4Z1OA

Hypoxanthine-guanine-xanthine phosphoribosyltransferase (hgxprt) from sulfolobus solfataricus in complex with alpha-phosphoribosylpyrophosphoric acid (prpp) and magnesium
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
176
structure length
171
Chain Sequence
YHIPSWDEIEDAVFSIGEALVKSNYIPDVLIAVLTGGIIPAKLLSDLLDLKVIRYIDIKFYRESKPVIRSVYTDSLEGKKVLVVDDVADTGETLEAVSNVITMFNPAKVMTAALYLKPWSKRIPDFYYKQIDKWIIFPWDKWDVVRENSNVPVDKKERFLNLYNQLLKIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hypoxanthine-guanine-xanthine phosphoribosyltransferase (HGXPRT) from Sulfolobus solfataricus in complex with alpha-phosphoribosylpyrophosphoric acid (PRPP) and Magnesium
rcsb
source organism Sulfolobus solfataricus (strain atcc 35092 / dsm 1617 / jcm 11322 / p2)
molecule tags Transferase
molecule keywords Phosphoribosyltransferase
total genus 52
structure length 171
sequence length 176
chains with identical sequence B
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2015-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4z1oA00
4MB6A 1Y0BA 3GGCA 2IGBA 1GPH1 1D6NA 3LRTA 1ECFA 5BRNA 3QW4B 1QK3A 4IJQA 4P81A 1ECJA 3GEPA 1YFZA 4OHCA 2H08A 4M0KA 1LH0A 4RANA 3KB8A 2FXVA 1I13A 1G2QA 1WD5A 1P17A 1VDMA 4RACA 4QYIB 1A4XA 3O7MA 3EFHA 4RHYA 2JKZA 4LZNA 1I0LA 5HKLA 3NAGA 3M3HA 3OZGA 1I5EA 4P86A 4RAOA 1A97A 1O57A 1U9ZA 5E38A 5IPFA 1A96A 1JLRA 4ZFNA 1TC2A 5KAPA 1A98A 1XZ8A 1DBRA 4QRIA 5JSQA 1OROA 1STOA 2C4KA 4S2UA 1XTVA 4X44A 1A95A 5EUCA 1QCCA 1HGXA 2AEEA 4P83A 1BD3A 2JKYA 4P3KA 1ZN7A 4LZOA 5ESWA 4LYGA 1CJBA 1XZNA 1QCDA 1Z7GA 4RHXA 1PZMA 3ACBA 1G9TA 2EHJA 2WNSA 3ACDA 4Z1OA 1P19A 3HVUA 1W30A 4JLSA 4WN3A 1ECGA 1DKRA 1XTUA 3H83A 4PAWA 5JV5A 4RQAA 1DQNA 1AO0A 3MJDA 4WMLA 1OPRA 3GGJA 1G2PA 1NONA 2E55A 1I0IA 1NULA 5BSKA 1J7JA 1UFRA 1P4AA 4RHUA 1GRVA 1VCHA 2H06A 1MZVA 1QB7A 1FSGA 3MBIA 1XTTA 4JITA 4TWBA 1QK4A 1O5OA 5HIAA 4RV4A 2H07A 3ACCA 4F8EA 4FYMA 3LPNA 1P18A 2JBHA 1ECBA 2XBUA 4RAQA 1L1QA 2YZKA 1BZYA 1U9YA 2DY0A 4LZAA 4RHTA 1I14A 5BQPA 1L1RA 1R3UA 2VFAA 1BD4A 1TC1A 3OHPA 2HCRA 1IBSA 3DEZA 1ZN8A 5BQOA 1ZN9A 3OZFA 1V9SA 4P84A 4RABA 4P82A 4RADA 3G6WA 3DMPA 3DAHA 4M0PA 5KAMA 1ECCA 1UPUA 1DQPA 1VSTA 3N2LA 4KN6A 4RQBA 2JI4A 4LYYA 4X45A 5ESXA 2PRZA 1QK5A 3S5JA 4M0UA 5K51A 2P1ZA 1QB8A 2PRYA 4P80A 1G9SA 4QYIA 1HMPA 1JLSA 2GEBA 1DKUA 1OREA 5IAOA 1A3CA 1UPFA 2PS1A 4PFQA
chains in the Genus database with same CATH superfamily
4EG6A 4D02A 5EKDA 1VIAA 1A7UA 3V7UA 4H77A 5CCEA 3COJA 3G5MA 4E13A 4RQUA 4MQFA 2D1QA 3EIOA 2BSXA 2Q46A 3R6WA 5AKEA 4A1OA 2WFMA 3PQCA 3QKWA 2P6UA 3R0JA 1O0CA 4LXTA 3QKTA 3ZU5A 1Q2UA 5JNSA 4ILEA 4DCJA 2GD2A 2FSFA 4FNOA 1XTJA 3KB8A 2IU3A 4F1WA 4CKBA 1XZIA 3PFIA 1ENOA 3DLAA 4FE7A 1MAUA 4DW8A 2VZEA 3HYSA 4LYAA 1H8ED 1SUAA 3PFHA 1A5ZA 2J3LA 3MJSA 3NYWA 4M83A 2B61A 2QTAA 2Z9DA 2IUEA 2R85A 2X3YA 2OOKA 1Z88A 1NXWA 2K87A 2PAAA 1VL2A 2YJ4A 2PL5A 3DFMA 4KLCA 2GVDC 1A96A 4RMNA 1CQWA 2PSHA 3W8EA 4RMHA 3ICVA 3IUSA 1QH8A 3O8QB 1V9LA 1KDTA 3KDSE 3PHHA 1QHSA 2YN0A 1DBRA 3DHWC 3EVCA 2D74A 5DNAA 3K6SA 1STOA 1ZZGA 4I1PA 3E82A 1SC4A 2ZBGA 3WLOA 1H4VB 5EWLA 3V1KA 1ZSVA 2HMTA 5IDQA 2VK2A 5KDOA 1QU2A 3FR7A 3C7AA 3G1WA 3D54D 2DPMA 1UDXA 1UZNA 4PNHA 4ZREA 5EWMB 4AX8A 1NDUA 1PR6A 3UF0A 3BWVA 3NMUF 1UDWA 3VNAA 1M3SA 2AJCA 2DFPA 1C41A 4GRDA 3VAYA 2QORA 3TF5A 3JX9A 4WKBA 2BGRA 2YWHA 4O1HA 1MO6A 2PS3A 1A9XB 1TLFA 3KHKA 4O2BF 5JSFA 1A9XA 1ULBA 4HX5A 2CSXA 1U0OC 1QAQA 5DSTA 1YS1X 4FHFA 1JZQA 1RYFA 2XQGA 3RS7A 3UXMA 3PB3A 2Q2VA 3CUVA 4P7BA 4C30A 4I1OA 4OXXA 3KB2A 4KSYA 2G9UA 1GRVA 3V55A 3MINB 3QYJA 4JA0A 3RS3A 4AVYA 2ID4A 5CB4F 1LSUA 3VQTA 4F3TA 4PC3A 1YZLA 3SM9A 2ZE7A 4HO1X 2V54A 3FUUA 3AZOA 2Q6VA 1L8XA 2FEWB 2ZE6A 4A0GA 1ULHA 1VRVA 4ZYLA 1A9RA 1O9BA 2XYGA 3FMFA 3QJ5A 5M29A 1U1CA 4C08A 4MB0A 3TLMA 5H9VA 1BAPA 2RBKA 3GW8A 5AUNB 3X1DA 5BORA 5B55A 3U4QA 1VGRA 4A6XA 4R7ZA 1PS8A 2NZ2A 1RM4A 1RPNA 2WU0A 1SUBA 4H08A 3D3QA 3TM5A 1TECE 1FJHA 2V96A 4LOHA 1GNPA 2DQKA 1GEGA 1GQSA 2ZPTX 4MZXA 1G8HA 3OM8A 2NZYA 4N39A 1K0UA 