2NNLD

Binding of two substrate analogue molecules to dihydroflavonol-4-reductase alters the functional geometry of the catalytic site
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
324
structure length
324
Chain Sequence
b'ETVCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNVKKVKHLLDLPKAETHLTLWKADLADEGSFDEAIKGCTGVFHVATPMDFESKDPENEVIKPTIEGMLGIMKSCAAAKTVRRLVFTSSAGTVNIQEHQLPVYDESCWSDMEFCRAKKMTAWMYFVSKTLAEQAAWKYAKENNIDFITIIPTLVVGPFIMSSMPPSLITALSPITGNEAHYSIIRQGQFVHLDDLCNAHIYLFENPKAEGRYICSSHDCIILDLAKMLREKYPEYNIPTEFKGVDENLKSVCFSSKKLTDLGFEFKYSLEDMFTGAVDTCRAKGLLPPSH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroflavonol 4-reductase
molecule tags Oxidoreductase
source organism Vitis vinifera
publication title Binding of two substrate analogue molecules to dihydroflavonol-4-reductase alters the functional geometry of the catalytic site
rcsb
total genus 111
structure length 324
sequence length 324
chains with identical sequence F
ec nomenclature ec 1.1.1.219: Dihydroflavanol 4-reductase.
pdb deposition date 2006-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2nnlD00
4DPMA 5KJCA 5HA5A 5ADHA 1GV1A 1QV6A 4XWYA 1ULSA 4KQWA 2D5AA 1KEVA 3GEDA 2HMVA 4JGBA 1U3WA 1WW8A 1XU7A 3IS3A 3IQDB 2BRUA 3PJEA 2VHWA 3TL3A 3RC1A 1F17A 3DZKA 3W8FA 3KZVA 2I5PO 2X0IA 3E82A 4J0EA 4BOYA 1UDCA 2CY0A 3LQFA 3MCVA 4DPKA 4A7PA 4ZGWA 5L7TA 2ZK7A 1VRWA 4Z0TA 1JA9A 1QRRA 3U09A 1ZIDA 4Y6PA 2B36A 4ND5A 3TSCA 3ZNNA 4FJ0A 1NPYA 3CEAA 3QQPA 3K8ZA 3PP8A 3C3XA 3GHHA 1ZUD1 1A71A 3JQFC 1WDLA 3WNVA 1I8TA 4P4GA 1DJNA 3VAZA 3HWRA 4RVSA 2NV6A 4JROA 2EP7A 1D1TA 4II2A 1IB6A 4QO7A 4OMUA 4WCFB 2C0CA 2GD1O 3ENKA 4RVGA 1DRVA 4XRRA 1GDHA 2HJSA 3EMKA 5HRUA 2C29D 4LN1A 3AOEA 3UCEA 3DL2A 5HS4A 1U5CA 6ADHA 4Y6SA 2B4QA 2Y99A 1MX3A 3BMCA 5KKAA 3I6QA 4E32A 1Y5RA 4J4BA 4WGGA 3GZNA 2FOIA 2UV8A 3WGYA 5F1KA 1AHHA 4FB5A 2JHGA 1IHXA 2GYYA 3R3JA 3RUAA 5GZ3A 1RKXA 4PZDA 1U1IA 4B3JA 5JCJD 3Q6IA 4CLDA 4JX8A 3SJ7A 3BAZA 4FR5A 5T57A 2FRDA 2BD0A 3PZRA 3C8MA 3DFUA 3S2FA 4YYZA 1V35A 4E21A 1ZSVA 4DMMA 5JDIC 3SJUA 3F1KA 4F3YA 3ICCA 1ZK3A 4YAJA 2YHIA 3JQ8B 2ZTMA 1YBVA 1VL0A 3PHIA 3WGZA 3M1AA 5F3RA 3NRCA 1GPJA 4P22A 5JYEA 4BO8A 5TLSA 2IRWA 2I66A 4OXNA 1AE1A 4IJVA 3CSDA 3Q1LA 4YJGA 4XQEA 3WR5A 4RL6A 1UR5A 1IYZA 1QXSA 3F5SA 4NJOA 4EEZA 4NFYA 1AHIA 1EQUA 3D1LA 2ZQZA 4DTIA 5ICMA 3H9QA 4BNMA 4QEDA 4K26A 2X9GA 2Y0DA 3HDQA 3LC1O 5I7SA 1DLJA 2CZCA 4HY3A 3NAQA 2UAGA 4FFMA 4RPGA 2B83A 1O95A 1P33A 1F8FA 4WKGA 1LJ8A 3TRIA 3V2GA 4CV1A 1SO8A 4IJUA 3I23A 3KB6A 5JAZA 2W2KB 3I9KA 3RVDA 3GVIA 1DIGA 3PK0A 1H94A 4ZVVA 1X7HA 3F4LA 1Z82A 3UCXA 3W6UA 2OFPA 3VPSA 5FEUA 2YY7A 3NTRA 4Z0PA 1PIWA 1BW9A 2AEFA 1SBYA 1TA4A 2AG5A 5HBRA 1MC5A 4CMGA 1GCOA 1PJ3A 4EUEA 3JTMA 3FNEA 3Q2KA 4MINA 4LMPA 1PQPA 4MIEA 1W0CA 4D45A 5EIOA 9LDBA 3ITKA 3V2UA 5T6BA 2PNFA 3GZNB 3O38A 3K92A 4BQRA 1PJ2A 1A72A 1WZIA 3E1KA 1Z7EA 3DZBA 2VUSA 3WNQA 4CLRB 1GEGA 1MG5A 2PV7A 4BNWA 2YYYA 3KYBA 4KP7A 2PD6A 4WCFC 4FQ8A 3UCFA 1LBEA 2C7VA 3ZDFA 2PH5A 2X22A 2Y68A 1GTMA 2DPHA 3JQGB 1ISJA 4DUPA 3LK7A 2VTDA 5DBFA 3T4EA 1U9JA 4MKXA 5COQA 4XYEA 4AJEA 4YT8A 1UXJA 4UVEA 4BNZA 4YT5A 3HB5X 3ZHBA 5TRTA 4IDGA 2HUNA 1DBVO 3OJOA 4BNVA 1EUDA 3TQHA 4JIGA 1NFQA 2Z95A 1ENZA 3ETDA 3L07A 2YW9A 4DIOA 2WD7B 1E92A 3JQFA 3ULKA 3LC7O 4TRRA 1F06A 3AWDA 3TZ6A 2VCYA 3RUIA 5G0UA 1LSJA 3RROA 2I65A 2Y1DA 3LT0A 3SEFA 2Q45A 2VWQA 3PFWO 5JAIA 5C7OO 1K0UA 5TNXA 4DA9A 3E9QA 3HG7A 4RZHA 3S2GA 4MVJE 1GUFA 4KUEA 3EY4A 1EK5A 1MG0A 2XPCA 4NJMB 4CLHA 4NNJA 1LQUA 1FXSA 1G6KA 3ZI0A 1ID1A 4J6FA 1KIFA 1H0KA 3GFBA 3ZH2A 1F12A 2O4CA 2ZYGA 1LNQA 2IEDA 3OP4A 5L9AA 1P0FA 1MB4A 4IXTA 1PTJA 4CJXA 3JQDA 1PGPA 3ZW8A 3INGA 3ONFA 2Q2VA 1LRJA 3BMQB 1GU7A 2VRCA 5JS6A 3CKYA 1X0VA 2HMUA 3AJRA 3C1TA 5T67A 4CLRA 5U4QA 3GDFA 3D3WA 1HDGO 4CMKA 4UVIA 3G1UA 3GF4A 4CQLB 4KUHA 3GAFA 5B4TA 3DOCA 1FDVA 2Q49A 3A14A 4R1SA 1X1EA 2PH3A 1CIVA 1CDOA 1ADCA 5A9TA 3D4PA 3B1JA 1XSEA 1ZK2A 1KVUA 3PHLA 4E31A 5CDUA 3G49A 4IGFA 2WD8A 1Q7GA 5I9LA 5HWSA 3QVXA 2HAEA 1U7TA 4E4YA 3MWEB 1WNTA 5GZ6A 3QLJA 1EBFA 2ZKLA 4LCEA 4B8ZA 5BSHA 1I2BA 5K9ZA 4AJOA 1XU9A 3S1LA 4R69A 1IOLA 1X7DA 3LT2A 1CF2O 3L4BC 3R3SA 4RVUA 3BTOA 3NDJA 5DT9A 3KV3O 1GYRA 1UXGA 2D8AA 4CMIA 5CDYA 4BNIA 4HFMA 4BGVA 2VRBA 3UKOA 1A4UA 1R4NB 5F5NA 3IIEA 3GZ4A 3TPCA 5I8WA 1ZKMA 3LF1A 3GA0A 4TVOA 3FBGA 1Y8QB 4ZHSA 2HO5A 4IDBA 3VPHA 4B3IA 4TQGA 1UH5A 2D3TA 3W1VA 2VN8A 3PYMA 3UHAA 3IKVA 5F21A 4HX5A 2QHXA 3V8BA 4BKPA 1PL7A 4BMVA 1JWAB 2CDBA 4EITA 4AL4A 4WLUA 1E7QA 2GLXA 3TOZA 2PTGA 2WWRA 2PR2A 3EZYA 1HSZA 1TI7A 3VHRA 2CVQA 2DKNA 5A5EA 3WSVA 2Q3EA 3JSAA 2CSUA 1LRKA 4U7WA 4L8VA 4DBVO 3RKUA 3Q0EA 4XJSA 1KERA 4X54A 3ZV3A 1IY8A 2AQKA 3L9WA 3ORFA 2ZCVA 4BKUA 4NG5A 1ULUA 4PVDA 3S8MA 3EC7A 3KO8A 5EL0A 4HXYA 1R16A 1KY4A 2B0JA 5COBA 4QX6A 4A03A 1P1JA 5IFLA 1ZCJA 1RYDA 2DM6A 5KKCA 1BG6A 2J3JA 1HDYA 4WEQA 4RPHA 4U6QA 2O3TA 4BMSA 1JN0A 3VTFA 4LGVA 4AJ1A 4J16A 4EDFA 4KDFA 2NVWA 3HN7A 3MJCA 4GMFA 4DQVA 1LI4A 1XR3A 2HKIA 2OOSA 5TIIA 1TT7A 3L4BA 4QT0A 3BA1A 5JDIA 1N7GA 5IAAA 4Q3AA 2EG9A 2HLPA 3AY7A 3MTJA 3ZWAA 4M86A 1SAYA 5CDGA 1Q7BA 4A5OA 1JWBB 2BFOA 2QYTA 3BMNA 4UUNA 