2NNLD

Binding of two substrate analogue molecules to dihydroflavonol-4-reductase alters the functional geometry of the catalytic site
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
324
structure length
324
Chain Sequence
ETVCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNVKKVKHLLDLPKAETHLTLWKADLADEGSFDEAIKGCTGVFHVATPMDFESKDPENEVIKPTIEGMLGIMKSCAAAKTVRRLVFTSSAGTVNIQEHQLPVYDESCWSDMEFCRAKKMTAWMYFVSKTLAEQAAWKYAKENNIDFITIIPTLVVGPFIMSSMPPSLITALSPITGNEAHYSIIRQGQFVHLDDLCNAHIYLFENPKAEGRYICSSHDCIILDLAKMLREKYPEYNIPTEFKGVDENLKSVCFSSKKLTDLGFEFKYSLEDMFTGAVDTCRAKGLLPPSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Dihydroflavonol 4-reductase
publication title Binding of two substrate analogue molecules to dihydroflavonol-4-reductase alters the functional geometry of the catalytic site
rcsb
source organism Vitis vinifera
total genus 111
structure length 324
sequence length 324
chains with identical sequence F
ec nomenclature ec 1.1.1.219: Dihydroflavanol 4-reductase.
pdb deposition date 2006-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2nnlD00
3P2YA 4ZD6A 4D3SA 2DPHA 4FC7A 5G4KB 3WQRA 3U9LA 1R0KA 1VSVA 4M1QA 1E6EA 4J7XA 2YDYA 3NTOA 1N5DA 4YACA 4IJWA 3TZHA 1MFPA 1CYDA 2OBYA 2R00C 1IPEA 2RAFA 5KOIA 2EIHA 4L76A 4TSKA 4MVJE 2HAEA 5DT9A 4UUMA 1ADGA 4NK5A 3LF1A 5A05A 3L6OO 5HTOA 2NM0A 3PLNA 1I2ZA 4LRSB 4MVJM 2Q1WA 4L75A 4RPHA 4CR8A 3DAPA 4BNKA 1YOVB 2I3GA 2I9PA 1I0ZA 2E48A 2X7HA 1K5HA 1WZIA 3GAZA 1T2AA 3G79A 4YT8A 2FZWA 3GC6A 1I8TA 1YBVA 2EKLA 3ZNPA 4QQRA 1W6UA 1KOLA 1NXQA 2CDBA 3BTOA 3WG9A 5L7YA 5JXWA 4ALKA 8ADHA 2Q99A 3DOCA 4D79A 4JJIA 1DAOA 4YRBA 4KQXA 2LDXA 1R37A 1V9LA 5HWSA 1O89A 1Y5RA 2RIRA 4Q9NA 2UV8A 1B3BA 1N1EA 1O6ZA 2HJSA 2ZB4A 4NFSA 3S2IA 5BNTA 3AU8A 3K96A 3PIIA 1PGOA 1H6BA 4HFJA 4E2ZA 4MP3A 4WLFA 1NVGA 2IEDA 4R1TA 4MO2A 4QTZA 1ZSNA 2YZ7A 1PGPA 4GSKA 4ZQHA 5ADHA 4BGIA 1GQYA 3PLRA 5JO9A 3SEFA 1NQTA 3C1AA 3V1TC 2J3JA 3QVSA 1D3AA 1AHHA 3FPLA 4PGFA 5DBGA 3AY6A 5L4LA 3V2HA 3AI1A 4KWHA 1M66A 1PJLA 3PHJA 5JAZA 2CDAA 1J5PA 3GDOA 3WQQA 4L9RA 4BQPA 5JW6A 4EW6A 1X7DA 3NGXA 1GZ4A 4MVJA 4OM8A 4WEOA 2EKPA 4D7AA 4Z0HO 2D1YA 1NFQA 3FBTA 3INRA 2FPGA 1C1DB 1NASA 3EVNA 1HDOA 5T8KA 4BNJA 2VNSA 1VKOA 4CMIA 3UAGA 5JCJA 4I5DA 1GZ6A 1MB4A 1LLQA 3H3JA 1PU2A 4XA8A 3ADOA 2R00A 5F21A 3AUUA 2UVDA 2DBVO 3DBRB 1B8VA 1YL5A 3ZWPA 1LNQA 4Y6PA 1CQJA 1KBZA 1LDEA 3OSUA 4J43A 1N8KA 3IC5A 2AW5A 4F46A 3AW9A 1GUYA 4OGWA 1EE2A 3BYZA 1QRRA 2IDZA 1DC3A 1NPDA 3UH1A 3I83A 4R9RA 1E1NA 1SO8A 2G17A 3ZW9A 3B6ZA 4NJMB 2H9IA 1DIBA 4YEDA 3CMCO 4JIGA 5A9TA 4ZN6A 4IM7A 4OKNA 4BKOA 4YT4A 4NI5A 1KY5A 3UW3A 4CR7A 2CMDA 4RPGA 4B3JA 3GVHA 2Q1UA 4MVJP 1NFFA 1PIWA 1UXGA 1KYQA 1YGYA 2GO1A 2HUNA 2OP1A 3F1KA 4HP8A 4QSMA 1I3LA 1BGVA 2QRLA 2Z95A 3K5PA 4BIIA 3QWFA 1ENOA 2BFOA 3QY9A 4CUKA 4RZHA 2VWGA 4CL3A 2SCUA 3PQDA 5CPBA 1HSOA 2EJWA 1GUZA 3WSWA 2Y68A 2O2YA 3K2BA 4WOJA 1UP6A 2JD0A 3OA0A 4OKIA 3DBLA 4B4WA 4OSOA 2EW2A 3H3FA 1I36A 2P91A 3H7AA 2HKIA 4YPOA 5KJEA 2A9FA 3SLKA 3PJDA 3I4CA 3LC2O 3OQBA 4TROA 3RUDA 4CMCA 2RH8A 5C3MA 5CEEA 1EBFA 2NACA 3COSA 2BGLA 2CVOA 3TNLA 3O03A 2GRAA 5TSDA 4PLZA 4GX1A 3A06A 3GPDG 4TWRA 3EY4A 3OIGA 4TKMA 1PZEA 4OYRA 4YCAA 1W0CA 3FBGA 3DFUA 3W8EA 1YBMA 1LRJA 4XQGA 1MG5A 2JKVA 2WDZA 4BNUA 2X9NA 4NH4A 1DIHA 2YY7A 1LXCA 5U9CA 1Z45A 4DTIA 2V6MA 3M6IA 4R16A 5AOVA 3WMXA 3L4BC 5F1PA 4O59O 1E7YA 5EJ2A 5J23A 5CPFA 2Y1EA 2PK3A 3IQDB 3VKUA 1IY8A 4JJGA 2PKQO 5DULA 1IOLA 1IPFA 3WNQA 3VTZA 1ULUA 3C1OA 1I3NA 2PD3A 3FF4A 4QUKA 3ZI0A 5IJZA 4AJLA 3I9MA 3GVIA 3K2EA 2QYSA 2WE7A 4E32A 1H2HA 1QR6A 1O9BA 2XAAA 1XLTA 3MJEA 3OQ1A 1R4NB 3IUSA 3MOIA 1QYWA 1CRWG 1D4FA 4QEDA 2GZ1A 3HHPA 3V2UA 3CSDA 1GFSA 4A10A 5JNLA 4A73A 4CQMB 3O8QB 2WTBA 4NPCA 2GUGA 3ASUA 5GZ1A 1X1EA 4CMJA 3L9XA 1ISMA 2Y67A 4GVXA 4DYDA 2ZATA 5I7FA 1QXSA 1WXDA 4AICA 4DPLA 1GQQA 3L07A 1YH3A 3WR5A 3KM0A 4FGWA 2G82A 2P4QA 4JJFA 3GT0A 4PLGA 4PLWA 2A94A 3PFFA 3G1TA 1ZO8A 4MKXA 4RORA 4L4RA 3CZMA 1E77A 3PXXA 1E3EA 5C7LO 1CF2O 4E12A 2OL4A 4L4XA 2NQ8A 2J3HA 4E5NA 4LVCA 1BXKA 1PJ2A 2BMAA 1U7HA 5CDUA 1JQBA 1DFIA 3CINA 5B37A 1YVEI 3AFNA 5DP2A 2PH5A 1Q2XA 4BNYA 2C54A 2Z1MA 2B37A 1B0AA 3GLQA 1GY8A 3FTNA 1PQUA 4Q3CA 5F3RA 1HKUA 1N92A 3TFQA 2IE0A 2EEZA 2PZMA 2Q2QA 4FJ2A 2ZCUA 3QWAA 4H3VA 4EUEA 4ZICA 4BL5A 3AUAA 1YOVA 3L4BA 1PGQA 4BNNA 2WYVA 1PS9A 4BB6A 1LI4A 5EN4A 3FNFA 2VHZA 2PFGA 1KC1A 3WTCA 3U0BA 4Y6RA 1PJSA 1SEPA 4ZRMA 5THKA 4WLOA 1ZMTA 2EV9A 5JDIA 4MVJF 1ZEJA 3MJCA 3H9GA 4JP3A 3D5TA 4AJEA 1YXMA 4CM6A 1M6HA 5I9NA 5ICSA 1FMCA 5T67A 3X2EA 1UH5A 2GERA 2A35A 2B4QA 3OH8A 3GMSA 2I99A 4PZEA 4XR4A 2OO5A 3SJUA 4RJTA 4BO0A 2OXIA 1GPJA 2VWPA 3SXPA 5JS6A 2EW8A 5TNXA 4M89A 4HBGA 5TIIA 1JWBB 4Q3AA 2ZIZA 3JQ8B 4YAIA 5B4VA 4M87A 1XG5A 3ROQA 4C4OA 5KWEA 2HSDA 2EKQA 4DQVA 3RD5A 2O3UA 3ENNA 1PS8A 2VRBA 4J1SA 1NQAO 2ZTUA 3E5RA 1E5QA 3JYNA 1L7EA 3A1NA 4G81A 4OSPA 4A2CA 5TT0A 2VT2A 2A92A 2I66A 1I5RA 3Q11A 1A4UA 3OHSX 4ZRNA 3OFSA 4FPXA 2B5VA 4XCVA 3VTFA 2VHVA 3JTMA 1I24A 3HB4X 4RO0A 4D42A 4YAEA 1B15A 2D0IA 1UP4A 5KKAA 4UVEA 3U4HA 4NMHA 2E82A 4MJLA 5EL0A 3EYWA 1L7DA 1YL6A 1N2SA 2EP7A 1Y8QA 4FQ8A 1D1SA 3E6AA 4R41A 