4R1QA 4X84A 3RSHA 3B9BA 2NU6A 3G0DA 3KR2A 5H4GA 3EPJA 4NBRA 3L8GA 5F73A 1EP1B 2BEKA 2OZPA 2XRFA 3WG9A 1P31A 3RJTA 1Y82A 1L3CA 4RVOA 2OA0A 2QE6A 4G85A 2NZ8A 3AESA 4I1VA 3R75A 4N6OA 4R0NA 1GNVA 2PZGA 3LDAA 2UUCB 1FMJA 3IPLA 3QEMA 3PFGA 2OPBA 3GPLA 3PVSA 1UANA 3DB1A 3HDQA 3QF4B 3KKLA 4LXGA 3S2SA 1W9HA 5IFLA 1G8GA 5CW1A 1FVXA 4LECA 5BV0A 1VXRA 2GESA 1PEYA 1YE5A 1TYCA 1VPDA 3A58B 1IRIA 1ZBQA 4GQIA 3A9CA 4GMXA 4O2LA 4MS3B 5LJIA 8AT1A 2IU0A 2AB0A 4GFDA 3M49A 3WIVA 1V37A 2AOWA 1ZUD1 2IGBA 3K0FA 3BULA 2A58A 3F9RA 2FSSA 3VNQA 4RMIA 4YJ3B 2J8ZA 3H1FA 4P81A 2JARA 2NO0A 3PR3A 1U1GA 2ZBPA 5H82A 2FR1A 2PCLA 3E81A 1YDEA 1UC9A 1NXVA 1I2AA 3IYLW 1R9JA 2C8VA 3L7JA 3H9QA 4UVEA 4DNFA 2CL0X 4FB5A 2NTVA 4ZIRB 2Z4SA 1DIBA 4YAFA 4YAUA 3BWMA 3AZQA 2FRDC 2R6HA 3L7AA 4IEFB 4MVJG 3IUBA 3GFVA 1RAAA 1T0HB 4JR2A 5LCXA 3EFHA 1TCUA 1NLZA 5AOVA 3VC1A 1UWLA 4S12A 2B7CA 3JQ8B 3K2BA 1UAAA 3A6DA 3FTCA 2J7PA 5GTDA 1U80A 4PZUA 5JS1A 2RJOA 3OIVA 5FWDA 1KOFA 1E8NA 1N2GA 1FUEA 3FYHA 4MI9A 4RK6A 4LCBA 4QNNA 1C4KA 5JAZA 2VJOA 2ZSFA 1THGA 2PUAA 3RSGA 3V5NA 1GZ7A 3BS4A 4E94A 3B5JA 1TEVA 4BFUA 2EAUA 1NG9A 1Z4PX 1VSBA 3OQ1A 3B38A 2HEIA 3W2TA 4ZJZA 3PIDA 1JWLA 5B2FA 1QNLA 1XD2B 3Q8MA 1FXWA 1K7SN 3M7IA 1V95A 4RETA 1BN7A 2IZ0A 3M6VA 3WLPA 4UE3S 4PLZA 2F3UA 3JR7A 4W5NA 1QIMA 2P0EA 3M1AA 3NHZA 3A6JA 5A0TA 4FIDA 2ZUEA 3SVZA 4RQTA 2PVPA 4W1RA 2VXCA 1B0UA 1WLYA 3EZ7A 1A88A 1ZEJA 1AIPA 2FPXA 2ZZKA 3ENQA 4HEHA 3UAWA 3P0FA 2HFKA 2J67A 2A0XA 2GKGA 3N0TA 1XQ9A 5D8DA 5KYVA 4D3DA 2X1LA 1ODFA 3GLHB 4X90A 5AJWA 5AJZA 4EG8A 1I6MA 3PDUA 4M38A 4ER6A 2ON6A 1Z74A 2QVLA 3OPQA 3TQRA 2CDNA 4V3BA 2JIBA 3AQ4A 3IDAA 2MINA 3F7OA 3UAOA 3GUHA 3I34X 1L7VC 2MINB 4MUEA 4D4IA 1XPOA 5F3WB 1SULA 3QE3A 4J4TA 4NCNA 4O6VA 1JHPA 2M1ZA 3QH4A 1EFVA 4YJFA 4HUJA 5JJ5A 5LZ4A 1C1DA 4BZQA 3QEBZ 2UVQA 3ETJA 5CGQB 2BIFA 5E9JA 1YJ8A 3N87A 5JNTA 5IYZF 4ZJUA 1WSBA 4FCCA 5EQTA 4LSMA 1NFQA 2D0DA 1IN5A 3RU2A 3CS3A 5E2BA 4WL0A 2G77B 3VV3A 1E9EA 1WTCA 3V2HA 3IAHA 2JDID 1OH6A 1AGYA 2FZCA 2NU7B 3FUXA 4V0MA 1OBHA 4L3WA 1OKKD 5HKKA 4DA6A 1RLJA 3M8KA 4MMYB 4P82A 4DIMA 1AQ6A 3M83A 2M6LA 1O3YA 4I5IA 2F55A 3LSTA 2P0AA 3LW7A 1Y7LA 3R0QA 4FTWA 3NDIA 1DQPA 2R6JA 2I4TA 5HZGA 2D5BA 5HE9A 4BGEA 1YB5A 3FF1A 4U6SA 3HUDA 2SICE 1MRZA 3U62A 1XZMA 4B6GA 4EB6A 4LRXA 4IL5A 4R9UC 2BFFA 1Y3AA 3TGWA 4CM8A 1KQ3A 2H0QA 1E2HA 1EB8A 1XDSA 1NYTA 6ABPA 3CH5A 3H2SA 4XJSA 3I9V6 1O9GA 4TYQA 3HFJA 1VBFA 2A33A 2Y9MB 4BFXA 1HA3A 4IO1A 4MW0A 4UUPA 2G80A 2CNLA 1P1JA 2VNSA 4NATA 2UYCA 2G0TA 1MJNA 1SKUA 2B9VA 1V43A 4GRIA 1UM9B 2GFHA 1LI4A 3GRPA 4NY1A 2QMUA 2BFMA 4IEEA 2RB5A 4F6LA 1S2GA 2ODWA 2JFZA 2KMLA 1XTKA 2ZIZA 3MC1A 3FMGA 2MYNA 4I08A 1KSGA 4XCXA 1S3GA 1E62A 1HETA 1F4PA 1JAHA 4F4DA 1TYDE 4QTTB 1SUIA 4UCWA 1CUEA 3DSRA 1LX6A 1GAQA 1I3LA 1Z6PA 1L9KA 1C9DB 2XKAA 2VNJA 3MTBA 4INPA 4MW1A 1YR3A 3AFNA 4R1MA 1AM4D 1MPXA 1YB1A 3FDXA 1KIMA 9ABPA 4KWEA 121PA 2WW8A 3GRUA 4S1VA 3WYBA 2XNDA 5CFRA 1BMTA 4H1WA 3NCTA 1LVGA 5IKOA 1WW8A 3LXMA 4GQAA 1W88A 4YUXA 3CU5A 1J0DA 5I5EA 3L8HA 1JPNA 1QBKC 4BO7A 2I8LA 1L7EA 2QG6A 4D42A 2VSYA 4DMLA 1X8LA 2QT0A 2VP9A 3OQNA 3ACBA 1I7LA 1P7WA 3FGNA 4DDHA 4JI0B 1ZGBA 2NV6A 3EXHA 1FYWA 2CF5A 4TT8A 4TZKA 1CETA 2F9FA 2BFEA 1SVOA 3DDCA 4GXQA 2Q3MA 1XPUA 1VJGA 4RJIA 2KPOA 1W52X 2BMEA 4IGFA 2RGNA 3VTAA 1SXPA 4IF6A 3GDGA 5HMMA 1K4YA 5TMDA 3TSAA 4OYHA 4Q1VA 4U5QA 4DA4A 1W96A 2JGNA 1E6CA 1GGKA 3CRW1 2OENG 4O1MA 3UXHA 5BSEA 4R8RA 1T1SA 3CNBA 1C9MA 1USIA 2V6FA 1A8SA 1PJCA 3QFCA 1NVUQ 3H5TA 2B4KA 3H4TA 3PBKA 2HXYA 1KTVA 4D9HA 5B4UA 1G3IA 2BEVB 1UPXA 4W8HA 2C54A 3SQNA 1I3KA 3FAZA 3GY0A 1IOVA 2YOFA 3PGMA 1MVNA 1NVXQ 1ZEMA 2W8ZA 3GNQA 4C4TA 2FNAA 4YQYA 4KE8A 1XVTA 5DHUA 4AMUA 1QQ7A 4NEGA 3U31A 5JNUA 4A03A 2WYOA 4LWZA 3ZWAA 2UYGA 3GVIA 1H4SA 1BE0A 1WPRA 3BXFA 4NMXB 3SJAA 3ET4A 2VPWA 1IJEA 2ZYTX 3GAMA 3CYFA 2VDWA 4TM7A 1BOOA 1KP9A 4L5JA 2IDZA 3A4IA 4XWKA 3IULA 3S99A 1KEUA 5U1PA 1MLDA 4FD3A 4FFBA 1JECA 1TQDA 4NIMA 4IDFA 4ID3A 3FMPB 3QVVA 1ZNXA 4HQ6A 2PT9A 4LOLA 3SZGA 3H3JA 4TV8A 2AOTB 3LBHA 2AR7A 3UHOA 2X4DA 