1J6UA 1R4MB 3I52A 3LF2A 3NJ8A 3OJEA 2JD2A 4K6CA 3TJRA 4B4WA 2O3UA 5CP8A 3AFMA 1ZK1A 3E9NA 4WLNA 4G65A 3OECA 1KEPA 3K6JA 4E30A 3IP3A 1IZ9A 3TWOA 3KYCA 1ZW1A 2Z1NA 2Q4BA 4NBWA 2C07A 2Y1CA 3MJTA 4GWGA 1C1XA 4BO4A 4DIBA 4DRYA 3AI1A 2X8LA 1Y8QA 1W6UA 1U3VA 3JCZA 3I9NA 4GSKA 2NVUA 3DAGA 2PZJA 4YAIA 3I9MA 2CDCA 4CLXA 2HQ1A 3OIDA 3NJ4A 4O5OA 3GUYA 3GHYA 1HRDA 4B7XA 1CQJA 1E1LA 1CJCA 1H9BA 4XR9A 2P4QA 3KUXA 4Y6RA 3GT0A 1DIHA 4W7IA 4FDAA 1YL7A 4XEHA 5A3JA 3GY0A 5F1OA 4WLEA 3P2OA 3K2EA 1R0SA 1A27A 2J5RA 2OL4A 5G0SA 1X0XA 4RDHA 2EKLA 3C7AA 3GVXA 5C3MA 4DC1A 1PL6A 2RAFA 5I8ZA 4GGPA 4IIVA 2W4QA 2WDZA 4DLBA 4UVGA 4DGSA 3PFFA 1DHRA 4BGIA 2X7HA 3GDOA 4LK3A 1B15A 3P7MA 2Z1MA 4WOKA 4OYRA 3QHAA 3VDQA 5ICSA 1KC1A 4R9RA 4BB6A 3CINA 1HF3A 3WTBA 4CV0A 4FFRA 1U5AA 3PRJA 3VZPA 2JD1A 5L95A 2DLDA 4M1QA 2JHFA 1A4IA 1PJSA 3O8QB 3V1UA 3DHYA 3PZBA 3RIHA 2VRCD 4GWKA 1O0SA 2UUOA 4I5FA 5AXCA 3DEYX 5DDIP 1VL8A 2GN8A 5DOZA 3BHMA 3FSRA 4TMFA 4YT2A 3AOGA 1C1XB 4W6ZA 3WLFA 3JYNA 4WPGA 2QRLA 3UICA 4TVBA 3R0IA 4O59O 4DPLA 5C7LO 1UDAA 5A03A 4OAQA 3WB9A 3IAHA 3H4VA 1KEUA 1PS9A 4XDZA 3MTGA 3OEYA 3A4VA 2EJVA 4XKJA 1DAOA 1ADFA 4L4XA 2POQX 3DZJA 4W7HA 4BV9A 5CEFA 1H6AA 4LVUA 5H83A 4OQYA 1N7HA 4HFRA 4JLWA 4OH1A 1SB9A 5JY6A 3OSUA 3PWKA 2NUAA 4IMPA 5TS3A 3MEQA 3WJAA 3WSWA 4CM9A 1I30A 1A9ZA 2Q46A 4CLOA 1BDBA 5JLAA 1XHLA 2AW5A 4NFHA 3VKVA 1MUUA 2IXBA 4NBTA 5IDWA 3EVTA 2H63A 3H65A 3H9GA 4FS3A 4YQZA 4JCOA 3VZRA 3GK3A 3DXFA 3KYDA 3LDHA 4IM7A 4JQCA 4R3WA 2NM0A 3IMFA 4GSLA 4RJTA 1GUZA 3OJ0A 2X58A 3HB4X 4ZA2A 5IF3A 5A5FA 2PA3A 4MIYA 5A05A 1O94A 2A92A 3GN1A 2J5QA 3E18A 1I33A 4P38A 3W4JA 3JQBC 2BKAA 5K0ZA 1HXHA 3G17A 3CPSA 8LDHA 4CQMA 4MVJI 4EUHA 3FCOA 4U0KA 1MP0A 4U5QA 4ND2A 1NVMB 4R1UA 4IS3A 4NFSA 1YONA 4L75A 1ZXLA 3DHEA 1T2DA 2EW8A 3PQFA 4MVJD 5TJHA 1U4SA 2P68A 1PWZA 2WTBA 4CMIB 3OBBA 3ZU5A 2E48A 1IHYA 1B3RA 1Z7BA 2EXXA 1VL6A 2D5CA 2JKVA 1LLCA 2SCUA 3F6YA 1FDUA 2V7PA 3ROKA 3VVCA 3AI3A 1DRWA 1EVIA 4I5EA 2PZMA 3WFJA 4GLOA 1VJ1A 3ASUA 3TL2A 3EAGA 1U4OA 2JCYA 3ZV5A 3CZMA 4CUJA 1DRUA 3SC6A 4OHUA 5KJ6A 3RBVA 2YV2A 1I01A 4Q3NA 2VYVA 4G81A 4GAEA 5JDCC 4E5NA 3WGIA 4J91A 5IZCC 3FPLA 1UJMA 1DHTA 4HFJA 1OI7A 3ZU3A 1WLYA 2Y93A 3CZRA 3ABIA 1WZEA 4BS9A 2HJRA 3FWZA 2G17A 1E7WA 1ZJZA 3MJ4A 4MVJA 4GBJA 4ESOA 1BXKA 3H8VA 3DBHA 1O6ZA 3WTCA 3RD5A 2R00A 3FN4A 3PXXA 4W9NC 1HL3A 2GRAA 4NPCA 1KBZA 4PLPA 5KOIA 3HJAA 1K6JA 2OMEA 1BHSA 5ER6A 2VWGA 1D8AA 5DCWA 4WECA 3R1IA 4CQMD 4NJMA 1PS0A 3TZHA 2JJYA 1XG5A 2ZTUA 3D4OA 4D79A 4YRAA 2RH4A 4Y8VA 1H6DA 1K5HA 1E1NA 3F9IA 4YRDA 2X5KO 3H9EO 3INRA 4F6CA 3E9MA 3RFTA 1LSSA 5JCJA 1A5ZA 4LSWA 5KVCA 3JQCA 4J1NA 3DZFA 2AA3A 4CMJA 3NYWA 5CFZA 1LEHA 1FDWA 1I3LA 3L6EA 4J9UE 5JYDA 5A1TA 3I9LA 1N1EA 2EF1A 1YL6A 2G0TA 4NR0A 3PIDA 3U3XA 3UFXA 3MWDB 2CF5A 3D7LA 1N2SA 2JFHA 3OQ1A 3A1NA 4BNGA 1SCUA 1JKIA 1H2HA 1E7SA 4OKNA 4XQGA 5AOVA 1HE2A 1GPDG 1T1SA 2XAAA 3ZWWA 3ZWNA 5IG2A 4I1IA 3QWFA 1HE5A 4ZD6A 1QR6A 2O3SA 4ZRMA 3WOHA 1E7MA 3WYCA 1KYQA 3RKRA 2GZ1A 2PGDA 3C7CB 5CEJA 2AXQA 2QRJA 4D0SA 4M54A 4XGNA 3C24A 3Q3CA 5GMOA 3OICA 3DBHB 4J1TA 2DFDA 4WLFA 4HV4A 1BXZA 2FHSA 2WE8A 3K9QO 1IPFA 1EUCA 1Y8RB 1XGKA 5KJEA 4GX2A 2ZQYA 1HDCA 1XKQA 1YQXA 1NM5A 1DEHA 3B20A 1LLDA 1YQGA 5I7VA 3JYLA 3DBRA 3N58A 3DHNA 4BL5A 1Z73A 2B35A 2NVBA 1JVSA 3EVNA 3FWNA 3AU9A 2X1HA 2ZATA 3QVOA 3QVTA 1YDWA 4RCVA 4NU5A 4CV2A 1XLTA 3KHUA 4IJWA 1OOEA 4BO0A 5A9SB 1GR0A 3KOUA 2CUKA 4OQZA 4UAGA 3DR3A 1EVJA 1V6AA 4IS2A 4H16A 2VUTA 3WLEA 4GX5A 1LSUA 3GN2A 3OQBA 4EZBA 1T4DA 3F3SA 4J4TA 4CR7A 2Q1TA 1C0PA 4L74A 1C14A 1XQ1A 3BTUA 2NVUB 3VC7A 3JQ9A 1BW9B 4TSKA 2FPPA 4ZN6A 5JO0A 2I6TA 3KEOA 1MXHA 4H3VA 4ZQFA 2JFFA 2FY8A 3WQQA 1R4NA 2ILTA 2OBNA 4RPJA 1NPDA 1PZHA 5TC4A 2X5JO 4AJPA 3VH3A 2IZ0A 3NT2A 1I5RA 5BSEA 2O3QA 2O48X 4XA8A 1K6XA 1T1RA 1HTBA 1LSOA 2JCXA 1UZMA 3AOEC 4YJFA 3PIIA 5DULA 1DIRA 1HDOA 4R51A 1DLIA 3D4NA 1XCBA 1R4MA 1YJQA 2GNAA 4ZQBA 4EBFA 5C37A 1T2EA 4WJZA 4FOOA 1KEWA 3NTQA 4NIMA 2HSDA 2HDHA 3M2PA 1C0KA 4UVHA 2OUIA 4MP6A 2YJZA 4UULA 1E3WA 4ALJA 4BNXA 1VLLA 4FIZA 4UEKA 4O0LA 1E3IA 1TVEA 3H5RA 1PWXA 1EEHA 4D3DA 3OIFA 5MGBA 1N92A 1ZJYA 1KVTA 2HK8A 3D64A 4RF3A 1P31A 3H5AA 2FZEA 1KY5A 3RJ9A 1B8UA 1YOVA 2I9PA 2X4GA 3NUGA 1X7GA 2AHRA 2VNAA 4L4SA 4YPOA 4M55A 2YZ7A 4DWVA 1I3KA 1M6WA 1CYDA 3TF5A 1HDXA 5BSFA 2YV3A 4PFJA 1E3WB 1HYEA 4QXMA 2G76A 5I7FA 4QFDA 2IODA 4L73A 3GGOA 1Y9AA 2VYNA 3WMWA 2EGHA 1PGNA 2O23A 3BMCB 4PZEA 4UREA 1Q0LA 4R9SA 4A0SA 2CVOA 4R41A 2VWHA 4BNHA 3OHSX 4MPDA 3ZU4A 4FBGA 3PVZA 1E3JA 5A06A 4CR6A 4DYDA 4WASA 4MP8A 3RC2A 2Y0EA 3DO5A 3F47A 3U4CA 2QZZA 1EVYA 2YFQA 2EKQA 3WWYA 2W2LD 4AJIA 4B4VA 4NBRA 4MVJP 1B8VA 1I2CA 2DUUA 4GGOA 5EERA 4AJ2A 4Q3BA 1UAYA 2EP5A 4EEXA 4R16A 4HNHA 1DJQA 4YACA 1JKJA 1DFHA 5EJ2A 4IZIA 3VH1A 1P1KA 1C0IA 5A3VA 4DL9A 1Q1NA 2VYVD 4MJLA 2HMSA 2VZ9A 2C54A 4QSMA 2PZKA 3DONA 4CUKA 3UUWA 4FJ1A 1E6UA 4L4RA 1PJLA 3E8XA 4J7XA 4Y98A 3MJEA 1DAPA 3UVEA 1GQYA 1S7CA 1XQ6A 1CRWG 1A7KA 4PRLA 1KOLA 4AJKA 3BHIA 1TXGA 5B37A 5T8KA 3WGHA 5BSGA 3AM3A 3W8EA 3GPIA 5ES3A 4DLLA 4TZKA 3I1JA 3O4RA 1V0JA 1VC2A 5JPIA 4D46A 4BO9A 1XYGA 1QV7A 1YWGO 1BVRA 5DNAA 5H81A 3GLQA 4R4JA 1T2FA 3V5NA 4IUYA 3AFNA 