4ALNA 4ZJUA 4F3YA 1LDGA 3KYDB 2BGKA 2NVUB 1HF3A 1R16A 4JROA 1B8PA 2X58A 1LQTA 5KTKA 4J91A 3DZIA 2B69A 4W9NC 5ENVA 1KVQA 1P77A 3CEAA 1XELA 4LW8A 4ND2A 1LSUA 4K28A 3Q6IA 4L8VA 4IDFA 1RYEA 4U6SA 3RC2A 5IG2A 1XA0A 4B79A 3ONDA 4HNHA 5MDHA 4J0FA 4LMPA 4MOWA 3SC6A 4WE3A 4GKVA 2X5KO 3TZCA 3R0IA 3W6UA 3INTA 2WYUA 2GPTA 4YWJA 3HADA 5JYEA 5A02A 4R9SA 3VZPA 4Z3KA 2ILTA 5F5LA 5A06A 2CFCA 4XB1A 4GQAA 5A5EA 1NM5A 3U3XA 1U3VA 2B0JA 4D3DA 2V6GA 2HK7A 3R3SA 3ETDA 1G0OA 1W73A 1ZKMA 2C59A 1LUAA 4DPKA 5CDGA 3GVPA 1A72A 1K6IA 1EVIA 3AM5A 5IZCA 4FFNA 1Y8RB 3HB5X 3GMDA 5JAIA 1GADO 2FP4A 4B4OA 5EPOA 3OJOA 4OOEA 1GEGA 3PWKA 3EGOA 3EZYA 4U6QA 5IDWA 4YAKA 3BMCA 1ADCA 2D5AA 2X0IA 3HG7A 4BNWA 3LLSA 1LC3A 4G5HA 1EEHA 3FTPA 1I3MA 3RJ5A 4CV2A 3HFGA 2A4KA 1FF9A 2YUTA 3FNHA 3OQ6A 5EESA 4CMEC 1D7OA 3RU9A 3S8MA 3WGQA 1NFRA 2B36A 3RUIA 5BSHA 4EJ6A 1HDGO 3BTSA 3EHEA 3CH6A 1BXGB 2ZTLA 3BMQA 4BHTA 5KVVA 3U09A 3A9WA 2PLAA 3LT2A 1NHWA 1DIAA 3SLGA 4LISA 2FPIA 5HA5A 2FRDA 1Y6JA 1HYHA 1YS4A 2ZYDA 4W9NA 4FC6A 5B12A 3OJLA 3ZWBA 3K92A 3F9IA 2ZKLA 4AVYA 3NEPX 4DGSA 1JAXA 4WGGA 3TZKA 4CUJA 1TT7A 1NWHA 1LSOA 3Q2IA 3RKRA 4YYZA 2BELA 3DONA 4BNMA 5LCXA 2O3JA 3BA1A 5CFZA 5I9LA 2NTVA 2V6BA 4ROSA 5DDIP 3LQFA 3T4EA 4EBFA 4XQEA 4GSLA 2GNAA 4DQUA 4IJUA 4PCVA 4ID9A 4ALJA 3VDQA 2EHDA 4U0JA 4PLCA 3E9QA 1XQ6A 4YBZA 3N58A 4GX5A 4QFCA 1PWZA 1N7HA 3MJVA 3WJ7A 5EQFA 3T7EA 4CM1A 2J5QA 1AGNA 5IN5A 3LVFO 4AJIA 1A27A 4CM5A 3PFWO 3U4CA 4JP2A 3C7CB 4EZBA 3H4VA 1GQ2A 3QVWA 4EUFA 3AFMA 3GZNB 4IIVA 3QLJA 2DVMA 4PG4A 4QX6A 2UUPA 4YQZA 4OJNA 4DRYA 4B7UA 2AEMA 4Q3DA 2FR8A 3ETEA 3I23A 5DBFA 3MWEB 2CF5A 1Y5MA 2IZ1A 1AUPA 3HNPA 1P1JA 4II2A 1T26A 2OGUA 3L0DA 4I5FA 4F6CA 4L73A 5FYDA 1JVBA 4OXNA 3V8BA 1Y9EA 1PX0A 1GAEO 2D8AA 3OBBA 1E7SA 4B8WA 4URFA 2O48X 1BWSA 2P9EA 1UZMA 1SAYA 4OXYA 4H7PA 1ZMOA 2CF6A 2YQ4A 3OA2A 5COQA 3P7MA 4GPD1 1E3WA 3PDUA 4NZ9A 5JDCC 5KNLA 4BVAA 1Q0HA 2YHIB 2DBQA 3V2GA 5G0UA 3GDGA 3UCXA 1T1RA 4BNXA 4UEOA 4UREA 3DR3A 3PTZA 3H65A 1HETA 4HFRA 2HCTA 3L4SO 2Q1SA 1MA0A 2OFPA 3RUHA 2FOIA 2I5PO 1BHSA 2YDXA 1U4OA 2QX7A 4F45A 4R01A 3WFIA 1TT5A 2PV7A 1F14A 3KTDA 4BNFA 3QWBA 5CP8A 3ANNA 4EUHA 2Y1DA 3KO8A 3TN7A 3SVTA 1V6AA 3EAGA 1HWYA 2X1HA 4YQYA 1G1AA 1MXFA 4EJMA 4XDYA 3WTBA 5L45A 2Q46A 1Z73A 3H5AA 1H9AA 4XX0A 3DXFA 2X0JA 3U4DA 1PZHA 4CLDA 4QO7A 3D3WB 5K6AC 2QYTA 3AM3A 1MLDA 3CKYA 1MFZA 2J3IA 3DBHB 1S7CA 4OH1A 1MV8A 1P9LA 1SBYA 1QLJA 3GH3A 3I1JA 4DPMA 4KOAA 1AXGA 1YO6A 1RM3A 1WNTA 1XEAA 2DTXA 5I8ZA 4CR6A 1ARZA 3NDRA 2ET6A 1YB4A 1V3VA 1K6JA 1FK8A 3LF2A 3JD2A 1GYPA 1XWFA 4PLHA 4ZQEA 2W2LD 3VOSA 1GL3A 1LLCA 4TQGA 3ZWXA 4XYEA 2FZEA 4TMFA 3MJTA 4S3MA 3MTJA 1Y9AA 4CLOB 1EQ2A 2VHYA 1ONPA 4M55A 4NU5A 3SC4A 5B4TA 2IXBA 2VTDA 4DIFA 1UXJA 4FGSA 4UVHA 2GN9A 5JDCA 2OBNA 4NHEA 2EJVA 3D4OA 1D8AA 1BG6A 1I2CA 3ROMA 4NBWA 1NPTO 1ZJZA 1K89A 3KBOA 4R1UA 3RBXA 1JLLA 2HLPA 1KS9A 3R1IA 4XQCA 4GL4A 2P9CA 3ZWCA 4K6CA 4O5OA 1NTOA 4ZHSA 5L4NA 1VJTA 4E5MA 4DWVA 4B3IA 4LVUA 1C0IA 3UF0A 4RLSA 3AUTA 5I7EA 1ID1A 4BQRA 4I9UA 4R1NA 2DPGA 3EMKA 3LZ6A 5COAA 1DPGA 1GDHA 1YJ8A 4HNGA 3ZCXA 4IZHA 4CLXA 3C3XA 1O8CA 3QP9A 4Z9YA 2VZ9A 5T6BA 4W82A 5TX7A 2P5YA 1IYZA 3AJRA 3GVXA 3BMOA 4B4UA 2ZCVA 3S2FA 5C5IA 2NSDA 3WYCA 5FF9A 1OFGA 3VH4A 1SOWA 4XJTA 4AJ1A 1QYDA 2DAPA 1Z75A 4KZPA 3HZZA 4GMFA 4WEQA 3OP4A 2PD4A 4NBVA 9LDTA 2Y1CA 3UGKA 5K6AA 1GYRA 3DTYA 2QQ5A 4CL8A 1JN0A 3TOZA 2OZPA 1SEVA 4R1SA 4O1MA 1UZLA 2IXAA 2OOSA 1U3UA 3F4BA 2NTJA 3QE3A 4IDAA 4U7WA 3M1AA 4LRTB 4Y6SA 3KSUA 4KQWA 1HDRA 2B35A 4Q3EA 3PGJA 4A03A 4Z0PA 2JAPA 1ZIDA 2VQ3A 5U4QA 3QVXA 4DBVO 3WIEA 4M8SA 2VYVD 4IMRA 4BV8A 1H5QA 3C7AA 1YRLA 5GMOA 4KUGA 5IXSA 1F0YA 3EC7A 1OC4A 4GVLA 4C7KA 4U0KA 2P4HX 5A04A 4P4LA 2BLLA 1GR0A 3NV9A 2DQ4A 5CAEA 4J1TA 1GEEA 4BMSA 1HRDA 1XU7A 4I5EA 1P1HA 2CY0A 1ZK1A 3W8FA 4TVBA 3VHRA 1SCUA 2RCYA 4H15A 4RVHA 1NBOA 1J6UA 5AQ1A 5ER9A 1PJBA 1AHIA 5BQFA 2V7PA 3TRIA 2JCYA 3HN7A 4Z0TA 5JC1A 3RKUA 1ISIA 1ISJA 3JQAD 4EI2A 1OOEA 2X5OA 3T4XA 2Y93A 3GPIA 1BDBA 3WXBA 4BGVA 1EVZA 4YXFA 1AN9A 3PRJA 2GSDA 2W2LA 1MXHA 5JY6A 2XOXA 4JQCA 1K2WA 4YDRA 5DP1A 4BO3A 4YAGA 1WZEA 4RVDA 2AXQA 3ST7A 4BKRA 4BNVA 1R4MA 4E3ZA 2HMSA 3IJPA 1XYGA 1OI7A 1CERA 3JQFC 4MP6A 3HSKA 4RQUA 2J8ZA 1XHLA 4QECA 5GY7A 4CV3A 1HE2A 1NWCA 4R54A 4UVGA 3ZU2A 3UVEA 4GGOA 1N9GA 4E2WA 5F1KA 4NBTA 4D44A 3GGOA 4YJFA 3VPSA 2GF2A 4CMBA 3RASA 5ILOA 1PSDA 1H93A 2C7VA 4ND5A 3DL2A 4D45A 2PWZA 1HE4A 3ZNQA 3U49A 5L51A 1DRUA 3DZJA 1NYTA 3BIOA 3AWDA 1SC6A 5C7IO 3TWOA 4U5QA 4FB5A 2VOEA 3RQSA 3GEMA 3JYPA 1I2BA 2W2KA 3JQEA 3JQBC 4NFHA 1ZSVA 4J1QA 2YQ5A 5JBIA 1Q7CA 2AHRA 4XDZA 2TMGA 5JLAA 4AJNA 4R3WA 3DDNA 3ZV6A 1UXKA 1ADFA 1A9YA 2XF8A 3QIVA 3D64A 5JFOA 3NUGA 1NVMB 1HZJA 5T64A 1HEUA 2BF7A 5DNAA 4CM8B 3AI2A 1KIFA 4AJ2A 5CG2A 1VLLA 5COBA 4IPTA 4TKLA 3UN1A 1T4BA 5LDGA 1HSZA 1HYGA 3E1KA 4WOKA 1IULA 5JC8A 4ZQGA 3ICCA 3I6IA 5IDYA 4DMMA 4IS3A 5BSGA 3W4KA 1H2BA 2PD6A 3VKVA 1DHTA 2GZ3A 2DUWA 2NQTA 4GWGA 3ZU5A 3KYCA 2VN8A 1WWKA 5HBRA 5CEFA 1X7GA 2VYVA 1EVJA 1MX3A 3WOHA 4BGEA 3GZ4A 2FSVA 4E33A 3DAFA 5A9SB 4TVOA 3HN2A 1WVGA 4MKZA 4AJOA 4CV1A 3CE6A 2BFMA 3RFXA 3I9JA 4AJPA 3JQFA 3AI3A 1IZ0A 4YT2A 3C7DB 3RCBA 1VJ1A 