2NNLD

Binding of two substrate analogue molecules to dihydroflavonol-4-reductase alters the functional geometry of the catalytic site
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
324
structure length
324
Chain Sequence
ETVCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNVKKVKHLLDLPKAETHLTLWKADLADEGSFDEAIKGCTGVFHVATPMDFESKDPENEVIKPTIEGMLGIMKSCAAAKTVRRLVFTSSAGTVNIQEHQLPVYDESCWSDMEFCRAKKMTAWMYFVSKTLAEQAAWKYAKENNIDFITIIPTLVVGPFIMSSMPPSLITALSPITGNEAHYSIIRQGQFVHLDDLCNAHIYLFENPKAEGRYICSSHDCIILDLAKMLREKYPEYNIPTEFKGVDENLKSVCFSSKKLTDLGFEFKYSLEDMFTGAVDTCRAKGLLPPSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroflavonol 4-reductase
publication title Binding of two substrate analogue molecules to dihydroflavonol-4-reductase alters the functional geometry of the catalytic site
rcsb
source organism Vitis vinifera
molecule tags Oxidoreductase
total genus 111
structure length 324
sequence length 324
chains with identical sequence F
ec nomenclature ec 1.1.1.219: Dihydroflavanol 4-reductase.
pdb deposition date 2006-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2nnlD00
3F47A 1T4BA 3W8EA 3Q0EA 4KMSA 2UUPA 1M6WA 1PL7A 3NDIA 4OOFA 4NIMA 1BVUA 5EQDA 3RVDA 3ADPA 4ZQEA 1ZW1A 5I9MA 4D0RA 5ITVA 4MKRA 4D3FA 3UCEA 2W98A 5BT9A 4I5EA 4RF5A 2GN4A 2VUTA 4TKMA 4PG8A 5B4TA 3P19A 3B20A 1ZVMA 1EZ4A 3PWSA 3UXYA 1DLIA 1ULUA 3IJRA 2R2GA 1T26A 1JVBA 1OMOA 1FDVA 1RYDA 4DBVO 4KWHA 1UDAA 3RSHA 3VZQA 2PD4A 3ONEA 2O3UA 1UXGA 4F6LA 1NFFA 4R01A 1GD1O 3NT4A 1E6UA 5EIOA 5A04A 3K9QO 4IGFA 1PJBA 1LI4A 4N5LA 3FD8A 3SLKA 2F00A 2ZTUA 3PWZA 2HJSA 2GSDA 4BNNA 1HZJA 1W73A 3L6EA 2VUSA 3GN1A 2O2SA 1HDGO 3I9KA 1VE9A 3GEGA 1V35A 2Q4EA 1H9AA 4J1QA 4MJLA 5JYDA 4J91A 3ASVA 3KYDB 4Q3DA 4EZBA 5G0WA 4YEDA 2NVBA 3G1UA 1NWCA 3OEWA 1KEPA 2JKVA 3HDQA 4PZEA 4EJ0A 4DIFA 5J23A 1KY5A 3VTFA 2JHGA 3H5AA 2CD9A 4F6CA 3DBRA 5JYEA 1KOLA 3PJEA 3I6QA 1XQ1A 1I36A 5AOVA 5A9RA 1ZK2A 4OIMA 5JMPA 1YGYA 1YQGA 1DSSG 2QX7A 1CIVA 2VYND 2W8ZA 4QO8A 3WOHA 3WSWA 2AW5A 1YWGO 4YT8A 4LN1A 2ZIZA 1ENYA 4QUKA 4NDNE 1XKQA 2BGMA 2PY6A 3BMQB 2GCGA 1TVEA 2JJYA 2FZEA 3GVIA 2A4KA 1PZEA 4Q3CA 5DCUA 3FI9A 3GVHA 2OUIA 4TRJA 2H9IA 4ZU3A 2C20A 3ZWOA 2D3TA 5KVVA 2GZ2A 4XDZA 1O8CA 2POQX 1ZSVA 3H9UA 3Q2KA 3RU9A 2H6EA 3C1OA 3QY9A 1ZK0A 2VHXA 3ZWXA 1CF2O 4L4XA 3EAGA 5L9AA 5L40A 4BMSA 1O5IA 3LC1O 4UVEA 2C2XA 2ZKLA 2RCYA 4NBWA 3H9GA 2VT2A 1D4FA 5LC1A 4E2ZA 5HTOA 4XR9A 1PL6A 4Q3BA 4D44A 4WKGA 2NU7A 1PIWA 3PEFA 5KJFA 2B4QA 5CPBA 3HN7A 3AI1A 1BG6A 1ULSA 3EUWA 5G4LA 4BNMA 4FC6A 1ONPA 1D7OA 1JKIA 2JCVA 3KSDO 3PXXA 3M1AA 5FI5A 4CM6A 3RBZA 1Z75A 2C5AA 2GDZA 4CM8A 1ZO8A 2E37A 3D5TA 3FNGA 3GDFA 4RF4A 2D5CA 4B4OA 4O63O 5JBIA 4MKZA 4MVJA 2C2YA 4CL3A 4IY1A 1KERA 5CAEA 3BMOB 4JCOA 4N7RA 3RC2A 3AK4A 1BRMA 2BI8A 1ONOA 1C0PA 1E5LA 3T4EA 2AE2A 4D45A 2EIHA 3QVOA 2VWGA 3RUCA 1C14A 1KC3A 5COBA 3D4OA 4MO2A 3ZGYA 4AFNA 3MJCA 1AN9A 2FN7A 3JQ9C 1TLTA 4NBUA 4UULA 3HSKA 3PK0A 2J3JA 2Q46A 3INGA 1DRUA 2C82A 3MEQA 3VPFA 1H2HA 4AJHA 1LNQA 3SBOA 1U7HA 2BFAA 2X0JA 2YDYA 1B8UA 2FZWA 5COQA 4TKLA 2AQKA 3OIDA 1F0YA 5CDTA 4I9HA 1ONNA 1KEWA 5ENDA 4M89A 4WCFA 1QV6A 3GQVA 2AG8A 1M76A 1Q1NA 2DFVA 5HA5A 2W2KA 1GV0A 2X0RA 4PZDA 2DUWA 2PFGA 2D5AA 3F46A 1LRJA 2VHWA 3W8FA 5DN9A 4BQRA 3GAFA 2VOJA 1FMCA 4L73A 3H5RA 1UH5A 1IUKA 1R0KA 1RJWA 2Y99A 4I9UA 3RKUA 1MG5A 4YQZA 1QP8A 2P91A 1WDLA 1BXGA 1PGPA 3LF2A 3OECA 1N2SA 2B5WA 4YTEA 4CJXA 3E82A 3WBFA 4A0SA 3VC7A 4YT4A 3U5TA 5CEJA 1R16A 4IQ8A 3QWIA 4RV9A 3ST7A 1T2FA 4WLEA 4PCVA 4YAEA 3GMDA 3LT4A 4YVFA 4N5NA 1DIAA 1O89A 2CDBA 2J3HA 5AXCA 3NRCA 1SB8A 1P1IA 5L45A 1JU9A 1DOHA 1LQUA 5DBFA 4KDEA 4XKJA 4JLWA 3E5RA 1ZMTA 2YDXA 3E8XA 4DUPA 3GLQA 1ID1A 1NQTA 2BI7A 3M6IA 4YRDA 1CDOA 5TLSA 1EE9A 1JTVA 5EERA 4Z0TA 1Z73A 1VL8A 2P9GA 1IY8A 3OEYA 1MC4A 3MJSA 4QO7A 4RPKA 3RJ9A 2LDXA 2EG9A 1PGNA 5T67A 4E5NA 1SOWA 5A5EA 4BO3A 2CZCA 5A1TA 2WD7B 3C7DB 3KSUA 2IRWA 3M2TA 2D4AA 4XJTA 2DLDA 3EHEA 4PIVA 1GUZA 1G0OA 1NBOA 1YBAA 3FRJA 4LGVA 1VLLA 3DWFA 4D46A 1N9GA 2Q1UA 3ASUA 4NJOA 3DBLB 4ZRMA 3BHMA 3GVXA 3ROPA 3VZSA 3PDUA 5KJ1A 2VN8A 4KTTE 3VKUA 1AGNA 1NR7A 1PGQA 1ZIDA 3WGYA 1NASA 1X14A 1MB4A 4B3HA 2YJZA 4GVLA 5F5NA 4RVSA 3ZWBA 2V7PA 3I23A 4FOOA 2C29D 2OXIA 3PQFA 4Y6SA 4CMEA 3FBGA 1NAHA 1EBFA 1H6AA 1GQQA 2NU9A 4W9NA 3B1JA 1T1RA 1H9BA 4BV9A 1OI7A 2GPTA 4BNWA 2UV8A 1Z7BA 1NPTO 4XQGA 1GQYA 1V3VA 3NDRA 1EVJA 5L7YA 2EJWA 3JSAA 2OP1A 2Y0EA 2A35A 1ZBQA 3E9NA 2OMEA 3O03A 5JAMA 1I5RA 3JQAA 5ADHA 4H15A 3EC7A 3JQ7B 3IIEA 3V2UA 4OJNA 3L6OO 1HWYA 2DPHA 3AI2A 4YJDA 1OAAA 1PZHA 1Y8QA 3FR7A 4IBOA 4PLCA 4WPGA 3K6JA 1ML3A 2RIRA 1HDCA 3GHHA 3H9JA 1BWSA 4UEKA 4I08A 1Z6ZA 4L8VA 3W4IA 4BMVA 1BW9A 3B1KA 4FIZA 1ISJA 4XD2A 3C85A 5L7TA 3GF4A 3COSA 1KETA 1HXHA 2C59A 4ILKA 1E3WA 1IULA 1ZEJA 4XYEA 3FWZA 2CMDA 4BIIA 1UUFA 3FF4A 3AOEC 1MP0A 4O6VA 2C7VA 1K3TA 3ADOA 4RGBA 4BKPA 4EI2A 3U4CA 1Y6JA 5IAAA 5IN4A 4MINA 4Z3DA 3JQBC 1B16A 3JD0A 1HE3A 4YJGA 3S2FA 2Q2VA 4B3JA 3M2PA 3ONDA 2X9VA 2IYPA 4KWIA 2JFGA 2D8AA 4KP7A 2E6UX 3TOZA 5CDSA 3OJLA 5T8KA 4QFCA 2FSVA 2V65A 2FPGA 2YW9A 1U8XX 4J7UA 1U2GA 2Y1OA 1YJ8A 1MFPA 1GEGA 3T7CA 4JIGA 1RYEA 4MVJP 3CH6A 5C7IO 