1UDBA 1PJCA 3DBRB 3QRWA 2HMWA 4UVDA 4A27A 1PSDA 5JMWA 2NU9A 3JYPA 3DBLB 3HDJA 4N5LA 1KS9A 3I4CA 2P5UA 1NWCA 5EESA 4FGSA 2WYUA 1VJTA 1BRMA 3PHHA 1M76A 1YH3A 4LSMA 1X14A 1Y9EA 3G0OA 4ITUA 3WIEA 2NU6A 5T64A 4Z0HO 5CHEA 1R0LA 1UZLA 4TROA 3I4FA 2O7QA 4UUOA 2H1SA 2NSDA 2H5LA 1U7HA 3AUUA 2W2KA 2HK7A 2I67A 3GNTA 1OFGA 3VH4A 1CERA 5EMHA 1QYCA 4LRTB 4R5HA 1Y6JA 2X5OA 1C3VA 1IPEA 2EIHA 3PLNA 8ADHA 1M6HA 4K1LA 2NACA 4PLCA 4WK6A 1ZSNA 3WGQA 4GMGA 3O03A 1O89A 4GL4A 2V6FA 4P4NA 1LC3A 1WPQA 1MFZA 1B2LA 3AY6A 1EVZA 4OOEA 2J3KA 1DC5A 2AMFA 1PU2A 4CM8B 2GERA 2FPGA 2PGJA 3CUKA 2VQ3A 3GMDA 1XDWA 3KXDA 4UUPA 2EV9A 2PGLA 1DSSG 3LVFO 3HFGA 4CL3A 1PX0A 2DBZA 2NTJA 4YDRA 2C5EA 3PYLA 3GNSA 1YOVB 4KOAA 1HWYA 3KYDB 4YR9A 5IXYA 1EDOA 1H93A 3GEMA 3GOHA 1EE2A 4N7RA 3GVHA 4FPXA 1IULA 3FRJA 2BFMA 3AUSA 3AY3A 5KJ1A 1AN9A 4R68A 2CNBA 5B4VA 4CMCA 3V1YA 5L53A 3L4SO 3JQGA 7MDHA 4QUKA 3ZN2A 4WLOA 4AJHA 4BO6A 1L1FA 2UYYA 4RF4A 1EMDA 4GVXA 4OOFA 4CM7A 2FR8A 2AQHA 3EDMA 3MOIA 2F00A 3HQ4O 4CMBA 4PLTA 3EZLA 2EGGA 4E6PA 3BHJA 2CDAA 2GPTA 4KTVE 4LCJA 2VOEA 1Q2XA 1HEUA 4E5PA 1FJHA 1BDMA 2O50A 4IQGA 3IKTA 3C85A 3GVPA 2EERA 1SC6A 3PI7A 2QQ5A 4YA6A 3WJ7A 4D44A 3T7CA 3JQBA 1SOWA 1UAGA 2OP1A 3IUPA 4D42A 5EQDA 4CUZA 4E12A 1P0CA 3GQVA 3AW9A 4IINA 4LVCA 3ROMA 3A28A 1YJ8A 1E3LA 1U28A 3ZNOA 1NTOA 3PQDA 2NTNA 2IXAA 3UXYA 3VZQA 1G1AA 4YJFB 2XOXA 5B12A 2YQ5A 2AE1A 5G4KB 2YFHA 4J9VA 5L40A 1ML3A 3EGOA 3I9OA 2QG4A 4L9RA 3RUEA 3WGGA 2E37A 4PLYA 1PJBA 4ALLA 1R66A 1WDMA 3ANNA 2C2YA 4OXYA 2E49A 1B0AA 3U62A 2BHLA 4TWRA 3LLVA 1YRLA 3NT5A 4EI2A 1UP4A 1ISFA 2BF7A 5BQFA 5CDSA 4ZICA 1OAAA 1TLTA 3RFXA 5CEEA 1GYPA 5DP2A 1JQBA 4JBIA 3DFZA 4OM8A 2FSVA 4F45A 4N54A 3K96A 3DBLA 3V1TC 4BO5A 1ONPA 1B8PA 1JLLA 1G0OA 2FWMX 2NNLD 3R6DA 2B4TO 4E33A 4EJ0A 2B5WA 1ZMOA 2P91A 5IJZA 2FR1A 2PKRA 4JJGA 4S1VA 5KNLA 3D3WB 3GAZA 4R1NA 2A94A 1T24A 4M8SA 1D7OA 3U4IA 2OZPA 3SLGA 1TT5A 4NZ9A 3U4DA 3VDRA 1CETA 1LUAA 3TDKA 1Z74A 3F46A 1NNUA 1XIVA 3OEWA 4PLGA 4RLHA 2DT5A 3UW3A 4E2YA 1ISMA 3RASA 3WIDA 2PLAA 3GGPA 2R00C 2DBQA 2PK3A 1HLDA 3M2TA 4MIOA 3RUFA 2IE0A 2BFAA 1ZEMA 4RVHA 4RV9A 3SX2A 5L4LA 1B16A 3FTNA 4B4UA 1WP4A 1W73A 1E6EA 1H2BA 2O4UX 3U0BA 1Y8RA 4N5MA 5HTOA 4HUJA 3SLKA 4BO2A 3IDSA 5FWNA 4Q3EA 3RCBA 3H3JA 5JXWA 1PGJA 3OA0A 4WUVA 4IDEA 5HS6A 1M66A 4CM6A 1P1FA 2DTXA 4E2XA 1YL5A 2B5VA 5IDQA 2PY6A 1SPXA 1U8FO 4RLSA 4NQZA 4IGEA 2DC1A 1JU9A 1YB1A 3CMCO 4BMNA 5KTKA 4BNLA 3PGXA 4Q9NA 3QE3A 4P4LA 4ZJUA 4ND4A 3DBVO 3KEQA 1MXFA 3P19A 5G4LA 3ROQA 5ILOA 1JAYA 1HETA 1JKFA 1EE9A 3BMNB 1GZ6A 3RC9A 4YBZA 3RAJA 2VT3A 4OJNA 2WMDA 1I3MA 3COSA 4IQ0A 5ILGA 4XQ9A 4N18A 1ZVMA 4HWKA 3S2IA 4FFLA 3RSHA 4PG4A 3ZWCA 4B79A 1HDZA 4CMAA 3FD8A 1J5PA 3I9JA 2BMAA 1BGVA 4NDNE 4RZIA 3GUCA 1C0LA 3BTVA 9LDTA 3ZWPA 4JK3A 4XYMA 3DZIA 4JN6B 3KM0A 3I5MA 1OZAA 1VSVA 2YUTA 5FFFA 4YCAA 2DAPA 4YJHB 1I0ZA 5AXAA 1WDKA 1EFLA 3OF2A 4C7JA 3BZUA 1ZO8A 4W9NA 2GDZA 3BMOA 3ANLA 4FSHA 1PS8A 3G3EA 5T8KC 3BYZA 1HT0A 3S55A 1GZ3A 1NASA 1SEVA 1VM6A 4J7UA 3TZQA 3RJ5A 2D4AA 1GV0A 4TRNA 1QORA 4ONEA 2XXJA 4XJTA 1GL3A 3WMXA 4DQUA 4M89A 2VHXA 3JYOA 4C7KA 2QZ9A 3DOOA 1E5QA 1MLDA 2X23A 5A04A 2BELA 4HP8A 4ZQEA 4R3NA 4QECA 1ZFNA 1H6BA 2Q4EA 3JD2A 3ADOA 1P1HA 4OSPA 5IDXA 3MJSA 3AUAA 2C5AA 3GC6A 1LTHR 3QWAA 3U9LA 4PG7A 1F8GA 3NV9A 2ZYDA 4G5HA 3TFQA 3S2EA 2NQTA 3UAGA 4CODB 4BO3A 4II3A 1NFRA 3Q2IA 4I5GA 1Q0QA 2WJPA 2EKPA 3QJ5A 1K2WA 2IZ1A 3CIFA 5EN4A 2OORA 2G5CA 3OETA 3KYCB 4I5DA 1R12A 3KRTA 3NTOA 4FCCA 4YJDA 4GKBA 2F1KA 3E5MA 3I3OA 3HFSA 3EUWA 1VSUA 4GX0A 2W98A 5A9SA 1QYWA 2IDZA 5LDGA 2QW8A 4XYLA 3RFVA 4YAKA 2JAHA 3W6ZA 2IZZA 2YHIB 3H9JA 4N5NA 4BNTA 2WE7A 2ET6A 4MVJH 4PLHA 3TNLA 4ALKA 3QA9A 1NAHA 5BNFA 1GZ4A 1RM5A 1DXYA 1NP3A 2D1YA 2J3IA 2V6GA 2WEKA 3ANMA 5CDTA 3IJRA 4Z6KA 5JC8A 4JBHA 4O6VA 2G82A 1MC4A 4A73A 3H6KA 4NBUA 4BO7A 4B4OA 1BXGB 2VT2A 4F46A 2PD3A 1EK6A 1BWSA 3GH3A 1AUPA 1VE9A 3QVSA 3G1TA 2C59A 1HSOA 4L76A 7ADHA 2DUWA 2B37A 1D3AA 1NQ5A 4GPD1 1GAEO 3NDRA 5G2OA 1E7YA 2V6BA 3UN1A 1FDTA 1PZEA 2HRZA 4EW6A 5DCUA 2H6EA 1GFSA 4UEOA 3ZWOA 4CM4B 1VPDA 1P74A 2BGKA 3BMOB 1E1KA 4IMRA 2CD9A 4U8GA 3WDSA 5BNTA 1NXQA 1PQUA 4GKVA 3RU7A 3IOYA 4BB5A 4J1QA 5A4DA 5IN4A 3ITDA 1DFIA 3F5QA 2NU8A 2V65A 3FPCA 3JQ9C 5I7EA 5BT9A 1I2ZA 5C7IO 1E7RA 1BSVA 5U1PA 1HYHA 3LSYA 4J2HA 2ZB8A 3B70A 4INAA 5KCZA 4GVLA 1NVTA 1UXKA 2TMGA 1Y1PA 2OP0A 4I8XA 5L51A 3CE6A 5DZSA 4FFPA 5AXBA 1KVRA 2A9FA 4M87A 4XB1A 1T4BA 3ZU2A 5JE8A 3IL2A 5J23A 1QG6A 4RPKA 4D3FA 2GZ3A 3IP1A 3JQ6A 2Y1GA 1ARZA 4J4HA 3LZ6A 5GZ1A 5IZCA 4D7AA 2NWQA 2CF6A 4PVCA 3TN7A 3GPDG 2UDPA 2WYWA 1D4FA 4JBGA 2R6JA 3E03A 4YAEA 1LDGA 3AK4A 1E5LA 2J8ZA 2PKQO 2JFGA 2VHYA 3SVTA 1N1GA 2FPIA 1C1DA 1AXGA 5I9MA 1X1TA 1A7AA 1OC4A 2GF2A 2R2GA 4ND3A 3QV1A 1QKIA 1ORRA 1DO8A 1JAXA 3GDGA 5G0TA 5K6AC 1TEHA 2NLOA 2V6MA 4MP3A 3JQ7A 4YAGA 3OIGA 3C1AA 4FFOA 3AM5A 2RH8A 3QP9A 4UUMA 4XGIA 3G79A 1ZXBA 1I10A 4RF5A 4BNFA 4IQ8A 2O2SA 4IDAA 1PL8A 4L0QA 1H6CA 3DDNA 3DTYA 5A9RA 1OC2A 1YDEA 4UEJA 2EW2A 4JJIA 2X86A 4GLLA 3JV7A 5AYVA 3TZCA 1LDNA 3ASVA 4RPLA 4EJMA 4GI2A 2VWPA 3PEFA 2JAPA 3SC4A 4URFA 5DP1A 3W8DA 1C1DB 2DVMA 2C20A 2UUPA 4A10A 4ZU3A 5TSDA 3LC2O 5JY1A 4QO8A 