4KX3A 1G7CA 1KEVA 2X1HA 1IWPB 2Z57A 3HKEB 1VE3A 2OFPA 1H6BA 3EZFA 1NBHA 1C5KA 5K8CA 3TZHA 1WR8A 3DO5A 4NZMA 5JD4A 3AU8A 2AUMA 3HWX1 3R3ZA 3S5UA 1UKEA 2VQEB 4BVFA 5C34B 2NUBA 4L27A 1X0XA 3AIOA 4UBKA 3S29A 1IQ0A 4BLUA 4JWTA 1I4DD 3WIOA 5I7FA 3BD9A 3OFVA 5FQNA 3TLGA 3TQFA 5A5EA 3DUWA 3FPEA 1GJRA 3NHWA 421PA 5HWSA 4XLLA 1DO2A 1LPAB 2H4FA 1ML3A 2TSYB 4FEEA 4R68A 1QE5A 2H1RA 2H4YA 2VUHB 1N6OA 3GFQA 4OHCA 5BT8A 4OMUA 3AR3A 4CM4B 1N2SA 2CDRA 5DYYA 3FRJA 2QA5A 4HWRA 1AQYA 2P4QA 4JBLA 1J9GA 1R0YA 4R8SA 5T57A 1QLJA 4C0SA 5ETJA 5TEWA 5A03A 1BXRA 1FDTA 3D4LA 4B87A 2JHGA 4W7SA 4BLQA 3HPQA 2Q3DA 5KVVA 1T24A 3T3EA 1DJNA 3LYAA 3WKEA 3ELBA 5A3QA 1X7WA 3TQIA 1YR9A 2I4OA 3AM5A 4QZVA 1YF3A 3ORSA 3PHBE 1W1UA 1P7VA 4NYIQ 2NP7A 2P9FA 4ZDIA 4JBGA 1Q2XA 5IBRA 3MGCA 2VLBA 3WIUA 1J90A 1QQ5A 3ILVA 2H2HA 4FP9A 5EMHA 1U5AA 3VRHA 3VZBA 5I7UA 3FUTA 4FHCA 4N0DA 1AMUA 3THXA 1GZUA 1L7BA 3CF4A 1KTIA 4CLDA 3DR3A 3CVYA 4P4SA 5HCIA 4CT5A 1V45E 4E15A 4YMTA 3O2JA 2W0SA 3INTA 5ITZA 3UB3A 3ENZA 4DQKA 3LPCA 3TUZC 2Y71A 2BZ0A 1QMPA 4BNDA 3KLPX 1LF0A 4IFTA 2GBFA 4NS1A 1FSZA 1B6SA 3N53A 4BTEA 1R50A 1WD7A 4Z51A 2X8JB 1ZP6A 2JD0A 4Z0PA 4LCJA 3O4JA 5F9HA 1ISGA 1BE8A 1V25A 3SXPA 1OZ0A 1UBOS 3K0SA 3K8QA 3VR6A 1YDMA 2D8MA 4G5OA 1OAKA 4JT8A 3VPXA 3X2FA 1MAVA 3RE1A 4DMUB 2XZOA 2ZXEA 3NHMA 1EQ2A 1BOFA 1AMNA 4MCIA 2ECFA 2VHXA 4E46A 2WJIA 3ZDDA 2DLCX 4CODB 4LBWA 2ZE8A 1VC2A 1GTL1 1CUBA 4X5OA 1PYOA 1VG0B 4J1SA 1CRZA 2VJMB 1E9DA 2ZPAA 1Q7TA 1BZYA 1K5HA 2FZLA 1RVDA 2ZSHA 5C8YA 5HTOA 1MXHA 2C3MA 3GROA 4QGHA 1KYIA 1NDQA 3RPEA 2O7NA 2XTAA 4A8HA 3FHOA 2O1XA 1UR5A 1KMHA 5L3QB 1E58A 1XLTA 1QIDA 2IYXA 2HI0A 2OILA 5DF1A 2NW6A 2XDWA 3OAAD 3N2KB 3VNRA 1ECCA 1RYMA 3E7DA 4D43A 3UK6A 4UD6A 2A5JA 1APBA 4ZZ0A 4LRQA 3DV0B 4HVLA 3BWBA 2QPOA 3HKEA 4H7DA 2XT9A 5FAKA 2O8FA 4HJRA 2OZEA 3HMQA 1VZ2A 4LE0A 4M0UA 4W1PA 3TRHA 1P0QA 3W8NA 5HMLA 4LOAA 3GUCA 5C1DA 2VYNA 4YJGA 3VTKA 1NXPA 1VCNA 3MTGA 3GZ4A 4KR0A 2ZIWB 1RZVA 1DAEA 1UC8A 4WNYA 4DYHA 1DV1A 2MYPA 4S0ZA 5AW9A 1ZMRA 2XV1A 1NMSA 3S1LA 3H1EA 4JC5A 5LP6B 1KEEA 2CLCX 1JH8A 2LP4Y 2QN1A 2CHFA 3DD5A 3PVCA 3DE4X 1NT2A 4OP1A 3UGQA 2BP7A 3GGDA 3TE7A 1BH2A 4PHCA 4EEZA 5AVYA 3AY7A 4RCVA 2I7DA 4O59O 3WGLA 2WJAA 3HU1A 1RC0A 1VFPA 1XQ1A 3DM5A 4P7JA 4DR5B 1C3LA 3NLLA 3FLMA 2P90A 4D1YA 1A71A 3TUJC 3UJ7A 1GA4A 5DLQC 2HSZA 2WM9B 5C8YF 2E4VA 1U0GA 1VI6A 2YHAA 4RHFA 4RXUA 1T9ZA 4OO3A 1BA2A 3TLYA 3KOZA 3TNYA 1U31A 2LIPA 1QKIA 1X80A 3GA7A 4FI3F 2V7PA 2EBFX 1T8YA 3K30A 4L4YA 2Z4TA 4P93A 4QOFA 1YA8A 1JEQB 3LFHA 4DS3A 1XTQA 1XVUA 1ZI9A 4YRLA 3LT2A 4X63A 3L7IA 5IPFA 1KMCA 1NN1A 2XA2A 3MMZA 5DULA 1BG6A 4RTOA 2AXQA 5SY6A 3AXTA 4JXZA 5IKEA 3ESDA 1MQ8B 4Z4EA 5AHWA 2R7KA 1L5KA 3GJ6A 5F64A 2CHUA 5CXSA 1FUIA 1GSOA 2XR1A 3UMBA 3U9SA 6CHYA 5ED4A 3MAAC 5D1HA 1IDN1 4TKVA 3BGSA 4PPFA 4DIFA 3GCWA 1U4OA 4EA9A 3T7EA 4QBIA 3ZQJA 5EEHA 4DPMA 3I8SA 2ZBDA 2C59A 1PX0A 3JZFA 3PLRA 4PYNA 4Z9XA 2B7BA 3OBIA 3DMFA 3UQYS 4F72A 1PTJA 4FOLA 4BO4A 1BC5A 1NZJA 4ZO7A 4YRNA 5H83A 3EQ6A 2CE2X 2EZTA 3NWPA 4MWEA 3ZWKA 3UAXA 4X91A 1J2RA 3DEIA 5DYNA 2R7NA 1M5UA 1FQJA 1CKEA 5AHXA 5FNVA 1W30A 3DZGA 3CVJA 1GSIA 2A78A 4LOIA 4MARA 4OGWA 2ZRHA 3SFVA 5KYYA 4IJMA 3SKXA 1S8FA 5KB3A 4DILA 5LN1A 3U4CA 3RIEA 3OOHA 3JW8A 4F4CA 5K6RA 1DUIA 3FE2A 3EQ2A 3KZVA 1WXDA 2ZB7A 2O5VA 2ODBA 5D1NA 1F6WA 5BO5A 4XFDA 4KSCA 1EDBA 1TI7A 4N7RA 3VAAA 3I42A 1EQUA 3ZQ4A 4OQQA 3C39A 1ZJZA 2ODNA 5TMBA 3VC3A 1Y4AE 4D25A 5TGZA 1U0RA 2R7MA 4OH1A 4H1TA 5DBOA 3VPFA 2C98A 3TQQA 5F3RA 1FUYB 2EIXA 3KKKA 1U3WA 3DGEC 3RAJA 1WBBA 4OH7A 3LCJA 5IM5A 4Y2GA 4B76A 4ND8B 4RHTA 1NSTA 5IM4A 2Y3IA 4Y8VA 1EXVA 3NUZA 4PS0A 3IBYA 3NHBA 3SJBA 3CPSA 3QKRA 1NN5A 4YDHB 1LDYA 2QIPA 1K3TA 3TW4A 3ZHVA 5CCXA 2XMRA 3D3JA 2JEZA 8ADHA 1GQOA 2HA5A 5LP6C 4Y67A 4NBNA 4QRDA 3BB3A 2FOIA 2B1GA 3WMGA 4EJSA 1U7HA 2CJPA 3VKWA 5BMVA 1W1IA 2ZITA 4YPOA 3ZCXA 1T2FA 1EFHA 3W06A 4UULA 1BW9B 1E92A 3QLTA 1N1EA 2JLZA 3LHIA 5JYCA 3QMWA 3RB8A 3BWYA 2FFJA 1P5FA 1RXYA 1SBCA 4D0LB 5K8LA 4OL0A 5HZHA 5ALHA 3IQHX 3AYXB 3SYTA 1H65A 3ZXXA 1DG3A 