1MXHA 1WWKA 1Z74A 2HJRA 5CHEA 1E7QA 3LC2O 2C5EA 2DBZA 3KXDA 1ZSYA 2E82A 3SVTA 4QFDA 5ES3A 4DPKA 4FD3A 4GL4A 1UXKA 3ZHBA 4CV3A 3HDHA 2IDZA 4CMIB 3BTOA 3DMTC 4WUVA 3AUAA 1P9LA 3PRJA 1GY8A 5EN4A 2Y05A 2GZ1A 3JV7A 4FFOA 4WOJA 4ESOA 4D3DA 2YV1A 3L9XA 4L4RA 4Y9DA 4QT0A 3D1LA 1KEUA 2OZPA 2CDAA 3JQ8B 4GWKA 4M49A 1E1MA 4L75A 3WGQA 4A73A 2IEDA 1QG6A 3BTVA 1Y9AA 3F3SA 2O23A 5COAA 1PEDA 2G0TA 3LYLA 5A9TA 2ZATA 4LW8A 2DVMA 4KUEA 2VWQA 2ZCUA 2D0IA 2FSSA 4MVJG 4OYRA 1CQIA 1T2EA 5AVOA 4UUPA 1DFHA 2EGHA 1C0KA 2W90A 4BNLA 3OH8A 3U62A 4Z6KA 2Q2QA 2V6MA 2D1YA 4XDYA 3S2IA 3FR8A 4N54A 4PRKA 1V0JA 1E3SA 3TL2A 1EE2A 2BKAA 4MIOA 3QIVA 1O9BA 5CPFA 3H7AA 1KY4A 3KBOA 3LLVA 3QRWA 4DA9A 1NNUA 4XYLA 3ONFA 3PPIA 1HF3A 2HK9A 4OXYA 2BHLA 3IC5A 5L95A 4JP2A 2GYYA 4DQUA 2VNAA 4R54A 1M66A 2J5QA 4K6CA 3QV1A 4S3MA 3GDGA 3VKVA 3HFGA 4A7PA 4BB6A 5BNIA 2PH3A 3HUDA 5A06A 3S8MA 2DQ4A 1I2ZA 3DONA 3DBHA 2P5YA 4E30A 2B83A 1E6EA 1TT5B 5F1KA 1PJLA 3RBXA 1UDBA 1JAXA 2RH8A 3D4NA 4LK3A 8ADHA 1GDHA 1PQPA 1E92A 4BUCA 3T4XA 6LDHA 1KVUA 4YCAA 4ZRNA 3TSCA 4BNTA 1C1DB 3VHRA 3NKLA 1B15A 4OMUA 4OXNA 1Q7CA 3F6YA 2YQ4A 3H9EO 1YQDA 3DOOA 3N7UA 4YDRA 3CKYA 1R4NB 1R12A 1FXSA 2V6FA 2X22A 1FDWA 2DTXA 3H2SA 4DL9A 1UAYA 4CLDA 3QLJA 4JQCA 4ALLA 1WW8A 5IZ4A 3TWOA 3D3WA 5FYDA 5A02A 3U3XA 5AQ1A 2O7QA 3LC7O 4OSPA 4GAEA 2G17A 4CLOB 4FW8A 1LSJA 4WNCA 4L0QA 4I5GA 1UJMA 3L9WA 2J5KA 2VYNA 4CR7A 4J4HA 5K0ZA 4BO1A 1YQXA 1ZFNA 2IYOA 5IDYA 2Y93A 4CQMB 4HX5A 4XQEA 3JQ6A 4FC7A 1PX0A 4PLVA 1ADGA 3GA0A 4E2WA 4EUHA 2CF6A 5DULA 2RAFA 2AE1A 4GMFA 5JC8A 3K5PA 1BVRA 1YL6A 3NX4A 4G5HA 4JXKA 4MVJE 1DAOA 3WMWA 3D5QA 4IZIA 4ZGWA 4YACA 1R4MB 5C7LO 1H0KA 1Z7EA 3F5QA 4UEJA 3ZV5A 2OORA 4FJ1A 4EBFA 3V2GA 2WM3A 4CUJA 1TT7A 4BGIA 4IDDA 5JAIA 1KVTA 3AUTA 1LDMA 1U5AA 1BDBA 1NPDA 3BMCB 4ND5A 1D1SA 3VVCA 1ZK4A 4MKXA 1T2AA 3I4FA 4YJHB 1I30A 1WLYA 3EGOA 4PN3A 3WGGA 2O3JA 1EFKA 1I32A 3KTDA 5G2OA 2AEJA 1I3LA 1PJ3A 4INAA 4RDIA 1QYDA 1C0IA 2DTDA 3ICPA 3QWHA 2B35A 3RIHA 5T5QA 4AJOA 3DMYA 3R0IA 5JCXA 5GZ6A 4A27A 3OFSA 2PZLA 1Q0LA 1T25A 3DO5A 4L9RA 3GUYA 4FFNA 3HFSA 4MVJM 4DIBA 4ALJA 5JCJD 3JD4A 2CDCA 1ORRA 3WLFA 4DMLA 1I8TA 1K6IA 1P1RA 3PFFA 4II2A 7ADHA 5GZ1A 4W6ZA 2A92A 2UVDA 2GNAA 2P5UA 3GH3A 3LU1A 3PHLA 4NI5A 4NBRA 4B4VA 1V3TA 1JWBB 3GFBA 1UZMA 4W4TA 1KVRA 3GPDG 5BSGA 3MTGA 5K9ZA 2WTBA 3BMNB 3MTJA 4UUOA 4ZHSA 3I9NA 3BHJA 1HDOA 1PJ4A 5FWNA 2X9GA 3L4BC 4GBJA 2B4TO 3QA9A 5BR7A 4Y67A 2VWPA 3VH1A 4PLWA 2Y0CA 2OGUA 3ITKA 3AOGA 3ANMA 4TRMA 1UP7A 3DQPA 3TJRA 3VDRA 1J5PA 2ZJ0A 1PGOA 1QYXA 2ZYAA 3KYBA 1P45A 3EVTA 1A4IA 4DMMA 3ROMA 3FBTA 5DOVA 1NFQA 5TNXA 1KS9A 3GZNB 3RC9A 1WZEA 3ZCXA 1JLLA 3PDJA 3RWBA 1LDYA 2VOEA 4D79A 1VSUA 5HBRA 1WDMA 4ZQBA 4WNIA 3GY0A 3VZRA 1U5CA 3C24A 4QQRA 3VPXA 5C7OO 3PFWO 2ZTLA 2V6BA 1G0NA 4MVJI 3KB6A 2NTJA 4N18A 1A72A 4Z9XA 5JDCC 1CQJA 1HYGA 2NU8A 1S7CA 3CIFA 4ZA2A 4DLLA 5FEUA 4E31A 3P2OA 5L7WA 2R6JA 2X1HA 3WG9A 3ZZNA 2Y1DA 2FPIA 3NT2A 3PJGA 4W7HA 1I01A 1VPDA 4I8XA 4WLVA 2ZTVA 2BH9A 4ID9A 3WJAA 5JFOA 4OO3A 1V9LA 1P1FA 3A1NA 4A03A 1KBZA 2VWHA 5G4KA 3E5MA 4LMRA 1OC4A 3OIFA 4OM8A 3MOIA 4IQ0A 3W6ZA 5CFZA 1VI2A 1ENPA 1YOVA 2VRBA 3IP1A 3W6UA 3BTUA 2O4UX 3WGIA 1JQBA 3F9IA 4Z0PA 1DLJA 1V8BA 3WNVA 3KLMX 4QTZA 1EUZA 2JFHA 5JPIA 5ICSA 3OJ0A 2AQIA 3R1IA 3IKVA 2Q1TA 2HDHA 4I5DA 4BNIA 1C3VA 4GPD1 4DYDA 3TL3A 1YXMA 1KYQA 1U9JA 3BA1A 3WBBA 4JN6B 1P77A 4CUKA 1GYQA 3OQ1A 1OC2A 2WE7A 3DBRB 4BVAA 2PK3A 1W4ZA 1NVTA 4GH5A 5GMOA 1VC2A 4JNKA 1W0CA 5ILGA 1ZUD1 3SC4A 3P5SA 2J3KA 3NGXA 5ER6A 1LXCA 3UCXA 3WDSA 4BGUA 3GEMA 2WYUA 3INTA 2E49A 3H3FA 9LDTA 4CR8A 1I33A 3VPGA 4XIJA 3JQFA 1BXKA 1XA0A 3NT5A 4YT5A 3F5SA 4MP3A 1ZK3A 5T57A 1HL3A 1UXHA 2NSDA 2HAEA 4TMFA 1P1KA 4IGEA 3TPCA 2WJPA 1N1GA 2VZ9A 3S1LA 3QWFA 4BNKA 3GGOA 1ISMA 4DBZA 2VYVD 4NQZA 1DAPA 5MDHA 3KEOA 3V1YA 2BD0A 3KVOA 3NTRA 4GLLA 4J1TA 4WJZA 3AFMA 4FFLA 3TFQA 2BFOA 5I7SA 4CV0A 1GUYA 1H6CA 2YHIA 1PQUA 1JDJA 4HUJA 1RM4A 1U2DA 2ZB7A 1O94A 1MG0A 4GKBA 4ND4A 4RLSA 3KETA 4FFPA 1PZFA 5KWEA 1YL7A 4BNUA 4AJ1A 4PRLA 4AL4A 4DRYA 5IDWA 1HYEA 4JP3A 1JA9A 3EVNA 2QIOA 2OBNA 5F21A 3FWNA 1LLCA 1PJ2A 1XYGA 1SMKA 3FN4A 1U28A 1WZIA 3VH3A 2GR9A 4HP8A 3QJ5A 1DC4A 5IDQA 2GRAA 2YFHA 3R6DA 4BKOA 1LJ8A 5THQA 4GVXA 4GQAA 4MP8A 1LRLA 4CM4A 4GSLA 4CM8B 2EP7A 4IDCA 3BYZA 4HKTA 4R16A 3K31A 5I8ZA 1A9ZA 4Y8VA 3CUKA 3O8QA 2OOSA 4GWGA 1IPEA 5F3RA 1NYTA 1WMAA 3W4JA 3VPHA 3ZHYA 4ALKA 2VTEA 4G2NA 4BNYA 1U7TA 2J6IA 2Q2WA 4ALMA 3T7EA 2W4QA 3GUCA 1NQAO 5I7FA 2JCYA 3CINA 4J90A 3SX2A 2HQ1A 4EITA 2YHUA 2X0IA 1H2BA 5A3VA 1T2DA 2NM0A 4J0EA 2X5KO 4BNFA 4E0BA 2VQ3A 5TJHA 2IXAA 2GGSA 3HG7A 4FN4A 1YONA 4P8RA 1H93A 2W2LD 4W99A 3RU7A 1PR9A 3RUAA 1QYCA 1BHSA 4HNHA 4RVUA 4R9SA 5HS4A 3LT1A 4IINA 4XGNA 1LX6A 5BSFA 1CYDA 4ROSA 2NLOA 1UXIA 4DVJA 5H82A 3EDMA 4WCFB 1IB6A 1XGKA 2X86A 1LA2A 1Y8RA 3AUSA 1O6ZA 3EW7A 2PTGA 4DIOA 3TDKA 1X1EA 2QZ9A 3W8DA 2PGJA 4TZTA 2EXXA 5K6AA 3LK7A 3STHA 1E7YA 3GFGA 1A4UA 3H3JA 3MCVA 2Y1CA 4R69A 3OQBA 4XQCA 3V5NA 1EEHA 4K1LA 4U0JA 4XGIA 2Y1EA 3DL2A 2OO5A 3DR3A 1BXGB 3WR5A 3PQDA 5ITWA 4WLOA 3ZWAA 4QXMA 5BQFA 1R0SA 3W4KA 4FB5A 4CM3A 1ZSNA 4IS3A 2BF7A 3IAHA 4X54A 1WDKA 3MOGA 1S6YA 5ENVA 1PL8A 