1V8BA 1YS4A 1B26A 4MVJG 4E13A 2BI8A 4CV3A 2I99A 2PWZA 2AQIA 3M1LA 1F0YA 3GMSA 4G2NA 4TKLA 3B1FA 3VH2A 1V3VA 4K28A 3JD1A 4F6LA 2EEZA 4Q39A 1BMDA 3DAPA 1EDZA 4BO1A 1GQQA 2W90A 3WGOA 1E3EA 1HZZA 1SMKA 1YKFA 2GN4A 4JP3A 3PJGA 3JQAB 2QYSA 2OXIA 3UGKA 4O63O 3VOSA 1I36A 5I9NA 5KVVA 2VYND 2E82A 5CAEA 4ALMA 1RPNA 4RQTA 3OM9A 4WNIA 2FMUA 2WD7A 4E2WA 1AGNA 4MVJM 2P9GA 2GASA 3DOJA 4XDYA 2FP4A 2Y05A 3FF4A 2WYVA 2EWMA 3EK2A 1MV8A 2RHCA 4R1TA 1EZ4A 2A35A 4KWHA 3WQRA 3OH8A 4Y67A 1ONNA 1BVUA 4OIMA 4WCDA 1DOHA 2IEBA 2RHRA 3ZZNA 2IYPA 3T4XA 3DZHA 4YEDA 2J5KA 4NH4A 1WWKA 4U6SA 1NQOA 1LDMA 1PJTA 1PJ4A 4NMHA 1YVEI 3HSKA 1ENOA 5AXDA 4BQPA 2DBVO 3GVCA 1W4ZA 4FGWA 1HKUA 1J4AA 5KIAA 2D2IA 1YB4A 3RUCA 5JBIA 4O1MA 3ZW9A 4KMSA 4GH5A 5ITWA 2BLLA 4CL8A 1P77A 2E6UX 1ZK4A 1DB3A 3GFGA 3K5PA 4CM3A 4D41A 1N9GA 3KLPX 4QFCA 4YTEA 3RC7A 4WCFA 1KC3A 3X2EA 2P9CA 3WS7A 2YQ4A 3FNGA 4BHTA 1U2DA 4QQRA 3JQAA 1DC6A 3JD4A 2LDBA 2YHUA 3KETA 3OJFA 2ZYAA 3DMYA 1T2AA 2GN6A 4Q3CA 3E48A 2I3GA 4PG8A 2E4AA 1Q7CA 5JAMA 1VJ0A 4BKQA 4LW8A 5H82A 5DF1A 1P1IA 3UH1A 3GRKA 1HZJA 1A9YA 3D3EA 3H2ZA 1ADBA 1DDOA 1FMCA 4BNNA 1NBOA 3JYQA 2Y66A 4RO0A 4XD2A 3AI2A 3LYLA 4CR8A 5ITVA 4J49A 4BUCA 3WX0A 1ADGA 6LDHA 1M67A 4PN3A 3QW2A 5KWEA 2GUGA 1E3SA 2W8ZA 4RQUA 2YV1A 3H2SA 5F5LA 1QYXA 1WMAA 1PGQA 3H7AA 1Z75A 3HDHA 4A26A 5FI3A 5JDCA 1NFFA 3DAFA 2Z5LA 4IDFA 3F4BA 3CXRA 3DZGA 2OGUA 4PRKA 3IJPA 1YBAA 2Q2WA 5TX7A 1HDRA 5DBIA 1NHWA 2ZIZA 4CQLA 1FK8A 4WLVA 4BNUA 4WNCA 1EQ2A 3JQ8A 3V2HA 1UXIA 2RCYA 1LDEA 3WXBA 3DB2A 1HYGA 1L7EA 1LLQA 3ZHXA 4J7CA 4PLFA 3BMQA 3HZZA 4K9DA 5DBGA 5FI5A 3RBZA 4CMEC 4R5MA 2VHVA 4DIFA 5KVSA 4YWJA 2BGLA 3QVWA 4MOWA 4H15A 5B4UA 4FFNA 1TB4A 3OJLA 5CPBA 1RJWA 2Q2QA 3Q9NA 4PG6A 4NU6A 1XEAA 1JW9B 1J49A 4RVDA 2NQ8A 2VUUA 4M49A 3WGTA 2VZ8A 4TKMA 4XR4A 5L7YA 3VPFA 1Z6ZA 1B3BA 2X0NA 4HKTA 2GGSA 4XYBA 4LRSB 2GCGA 4XCVA 1LC0A 3Q11A 1PEDA 1X13A 2C7GA 1GADO 2WM3A 4ND1A 1NVGA 4B7CA 1KVSA 3ZV4A 1UP6A 3VZSA 1L7DA 3U4HA 3RUDA 1P3DA 1LXCA 1Y7TA 3PYXA 1Q0HA 2BFPA 4RVFA 4IDDA 4KUGA 4NI5A 2ZB7A 1NHGA 4XIYA 1P44A 1R37A 4AJLA 2I3AA 3ENNA 1H5QA 2BI7A 4IPTA 1LDBA 3ZGYA 3FHLA 3GRPA 3D5TA 1Y5MA 1ZNQO 2CMDA 3DMTA 5ENDA 4YRBA 3L77A 3BXXA 4AJ4A 1LQTA 4J90A 5BR7A 4TZTA 3MOGA 1N9GB 1WMBA 3NGXA 2Q1SA 2CVZA 1GYQA 2J3HA 3DQPA 2AQ8A 3L6DA 4CM9D 3K31A 1NR7A 1P9LA 5EQFA 4KZPA 3QWBA 5JMPA 2PKQP 3I6IA 4XX0A 3T7EA 4Q3DA 4D0RA 1KETA 1MGOA 2QX7A 1YE3A 5JC1A 2FN7A 4E0BA 4LMRA 1NYTA 4YXFA 2GO1A 1YBMA 1J0XO 1BXGA 2JD0A 5TF4A 3ZWMA 3B6ZA 5KVQA 1NPTO 2ZB3A 4CMEA 1NX6A 3U49A 4CPDA 2LDXA 1FDSA 2NADA 3FI9A 4I08A 3ZWVA 1CWUA 4ZQHA 4OXKA 4AJJA 4YT4A 3EW7A 1EFKA 1DIAA 1W8DA 3C7DB 3LT1A 3PQEA 1QYVA 3NT4A 5FF9A 4D3SA 4OSOA 4BIIA 4W82A 2Q50A 3TOXA 1GY8A 1IE3A 4R01A 1O5IA 3ROPA 1HLPA 1JTVA 1UZNA 1WXDA 3K73O 2GN9A 4NBVA 1K3TA 4W99A 4DQXA 1V3UA 1YQDA 5BNIA 1QMGA 4K6FA 1BTOA 2X9VA 3VPXA 3HUDA 3WBFA 2ZTLA 4BVAA 4ZRNA 4R54A 2OBYA 4I9UA 1GQ2A 4NHEA 1Z45A 3KTDA 4EGFA 3KBOA 4KDEA 4PGFA 2RBEA 1NQAO 5T5QA 4RGBA 3IC5A 3ICPA 1FF9A 3FNFA 4PZCA 3PWSA 4AVYA 3LLSA 4ID9A 2VTEA 5TJ9A 4MVJF 1LX6A 1YB5A 1RYEA 1QSGA 2A4KA 1E0DA 2C82A 4XB2A 5CPFA 4XRGA 2H9IA 3H5NA 4YJGB 3L0DA 4P8RA 5A02A 2G1UA 3FR8A 3GG2A 3JD0A 4QTZA 1VKNA 1R15A 1ZMTA 2JCVA 3D0OA 3OMLA 2Q1UA 2X0JA 5G4KA 1B14A 1N8KA 4J0FA 3KVOA 3DMTC 3MZ0A 3PTZA 3EYWA 3WFIA 4DREA 3L9XA 3QY9A 4AJNA 3QWIA 1MFPA 2OO5A 4TRMA 3VVBA 3BIOA 3PDJA 3GNQA 3FBTA 2VZ0A 4FJ2A 3ONDA 3UF0A 5CG1A 1YO6A 1LA2A 3M6IA 4CQMB 3N74A 5L45A 1GCUA 3AUTA 3JQAD 1YGYA 4MKZA 1DPGA 1KVQA 1QLHA 4JNKA 2PD4A 2AEJA 1UXHA 4MDHA 3UOGA 2C2XA 2AE2A 5LDHA 5MDHA 5TT0A 4YQYA 3JQ7B 4C4OA 1ZH8A 4D43A 5L7WA 4EJ6A 4AFNA 5AQ1A 1XWFA 2FSSA 4DC0A 2GZ2A 1DIBA 4DBZA 1ENYA 5JCXA 3FR7A 4OL9A 3ETEA 3HADA 4PLZA 1XA0A 4IDCA 3FNHA 1RM3A 5LCXA 3JQEA 4Z3KA 2FR0A 5COAA 3IUSA 3PGJA 1IL0A 5LC1A 1RM0A 3HNPA 2NTVA 1I24A 3LT4A 2W2LA 4I9NA 4WE3A 5IZ4A 1SB8A 4E2ZA 3KSUA 1EUZA 3KLMX 1LRLA 2Q1WA 2YDYA 3NX4A 5G0VA 2AEMA 5DN9A 1V9LA 2O2YA 2DQ4A 3PJFA 1VI2A 2OHXA 4DYVA 3RI3A 3VTZA 3NKLA 4PCVA 1U3UA 3LU1A 3CTMA 4Z9YA 1U8XX 5HM8A 3ETGA 4XZ3A 4Z3DA 2ZJ1A 5U9CA 5JNLA 4ALIA 4U0JA 2YDXA 4B3HA 4LISA 4FC7A 3QWHA 1OMOA 1GEEA 3KSZO 3QIVA 4MO2A 5JAQA 3I83A 4AG3A 5DOVA 3E6AA 3C1OA 3DC2A 4J43A 5TT1A 4XGKA 1IZ0A 2P2SA 1WAMA 4YB8A 3VKUA 4BKOA 1UP7A 3W4KA 4IJKA 4FN4A 2VHZA 4CM5A 2CFCA 4JJFA 3O8QA 5F1PA 2ZCUA 2Y1OA 3TZKA 2IYOA 1ISIA 3PHGA 2D0IA 4B7UA 3ZHYA 2X0RA 4BGUA 4DLAA 4BNYA 1WVGA 2O3JA 4XIJA 1PR3A 2B69A 2DFVA 1I3NA 3SXPA 3P2YA 2X6TA 4TRJA 5TQVA 3PDUA 5K6AA 4W4TA 3INTA 4HNGA 3ON5A 3JD3A 1SEPA 1DC4A 4Z9XA 4E5KA 2HRBA 3PLRA 1X15A 3L6OO 3ZNQA 1PR9A 5TGDA 1AXEA 4KTTE 3RUHA 3K30A 1G0NA 4E5MA 2VNSA 2QIOA 5EINA 3O26A 3OQ6A 4J2OA 3F1LA 3WWZA 1B7GO 1ONOA 3RWBA 3A9WA 1JDJA 2AG8A 4OKIA 4PLWA 2Y1EA 3ZWXA 4ZQGA 4E5YA 2GSDA 2O3RA 3GEGA 4KQXA 4B8WA 1V3TA 4PLVA 3NGLA 2XF8A 4Y9DA 5IDYA 2ZB4A 1SOVA 1R0KA 4PG5A 4RORA 2XXBA 2BH9A 2PFGA 3ZV6A 1MA0A 5JW6A 3ZHZA 4NK4A 1NR1A 5ENVA 1UUFA 4FOSA 3U5TA 3BTSA 5JO9A 1P45A 4ROSA 5CG2A 4XQCA 2O7SA 4IZHA 5ER9A 3KSDO 2ZJ0A 1NQTA 4H7PA 4CLEA 4YVFA 1NAIA 2PZLA 1D1SA 2DBRA 4BGEA 1PZGA 1JVBA 1S6YA 3HN2A 1NWHA 1U2GA 3A06A 3PJDA 1ZSYA 3NDIA 4GX1A 2Y0CA 