2C2XA 3GAFA 3ZNNA 3CXRA 4I08A 1BSVA 3PEFA 3FRJA 3D5QA 4PRKA 2Q4BA 3JQAA 4EGFA 3ZWVA 1HE3A 3D1LA 3PZBA 4UEJA 2C29D 3JD4A 1MC5A 4E4YA 3F5QA 3I9KA 2JHFA 4W99A 1O95A 4CM9D 4N5NA 2NTNA 1H6DA 1ZCJA 2DT5A 3V5NA 3IS3A 3WWYA 1E3SA 5JCXA 3DHNA 4MIEA 3WNVA 4N5LA 1C1XB 3JQBA 4CLRA 2X9GA 3VVBA 1O94A 1EUCA 3LU1A 4H16A 2EWMA 3BMNB 3I9NA 3RC9A 3BHIA 4CLOA 3ZV4A 4P38A 2Q2VA 1HXHA 3VH3A 1QP8A 2I67A 4AG3A 5H83A 1UXHA 5A9RA 4XYGA 1YQGA 3UCEA 3W4IA 3FNEA 3LDHA 4WLUA 1BDMA 2GCGA 2PGDA 3TL3A 1ZK4A 4CQLA 2WD8A 5FI5A 4NJOA 4PZDA 4WECA 5MGBA 3GGPA 5AXBA 1B16A 3H5NA 1IHXA 4II3A 5G4KA 2IODA 3RVDA 3JQDA 4IDBA 4EITA 3BHJA 1WAMA 2HMVA 3GUCA 5AXAA 3TPCA 1D1TA 1YDEA 3F1LA 2BHLA 2F00A 2FSSA 3AUSA 1ULSA 4DBZA 5ITVA 2E49A 2J5KA 1W8DA 1GPDG 3HDHA 4IZIA 5HRUA 3ROPA 2VZ8A 2JFHA 5JSFA 1U3TA 1NP3A 4Z6KA 4DUPA 1PQPA 3PYMA 3NTQA 1GV0A 2DU8A 2HK8A 1R15A 3CIFA 2BI8A 5C37A 3DAGA 2D3TA 2EG9A 1HT0A 4RF2A 4YAJA 3RWBA 1E3IA 1FDSA 2O50A 4RDHA 3A14A 5K0ZA 3W1VA 4KWIA 3TL2A 2WD7B 4LK3A 1T2DA 4QXMA 1QKIA 2J6IA 5CG1A 4ZGWA 3UICA 4M54A 4TZKA 4M49A 3D3EA 3RUAA 1B26A 4EDFA 4E6PA 4GAEA 4MVJI 1DIRA 3ITDA 3H9EO 3NX4A 3WGIA 2CUKA 3DMTC 1Q1NA 5TT1A 3JCZA 3FD8A 3GK3A 1CWUA 3RAJA 1A5ZA 5CHEA 4E31A 4IMPA 3W6ZA 2BFPA 2XXJA 3GHHA 3WS7A 4KDEA 2G76A 2NU6A 3JQ9C 3PYLA 1DJNA 1B14A 3NYWA 3WFJA 1ZK0A 1U7TA 5TQVA 3S2EA 2YV3A 2O4UX 2H63A 5TC4A 3B70A 4MIOA 3AK4A 3EUWA 2GN6A 1EZ4A 1ZBQA 4JX8A 1NPYA 1JVSA 4BKQA 3QQPA 5CDSA 5BNIA 1TA4A 1DC5A 4UVIA 2FN7A 1KEUA 1UR5A 3L6EA 1C14A 3RBVA 4LSWA 2NU9A 5IN4A 4MP8A 1C1DA 4DIBA 1O5IA 4CM9A 3RUFA 5EQDA 3RUEA 2DUUA 2W4QA 5L95A 3IUPA 5DCWA 1ORRA 2BGMA 4NFYA 3RBZA 3WICA 4PG5A 1LU9A 4P8RA 2VYND 1PTJA 3TSCA 3M2PA 1LRLA 4FFPA 3V1YA 2GASA 4CQMD 3DBRA 4WNCA 2I6TA 1BW9B 4BO7A 1T2FA 5A4DA 1GUFA 3UHAA 5IDXA 1BMDA 1HDCA 3T7CA 3GEGA 1IHYA 1OAAA 4IDDA 1VM6A 2DBRA 4DMLA 3NT2A 4FOSA 4GLOA 4NJMA 4QFDA 1PQWA 4BGUA 5C7OO 2C20A 2ZK7A 1Y1PA 2ZQYA 5AXCA 3GNSA 4D41A 3CTMA 5TLSA 3S2GA 3ZWMA 1N1GA 3PHGA 2ZYGA 5DCYA 3GFGA 4IINA 2YHUA 4CV0A 3AY7A 5TF4A 4OXKA 1J4AA 1ADBA 1HDXA 4ALMA 5KJ1A 3DMTA 4OQYA 3IKVA 4E2YA 4NU6A 5BT9A 3KEOA 5B1YA 3HDJA 4DC1A 3ZGYA 1IB6A 4ZVVA 2OMEA 2Y0DA 1UAGA 4GX2A 1OBFO 3D0OA 4JCOA 4YVFA 3PWZA 1ISGA 5KJFA 2VUTA 2Y05A 3P19A 7ADHA 3P2OA 2D2IA 5JMPA 4CM8A 3L6DA 2DM6A 4B4VA 1CQIA 4WUVA 1SB9A 1NNUA 2JFFA 2PY6A 3TF5A 3UCFA 3ZW8A 4YJGB 3SX2A 3I9OA 4N7RA 4EEZA 3F46A 3TQHA 3I5MA 3ZU3A 3K9QO 3MJ4A 4BNIA 2CVQA 2NADA 4Z3DA 1EE9A 2ZTMA 2CD9A 4XGNA 3PVZA 1E1LA 4J0EA 2ZYAA 3ONFA 2Q2WA 3UUWA 3O9ZA 7MDHA 4XYMA 3ZHZA 1PEDA 4HADA 4YJDA 2GYYA 2P5UA 3PI7A 1EVYA 1A7AA 1E7WA 4XQ9A 4FBGA 1UUFA 3NKLA 3OEWA 1VSUA 5A1TA 3GN2A 4J2HA 4D43A 3KOUA 4FR5A 1WP4A 2WE8A 5B4UA 1GZ3A 3OICA 2NLOA 1HDZA 2P9GA 2CNBA 2OP0A 3H8VA 4I1IA 1Z82A 8LDHA 3LT1A 4UVDA 1BVRA 1SMKA 4WPGA 5KJCA 2Q3EA 2FR0A 3QWIA 4YA6A 2W8ZA 3IP1A 2DTEA 2X22A 4CMKA 1R4NA 2VWHA 2VYNA 3GNQA 3GOHA 4KUEA 2Q1TA 4MVJH 2VHXA 5ICMA 3R6DA 2VRCD 2X23A 1R0SA 1NAIA 4GH5A 4CQMA 5IF3A 3O8QA 4RCVA 1E7MA 2JAHA 3D4PA 4IXWA 4CJXA 2Z5LA 4IQ0A 1T4DA 2BKAA 3IP3A 3JYOA 3QJ5A 4XRRA 3GNTA 1UXIA 1HLDA 4P4GA 3V1UA 3DZBA 1TLTA 3AOEC 4E30A 5U1PA 1LC0A 1O0SA 4W7HA 3DHEA 1JAYA 2EP5A 1EQUA 4J90A 5DZSA 1QLHA 4ZA2A 2VNAA 4Z9XA 4NBRA 3EK2A 3JQ7B 4R4JA 3KUXA 3TZ6A 4BV9A 3E5MA 3NDIA 3NJ4A 4ESOA 2WYWA 2V6FA 2DKNA 2YW9A 2WJPA 1TEHA 1ZUD1 1PL8A 4HV4A 1E5LA 3KHUA 1XKQA 4FCCA 2VUSA 1U4SA 1I3KA 4FOOA 4DLAA 2HMTA 1U3WA 1RM0A 2DFDA 3M1LA 4I5GA 1ONOA 1P1IA 4N54A 4FJ0A 5F5NA 1WLYA 3MWDB 4CMEA 1Z74A 4R3NA 1U1IA 4RL6A 3ABIA 4ZQFA 3WGTA 2D4AA 3QVOA 3JSAA 2D59A 3VPGA 5ER6A 1Y7TA 1T2EA 1H6AA 1UDAA 2AG5A 3BTUA 4FFMA 3GFBA 2QIOA 2PKQP 3DBLB 3Q9UA 1V3UA 1WW8A 3WYBA 1UZNA 3UFXA 5BNFA 1NR7A 3D7LA 3FWNA 3KV3O 2AE2A 2VTEA 1XDWA 2WSBA 1HTBA 1VPDA 4DLLA 2P2SA 4I8XA 1LDNA 3H9UA 4CM7A 3LK7A 4D3FA 3GVCA 4BNHA 3GG2A 4FW8A 3WLFA 4XGIA 2POQX 3E82A 2XXBA 4PZCA 1E7RA 4JBIA 5DOZA 1NVTA 4UUPA 4NQZA 2VCYA 4G65A 3AOEA 3U5TA 4MDHA 3JQ8A 3VZSA 1WPQA 3PDJA 1E6UA 2HRZA 1LDMA 1PGNA 1JKIA 1KEWA 2UDPA 4NIMA 3W8DA 3PWSA 4PLFA 3DFZA 3VPXA 1ZW1A 4J9UE 3ANLA 2IZZA 1JWAB 1HE5A 1DC4A 2VRCA 5KVQA 2GN4A 4PVCA 4BNGA 2FY8A 2JHGA 3VH1A 1R0LA 2W98A 4LCEA 4NG5A 1DLJA 1LSJA 2G5CA 3JD3A 3QV1A 2FPPA 4NDNE 4AJHA 4K6FA 4RZIA 1BW9A 1DRWA 1WMAA 4YT5A 3RROA 3LT0A 1MG0A 9LDBA 1MC4A 5TS3A 4O63O 1RYDA 3PGXA 3KYDA 3NRCA 2NVUA 4LGVA 3RFTA 4TRNA 1DFHA 1I32A 1KEVA 3Q1LA 1DLIA 3S1LA 4XZ3A 6ADHA 1SPXA 1WDKA 2RHCA 2O23A 4W4TA 1V0JA 2Y1OA 4PG7A 4N18A 3VVCA 3MEQA 1XSEA 1QYVA 2OUIA 3EDMA 3O26A 3A4VA 2Y0CA 3F6YA 3HDYA 2WM3A 2BD0A 2IEBA 2X6TA 4BMVA 4LN1A 2VZ0A 1XCBA 4J49A 3DHYA 4M86A 3ZH2A 4FDAA 5T57A 3OJ0A 1A4IA 5IZ4A 5K9ZA 5T8KC 4A27A 3E03A 1R6DA 1S6YA 4GI2A 3PYXA 5I7VA 1IE3A 1NQ5A 3E18A 4IJVA 3ZHXA 2B4TO 4XKJA 3F5SA 3EZLA 3GRKA 3W4JA 4PG8A 3G0OA 1EMDA 3DZHA 4TRMA 2O4CA 4HX5A 4DVJA 4X54A 3DO5A 5FFFA 1CIVA 1P31A 1Z7BA 1NHGA 4DIOA 5JAMA 1EBUA 4YJGA 1Y8RA 2NV6A 1Q7BA 3B1KA 3GRPA 5I8WA 2C5EA 3ZHBA 3JQCA 4Z9FA 4GGPA 4YTEA 1XQ1A 3H2ZA 4B7XA 3KSZO 2NU8A 2NNLD 2OORA 3LC7O 1P0FA 1C0LA 3INGA 2B5WA 3R3JA 1JTVA 3UOGA 5G2OA 3PHIA 3FR7A 1EFKA 2DLDA 2I3AA 1UDBA 1T25A 4R51A 4BO1A 3AOGA 1B3RA 2YYYA 4LSMA 4RVGA 4XRGA 1LJ8A 4WJZA 4IBOA 