5L4LA 4PLYA 4DC0A 1LC0A 2ZTMA 1BGVA 4HXYA 4UAGA 3ZU4A 1DIHA 4XWYA 5A4DA 4RF2A 1B3RA 3AY6A 3ZWCA 2NU6A 3PGJA 4JJIA 4I5FA 3RFVA 3S2EA 5B12A 3H65A 3LLSA 3RFTA 4MPDA 1YE3A 1NAIA 3JQDA 1YJQA 2IEBA 4FFMA 4DREA 1U1IA 2PD6A 2QYTA 1P3DA 1HE5A 2JD0A 4IDBA 2Q49A 2X5JO 4J49A 5B4UA 1H5QA 5I9NA 1SZJG 1IE3A 2Y1GA 3TZ6A 2HMWA 3JQCA 3G79A 3ON5A 4PLTA 3DFUA 3H8VA 4OKIA 2FR0A 4Y6RA 2VZ0A 4ZVVA 4R3WA 1Y1PA 4NFHA 4DLAA 4WEOA 2NWQA 5L51A 1NVGA 4OL9A 5IF3A 2OHXA 5TIIA 2ZYDA 3LT0A 4N5MA 1M6HA 2UYYA 4YJFA 4AJLA 1N9GB 3OICA 1QMGA 2VRCD 3I1JA 4CLRA 4JBGA 3PJDA 2V6GA 1DO8A 3U4IA 2BMAA 1DC3A 3A4VA 1X0XA 4E32A 1I3MA 3Q9UA 4P4GA 5JNLA 3QWAA 3WMXA 1LLQA 5A9SA 4WGGA 1Y9EA 3KRTA 4IS2A 1DPGA 1PS9A 2E48A 2Z1NA 1JAYA 5KOIA 3L77A 1AHIA 3DDNA 3NEPX 4XEHA 1NTOA 3OETA 1EUCA 4CLHA 1QORA 4BB5A 3NTQA 2OBYA 3GK3A 4IIVA 4G65A 2NADA 3DC2A 1E7MA 1LU9A 1GQ2A 4ND3A 5IXYA 3O9ZA 4R5HA 4E33A 1X1TA 4FQ8A 3UGKA 1YS4A 1NHGA 5AXAA 3SEFA 3RKRA 3EYWA 3PP8A 4WECA 3PHHA 3GDOA 3NJ8A 4NBTA 4NH4A 2EW2A 3H4VA 4XGKA 1LDBA 2JHFA 1RPNA 5G0VA 3TOXA 1E1NA 4K9DA 1DEHA 3PIDA 3WIEA 4KUHA 3JQAB 1KEVA 2EEZA 4RVFA 4E4YA 3OBBA 4M87A 2X58A 2R00A 5EINA 4ZN6A 3WS7A 4BL5A 2P4QA 4R1UA 4CQLA 1Y8QB 4RVGA 2WD7A 3DHEA 3I6IA 4P22A 3Q1LA 4URFA 3JD3A 3E18A 3F4LA 1U4OA 3L07A 3ORFA 4YA6A 4Z9YA 1BW9B 1UP6A 5LCXA 1E3IA 1JKFA 4UEOA 3DB2A 4B7UA 3DBLA 1DDOA 5DOZA 1IHYA 1WMBA 3UF0A 4CV1A 1GYPA 4MP6A 4ZD6A 1E3WB 3E9MA 1DRWA 1HETA 3UFXA 4XA8A 4YYZA 2IZ0A 4RPLA 1ZJYA 1ADCA 2Q3EA 1C1XA 1H94A 3WQRA 3I9JA 4UVIA 4IJKA 3OJEA 3A28A 1ZK1A 4EW6A 2Q50A 5B4VA 4P4NA 3K30A 5AYVA 3OM9A 1PU2A 5I7VA 5I7EA 4YJGB 1B3BA 2TMDA 4AG3A 1EQ2A 4BOYA 5BSEA 1ENZA 1EFLA 2ZQZA 4KUGA 1QV7A 3WGOA 3DZJA 2WD8A 3NTOA 3DAGA 5U4QA 1LBEA 5C3MA 4ZQGA 4CM9A 5LDGA 2IE0A 2J8ZA 1HYHA 2EJVA 1I2CA 2BGLA 5JCJA 1GUFA 1WAMA 3ROQA 1AXGA 3VPSA 4NNJA 5KCZA 1U3VA 2VHVA 2HRZA 4ZQHA 6ADHA 2DU8A 1IZ0A 1W6UA 2AHRA 4E2YA 4Z9FA 1DXYA 1JN0A 1SPXA 4BO7A 3KZVA 1NHWA 2FP4A 5CG1A 3TZQA 4FFRA 1P33A 4RLHA 4CMJA 5I9LA 5BNFA 2WWRA 1JKJA 4F3YA 4R3NA 4CL8A 4E21A 5KJEA 3I52A 5GY7A 1ZXLA 3DTTA 1HE2A 3I9OA 1BDMA 1DHRA 5DT9A 3TZHA 4BS9A 3NJ4A 2O3RA 1EUDA 1YRLA 4UVDA 2DBVO 2QRJA 4AJJA 4EGFA 3DHYA 2O2YA 3GC6A 1NVMB 1VL0A 5JW6A 4KTVE 3F4BA 1PGJA 3LT2A 4B3IA 3VZPA 1TB4A 1B14A 2PWZA 2JAPA 5KNLA 4O0LA 3Q9NA 1EVYA 1A5ZA 2OP0A 4R1TA 2HK7A 1DFIA 3N74A 1DFGA 3ZW9A 4L76A 3CMCO 3KOUA 2IODA 5JO9A 1F14A 2CNBA 1QYWA 3BXXA 2CVZA 5FI3A 1K6JA 3TN7A 3NAQA 2JCXA 2GUGA 3GOHA 4YR9A 4IQGA 3KV3O 3HHPA 1CJCA 3G1TA 4BKRA 2ZYGA 3PVZA 1GV1A 3JD1A 5U9CA 2X6TA 3DOCA 2Q99A 3WWZA 3PQEA 4IMPA 4D7AA 2RHRA 3DBHB 1R6DA 2Z1MA 4GGPA 2HRBA 3SJ7A 3ULKA 1Q0HA 4AJKA 1ARZA 3E9QA 1R0LA 2CUKA 3JTMA 4U5QA 4WCFC 1VKOA 3PTZA 4CMIA 4Q3NA 4FGWA 4M86A 3ZWNA 3SJUA 5HRUA 1HLPA 4S1VA 3U0BA 5ILOA 4M55A 1LSOA 3K8ZA 5CG2A 5IZCA 1X7DA 5EJ2A 2BFPA 3AW9A 1NQOA 2H63A 3JQ8A 4PG6A 1VJTA 1E7WA 4IPTA 2GO1A 1FDTA 3FTPA 2IXBA 4AICA 3I4CA 4K6FA 4XRRA 4NJMA 2X8LA 3AU8A 2PZKA 1F17A 1WXDA 3UHAA 3KYCA 2Z95A 4HFRA 4WASA 4B4UA 2NTVA 4HBGA 3S2GA 1PR3A 1A27A 4OSOA 4I1IA 3RROA 1MC5A 2PKQO 3GEDA 2QQ5A 1NQ5A 5TRTA 3OA2A 4XYGA 2AQHA 2PZMA 3TZCA 3VAZA 4OXKA 1FDSA 2X7HA 3K2BA 1RKXA 5G0SA 1SNYA 1ZXBA 3QW2A 5KIAA 4UVGA 4O59O 2VYVA 4NK5A 1LDEA 4J0FA 3K96A 4CLXA 4YT2A 1J4AA 5G0UA 3GAZA 4YBZA 3JYLA 4JBIA 4NPCA 1E7SA 1EVIA 4C7JA 2UAGA 2I67A 4RZIA 4EYEA 4YAIA 1LQTA 1YKFA 3GRPA 4U7WA 4Z3KA 2GN8A 4AJPA 4F45A 3HDJA 4NFSA 4BQPA 1P31A 2B36A 3WTCA 5CDUA 2PNFA 4LVUA 4FBGA 4RDHA 3FNFA 3LDHA 4R1SA 1MFZA 4TSKA 3MJ4A 4CR6A 3JYPA 1VJ1A 2CSUA 3GG2A 2AMFA 3ZNOA 2RHCA 2CY0A 4E2XA 2DKNA 4E13A 1B0AA 4RZHA 4ZICA 4HADA 1XCBA 3IUPA 3ENKA 2NVUA 3O4RA 4CM7A 3GNQA 1LC3A 2Q1SA 4J2HA 3RFXA 3GT0A 3AY3A 3AU9A 5EMHA 4IDFA 2PH5A 4CMEC 4DTIA 3JYNA 1MX3A 2J5RA 4CV2A 4CMBA 3PIIA 2VT3A 1K6XA 1PJSA 5EPOA 2R00C 1WPQA 4HFNA 1SEVA 4D43A 4FDAA 1GAEO 3VH2A 4RO0A 4W9NC 1ZZEA 4DGSA 1BTOA 2UUOA 5FF9A 4BNVA 2J3IA 3ZI0A 2BELA 4IDGA 2HO5A 3DBVO 1GCOA 1X15A 4BO4A 3RI3A 2WEKA 2Q4BA 3JQ9A 1JW9B 2W2LA 1LSUA 2ZB3A 1R4MA 2AQ8A 1I10A 5FFFA 3HB5X 1EBUA 1K2WA 1Y5RA 5DCWA 3I83A 4GX2A 4OQYA 3RAJA 4H7PA 1XDWA 1NXQA 5F5LA 1AHHA 4Y98A 3RUDA 2NVWA 4PVCA 4AVYA 4LRSB 4B8WA 2DC1A 2PD3A 2CFCA 1X7HA 3BAZA 4MIYA 2CVQA 4R1NA 3AUUA 3ZU2A 3GNSA 1PWXA 4FS3A 1F06A 3OJOA 4XCVA 3OSUA 5DDIP 4O1MA 3K73O 2O7SA 4IM7A 2I5PO 3C1TA 4L74A 5IG2A 3VDQA 3GZ4A 1GZ3A 1M75A 3G49A 1X7GA 5JXWA 3UCFA 4JBHA 3WB9A 1YDEA 4J2OA 4MOWA 3F1LA 3GPIA 2GLXA 3ZWYA 4IJVA 2O3TA 1PJTA 3NGLA 3NV9A 4XX0A 3IMFA 2O4CA 1HDRA 5DNAA 1DRVA 4JJGA 5JMWA 3OMLA 3LZ6A 1SB9A 4OHUA 4E5KA 1PS0A 3B70A 4RVHA 1I24A 1TA4A 3GR6A 2NTNA 5T8KC 1DC5A 1VRWA 5CDYA 1GR0A 1ISGA 5KKCA 4MVJF 5A03A 1YOVB 3PYXA 2E4AA 4CPDA 4TROA 2ZK7A 1SC6A 3G0OA 1SAYA 1PS8A 3VTZA 5AXBA 2C7GA 2XOXA 4II3A 3Q3CA 3UUWA 5TS3A 3WWYA 5CDGA 3ZWVA 5A5FA 4HNGA 3IL2A 3DZIA 1GPDG 1YDWA 3HADA 1E3JA 3V8BA 2B69A 4HY3A 4Q39A 4W82A 4DLBA 5JLAA 4DWVA 3TFOA 3DTYA 4J1NA 3HDYA 4BKUA 5C5IA 2HMSA 1P44A 2GN6A 3ABIA 3C7AA 4BO8A 3DOJA 3I5MA 4O5OA 3H2ZA 1JVSA 3PHGA 3I9LA 1SOVA 1LRKA 1KVQA 1DIBA 1NR1A 3HJAA 4E5PA 4IUYA 4R9RA 3HE3A 2VRCA 3X2FA 4BNJA 3P7MA 2ZQYA 3ZNQA 1EK6A 3IS3A 4E5YA 2EKLA 3JQGA 4E6PA 9LDBA 2RH4A 1WP4A 5T64A 