1XELA 5L3ZA 2DTDA 1M75A 3K2BA 2EJWA 2X9NA 3AM4A 3RU9A 2D59A 1LU9A 4FD3A 1E6WA 4CM4A 1PZFA 1ISGA 1I32A 3WBBA 4EUFA 1PGOA 1H9AA 3H9UA 4KWIA 4YJHA 3OFSA 1P1RA 1ZEJA 5GY7A 2HCTA 2FZWA 5JSFA 4RDIA 3MJVA 3CH6A 2Y67A 4NK5A 1N5DA 1LLUA 1O8CA 4CM1A 3PWZA 1PQWA 4BNJA 4CMHA 4EYEA 4BV8A 1R6DA 3VPGA 1O9BA 3RQSA 1PJQA 3E5RA 5KJFA 4RF2A 4CLOB 1U3TA 3GGGA 2TMDA 4PIVA 3ZCXA 3DTTA 1DFGA 5JFOA 3H3FA 3EHEA 3GR6A 4HFNA 4XYGA 3NEPX 1RWBA 1QLJA 4OO3A 4ILKA 2Q99A 5THQA 1YXMA 4J1SA 3W4IA 3WQSB 3O9ZA 5FYDA 1SNYA 3ZWYA 2NU7A 1VKOA 4DMLA 5C5IA 2P5YA 1CEQA 2HK9A 2J6IA 4MKRA 2P9EA 2DU8A 5G0WA 1SZJG 3HE3A 2QRKA 1EBUA 1ENPA 1HE3A 3B1KA 3HHPA 4OGWA 4IIUA 1GUYA 3ST7A 4DXHA 2UVDA 3GG9A 5EPOA 5B1YA 1T2CA 1Y81A 4CM8A 3PPIA 4ALNA 1ZZEA 3WG9A 4DVJA 2DTEA 2HMTA 1OBFO 1T25A 1ZBQA 1E77A 3FTPA 3ONEA 4WOJA 4WEOA 4IXWA 1RM4A 2JL1A 3N7UA 1K6IA 3AU8A 4FW8A 3WYEA 4S3MA 3DWFA 1T26A 2GR9A 1CQIA 2HU2A 2BGMA 4I9HA 4HBGA 5AVOA 2I76A 4GQAA 2P4HX 4HADA 1IUKA 4FC6A 4Z9FA 1HE4A 5THKA 4JP2A 5DCYA 3ZWBA 2DPGA 3X2FA 1E1MA 3WICA 1QYDA 1F14A 3D5QA 4JXKA 3HDYA 1K89A 3OA2A 4E3ZA 5IXSA 1TT5B 1M2WA 4AICA 1DC3A 3PHJA 5L4NA 4BKRA 3RBXA 4IY1A 2RIRA 3ADPA 3Q9UA 4IBOA 3ZNPA 3TFOA 4BNKA 1QP8A 3STHA 3SBOA 2Y1FA 4A2CA 2WSBA 3CMMA 1LDYA 1GD1O 2B4RO 3WYBA 1ZK0A 2ZTVA 1ISHA 3P5SA 3QSGA 5L4SA 5IN5A 4J3FA 2VOJA 2EHDA
chains in the Genus database with same CATH superfamily
5KJCA 4HTFB 1UEIA 5J2UA 1WLSA 1QV6A 4XWYA 3UT6A 3K2IA 3K6SA 1E9RA 3A3KA 2LCQA 1ULSA 1F8XA 3IRUA 2ZIGA 3N0TA 4KQWA 1KEVA 2REQB 2Y3IA 3HO6A 4JLPA 3PXGA 5IRCD 1U3WA 4MWOA 4NV3A 1CHNA 4RJ2A 4U3JA 1I80A 4EHBA 3G23A 1NQVA 3JALA 3N2ZB 2ZBGA 2NPFA 1F17A 1TIPA 1W0JA 2XEXA 3FROA 3KZVA 3QPAA 4MLCA 2X0IA 1A9OA 2R4UA 1TQHA 1Z29A 1XOIA 4IVQA 5LM3A 3REOA 4OAOA 2VJLA 3RFCA 2VUHB 2ZJ5A 4Y1EA 4EOGA 1BJKA 2WT8A 3VR2A 2JVIA 2SHKA 2HPVA 4Z0TA 4G09A 1JA9A 3VYWA 5JSHA 1QRRA 1V1RA 5K7SA 5JQGB 2W2XA 1XZGA 4S1WA 2NYAA 3QUTA 4WINA 1SBIA 3U0VA 2IYRA 4MV3A 1J42A 3AVXA 1QCCA 4HDMA 1ZRSA 5HJEA 4MEJA 2BH2A 4BQQA 1VPWA 1I5EA 2OA0A 1ZUD1 1A71A 2H1HA 3GZTB 5KYVA 1RZRA 3WNVA 2OCAA 3LQYA 2CVFA 2WOJA 3CUEF 4S1TA 4A3SA 1KAEA 2CLHB 5LOVF 3D6JA 4Q4DA 3RS5A 4OMUA 2JEOA 2R8RA 2RHLA 4EF6A 3DYBA 5ALPA 2W6OA 2GD1O 5CYGA 3MIZA 4JYCA 3CE9A 5ALKA 2RE8A 1JEEA 4RLFA 2IHKA 4ZC8A 4HH4A 3N7TA 2C29D 3MUFA 3PNYA 3AOEA 1TO6A 1P7PA 2MSEB 3QH4A 1LZKA 4Y6SA 1YMQA 2V4MA 5EIBC 3RK0A 3U7EB 3BREA 3BMCA 3LIIA 1Z5PA 3PR3A 5DGXA 4HPWA 3EIOA 2VLBA 3PTLA 5F1KA 1FU7A 1W44A 2JHGA 2PZ8A 5GZ3A 4HDKA 1EIWA 2RJOA 3U3JA 4B3JA 3BD8A 3IKLA 2WZBA 2V8OA 2BOVA 3TLJA 1UMDA 3SJ7A 5FPSA 3EXIA 2B5OA 3PZRA 4HGNA 3DFUA 1WHTA 4JBYA 4J0CA 4D1YA 1XA3A 2NV2B 2RKOA 4C3ZA 4KX3A 1KQOA 2YZMA 4YYZA 1ZSVA 3IQXA 4OB6A 2FZVA 1RC1A 5HSGA 1YS2X 1ZK3A 2HJ9A 1ZJ4A 4Q1FA 1HQYE 1ULBA 2ZTMA 3I2KA 1PKEA 4Q9DA 3PHIA 4ESVA 3UY4A 4OM7A 3OEEA 1KO1A 3SYLA 1GPJA 1MF7A 4BO8A 1Y5LA 3IERA 1VPTA 1VG1A 3PKZA 3WMGA 1CYEA 2V0CA 3I53A 2VQFB 1E9AA 1PI3A 3QOYA 1JG6A 1ANKA 1I1OA 3MYYA 1F48A 3TRKA 1YOBA 1KJ9A 3GGCA 3WR5A 1P2SA 3AR3A 4K5QA 1T10A 4FYJA 1Z6QA 1X87A 2ZQZA 2WRZA 1UPFA 3TBKA 1L6IA 1NF8A 2XMRA 4QFMA 2R8XA 1MNAA 5H7XA 3OUZA 3RT7A 2RGRA 2VJCA 2A0WA 4GEGA 5CX1B 3LC1O 4RV4A 2CZCA 4TTVA 4DZRA 1FLVA 1RYNA 1Z0AA 4FFMA 2B83A 4RPGA 2FFAA 3OURA 3TKAA 3E3MA 4I1RA 2QK4A 1EXDA 3I23A 3FY4A 3KB6A 5JAZA 1F51E 4DIDA 2W2KB 5FPQA 2BGTA 5CX1A 2HIMA 1DIGA 3PK0A 3DWEX 3RLFA 1WU8A 1X7HA 1DO2A 1Z82A 1QE3A 2G5GX 2I6FA 3OOYA 3PITA 1Y7PA 4KN9S 4RHFA 2YMLA 4ZCSA 1PLKA 1PIWA 2ZIEA 3F8TA 1SBYA 5TEWA 1CEXA 4CFSA 4CL0A 4CMGA 5BRJA 3EXIB 3JTMA 4KQCA 3OJCA 4MINA 4O3FA 5C8YF 3SYKA 1SU4A 1T5TA 1JJBA 4ARZA 1UMKA 1AURA 1UANA 1F60A 2NZ2A 5F35A 3R75A 3WGMA 4LC9A 4QTYA 5C5EA 4KXWA 1FTYA 2ZI3A 2PNFA 3GZNB 5UKDA 3PUWA 3F6EX 5C31A 2X2PA 5HFJA 2H4ZA 4YRZA 5BVGB 1QQAA 1PJ2A 1A72A 2Z6VA 2Z3ZA 4IH1A 5GOTA 1CDEA 3O8DA 4BP9A 2O5EA 1FMFA 2GK4A 4UD6A 3BCSA 3V46A 3H5TA 2YYYA 4RSGA 2HXGA 3KYBA 2CHEA 3NBMA 4FQ8A 4L72A 1PNOA 1RVV1 3LMKA 1LBEA 1SCIA 3AINA 4IJ6A 3UCFA 3EEFA 3A2KA 2HIHA 1EGMB 2FPIB 3SYNA 3SHTA 2UXBB 4PZZA 1KJYA 3EGEA 1QS0B 3TM4A 4BFTA 2W37A 2NO5A 1U9JA 4TSFD 3MSXA 3F71A 3OZRA 5JXIA 5FTWA 1XEWX 4TQAA 3G2QA 1U28C 1VJCA 2A1IA 2QT9A 1QHXA 1JSXA 1RBQA 2D1QA 4YT5A 4BNZA 3KZNA 4WBNB 3R9WA 3BSWA 2C5GA 3O91A 4W7SA 1JIVA 3KU4A 5AKGA 3ZCVA 1OLSA 1P1CA 3JWJA 4BYGA 1QJCA 1RI2A 1DBVO 3OJOA 3NANA 4D4GA 2JGDB 2Z9BA 4KXLA 4DOMA 3UK6A 2AXEA 1ADYA 1RXWA 1ENZA 3MUEA 3ETDA 4JX9A 4MW1A 4DIOA 4B81A 1PW7A 4HAYA 3ZGXA 3E2PA 2VQ6A 2NO1A 1XMSA 3JQFA 4YALA 3UFBA 1GKUB 4FOTA 4LV6A 1V7PC 3TZ6A 4E14A 2WV7A 2KPOA 2WM2A 3R0XA 4I55A 1UDWA 1E8MA 1LTQA 1FRZA 2Y1DA 2ZREA 3I0NA 2VWQA 1NXWA 2IYYA 3PFWO 4DIEA 5M7EA 4MV5A 1ZIPA 2QM8A 3L7BA 2VAMA 3WMRA 1K0UA 3LLMA 3TFWA 1SXQA 1OH8A 2I2CA 3O7MA 3TQIA 3HG7A 1I1QB 1VHQA 4HDMB 4MVJE 4CKBB 2K6GA 3DOEA 4NFLA 5CVTA 4AZ3A 2PX3A 5CVEA 5GPBA 3TAHA 2ZXFA 3ZUPA 4ACAA 5EPUA 4D98A 5CDHA 1LQUA 1WUJS 1Q12A 4DNPA 1TVKA 4I19A 4FGUA 2V5UA 3ZE8A 1XZBA 2PAAA 3HA3A 4U6NA 3DAOA 3INNA 3ADBA 3RODA 1F12A 1OBOA 1QQ5A 4RMHA 3HKEB 5L9AA 1P0FA 1MB4A 2FK8A 4TQ9A 4R8KA 2VT7A 2FPXA 4ZO6A 4P7FA 1XCGB 3HR7A 3ONFA 2Q2VA 4I9GA 2RI1A 2JLUA 5IC5A 3BMQB 3GUZA 2YNMD 4CG2A 3MINA 1TQDA 2FLVA 4WNAA 