Y1EA 4Q3CA 2FMUA 2R2GA 4MVJM 1GZ6A 3Q2IA 1I32A 2JJYA 4M54A 5A3VA 3K31A 1A7KA 1E3WB 3N74A 5A9SA 2YV1A 1FF9A 2O4CA 3FRJA 3KLPX 1JAXA 4YJFB 3IJRA 2P91A 3DMTC 4E2XA 2WE8A 1YWGO 3S8MA 4HUJA 2CY0A 1U2DA 5AOVA 1SPXA 2GYYA 3WNVA 1KIFA 3JQ9A 1NQAO 2FSSA 4BL5A 3O4RA 1XQ6A 4J1SA 3ICPA 4B7CA 1SMKA 2NWQA 1T4DA 2D8AA 1T24A 1D1TA 4E5KA 5JY1A 1IZ0A 1E7SA 4GVLA 4TQGA 5KJEA 1O94A 3NT4A 4MVJD 3WWYA 1MG5A 4TRMA 4CLDA 1HF3A 3RU7A 3GMSA 2O4UX 2PD4A 1LC3A 4IZHA 3EMKA 3WJ7A 1YVEI 6LDHA 1JWAB 3HG7A 3WGGA 1WVGA 3ZWVA 5GY7A 4H3VA 3NTRA 1YXMA 4QEDA 3WBFA 2CUKA 1H6AA 3SJUA 4EYEA 1GV1A 5BSFA 2ET6A 2FR1A 2X5JO 3H5NA 3OP4A 2P2SA 3F46A 5HTOA 3UHAA 3EZLA 5T57A 5ENVA 1QRRA 3IOYA 4Y98A 1IB6A 4LCJA 3GFBA 5L7TA 2PZMA 3KO8A 3ST7A 3S2IA 4RGBA 3K9QO 3E8XA 3GN1A 2RHCA 5B4UA 3VZRA 5B4TA 3L0DA 3QVWA 4Z6KA 1K2WA 4YAEA 4JCOA 1AN9A 1BDBA 1EE2A 2AQHA 1LDEA 5JMWA 2FP4A 1ULSA 4LCEA 1PIWA 3AUUA 3DZHA 1IE3A 1NBOA 1GYRA 3BMCA 2VQ3A 1NPDA 1Y5RA 2I9PA 2YYYA 4AJHA 1MX3A 3Q6IA 1OFGA 2PD6A 5KKAA 4FFPA 2X4GA 3INGA 4CM9A 1ISHA 4DXHA 1LX6A 1DIRA 2B37A 4E2ZA 2HSDA 2W8ZA 3MJSA 5G2OA 1C0PA 3WS7A 4RO0A 1BXGB 3AUTA 2VWHA 3A1NA 4R9RA 1N7HA 3QA9A 2A92A 1LEHA 1JVSA 3G1TA 4GI2A 3GY0A 1NR7A 2Y05A 4BNNA 2O2SA 3PVZA 1R66A 2DQ4A 2C5AA 1BWSA 1TT5A 2ZB7A 3CINA 4D3DA 8LDHA 1Z74A 1ZEJA 1FDUA 1N5DA 3OJLA 3DAGA 2H1SA 1XLTA 3DTYA 1PU2A 3DOOA 3GF4A 4F45A 1M75A 3IAHA 1QYCA 1F17A 3I4CA 3K2BA 2QZ9A 3Q9NA 4PG7A 3WYBA 1PGPA 1ADGA 2GD1O 2EWMA 4D0RA 4BUCA 2ZTMA 1Q0QA 1YRLA 1AE1A 4ESOA 3ADOA 2WDZA 1Q7CA 2B36A
chains in the Genus database with same CATH superfamily
3QF4A 3ORHA 4L0CA 1QGDA 4RORA 3WX0A 5FIUA 1MNAA 1QOZA 2FQQA 3DP7A 3KYCB 1UBFA 1IC6A 3PKIA 4LC0A 2FOLA 1P44A 2GEDA 4Q34A 4O3FA 4L6CA 3RS7A 3TE7A 1ENZA 2FR8A 4ZO6A 3SYMA 1UFKA 4YV2A 3TF5A 1G7TA 2GPWA 2QRGA 3KUCA 4N18A 2Q2OA 3UUGA 1RACA 4A73A 1AQJA 1CY8A 1ZM2A 2J48A 4KQ9A 4YCAA 1WTCA 2WUDA 4UAUA 1K3TA 3ICOA 3C3XA 1VIAA 1A96A 3LBIA 1EFCA 3TTVA 3V5NA 3IUQA 3WHKA 1T0BA 1U1IA 1BU5A 3LXMA 3BFJA 5GV8A 1AKRA 2WRZA 3CNOA 3IKVA 4MUNA 4P53A 5AKJA 5JQGF 5DNVA 3BF8A 3KAJA 4G65A 1L7QA 4GPBA 4TWIA 1CQJB 4DJFC 1KK3A 3ADDA 3U7RA 2DTDA 4GGPA 1L5RA 2A86A 1M2GA 4FT4A 1TC2A 2XVAA 4Q47A 3BXFA 3ZVLA 3L93A 2JAPA 3G88A 4PTZA 2VR1A 1P75A 5DTJA 1WW8A 3LE8A 1X6VA 4HAZA 4JVLA 3A4MA 3ADBA 1KI8A 2JGIA 4U6QA 2E21A 1Z4IA 4PGHA 2G9VA 3DV0B 4MDYA 4XYGA 4YCBA 4UD2A 5ALOA 3RJMA 1TD1A 3RVKA 2DEUA 3WP0A 2TSYB 3O75A 4JJ8A 1X7ZB 3T4PA 2XJ4A 2P35A 1MV5A 3U6KA 1U9JA 2I1WA 4XIGS 4YK7A 3IJPA 1C8KA 2VP3A 3KCNA 3AEXA 3FOBA 3LUHA 5D3KA 5AH0A 3SXPA 2XMGA 2BSQA 1XRMA 2O0LA 1Z0AA 4PIPA 5KKCA 1QIFA 2C84A 