1L1FA 4BGEA 3B6ZA 3QVTA 3QVSA 1EMDA 5KJ6A 3WFIA 4M8SA 2JL1A 5DCYA 4ALIA 1D1TA 3D4PA 3ZHZA 1HTBA 4R5MA 1DIRA 2X9NA 1UZNA 3R3SA 1D8AA 3EMKA 3GG9A 2I65A 1I3NA 1R15A 1QLHA 1LLUA 1XSEA 1V3UA 2YHIB 2DM6A 2P68A 4U8GA 5LDHA 4D0SA 4PG7A 2VHZA 3PI7A 1OOEA 4TRRA 4KDFA 4YAKA 4J7XA 2QG4A 5MGBA 5L4SA 2PLAA 2WSBA 2B5VA 4BO9A 2GN9A 3PZRA 2FOIA 1E1KA 5IZCC 1DC6A 4RQUA 1E5QA 4W7IA 1X0VA 3PWKA 2JD1A 1B26A 4CMKA 1HKUA 2VZ8A 2B4RO 1B7GO 4J3FA 3RBVA 3G3EA 3SLGA 3ZU5A 1A71A 1RM0A 3ZV4A 3U4HA 4CM4B 5GZ3A 1OBFO 2PR2A 4PZCA 2IZZA 5L4NA 1HSZA 3D0OA 4WE3A 3O8QB 2NV6A 4M54A 1U3UA 2VUUA 1J0XO 3KYDA 1ZJZA 2HMTA 4J4BA 1O0SA 5IN5A 3NDJA 5TT1A 2XPCA 2I76A 4JGBA 1XU7A 1NX6A 5B37A 3FPCA 2YV3A 5BNTA 3H5NA 3JYQA 4RQTA 4YAGA 2PKRA 1EDOA 4PFJA 4WEQA 5A3JA 4DPLA 5HWSA 4JROA 4KZPA 1Z45A 3QE3A 2XAAA 4BNZA 3HN2A 5THKA 1IL0A 3GVCA 3AOEA 2O50A 2UDPA 3CXRA 3HWRA 4CMCA 5B1YA 1MV8A 4EEXA 1DBVO 2WE8A 4J9VA 1HRDA 4NMHA 1H6DA 3JQBA 3RD5A 4WCDA 4KQWA 4BNGA 1A7KA 4ALNA 5TF4A 5EESA 4CMGA 4CQMD 3O38A 2EKPA 3JCZA 5JY6A 4XYBA 1PJCA 3BMQA 2OL4A 2ZB8A 4ONEA 4CM5A 1DHTA 1I0ZA 2AEMA 1Y81A 1Y8RB 1KIFA 1Y7TA 1HEUA 5JC1A 2X0NA 4OH1A 4R4JA 4DXHA 3RCBA 3EZYA 4CUZA 2PZJA 5TX7A 1HDYA 3WIDA 2GD1O 1OZAA 1T1SA 3RJ5A 2DPGA 5A05A 4JK3A 3AM3A 3DMTA 2NUAA 1BXZA 3ZN2A 2AXQA 2W2KB 3AI3A 5KKAA 4GI2A 5DP1A 4BMNA 4PLZA 4RCVA 4RF3A 4WLNA 1GYRA 3WNQA 1GEEA 5DF1A 3ZWWA 4DQXA 2EWMA 1PJQA 1CEQA 2ZB4A 5JY1A 1XELA 2P9EA 1TEHA 3DFZA 5JSFA 4R41A 1DJNA 1P1HA 2WDZA 1YB1A 4IJUA 4FOSA 3ZH2A 3V1TC 4C7KA 5KVSA 2D59A 2FMUA 1B8VA 3KUXA 4QSMA 1IHXA 3V2HA 5IDXA 2EGGA 1XWFA 2YV2A 1VSVA 3OA0A 5CP8A 4NBVA 1L7EA 3ZW8A 3BMOA 1GL3A 4YB8A 3WYBA 4DPMA 2QRLA 3E6AA 2NNLD 3ZNNA 2G82A 4LISA 1BMDA 1ISFA 1QLJA 3CPSA 4BO2A 1K5HA 3MWDB 4AJEA 2EV9A 1D3AA 5F1OA 1E0DA 2PKQP 1K0UA 3CZRA 4OQZA 2QRKA 5L3ZA 4YJFB 1CRWG 3VVBA 4LSMA 2NQ8A 1EDZA 3KM0A 2JD2A 4CLRB 1ZEMA 2NACA 1FF9A 2QZZA 3OF2A 3L4SO 2FR8A 5A9SB 1M2WA 2FY8A 5AXDA 1XHLA 3A06A 3GN2A 3O26A 4L4SA 4PLPA 4E12A 3IQDB 1GADO 3RC7A 1G6KA 4R68A 1E77A 3ZDFA 4J1SA 4B7XA 3TRIA 2I6TA 1UAGA 4A10A 1WNTA 3KEQA 3A9WA 3NUGA 2GF2A 2PV7A 3DAFA 3E03A 4WLFA 3ROKA 2ET6A 2EW8A 1NPYA 3LQFA 3BHIA 1RWBA 4YQYA 1Q7GA 2B37A 4LRTB 1MGOA 1GPJA 1ENOA 1ZNQO 5KVQA 5TSDA 3P2YA 2FPPA 3D3EA 4NZ9A 4PG4A 1LSSA 3E48A 3FTNA 1DJQA 4BGVA 1B2LA 3UH1A 3LF1A 2Q1WA 5DZSA 2YFQA 4OGWA 1Q2XA 4H16A 2P4HX 2JAHA 5KTKA 2WYWA 5HS6A 2FHSA 3UVEA 3CZMA 2Y0DA 3IDSA 4U0KA 3U09A 1TXGA 5TGDA 4CQLB 3D7LA 4CODB 1QYVA 2VNSA 2YY7A 1W8DA 3R3JA 4WOKA 4OKNA 3GHYA 3UN1A 5TQVA 4FJ0A 3FCOA 2A94A 4RPGA 2PGLA 1A7AA 3PHIA 3GGPA 4Q3AA 3D64A 3K2EA 1VJ0A 8LDHA 3UAGA 4UUMA 3TZKA 3AJRA 4H3VA 4LCJA 4BO5A 3U9LA 1EK5A 3PYMA 4A26A 1AXEA 3WTBA 3KSZO 2DAPA 1U3WA 3PGXA 4LCEA 4AJ2A 4FJ2A 2EF1A 2ILTA 3SXPA 1YH3A 1C1XB 3WGHA 1Q0QA 1B8PA 1E3LA 1PTJA 2AEFA 4FGSA 5H81A 4NFYA 1I3KA 4OOEA 2AA3A 4HWKA 4NU6A 3JYOA 2TMGA 3WYCA 5JS6A 3IP3A 4AJ4A 3W1VA 2HSDA 3ANLA 4LSWA 3JQFC 1FDUA 1P74A 1WVGA 1ZH8A 2PGDA 1P0FA 2Y66A 3SC6A 1UP4A 3MJEA 1F8GA 5KVCA 4TQGA 1YB5A 2PA3A 4A5OA 2HCTA 3RUHA 4D3SA 4EJMA 2BFMA 1YBVA 1ZKMA 2O48X 4PVDA 1ADFA 2NQTA 4CM1A 1CETA 2G1UA 3CE6A 2RBEA 1P0CA 5G0TA 3WICA 4C4OA 5CEEA 3VOSA 4TRNA 3HQ4O 4HFJA 4IXWA 1VM6A 1XG5A 3IOYA 1VKNA 3FHLA 3ITDA 5HM8A 1ZCJA 3DXFA 1IZ9A 4IZHA 4Q3EA 4Y6PA 4BKQA 3CTMA 4UUNA 1L7DA 4QX6A 5JAQA 4Z0HO 2DT5A 1HDZA 1SBYA 4EDFA 4JJFA 1K89A 1SEPA 2ZCVA 2DTEA 2SCUA 3NYWA 4HV4A 3Q6IA 3L4BA 1CWUA 4YRBA 2GZ3A 3ETGA 3QSGA 4AJNA 3QHAA 2HUNA 3JQ7A 2HKIA 4I9NA 5ICMA 4XB1A 1LDNA 2BRUA 1H6BA 1NWHA 4IXTA 4EJ6A 1N7HA 5TC4A 3S55A 1MLDA 1T4DA 1QKIA 1IPFA 1NM5A 3ANNA 1QRRA 1ADBA 2VHYA 3QQPA 4PLHA 4MVJD 5JAZA 2DFDA 3L0DA 2YYYA 4PGFA 3UKOA 3OJFA 2QW8A 4CMHA 2QHXA 2HLPA 3PJFA 1EQUA 4A2CA 3UICA 4HFMA 5I8WA 2HK8A 3KO8A 4NU5A 1UDCA 5JDIA 3RASA 4FSHA 4J16A 5JDCA 3BTSA 3DZHA 2FR1A 1HLDA 3U49A 3GNTA 1LTHR 1E1LA 3QVXA 4QEDA 1PQWA 2A9FA 3ETEA 1ZMOA 4P4LA 3A14A 4GX0A 1N1EA 2LDBA 3X2EA 1GZ4A 2DUUA 4MVJH 3OIGA 2C07A 4IJWA 4B8ZA 1LDGA 3N58A 3QP9A 5CEFA 1NP3A 3DEYX 1CERA 3QWBA 2JFFA 1KVSA 3DZGA 4U6QA 3F1KA 4GSKA 5BSHA 3PYLA 1R66A 2IZ1A 3ZWMA 5K6AC 1Y5MA 1N8KA 2G5CA 2O3QA 3TF5A 3ENNA 3MJVA 1AE1A 5C37A 3WJ7A 1A9YA 3QVWA 4WLUA 4J7CA 4PLGA 4GX5A 4RVDA 3BIOA 4XQ9A 4B7CA 5EL0A 3GVPA 4J9UE 3EZLA 3ZWPA 1IOLA 4OAQA 4TVBA 4NJMB 3WX0A 1I2BA 1HT0A 3KYCB 5IJZA 1N92A 1P1JA 1LEHA 3ZU3A 3C1AA 4DQVA 1LUAA 2C0CA 3CEAA 3MWEB 2FWMX 1T24A 4LVCA 4IDAA 4BNHA 2D2IA 4UVHA 4KQXA 3RUIA 3EK2A 4Q9NA 2X5OA 3UOGA 4YRAA 1Z82A 7MDHA 2XF8A 1KC1A 4RPJA 3D3WB 3WLEA 3ETDA 1F12A 3HNPA 3DAPA 3WFJA 1E7RA 2I3GA 3WGTA 3K92A 1XR3A 4G81A 3WQQA 1ISIA 3PZBA 5TT0A 1G1AA 3INRA 1X13A 4FPXA 1DB3A 2WYVA 4B4WA 2XXJA 3RC1A 4YPOA 2I3AA 3RUFA 4XYMA 3B1FA 3C8MA 4J6FA 1E3EA 5JE8A 2HMVA 2HU2A 1BSVA 3AM5A 1OFGA 3TNLA 3H6KA 1UR5A 5DBIA 4F46A 2AG5A 2QYSA 4TWRA 1XU9A 4GLOA 4RL6A 4XJSA 3AWDA 3M1LA 3OHSX 4EEZA 5IXSA 5T6BA 4ND2A 3WQSB 1R37A 3WXBA 4U6SA 1NFRA 1TT5A 1UXJA 4RORA 3WYEA 4XZ3A 4YAJA 4PLFA 4DYVA 4BO6A 1RM5A 2CVOA 3AM4A 3ZV6A 3IKTA 2NVUB 5KJCA 2B0JA 2GERA 1C1DA 1QXSA 4M1QA 1U4SA 4XIYA 3AY7A 1XLTA 2EKQA 5L53A 4GGOA 4FR5A 4TVOA 3UW3A 1R4NA 1ISHA 2HMUA 5DP2A 4XB2A 2I66A 2GASA 4BHTA 4E3ZA 4BV8A 3BZUA 4E5MA 3OQ6A 