5EA2A 5JS6A 1A4RA 1NR5A 1F2VA 2DERA 5T67A 3GP5A 4EYOA 1E5DA 1VGRA 4FKZA 2RAVA 4ETNA 1HDGO 3RIXA 4CQLB 4KUHA 4XFJA 3LBYA 1NXTA 1GO2A 3BILA 4KLZA 1FDVA 5B4TA 3IEUA 1UC5B 1X1EA 2PH3A 1CDOA 2AC7A 4RD2A 1ZK2A 1KVUA 4E7PA 4H4CA 3F8SA 2GTPA 2Y1KA 3IR7A 5I9LA 4QPPA 3PR1A 4F06A 2WNSA 2HAEA 2IX9A 2ZR9A 4CEHA 2AR7A 3MWEB 1WNTA 3MTDA 1G2PA 4KR0A 5HZMA 1EBFA 4B8ZA 4DSAA 1PVDA 2FX3A 4AJOA 2XGGA 3QJYA 1T6YA 1TOAA 4R69A 2VHJA 3HB7A 4AROA 1ABBA 5F9MA 2ISCA 4BRUA 1X7DA 1BE8A 4OXIA 4WOBA 4L5IA 3ROGA 3VUEA 1OWOA 1E2LA 2QEQA 4IIBA 4DCSA 2XCSB 1JZQA 3N8DA 2R0QC 3IP5A 4OJMX 2IUEA 2P27A 4BNIA 1YB6A 1YU6A 3PC4A 4HFMA 2PRZA 4WZAE 4EW1A 1UJ5A 1R4NB 3IIEA 3GZ4A 4TUYF 5DI9A 1ZKMA 3W5IA 1E18A 4D96A 1U0BB 3GA0A 3IBCA 2XJ9A 4N9QA 1KK3A 3EE6A 3IAXA 1ELOA 3RYIB 1LD3A 1N7IA 2XGOA 3O7WA 5FFNA 1SUSA 2HCFA 1WB4A 4H7JA 5CVVA 4M60A 1KDYA 1FSPA 4C03A 2ZYIA 4B3IA 3B85A 4OMDA 2PQ6A 1KP3A 4FEGA 1HO3A 3KR1A 3L6RA 5F21A 2IWHA 4IOJA 3B1VA 1Z15A 3BRCA 3IA2A 5I9SA 3V8BA 1PL7A 1VYUA 2D1SA 2PQMA 2PCLA 2RDMA 3D3QA 3IO3A 3N2EA 3B1XA 4KV7A 1KMQA 4A9AA 4CT4B 2Q6TA 4YLGA 4HZIA 5KKNB 4AL4A 4KVZA 1UJBA 3TOZA 3HACA 1FOEB 3OY7A 1JJFA 4PPQA 1TCVA 2L42A 4X8LA 1N6NA 2QGZA 3ETCA 1IQ0A 1Q92A 5TARA 3TJZA 2CVQA 4KXMA 4JBWA 4F7DA 2M6RA 1GFWA 3LA6A 1LRKA 1P80A 4U7WA 4L8VA 3QFRA 4ZJPA 4DBVO 3Q0EA 2HQRA 3GQBB 4QIHA 3EWNA 2PYDA 4CZ2A 2W2NA 3GRAA 2QM0A 1U0FA 2CFTA 4BKUA 4LV5B 1DV1A 3EC7A 1UOPA 1SVUA 1EUCB 1S0UA 4EPTA 4F12A 2ZDQA 4ER5A 1KQFA 1FRVA 3FMPB 3WADA 4CGYA 3RC8A 3M49A 4WZBA 1V47A 2IUSA 5IFLA 3BSSA 4QOEA 4EG7A 1RYDA 2DM6A 3LV8A 1BG6A 2J3JA 2BI4A 1HDYA 2C77A 2NYUA 4HEA1 3FIJA 3VAYA 1BOOA 1LQ2A 4OHRA 2XY4A 3VTFA 1UFOA 3ED1A 2EVWX 2JJ1A 4LGVA 4UFPA 4O4LF 3LXXA 4N0EA 4H6PA 4URVR 4KDFA 1Y3IA 3OWXA 5JH7F 1JBEA 1TF2A 1XR3A 4PYIA 2QYHA 4RA6A 2OOSA 3GJQA 1ODLA 2G8LA 2AOUB 3TG8A 3BXZA 3IEKA 1N7GA 5JDIA 3EZ2A 3ZWAA 2HLPA 3MTJA 3AY7A 4DCOA 3VYRB 2GAJA 4LRQA 1SAYA 5A3QA 1Q7BA 3WSTA 4IF4A 1YZQA 4A5OA 3S2ZA 2O59A 2BFOA 2GAIA 3BMNA 3QNUA 4ZVQA 3DL7A 1AGXA 1J6UA 3LF2A 4K6CA 5CRIA 1E79D 2O3UA 4AO7A 1JSZA 2PYIA 3K4HA 4EFDA 3AL0C 2BAGA 3M9LA 2ZI6A 4G65A 3OECA 1NBME 2R8BA 3U48A 1GQOA 4IVRA 3DVQX 1MVOA 2RKWA 2Y9PB 3IP3A 3PXUA 1IZ9A 4G1EB 2ONYA 2ZRFA 3TVYA 2JKYA 3KYCA 4CF3A 1ZW1A 2PMWB 2OK8A 4MAAA 4KAJA 2Z1NA 5DCLA 1WG8A 4UCWA 5E4YA 2HXYA 3PGKA 1SIBE 2IITA 4Y2YA 2HCJB 2ISSD 3CN7A 3UG6A 2NNWB 4GWGA 1ZN2A 3CX8A 2X2OA 4DIBA 4DLWA 4F1KA 1R6BX 2R6FA 4PX2A 1CUIA 3JASB 1XCPA 1CZHA 4XM2A 3I9NA 2YHSA 4H35A 3ZDZB 3EHDA 4LI3X 1TZJA 4MW2A 5CBPB 1KFJB 4PYKA 1YCGA 3NJ4A 1JFLA 2QZJA 1GCAA 3GHYA 3MELA 1TLFA 4B7XA 1FNSA 1PLLA 1CJCA 1EIZA 1H9BA 3H19A 4RW0A 1NM5C 3IULA 5K09A 3KFXA 5LWQA 5H3LA 1P7CA 3FCAA 2WWIA 2WQZA 3KUXA 2HDNB 3K32A 5LQNA 2DE0X 4FDAA 1YL7A 4BWGA 1SD2A 3ICQB 3C5HA 1JF8A 3NAGA 2GPYA 2YOFA 1EWQA 1ESEA 1A27A 1U8ZA 1X74A 1Z2OX 4B6FA 3IHTA 2RH5A 4LBWA 5I3CA 1X0XA 1OA0A 2G06A 2EKLA 3EVBA 3OO1A 2ODNA 3GVXA 5DLYA 3UM9A 1AV7A 2EARA 4N4AA 3ESBA 5K0NA 5TPWB 1Y4SA 5DNUA 3AZOA 1RWNA 1Z9BA 5I8ZA 1K0FA 1M2GA 4JKOA 3C8UA 4UVGA 1WUYA 4Q9JA 2I1QA 2PUAA 4DSUA 5ESXA 1DHRA 4RCZA 1BHO1 2OWDA 2TMYA 2CXSA 2P9ZA 3M82A 2VHEA 3LBAA 2OTCA 3MOSA 5FL3A 3D4BA 1CJVC 1LLFA 1KC1A 4Z4GA 3QENA 2V58A 4O2AB 5FHRA 5I7RA 4TWJA 4R9RA 3HJTA 1B42A 5H59A 4DCGA 3WTBA 4FFRA 4YP6A 5L95A 2R4QA 1U0TA 1FLDA 1UDXA 4PXYA 4LZNA 2NX2A 1S4MA 2AF4C 4KH0A 4MTLA 1DI0A 4DRXB 1E2FA 1V5WA 2F59A 2VRCD 4RFSA 1NQUA 2FB9A 3WWDA 1KNXA 3DEYX 5GIPE 1N2GA 1N57A 5HX7A 2NU7B 3C6YA 3VR0A 3I0ZA 3Q8MA 3BHMA 4KO2S 3FSRA 2VJOA 4QXAA 3AEZA 2EKZA 3A1TA 3PUHA 3RHSA 1SRRA 4QVIA 3JYNA 4WL0A 2CSXA 2FEXA 2ILVA 5EJ9A 2QRLA 1YI1A 3UICA 2PE5A 5CA0A 3THYB 2DFKB 1W94A 2ODEA 4QVGA 5TEVA 1QP0A 1IWBB 2O1WA 3H83A 5HQ3B 3CUWA 3VVLA 1AHPA 1U04A 1ZESA 1KEUA 4XDZA 4YUYA 3BH0A 1E2IA 2FI1A 2GILA 3DOIA 4QARA 3MTGA 3LDAA 5B57C 2WZQA 4L4XA 2POQX 5KNBH 3MNFA 4JI3B 5ADUS 1QG0A 4BV9A 4LVUA 3USCS 1FFWA 1N5OX 2WNHA 2XVAA 2B92A 4FDTA 5JY6A 3OSUA 2ROQA 2NUAA 2LTAA 3D2LA 3MEQA 4IMPA 5TS3A 5KYWA 3WSWA 3CNOA 1I30A 4HDCA 4OTZA 3SBXA 1TDJA 2JIRA 2ZSKA 1D0IA 2E4XA 2VQSA 3KWJA 1IXSB 3GQBA 1T1JA 2IXBA 2A9KA 1H1LA 1KO8A 2ZUWA 2QROA 3EVTA 3H65A 3H9GA 3K9NA 4M37A 3QFSA 4NYJR 5DV9A 2O5CA 4GNRA 5CLIA 3OPYA 1AK2A 4FE3A 1M5TA 3LDHA 3UJ3X 3ND5A 3MD9A 1OAKA 2VPPA 4IM7A 1QP7A 3EVFA 5A0TA 1PX2A 4FSDA 4R3WA 3FWYA 3IMFA 4MPPA 4UBMA 3R7FA 3GLUA 2A4MA 4GSLA 4LEIA 5B58T 1SUWA 1GUZA 3A37A 2PWPA 4RJTA 4ZA2A 3BS4A 3G9TA 5A5FA 2BM1A 3IO5A 1IM5A 3SIWA 2I4RA 4MIYA 1QNFA 4AXXA 1GGKA 1W85A 3KXLA 2GXQA 3W4JA 4CIXA 1J00A 2E1PA 3AIIA 2WYHA 3SFTA 2EBHX 3VQTA 3QF4B 2CUZA 3K0HA 1NF2A 3CPSA 3I8SA 3MERA 4QDKA 4S35A 1MX1A 1RHUA 3EUEA 4TYMA 4TXHA 4U0KA 4JODA 4ZWNA 5LIRA 3KBBA 4IS3A 2JFVA 4NFSA 4AKSA 3KTFA 3O6VA 5F7OA 1OXXK 4BASA 1NW8A 4XUGB 4GZLA 3STTA 4ND8A 1P6XA 2J07A 1I7PA 2EW8A 4R1LA 5DHFA 3LRXA 1N5MA 3CNNA 1F8UA 1RFLA 2AUNA 3HLKA 2CHVA 4FK8A 3VOBA 4ZHQB 4ZI7F 1GTSA 2EZUA 3ZU5A 5AI5A 3TLMA 1KYWA 4GUDA 3F6YA 3FHJA 1UXOA 4ZT3A 4ZVOA 4HPJB 1LWOA 4I5EA 4M6WA 1PJAA 3E27A 4GLOA 4TTRA 4EKEA 3BFKA 1A9PA 5ALVA 3ASUA 5JS1A 4UEWA 4N0DA 3EAGA 5KB3A 1CUEA 4I5IA 3ZOKA 1DQNA 1NV9A 2YV2A 2MINB 2VYVA 3GT3A 4G81A 4KDRA 4IHJB 1JDPA 3KCQA 3J7AC 