1R8SA 1QE3A 3B3GA 4BNXA 2OBMA 3TECE 1MIHA 2ZJ3A 3F49S 3RRBA 3GGDA 2UYOA 4TLLB 2GAIA 3AK4A 2CFOA 3IR5A 5AKYA 1M7GA 1YU9A 1Z22A 1UJMA 3GAZA 5DNEA 3QTTA 2IYWA 1JLLA 1XE3A 2VFAA 4KPFC 4BMDA 4MA0A 4IDCA 5BP7A 1XPUA 2PGLA 2XUIA 2X86A 3DFFA 1X13A 4M9QA 5I9SA 1JIQA 1IHOA 1N32B 1U8TA 2FUNB 2PGIA 2PKQP 2QUAA 1VECA 2WYOA 1K3UB 3C74A 3H1PA 3O31A 3NANA 1RZ3A 3Q41A 1W1UA 1YUBA 2OKCA 3NBUA 4G0VA 4B74A 1M0EA 3H9CA 4LJ7A 4C3UA 2R8EA 2ZGVA 2ODBA 2O8DB 3UATA 4O4HA 5JS6A 4UFPA 4BXOB 4R1TA 1RRCA 3KAKA 2AIRA 4HQRA 2MSLA 1K2VN 3ICVA 4Q9NA 1GN9A 2JBAB 2PUWA 2ZJ0A 3ENZA 3KP1A 3PD7A 1KI4A 1ZH6A 4OF4A 4I3GA 2QG9A 2H7XA 4L9SA 3TDMA 3LPNA 2WZQA 4D80A 2G1JA 4ZHQA 1YSCA 2A5JA 4EMBA 2JJ1D 3PQEA 2GHTA 2ZJ2A 4N0PA 4RJIA 4FYYA 4D8UA 4B79A 4IQ8A 5CAEB 2I6GA 1RJ9A 4BOYA 1F0PA 1S0UA 2FHPA 3FDXA 5B57C 3OESA 2BI8A 3U3KA 1BROA 3DEIA 4MZDA 3D3EA 1ODSA 1P0CA 4CDRA 4D1YA 4WN9B 2A8YA 5SYAA 1ICEA 2L69A 1O87A 2OCYC 5I7EA 3GJ8A 3VI3B 2JLVA 1Y33E 2NXCA 2PMEA 3W3AA 4HQLA 2YMPA 3OQIA 3KETA 3KE9A 4WESB 1MRSA 1U28C 2Q5LA 2QN8A 3K1AA 1EB8A 3NUQA 3PXDA 1QIHA 1G8MA 4XWKA 1W581 4RADA 4E88A 2A78A 2C8KA 4R8VA 1RR6A 3H97A 2QLMA 4CKBA 1FP1D 2OHGA 4JT9A 2IBSA 1Q83A 4ZRDA 1AVTA 3W90A 4LOIA 2IV3A 1G55A 5AQ1A 2OYSA 1QQ5A 4GS5A 4IKPA 1KO4A 3C6QA 1J22A 2QPTA 2WM8A 2BKLA 1L4LA 1DCKA 3QU9A 5ELXA 1L0BA 4B7ZA 2EX1A 3KEQA 2X0JA 3SZUA 1RNLA 2PWYA 3F5DA 4CN9A 1J07A 1JFFB 5L51A 3IVMA 4IQGA 1YB2A 3L7NA 1I7PA 1K8RA 4IMRA 1NW3A 1WX1A 2YJ3A 3T95A 1AD2A 5LBUA 2G9UA 4PZZA 1Z4MA 3IE0A 5EJMA 1CUBA 2BRUC 3A26A 4Z7OB 4BNDB 2C4VA 3BHJA 1E3WA 2Y93A 1Z73A 3AEYA 3P8ZA 2IS6A 1ZNQO 1I1QB 3L77A 3IMKA 2EU8A 9ATCA 3RT1A 4QPPA 1NW9B 1Y80A 2WV7A 3G0CA 1OSNA 5LPNA 3R5SA 2PJDA 4F72A 5K20A 2ICAA 1YA8A 4WXEA 1W44A 3PBKA 4TL6A 1MC4A 1MUUA 2ZUUA 1II9A 2CXQA 1ZLYA 3SVZA 1K0UA 1J5PA 4QOSA 4XDHA 3PEYA 1F3LA 3AETA 2RGUA 4QULA 4WEQA 2CCKA 3OOHA 4AW9A 2C7PA 1H8ED 1RAFA 3OZIA 4TV8F 2R4TA 4CN8A 3VR4D 1ZRHA 5JNSA 2A9OA 4G67A 1BIFA 4KVZA 2QAGA 4C1BA 3V3KA 1BGXT 4OJYA 3M1YA 4WK6A 3LV8A 4MLZA 2I0FA 1U0JA 3A9CA 1JDPA 3L1HA 1UDWA 3OQBA 4LA4A 1UK7A 2HLDA 4DMUB 1IVNA 3ZYCA 2ZQZA 2D74A 3KNZA 3L8CA 4ZGBA 4LBYA 2F48A 4UVIA 2HHJA 2RJ3A 2ZYUX 3E5RA 4CV2A 4NMHA 1UJBA 4P5EA 3GP5A 3UCFA 1OX4A 4E30A 2PX3A 2SICE 2Y9MB 4TLEA 4YPVA 3QI7A 4EKGA 2C54A 4BNFA 4YR7A 1NURA 1SUIA 1IN4A 4ZANA 2A57A 3LCCA 3EPHA 3OUTA 4GI3A 4DQVA 3I37X 5JY6A 3HXOA 3V1NA 2R6AA 3OFSA 2H9AA 5DSXA 4AIRA 4F3RA 4PZEA 4XVCA 3KLNA 1H23A 2QHXA 3VTZA 5DZSA 3TQSA 4QNMA 4X85A 4DWWA 3GLFA 3PUJA 1E2QA 3ZIAD 2W2OA 1PL6A 1C0LA 1T4BA 1BHSA 2M2IA 1L4KA 4EUNA 4RPJA 1DV1A 2QTTA 1G5TA 3QBVA 1FB5A 