1L7RA 1T15A 5C8VA 2QRJA 2ONCA 2QYOA 3PSHA 1W4LA 2QX6A 1NVMB 1O95D 4J94A 3KPVA 3LQ4A 4EFDA 3HCWA 3CW8X 1YQUA 1ZNQO 3KXPA 3UMGA 1EESA 3O5AA 2FSGA 2C99A 2PIDA 2ZRNA 1WHSB 3JALB 4J49A 4LC1A 1XHFA 1BWSA 3V8MA 2Z3ZA 1P8JA 3UANA 4FLEA 3ZE1B 4DLWA 1LK7A 3SKYA 4RPCA 2GAJA 4YT5A 1CNEA 4Y6LA 2DLDA 3RU3A 1MXFA 1L8QA 1U0NA 3B2QA 2FZEA 1P3JA 3MXOA 4OF4A 5FPSA 1YAJA 3SQLA 3ZU4A 1T5TA 1NMQA 2O57A 4IXTA 1AKQA 1XRJA 3ETCA 5EUMA 4GW3A 4RACA 4F12A 5CFNA 3DFIA 3L02A 2VCHA 2VRCD 1C9YA 2II6A 4BWGA 5DNUA 1T8UA 1JG6A 1JIXA 4BFWA 1YUMA 4JHXA 1IHPA 1IN4A 1E1CB 5BVHB 3CINA 1Q20A 4HGYA 4LRUA 3ZVLA 1PS0A 1P0PA 4B48A 1U9ZA 3OIWA 1SWWA 1EUCA 1TRHA 4H7FA 1TMYA 5CYFA 4KGZA 4CM3A 1P7YA 1JSRA 2WJPA 4PO1A 3OZRA 3UMCA 1U1EA 2AUTA 1Z0DA 1X39A 5DVZA 1ZBDA 1BKSB 1UIMA 3M4YA 4OXYA 5JSZB 1DEKA 4GKKB 1K88A 3HN2A 3JZAA 2CN1A 4MW9A 1M10A 5FBLB 4YREA 4A0HA 2HN9A 3CMMA 1V1MA 4KO3S 4KQ2A 1BD3A 2BI4A 1G8YA 3AY0A 2W6NA 4QBGB 3U7HB 1RZUA 3TFOA 1CC1S 4E3WA 3LCRA 5C7YA 2XHEA 1W5EA 5ELLA 1X13A 2RK6A 3I8OA 5FIUA 2VG8A 2QLFA 4N0EA 3LHSA 3TZQA 5BOSA 4NE9A 5GIPE 2HDWA 3ZUGA 5IMBA 3UC5A 2EDCA 4JLVA 1J4AA 2V9ZA 4CM5A 4COKA 1BS2A 3R0ZA 4DBLE 2JCVA 3RUCA 4TL9A 4EB6B 1U2DA 1PP4A 5CYPA 4NENB 5C3UA 2R86A 4WADA 3H2KA 3QE2A 4QT4A 2C3YA 5ICSA 1K3UB 4Q4HA 4MKZA 3UAZA 5F7XA 1V2HE 5BVGB 4OHWA 1TKBA 1O6CA 3NEYA 4X1OA 1V6SA 2G4LA 3DE1X 3GK3A 3IP9A 4KXMA 1E6KA 4Q4AB 4NCHA 2CMFA 1IJBA 1KAGA 2QRHA 2ZAYA 3UJCA 3G2OA 2Z09A 1YONA 1PEAA 1XR3A 2VUTA 1R3DA 1C3OB 3B60A 4WK6A 5PNTA 3UT6A 1B8PA 1W35A 4DADA 1YHYA 3AJEA 3H2GA 4YCAA 1G8SA 1DBVO 3FD8A 3JYQA 4DSNA 1PNTA 5E7JA 4H0CA 4HS9A 1DQRA 3R7BA 3HY4A 4GOMD 1AUXA 2QL6A 3COZA 1AHNA 4BRSA 4UNRA 1U5BA 3FTDA 4MDFA 1S5PA 1XMOB 2R1TB 4L6CA 3MLAA 4FBGA 4ND6A 3HBJA 2ZRFA 3UICA 3PUXA 5KTOA 1TYAE 1ZH8A 5IYZA 1N2ZA 3HU5A 4REMA 1UMDB 1BMFA 3VO9A 4AURA 1UMDA 4DMCA 2XUQA 3GLGE 4U7HA 1TIKA 3OLWA 1YL7A 4U7TB 2QMZA 4KP7A 3ZEIA 5B5SA 3W5CA 4ZJPA 5EWLB 2YR0A 1GLGA 4R1SA 1NFFA 2G09A 3OCUA 1B3RA 1I33A 4PFQA 3NHPA 4WBSA 4QFMA 4P0QB 1M72A 1XL1A 4Z7OB 3AV0B 3VNUA 1E0SA 1P1CA 3S6JA 4B74A 1NRJB 4Y1FA 4ME6A 3Q1LA 1QH8B 3O8QA 3T9FA 5I9BA 3VR5A 3UMYA 4MQLA 2E5WA 2QW1A 3DAYA 3QEMB 2NSLA 3SBXA 3I3SR 4AICA 4ETNA 4ZDKA 5KNBA 3NDBB 3IAM6 4DIEA 3RUHA 3IO5A 1WPXA 4D92A 4NH4A 2PMCA 2C4NA 2Q5LA 4MA4A 1D09A 1PKXA 4PZZA 3PTAA 3ICEA 4MYTA 1WPGA 5CB6A 2YHSA 3OCVA 5HKBA 3EOBI 1AY0A 1G9XA 4X8OA 5K3FA 3UC9A 5DBGA 4Z9AA 1ZUIA 4MVWA 2GPJA 3LK6A 2G25A 2ZJYA 3UK2A 1Y98A 1AA6A 2BBWA 1KI3A 1U0SY 3VR0A 2P3SA 5K09A 3SYRA 2CZCA 2ZIAA 2E85A 2ZTUA 2D59A 2IHBA 1ZVQA 1X86B 5B1YA 1WCIA 4P1ZA 4KYUA 1GZ6A 3G7UA 2FEOA 3AFMA 3CX7A 3LFUA 3WL6A 2R11A 4OHUA 2P9GA 4LV6A 2D00A 3H87A 4YHBA 3W1EA 4A8JA 3ZDBA 4N3BA 2XOEA 3UK7A 2XMZA 2PKEA 3OZEA 5EGNA 4J0DA 5EJ6A 1FJGB 1BE1A 2YWBA 3PJRA 2BHTA 2VC2B 1LNZA 3KSRA 3QPDA 3PIRA 5DM0A 1P9WA 5LU9A 1RHQA 2BDEA 3GEIA 1KEPA 2XVAA 3TRDA 1T4MA 3T3PB 2A0YA 2DFDA 3OE7D 3DEAA 4B82A 4TTVA 1T43A 2XB9A 4XDZA 4PSKA 4BBJA 1EK6A 1OAOC 2RGEA 1LPNA 5G1OA 4JJ7A 4Q0MA 4R71A 2AW5A 1EWVA 2MSKA 3DULA 3HDYA 3KWLA 4G36A 4I14A 4IJ6A 4CW7A 3CR8A 3GGJA 2FV8A 3LBYA 3MM4A 2IGTA 4MIYA 4JQCA 3HBFA 2VYCA 5TMEA 2E18A 4PBTA 5A62A 3F71A 721PA 1LBIA 1ETUA 4IDNA 4Z9BA 1UMKA 2D0PB 2ZWIA 4HFRA 2E1PA 2QK4A 4B81A 1YDGA 4P22A 5ARDA 4YUWA 2EHDA 4E5DA 3IPCA 3LY7A 2PXCA 2CUNA 4XIIA 4FDUA 1NF8A 5KYXA 4LKRA 1RIIA 3G0IA 4RA6A 2D3WA 3L7KA 5KVQA 1P74A 2ISCA 3H8JA 3WYEA 4LI0A 1WETA 4ZAZA 2CFRA 5KNBD 4H0NA 4DPLA 2X8LA 3QFFA 2WIDA 5JYEA 4YN3A 3DMRA 1D2NA 1PR4A 4OBWA 4M3NA 4NYMQ 4OHOA 2FSVA 4RWZA 1HQDA 4E70A 2GCGA 2GHIA 4UAVA 4TYNA 1R4MB 2L2QA 1YASA 4D8WA 3A1NA 4MWZA 2ZOSA 2BZGA 1QP7A 1A9PA 1ZI6A 3E61A 4MPTA 2XYPA 4EI2A 3R0VA 2G28A 2W2VA 3PG5A 3LPAA 5KQPA 1EWKA 1V11B 3KJNA 2DUMA 3FCCA 4QX6A 1S3SA 4HN9A 4MKIA 5EHNA 4EVQA 4RTQA 1Z2PX 1OHHD 5EE0A 3SC2B 4HNVA 1ZOIA 4LWQA 3EXAA 1XAGA 1ORIA 2V5UA 4ATNA 2P9CA 1CUSA 5EHGA 2X5XA 4K9OA 1PL7A 3UMRA 1MA3A 3HA7A 1ZLYA 2EFEB 2HRZA 4G0QA 1K2VN 2NQTA 1ESEA 1XLVA 3MCUA 2EL9A 2SNIE 1SU4A 4S1OA 2C29D 3IR5A 1TPZA 3ZWQA 4L22A 4CFSA 4AZ0B 3BWEA 4RH3A 