3KHUA 3ZV3A 1J49A 2DBQA 5TJ9A 2VCYA 5H83A 2H5LA 1TI7A 4J4TA 1E6WA 4NG5A 4CLOA 3DZBA 1O95A 2BLLA 1YVEI 3IUSA 3JQAD 1UZLA 3G17A 1YBMA 1YB4A 5ER9A 4CQMA 3FSRA 1SO8A 2YUTA 3PLNA 4LMPA 4NHEA 1HDXA 4NK4A 1PWZA 1U3TA 4MIEA 5IFLA 3MZ0A 3GRKA 2EP5A 3MJTA 1QSGA 2F1KA 3C3XA 4K28A 3L6DA 1GFSA 4P38A 4RPHA 2X23A 3CSDA 1N7GA 2I9PA 3KLPX 1PZGA 1FJHA 3DZFA 1AUPA 3WSVA 4ZJUA 2WMDA 3H9QA 4D42A 4IDEA 1J6UA 5DBGA 3VH4A 1GZ6A 3FPLA 1GCUA 3RQSA 5JO0A 4D41A 4PG5A 3BMCA 4JX8A 4BNXA 3JQEA 2VTDA 4RJTA 4YJHA 1YL5A 3I3OA 4CM9D 3PHJA 2EHDA 3HB4X 4NR0A 1U8FO 1YO6A 4J43A 1M67A 2Y1FA 1JWAB 2I99A 4IIUA 3HZZA 3DHNA 3IJPA 2ZJ1A 2Q45A 1IYZA 4R51A 4KOAA 3TQHA 1XIVA 5U1PA 4B79A 1Q7BA 3RUEA 2Z5LA 3OP4A 2X4GA 3DZKA 4FCCA 4CLEA 2FRDA 3Q2IA 3I9MA 4UREA 1EVZA 1RM3A 2G76A 1SCUA 4WK6A 4MDHA 1GTMA 2DBRA 3FNHA 2BGKA 1HZZA 2H1SA 3GGGA 2P9CA 3ZHXA 3ZNPA 1MUUA 1VL6A 1XQ6A 3V1UA 3LVFO 4XR4A 4AJIA 3PLRA 4ITUA 3C7CB 1DIGA 3WGZA 4QECA 3EY4A 4GMGA 4CMAA 5G4KB 1PSDA 4GX1A 3U4DA 1C0LA 1HE4A 3ICCA 3E1KA 4XRGA 4IMRA 2C54A 4EUFA 4BO0A 1QR6A 3GMSA 3JD2A 1HSOA 3BMNA 3Q11A 4YXFA 2CF5A 4DC1A 2OFPA 4K26A 4EUEA 1N5DA 4GKVA 2XXBA 3FNEA 2EERA 5EQFA 2O3SA 1MXFA 2Y67A 2YZ7A 3LSYA 1MA0A 5F1PA 1F8FA 3AFNA 4TZKA 1LLDA 1T2CA 2YQ5A 3CMMA 2P2SA 1V6AA 3JQGB 5JDIC 1GU7A 4YWJA 4ND1A 4ZQFA 3GZNA 1FK8A 1XEAA 2Y68A
chains in the Genus database with same CATH superfamily
3F47A 1PR4A 3HH8A 2ST1A 1XZHA 1BVHA 2WKWA 4KMSA 1E18A 1ZJ5A 2WDPA 1YHZA 1PL7A 3RAPR 1XXHE 1F9AA 2O0HA 1NJSA 1NYQA 4P7BA 3ADPA 4YJ2F 1ZW1A 5ITVA 1OWPA 4I9GA 1DAFA 1KHHA 1VSTA 2HIHA 2H4XA 2L82A 2TMYA 3Q4GA 2BSXA 4JT9A 4R7ZA 4A8JB 4I5EA 5DX0A 3HEAA 5ALEA 2VUTA 4OHYA 4TKMA 1TZCA 2WTXA 3T9AA 4K9SA 1QMPA 4UUBA 5B4TA 4LY0A 3B20A 1ZVMA 1EZ4A 2P8JA 2SHKA 2XNHA 3PNKA 4W8GA 3TSZA 2ZM6B 4JMPA 4HD8A 2R2GA 3PC8C 1T26A 4RCYA 3LGSA 4C0BA 1RAGA 2H1HA 4PFKA 1POXA 4ZV4A 2QD1A 1WEKA 4RMIA 4B2LA 1BWQA 1VHLA 2PD4A 3ONEA 2O3UA 5JT1A 4F6LA 1ULAA 2REBA 3THRA 1WV1A 4R01A 5AW5A 3UOWA 4D8XA 3B1ZA 3K9QO 1XDZA 4U2BA 2YVUA 2V5AA 3MGCA 3OMXA 2A0WA 4X7PA 4N5LA 3GCXA 3GLFB 4RYDA 2ZTUA 4UCFA 2HJSA 2QRVB 2NO1A 2X3UA 1ATZA 1A8PA 3PUZA 1Y1TA 2VUSA 3O8DA 4KNVA 5E3JA 3T0GA 1EFVB 1P7CA 5BN4A 5JVDF 1E2GA 1K97A 1HDGO 2GB4A 3I9KA 1VE9A 5DT2A 5BUZA 1HURA 5CGZA 4H60A 2BFEA 1ZCAA 4WXRA 1UOQA 1KO7A 4J91A 3AERB 3I01A 4GUDA 3USCS 2CYBA 3ASVA 1YRAA 1M2GA 4AROA 3G5MA 4YEDA 1E2KA 1CRZA 1FQJA 4ZAFA 3SPXA 3ZHUA 3CUYA 4PZEA 4EJ0A 3HJGA 4NCNA 1YRYE 5HUJA 4XW2A 3KFLA 4UXHA 3L4KA 3RVPA 1I7DA 3FCAA 1K68A 3H5AA 2UZ4A 5AVUA 3U7FB 3IKLA 4OJYA 1KOLA 5JY6A 3W05A 1VDMA 1QUEA 2I87A 3BWXA 4RIGA 2BBWA 1FXWA 4WUTA 5G3ZA 5A9RA 2Q6VA 1HBJA 3FKSA 1UFQA 4OIMA 2CEKA 5E2AA 2OCLA 2VSQA 1ES9A 4X5OA 1YQGA 5I7RA 3IAS1 5U4XA 5DK6A 5F3WB 2YNMD 4KXYA 4QO8A 4JBWA 2ZI9A 1QQTA 2V7QD 5JS7A 4YT8A 5GONA 1KIMA 4G41A 3TZBA 1OBOA 1USUA 3ZZMA 4EMBA 3BICA 2GETA 4A6PA 4PW0A 5AVVA 1MO4A 4IF4A 4ENPA 1N0HA 4KMOA 1TVEA 3HGMA 5K2OA 5KZMB 3A2KA 2Q5IA 1OYYA 2O8EB 2OUIA 1Y4ZA 2QRMA 2FZKA 3FHJA 4TRJA 4B3SB 1EVQA 5LBTA 1TCBA 2D3TA 4DV7B 3PNSA 4TL8A 4BLTA 2XHZA 3AKZA 5EWJA 5A2GA 5D1HA 1X38A 1ZD8A 1X9GA 4HGOA 1ZQ1A 4HGPA 2QRNA 2WHRA 4L4XA 3RSSA 2QPOA 5L9AA 4WESA 4AMYA 1XNGA 1IN6A 5IKOA 2H57A 3H4TA 4N0QA 2AOUB 4Q05A 5K8CA 2SNIE 2WTEA 4UVEA 2RCYA 1ZY2A 4W5RA 3UHPA 3V4RA 2VT2A 3SDZA 4G0VA 4LJKA 4JASB 1CE8B 5HTOA 1W4LA 1H66A 1V41E 4H1VA 1M2OB 1PL6A 4Q3BA 4XR9A 5J4KA 3B1WA 1I4OA 3FFWA 4N8DA 2O2GA 4WKGA 1M83A 3PEFA 3RVJA 2IYLD 3VYSB 4F85A 3AKDA 3AI1A 2DGDA 2IYRA 2VHJA 1TCCA 3LM8A 1T9GS 1A9OA 2BM8A 3QLEA 1L6RA 4BNMA 1XZPA 3LX8A 3IT1A 4Z86A 2VL7A 3P0EA 2HZ7A 2BI4A 1RE1A 4RM3A 2OESA 3M1AA 2QAGB 1HT3A 4W5JA 3LD9A 3RBZA 1KSJA 1Z75A 2GDZA 1ZO8A 4LQ4A 3F90A 1W2WB 4TSFD 3LG2A 5GINE 2XE6A 2XCTB 4NZYA 4MVJA 3RWOA 2I1LA 3BMOB 4D9JA 1JT9A 4BUZA 1TEVA 2AE2A 2BYTA 2EIHA 4DR2B 4I66A 4QG7A 5B1HA 1RWVA 3BQNB 5COBA 5J1SB 5DHUA 4RJLA 4MO2A 3VO8A 5IUJC 1ORHA 1ZH6A 1B8OA 1GTSA 4R2XA 5EIEA 1ZD1A 5EPEA 2AG6A 3ZDEA 4C7VA 4D9FA 3K94A 4NE2A 2Z4TA 4I3FA 2R6ZA 4A15A 3I8SA 1P9WA 3NEYA 2VHCA 2BGTA 3GEEA 4MI6A 1UANA 1LNQA 3VHXA 1C9JA 5HIAA 5MF6A 2B7BA 4M0EA 3RIXA 3OI7A 2DR2A 3Q6MA 5A7GA 2Z98A 2BFFA 3PNBA 2ZIVB 5DX8A 1XRNA 4DIUA 3I5YA 5K20A 4GE3A 4YJ3F 3SLRA 2WBLC 2JFOA 4FGLA 5JYCA 3PXCX 2I6XA 2XVXA 2D1RA 2P5TB 2P7HA 3IT2A 3TG2A 4RFLA 3NHUA 3VI4B 3T7RA 3QU9A 4HVCA 2O54A 1J39A 5EA2A 4EWLA 2DFVA 5HA5A 1ZJWA 3QPCA 4HPWA 1GV0A 1ZNXA 2X0RA 2G1AA 3KC2A 4FZ3A 2PFGA 4M7WA 5BMVF 2D5AA 1KRXA 2JA2A 1LRJA 1ZXXA 1RAIA 3W8FA 4PO3X 3O73A 5CXSA 1M5RA 5DN9A 4BQRA 3GAFA 4RIFA 4L73A 1NZJA 3P9CA 2VDWB 1UH5A 2ODBA 1RJWA 1UM9B 4I9UA 1NUUA 4PZZA 3BCUA 2BV3A 1EFRD 2OT3B 1PGPA 1GAJA 1UIRA 1LD3A 3PGKA 4ZDWA 1DAKA 2B5WA 5JXHA 2FPPB 2XE8A 3WYDA 1YR8A 4CKWB 3AR5A 5FPKA 2NXNA 4FYMA 1RQXA 3E82A 1VL5A 2XLCA 4R1LA 2XYVA 3LP5A 1NXVA 5LQSA 5CM9C 4TXJA 8AT1A 1E9FA 2J3LA 3VC7A 4YT4A 3UNXA 3U5TA 1AO0A 4IIYA 3ICOA 3B51X 4IQ8A 3ZU6A 2EFEB 3VNQA 5ADUS 3FLAA 2I4LA 3AONB 4TMVA 5ALTA 3UV6A 4RHYA 1A7UA 3I9FA 3IPAA 2WA2A 3FDJA 3H84A 1FS6A 2HD4A 4JL8A 4AO8A 1BD3A 2H00A 3FMOB 3QE9Y 1P1IA 5L45A 3IOEA 4CXMA 5M34A 2FEWB 1T3ZA 2NZJA 3E5RA 3F3YA 4KSBA 4XKJA 4B34A 3MHPA 1OA1A 3E8XA 1X8KA 1VHJA 1SY7A 2YV4A 