3E58A 3RI3A 5CLLA 1KI6B 4RPHA 2XBLA 4ZZ0A 2V8BA 5AP9A 4OX9Y 4YRKA 1CY1A 2GKGA 2B1QA 1M2JA 5JVDB 3ZCPA 4HWOA 1IJBA 2FW6A 2JD1A 3TM4A 2OHHA 3AJRA 5FI1B 1P2TA 2JFYA 3L8HA 1ZHFA 4QTTB 2PV0A 1ISSA 2RDMA 5AHWA 5L3ZA 1TVEA 3UJ7A 1XCOA 3ZJYA 4P81A 2OCPA 4C3OB 2H0RA 3BB4A 3L6RA 3OPXA 3W6ZA 2Z04A 3K9BA 4CTKA 3EVTA 3LQRA 3COYA 1EUCB 1OXUA 3MSCA 4OSEA 1EDZA 1Y3DE 2DBQA 5FORA 2LKCA 4PLPA 2XKBA 1D7AA 4FX2A 2EQBA 4JB8A 2WR8A 5ALSA 1ZKDA 4ZO8A 2A9QA 3HA3A 3HL4A 1CUAA 4FOLA 1J21A 2Q6LA 2P1ZA 3UXHA 4HQOA 2QKYA 3QEOA 1BVUA 1KJJA 5BMVB 1E9BA 4C7OB 2B2XA 4CKEA 1IPFA 3TSWA 3UEOA 5B3LA 3VKWA 2WKWA 2WTAA 1C2YA 4HRAA 1GDHA 1CZLA 1NQOA 5BT9A 3QMWA 4MR7B 1RAEA 3G9XA 4PYNA 3EAGA 1XRSB 1V6SA 3LWZA 5AUPB 5CXQA 2WHEA 1AUXA 2Y68A 3CJQA 2I7XA 4IHQA 4Q00A 1VKJA 1V8BA 5EXPA 2ZJZA 4WASA 2J31A 4XX0A 1F4VA 1IIBA 2OFFA 4YFYA 4I9UA 3HZRA 4YGXB 4U3JB 3ORQA 4REQA 1QWSA 1WDTA 3D2CA 4IVRA 4R3UC 1CLUA 3KZVA 2H08A 5AM0A 2WJIA 4ZAGA 4C5BA 4Q0MA 4RSGA 4XYBA 3SC4A 3OMXA 3U26A 4MPTA 4EHHA 3STUA 4BZXA 5CG2A 2HYIC 5D51S 3RTAA 5SY6A 1RWOA 3ICCA 4KYIB 4X6XA 5JAIA 3PXUA 3TJMA 2A4MA 4ZT3A 3JWGA 3LLSA 2IIVA 4GI7A 1VXRA 5KOIA 1K6JA 3PFFA 4X20B 2CJPA 2EKBA 2GF2A 3OFKA 2PRKA 3DUWA 1SHLA 4GBGA 3EN0A 5KAPA 1IMJA 2O8EB 5E7IA 2I7CA 2CJFA 1D2MA 2M9MA 1GVNB 4JJFA 5LR6A 3P45A 2D2FA 2GCGA 2VNKA 4XRRA 3IDOA 4UAJA 3S28A 5BR8B 4MJ3A 1LQ2A 2WWXA 3N0RA 1IULA 1ZW6A 4GICA 5LMCA 2PG3A 3DS8A 1X9GA 1B1CA 3VYSB 2VDWB 1ZAKA 1NMEA 1NBEA 2EIHA 2IYUA 3I0NA 2RGNA 1CD5A 3NIBA 4RWZA 4WCFA 3I9OA 1WMDA 3FY4A 3IIEA 3KXIA 2IY9A 2WWWA 2CNBA 2O7RA 4A8JA 4AJPA 2VSFA 4D5EA 3HKBA 4CLOB 1PR9A 4V3CA 2R3SA 3HS3A 3BFPA 1VL6A 4MIEA 4OJTA 3A9SA 1OPXA 5DBOA 3VNVA 4UEWA 2R66A 4Y2YA 3PXGA 4TV8A 4YCSA 1FA9A 1CJVC 2PRYA 3ENWA 1Z8FA 4RVFA 4IHKA 3HJUA 4RHXA 3V2HA 3TEFA 3CX4A 4FIDA 1Q0SA 4IWNA 1F60A 4P93A 5DN6D 1V41E 4D25A 3I9V6 1VIMA 5IRCD 3EIHA 4B0PA 2FU5C 3RS9A 2QBYB 4RIFA 4UUNA 3WGNA 4UOEA 5C9ZA 2R8XA 3P52A 1Q77A 4KUGA 1RWPA 1JDJA 5EWLB 2HLNA 4WY5A 5FBRB 5FTWA 4M1QA 2AOWA 1XQ1A 3O2JA 3DKKA 2NXEA 3V2IA 2BTOA 3HXPA 2BFOA 5DW0A 4BQPA 3A9WA 1J2YA 3CE6A 3ESQA 2O1SA 1KK2A 3FBGA 4EYKA 1G38A 3C5VA 3M7IA 3GK3A 3KCQA 3W79A 3GYGA 1COWD 3GJZA 1RQNA 2IDZA 2VRNA 1XZ8A 2OBXA 4HL6A 4RFSB 4N03A 3B6JA 3SZOA 2ZWAA 2XTNA 3E9NA 4DWOA 4JFAA 3D6UA 4D99A 4P0QB 4TYYA 3G23A 4KBYA 1CTQA 2XZOA 1I80A 1UKEA 1UXJA 3PRJA 3DFIA 1UJ4A 1Y4SA 1YRQA 2QMHA 2QTWB 1I6MA 3WOVA 2V7GA 3IEXA 4NPAA 7ABPA 1QRDA 4DV1B 2R8OA 3LZCA 2YOHA 3BJIC 3E70C 2FI1A 4N40A 2FWPA 4HYQA 2V7PA 5AK3A 4EA8A 1ESMA 3PR2B 1TT7A 5JPCA 3AUYA 3QEBZ 1YAJA 3EZYA 1XPRA 1ZAYA 5DHTA 2IYAA 3LCJA 5FJIA 