1QGUA 1NUUA 3G17A 3FA2A 4I19A 4W4TA 2DT8A 2QP4A 1LH0A 3TIXB 2OB1A 3O94A 3QXXA 2LCQA 2BF4A 2OPHA 4RLFA 2GCOA 4TRRA 4WLOA 3PC2A 1R00A 4FGSA 2VF7A 1MJFA 3A1WA 3R44A 3UUFA 1RYNA 3HKDA 3MRSA 3GLIB 3KYIB 2GYYA 3VJLA 5JSHA 5IAGA 2PFGA 4Q7QA 1UP6A 1GAXA 2ZFUA 3VPBA 1PJ4A 3RRYA 4J4BA 1FMCA 3IIKA 1PAUA 3DDWA 5KTPA 3VSEA 3UA3A 3T99A 1USKA 2YCLA 3NGMA 3FTNA 4GYJA 3RS0A 3OC6A 3IEMA 1DAPA 2CD7A 1NF9A 3OIUA 4CV3A 3ZKWA 2V03A 3CWZA 4F38A 3AGQA 3WMXA 3VDXA 5U4QA 3PV0A 3WS7A 2A5LA 1WF6A 3AEYA 2J45A 1KFEB 4LGVA 3DMYA 3EULA 4LZOA 3TGPA 3DWIA 2VSNA 4NEQA 5IHPA 1OZHA 4OLBA 2YV3A 1A4RA 4X6LA 1CDOA 1FFAA 1WRBA 2FU5C 2O2IA 3ITEA 1V26A 1DNPA 5KWSA 2Q6IA 1C1YA 2WAAA 3DBRA 1DKOA 4BEJA 3B20A 5C4IA 5IEJA 2VHCA 3LXUX 3O8OB 2W93A 5REQB 2FR8C 3RV3A 3KZOA 1RJ9A 2WU4A 2OLJA 4Z9FA 3RIHA 5LMZA 3ZS8A 3UZUA 4A5SA 5TT1A 1SN7A 2IXTA 3I39X 4JGIA 3U9LA 3ZW7A 1KYQA 2L42A 5F51A 5DDIP 4JB2A 2A9KA 1WZUA 4LWPA 4EHLA 1SA0A 4UHEA 2I4LA 4C7BA 4ZOLF 1L4YA 2Q1SA 1M34E 2ZG6A 4FYMA 3K5PA 1JZSA 5H70A 1UKYA 2P2SA 2FZGA 1P7ZA 5G4KB 5IJXA 3PEWA 5ALEA 5FUYA 1ABEA 5JFGA 1VSQA 3UKDA 4CIBA 4L2IA 5KNCH 4TV9B 1JXAA 3UTCA 2R8RA 5AKHA 2AV6A 2J5RA 3KUCA 3A25A 5HIJA 1GZ3A 5LZ7A 4EZIA 1H4QA 2NU9A 1M6EX 4ZDJA 3C43A 3G8DA 2WB2A 2Y1KA 4AN0A 1QHHB 2JH8A 3FUVA 4DMKA 4Q4DA 4P0PB 2XVZA 2XI4A 2ZTHA 3NOOA 2GILA 2NXEA 3M5DA 3OCCA 4OJQA 3QUCA 2IYFA 1TAUA 4HLUA 4UNSA 4E31A 4KXXA 3SX4A 1ZM4A 2AKEA 1C4WA 3FOWA 1G5FA 2IXEA 3T5GA 4K9QA 3CLRC 3UHFA 1V1JA 1KVTA 3HVHA 3TR6A 1X14A 3IESA 1QGOA 3P94A 2WAYA 2W2XA 4TKVB 4RBNA 2ZAGA 3I6MA 4C3OB 4IMJB 2YWXA 1GU0A 4OHXA 4YX9A 3AUJB 4MB6A 1O58A 2A4KA 3FR8A 1G19A 1FEZA 3DTVA 3W5UA 4Y6OA 2WYWA 3HKBB 3KPYA 3AMVA 3HBNA 4OSOA 4AWBA 3N07A 5BNWA 1Z2CA 2BBOA 5A4KA 1KC1A 2ES4A 2ZYSA 4E88A 1BGVA 3PD1A 4F3KA 2P62A 4JJ4A 1ESCA 1HDOA 5DXJA 1Y5RA 2AFHA 2YQ4A 4JJEA 3F67A 4EY6A 2VRBA 3HLKA 2WOOA 4IIVA 4DCPA 4ZCSA 4EGJA 1IVSA 1H2RS 2W6OA 5K4AA 1GKLA 1RYEA 2QYHA 4WT7A 5KSYA 5CNMA 2GA8A 2GN2A 3Q2IA 4XQ0A 3C3BA 1TTPB 2OV8A 4HMPA 3S7TA 1SBTA 3ZNPA 3L40A 1I5EA 1I3OA 1I51A 5AVXA 4GC5A 3EH2A 2F43B 1N34B 4AAYA 3GLUA 1E59A 4QG7A 2P9BA 4DV4B 3CIOA 5JAUA 4MVXA 3DP9A 1SOWA 4JVLA 1EVKA 4IHJF 4ALNA 4DNXA 1XZKA 4KH0A 3ER9A 4F85A 1T2NA 3E9YA 3RC9A 4A0RA 4Q4LA 3CC8A 4NU6A 2UV8A 4AJLA 1T34A 2IYVA 2XTNA 2M2IA 2P1DA 3ITNA 3RJ5A 3S4YA 2MSDB 1SCUB 1X8KA 3DE0X 4DWVA 3AB3A 5BT9A 1PEKE 3COPA 4IDOA 4LZLA 1UMCA 3GMIA 4R8KA 2H3EA 3K53A 1GO2A 1IXKA 1XZEA 4OJKA 2I62A 3KQHA 1VPWA 3ND7A 1QZUA 3KXDA 3EVNA 1TZ2A 1N7IA 4FMBB 3CN7A 2VI5A 4PANA 2NP6A 2Z98A 1NOKA 4BNMA 4O5AA 1NONA 2ZYDA 3HDHA 4ZYYA 4ZVQA 2J3HA 3H0EA 2W6IA 1LBEA 1JLLB 3KXIA 4OFZA 2WSMA 1FP7A 3CRNA 1XD9A 4HTFA 4Y18A 4TKUB 4URHA 3PHCA 3T5BA 1GILA 2AL7A 2C3OA 2QIOA 2OBYA 2GEJA 2WKRA 3PNSA 2VYQA 4UMFA 4DV1B 1W0CA 1FP6A 4PZDA 1PFQA 1DCFA 5COQA 1H1TA 3JVUA 1GCOA 4X65B 3GJXC 2DHRA 2I3BA 1P44A 1W44A 3AXSA 3EC7A 3P2KA 5BYKA 1GADO 2YW9A 3JAWB 3NXKA 4JFRA 2C5FA 2W2KA 4MEAA 1ZRNA 1U9YA 1L4BA 1UBTS 2GJ8A 3EK2A 3D2AA 4HEA1 3G2MA 1PWYE 4E3ZA 2IQIA 3H1PA 3GV0A 5DXFA 2I2DA 1TC1A 1JHMA 2XBLA 1CZUA 2ID9A 5FHRA 2OCYC 1B76A 4B7CA 3A05A 3RT1A 3K94A 4HBZA 4YT8A 2RE8A 1AKNA 4WY8A 2A1TR 2FSIA 3BMXA 4JHLA 3KO8A 4MROA 1XX6A 4Q3OA 4HP8A 4JI2B 1JPJA 1V3TA 3ZDFA 4CMIA 1J5PA 3AHJA 1CY7A 5HDBB 4M60A 4Q1BA 2W70A 1FFDA 1ZESA 1RPTA 1EI9A 3AUUA 1OIVA 1BHO1 1U0EA 4TS4A 4E2YA 3VI3B 4RE5A 2PRYA 1V3UA 1B73A 3RARA 4UUQA 4KLZA 4LF8B 3DT8A 3DXZA 2AZDA 3C3PA 1VKRA 3D6JA 2MHCA 5D7NA 4C4SA 2DFTA 2VBFA 3HVJA 1DP4A 5F5XA 5JT1A 1G7TA 5JISA 4F84A 1DXYA 1L2TA 2FDXA 3OPNA 2CDBA 3PZBA 1U8EA 2FOXA 4N40A 3OIYA 4PSAA 2D2VA 4IJWA 1KZHA 2RGBA 3QU9A 4RVCA 2XGJA 4CQLB 1X8XA 3ESYA 4BQPA 3L1HA 4CQMD 5L95A 3D8NA 3TM4A 4RGQA 1Y81A 5LUAA 4QIHA 4D0GA 1W36C 2Q3BA 1FLDA 2FPLA 3HNOA 2FFRA 3EMKA 2CSUA 1J8QA 3I9FA 3QBVA 4MCJA 3H16A 4CM9D 4ZAVA 3PD7A 3CKMA 3REQA 1ENZA 3BH0A 2NZUG 2RGYA 4HUQB 4RYDA 4Z0TA 5H80A 3WYNA 1PQWA 3LDGA 5IVDA 4ZK6A 3DOUA 3LCVB 4L3OA 4QXRA 1W1WA 1AGRA 5C37A 4KR3A 3VKVA 3ZQUA 5FV7A 2IP4A 4U9UA 4AJNA 5BN4A 1UXHA 4HQOA 1GPLA 3VO8A 1G5QA 1WDWB 