2HYIC 2BI7A 3SHWA 5LM3A 2II6A 4UBLA 4LJRA 1XXHB 1HLGA 1JTVA 2ID9A 2PX5A 3PR2B 4DADA 5I4IA 1CS0B 3S44A 5ESXA 1Z73A 4Z0TA 1FTWA 4M7OA 1CY4A 1A04A 1IY8A 3OEYA 1G8PA 1EDBA 3MJSA 4QO7A 4RPKA 2FMFA 2WM9B 3LGXA 2EG9A 4AP6A 2LGJA 4WX2B 3VSBA 4QFBA 2Z3VA 3R7BA 4BB9A 3FAZA 3KSUA 4X8OA 3SZOA 2NT4A 4DIMA 5IM5A 3LHIA 2PRIA 3GZJA 1SKQA 2HT1A 1Z2AA 2J85A 4LGVA 3DWFA 5ALNA 3TTYA 2IEYA 3E4DA 1M2KA 3VNUA 3KHTA 1RLTA 3FROA 3GD7A 3OZWA 4CG2A 3P4YA 4ZRMA 2EJUA 1YQWA 2KBEA 4C5AA 5C8DA 3J81A 3PDUA 1H1LA 4LYAA 5DHQA 3G0BA 5CB8A 1RRMA 3QVLA 4KTTE 1ETUA 1LNSA 2W7TA 4EPXA 1AGNA 1PGQA 3IQHX 3L8MA 3ODGA 4DILA 3AW8A 1NASA 3PE4A 4QNMA 1LTKA 1MB4A 4IOJA 3SF8A 3RG2A 4J0KA 2YJZA 2AL7A 1EM8A 4IQ4A 2JIQA 3I0MA 4MB0A 4QPJC 2WPDD 3FVQA 2PR7A 4PQEA 3UZUA 1J21A 3I23A 4FOOA 4MR7B 2XUHA 1KEEB 5AM4A 3IAEA 3RPEA 4Y6SA 1BEUB 3VC2A 4AN0A 3AIIA 2XB6A 4IV5A 3IAUA 1YRWA 3SE7A 3VZDA 5FBHA 1GQQA 1JDPA 4WOPA 5CIWA 3JR3A 2VZEA 3ZOKA 5CVUA 2FWNA 2XA9A 2ODNA 1EVKA 3B1JA 3EZGA 4Q7LA 1WMDA 1Z0ZA 3P2EA 4ZCMA 3BULA 3NC0C 1GQYA 1V3VA 1Y1QA 1EVJA 2FGKA 2PZFA 1UPXA 1W88A 3DS8A 3EQ8A 4C4SA 2GCPA 2Z56A 4XTRA 3E9NA 1H3EA 2IEGA 2WZDA 5F76A 1I5RA 4PX9A 4RWZA 1V7ZA 4OUDA 5ADHA 5CT4A 1NDQA 5KYVA 3EC7A 1TL7C 2JBAB 1OB2A 1HOTA 1FNNA 4NV3A 3QYAA 2PGNA 5D3MB 1NJGA 2AJBA 4G3XA 3CH7A 1XXLA 1KGDA 2CHQA 4YJDA 4ZAVA 5J59A 1A5TA 3LWDA 5FI0B 3F6BX 4IHJA 4YRPA 3LBYA 2BEJA 3K6JA 3O3OB 4LXTA 1DQZA 2QD2A 3QVGA 5A1JA 2CC2A 2F1OA 3H9JA 3PDHA 1XMPA 5HILA 5KI6A 5AI0A 2C0QA 1E3TA 1T34A 2C3UA 4FIZA 2JGAA 4X1YB 3C85A 1BO6A 1T5OA 3GF4A 4X7BA 1P5RA 5BN3B 2Q21A 5K3FA 1HXHA 2F59A 1NXXA 1QVVA 2C42A 4UC0A 4WBXC 5HFNA 4J6EA 3Q88A 3ZWQA 1IULA 1CR1A 2Z9DA 2WILA 4JEMA 4X20A 4H9GA 3MD9A 2O8CA 2AMLA 2DPXA 4NTZA 4RMGA 4BIIA 3I1IA 1ZVJA 2RHTA 2D1TA 4TVSA 1MPTA 1SD5A 2VNJA 2X4LA 2YMLA 2ZRIA 3FF4A 4IHKA 1I6MA 1KFCB 4O6VA 4JWTA 4RGBA 3ADOA 4K05A 3WISA 1P2GA 2Q6LA 4FINA 3U4CA 4BC0A 4MINA 4DCJA 3DO6A 2ZXEA 3V8RA 1CFJA 1SQFA 3OZDA 1EHCA 3HBJA 1M6EX 3JD0A 4GEGA 2XD9A 2D13A 2ZTHA 4R05A 3BCHA 2V7VA 3PEEA 4QDUA 4X44A 1K1EA 2BKUA 3TOZA 3W06A 1KAMA 1II8B 4YONB 1IM8A 1SRRA 2FSVA 3IPXA 5KB3A 2JKZA 2V65A 4FD2A 4KRXA 3QU4A 1VKZA 2RI1A 2BJHA 2Y1OA 3PUKA 4BFCA 1GEGA 3NTVA 3GJ4A 3KUDA 1EU1A 1MXHA 1Z74A 2WTAA 3O90A 3RK1A 4ZXPA 1ZLYA 2OQRA 4MJ3A 5BMOA 1ZSYA 2F90A 4P32A 4X7MA 4QUGA 5K0SA 3LKVA 3SVTA 2VNKA 2EL9A 3KYIB 5A4AA 4M53A 4REMA 5EMNA 4EHLA 4YCMA 3K0FB 4GL4A 1WQ3A 3UK0A 2Z2IA 3B78A 2GKGA 1P3JA 3BF7A 3HDHA 3LX4A 2UXCB 4I4TA 1YUBA 3VOTA 3RYHB 3ZE7A 4CMIB 5ICGA 3DMTC 1RC0A 3FGNA 1TECE 1VRCA 4WUVA 4MDEA 3PUWA 1VFNA 3AUAA 1P9LA 4RHUA 3ZHVA 2AWNA 3F78A 3TZLA 3JZAA 3L92A 2DQSA 4ESOA 1FNCA 3BF8A 2YV1A 4GPEA 4Q7JB 3VNRA 3I92A 5IP5A 4L4RA 5FL7A 4D3DA 2B99A 3WA6A 2FZLA 2JFXA 2EG5A 2QM3A 4LTNA 3UFBA 1JG1A 4GWKA 4MTLA 3W3AD 1EJ0A 1QG6A 2V45A 3A7EA 3QXHA 1FX0A 3BSYA 4IIXA 4MLZA 2P9FA 1ISPA 2J87A 5K05A 2H17A 2O23A 1YKGA 5BN1A 2G0TA 5LIPA 2YWBA 2H4YA 4MW1A 2YMQA 3WK8A 4GPAA 3GUHA 3REQA 3ROEA 1RR6A 2QN3A 4HWOA 4LJ7A 4B84A 2NG1A 4TLLB 3C6ZA 2ZM5A 1C0KA 2AYZA 1KDTA 2A9OA 4YP7A 2Q2QA 3U62A 2D1YA 3S2IA 2OV1A 3FR8A 4JC8A 4FGJA 4URVR 4RD2A 2BSAA 1N5IA 4N54A 4E03A 1EE2A 2BKAA 1VYHA 2OCYC 4MIOA 1O9BA 4RKFA 3RODA 3HR4A 4ED9A 5CD9A 1Q1ZA 4LVOA 1Y5NA 2I3DA 4DA9A 1D2RA 1IC6A 4YPVA 1AT1A 3SYLA 1SIOA 4XYLA 2AW3A 1JILA 4ZT4A 1TM2A 2W6JD 3P94A 3MJHA 3W3AH 3RT9A 3VOAA 3IC5A 3L8YA 4QWMA 5TS2A 3LC0A 3OOYA 4DQUA 1QIHA 2VNAA 1M66A 4R54A 4K6CA 5H0IA 3K70B 1Z36A 1GGJA 2G6TA 4BB6A 2OB1A 3HB0A 4D26A 2QGZA 2X76A 4MA5A 3QXXA 4I2VA 1I2ZA 3KSMA 3DONA 2XNCA 1TMKA 3FZQA 4E30A 4LBZA 3QFCA 3RBXA 2Z09A 3ELDA 2FR8C 4NG4A 3ZJYA 4MWZA 3D4NA 5KCMA 2X0EA 4D9EA 8ADHA 4U4AA 1GDHA 1F2TA 2F8MA 3LGAA 4BUCA 3ZD9A 1QU2A 3GJ6A 1GLVA 3ILYA 3T4XA 3ZX5A 1T8UA 3VX4A 4DCTA 4YCAA 2VDQB 1M2VA 4KQJA 3TSCA 4BNTA 3TOVA 5AFSA 3VX3A 4OXNA 3NFYA 2QRPA 5DK4A 3DOOA 1RJEA 3I6ZA 3Q6NA 2X22A 1CIPA 4ZPJA 3KVYA 3H2SA 4CCWA 3MGKA 4DXDA 3E3MA 3MMPA 4FQ7A 5JAUA 3FPFA 1F2VA 1J8FA 2W0MA 4XD7D 2FN9A 4PZAA 1GFWA 1TJYA 3M6LA 5F12A 5F7JA 3PICA 5JEDA 5JPDA 5KYTA 5J2UA 5A02A 4U00A 2IU6A 2IOHA 3M7IA 4JVSB 5D86A 1IAVA 5C0OE 5IVPA 4OSPA 3VFDA 1NT4A 3EXFB 3WLAA 4CT4B 4XSGA 3OTHA 2C9CA 2DFNA 2G17A 2JRCA 4OI1A 4HQOA 3V42A 1S9DA 4CLOB 1LSJA 1OH8A 1PFGA 1CY8A 1NW6A 3L9WA 1AIPA 1L8AA 1T9AA 2J5KA 1JQKA 1L4EA 2YNMA 1HDIA 2JASA 3QKRA 4MYDA 3JATB 4QXQA 4L27A 4X85A 5IARA 3NMUF 4P92A 3FFAA 4MTCA 1V71A 1FFXA 5CCDA 5IDYA 4ER6A 3E9RA 3JR7A 1U7PA 1KP3A 4PLVA 1OPRA 1Z28A 2FSIA 4K46A 4EUHA 3O4VA 5LQUA 2Z8YM 4RKWA 5ALJA 1XD8A 3B5IA 2QXTA 3IDQA 1Z4JA 5JD4A 5JC8A 4CF7A 1RWXA 3I72A 1KPGA 2Z5GA 4HNUA 4GZ5A 2HXGA 3A9VA 5C7LO 1Z7EA 4OBEA 1GIAA 1TJPB 2UZ1B 1U7OA 3G5TA 4EB0A 5A5VA 2OORA 4FJ1A 1KDYA 4D4GA 2W70A 4LJ8A 2QN1A 1F8UA 1H8ED 2V0CA 1H4TA 3QOXA 4BGIA 2MHCA 4IDDA 4B6GA 2XDAA 3AUTA 4M98A 2R6R1 4UTZA 4F38A 1N78A 3DEHA 3IA2A 4Z0NA 3RSLA 5JRDS 1D1SA 3LBIA 3VVCA 4A8TA 2R4UA 1PTJC 1GVHA 1T2AA 4QJ3A 1O03A 4JLBA 3HKBA 4WAUA 3EGOA 3VGPA 2EBUA 5B58C 3D8HA 4Q37A 2N0SA 4PN3A 2H29A 3WGGA 3RRNA 1VPTA 1Z6YA 3DKVA 3JWJA 1FSFA 4LGYA 1N25A 3M6FA 4Q34A 1SBQA 2GTPA 5GJWC 3VSCA 5IK2D 2AK2A 1YFJA 4LFBB 2OXRA 4LI0A 3BSFA 5ALFA 4MV9A 3T3NA 1G38A 4AMUA 