4JK3A 5L3ZA 3FWZA 4BMNA 2ZTVA 3NDJA 4MPDA 5TJHA 3DZKA 5L53A 3WQSB 1E92A 4PLTA 2V65A 2JFGA 2VWQA 5DN9A 2J5RA 4E13A 1BXGA 3BZUA 3WJAA 2I65A 2PA3A 4BOYA 1JDJA 4J4HA 4UUOA 4HFNA 4Y67A 2W90A 1QMGA 3WX0A 3E9MA 1PZGA 3MOGA 5FEUA 1UP7A 4JLWA 3KXDA 4HWKA 1HDYA 3DZFA 4ALIA 1GCUA 1KVRA 4OAQA 3BAZA 1W4ZA 1P1KA 2PKRA 3OMLA 3PJFA 5DBIA 4YR9A 3FI9A 2YFQA 3HQ4O 3ON5A 1KVSA 2Q45A 4GKBA 4XEHA 4CLEA 3RUCA 4E0BA 5ITWA 1LDYA 4OL9A 4WLNA 3AY3A 1PS0A 1E6WA 1PJ3A 1ISFA 3DB2A 1PGJA 3JD1A 3VC7A 3F4LA 1M67A 1HZZA 3ITKA 5JY1A 3PZRA 1IL0A 2NUAA 4K9DA 3OJEA 5TJ9A 4J1NA 3SJ7A 1B7GO 4ND4A 4D46A 1LEHA 2RHRA 1Y81A 2CVZA 3WGYA 5EMHA 2FWMX 1X13A 3QW2A 3ZWAA 1C3VA 3GUYA 4F6LA 4WASA 3VAZA 2UUOA 2E4AA 3TZQA 2Q50A 4RLHA 3ZWWA 5I7SA 3GZNA 3LYLA 3B1FA 4FN4A 4RVFA 3H5RA 2PNFA 1PL6A 4I9HA 4IGFA 2O7SA 1KETA 1B2LA 4ITUA 3QSGA 3JQ7A 1Y8QB 1RM4A 3DBVO 1X0XA 1ZSYA 2CSUA 5A3VA 1EK5A 1G6KA 1PR3A 1JA9A 1U9JA 3WBBA 4XB2A 1KC3A 4I9NA 3NJ8A 4AJ4A 4BO2A 1V3TA 1TB4A 3PPIA 3WB9A 4E2XA 1DJQA 4PLPA 3RIHA 2D5CA 2I76A 1VL0A 2CDCA 3QWHA 4FFLA 5EIOA 4DLBA 5GZ3A 2WMDA 4GWKA 1XGKA 4JBHA 1R66A 3CPSA 3PJEA 4KTTE 4HKTA 3VDRA 1NX6A 2C07A 1YONA 1IUKA 3B20A 2YHIA 3PK0A 3ULKA 2RBEA 4BO8A 3HDQA 1X14A 2ZQZA 2FHSA 2HK9A 4DA9A 1DXYA 3OIDA 1UJMA 1U8XX 1E0DA 1VC2A 3WIDA 2LDBA 2QW8A 4IGEA 4O0LA 4KMSA 3DEYX 1ONNA 1JKFA 4BNTA 2O3SA 1EFLA 3EW7A 3PQFA 1YB5A 3KRTA 1PWXA 4KP7A 4BKUA 4J7CA 3O4RA 4EJ0A 4LMRA 4IY1A 3TJRA 3OETA 4TRJA 3WGOA 4EEXA 4OHUA 2YFHA 5KIAA 5THQA 5JE8A 1DOHA 1LBEA 3JQGB 3PQEA 3G3EA 2AQ8A 3JD0A 3WDSA 4CM4B 4L4SA 1WDLA 2AEFA 2JCVA 3BMCB 2J3KA 3D3WA 3IMFA 5L9AA 1QV7A 2HDHA 4W7IA 5AYVA 3VPHA 4EYEA 3MZ0A 3DBHA 2JD1A 4J4BA 4OQZA 2FR1A 1F17A 1EDZA 5L40A 3ADPA 2QRJA 2RH4A 3VH2A 5HM8A 1X15A 3ZNOA 4A26A 3Q0EA 1I33A 3G49A 3CUKA 1EUDA 3BMQB 3OF2A 4A0SA 4PFJA 1C0PA 5KVCA 4PVDA 1MGOA 2PGLA 4RPKA 3GQVA 3KZVA 3M2TA 2P68A 2JJYA 4YJHB 4Y98A 1QYCA 3IKTA 1F8FA 3WLEA 5JDIC 2AMFA 4RVSA 4DYVA 2HRBA 5JMWA 1LDBA 4WKGA 4B3HA 1P74A 4E5YA 1N7GA 2PZLA 3ZWYA 1VI2A 3AU9A 4J7UA 4FFOA 4E5PA 3OM9A 3FSRA 4A7PA 1FDUA 3FHLA 3KYBA 4J6FA 2GLXA 4E5KA 3K30A 1NAHA 2Y99A 2WWRA 2ZJ0A 2ZB3A 4J3FA 1ZK3A 4RDIA 4J16A 3I52A 3FPCA 3MCVA 3DMYA 4XYLA 1P45A 4CMAA 3G17A 3ZN2A 3CMMA 3GA0A 2TMDA 1KERA 4IQGA 5BR7A 2VT3A 3RC1A 4UUNA 3QVTA 3GG9A 2ZB7A 3BXXA 1ISHA 1ZEMA 2QRKA 1PJQA 3HJAA 4O6VA 2FMUA 4RPLA 4J2OA 4XJSA 1KEPA 1U28A 2O7QA 3G1UA 2IYOA 3I9LA 1P0CA 4MVJG 1ZXBA 2AEJA 4XWYA 2IYPA 5HS4A 1X0VA 2X4GA 5KCZA 1RJWA 1BTOA 4HXYA 4L74A 4BO4A 3DC2A 1K0UA 3ZDFA 4CUZA 3GR6A 1M76A 4W6ZA 1PZFA 2DBZA 4AFNA 2X8LA 3SBOA 2X86A 1B8UA 4MIYA 4B8ZA 1DBVO 3NAQA 1X7HA 3Q9NA 4BNZA 3FR8A 1YQDA 1ENYA 1CDOA 1E3WB 1ENPA 4S1VA 2DTDA 3DQPA 1A9ZA 1Q0QA 5LC1A 3DOOA 4NK4A 3GEDA 3LT4A 1X1TA 3ZV5A 4DC0A 4BKPA 5G0VA 1A71A 1A7KA 3BTVA 4WK6A 1CEQA 3DWFA 1YE3A 3B1JA 4BNLA 2NVWA 4XGKA 3ZWNA 2C0CA 1SB8A 1I30A 2PZKA 3NT5A 1MP0A 1TT5B 4QO8A 1LX6A 1GTMA 3U62A 1JKJA 1YWGO 2X5JO 1WMBA 1RKXA 3FCOA 1UAYA 3KLMX 2YV2A 3HFSA 4N5MA 1QORA 4DREA 3Q3CA 1KVTA 1TVEA 5IDQA 3JV7A 4U8GA 1E1KA 1QG6A 5A5FA 3I6QA 5I9MA 1SNYA 2HQ1A 4IDCA 1OC2A 3MJSA 1F06A 4XR9A 3F3SA 1P44A 5ILGA 4DL9A 3H9QA 4JGBA 5TGDA 4TRRA 1V8BA 3MTGA 4FFRA 3U4IA 3C1TA 2BRUA 5G0SA 1YL7A 2H5LA 4ND3A 5T5QA 1VL8A 5IZCC 3FN4A 2EGGA 2YV1A 3TDKA 4CMGA 4AJKA 5CDYA 4RV9A 3F47A 2GZ2A 3C85A 4JBGA 3WGHA 1YQXA 2Y1FA 3JQ6A 1AXEA 4UAGA 2UYYA 1PJTA 2HO5A 4BO9A 4NBUA 3RFVA 1TXGA 2PZJA 3I4FA 1SOVA 1PJ4A 1DIGA 3Q2KA 4FSHA 2PTGA 4IDGA 5HS6A 4WCFB 1GCOA 4IUYA 4HUJA 1P33A 1YBAA 4JNKA 2VUUA 2BI7A 3PHLA 1VRWA 3UKOA 3X2FA 2R2GA 3O38A 2H1SA 3BHMA 2C7GA 5FWNA 3OEYA 1FDWA 3K73O 4OO3A 4WCDA 1DEHA 1ZZEA 3HWRA 2C5AA 4PLVA 4Y9DA 1U5AA 2CZCA 3KEQA 5LDHA 4UULA 3ROKA 3ANMA 4Q3NA 4Q39A 3TFOA 2X0NA 3WSVA 1ZNQO 5G4LA 2AG8A 5L4SA 3FNGA 1ZXLA 2NVBA 1BRMA 3OIFA 4RVUA 3GDFA 3JQ9A 2QG4A 1P1FA 2PR2A 3EVTA 4XIYA 5CEJA 1SZJG 2XPCA 1H0KA 4XYBA 5H81A 3ENKA 3PHHA 1XU9A 4CLHA 1NR1A 1K6XA 3AM4A 3N74A 4INAA 1LLDA 3RI3A 3ZHYA 1JW9B 1FDVA 3BMOB 3IL2A 1YJQA 4IDEA 4IS2A 2ZB8A 3DOJA 1T1SA 1GD1O 4RQTA 4BUCA 3K31A 4ILKA 4FJ1A 4PLYA 3L77A 3OJFA 5AXDA 4D0SA 1FXSA 1Q0LA 1U2DA 4AL4A 1ZH8A 4ZU3A 5DOVA 5G0TA 4R69A 1VL6A 5A9SA 1TI7A 1OZAA 4PG6A 2C2YA 3VPFA 4J4TA 1FJHA 2YJZA 4P4NA 3HE3A 3IAHA 3JQGA 4ND1A 3WMWA 1YDWA 1VKNA 1HLPA 1YKFA 2B83A 2GN8A 4Q3BA 4CM4A 3PJGA 3IJRA 1J0XO 5IXYA 4OMUA 1PR9A 2AQHA 2EGHA 2JD2A 5ENDA 3KETA 3L9WA 4RPJA 2NWQA 1VJ0A 2Y66A 4R68A 1DAPA 2DC1A 1E3JA 1ZVMA 2Q49A 4ONEA 3UXYA 4HFMA 2E37A 1IZ9A 5JPIA 3JYLA 5BSFA 1XIVA 1DDOA 3E9NA 4OOFA 4RGBA 1LRKA 1DSSG 1M6WA 3LLVA 1LA2A 1NQOA 4AJJA 4YRDA 1CETA 4J9VA 1QYXA 4D0RA 2DFVA 3H2SA 3P5SA 5ES3A 3TOXA 6LDHA 4FD3A 1CJCA 2R6JA 2JCXA 3ICPA 3GY0A 3RC7A 5A3JA 1DB3A 5CDTA 1U5CA 5IFLA 1C1XA 4YJHA 2QZZA 5EERA 3ORFA 3DTTA 4IJKA 4YB8A 2B4RO 4CMIB 3BMNA 1U8FO 5L7WA 4WNIA 4BO5A 1GYQA 4MKRA 5KKCA 1WDMA 1UDCA 1XR3A 1RPNA 1R4MB 1I01A 4FS3A 3GGGA 1EK6A 1J49A 3STHA 1OMOA 3S55A 1DFGA 4DQXA 1E3LA 3H6KA 1HYEA 5JYDA 4DXHA 4HY3A 1V35A 4JXKA 5JAQA 5KVSA 4CODB 4XD2A 1ZJYA 1N9GB 4IXTA 4KTVE 3LC1O 4YJFB 3ZU4A 1BXZA 5AVOA 2HJRA 3WWZA 3ZWOA 5IAAA 1EUZA 4NR0A 2QHXA 1K3TA 1GU7A 2AQKA 4PIVA 2GGSA 2O3QA 4CPDA 1RM5A 2IRWA 1E1MA 3RJ9A 3E48A 