4YIHA 2C7VA 2JLCA 3QPVA 1KKUA 2QM0A 2XT0A 2R9VA 3U1TA 5ITSA 1E66A 1WD5A 4UARA 3ROTA 2QRLA 3RUFA 2G09A 4IDNA 3BQ9A 3U56A 3WFIA 1A50B 4POAA 4ETNA 1I0ZA 4JIMA 5CHEA 2I7TA 2FCRA 2PH7A 1ODKA 1WDLA 5DGIA 4ZALA 1E9AA 4WQMA 1KH3A 1NXTA 3ZVRA 4F3TA 2XT9A 7REQA 4UUQA 2WWFA 3U81A 2ZJFA 3QU4A 3NYRA 1O6GA 4OQPA 4DZZA 1AGYA 3VPCA 2YC2C 2NZXA 2ID8A 3JQ8A 1E2PA 4HUQB 5HCUA 4BAZA 5EINA 3EC7A 3BMQB 1X8JA 3W2IA 3V7FA 4Z4HA 2H4WA 5IJZA 2O6LA 3VSBA 2W2NA 4CCYB 1UJ6A 2LPMA 5FO0A 3W9UA 4LNHA 5INTA 1Z63A 4ARZB 4ZOAA 4L0MA 1L7PA 3FYTA 2CNWD 3MOSA 3OCWA 2G5CA 4LHVA 5DGXA 2CKMA 2WE7A 1E0DA 1X8LA 2YWRA 1G21E 3RC7A 4F4IA 4TPKA 3DPIA 3N8GA 2BMVA 2ZDHA 5HKOA 1WS6A 3PJDA 1VZ3A 3VH1A 3FOWA 3LL4A 5EHGA 3ZWKA 3ESRA 1QONA 4BKPA 4DOMA 3A9RA 1C14A 2GEKA 3EXG1 2X8LA 3G8BA 4LDRA 4DIBA 1Z5UA 4WXRA 2QMZA 2QTMA 2W43A 3HGTA 4X71A 1WLYA 1OYVA 2FW0A 4PN7A 5CA0B 2WJAA 1PJTA 1NYTA 3BREA 4DLXA 1UDAA 1C9MA 3JWPA 5A3JA 3C4JA 1BKDR 4ZVSA 1RKXA 3G2KA 4PXAA 3RSHA 1GGEA 5IBPA 4NENB 3F6SA 3UWPA 2J5XA 1KYZA 1UBCA 2P9JA 3AR7A 3DT9A 4O2RA 5EHQA 4GVXA 3C1AA 2C8LA 1JA9A 3UAWA 4NE9A 3ZHYA 4RV5A 3TL6A 1YB7A 5I7VA 4GXQA 1E64A 3GIWA 4B33A 4F60A 1ZBDA 1N2CA 3ORRA 1JLMA 1JGTA 2ZSFA 3TR6A 3W6UA 5KTMA 1CXZA 1U0TA 2ZYGA 3GA5A 2VHCA 4HTFA 4RZXA 3RFFA 2Q6IA 4CQMD 1SC4A 4MKGA 2BTQA 1NYRA 2HBQA 2C5GA 1Z4KA 1E3JA 3HHPA 4G0PA 1H0RA 2Y4NA 4KPUB 3C8HA 1GA4A 3HFRA 4BFVA 721PA 4DLLA 5JEEA 1GTVA 3VXKA 3UOAB 1DIOB 3RABA 2YW2A 1P9OA 2HSEA 5B6PA 3DNMA 3NVMB 1CQIB 3C70A 5CT6A 1UWLA 3C3MA 1X7YA 3W5DA 2G3YA 2X7HA 3EVGA 3SFVA 3L1VA 5BRAA 4AJ1A 3IOMA 2W6ID 3O2SB 1VJ0A 4ALKA 5BQOA 3B5JA 1UM8A 2OQVA 5FLKA 4B8WA 3MWFA 1OWNA 3ML1A 1YI1A 4ZVKA 4IJ5A 5CYOA 3D2LA 2F8MA 4GL4A 2Q3CA 1ZD1A 1BTOA 1VPWA 2MYTA 2FEAA 3AHFA 4XB1A 5TF4A 3KQLA 1NBMA 2FFBA 5I47A 1FL9A 1RIIA 3T61A 3MGBA 1LPSA 3CZAA 3NFYA 3GXBA 1VJDA 2PSJA 2VXBA 5IDYA 1LXCA 3SZGA 3VSAA 5KHLB 1KEEB 5EMKA 4CYMA 2AVNA 1U2EA 1Z0UA 5BQ5A 4M1EA 1WW2A 2PX8A 2C5BA 3FB1A 4BNVA 5M2QA 4BLWA 1L7AA 4XGIA 1G4UR 4BLRA 2PE5A 1ORTA 5HQ3A 2IODA 1F2UB 1Q3TA 3HYNA 1Z6YA 3L6EA 4GHWA 1YMQA 4P4TA 3FPFA 4LIPD 4QU8A 1WU7A 1OAOC 2AYXA 3EA4A 2YHIA 3OUUA 3QFTA 1LFAA 4NAVA 1WO8A 1C41A 1D2CA 3W5UA 1E7YA 1P2UA 4P32A 3CHYA 2Y76A 2XUKA 1SOAA 5JATA 5AESA 2ZZNA 1QORA 3JPYA 4JFRA 1QR2A 3HRIA 3JVIA 3NTOA 4N5MA 3SKYA 4C14A 4CTNA 1IK6A 4ZI2A 1TLTA 2OCDA 3OZVA 3DLTA 4IIVA 4EEZA 4DR5B 2ZSIA 2C7BA 1DXOA 2VTKA 2DY0A 3EASA 1FQKA 1DC6A 1JQJC 3HR8A 2M32A 3Q8XB 4R16A 1CJBA 2Q1UA 5KOJB 2ILVA 1MNQA 1JLHA 4NBUA 2V4UA 3RB8A 3TLGA 4ZODA 1XZLA 4JC5A 1MENA 4P83A 3ESAA 3DTTA 3N2GB 3WGQA 3AZOA 2Y8EA 4LJAA 4DIMA 2CLCX 