3SOPA 4OB6A 1II0A 2JIRA 3W5VA 1VBKA 2XIJA 3BDIA 1HO3A 1J24A 3WK6A 4BLTA 3EEOA 1S3FA 2XMQA 4XUDA 1HDXA 2CUTA 5EZSA 1VIVA 3KE9A 3O4HA 1YTLA 3PT5A 1BXGA 4YCBA 1QKJA 5HHTA 1PYDA 4GBED 1IK6A 1YULA 2W43A 1GQQA 2BF7A 2OAP1 5GM2A 5B3JA 2JHAA 4EBFA 4KRXA 2OQ2A 4YUAA 1XZNA 2HUPA 1SU8A 1GDDA 2F9LA 2ONZA 3MCTA 1V48A 3ONEA 4X92A 2Q0XA 3UV6A 3X44A 3GJ3A 7YASA 4GI2A 3RC7A 1RBMA 2VSQA 3GLSA 5P8WA 2Q27A 3TR5A 2CCJA 2Y1FA 2XCQA 1EUQA 1ZLXA 4UUAA 5J4LA 4NBKA 4WMLA 2ZWAA 3MW8A 2IPLA 3GHHA 5B57C 5JQGA 3GUZA 1N75A 3GYGA 5BSKA 4FFMA 4GLLA 1NN3A 4HWPA 2K2QB 3UWKA 2HA6A 4OPMA 4CMBA 1NW6A 1H2WA 1GQRA 2PX4A 3HUEA 4IIHA 3FTEA 5BW6B 3OHMA 1V8BA 4AZSA 4AF6A 4R2HA 1R0KA 1NPTO 2IJGX 1M2GA 3PIIA 3EXHC 4JB3A 1KBQA 3LT1A 2YZGA 4JJZA 3I4FA 1DRJA 3EW7A 3WNBA 4F9FA 5E0KB 1CUJA 2NPOA 2J5QA 4UAJA 4JR1A 4W9NA 4JP1A 3UWDA 1FC0A 1KIAA 2LPMA 2OHOA 1HE3A 3G2HA 3R9IA 4MI6A 2Y0EA 3W2HA 1QUEA 1SXJA 3ADPA 4UVGA 1X3SA 2NNWB 2VFAA 4LBYA 4NG5A 3F46A 4RHCA 3T9CA 5I7RA 5JLJA 2O8DB 2ZUDA 3IAS6 2P9QA 4RK1A 4XGRA 1U8FO 4X3CA 1EDOA 3BE6A 3IP8A 4RABA 5ALRA 1FYXA 5H3LA 3ZKAA 1M0WA 2YBDA 4E33A 2ALJA 2QMOA 3TLBA 4C4AA 4MPRA 1KYWA 5E4JA 2GGSA 3KP1A 5KKAA 1UPUA 2BRUA 1J2JA 4U00A 5IDXA 4XSGA 3VFDA 1KQFA 2NV0A 5EHQA 1U3DA 2K6GA 4WZBB 1E18A 3JQAD 5ALSA 2GCNA 3CNEA 2BEUB 1X92A 1G9SA 3OPXA 3IOCA 4KPUA 4AJOA 3VGPA 1OTXA 4E22A 3FKSD 3KXLA 1JBQA 2H59A 3TJMA 3STUA 2IOFK 4DPKA 5AXBA 3T7JA 2WVGA 1YACA 1H8HA 1HT1E 1SBHA 3ONWA 1KJYA 1FJXA 1MB2A 3LKZA 1UKVY 2WF6A 4G81A 4WFIA 3GBVA 2QUBA 2RJNA 2DSNA 1NVEA 2E4UA 3TOCA 3TIFA 2ZS8A 5KYYB 3MJVA 3WNQA 4E2XA 1TAHA 3DE5X 3T12A 1M2HA 2IDKA 2XF2A 3LGXA 3V1YA 3WYCA 4BBAA 2L69A 3HO8A 3C3WA 2IS1A 1NJ6A 2EEZA 1KOJA 1D2RA 2OT3B 3C8HA 3OQHA 4E7OA 4WJZA 3W90A 2EOAA 3LG2A 1QV7A 3C3CA 3FCSB 3JQFC 1PGQA 5LNK1 4D9BA 5AVUA 2Y92A 5E9QA 4YAGA 1DJMA 1SVUA 2ZDQA 1EXDA 5JXGA 1U2QA 3L0CA 1T5SA 3EGVA 4U3JA 4URXR 3A4MA 4U39A 1PNRA 1GQ2A 2JB9A 3CEPB 5TVKA 3PSAA 3WMWA 1NVFA 1QF6A 2AOXA 3WWDA 4D80A 2EG9A 4JV5B 4OI1A 1VQ1A 3AL0C 1H42A 4ARVA 1QORA 3Q5DA 4E1BA 3NXSA 5JY1A 3RFCA 3FCAA 4OLFA 4XJTA 2VHYA 3GUUA 1U04A 5ENDA 3LECA 3F5SA 1EFAA 1TF2A 3QF7A 1Q3HA 4LX0A 4C0KA 4AS2A 1PK8A 1GFSA 1JVBA 2E48A 1LW7A 2VXBA 4D3SA 1X1BA 1NXTA 1EGMB 4GLOA 3MILA 1OFIA 4JYCA 2DH5A 4LJKA 5FI0B 1DUVG 2DFKB 3UJ6A 1RYHA 1TW2A 4KMSA 4LXQA 4P98A 5BRAA 1N2BA 1MABB 3V34A 5JMWA 4IWXA 2HK8A 3PU6A 3ECCA 3HWWA 4EJMA 3EIUA 3M89A 3RSOA 2DH6A 2ZQZA 2PKCA 2R7AA 2QAGC 4IVRA 1E2DA 4AP6A 3LU1A 1E1DA 1I1QB 3W1WA 4B6QA 1AK1A 2C2YA 5C80A 3H86A 1AT1A 1CB0A 5IAJA 4MS4A 3HJAA 4B7XA 1M2NA 4I4TB 4ZZ1A 4DC0A 1UC5B 4FYWA 1R0ZA 3VR1A 1VGVA 2W2LA 3Q12A 4N0QA 3T3OA 2Z83A 3PEYA 1YKGA 3RROA 1Y8QB 4RY9A 2AG0A 1T9KA 1NXQA 3D6FA 2C9ZA 4IDPA 4ICIA 4TGLA 3EZ6A 1E1YA 2JASA 2I66A 1WMFA 2AJDA 4GSYA 5FR1A 1YZFA 2YV5A 4Q3CA 4CGYA 3AFIA 5CJJA 2DP4E 3N2GA 4AK9A 1IXZA 2VJAA 1GTG1 2VBIA 4M7OA 1DGQA 1GN8A 4DBLC 2ABWA 2BKLA 2WV7A 4MICA 3GRYA 2TMKA 4KHPB 3NC1C 2KE5A 5T4HA 1N9GA 3WX0A 4AI6A 1CVIA 4FLFA 2ZZNA 3F6CA 5FT9A 5CX1A 4KPEC 1SRQA 2VL7A 2RHTA 1KZYC 3AO0B 4ZXFA 3RUEA 4FOOA 4C2BA 5LPNA 1D1PA 1W581 2FW8A 1RQ2A 1U5CA 2LZ0A 4KVFA 1B43A 2P65A 3QLEA 2ZS9A 4UD2A 3W7VA 4BLRA 4D4LA 4EI8A 2BMFA 4PQFA 4F6RA 3QE4A 2EZUA 1GLNA 5F1PA 1G55A 2EJBA 1AX9A 4UDXX 1QIIA 4RKWA 3TKLA 3IURA 4TUYA 3S0JA 2XF8A 3R5JA 4L4XA 4CJXA 1PR3A 2ZUUA 1MKYA 3VPAA 1QK3A 1CEEA 4RV9A 4QUIA 1Y9AA 4Z6KA 1TK3A 1YR7A 3A36A 2DTDA 1C7QA 1K1EA 2PL3A 3N8IA 4FINA 4P5PA 3RYIA 2R44A 4QU8A 2NZXA 5TMPA 2YYSA 1AO3A 1GKUB 4JY7A 2ZJAA 1WMBA 1TU4A 4RL6A 4DLYA 2JGFA 3K0CC 1I7SB 1E6EA 2C2GA 2CNNA 1DDIA 3FVQA 4OHRA 2HMVA 3TNFA 5LD2C 4E6EA 2H5IA 5LQRA 821PA 4Z4FA 2GETA 1XXHE 4NBLA 1OT5A 3JQ6A 3I01M 4TWJA 3EMVA 4EYEA 4H0FA 3MZ0A 1RRMA 3EDYA 2HU7A 3NBUA 4RY0A 4ZTBA 3KJEA 4J43A 2QE7D 1Y6FA 3BMOA 3ZCRA 2HF8A 5HFAA 1MJ5A 1AURA 2QL9A 2CZQA 1J2EA 2K7ZA 4IF4A 4TQUS 4ZEOA 3RSZA 2I4IA 4DRXA 4J3NA 2WJYA 3OM0A 3QLUC 3OA0A 1CQIB 1NKTA 2FQQA 4P4GA 3OSZA 4Z2YA 3J81k 1EXMA 1WQ4A 2EXXA 2XXJA 3W2IA 4GPD1 2M98A 5ES3A 3D3WA 3L8CA 3TAHA 3ZDZB 1C2YA 3WHLA 1D07A 2IF2A 4POAA 