4R5MA 4LCJA 1M75A 3GF4A 3WGZA 2Y0EA 4K1LA 3A28A 2GD1O 4KDFA 2BH9A 5TRTA 3D4NA 1F12A 3KB6A 4UEKA 4ALLA 1T24A 2O3TA 3VZQA 1YB1A 4K26A 3QA9A 3OECA 4E21A 2W2KB 5JO0A 4BB5A 2WD7A 2G0TA 1P3DA 2PH3A 4WCFC 3PIDA 3KLPX 3WYEA 2X0RA 4RF3A 5KJ6A 1LQUA 4GMGA 4JN6B 1ENZA 1H9BA 2GR9A 1DO8A 2AQIA 4XIJA 2JL1A 3I3OA 4P22A 4CMHA 1KY4A 4TZTA 3H9JA 2EXXA 3K6JA 3E8XA 3NT4A 3LSYA 3JYQA 4RF5A 4BO6A 3IOYA 5BSEA 5GZ6A 1FDTA 1HL3A 4L0QA 3ZZNA 1QV6A 3C24A 1BVUA 3QRWA 2IZ0A 1AE1A 1EDOA 4R5HA 2UAGA 2HMUA 3KYCB 4PN3A 4A5OA 2NU7A 1U2GA 5EINA 1GV1A 1LTHR 1T2CA 2HU2A 2G1UA 2Y1GA 4KUHA 2OHXA 3NGLA 2F1KA 2VOJA 1H6CA 1QSGA 1ZK2A 2EERA 1L1FA 5F1OA 2BFAA 4PRLA 3GHYA 2VHWA 1LSSA 4WLVA 4RF4A 3VZRA 4ZQBA 1DRVA 2WEKA 4MINA 3DZGA 5L7TA 4GX0A 3RSHA 1Q7GA 3RU7A 4BS9A 2C82A 5G0WA 3ONEA 4Y8VA 3KVOA 2PGJA 1LLUA 3ETGA 4GLLA 3ZV3A 4B7CA 4WLEA 4MVJD 4GBJA 5DCUA 1Z7EA 1DHRA 3JQAB 1E7QA 1G0NA 2Q4EA 2AE1A 2GDZA 1ZFNA 2ZJ1A 1I10A 4QT0A 3N7UA 2EF1A 1PJCA 3QHAA 1RWBA 4IQ8A 4OIMA 5DF1A 2QZ9A 3IDSA 3ASVA 1M2WA 4IIUA 3WGGA 5A03A 5JCJD 5FI3A 1VE9A 1R12A 4FIZA 1PL7A 4G2NA 1DC6A 4YRAA 4CLRB 2Z1NA 3K8ZA 3IIEA 4WCFA 1H94A 1P1RA 1F8GA 1C0KA 1ML3A 1JU9A 1Z6ZA 2H6EA 4C7JA 3WBFA 3NTRA 4CM3A 1MUUA 2X9VA 2O2SA 2AA3A 3C8MA 3HUDA 3GN1A 2HMWA 4NNJA 4CQLB 3KSDO 2E6UX 3PP8A 5H82A 1KVUA 3CZRA 2O3RA
chains in the Genus database with same CATH superfamily
4MAMA 4EY6A 3HK2A 3FOWA 4D3SA 5DNCA 1II9A 4FC7A 2Z3WA 5G4KB 3U9LA 2K2QB 2WFAA 1F6BA 2F8MA 2RGXA 1U6KA 3GUZA 4WFKA 2NYVA 4BCCA 1C3LA 1E2PA 3V00A 2FPOA 3EGDA 1KO4A 3NTOA 4I55F 4BPRA 4C05A 3RAFC 1ZU4A 3ESYA 4WKNA 4GKAA 1ZICA 1QCYA 1CS0A 3KQVA 4M0PA 2OBYA 1XRNA 4MWDA 1YIAA 2LVBA 2EIHA 4KI0A 3UG7A 1QYRA 2HAEA 1G66A 1G9TA 4NK5A 2YOGA 1U1CA 3C8ZA 4WXHA 4YDSA 3RR2A 1DBQA 2AXNA 2GWRA 3IVRA 2IHBA 3ECSA 1UMBA 3OO1A 2R44A 4P81A 2B2CA 4ZVUA 4LRSB 4RPHA 1RCUA 4DW8A 4F72A 4BNKA 4H7HA 2I3GA 4YAFA 2GKOA 1RLMA 2E48A 1O4WA 2X7HA 3B89A 3CPJB 1K5HA 1WZIA 3EE6A 4FOPA 4IAOA 5C53B 1Z35A 2WHEA 3CWQA 3CF6R 4CG1A 5C18A 2NP6A 5ESWA 3GC6A 1I8TA 2EKLA 3QTTA 4B84A 2JVKA 1M2VB 3A3PA 1G4HA 1P1CA 2R4UA 3KHTA 4FKMA 3ZNPA 2IX3A 1D9XA 1W6UA 4W5TA 1KOLA 3SIWA 3RABA 4KE9A 3VC3A 4OBBA 5JXGA 4KO1S 2MSNA 1YD7A 3DOCA 4P2BA 3SNHA 5JS2A 4D79A 1DAOA 3T5AA 5BT8A 4YRBA 4KQXA 2PBLA 5G3ZA 2FEKA 5TPZA 3KHKA 4G01B 1O3YA 1GJRA 2D8MA 3ESXA 4RH0A 1B3BA 1K27A 1IU9A 1N1EA 2JJMA 5TQ0A 1JP7A 3K1AA 5H16A 4ZOLF 3SYKA 4H4EA 4ROTA 5LBUA 1SIUA 1HY3A 2QOEA 3ZCTA 3NC4A 3L40A 1NVGA 4MO2A 1D1QA 1ZSNA 2WKPA 3PLRA 5JO9A 3MTAA 5F52A 5FQNA 2PX4A 3DOHA 2ZIUB 3FDZA 3H17A 3QVSA 1KNXA 4HZUB 5EKSA 1D3AA 3OZIA 4KWHA 5CIQA 1PJLA 2XZTA 5JAZA 2AD1A 3QHQA 4TYNA 5GQSA 5I5GA 4YPVA 1P2DA 3QZUA 4MQUA 1ZR4A 7REQB 4XOUA 3R5SA 4CCSA 1O8BA 2N3ZA 2HGSA 2NQ2C 1N2CA 3OLQA 3UHFA 4BQPA 1JDVA 1ICEA 3H0EA 1U2EA 3JQRA 4CCYA 4MS3A 3RQIA 5M2QA 2XR1A 4GXQA 4P31A 4MX8A 4X6LA 1WUYA 4WEOA 1AKVA 5EP3A 3UJAA 4QPJC 4UHCA 1NFQA 3T8YA 4GR5A 1ZH2A 4PQGA 3L4KA 3J81k 2FOLA 5T8KA 5LPNA 5E3HA 1TYEB 2ECPA 3K0HA 4H1WA 4QOFA 4ZI7B 3UZUA 1BX3A 1E64A 3RSGA 3THWB 1JLMA 2WSSD 1S0UA 1SZCA 4WKBA 1PFGA 1OF1A 1WQ3A 2HYDA 1QOPB 1IK6A 1P7ZA 2UVDA 2RGNC 4IRMA 4KIUA 4OBEA 1QQTA 4UPDA 1B8VA 4B6SA 2J30A 3VR1A 4F71A 4LXTA 4LJKA 4ML3A 1L5YA 1TQ8A 2BFFA 3UQYS 5FUQA 3BIFA 1JR3D 3CNBA 2C9OA 4J43A 2IYSA 3IC5A 4P7KA 3CKMA 3EY9A 4F46A 3AW9A 4U02A 2Q29A 4ZQIA 1QRRA 4CKBB 1DC3A 1NPDA 3OD1A 4QYIA 5DPMA 2G17A 5GWXA 2ZVPX 1RZ3A 5B3LA 1ZESA 2GFIA 4CKWB 1BKDR 1GZSA 2LBPA 4IVNA 1QHSA 4HN9A 4ARSA 1D4ZA 3QPBA 4IM7A 1UJ5A 3HKDA 4OKNA 4OHPA 1W4CA 3IAM1 2CMDA 4F3RA 3T5PA 2G6TA 2XKKA 4BXOA 2Q1UA 5AKZA 4WNAA 4Z4IA 1UXGA 3D2CA 1A9OA 3PL1A 2HUNA 4EARA 1I3LA 1BGVA 1US8A 2EJCA 2I2BA 2WAOA 4FUTA 5EXTA 1ENOA 2JEZA 3QY9A 3ABSB 3Q7PA 4M1OA 1JG3A 4RZHA 2VWGA 1XEWX 4ARCA 5CPBA 2EJWA 2X0EA 1GUZA 3WSWA 2B8TA 2FE1A 4UCQA 4IYJA 5EUMA 5DX0A 4I8IA 2AXEA 2P91A 3DWGA 1XTVA 4UEQA 5HK9A 1MOSA 2HKIA 3EFBA 1FDOA 1WKCA 1XQ9A 3HVIA 3RTGA 2QAJA 4KWTA 1DCFA 6CHYA 1K8YB 2M6RA 3K4QA 4QBTA 2RH8A 1PLKA 2OB2A 1EBFA 2QI9C 1WM1A 2BGLA 1HGXA 1CQIB 4N8EA 4ZQCB 1T8UA 3OLVA 1OI2A 3I5UA 5L8VA 4D6PA 1B42A 1FLDA 1QNLA 4W5WA 3U4MA 5DNUA 2B61A 4ZT7A 4KR0A 2BY4A 2FN3A 1RLTA 2RGGA 4GX1A 5TSDA 2Z2ZA 3ML1A 4M0DA 4F93B 1PZEA 3R7LA 5B2FA 3I2KA 1W0CA 4M1YA 3UIEA 4MW9A 3ZKWB 4ND8A 3E2IA 2NXEA 4XQGA 1AU9A 1B6RA 2I2DA 2WDZA 1V5EA 3NYIA 4JQYA 2ONCA 3DZDA 4ID3A 2ZSHA 5H7XA 5B7NA 3KCNA 2ZZNA 1DIHA 4KLAA 5EMJA 1G55A 2OZEA 3HM2A 3QVKA 5CT5A 1LXCA 4H6PA 4RD3A 1VHLA 1Z45A 3TLMA 2VNJA 3C4QA 3FFXA 4I46A 4R16A 3MUEA 4C7VA 3C8DA 2QMOA 4WDQA 2F2TA 1PEKE 1QOQB 2G0AA 2HI0A 2RIPA 3SE7A 3VC2A 1CQPA 4AKGA 1L5MA 2WLSA 1IY8A 4URVR 2IOFA 4Q48A 2G67A 2PKQO 1F2UA 1IOLA 4JEUA 1UBGA 3U7JA 5C35A 5LOVA 1W44A 3VTZA 4FM9A 4AO8A 3FF4A 1RQGA 1ZN9A 4N8DA 3I9MA 3GVIA 4NMWA 1ACMA 3O0DA 4L2IA 4E32A 1O6FA 2OCPA 1XJCA 1QR6A 3FMPB 1XX6A 2MSEB 3KZOA 3OQHA 4TS9A 3WLRA 4JJEA 3DG9A 3OT1A 3NPAA 4CEHB 3RYHB 4QEDA 1D4FA 1H8HD 3CSDA 1CZHA 1M0WA 3D6MA 3VFDA 3KQSA 4NV3A 2R7AA 5BYKA 1DAFA 3G13A 2HF7A 2WPDA 3IODA 2WWFA 3BVPA 4BUJA 5JLJA 3AF3A 3RWMB 3HKEA 3I34X 4FMDB 4IP0A 4HAOA 4KV7A 1HTWA 4C87A 5A1JA 4CMJA 3S1AB 3BUSA 4GVXA 5FUMA 5EVJA 4A2PA 1U7XA 2EBWA 2WKQA 4F3CA 