3LGXA 2NQTA 1K06A 3QVTA 1BHQ1 1UBTS 4X54A 3WL8A 3S8YA 1F48A 5JH7F 1BX1A 4AKIA 5G53C 3L7JA 1E1YA 3QMMA 4DBLC 1ZR2A 1RPZA 3H2SA 1S02A 2AQIA 2WP0A 1E7RA 1M0WA 4R0MA 1DQZA 4YT8A 3W2FA 4UJ3A 5TS3A 4YAIA 2C20A 2NUTB 2EZ4A 1TZJA 2JI4A 4PNEA 2WSYB 1KRWA 2E6KA 3AY6A 4FOOA 2DC1A 4J9VA 5DMHA 4EABA 1P0MA 4JB3A 3RRFA 5FL3A 1SOUA 2WM3A 1BZYA 1PFVA 2Y1WA 3U4DA 2IX9A 3BTUA 5ANRB 4YV1A 1IHXA 1ZMOA 1RPAA 2OZLB 2PS0A 1BMTA 3FYCA 3M34A 4FVTA 5TXGA 2FQXA 2GVDC 4UNPA 6CHYA 4KR3A 1PZNA 5FPHA 3PLAE 3ELBA 3KAPA 1GRRA 1D4AA 1WIWA 3ANMA 4IBOA 3ZIDA 1OWLA 3WKAA 4C6RA 2NTNA 4H15A 4YQZA 3P9SA 2DR3A 3BN3A 1H85A 1XF9A 2BSXA 3DDSA 3MINA 4ZT4A 3U31A 4KXQA 4J7CA 1ESDA 5BV8A 1QIJA 5FPQA 4DBZA 2M1XA 4H60A 4ALIA 4PSVA 2AMYA 2J5BA 4URVR 3TB4A 5E95A 4U7DA 3TOVA 4PS1A 2J6CA 1LTQA 1OYOA 2QL5A 1EDBA 4FE4A 2IUFA 2O05A 4G84A 4JH0A 3M1LA 4ZCLA 3TMAA 3TL2A 3C41J 3V46A 4B45A 2XW6A 3ECSA 4MW9A 4DLAA 3CNNA 2PJRA 2VXOA 4U7WA 4EG1A 3GEDA 2SCUA 3TCNA 2P2YA 4X63A 3ZNQA 2H31A 4YI3A 3T15A 4FMDF 4L3WA 1VRWA 1HEYA 2DWPA 2O8NA 3W4KA 2O50A 4I4NA 4BQIA 3U7IA 4H08A 4ZZ3A 1T1IA 2BZ0A 1HT2E 2VDVE 2ZIVB 4LMBA 1SD1A 1F5NA 7ADHA 1ZIXA 2PPLA 3QHAA 2UUOA 1G8PA 4FFBA 5H3LA 2XHZA 1ZY2A 2IKSA 4PR3A 4G4JA 3AJAA 5BRJA 5ENZA 5K6AC 4L5AA 5A5EA 1AX9A 1AIPA 1DAKA 1JILA 1YFKA 4FYXA 4LY6A 4Y6QA 5C37A 1QTRA 1G18A 1ZZGA 2SHKA 2VJQA 3E81A 1TAQA 2BAGA 3LBHA 1JALA 3LXRA 2F67A 2HF7A 2YYZA 4RTJA 3NYWA 2WOJA 1IN1A 1MH1A 2WUEA 2IF2A 1KK1A 1FRZA 3S70A 4HLCA 1HYBA 3Q6NA 2P5YA 2BFBA 3ZU2A 4GKVA 2W6JA 5IJ0B 1NLZA 3F71A 3GJ5A 5DBFA 3DOFA 1P1CA 3PF9A 3TIIA 1ZH0A 3A1SA 1L7EA 3DDWA 1ZZEA 3KYDA 4B2IA 2NMVA 1AKTA 2VAVA 5GGXA 1USIA 3ZQJA 1SC1A 2BM0A 4WNAA 2NU7B 4CDMA 3ZOZA 3FMIA 3TQTA 1HEIA 4HNVA 1C30A 3EVFA 4NRDA 2IL1A 2AN1A 4EY4A 4FW9A 1NE7A 1KEVA 3UJHA 4DV3B 1LTHR 1UWKA 4RKFA 3PDJA 2AX4A 1YL5A 1LCIA 1RWKA 2XMBA 2Y0BA 3JZFA 5DNYB 3ERCA 3KB2A 4D8WA 3INYA 1VYTA 5F21A 1GTZA 1ZD2P 4ZCSA 3JSXA 3GDGA 5TRTA 4ZEMA 3C24A 5KSOA 3FTPA 4RD3A 1HZJA 2BMFA 2YMMA 1GTMA 2IQ5A 2PT7A 4INAA 4MKHA 3OEEA 4JYCA 4HQKA 3GT0A 1K27A 3JASB 3VOBA 2RGCA 5BV7A 1P45A 3REQB 1PKEA 1T5SA 1YQEA 2B7CA 3OQPA 2OHIA 2X2FA 2XYRA 4UCWA 4UTOA 1CS0A 4C78A 3JCZA 5HS4A 3U3JA 1WB4A 3RASA 3WKEA 3REGA 1UKCA 4ZVUA 4YMTA 1JMVA 1XEXB 3TOZA 4B1FA 4JS0A 5HOQA 1KKLA 4Q4LA 1SXGA 4Z4GA 1YR2A 2HV9A 4GPAA 2FPIA 4Z99A 4RE5A 4RSMA 1YDHA 4INOA 4R8RA 2F62A 1VL5A 4V0QA 3FWHA 1QG0A 1D2AA 5EP2A 5F33A 1G3UA 3SSNA 2IS1A 1FLDA 1HFEL 4HAIA 1YK1A 3A2LA 4HRYA 4PG6A 2AX3A 4TXJA 2O2HA 2PS1A 1GY8A 1TF5A 3QMVA 5A5VA 3PRKE 4R9NA 2WWHA 2X0KA 5DV9A 5JTTA 3SSAA 3DDHA 3V9PA 1L8OA 3HCCA 4L8GA 3TUIC 