4ZMBA 3D9QX 4UAGA 3MWJA 5HSGA 3IP1A 1RYYA 4PG6A 4PQEA 1VMDA 4Z3KA 4WLEA 5A1JA 2PUDA 1NNLA 1TOAA 3HZRA 4AM8A 3EODA 4NK4A 3UUWA 2X40A 4FDTA 4DSOA 1Z83A 2B83A 4DT1B 2E87A 4FX2A 5EAIA 2A3NA 2Q99A 2C4TA 2VNKA 2EZ4A 2VH2A 1OB2A 1I6LA 1WSWA 1H0RA 2AE1A 3BYZA 3CIFA 2DBQA 3Q3HA 3HY6A 4HJXA 4HMOA 1J21A 5F23A 2HREA 3MB5A 1X9HA 4RTLA 1OLUA 3L41A 5FUQA 1MZVA 3QLVA 3LDHA 2GERA 1M1YE 1FSPA 2I7XA 4G09A 2RFLA 4MHOA 3GAFA 3K7EA 2W6JD 4L95C 1E79D 4URYR 1THZA 1NBOA 4M9XA 2WWTA 3HVKA 3PQ8A 3G5UA 2D5CA 1U8CB 1D9XA 1QM5A 4MRSA 4HFJA 4PY2A 4HDNA 1BVUA 1MCZA 3L92A 4GGPA 5L7TA 5IDYA 4Q9LA 1H93A 1P62B 1W5AA 2IHYA 1M8KA 1GTRA 1RI1A 3E9NA 3P2OA 4MDYA 4QSHA 1NUQA 3WISA 6Q21A 5JCOC 4CDMA 4OFBA 2RI6A 2PTGA 3EVAA 2ZR8A 1XE3A 1OE0A 3HKDB 2WEKA 2WU1A 4XCVA 4YGXB 1H0SA 1G8JA 1GRNA 3LNTA 2BHSA 1VL8A 3I3OA 1C0LA 3EA4A 4X8HA 5DYTA 4A10A 4DA8A 3A9UA 2DTXA 1YWGO 4FX5A 3ZCUA 3ESXA 2ZIFA 3DOJA 1BVHA 1QYWA 3LWDA 2FJ0A 3HL4A 3C5VA 2CMKA 2WAMA 4II2A 5FP0A 1CRQA 3SDZA 3TZCA 4Q9DA 4CL3A 1K9SA 4A8PA 5KINB 4ACBA 4HXYA 3C1UA 2DXIA 1FNNA 1FU7A 4NH0A 2VDWB 3O3NB 2H8GA 4BP8A 5AOAA 5FUBA 4LFCB 4DFDA 5IKPA 2CEAA 1O6BA 3IP5A 1ZZEA 4LHVA 5J2TF 4UFNA 4UQPA 2P5UA 3VM6A 1A7AA 2YJGA 3GT3A 4XYBA 5H3HA 1KMMA 1FFHA 1X7XA 2GZAA 2AG1A 3SFTA 2J48A 4AL4A 3FJYA 4G65A 5DB4A 3EIHA 4NJEA 3SHFA 1VJTA 3OEEA 1XRMA 4N01A 3UCFA 3V8VA 1G2QA 1M2OB 2JS7A 2RONA 2R00A 3FBTA 3OURA 1OH7A 1R6TA 1SOAA 4N48A 3I04M 3RT7A 1A9QA 4ABTA 2XB2A 5B2ZA 2BR4A 5CH8A 3RRXA 2DMRA 2DJIA 1VYUA 2P77A 4UUOA 1LLQA 3I37X 3FOZA 2O6HA 1FYVA 4HH1A 5B53A 1OFUX 2WUFA 3GLFA 1P29A 1NJGA 4GOXA 4GMKA 5FL7D 1GPWB 1SQGA 2QJRA 2ZRJA 1OVGA 4DQ0A 3AR7A 4P3YA 3K09C 4F21A 3RIGA 3LK7A 2HV8A 4D9FA 5E3HA 4DRXB 5GONF 2EERA 1Q0LA 3QVGA 2JG3A 3C15C 3LZ6A 4JUAA 1JDBC 5IXYA 1IAVA 4J3FA 1IB0A 3S27A 1NLYA 2B8EA 4WA7A 4CF7A 2BEVA 1CDEA 2AC7A 1M5TA 1GNLA 1I10A 3R8XA 4AY4A 4QATA 3DXYA 1H22A 1X9GA 5FBHA 1NJ8A 4CKCA 3DKRA 4BNNA 3LCMA 1YJQA 1ZD9A 5BW5A 1XXHB 2PQ0A 3LX5A 4I9FA 1MW9X 4KUEA 3TTUA 2OGTA 2YHIB 4G9EA 4GPBA 3E3OA 1EP2B 3N59A 1QBGA 4FZVA 4BWFB 5D3MA 3GNSA 4NFSA 3KAKA 3NHUA 2G5CA 2IKQA 3NETA 1MC8A 2WTMA 3VU9A 3DO6A 3AEKA 3SHTA 4F7WA 4MW4A 3L6UA 3Q7IA 4U2FA 1CY4A 4PV7A 4B47A 3OZBA 5DX1A 1ACMA 2HA3A 3LX4A 3ADDA 2PK3A 4G4SO 2BY4A 1QGDA 2PPVA 4EPWA 1M6VA 2QENA 3JYNA 2Z08A 4N3GA 4PX3A 1UZMA 3L1IA 4EMBA 1YQQA 1TCCA 2HMYB 2PKYX 2VDOB 2R84A 3V8EA 5JAPA 2PL1A 3U81A 1X1RA 3C41J 3H6GA 2XUAA 3NGXA 1VLLA 2FWMX 2H3HA 1ULSA 3KPJA 4EMUA 1DC7A 4FN5A 2O0HA 4FDMA 4RTRA 2P6NA 4BRZA 3E9CA 2H9IA 4KPYA 1SKMA 3HA2A 1XWFA 4BC0A 5LC1A 4UARA 1ABFA 1FP2A 4G07A 4CIAA 1RWQA 2PZFA 3F78A 3LUPA 3HXMA 4YRQA 2B4QA 2JJYA 4BE4A 3DW1X 1FDWA 3FHLA 3IJ5A 1A77A 3QYPA 5JLAA 2R5FA 2YMPA 2C00A 3BUSA 3O75A 2O19A 1S3IA 3ESQA 4OGKA 4FIZA 2BEWA 4BIIA 3BXEA 5CAEA 4GPAA 4MUNA 3B3AA 1R7RA 4EZBA 4JCOA 2DULA 1HTWA 2I9KA 5AUPB 4RGBA 1G8FA 1A3CA 1BX1A 3DVLA 3RBXA 3ZX5A 3PNVA 3ZGVA 4ZYTA 4X7RA 3KQVA 3DYIA 1YK0A 3K4QA 4AUKA 3V9AA 1IUNA 4R84A 2GM3A 3X1JA 1W5FA 2HCFA 3PNMA 1W0JD 4CKWB 3CUTA 5B7GA 4CIYA 4JYAB 1RYBA 1TZJA 2QSYA 2GN4A 3WK7A 3X1MA 5CMLA 2P27A 1KMIY 2D2IA 2WMDA 1E5XA 2XKBA 3MWKA 3EZYA 2A4MA 3KG2A 3PQFA 4PCAA 3UUEA 5IJZA 3A37A 4GXNA 4OM7A 3GH1A 4DRYA 2QD1A 4ZV4A 5JYBA 1J25A 2DETA 4ZYWA 3E35A 2R8ZA 5EL0A 2JBWA 4H3HB 4AP5A 3WIEA 1ZITA 5IVHA 4OK5A 5FPQA 2PTHA 2G0NA 1RJEA 5GJWC 3WGGA 5GZ1A 2F90A 2B99A 3OUTA 3H5AA 4PZLA 1QRUA 1JHZA 2XQKA 1ICIA 2XWPA 3QA3E 4M54A 2ZUCA 2ZWMA 4F6CA 3ZHZA 2UKDA 3HSYA 2X23A 4TROA 3TZKA 3CSDA 3LOQA 4M7PA 1HSOA 4CN8A 4IIBA 4ZVNA 4QELA 1SBQA 1W48A 4L2IB 4DMMA 3COSA 4M22A 2RGWA 3VR3D 4BIMA 1Z68A 5DTIA 3AI1A 1ML4A 1C14A 1UM8A 4GSLA 3GAZA 4L8YA 4XLTA 4BZWA 3GJ4A 3ODPA 2VDLB 5KEIA 2I55A 3IOYA 5ESWA 5L3ZA 2NQ2C 1NDHA 3L04A 1FPQA 1PZMA 5E8JA 3SM3A 2HIHA 3CLSD 1FJ2A 1KPIA 2QUKA 4IVPA 4NBSA 3AETB 2YXBA 1J0AA 5CU7A 5IKXA 5J4KA 5IWAB 4A91A 4ZVVA 2F8LA 3T9AA 2X0EA 4BATA 1V0JA 2YVUA 3UJ3X 3AK4A 3D4OA 5D2CA 3ID6C 4CM1A 2V6BA 1P7PA 4IX9A 1N1DA 1YRWA 4QVGA 1PW5A 2OLKA 3OF3A 3AW8A 2PGLA 4TTJA 2M6SA 1TCBA 4G37A 2VWQA 1B0ZA 1QXSA 