4INAA 4BPBA 1Y8CA 1L8QA 2AOTA 3QVKA 2DPLA 4RHTA 2X8JB 2AX4A 1CV2A 2GQ0A 2H9YA 3P9RA 1G60A 3IT0A 5ESDA 2BEVB 2GPSA 4IDHA 1W19A 4A27A 3OEED 3C7KA 3L5OA 4PHGA 3DO5A 3L01A 4TSFA 1NRIA 4BAGA 3CH5A 2EFHB 5BP7A 5CXUA 1Q15A 4YLYA 3KG2A 3NUZA 5G02A 1TCUA 4ALJA 2QB5A 3JD4A 1T4CB 5KYYB 2CDCA 2VF7A 3CB4A 5EJIA 2XXAA 1NN5A 3OF3A 5TR9A 1I8TA 3OEHD 3PNLA 3PFFA 3Q3EA 1QP0A 1YNOA 3NH6A 4II2A 4N03A 4RY2A 7ADHA 4W6ZA 3SFVA 4N0EA 3P5BA 4UU7A 1SUSA 2IPXA 4C87A 1KMHA 5CFMA 4JI8B 4NI5A 2BZSA 4KKVA 4PF1A 1V3TA 4UNQA 2PSSA 4B4VA 3HCPA 2KE5A 3RDPA 3ORHA 4HAIA 3MTGA 1D8TA 1BHJA 2BR5A 3QELB 3BHJA 2Q4RA 2GPAA 1PJ4A 2UZIR 4GBJA 3NTLA 4FFBA 4QT4A 1R1DA 4K81B 4LY3A 2SKEA 4RE5A 4CDMA 3WRXA 1PNOA 1YULA 4AIIA 2NV2B 2BRUC 3VDRA 3CJTA 3L41A 3LY5A 1JTFA 1J2UA 3RK4A 4AURA 3EVTA 1N5LA 4ZVLA 5GOTA 1GAQA 2B94A 2F4NA 2XADA 4TLMB 3ESQA 2PL3A 1NFQA 3NDPA 3UJDA 2G88A 2IU4A 1K3UB 3PHCA 5KNDD 1WCXA 5KINB 3PDJA 4CWAA 1NW5A 1RBMA 2WJ4A 2PKEA 4GRDA 4HDKA 4C1BA 1GVNB 3T1NA 3ZXIA 1JDNA 3PPWA 4I55B 3UOAB 2B4AA 1S2LA 1ZMRA 3NBMA 3DGEC 1VSUA 4WNIA 1U8UA 2ZUBA 5KDDA 4QQRA 2P4SA 3PFWO 1GZ5A 5D7NA 1D2CA 3GRFA 2VJPA 2CWDA 2HRRA 1Z37A 3KB6A 1OLXB 4J16C 1EFRA 4N18A 4DBLC 1ZKDA 1AJEA 1MIOA 4WKNA 3U7IA 2GK6A 4KO4S 3VKFA 2NU8A 1M1NA 1S7CA 5F3DA 5FEUA 3P9PA 3U3RA 7YASA 1BDIA 5L7WA 4ZO4A 3ZZNA 4W7HA 1I01A 2PS3A 4I8XA 4WLVA 1FJ2A 4YDSA 1GA1A 2JHAA 4B43A 1RWMA 4M1TA 4DHWA 2LE0A 4UJ5A 3EXEA 4P53A 3T7AA 4EL5A 5A62A 2E87A 2VWHA 4I6EA 3E5MA 1U9CA 4LMRA 2JGDA 3OIFA 4OM8A 2QVBA 1LQ2A 3MOIA 4IQ0A 4J0GA 4NU8X 4REOA 3UK6A 2VRBA 1ENPA 1M1YA 1YOVA 2QZJA 2ZE8A 1VG1A 3B52X 3IP1A 4KXVA 3LFUA 3W6UA 4EF5A 3THXB 1MOSA 3PUYA 3WGIA 2CFTA 2C5BA 2R1TB 1V7PC 1PT6A 1MEOA 1N2BA 5AJVB 2BEKA 2WJ3A 4DQLA 4MJ7A 1N6OA 3R5TA 4LXQA 5JPIA 4HAYA 1PZMA 4B17A 3D3NA 3A6JA 2WV7A 1TUGA 3R24A 1BX1A 3R76A 4BNIA 1L5HA 2ODWA 5CX1A 1YXMA 1KYQA 1OZHA 1U9JA 3BA1A 3HJRA 3TM5A 1QK3A 1BJTA 4G1VA 3DCIA 2AYYA 4DJDC 1RKQA 4E88A 1NUTA 4MHOA 1YR3A 4BVAA 1PJ8A 1VE6A 5HGJA 3T5BA 3AJ8A 1FBTA 1CVLA 2P4UA 1ZUD1 5ILGA 1SXPA 5IM4F 3OLVA 4IVNA 1JHPA 5DI3B 3CVUA 3QXJA 1LXCA 2XRMA 5TQJA 3TW8A 3M6AA 2ZBVA 2CV2A 2PS9A 2FF7A 2G0AA 3GEMA 2WYUA 4UCXA 5JADA 1WIWA 2E49A 3L7AA 1I33A 2H1IA 1FNDA 4OTZA 4XIJA 1RJ9A 1QG4A 3LLMA 4K86A 4WL0A 1JFRA 4ZO6A 3WMEA 2DHQA 1XA0A 1GZSA 2Q5JA 1ZK3A 3CRW1 3HMQA 1UXHA 3FGOA 1J9GA 1WD5A 2HM7A 4N0DA 1K7EB 4K5QA 4Q9KA 2WPDA 3RS4A 1N1GA 5EKSA 2PBFA 3M5CA 2K4MA 3QWFA 3S1LA 4BNKA 1ISMA 4DBZA 5BXQC 1FRVA 3PFNA 3TD9A 5FLXA 4MHTA 3KVOA 4G1BA 2I4OA 4CCYB 2OAQ1 2ZRAA 1STOA 3LTNC 1VLHA 1P81A 1TFUA 4GQIA 4YC7A 1P2SA 1N5JA 2BFOA 4E70A 3OU7A 3HKCA 4CV0A 1GUYA 2YHIA 1WPXA 4HUJA 1JDJA 4XUGB 1U2DA 4BMOB 2AEEA 5EZYF 1JUDA 3RVSA 1VBKA 3DVRX 1DMSA 3KETA 1IN5A 2JJ2A 3DV0A 4FFPA 4EFMA 2H2HA 3EXG1 4RTJA 4ETNA 1IZ8A 1V16B 1GKKA 1U0JA 1YL7A 2GEKA 3A36A 3H18A 4AJ1A 1W36C 4OQLA 4LDAA 2QJFA 1NA5A 2IDKA 3E7XA 1MU0A 5E2BA 4DLXA 4E5SA 5CLJA 4ENSA 4FSDA 1T3SA 2QIOA 1Z6XA 2OBNA 3SXUA 4O2BF 1LLCA 2ECKA 2NU7B 3I9V6 3VSAA 3W5DA 4U02A 3FN4A 1U28A 2A5LA 1WZIA 4WN9B 4KAAA 4YQEA 3Q7QA 2V97A 3QJ5A 2XCQA 3LBFA 3H5WA 3AFHA 2FKNA 5ERGB 5THQA 2XT6A 3PXBA 5BN5B 3AHIA 2HFKA 1L5OA 4PPQA 4ZC1A 4CM8B 3D7SA 4HKTA 4R16A 1KK3A 3BC1A 4BEVA 4Y8VA 4CTNA 1CDZA 5DLPA 1TQ4A 4GWGA 2R8OA 2VAMA 2HDWA 3BK2A 1WMAA 4W5HA 4EX7A 3SQXA 3KZOA 4ALKA 4HX9A 5CAEB 4JU9A 2J6IA 3AO0B 5FWDA 4GMDA 2PWPA 4HWGA 4LCBA 1NQAO 5FV4A 1Y98A 4LYHA 4DLYA 3OSZA 2JCYA 3CNNA 1W5EA 2P41A 1PHPA 3CINA 3FY4A 3Q8LA 1FC0A 2C8JA 3VR2A 1XLWA 2D5LA 4HEA1 1T2DA 1AA6A 4X0EA 4KHZA 2VQ3A 1KPHA 4RESA 5TJHA 1N77A 4DNFA 2W2LD 1PZXA 5HF6A 2JH9A 3RU7A 5EIAA 5IVDA 4RUKA 4EK9A 3K9HA 5AJTA 1YVUA 2CXUA 5AKYA 3PE6A 4RQBA 2E0IA 3H2JA 4J8PA 2ZVDA 2A5DA 4TVKA 1JDBC 4S0XA 3ZK7A 2PX4A 3RQIA 4R8MA 4KXNA 3RIGA 1WQ1R 3T5GA 1ZD5A 5HHTA 2XHEA 4MA4A 4DVJA 2DJ5A 5H82A 4N1AA 1XTBA 4NPAA 2FCAA 4Q9AA 3A10A 5IUKC 2NXJA 1LA2A 1Y8RA 3EMDA 1O6ZA 3MSXA 4RADA 2PTGA 4XLTA 1QFYA 1OT5A 3RJZA 2PGJA 2YWFA 2XYGA 2CGEA 1VL1A 4KPEC 3H3JA 5JALA 4MW9A 3LIIA 3UK1A 2CK3D 4C03A 1EEHA 1G8AA 4EVIA 1GPKA 4MUMA 4U0JA 4XGIA 3IRUA 2ETVA 3FRHA 4EG7A 1G2QA 1OQAA 5B30A 4Z4QA 2OO5A 4WGFA 4MLDA 2BGUA 4BCDA 1EX9A 3DM5A 1E1RD 5H1YA 1BE0A 4QXMA 4EGAA 1Z56C 4HWSA 1S8NA 1QM5A 2R1ZA 4EY4A 721PA 3AXSA 1ZSNA 4AN4A 4B3MB 2G4VA 4GYKA 2X8AA 5AW8A 3RTEA 4UBMA 1QPZA 2ZIXA 3W3AA 4MS4A 5L4LA 2C7OA 1FFYA 4HXYA 1SXJA 4C4ZA 3GRUA 4DAOA 3UUGA 2FRDC 3AY6A 2QRUA 1R4AA 4R7TA 6NULA 3ETNA 1D03A 3W6NA 4G09A 4IKPA 4JJIA 2V1UA 5B12A 1PD0A 1KYIA 4Q12A 4RKYA 1KJQA 3H65A 3T7SA 2O5EA 1N2JA 3RFTA 4M1SA 5TDHA 5K0LA 4W5QA 1CR4A 4IGKA 2HBRA 5ECYA 5EJFA 2BR3A 4I50F 4EYSA 1RAFA 2Q7DA 4R0NA 4DREA 1NLZA 3O2SB 2AXNA 1TYDE 3IP9A 1P3DA 1HE5A 4J49A 5B4UA 2ZLBA 3OBIA 3WIBA 4OLFA 1G2IA 2KBFA 1IE3A 1YIDA 2W6JA 3RRMA 1T1EA 4BCBA 1QVAA 2DT8A 1TTQB 1NTRA 3ON5A 4PLTA 3EHDA 3H8VA 5JQGA 3FYDA 2VZ0A 4JHLA 3P20A 1Y1PA 2A9PA 4ME6A 1ACLA 4RLQA 1LLFA 4JT2A 2OHXA 4QFMA 2OK8A 1GRQA 3U7EB 4DCNA 2ZYDA 2OAEA 3TRDA 3EMVA 1HE1C 2QMHA 3BD7A 4G5OA 3ZLJA 1N9GB 3BA6A 3OICA 3R7SA 5L3QB 1G7TA 4YRNA 2Y6UA 3I1JA 4CLRA 2J0QA 5ALIA 1K8QA 4H7KA 2PWYA 2V6GA 1J06A 1DO8A 3FZYA 3TRKA 1DBWA 3GEBA 2BMAA 1DC3A 3SHOA 1WUTA 1T1JA 1I3MA 