2XCSB 1A2QA 4PS1A 3KM0A 4EF6A 4FBMA 2P4QA 1BIFA 1Q2UA 2C2KA 3V9AA 3T41A 1NQWA 1QRDA 2A94A 3TNJA 3D8NA 3G1TA 1UM8A 2AF4C 2XVMA 2F55A 1TCCA 3LBHA 4MB6A 1G5TA 1RLJA 5EKTA 4CCAA 5KAMA 3DMGA 4LF5B 1KXZA 4E12A 2NO9A 4HLCA 5BORA 5IW8A 4QBKA 2NQ8A 2PO5A 4ZDWA 1KPGA 3NIGB 1U7HA 5CDUA 1R88A 1JQBA 4NAVA 3R0QA 5CYFA 2JLCA 1YQTA 3CINA 4WKPA 5B37A 5DP2A 2FKAA 1KZ7B 1N6HA 2PH5A 3T4UA 3ZJ4A 2Z1MA 5HZGA 1B0AA 3QA3E 4R8VA 1GY8A 1UPBA 2BUBA 2G1AA 3FTNA 1AY0A 4HDQB 3QEAZ 1G8PA 1ZRNA 1B00A 3AHDA 2JFUA 4Q3CA 3TFQA 4JLBA 2IE0A 4EG3A 3LLCA 3A6PC 4E46A 2X8BA 3U0VA 4FJ2A 2ZCUA 2XRMA 1CJKC 1GRNA 3MT8A 3QWAA 2YICA 1B0ZA 3F8WA 4P3PA 1I6MA 3OCZA 3SYRA 1JE1A 4QQKA 5C46F 4YRKA 2WZCA 3HWX1 2OENG 3CEPB 1SA0B 4LAFA 4R1OA 1B6GA 5C8YA 3AJEA 4MRMA 3WO0A 3OZBA 1F9EA 4DIUA 5HUJA 2PEYA 4EY7A 4EVQA 2ZRMA 1BE8A 1E2IA 3NM6B 3TG2A 4Y6RA 2X4IA 4JJ4A 2IBMA 2ZSKA 1SEPA 3O92A 1R8YA 4ZRMA 3PUXA 1VB3A 1ZMTA 2B8JA 2EV9A 1XMIA 3I32A 3IXLA 3R77A 5JDIA 3RM3A 3C5CA 5LU8A 2A3RA 4RD0A 2YCLA 2NT4A 4JP3A 5CX1B 1M2GA 2N0SA 4LYEA 3UTCA 1PX2A 4UHDA 4GNKA 1RLUA 5JVDB 2OYSA 3LY8A 3VA7A 1UH5A 3PKZA 4I50F 3GFFA 3SS8A 3LUFA 3FF1A 3U7RA 2I99A 5JG7A 2BP7B 4XR4A 1ODIA 4LV8B 5D3MA 1PVOA 5J2TF 4FGUA 3AKZA 3IPXA 1WXGA 2R25B 2XUPA 1KQ3A 3HVJA 5JS6A 5HKLA 1Q50A 4M7WA 4D4JA 4RHCA 5KUTA 2O54A 1EXVA 4QXOA 3MUFA 3QQ5A 2CUNA 4TQ9A 5FAXA 4UTRA 5KYGA 4NJEB 4OKSA 1X70A 5PGMA 2ZRGA 3LA6A 4YP1A 3U2QA 2C57A 3QFRA 4AZ3B 2EKQA 1ND6A 4AO6A 3ENNA 1JMKC 3CLKA 1P9WA 1QK3A 1TZJA 3B8HA 3W5IA 3EXHB 4AMGA 3ADCA 1SFRA 4OSPA 4A2CA 4KQIA 2LXNA 5HG0A 1BMTA 3CG4A 3Q11A 4OIFA 1YMVA 1DKQA 4FPXA 3VTFA 5KDOA 1GLNA 1RAFA 2VHVA 5H70A 3ZCUA 4NU8X 3BC1A 2OR3A 2PX3A 4YAEA 3IUMA 2FMFA 1UP4A 1N5RA 2YY6A 2GF9A 1X7WA 2FFJA 3QI2A 3U4HA 4BN5A 3WYGA 3AVVA 2FPPB 2EW1A 1L7DA 2G5TA 1YL6A 2XE4A 5I4BA 4N5HX 1P73A 1Y8QA 4DR7B 3GJ8A 4HDNA 1IXSB 1XA4A 3O3OB 1G18A 3TMYA 1J24A 3O1JC 2YTZA 4O2AF 2I2AA 2NVUB 3CZ4A 3DZ8A 2FJPA 1R16A 3G02A 3GH1A 3EGXA 4REMA 4JENA 5AKXA 4TKUB 3NM5A 3JAWA 4G67A 1F4VA 1V1RA 2OCBA 2CFOA 3CLTD 4JQOA 4ZC1A 1BROA 1O08A 3ZIDA 3VNUA 1P2UA 2OD7A 2YYAA 3I42A 5K3OA 4L8VA 4IDFA 4XIGS 4QM6A 3BDIA 2QUJA 5DHUA 5M5BA 3WE7A 1ECPA 2H3EA 1JDUA 1RRKA 3PHCA 4LMPA 4O5AA 5HDQA 2QAGC 1CUCA 1QH1B 1JALA 1QIFA 2A5FA 2AFIA 3L1HA 2R8BA 3HO8A 2EU8A 5LA6A 4AKTA 1Y3FE 1VBFA 2IQ5A 1QJ4A 2LE0A 2GPTA 3J7TA 3OFKA 1DTSA 3OZWA 1Y4SA 4TMWA 5SYNA 3RS9A 2PGNA 2ZRNA 1Y1TA 3I3SR 3UKJA 5A02A 5JYEA 4X0EA 2ILTA 5F5LA 4LRYA 4MICA 1CR1A 4XB1A 4XLTA 3HMKA 3REFA 4PPNA 1XZ8A 3A70A 3I64A 1AO3A 4JX9A 4PYJA 1W25A 2PT7A 5K3SA 5HKKD 3WLSA 3ETLA 3MM4A 3WNZA 1QO0D 1H42A 2HK7A 2XUGA 4K6HA 4BRZA 3R3SA 2BN4A 3ETDA 2QRZA 2BEUA 3QI7A 4DPKA 5FBHA 1LUAA 2IKQA 1ZNZA 2O5EA 2HLNA 1A72A 1K6IA 1POWA 3QUAA 4MULA 1H1LA 4NWIA 2EZTA 5IZCA 4FFNA 3NHBA 4DLTA 5JAIA 2WWXA 2JGIA 3G0DA 3IV7A 4YRZA 4NC9A 1V45E 4M1KA 2P2LA 1R9GA 3TQIA 4U6QA 2AMLA 2CMHA 4YAKA 1ADCA 2JK1A 2ZRIA 1C3OA 3O5AA 3DOFA 4BNWA 4D81A 1HEYA 3LLSA 5K0CA 2ZYIA 3DHWC 1C1HA 2LUOA 4US2R 3GGSA 2F59A 3GRVA 1SHUX 1MGPA 1OI4A 3RJ5A 4CV2A 1E79D 1GPBA 3T7TA 3FNHA 4QYXA 1FQKA 2YWJA 5ALHA 4G1MB 1HFWA 1NFRA 2QQ0A 2WF5A 3WGQA 2C7OA 2J3QA 5EXXA 1QJCA 5BSHA 1BRTA 4FDMA 4YNBA 3CH6A 4XM0A 1HV8A 3A26A 3MRTA 4BHTA 5KVVA 3Q87B 4PPYA 3PG5A 4LGMA 4F7WA 1NHWA 4B3SB 2QN8A 2H9AA 3VR2D 4BYGA 4BZQA 1Y7PA 2OCDA 2EATA 2FPIA 2C4UA 4J0GA 3KQOA 5F2NA 1Y6JA 3CXUA 3A04A 4FC6A 3ZHSA 4M38A 4MVXA 4BJ1A 3F9IA 4DGSA 3NEPX 1KRWA 1KKLA 3V3TA 5DBEX 3MIIA 2X0DA 3KBBA 4C14A 5KYWB 4CDGA 3DONA 5CFZA 2O3JA 4MV7A 2GRUA 1QG0A 3DD1A 4PAOA 1OWLA 3L1UA 3O95A 4GSLA 2P2GA 5CK4A 2JLXA 1BU8A 2PZAA 3KAQA 3KR0A 3KQMA 1JEQB 2RHDA 4ALJA 4JI1B 2PEZA 3VDQA 4DWOA 4QYSA 1XQ6A 3N58A 4DEVA 2ZW9A 1ISSA 4QFCA 3A0UA 4QYWA 2XITA 1I4OA 3IUYA 1T9KA 3MJVA 1L5NA 3WJ7A 1QRUA 1N32B 4MGYR 1FDIA 1QU2A 3MQFA 3JVIA 3EDCA 2VTBA 4XVQA 3KV1A 5AM4A 1WTCA 4CM5A 4DNXA 3LT5A 4JP2A 3N2KA 4EZBA 1XD8A 3H4VA 5G3YA 1GQ2A 3JS5A 1YTUA 3AFMA 2K7ZA 4IIVA 4D9KA 4EKDA 4DRYA 1TADA 3STVA 3KFVA 1SHJA 3UWDA 1MO5A 5TMEA 2HQBA 3A2KA 2Q6OA 4KI7A 3UAOA 4M7OA 1TKAA 1IFXA 1SJ9A 5KTNA 2CF5A 1SKQA 2WIKA 1P0PA 4GUAA 5AHKA 2R60A 4IH1A 1E18A 4YUZA 1MZVA 2FJ0A 3R9WA 4I5FA 5IWAB 1OZGA 2EQBA 1EAMA 3OEHD 3PNBA 4L73A 1Z33A 4BMOB 5D85A 2PMKA 4BCBA 1J0CA 1PX0A 1SY7A 2IYFA 3QLUC 4FT4A 2GN0A 3AEQB 5ALQA 3B9RA 3OBBA 5GVSA 3UM9A 4F2HA 2DHDA 3KSBC 4P3XA 4G9EA 4DB2A 1UZMA 5EIFA 5GJCA 3TTUA 4H7PA 2YQ4A 3BGIA 2J87A 3VZDA 1TO2E 3ZVNA 3LDUA 4JYMA 1P91A 3NC0C 4L02A 3RIGA 5C1DA 1EXDA 4BVAA 3QPCA 3YASA 5LBTA 4G24A 3GDGA 1HDIA 4UQLA 4MA5A 2VHJA 2OHVA 3PTZA 3E7DA 1ITZA 3H65A 4Q0MA 2BLNA 2QM8A 4HFRA 1XRPA 4OI4A 3HB0A 4CN9A 1P2VA 1UFOA 2OFPA 4NATA 3RUHA 1GGMA 1T9CA 2O8FB 4KGZA 2G77B 1U4OA 1W5EA 4RHXA 2HJ9A 4X90A 1MB9A 2PV7A 1ORVA 4ZC8A 5GV7A 3CLRC 1IMJA 1NL3A 4DA4A 4MRNA 1VZ2A 3R0JA 4EQZA 5CGQB 2MR6A 4LOKA 1ZRMA 2O2XA 3K0EA 4MUXA 1EE1A 3OPMA 5I47A 2WJ3A 3JSXA 3QXGA 4G5SA 5JJIA 2LW7A 3U31A 2Y1DA 3KO8A 5J5AA 3WDMA 1YHNA 3DVQX 3EAGA 4H08A 4BQEA 4ENTA 5B6JA 4LF4B 1OWPA 3BE4A 4JS0A 1MXFA 2W6NA 4MS4B 2CV0A 4AW9A 1G5QA 1ESCA 3KLOA 1L4NA 3WTBA 4PZZA 1EXNA 1RPJA 2R8RA 1H9AA 4GMDA 1IY1A 3U4GA 4XX0A 6Q21A 3RARA 2ZYTX 4BQFA 2X0JA 2YVLA 1HYQA 3U4DA 