2BWJA 2JEOA 2FP3A 2G17A 2RAPA 4BKRA 2VBCA 3PFIA 1IYZA 1YVDA 1JR2A 1U0BB 1YB6A 3DL7A 4GT1A 5LM3A 1LLFA 4WZZA 5JH7A 5CTJA 3V97A 3NEYA 4OKNA 1Z6GA 3G2NA 3ZNNA 3SP1A 3NS7A 1UZLA 3D4PA 4LXQA 4YYZA 4J0JA 1FMFA 1T9CA 5IDVA 1QFXA 4RY0A 5L4SA 5TMBA 3D6AA 4CMEC 3ER8A 3TW6A 1DKOA 1E5VA 2HNBA 1D1PA 2VHWA 3W7BA 2W2PA 3A11A 4OQMA 1MW8X 7MHTA 4EVQA 3AI3A 4Z54A 2FXVA 1Z5OA 2AR9A 1KZ9A 1P29A 4Q9JA 4KIWA 3TQQA 3RAEC 5JNTA 4CL3A 2H6EA 2QMEA 2IRWA 3MB8A 3Q8KA 3GP8A 1UC4B 4J1TC 1IXZA 1W36C 4H27A 4RKYA 3RUEA 2IELA 1U6JA 4MA4A 1JI0A 4HS4A 2WJHA 2NX2A 3QK7A 4TMYA 3DGFC 4ZC8A 4E1BA 4HNUA 5IXJA 2QF7A 1Y6QA 1ZH8A 2W93A 4ND1A 5G1PA 2Q21A 3TQOA 1I7QB 1QVAA 2HA0A 1IOLA 3CLHA 3KU1A 4G9GA 4TT3A 4ZVPA 4PFJA 3WC4A 4AO6A 2BTEA 1MRNA 1KJ9A 1DBQA 4GOOD 3GMIA 4JJEA 5LZ7A 3ZKWB 2IBTA 4TRRA 2DJ5A 4J1QA 4BO9A 1TCAA 5CDFA 3A6PC 3B1FA 3NM4A 3ECAA 4I14A 1NN3A 3PQ5A 3FWYA 4JT8A 1TAGA 5AI5A 2ZPTX 1U7DA 2C3PA 3LJKA 4RKRA 1X8XA 3NBYC 3IJ5A 3R5FA 4R1LA 3H9QA 3ZHRA 2V1XA 1QYWA 3TLXA 3G2LA 5AHRA 2RONA 4HWGA 4MR8A 3L2OB 4GYWA 4KQ6A 3ZU3A 5FLXA 1MOQA 2WC1A 4BMYA 2XQFA 1V71A 3UK6A 2JZOA 3OCVA 1N7JA 1SG0A 1W29A 2QA5A 1YGPA 5HKBA 2EGGA 2REOA 1QTNA 2PO7A 1T5BA 1I7NA 4RHTA 4OQDA 3FSRA 1V8OA 2CL0X 3B78A 2NTVA 2Q1XA 4GLFA 3RROA 3LX4A 2ZJ1A 3AF1A 3Q87B 5FUBA 1NRWA 1TZCA 2CXUA 3JYQA 4NS4A 4PIMA 4W6ZA 4MS3A 3K30A 4CM1A 2GKSA 1PYOA 2RIRA 3MJVA 1EXWA 1J0AA 2I2CA 4G09A 1IUPA 2H8GA 3DZBA 3S2ZA 1ZK2A 2H3HA 3KSUA 1O6CA 1D6SA 3ZXUB 1Z3IX 4DT1A 1VI6A 2GBLA 2VDLB 4R51A 4L9AA 3WQRA 4B3CA 1QE0A 2D62A 3E9RA 3GLHB 4OHMA 1WXHA 3NYQA 4GX0A 1R5NA 3ME5A 4FD3A 4TYPA 1GKUB 3GT3A 1MC5A 1X0VA 3NJ4A 2C8JA 4LYHA 5DYTA 3LIIA 5KCMA 1KERA 4JBXA 4MNTA 3REOA 2BISA 2WB2A 2TMDA 4OSOA 1PS0A 3VO2A 4TS1A 1CF2O 2VWGA 3U0VA 2W8BB 1KZHA 2H18A 2HU2A 4DA4A 1FNNA 3GH3A 4B87A 4Q37A 2W2VA 5GPBA 3FUUA 1N2OA 4FYPA 1CF4A 1G291 4BGDA 3BGSA 4UHHA 5IM5A 3SQLA 3JYNA 1H9CA 2C94A 2ZIWB 1ZFNA 3DKVA 4JU8A 4QXPA 4B4UA 3DJYA 4ROTA 3IH5A 2I55A 3CWZA 2QX7A 2PGNA 4X1IB 1H6BA 1NJ6A 1T9AA 2GXAA 1UMDA 3ZWOA 1F6WA 4YRCA 2IH4A 4DUGA 3IIIA 3X0DA 4BVJA 5HW0A 2MOKA 1O54A 3EDYA 3TD9A 2GFIA 5HQ3B 1OILA 1A3CA 4QEKA 5FV4A 1Q95A 1JYEA 2B1RA 4XI9A 1W85A 2JAUA 2DUMA 1S2LA 2R8ZA 5DVZA 2B2NA 3F3YA 5BV0A 1CNEA 1J23A 4HYYA 5E4YA 3SVLA 2NYAA 2IGBA 2Z2XA 4KO3S 1JXOA 2IDKA 1HYEA 2NAPA 4TSRA 2XUDA 4RPLA 3W9SA 3PDIB 5KS2A 4C4OA 4GWGA 5DM1A 1NMYA 2QPLA 3EX7C 3PC6A 1G5PA 1M67A 3DOCA 2H7VA 4OP1A 1EDDA 2FN7A 4MQBA 5CEJA 1GGMA 4RLFA 3Q85A 1H9AA 4FWIB 4Z3OA 2WT9A 4OO3A 3KHSA 1QHSA 4LHZA 5E2BA 3K0EA 4Z49A 2EKDA 3HJTA 4QXRA 3NNSA 2PX5A 4COKA 2J3QA 3T9CA 4GX5A 4PZ0A 1Y8QB 1YQTA 