2D5BA 2IKQA 4LRUA 2AYXA 2VYCA 4YDHB 2NPIA 4Z9AA 2E48A 1VIVA 2ZJZA 3LXRA 5KOIA 3OUUA 4C29A 1EXMA 3BE4A 1YS2X 1G41A 4DW8A 1YIAA 2XBUA 4IX9A 2CV1A 2HHHB 4F1JA 2HI0A 3A3OA 4Z7QB 2IHBA 4BB5A 2ZWOA 1KKMA 2OBYA 2IIQA 3ABSB 3MJRA 5E4JA 1V6SA 2ONYA 2WY2D 3WLNA 1RCTE 3DC2A 2R60A 1LU9A 4G5QA 4P2BA 2AN1A 1DPFA 3IBFA 4XVRA 5ADWA 4FQ8A 5LSAA 2O2EA 1FFEA 2YJGA 1M2EA 4JL6A 1E62A 3MMSA 4MVWA 3EWIA 1IHUA 1VRVA 1NHGA 4WXHA 3SEFA 3SFTA 4CTOA 1B6GA 1ZH4A 1G9XA 2X0KA 3NHWA 2CKMA 2QVGA 3GDOA 3MCAA 1BZYA 5ALQA 1RPNA 2FE1A 5HE9A 3UB4A 4C08A 1DDGA 3PIDA 5CFNA 5KYWA 5AW9A 2BMWA 4AY6A 1TF7A 2RGXA 2RHOA 4RVFA 1SCAA 4MV6A 4NAHA 4E4YA 4EKIA 4M87A 3D8RA 3A9CA 2XTNA 1X1CA 2BTQB 4KPGA 1WDTA 5KWIA 3WS7A 1QB8A 4R1UA 1SUBA 4CQLA 2BVNA 4EVRA 1Y8QB 2MJLA 3KLOA 4RVGA 4TSRA 4P22A 3U4GA 1U8ZA 3WO0A 4BU1A 2B1QA 3DDSA 3V6LA 2CD7A 3E18A 1MGPA 4YA6A 3ORFA 4Z9YA 1T0JB 2P3OA 1BW9B 3THWB 2D3WA 1VLMA 2C5LA 4L72A 2VTKA 3CVOA 5B3JC 4L7QA 2D8MA 3GNLA 3DBLA 5I9IA 2ZZKA 1IHYA 1WL8A 1K8YB 1LK7A 2I3BA 2YWGA 4KFRA 4O2RA 1H8EA 2NT3A 3O6VA 2AXPA 3E9MA 4IXNA 3TO5A 5KYGA 4LF4B 3CH4B 1XAGA 1NXSA 3A26A 2HUPA 1G7CA 1IVYA 2XWSA 1M8FA 1C4KA 1PFWA 2Q3EA 5ALHA 3I0ZA 1WETA 5JS8A 2B98A 2EW1A 1QHIA 1M7GA 2WF6A 3GQBA 1UKCA 3I9JA 4QUHA 3OJEA 4UVIA 1Z22A 1TKRA 3WMFA 4EW6A 3D8SA 3R3HA 4LNHA 2JAOA 4QDJA 2PAFA 1L8LA 4UDXX 4AJ9A 3PNYA 3K9FC 1DKLA 1N3LA 5IK2A 3M6WA 1PU2A 5I7VA 1HG1A 1SC4A 2HWXA 3B9QA 1B3BA 5LYJB 1KAHA 1H2EA 3UKDA 5BSEA 2IPMA 5JZBA 1C9DB 3RLIA 1YFLA 4JI4B 5FORA 1N6HA 3WGOA 1HY3A 1RMYA 2WD8A 3DAGA 2OGSA 1LBEA 2PMDA 4NATA 3SKYA 4NJEB 2WIGA 1SM4A 1YZGA 4H1TA 4C4XA 5LJIA 2JH8A 1HYHA 3TBKA 4JI6B 1BE6A 1I2CA 3D5EA 1B1AA 2OA0A 1GUFA 4M8KA 2IV2X 1TOAA 5I4CA 2H5IA 3OE1A 1WVMA 3OEHA 4OQFA 1WQ4A 1I6KA 2YOFA 1U3VA 1DU4A 2XX3A 4ZQHA 3O1HB 5FOWA 4AN1A 6ADHA 4JSYA 3AF0A 1TZ2A 2ECQA 4TTQA 1QRAA 1V8ZA 3JX9A 3HO6A 4Q4DA 3RU2A 2AI3A 4UAJA 1W6UA 2AHRA 2C2BA 4BO7A 2HRCA 5CG1A 3O7WA 3RYFB 3USZA 3PGLA 2WAXA 4FFRA 1P33A 3LAWA 1E1YA 3N2LA 3QMWA 4RLHA 2C78A 2C98A 4UKDA 4KK3A 2WIBA 3HXKA 2BFCB 2FDXA 5JSKA 3HVIA 4DLKA 4HTAA 4Q18A 3TQSA 1HE2A 2BY4A 3I9OA 1DKRA 5CNKA 4EW3A 1Z0DA 5I5EA 3EOZA 5JECA 3G23A 4HAZA 1LPPA 2QV7A 1HDEA 4DV4B 3ZHOA 2XECA 1EFUA 4PTZA 1MNAA 3LX5A 3DHYA 4EGFA 2ETXA 2IDMA 3JQPA 1ESEA 2XMGA 4O4IF 5KNDA 5D1NA 1MQ9A 4KTVE 5CFQA 1Z2NX 2PLNA 1E2NA 3LT2A 3QUBA 1SVMA 2BDTA 2PH7A 1RRGA 3U48A 4MWEA 5CVEA 1Z16A 1Z7GA 4G1FA 2DWCA 1B14A 3QBVA 1GGVA 2ENUA 4LKOA 3P1JA 2OFOA 1A5BB 1BWPA 2BKEA 4BX2A 2AGVA 1DFIA 3LZCA 4LX8A 3ZW9A 2PS1A 3IB6A 3KOUA 3HBFA 5JO9A 4ITVA 4M8NE 4NH0A 2DUMA 1YT5A 1J22A 3BXXA 1JDVA 1RYBA 4RW0A 4CKZA 4PC6A 1T0UA 3IKMB 4Q4AA 3NAQA 1I13A 1RIFA 2IE8A 2JCXA 5IW8A 1RHUA 1SVKA 3MJFA 4DV1B 3T99A 1J07A 3CGWA 1JZSA 3MMZA 4U2DA 3W2TA 5LA6B 1GV1A 3FRIA 2F3UA 3JD1A 4RGYA 4EA9A 3EXIA 1K88A 4FYXA 2FPKA 2I2XB 4H2DA 4RGQA 3GFVA 5A7HA 4D74A 4C3OB 4FYKA 5LXTF 2ADOA 3HZRA 4ZOLA 1EP1B 4NOJA 3EZ9A 1VIMA 1R0LA 4XGRA 4KKXB 2AWOA 2GKOA 3IXQA 3ZD6A 2CUKA 2I8CA 3JTMA 4K6KA 3E9DA 4AWBA 3PXEA 5H16A 1ORWA 4Q3NA 1US8B 4KLZA 3FOZA 3KR1A 3T52A 2QUZA 3SJUA 3BE6A 3QOFA 5HRUA 2G9QA 4M55A 4YPFA 3K8ZA 1SKBA 2P2LA 5IZCA 3UJ9A 4RE6A 5I48A 1MEEA 3TLBA 3QUAA 5CUQA 5KTNA 4KPYA 3JQ8A 2YCLA 3PS9A 3AWIA 4URUR 1VJTA 5HXAA 3FUTA 3LP6A 4JQOA 3FTPA 4KI7A 2QXUA 4ZVSA 4WNAA 4MGEA 1GGEA 3JVEA 5TGZA 3UJ3X 4AICA 1LS1A 1KQOA 4XRRA 4NJMA 2X8LA 5IBPA 3RABA 1WXDA 2B61A 1I9CA 3RS0A 4B4UA 2FSFA 4HBGA 1YFKA 2Y27A 3KR0A 4FYYA 1SCIA 1PR3A 3GRRA 3D1JA 3NWOA 3EF1A 3GEDA 4HEHA 1P2DA 4XYGA 2PZMA 4PAGA 2HNBA 4Q1EA 1DCFA 1DXHA 3VAZA 5EIXA 4EG6A 3D02A 3DMRA 1AGXA 3HA7A 4RHFA 4TYPA 4Y6OA 3TEJA 1MJ5A 1HT2E 1QONA 2V8OA 2XY4A 1RJDA 1RKXA 3QV2A 5G0SA 1MHPA 3QW2A 2PJZA 4Q4CA 1JEOA 3E58A 2YRXA 4V0KA 4MQUA 4UJ3A 3WIVA 2WUEA 3Q7RA 4NK5A 2Y2VA 4YWHA 5KSOA 3DFIA 4CLXA 1J4AA 3G85A 5IAKA 3HCAA 2A0UA 2YCBA 4JBIA 4NPCA 4EJSB 3QBTA 5IJ9A 3JXEA 5UKDA 1GG5A 1CUWA 3G82C 4BFXA 1SQ6A 3VKGA 2X1MA 2EZUA 2ZBQA 3KPYA 3ZHQA 4Z3KA 1E0AA 2EJCA 3K9CA 2GN8A 3BGVA 2AC7A 3H83A 2N42A 3P26A 4JBNA 1P0MA 1CUYA 5I3CA 4BQPA 1P31A 3R9KA 4WZBB 4B6OA 2B36A 4F06A 2V96A 2O59A 3O3NB 4RPCA 3CLRD 5BV1A 4HO1X 4LVUA 1EDDA 4FBGA 1PLKA 5B55A 1JBQA 3LXXA 3DCJA 5DXAA 5AM2A 3SFZA 2YKGA 4LI3X 3BGOS 1L5GB 5DHAA 1CUCA 2P1ZA 2OWEA 1MFZA 1M6YA 3MJ4A 2WLTA 3JYPA 3K9WA 2AMFA 3ZG6A 2CY0A 1A1VA 1Z83A 2ZBEA 3EF0A 2DKNA 2MSEB 3S1SA 2G6BA 5BSMA 4D56A 3GEPA 1XCBA 4MCIA 3SBEA 3GNQA 2Q1SA 1Q16A 3EWSA 1JVNA 2JFNA 1TKCA 3AY3A 3GT0A 2CVFA 4P3YA 2YHBA 1ZVQA 5EMHA 3LQ2A 3BFJA 2AKEA 1NU6A 2OY0A 2IZ6A 5AJYA 1DG3A 3PIIA 4V03A 1X8LA 3RIYA 3NVDA 5EPOA 4F84A 5ALVA 2R00C 3T7TA 3PGVA 2QN8A 4KQMA 4WDQA 3TG8A 1U99A 4A23A 4FDAA 4EQ6A 4DR5B 1FXWF 4YO7A 1ZZEA 4P36A 3EZ7A 5HF5A 1BTOA 4DGSA 2BEWB 4F2GA 4XSVA 1X9HA 1RXIA 3LCVB 1K6MA 1UFOA 4PIVA 3N0WA 3DBVO 1DO0A 4G1UC 3ZH9B 1K08A 3RI3A 2OPBA 2WEKA 1X1QA 2B8WA 3OX4A 3JQ9A 3G59A 2MU1A 5CVDA 4AZSA 2W2LA 5GONF 3PC4A 1LSUA 3JAKA 4NECA 2AQ8A 1I10A 2IZOA 2WU8A 1ZC4A 3HB5X 3I45A 4D1YA 1K2WA 5BRNA 1ZW6A 3AB7A 4FN5A 3GJSA 1U1FA 4UHCA 3ZHSA 3KNZA 3IQIX 4FEGA 4FDMA 4MEJA 4Y0AA 2ZULA 1GKUB 1E4OA 3DOEA 3N53A 1QP7A 4HMPA 2VP0A 2BE9A 3ETJA 1T29A 1A7JA 2HPAA 4P3NA 2CDRA 2R62A 5M2QA 3CW8X