4KWEA 4QO7A 1A8HA 4CLDA 3D5EA 3M6WA 2QYTA 3MCWA 1UPCA 1E6LA 4IF6A 3ZDEA 3HP4A 5CM9C 1MFZA 4ZCPA 3ZC3A 1PJZA 1PLJA 5IYZF 4ZYUA 1N6KA 4B6FA 2BSXA 3DUWA 3K3PA 1FX1A 2UVPA 4ZT6A 1NUPA 3R3WA 3OJXA 4DWWA 1P9LA 2AJTA 3LKBA 4NHOA 3FUTA 3I1JA 1DAMA 1EVQA 3T1NA 1J00A 2O2HA 1OTHA 4JBYA 5FJIA 2UZIR 1NVXQ 1RM3A 1XRJA 4QBFA 3EFEA 2OORC 3GEIA 2GZRA 3P2KA 4KDRA 4RZSA 2P69A 5KMGA 2PXXA 5K45A 1YU6A 1V3VA 1K6JA 3EOBI 2QD4A 3GBVA 4AS3A 2FNAA 1P75A 3SJCA 3CPHA 3VOSA 2W2LD 3QLUA 4TQGA 1UBNA 1ZQ1A 2ON6A 1EAYA 4R1LA 3VTKA 2NYUA 2FZEA 2PX8A 4JOBA 3BAFA 3MJTA 3DO6A 5IK2A 1NYQA 2B20A 2VHYA 5CNMA 3EVEA 1F20A 1NDHA 4NZZA 3NHYA 4NU5A 3FYUB 4EG6A 2ODTX 4C0WA 2GJ8A 2CNKA 1LF5A 4DIFA 1W9HA 3L82B 1S2DA 1J7JA 1DWUA 2GN9A 2DUNA 2P2ZA 3ENZA 4L5IA 4DDVA 1NXXA 1DZ3A 1M54A 5CCDA 1A8PA 2LGJA 3PIRA 1VE6A 3SZRA 1GPLA 3FFWA 2YZGA 3G7NA 3E22A 4MZDA 5K0BA 2ACEA 4OXXA 1ZRHA 1K89A 3KBOA 2NZYA 2AN3A 4FQ7A 2X14A 4O3FA 3RSZA 1T9DA 4XQCA 4GL4A 2P9CA 1RIFA 2WQ6A 1VG1A 2H06A 3EMBA 4N6GA 2QUHA 3UMCA 4QODA 4ZHSA 4OHYA 1IHDA 1OA1A 2VRNA 5SZKB 4DWVA 4WESA 2HV9A 4B3IA 1C0IA 1W34A 1PT7A 4YI3A 4BQRA 3ZS9A 1Q1AA 3H84A 4E88A 2DPGA 3EMKA 3LZ6A 3RHFA 1DPGA 1GDHA 2ZJ6A 3DFIA 4IHJB 4XIIA 3TCKA 4IZHA 3SE0A 3ZCXA 1OLUB 1CCWA 2GMWA 1Z5NA 2COEA 4CLXA 1LBQA 1G2IA 1K4MA 2IUEA 2XMPA 2FU5C 3CSSA 1BHJA 3DEZA 3BMOA 3P4UA 4I7EA 4G23A 2X8JA 4MMYB 5FXMA 1XV5A 2IA5A 3WYCA 4B4UA 5FF9A 2CNWA 3VH4A 5ALZA 1SOWA 3OE7A 4XJTA 3T3HA 5HIMA 3U7IA 3LX6A 4DA8A 1Z75A 5AM3A 3HZZA 1PBNA 1NY6A 4NBVA 4WEQA 3OP1A 4C76A 4DIDA 4EW3A 1JEDA 9LDTA 3KQQA 2BFCA 1IVSA 3OMXA 3R3YA 4D92A 4UTVA 1K4YA 3TNYA 1JN0A 1GRQA 1VPEA 1SUCA 1HMYA 2OZPA 1XZHA 3V4PB 1TM4E 3IQXA 2JHPA 2YHAA 3MGBA 4E7OA 1ISPA 5HF5A 3RGGA 4E09A 2FPMA 2OZLB 4AWBA 5HZKA 4OFZA 4DMCA 1PEYA 1YAHA 1W0JA 1J0AA 3KSUA 3M1AA 4Y6SA 2VPIA 4QPZA 5KQGA 4KQWA 3PNLA 1HDRA 3VMMA 1L5QA 4NMXB 3MPOA 4NZYA 4XVUA 1JIQA 1G60A 3QVXA 3RS3A 2RH9B 3L0YA 4QDKA 2VYVD 4IMRA 3PX2A 5HTKA 5JARA 5JH7F 2YZMA 3FWYA 1UK9A 2ASVA 1TCUA 4P32A 5KYUA 2ZSEA 4WINA 3SF8B 1TEZA 1IONA 2OBLA 3GYBA 3W34A 3ZEAA 4C7KA 4RD1A 5HGXA 2P4HX 1WMEA 4J75A 4WT7A 1VMEA 4AKSA 1GPH1 2GN2A 4BJ5A 5AVVA 5JZVA 4Q16A 5B53A 4MGZR 3WK5A 1HRDA 1GVNB 4FMDF 2CY0A 1ZK1A 1LFDB 5JADA 4KVAA 1SCUA 4Q82A 5GM2A 1TQHA 4NBNA 2BGUA 4QWMA 2RCYA 3WLNA 1NBOA 4D96A 4RBNA 1FFWA 1JXMA 1TD9A 1YZKA 4W63A 3ZGOA 1GUAA 2E4WA 1PJBA 2CLFB 3LNCA 5FWXA 4B6GA 4EDHA 2RGUA 1AHIA 2HADA 3LUJA 5BQFA 2XZPA 5JWHA 1ECJA 1KMHA 3MFYA 2EFGA 3C43A 2ZS7A 2JCYA 3EIFA 3HN7A 3UO8B 1B2RA 4YMSA 5K6TA 2GFHA 3BWXA 1OOEA 3N8IA 4BX0A 1GNTA 2Y93A 1BDBA 4YCLA 3ZCVA 4U7GA 3UMBA 3ZDQA 3BWEA 3KQYA 4HTAA 1KSFX 4MROA 4EO7A 5HQTA 1ZUWA 2XOXA 3NHJA 1A7JA 3D7SA 1WZEA 3D8TA 4HCJA 3U13A 2AXQA 4BKRA 2ODEA 3LDFA 1R4MA 4BNVA 4R7ZA 4E3ZA 1Z0IA 3NEJA 1R5NA 5AJHA 1QVWA 2RC5A 2BE9A 4HSEA 4B3GA 1CERA 1U0JA 4MUMA 1G98A 2A0FA 4RX1A 5DW3A 3WLJA 2FFAA 3ZHCA 4YMIA 1XNRB 4LKRA 1UBJS 3G9QA 3SICE 3GNLA 3T7JA 3W9YA 4R54A 1NBWB 4AWAA 1QHYA 2V7QA 3TQCA 4L9AA 3UVEA 1NT2A 4E2WA 3REQA 3EX7C 5F1KA 4K9LA 2ERYA 4O4LA 4DFDA 3NDPA 4MK4A 4MS1A 1ACJA 1LFAA 2I0FA 1YZGA 3RASA 4CMBA 5K01A 2R8PA 1SQGA 2R7LA 4ZP1A 3PC7A 1OU0A 4B6RA 4DZZA 5LXTB 4ND5A 1GVHA 3DL2A 2DRIA 4MV9A 3AKYA 4RMJA 2CJWB 3SIPA 5JPCA 5M34A 4MGHA 4KO4S 2XOKA 4DDWA 2W0MA 3BIOA 4JI0B 3RRZA 4FYYA 1RBYA 1YCHA 4U5QA 3GEMA 1UMKA 2V55B 1KY3A 3JQEA 3JQBC 3PU6A 4P58A 1KFCB 2TMGA 1O94C 1OYOA 4FKBA 4G8BA 3KEFA 2JIZD 4ISBA 4RM2A 1ADFA 3FMFA 3R3ZA 1X7ZB 4J94A 4P92A 1T9GR 3D64A 5JFOA 1NVEA 1TQ2A 2ENUA 3IP8A 3HTXA 1GTL1 1MB2A 4Q05A 2IVFA 3MTBA 4Q00A 4BZZA 1Z4JA 5CG2A 2AVNA 5COBA 3M0EA 2VJKA 1O54A 4G85A 1FP7A 2AYXA 5IT4A 1XLWA 1YRAA 3UXMA 1HSZA 1IUOA 4URUR 1U2SA 1KI6A 2OCLA 3M70A 1FTGA 4B0PA 4HEHA 3HKCB 1JR3E 4WFJA 1EG2A 2M6KA 5LP6F 3UPUA 1A7UA 2GM4A 1VCMA 1N0WA 2QM3A 2HOQA 5A0VA 2WAMA 2IP2A 2OCGA 5KB3A 2GZ3A 1JQAA 2DUWA 2GFQA 4HAVA 4AC9A 1WWKA 5HBRA 3PTAA 3AL0C 3B5IA 5CEFA 4UMFA 1A96A 1ZINA 2RDMA 3WOHA 3AR3A 3CLSD 4GNRA 3F8SA 2QJTA 3H18A 2YHSA 3KUDA 2XH8A 3ABQB 3S4YA 2JFVA 4TWZA 2HN9A 4Y2RA 2JASA 1E8DA 4HZIA 4MKZA 3T7KA 1JHUA 2EJTA 3CUWA 1NZFA 4CV1A 1IVNA 1KJ8A 3CE6A 3NU1A 2BEVA 1HQDA 2BFMA 1JNXX 1GOTA 2BM1A 3IESA 4JODA 4U1RA 4Y9RA 1UMCB 1DP4A 1DX6A 3HS3A 3RFCA 3AETA 3LKDA 3A8TA 1AMOA 4G3XA 4LPSA 1J2UA 4ANFA 1E96A 1AZLA 1CUYA 1R8JA 1H2ZA 3UJ9A 3UA3A 4R2WA 1H3FA 2I3BA 3D5QA 5F2OA 3RS5A 1W2GA 3SSNA 3D6JA 2E89A 2Q4BA 2WU1A 1RIIA 3F0TA 4EGFA 3HI4A 2H2GA 3PZBA 4BB9A 3U4QB 5K1ZA 1JVNA 1PUIA 1EJ0A 1MC5A 1S2IA 3JD4A 5GPBA 3WLOA 4K2HA 5IVDA 3I9KA 3IIJA 3KOOA 2W6OA 4CM9D 1KR2A 4N5NA 1CNEA 5EI5A 3HACA 1BO6A 3OIUA 3D7RA 4X1KA 2EEPA 4D9HA 1OFHA 2WT9A 1Z7WA 4K6OA 1A9XA 3L49A 1E3SA 2Y1LA 1JR3A 2F6RA 3JQBA 3TQOA 3RIMA 1N33B 1FBNA 2G7ZA 2X9GA 4MWBA 5D5HA 2EVWX 1S5PA 1WF6A 1O94A 4TSRA 1EUCA 1UBRS 1YI8A 1WKVA 3KJNA 5CURA 3D6HA 3WKCA 4CLOA 4D2IA 4LTMA 4P38A 1WY5A 4JT8A 4MPPA 4R6WA 2F43A 3CYFA 5H83A 2CLHB 3STYA 4XYGA 5A9RA 5I7HA 1Y5IA 2YNMC 3W4IA 2ZJ7A 2I3ZA 2DHCA 3TL3A 3CG0A 1W0KD 5AJTA 1XTSA 3VOAA 4CQLA 1RXIA 1Q16A 1HG0A 5MGBA 2IITA 4ZEOA 4HPXB 2ACVA 1GKLA 1XCMA 1AKTA 1B16A 4AJ9A 3FHCB 5G4KA 3BE5A 2QY9A 2XMDA 3QPAA 3BHJA 1VP3A 4G1CA 2I4NA 2WAYA 3GI1A 5DGIA 2DLCX 