5EKSA 5CITA 1TOAA 1U8CB 1N78A 1G2QA 3TBHA 3C3KA 3TNFA 4QGSA 1TZBA 4LDAA 5LIPA 2EFDB 3ZJ4A 1NL3A 4AJ4A 3R6GA 4H1UA 4MV5A 4DCUA 2EJWA 5K3EA 2OYRA 5IHXA 3U7EB 5FTLA 2IYRA 3RBAA 1WXXA 2EZUA 1MC1A 3PQ8A 2HRQA 4M6WA 2X22A 4NVRA 5AVQA 1AGNA 2PLFA 4FMBB 2QX6A 3WK6A 2ZIXB 4P4GA 1CUSA 1ULZA 2GJSA 3DPSA 2RGYA 4G5YA 3NASA 4XIIA 4EY5A 3W5HA 5KVSA 1U0LA 5B2ZA 5AJUA 3OFNA 4M7PA 4KXLA 3V32A 4ECAA 1ESEA 3UHOA 1V5GA 5CYFA 3IIJA 3WB9A 2QLNA 3SQWA 4QYSA 3OQVA 3CZCA 3O9VA 2X1VA 3E82A 1KNQA 3E22A 3QJGA 4OJQA 2IT1A 1JFRA 4M8SA 3UAZA 1RWQA 2GN1A 4CZ2A 1WPGA 2EKLA 3BYZA 4XYMA 3H5TA 2HA2A 2XUFA 2X3FA 3C3CA 2PKXA 2WKPA 5LU8A 2RHOA 3W5CA 5E7QA 2DFVA 1RKBA 2Y1XA 2DERA 1HL3A 1HDEA 3SE7A 2XQGA 1G3IA 2C8VA 2FK7A 4L75A 1LLUA 3GJYA 5LP6C 2W2LD 1HQYE 1V3QE 2ZE7A 2AEMA 1XA0A 5TY0A 1KY4A 5KZMB 3D1LA 4GD3Q 5HQTA 1UMCA 4DLTA 3DVRX 3GFSA 2CBGA 1AURA 4RAOA 1EE9A 4RCZA 1XTZA 1GGHA 3U4AA 3DDNA 4DQDA 1YCHA 1ZXLA 5EZYB 2DH5A 2ZE8A 2PWBA 2WFAA 3F6PA 4MB6A 1XRNA 2VA8A 4P4NA 4F84A 1CUUA 2IYEA 2P67A 2QZJA 1OTYA 3DCIA 4G1EB 4N8EA 3ZHVA 4PQRA 2NXJA 4M0EA 4QPZA 4XEHA 5KDOA 1R15A 3QG1A 3V80A 5JDIA 2JZNA 3VR1A 3IRUA 4H4CA 3N2EA 1B0PA 2EKQA 4NBVA 1IBSA 3AESB 3LVBA 4G0ZA 4YALA 2QMUA 2FZCA 5GM1A 4KYUA 4WMLA 1CUCA 4J3JA 4Z7NB 4KIJA 3IULA 5ALWA 5IDXA 4C0XA 3LY5A 1MABB 1E94E 2GH1A 1G0OA 2GYUA 5EIEA 2Z8XA 1NX9A 1R5OA 2IEBA 2P9FA 3JQAB 3BBLA 3S1LA 3ZN2A 3CVOA 3DHVA 3OO0A 2NZVG 2IZ1A 3H04A 4KSYA 4EJ6A 4Q9KA 7MDHA 3DLAA 2QL9A 1MT0A 2VJKA 4H7HA 2A14A 1XWWA 3NT2A 4HNAB 1LK7A 4OK6A 3FPCA 3IPRA 2ZIEA 3D8NA 3MIIA 4BO7A 4UM9D 1SWWA 1NC3A 5SYMA 2Z95A 3GA7A 5HZHA 1B8UA 1Z3CA 1UXHA 4D82A 10MHA 4KGZA 1LPOA 1NNSA 3K0AA 1N7IA 5K2MA 4LY9A 2PS9A 1DTSA 2ZI7A 1L3BA 2V7WA 2NVWA 1OLSB 4I50F 1MP0A 2PA3A 2P3LA 4KH0A 5ICCA 5JC8A 3D0RA 3AP3A 1EFHA 2FEKA 1J99A 2O6HA 5HRUA 4BHTA 3LVRE 1Y3IA 5JJLA 3HB9A 2P3SA 3AO0B 3PUWA 1EQAA 3R0ZA 4QELA 2QTCA 4U5QA 1OX6A 4B5KA 4O4JB 2EW2A 3ZHOA 2ODEA 2LWIA 1O4VA 2WTMA 3NU1A 1VFNA 5BURA 4TROA 3LOPA 3UJPA 4JIGA 1CV2A 1PR1A 2AYYA 3TFOA 3T5CA 5HUHA 1Y1KE 3L4JA 3FKSA 1RZUA 2ERCA 4E5PA 2RHHA 2OXCA 4DLZA 4WHMA 1I13A 1DC3A 1YDWA 3TG8A 1I01A 1GLGA 3MWLA 4ETWA 1O57A 5FFNA 3IOBA 4N3AA 2WNHA 5BVHA 4ZHSA 1I9CA 1C7ZA 3SFTA 3TKYA 3IPAA 4MOWA 3ZDQA 4IZOA 1RQRA 2YN0A 3HE3A 1GLVA 3IHKA 4PAOA 2PGOA 4HAOA 3ZTWA 4BQFA 2P6NA 2IDMA 4UTNA 2J6HA 4BFYA 1B1AA 2P4SA 3DEJA 1V16A 2OOSA 3TUZC 1JIKA 3ZWXA 3ZVKA 1C81A 2PXCA 5LZ4A 3G13A 2Y99A 2G28A 3NDRA 3JS5A 5CT8A 4JOQA 3U48A 1WQ3A 2GN2A 4ZV7A 2ZANA 4GMXA 4X66B 1XRQA 3EHEA 3KEGA 3GH1A 2ISSD 4F0JA 1HFJA 4PBRA 4LVOA 3BJEA 3K0BA 3VHQA 2ENWA 3ROFA 2YDXA 1KYIA 