1TGYA 2A14A 3B89A 4E5NA 5B6IA 2ORWA 1BN7A 4ZDKA 1UBLS 2PBZA 1Q0PA 2UZ1B 3K0BA 5ANRB 4ZANA 3WGIA 4TLCA 2H1WA 1IC6A 1XTRA 2GN0A 3Q5DA 1JYSA 4LWQA 1ESZA 1QBGA 1W85B 4ZEOA 3WP0A 4M8IA 5ALUA 3F8WA 4OHFA 2HIGA 2W6NA 2COUA 3WBKA 4BS9A 1RC8A 2MYTA 5HRAA 3D7RA 2CCJA 5KU7A 1E7WA 1YTLA 1G63A 4IRMA 3T7KA 1BXKA 1COWA 2CHUA 3DBHA 3H8VA 5AD1A 1KDZA 4GXQA 1KPHA 1XP5A 2BEVA 2OZLA 4RXMA 4P53A 2B78A 1J2EA 3MINB 5CA1B 2P35A 1X42A 3OSZA 2WM8A 4NPCA 4EF4A 2WFZA 4X7PA 2Y77A 2RI6A 3H11A 2KJQA 2QL7A 1GZSA 1KO5A 3CBQA 5K99A 3CR3C 4YV1A 4CT0A 2IS2A 4Y2XA 5LDDC 5JD5A 1U7OA 2NZWA 4PHTA 4A8JB 3LUAA 2HX1A 2BEUA 1USGA 2FN8A 4WECA 2HOQA 4HH0A 4X7MA 4CQMD 2R5FA 3KJGA 4RYDA 5LR6A 3TZHA 5BV2P 2O8EA 1L7NA 1XG5A 3BL8A 5FOQA 3H5LA 2RH4A 2H85A 1XZKA 821PA 1H6DA 2XMBA 5AKIA 3OTWA 2BR5A 1E1NA 1K5GA 2F62A 3F9IA 3Q3GE 3GB9A 2VDWA 3K9HA 4LRXA 1E61A 3VR3A 3E9MA 4XUCA 4JOQA 4MWTA 5JCJA 5FL7D 3NRJA 4J1NA 4JQZA 1F3LA 3WY9A 3W2TA 3QXGA 2YNMA 4I1UA 5CFZA 1L9XA 4RDXA 1LEHA 3L6EA 1I3LA 2AMYA 5JYDA 1GUDA 1YRAA 3I9LA 1JDTA 4L1KA 3M4ZA 2HBRA 3PC6A 1A9QA 2CF5A 3D7LA 3W9UA 3STYA 4GZ6A 2HSWA 2JFQA 3A1NA 3OQ1A 5E7QA 1XJWA 5A62A 1KMNA 4DNOA 4G86A 1Z2CA 1N0IA 3GU3A 4RK7A 2ZWAA 4Q9IA 4XQGA 5EMKA 4B32A 5JZOA 1HE2A 1T1SA 3WQHA 3JZFA 3ZWWA 5BN4B 2ZRHA 4R83A 5IG2A 4M1KA 2ZBDA 1SN7A 3QWFA 4E1AA 4ILEA 3E1GA 4ZD6A 1QR6A 2K5UA 4L4YA 4YIHA 5C8ZA 2XA2A 4ZRMA 2P8SA 3MAAC 4FBLA 2Q4RA 2J5BA 2V96A 2GZ1A 3C4VA 3WLJA 4D0SA 1ZL0A 3W2IA 1XLVA 4M54A 5FKJA 4QNRA 2VP9A 3Q3CA 2B25A 4BV3A 3PB3A 4HV4A 1GHTA 4JJ8A 3IBGA 2FHSA 2YRWA 4JC5A 4DBLC 1FFSA 1ODSA 1EJ2A 1XGKA 4HYTA 5IUJC 2GMWA 3L8MA 1HDCA 1XKQA 2PKXA 5D5PA 1NM5A 2ZBFA 1K7EB 3B20A 5CLJA 2EX0A 1YQGA 3HUEA 2B20A 5K6RA 3AB3A 4U8HA 5FXMA 2Q9CA 2WUFA 1SUIA 4EJSB 1UK6A 3E4DA 2F1IA 2B35A 3W05A 5EWMA 4BWVA 4AUNA 4JSTA 4QEKA 5KQGA 3FWNA 3G1WA 3AU9A 1P2TA 3OT4A 2ZATA 1NJ8A 4YRMA 1E2EA 1TNDA 3AQIA 3HKDB 3I5UA 1RPTA 1VJDA 2L69A 1OYVA 3IOCA 4IJWA 4JJZA 4TT8A 4U39A 5DSZA 4CV2A 5A9SB 3EQ6A 2P62A 1AX9A 1GR0A 3RG2A 4EHJA 3TSAA 5IEJA 3ZX5A 1JR2A 5LYJF 4HT3B 2H18A 1CUXA 1TF7A 4HXFB 4M8LA 2NTEA 3G9XA 3OQBA 3R6LA 4TTSA 1VSTA 2UZ3A 4JSYA 1JJVA 2I33A 5G3ZA 3WDKA 3SIRA 4L74A 4D8XA 4ED9A 3OZFA 2FWJA 2IQIA 4ZC1A 1XQ1A 4DHWA 4E94A 3PDWA 1G8YA 4TZ0A 3EGXA 2ZI9A 4ZN6A 5JO0A 2QS9A 4MCJA 5D84A 1HLGA 1GNSA 5J63A 1D9XA 3WQQA 1D6JA 1TVMA 2ILTA 2WPDD 1IFXA 2BY4A 4QQ8A 3W7VA 2C58A 4B4DA 2DYKA 1PZHA 2X5JO 4P98A 2IZ0A 1F7VA 1OWLA 4QNNA 1CUSA 1M1NA 2PUCA 3Q0IA 2FSVC 2O48X 4F4HA 5AW8A 1HTBA 1Z06A 5ALNA 3ZDDA 2C1EA 3L0CA 1DLIA 3P4XA 5EGNA 3D4NA 1TE2A 2F7SA 3RHFA 3OCUA 3WYFA 1G291 4ZQBA 1EFTA 2PIAA 3JARB 4NU8X 3T41A 2R6HA 3GEEA 3T7RA 4FHCA 4MWZA 2ZJ3A 4X90A 5JQGA 2HSDA 3ODGA 1EX1A 1SVIA 1Z08A 4FD2A 3U3OA 2WP0A 3F3YA 3LVBA 1BU5A 1CZUA 2AOUA 1DS6A 2OUIA 3ILVA 3KPYA 2YJZA 2G9NA 2V8BA 4ALJA 1L4HA 4BNXA 5JXGA 4O0LA 3TX6A 1B1AA 1E3IA 1OWMA 2A78A 4QBIA 3QVUA 1EEHA 4LK2A 3L0YA 4HVCA 3X2SA 1SC1A 5ALDA 1KVTA 2HK8A 4Z7JA 2SNIE 3LWBA 4HLDA 4O8ZA 5BURA 1P31A 5E4FA 1SQFA 3T6KA 1JQEA 1H2WA 2I6XA 3LQ2A 2EQAA 3RJ9A 5E6UA 3RABA 2I9PA 2X4GA 3KQOA 1Z2DA 1G5HA 1X7GA 2OV1A 2AHRA 1R9GA 3FMOB 4PSKA 4B6JA 3ND9A 5IAEA 1I0LA 1KU6A 4YX9A 2YZ7A 2ZSHA 1I3KA 4CKEB 4DN6A 1CYDA 3IAM1 3TF5A 3HJCA 4MUAA 4L02A 5HYVA 4MR9B 3IXMA 3PR2B 5B3JA 5CCBA 3F5MA 4QXMA 2AWOA 3R3XA 2EBFX 3O2QB 1JLHA 2PSEA 1R0CA 4G4SO 2EGHA 5EY5B 3BMCB 4UREA 4V3CA 4A91A 1QC5B 3BDIA 4O4HF 2HNBA 2PL5A 3O4HA 4NY1A 1SUEA 4R41A 1FU8A 2VWHA 3EWSA 3MG9A 4PX3A 4FDVA 2RHTA 2FEMA 4F4UA 5HXAA 3A6EA 3PVZA 2G63A 3G13A 2G40A 4Y1RB 3O93A 2FSPA 1J23A 4IDOA 5HKAA 5A06A 4CR6A 5B6JA 3H4IA 1NZDA 4GMDA 4OJKA 2GHQA 2F8TA 2IOQA 1YUMA 1XFAA 4OI2A 3GUUA 3U4CA 2QZZA 3OT1B 1I7LA 3VYUB 4B4VA 2W2LD 5AVRA 4MVJP 4HGOA 2NIPA 4MQ5A 1E3DA 1YC2A 3NIWA 5EERA 2Z9CA 3QKIA 3FGOA 1UAYA 1K97A 4R16A 3AFOA 4HNHA 4DG8A 3F2VA 4I4TA 3A1DA 2E9SA 1JKJA 2FG6C 3BWXA 4K8RB 4BMXA 5E7IA 4R9VA 1Q1NA 4RELA 3PUJA 4YC7A 1I4WA 3IDFA 1L3IA 4MVWA 5CX4A 2GFQA 1LJUA 2J3EA 1A8UA 1J70A 4FKMA 1PZMA 3FYTA 2CXTA 1E6UA 1OA1A 3C5VA 3HP7A 2PKEA 4M9SA 1WW2A 4IIDA 4LWPA 5LIPA 2X8BA 4Y98A 4A36A 1GQYA 2HV9A 1FRNA 2EWWA 5IYZB 2YZGA 1J39A 1QIGA 1TXGA 2VPYA 3BHIA 2QX4A 4IIHA 3AM3A 2JZNA 4NJEA 5DHAA 3WGHA 4D6YA 5BN3B 4TZKA 3FOZA 2RGXA 4KC0A 2H00A 1E1CB 3Q41A 3QE9Y 2K2QB 1PD0A 3IOBA 5F2KA 5B55A 4DNFA 4D4KA 1QV7A 4G0NA 1BVRA 2WBLC 1U7WA 4FONA 3OFND 4NJEB 5EE5B 4MW0A 1P91A 2OBFA 4IUYA 3M4JA 1RAIA 2FYTA 1EBBA 1D6NA 3N9IA 1D7AA 1SBTA 1KMCA 1PSDA 4JYMA 4HI0E 3DBLB 4G07A 3HDJA 1P7ZA 4EH1A 3I4CA 1I7DA 2PWAA 3T9DA 5J1TB 2CB0A 2NT3A 4IJ5A 2L19A 5KZMB 1GN8A 4ZOLF 2FEOA 5H5JA 4B6GA 1MEOA 2H4YA 1BRMA 1XZ8A 2VJQA 2YIDA 2E4UA 2P69A 2QMZA 5F77A 4ADSG 4ZV4A 3U7IA 1Y9EA 1WY5A 4ITUA 3TPFA 1D2MA 5IW8A 2BMJA 5BWBA 1N1MA 4DLTA 5BN3A 1XALA 4EK9A 2CL6X 2JA1A 1O0BA 2MYPA 2HCRA 5F78A 3VH4A 3SWWA 1L5WA 3GJ4A 2V0NA 5FOUA 1OX6A 2QUJA 1U9IA 2D3WA 1O8BA 3CCFA 2QWXA 4QBFA 4TQUS 3M5CA 1DWPA 3JX9A 2BSXA 3R5TA 3SLRA 1JHDA 1M6EX 1UZUA 2EIHA 4Q12A 8ADHA 3WGQA 4WK6A 4A6EA 1PF7E 5B2ZA 2WIFA 5KSWB 1LC3A 1WPQA 4KU4A 1MFZA 3FCCA 3ZZTA 3AY6A 1Z8NA 3LYHA 1TVCA 1LPMA 2J3KA 3ROZA 2AMFA 2IYNA 1I7SB 3ZE6A 4CM8B 3O8LA 1NE7A 2FPGA 2PGJA 2FZ5A 4IWNA 1UOOA 