2F00A 3EQ6A 4ADSG 4DJDC 3IMKA 1Z4QA 3U81A 4BAUA 2CUZA 3HDHA 1K68A 1PTJC 1R8SA 2J5KA 3F5DA 5F5XA 3ROPA 2O52A 2J7PD 5ITZB 5K8UA 4LXGA 2WWYA 3IKMB 1NP3A 3CUYA 4EENA 5ECYA 1STOA 4L5CA 4YHBA 4DUPA 2I1QA 2C3MA 4J0KA 5EZQA 1AZTA 1BGWA 2ZSJA 5SY6A 3CIFA 1NNSA 3N0WA 4OM7A 3UJCA 2EG9A 4YLYA 4FZ3A 1N2JA 1FDSA 2IPAB 5H3LA 4OA8A 1DZIA 3ROFA 1IRXA 1KYZA 1GKUB 2WT8A 1P6UA 3KVNA 1M2VA 3Q0TA 4MVYA 4KNYA 2NO4A 3CNQS 3NHRA 4RK4A 1Q1QA 1WUJS 4PEVA 1PI3A 3NLLA 5J40A 4CBVA 4TWBA 5BW8A 4CIDA 2R85A 4ENPA 2YBEA 3B51X 1SXPA 1FU8A 4ZGWA 5CG1A 3RUAA 3S2ZA 2VBGA 1EJ2A 4MB2A 4GAEA 3JX9A 3L6CA 3H9EO 2ZI9A 3WGIA 2CUKA 2WJIA 4TMYA 4WADA 4WFQA 4Q9JA 3M3DA 3NAMA 4ARIA 5TT1A 1OX5A 3JCZA 4LXXA 1WF3A 1H8EA 1SKMA 1CWUA 2HU7A 3RAJA 4BASA 1GHTA 3HVRA 2A1TS 2FRXA 2C5BA 5B1EA 1CDDA 2FUNB 1EFAA 4HZUA 1R4AA 3N87A 4JLAA 3N76A 3ZXXA 2CXRA 1B14A 1JKXA 1ZK0A 5FFNA 3S2EA 1D5WA 4NBKA 1ODJA 3EUFA 3KL4A 5ALVA 7REQA 4RQAA 1XMOB 3AK4A 3EUWA 3JU3A 1NPYA 4JI2B 2FSFA 2YNMA 3I39X 3QQPA 5CTAA 5G1NA 5BNIA 3B53X 3H75A 5CB4F 4GDFA 1TJ3A 1FA9A 2YWEA 3GBPA 3ECCA 4O2BA 4BTEA 5LQNA 1KWGA 3AVYA 4P9NA 1C14A 4LYDA 5K0EA 1RWNA 1L5ZA 4DIBA 1H8HA 5FKJA 3CNOA 4KGDA 3K1ZA 1SUPA 4ZI7A 3QPVA 2W4QA 4FMCF 2KWIA 1EDDA 3MG9A 1ORRA 2A14A 3WICA 3THWA 4PG5A 5FPTA 2P1DA 2QTRA 3FB4A 1R6BX 2WKWA 1PTJA 3GROA 4JB2A 2IEIA 4B82A 3TSCA 4JP8A 4CF7A 3M2PA 3EZNA 3CW2A 2A78A 3FAKA 1W75A 3NNDA 3HM9A 2I6TA 2IHKA 3VSDA 2CFSA 4RGQA 4MVWA 4KOEC 2H16A 4KN8A 1T2FA 5YASA 4BO7A 1L5LA 3C98A 1GUFA 2Q8NA 1XA3A 1ABBA 1RXWA 2LCQA 1WXHA 4HRVA 1TTQB 2FLVA 2PSJA 3UY4A 5JTTA 4JLPA 4N1AA 2R1ZA 1C7EA 3ED5A 3T7CA 4CKBA 1KE1A 5FJJA 1UBUS 3OPQA 1OXBB 1U2RA 4Q34A 4GLOA 3ZE0B 3EZ9A 1WB9A 1BNCA 4CKWA 1MPTA 2JI6A 1ESEA 4BGUA 4MI9A 3UA4A 2ZK7A 4TT8A 1B93A 2AUTA 1U9IC 4V3CA 3S2GA 3FGZA 3K4HA 3FHJA 3NEYA 5EIWA 4I1YA 3AC0A 3JASB 3PHGA 3W5CA 3ZJTA 2H0QA 3GFGA 4LJLA 3DO8A 1DBWA 1KSGA 2OXTA 3AY7A 3QYAA 4LI0A 5HF9A 4G0WA 4OXKA 1J4AA 1TKCA 1ADBA 3N2YA 1ZD5A 4PC2A 4UDYX 2XRFA 4ESHA 4AULA 4JFRA 1ABEA 5BT9A 1RVV1 2CDRA 4CFYA 5B1YA 4FDVA 4BMYA 4DNOA 3ZGYA 4KXYA 4PGHA 4YCBA 2Q41A 3STWA 2H5IA 5ALDA 3TKAA 2ZB2A 4HGZA 5KJFA 1T5OA 4N7MA 5EFOA 4CG2A 1Z6TA 2Y05A 1AK2A 1TVKB 5E4YA 1N0VC 1ZISA 3Q8KA 3P19A 2BBTA 1W4BA 3GRCA 4OMDA 1OXUA 3P2OA 3RS8A 2DH5A 3QTLA 4JT2A 2V7WA 4J8PA 4YMGA 4CM8A 1G7SA 1XNHA 3VNRA 1CQIA 3K2QA 1KAMA 3T1YB 3Q3EA 5AVJA 4Z3OA 3W2TA 2H9YA 1LS6A 2Y76A 3I04M 1KTIA 5AP9A 1AS3A 1OD6A 2AHOA 4I4TA 4UNRA 4ENUA 5CBKA 2NUBA 2VG8A 4EEZA 4LJRA 5C5DA 3I5MA 4ITVA 4DMRA 3K9QO 4Z3DA 3GLSA 4E94A 1D2GA 1EE9A 2ZTMA 3ZKWA 4GM0A 3HO1A 1CULC 3DUFB 3DPIA 5IH7A 4R8RA 1JHAA 4J0EA 1OKKA 3ONFA 4PANA 4X66B 4O2RA 2XA2A 2G9NA 3NV7A 4X3CA 4QGBA 4UNQA 2MWMA 1W1UA 2P5UA 1EVYA 1CLUA 4HLUC 2PSEA 3G68A 5JCOC 1KKMA 1SD5A 1XDGA 3I72A 4QU5A 1R10A 1JJFA 4KLZA 1RPZA 5CCBA 1N6PA 3KOXA 3N9IA 1BX1A 1KY2A 3IMEA 4L5BA 5DISB 1XKXA 3MLAA 2IHYA 1RC0A 2WIGA 2WSLA 3R3XA 5B4UA 3OICA 3CJRA 1QDUA 4LGCA 1OWOA 1N3LA 3G2OA 3P0EA 3L5OA 2OP0A 4IUDS 4OLJA 4EHHA 1A82A 4ZAZA 3ESBA 4LBZA 2O07A 4UVDA 4U7DA 1KJIA 1GU0A 1SMKA 1XAIA 3OUUA 4RACA 3SDBA 1U5BB 4Q01A 4TLDA 3ZZ1A 4YA6A 3C5VA 2W8ZA 2G71A 3RVLA 2DTEA 2X22A 3WIVA 2I54A 1QS0B 5NULA 2IUSA 3RYHA 4CEHA 2C97A 2PU5A 2C3UA 1UPXA 2PT5A 2NSLA 3GNQA 2Q1TA 1S1CA 2VHXA 4M9RA 2FZKA 4MVJH 5E1DA 3V8QA 2OLEA 1T4MA 3RC3A 1P9OA 3CH5A 3BGDA 5HIKA 2ORYA 5K8LA 3HJRA 1MW8X 5TS2A 2QTMA 4NNPA 2Z9DA 4KZKA 4CTOA 3S1AA 1T4DA 3K8YA 3QJ5A 2VNKA 1GIAA 5T4BA 3QPDA 3GNTA 3S5UA 4U7PB 4OLFA 1U31A 1UXIA 3GLKA 4P4GA 4F56A 1TLTA 3AOEC 4PYMA 3U80A 1NLYA 1RRPA 2QR5A 1EX9A 5HMMA 5U1PA 2FXVA 4B43A 4L0DA 4BWGA 7YASA 2B3DA 2MYUA 1RWOA 1XZAA 5AW2A 1J1IA 4J90A 3T5BA 2IS1A 5DZSA 3VYVA 4OUDB 4JSTA 4BMZA 2VNAA 4BV3A 5FWYB 4R4JA 3JQ7B 2JH8A 1DRJA 3C3YA 2V6FA 4N6NA 4BLUA 5JWRA 1CR6A 2CBXA 4OJTA 3KU4A 3S7TA 4HN4B 1GL6A 1L5FA 4BX3A 1LI5A 1TEHA 1ZUD1 3PDIB 1SBNE 1U6JA 1XKQA 2GEDA 4LWPA 2HQSA 2B9VA 4QGHA 4X64B 1QNFA 2HMTA 1OBHA 1RQLA 4G5QA 4F5YA 2XSZD 1VA5A 4RXMA 3QFCA 4ABTA 3D59A 4N54A 4PYQA 3L92A 4E4TA 4UBKA 2R6HA 4HLUA 2J9YB 5JCOA 5HKKA 1G7TA 4B17A 1WB5A 1FPMA 2HSZA 2D4AA 4H1VA 4HAXA 1JLRA 1T6ZA 3QVOA 2D59A 1SA0A 1T3SA 1C7ZA 4JLNA 5EQTA 1C7RA 2II6A 2VFAA 3HEMA 5ER6A 1Y7TA 3VPGA 3K0FB 3X1WA 2GEUA 2DWCA 2I7XA 1W5TA 1U0TA 2WMNB 2P6OA 5SY9A 1XZEA 4QT4A 1F38A 1WW8A 2W00A 2WFZA 5FV7A 1I4TD 3NNNA 4B9EA 3PNPA 5FWAA 5LNK6 3KPVA 3FWNA 3RAEC 4DDTA 4OI2A 1NJ1A 1QTQA 2ZWPA 5CX1A 2NXWA 1FQOA 2GCIA 3GJ0A 3CLHA 1FUKA 1VJRA 2P9BA 2XTJA 3W7BA 5JVDA 4DLLA 1E79A 3M1IA 4I8XA 4MEBA 3SKVA 3TW8B 4TL8A 3GVCA 5EWMB 2DSTA 2BP7A 3K1TA 1CUGA 3Q9LA 4DV0B 1VIYA 3LP8A 1G16A 4BNHA 4HDMB 3GG2A 5IWCA 1NBAA 3E82A 4Q1FA 4PZCA 3DH0A 1Z6YA 2FLWA 2NO5A 1RPAA 1XE3A 1OX6A 2B1IA 3BGWA 4UUPA 1DEKA 4NQZA 3P9PA 4G65A 1T8WA 1A77A 3AOEA 5DM2A 2JIRA 2Z4TA 5A4MS 3HSYA 1WPQA 1MQSA 4FHGA 3THXA 1PGNA 3NBMA 4NJEA 2I9KA 1WG8A 4LC0A 1U8AA 4JLSA 2UDPA 4GOJA 4JLMA 4AZ3A 4OI0A 5IHPA 2CZQA 4L3VA 3PWSA 3VPXA 3GAMA 1R1DA 1M74A 1KYTA 4H27A 4ZHQF 2B25A 3EXHA 1SCIA 5AR1A 1R3UA 2HRQA 3ISTA 1IM2A 3V1MA 3ZW7A 1IC6A 3AUYA 2VRCA 2Y2VA 2ZUSA 3EXEB 1DC8A 1I0LA 3QBVA 5B1DA 5KVQA 2VR1A 3EPRA 3BERA 3MRSA 1ZWKA 1PFUA 1SD2A 2DHRA 3VH1A 1S3SA 1YA6A