5D2CA 4JWKA 2XEDA 2E55A 3OTHA 3B1KA 2HNAA 4EUKA 1JJIA 2OQRA 4XKJA 4EA9A 2H1RA 2XIQA 4NARA 4QJ5A 3VDXA 5I3ZA 1XMOB 1HORA 1Q19A 2YV4A 1CP3A 4L27A 2CFCA 2TMGA 3QXCA 4K40A 4GUAA 1PD0A 2FSGA 3NHMA 5IVHA 5FL7A 1D2HA 3LIPA 3OSZA 2XR1A 2CLDX 4HI0E 4DIDA 3RREA 1I7LA 3NHYA 3CEAA 1PL7A 2GDZA 2C0PA 4A15A 4YQFA 1F1JA 1B8NA 2DQKA 2CXOA 2Z1NA 2QRKA 3HJAA 4JEIA 4NL4H 5EJIA 4I5GA 2D5CA 3CLVA 2IHKA 1REQA 3KQNA 5FOVA 3GLHE 3N59A 1I5OA 1LDNA 3KS9A 4F6RB 3LY9A 2PX2A 3WLAA 1KP9A 1ML4A 1X38A 3IYLW 4LJYA 4EI9A 5MN6A 1K7FB 2Q0HA 3PFBA 4NICA 4K6OA 2BSAA 3PQCA 4Y30A 1CUEA 1JG3A 4ZEWA 1X1DA 4OH7A 5JWHA 4F9TA 4Y2JA 1BKYA 3HZOA 2X13A 2OD2A 2DH6A 2I76A 3AOGA 1CIVA 3JARB 3KFVA 5F2OA 3SEFA 1W6UA 1HUQA 3PT5A 4J03A 3RR2A 2WAXA 4ARBA 2EBWA 2TMYA 4HJXA 1KVUA 4PSUA 5KNCD 1Z34A 1VKNA 5JNLA 3Q88A 1FYWA 1T13A 2QW0X 2LVBA 4XARA 3RK4A 4I1SA 3BE6A 2X8JB 5MGNA 3BWEA 1LRKA 4G5FA 1U2SA 4RVSA 3VO1A 2ORYA 2Q3LA 4OQEA 4Q21A 3NFRA 3DEZA 3ZDZB 3M81A 1K75A 4IHAA 2JGAA 3L02A 5F1YA 4DKXA 2HRCA 3O7MA 4FC7A 3OLVA 5JR3A 4Q4AA 4RQAA 4YMVA 3X1JA 3AL2A 1G1MA 4PYMA 3JQFA 1ZVQA 5JS8A 3UOGA 1NZDA 4QO7A 3LW7A 4HP8A 1J5EB 1XYGA 4BBPA 1P3JA 1T0PA 4HNQA 5AW6A 1ZUWA 1U7UA 3SIXA 4EDHA 1AXGA 1E8MA 1XU7A 4BLTA 1K97A 2IYPA 3FZEA 3HLTA 4D3ZA 3JAMA 5LD2C 2HHHB 5FP0A 2WAMA 2B94A 1OFTA 3FUCA 3UVEA 5KQSA 1BQ4A 2AD5A 4NBLA 3DO8A 1QFJA 1T10A 1XO1A 2BEWB 5AIBA 5K1ZA 1XDWA 5I4KA 1ADYA 3KJZA 2XPCA 4KPGA 5ER6A 3DQQA 5DX1A 1KI9A 4A6DA 2CT8A 3G02A 1XMXA 1Y4UA 2WIKA 3ONVA 4E08A 4TWBA 3BCHA 2Q6OA 3CT4A 4X0EA 4EZIA 2AG1A 1TJ3A 4CMKA 5BSWA 4QM6A 3JYHA 3F67A 3LHKA 3TTUA 1ODFA 4JCCA 3WQBA 5IWAB 3L8GA 2X4IA 3WMFA 4BMVA 2DKNA 1QTQA 1BWPA 3BKXA 3KEOA 2NZ8A 1XZMA 1VP3A 2HK9A 4WN3A 1YZHA 5BW5A 2GPTA 3FNEA 3GUZA 4ISCA 2Q5IA 1TGVA 1JKJB 4PYJA 1W9MA 1Y3HA 1QMPA 3HUTA 4I50A 1C0IA 1JSRA 1U6KA 3DVSX 4RDXA 1ULTA 3LCRA 3GUVA 5FD8A 1BH2A 5K3BA 3RLIA 1YS4A 4KQMA 1NONA 2Q3EA 5CBPB 2HEGA 1TL7C 2GCOB 3WAJA 3U1BA 2FZ5A 2XD9A 1IEWA 3LPDA 1DKNA 2R751 3BUSA 2QP3A 1KBQA 4TM8A 3TIGA 5BSUA 1MZVA 4Y3UA 3MMPA 3TIVA 5B55A 1PN3A 4NAHA 4CT5A 2ONKA 4IGIA 2AFRA 2V98A 4HNRA 3C87A 1I94B 2CJYA 5K8CA 3COWA 3A70A 3A1UA 1PV1A 5EGSA 4B32A 2Z8YM 1ZOOA 4OAOA 5K2OA 4W1SA 5FAXA 8MHTA 4XLLA 2NACA 3DXYA 2GZ2A 2AFIB 3HZZA 3ZHCA 4LYFA 1VSBA 3N6RA 3L3BA 3RFTA 1T2AA 2XF8A 5F1KA 3MT8A 4IJKA 3WO1A 1U7PA 3OU2A 2I2BA 1KL7A 1JE0A 4H1TA 3A6HA 4DV0B 1GNTA 3A1EA 3A7DA 4L3OA 3KSZO 2ZTVA 4DVJA 4DAOA 5BNIA 4D41A 4EY6A 3MERA 2Z0MA 2VL7A 5SV2A 4ZCIA 5U9CA 2LXNA 3HHEA 2Y0CA 1X1EA 3USZA 3VDQA 3F7OA 3U4HA 4C88A 5JO0A 1MQ8B 1TQ6A 2COEA 2QRNA 3EXG2 3Q0TA 3MRXA 4JJAA 3UENA 1I10A