3C3BA 1P8AA 1XDWA 2H1FA 3GLFE 2EV9A 1IZ8A 3LVFO 5DTEA 3S4YA 4Z8YA 1PX0A 1W19A 1C41A 2DBZA 2NTJA 2RCNA 4Y9RA 1TEVA 4YDRA 4GBMA 2BHTA 3IQWA 4LJLA 3TLKA 4H3SA 1QWSA 3PYLA 2B94A 4EGCB 2W6JD 1HWYA 3CPHA 3FPEA 3KYDB 2HF9A 2D2FA 3R7NA 3RJMA 2YMQA 1SRQA 4CCAA 1EDOA 5EIXA 3M4NA 4GXTA 1BCSB 2JLQA 3GVHA 5C51B 3LUKA 1IULA 1CS0B 1BDIA 1GTVA 5KJ1A 4M46A 3UT0A 3QG1A 4R68A 2X4LA 3IQIX 5B4VA 3DA8A 5L53A 4GOKA 3L4SO 4JB0A 1A76A 4QPZA 1NXOA 3QYAA 5AHOA 2MR6A 1OFUA 2X0KA 5FBKA 5HQJA 1L1FA 3I6BA 4MUHA 1RIIA 4OOFA 4CM7A 2AQHA 3GXOA 4FR2A 2CGEA 1GQRA 1L3BA 1WJGA 2B8WA 2EGGA 2IV3A 2XNDD 4EIWA 2CDAA 4KTVE 4NBLA 4HAVA 3U7FB 2BFDA 4UXJA 3WWPA 5L51A 4EJ2A 1BDMA 2MSWA 3IKTA 1DQSA 1QF7A 3C85A 5K8LA 3CWZA 4YH1A 3N8HA 3JPWA 2LCFA 1COWD 1MIHA 2NZVG 3WJ7A 3LM8A 3SEQA 2GESA 4WZBE 1OQAA 1XD2B 1IBCA 1OREA 1TYAE 1DC7A 4MI9A 2IBSA 4R9NA 4M22A 5H9VA 4OLBA 2OP1A 1V2HE 3C8DA 1UJNA 1D2CA 1C1YA 4G0UA 1YK0A 2POCA 2DETA 3NNNA 4CUZA 4JITA 1BC5A 3AW9A 3RRBA 1EKXA 1YJ8A 1E3LA 1U28A 2ZI4A 3ZNOA 1TPZA 3DKKA 4JEIA 4FYXA 2C8KA 4U2CA 1U2GC 3AI7A 3FPSA 4YJFB 3E58A 4ZCPA 1QZTA 5G4KB 4F38A 1IOVA 4GEKA 3AUYA 2A3RA 1KAOA 2WPNA 3IT2A 5BMOA 4L9RA 3KXIA 3RUEA 5ALLA 1FE8A 1PJBA 1PD1A 1R66A 1TTHA 1JMYA 1WDMA 2ZFUA 5JCOA 2C2YA 3RYHB 1B0AA 1WEHA 3VDXA 1T3ZA 1Q2UA 1LV7A 3UUEA 2Z3WA 3EBPA 1Y5NA 3LLVA 2FW8A 1G4UR 1ULTA 4HZUA 1GNPA 3Q7PA 5BQFA 3WI7A 4WHMA 2LGJA 4EVQA 4ZICA 2C95A 3CGWA 1OAAA 5CDSA 4UM5A 5JNVA 4L5BA 2ZUCA 5LYYA 4GLFA 4JBIA 4WOPA 1XC7A 3FVTA 2I2BA 5KQLA 4JR1A 2P3QA 4QG7A 2AIRA 4H6WA 4F60A 2FWIA 1CY1A 3V1TC 5DKFA 1ONPA 1LBIA 1VGVA 4EJ0A 3E8MA 3CF6R 1BMFD 1ZMOA 4Z1MA 3RK4A 1C29B 2O8FA 2AC4A 2QJRA 5B30A 2BWJA 1PK9A 2ZP1A 3R3YA 4RY9A 1W4CA 5AKLA 1Q3TA 1XRLA 4FHDA 1T24A 3SLGA 4I1SA 2I7XA 3Q8WA 2RK4A 1TT5A 2DF8A 3U4DA 3MAGA 3UATA 2RFLA 5C9ZA 3TH5A 1Z74A 2ZSEA 5CIYA 1XIVA 4OX9Y 4U4AA 4HNQA 3UW3A 1JHZA 1XMVA 3RASA 3WIDA 2PLAA 1H9CA 1U2ZA 3CVJA 3GGPA 1WUKS 4MIOA 3TW8B 1JAZA 2Z3VA 1JXMA 4E09A 2BFAA 1ZEMA 1JLMA 4RVHA 1DKOA 1WQ1R 1PV4A 3FTNA 1WP4A 3LDGA 2ZVQX 1E6EA 1Q57A 3U0BA 1C9NA 2QUIA 1EWRA 1T91A 3WK9A 2VSOA 2ECQA 4N5MA 3TQOA 5KDOA 5HE8A 1JHYA 1NXVA 4RHXA 1V2GA 3QX8A 5FWNA 4JMPA 1ORHA 3FPFA 4LDAA 3VFDA 1NLFA 2Q9AA 3OA0A 1RIFA 2RBGA 4CIDA 1AUVA 4ODIA 4ZI7A 4CM6A 2Q8QA 1V41E 4LC1A 1A8QA 4E2XA 4I66A 4H3KB 4HDOB 2ZAYA 3C3MA 5JJ5A 3QPCA 4MYSA 1U8FO 2BONA 2C42A 2WLSA 4UUQA 4JC4A 4YK7A 1J5EB 3CMCO 3DC7A 5I7WA 2DLNA 5HDQA 1EXNA 3PGXA 4Q9NA 3QE3A 2D1FA 4CKZA 1QZ3A 2COEA 2W7TA 3KEQA 5E0KB 5G4LA 3ROQA 3AFHA 1JAYA 2YNMC 4UCFA 3N2GA 2WIJA 4Y9UA 2V7QD 5HM6A 3I6YA 5J5VA 4EHAA 3VO9A 1XVAA 1L5ZA 2FPUA 5FBRB 2EJCA 2WMDA 3DULA 4PNPA 3C3JA 1LTKA 1L5VA 3BVPA 3PICA 2BPOA 4HATA 3SFVA 1V4BA 3DEZA 5I47A 1H5UA 1YCFA 4HWKA 2IVZA 1ONSA 4P81A 4P32A 4XD7D 1E3MA 3KPWA 4YR7A 3FVVA 5LZ8A 2B8NA 3HFRA 3IIKA 1J5PA 4O2LA 3I9JA 1XMOB 5AW1A 3LPAA 2OHOA 5HBGA 1I4OA 2Q9UA 3I05A 3GUCA 3WAGA 4WDRA 1U4NA 1Z12A 3NTUA 3ZWPA 1H3NA 1AKVA 3OFKA 1X1DA 4YV2A 1RP7A 5GV7A 1VSVA 4X84A 4LQ4A 1NIPA 1BHQ1 5J2UB 2V7UA 4JJEA 1CNMA 4NSNA 4YRSA 1Z4MA 1WDKA 5AXAA 2DH6A 2KMLA 3K20A 3OF2A 5EGSA 3T4PA 2R3SA 4KKVA 2WAAA 1K8ZB 2P3LA 5ED0A 4QC2A 1XX6A 2AFIE 5CM8B 5B3LA 2CEKA 4CDMA 1PS8A 5AVKA 2E4WA 1CR6A 3L05A 3BYZA 3M6AA 4Q48A 1NASA 4JZKA 4H7KA 4J7UA 4RMJA 1SCKA 2X3FA 2WJAA 4NZYA 1GV0A 1QORA 2OZLB 4XJTA 3CEMA 4DQUA 3NHBA 4M89A 5CK4A 1NJGA 1HE8B 2ZRIA 4IEIA 4PW0A 2I91A 3QUCA 1BD3A 1UKEA 2JZCA 4Q47A 4C6HA 1NJ5A 5HKOA 5IT4A 4JV5B 2NXNA 1YF3A 4OSPA 1MT0A 5AOAA 4U7PB 5IDXA 4M9RA 1C9YA 4QOHA 3EULA 3AUAA 2XUZA 3GC6A 3KEGA 4HJRA 1IUPA 4R8LA 5EHGA 5SZJA 3ZDEA 4BFZA 5KWSA 1LTHR 1PZXA 1N5RA 3BK7A 3ZIUA 1CQZA 2G9UA 3NV9A 4RD1A 1RQXA 1O4VA 3L8GA 4G5HA 3TFQA 2X5XA 3UAGA 4CODB 1QRUA 4BO3A 1E1QA 1FXUA 1SVWA 4KVGA 2IXTA 5CT9A 4G89A 3DGEC 3OEHD 4MUNA 4DQKA 4RV5A 1KOFA 1Z16A 2Z2ZA 4CDRA 2H7CA 1MGPA 3BCRA 3G8CA 3P9KA 2VJAA 5D1HA 1OJLA 1L5NA 2OORA 4IO1A 1Y3DE 1CXZA 3OETA 1TUEA 4RSHA 1I6KA 1R12A 1VLZA 3KRTA 3FPHA 2NTYC 3E5MA 3N0RA 4ZOQI 4EO9A 4KR3A 3S2UA 4U2DA 1KDRA 1FYEA 5DEIA 3LCUA 4UHHA 2TMKA 4M1WA 2W98A 1SQ6A 4JU8A 2OVBA 2QN3A 3KCNA 2IDZA 2NSJA 5LDGA 5KNDA 2QW8A 2EFEB 1EGQA 5FP0A 4XYLA 4ZO8A 4YAKA 2BLNA 2YHIB 4BJHB 2WWHA 1OT5A 3FNRA 3K9WA 3L0OA 1FC0A 1U2PA 4PR3A 4TMYA 4H1HA 4RZSA 2VP6A 2WC1A 4S1NA 2XADA 5BNFA 3WGLA 4PZPA 3DUFB 3QELA 1DXYA 2B1QA 1NBAA 2WEKA 3AIKA 5B3AA 1VB5A 4KI0A 5C1BA 3I62A 5AW5A 4Z6KA 2I3DA 5JC8A 1U9YA 1KI9A 2VZEA 4O6VA 1FJ2A 2W6ID 4LF6B 2G82A 4K2AA 1XDSA 3UIEA 3G2HA 3NHYA 3H6KA 4CIAA 4DUZB 3ETLA 3PG5A 1JQ3A 4BRWA 1BXGB 1PQ4A 3D6MA 3L5KA 1NRIA 5C4MA 3LVRE 2Q3HA 5LKRA 1BWSA 4KR7A 1IRIA 4ZXPA 3QKRA 5MN6A 1IK4A 3C6QA 2EG5A 1JA1A 1BGXT 2C59A 2GXSA 3PFKA 4LX0A 2ZBUA 4F85A 4D6XA 4Q0MA 5LJIA 4L76A 4UDOA 4KMRA 5INTA 1YZVA 1GAEO 1RI3A 3C48A 3NDRA 4BLSA 4N5DA 2DR2A 1VKRA 1LCIA 4BMZA 2QTGA 2V6BA 1H1LB 1P61B 1FDTA 2ORED 3IP8A 5DWQA 1HTTA 3GFQA 5CVJA 1MEJA 2HEIA 2PT6A 4QASA 4GO1A 5DCUA 1VPDA 4QU9A 1NKSA 2R1TB 2BGKA 2X40A 4HGZA 1E1KA 3KJZA 5DB4A 2VIIA 1DG9A 4G97A 2IS4A 3FE2A 5FWYA 1JLSA 3H6HA 5A4DA 1Z34A 3ITDA 4D56A 4MCIA 1MAUA 1NSTA 1D9ZA 5KTPA 3F5QA 4K9KA 3FPCA 4NYJQ 4JUDX 5B1DA 5F98A 3QBDA 1I6WA 3ZXXA 2ONCA 2JG3A 2PLFA 1E7RA 1KARA 3DTVB