5DGCA 1OH8A 2AF3C 1D5CA 3D8SA 3NPMA 3ZE6A 3G9QA 3KZ1E 3I52A 3E1GA 4DJ5X 2X9GA 1JJ7A 3L49A 4P9NA 4PRYA 3MMSA 3IMGA 2P9ZA 3WYGA 1IHYA 4IJ5A 1CE8A 4FNAA 3DTVD 1TVKB 1ZS9A 3FZQA 4Q3EA 4PBRA 4Z54A 4YC7A 3SEAA 1CY8A 2W6CX 1YL5A 4TWIA 4B2IA 2L82A 4YO8A 3Q9LA 3H2JA 4Y7DA 2O48X 2RAVA 4DLBA 2OO5A 3CZRA 1VOTA 2OWDA 4FGLA 5JATA 1E0JA 3UG6A 1KS9A 2HMUA 1NYQA 2DUJA 3JVVA 2QX7A 2BP7B 2NAFA 3TW8A 1SVLA 3KWMA 4BHTA 2ZSIA 4JC0A 4TYYA 4KFUA 4XIFA 4JP3A 2O1EA 1US8B 2CNKA 4OUDB 4LF5B 2A86A 4C04A 5AKGA 5BURA 4OYRA 1E3DA 3FB4A 4FFWA 2O3JA 2FPRA 4KACA 1PJZA 3TTSA 1NVGA 3EAFA 1O08A 3TK1A 3X2SA 3IFSA 3ZGYA 5KQGA 3SYLA 2QM3A 2DG2A 2Z6VA 4PPQA 4B43A 1JR3E 1K6JA 1EM8A 2WKWA 3V9PA 3WLTA 4NE7A 5GJBA 1KZ7B 4CWAA 2D8AA 2V5AA 4QD3A 1SXHA 4KQCA 2EKQA 5DTJA 3HYLA 5F5LA 4DCMA 3FOCA 1KARA 4I2VA 2PJDA 3PENA 4URUR 4MAMA 1ZOOA 2C4WA 1YUBA 4CG0A 1EZ4A 2N47A 2DHDA 5CDFE 4TTSA 2JAPA 2R65A 2RIPA 3FHJA 3ON5A 4IFEA 4IRMA 1X42A 2QVXX 2ZXFA 4KK3A 5DTEA 5K0EA 3DWGA 4LTNA 2FXVA 2DR2A 1ODSA 2C9BA 3CCBA 1QFSA 3GFSA 2XDQA 3L6EA 5IM4F 2WTXA 3BIOA 3P9CA 3AVTA 1L5OA 2O0LA 2Y1OA 3VHXB 2OBNA 1HK7A 5KKCA 5DGXA 3PDWA 4ZMRA 2ORIA 3WWCA 3IP6A 5IG2A 1A9SA 2J41A 2UYQA 3LLMA 4Q9HA 1IVNA 4X9XA 3EGWA 3A1FA 4XOUA 3FAKA 1MTZA 4GYYA 1PBTA 2OHVA 3M6LA 1C1XA 1AZTA 1Y8QA 2O4CA 2Q2NA 2QN6A 4HH3C 2O2JA 1YIDA 1MC1A 1QVWA 4PN7A 2WD9A 4YMWA 2ZVQX 4JXKA 4C07A 1HOXA 1DWQA 5C1BA 5AVQA 1F5NA 3BHJA 1MA0A 4AJHA 3C74A 5BWMA 5A9RA 1AJEA 4O1IA 3JQAB 2FPSA 1A72A 2PZAA 3AOGA 2PT7A 4YP5A 4EHHA 1I4WA 3V6LA 3AR2A 1GL3A 2Q6OA 3D8RA 5JNRA 4RTJA 2IEIA 2FX3A 1ILEA 1V16A 3HCFA 1XVAA 2X42A 3WTBA 1AO0A 3FH0A 3PQ6A 5KNCD 4LXHA 1D6SA 1TUGA 3M1YA 1ZJJA 2FK8A 2BISA 2IP1A 2O0KA 4O63O 2TS1A 4YRPA 5SYNA 4OSPA 3FBGA 3O2NA 2G8NA 4LJ8A 4EHAA 1FNMA 2AK2A 5ILGA 1WY7A 2JEOA 5D01A 4K87A 2O8VA 3VOTA 1OLSA 2Q4OA 2B1JA 4WFQA 1X80B 3JYLA 3BXPA 1QHIA 4GZ6A 5B36A 3JSAA 1JFVA 4OQZA 1Q1EA 3GF4A 4WJLA 1QDEA 3CE6A 1B6GA 2V9PA 3MGGA 4JODA 4O4HF 2CK3A 4JC8A 1IL0A 1F6DA 4LUCA 5FJJA 4ENPA 2PKRA 3FIJA 3T1HB 3SJZA 4FQ5A 1NU6A 1VL5A 1DELA 1ZHHA 3JAKB 3UXYA 1OH5A 3HA5A 5CA1F 2YJTD 1WDTA 3CJQA 3H2IA 1AD2A 3NPAA 4J0EA 4QPJC 3X1KA 5DX0A 1Z4KA 5F7JA 2VAPA 3SFZA 1SUDA 1MB3A 3NUGA 2ZSAA 5AI4A 3X2EA 4B5KA 1RHUA 2IODA 1NBME 1QPGA 1JEAA 4KAXA 3GBPA 4ZU3A 1MOQA 1QFMA 2O50A 1KF0A 1UBEA 3PC8A 4D9GA 1KO7A 4F06A 3A9VA 5CA0F 5LL6P 1DKMA 4WK4B 2AG5A 2B3TA 3DBVO 4ITRC 4YEDA 5EVJA 1RPJA 2DVMA 5KMGA 4KE6A 5DCWA 1UKCA 2AJTA 4MRAA 3I2IA 1DX4A 4FS8A 5JMPA 1SRRA 4TKLA 5TQ2A 2PRZA 3HVRA 5JJKA 5CURA 4U9HS 4XSVA 3B3QA 3D4IA 4ARZB 4YP7A 1GDHA 3UJHA 1FX0B 4CPDA 2IS4A 1CP2A 4DWOA 1J5EB 5F98A 1WU7A 2JRCA 2ODQA 1TJPB 3LHDA 1Z2AA 3E3AA 1W4ZA 3LPMA 3RU7A 4ECEA 3HGMA 4ETWA 4ZVLA 2ARKA 3MJTA 1RAGA 2NUAB 2PWYA 1AXRA 2YRFA 3AIIA 4YYEA 2HV9A 4AWAA 2A5FA 2AOUA 3IV9A 2V97A 2AXEA 3L4EA 1RFGE 1YZ3A 4II3A 3VSCA 4G1EB 2UXDB 1WF3A 1HFKA 2GK6A 4KAFA 3QVXA 3OJ0A 4ZAFA 2GAFA 1LFDB 5JQGF 1QFJA 2TRSB 1JKXA 3KSUA 4KJXA 3EUWA 2A9OA 4AXXA 2ENUA 1QVVA 5IARA 1EM6A 2NU8A 4DLKA 1P2UA 1LA2A 2I1QA 3O2SB 4ZYUA 3PFWO 5FDFA 3W5SA 3NONA 1P2TA 1IK4A 1P45A 2OYSA 3CZPA 5K0TA 2HBRA 4U4AA 3R7NA 1W29A 3ABOB 4KQ1A 1U5BB 2DFVA 1F51E 1QFYA 4RKRA 1PUIA 2A9VA 2P78A 2YRWA 4AQDA 1AQJA 1I7QB 1C8BA 1YFKA 3KYBA 3RTBA 5G40A 2FPOA 4WBXC 4J0CA 2Q4RA 3FNBA 3RJMA 4EQZA 1JFSA 5LLDA 3MS7A 2X0KA 1U65A 3OJWA 3GJ8A 2HPAA 2XE7A 1TAQA 2E7ZA 2IA5A 2OCBA 2QW8A 3N2IA 4I4IA 4JJIA 4LW8A 3STYA 1F2TB 3WGQA 3ZJ5A 1P9NA 4NC9A 1F2TA 1T0BA 2NMVA 3AUSA 1CUUA 3DH0A 1IXRC 3TIIA 2ZB8A 3DE7X 1K7EB 3PQ7A 3W9YA 1VJ1A 2OC4A 3AJDA 4ENQA 1Q77A 2WY2D 5BWOA 2HLNA 1K7FB 3HHEA 4AROA 3FSJX 3C6BA 3ZGNA 1PJRA 2I54A 1SD2A 2CLSA 2V7UA 1NE2A 2IS2A 1V8OA 2C7VA 1ULZA 4HYEA 3WZMA 1SOVA 1RWNA 2FKNA 4QOJA 3AHCA 5BR4A 1H9BA 4OTZA 1GZ5A 3LGSA 4TMYA 3DW3X 2WK1A 3I83A 3EQ7A 3JRXA 3PC6A 1ONSA 5CM2Z 3RRZA 5LQNA 1BDIA 1I9CA 1N2IA 4TRMA 3RYHB 2OHHA 5JI3E 1GAEO 3NIWA 1IZ7A 1UT6A 1Y3BE 3A6LA 3NOQA 5KYTA 1O0BA 5EUQB 1U4SA 3IKTA 4FFPA 4J0HA 4OIMA 3ZBQA 4BVKA 4GP7A 1CS0B 2QOEA 4WUTA 4XVUA 4FR0A 1Y7PA 5JAQA 3NHSA 1SOMA 1W36B 2W5UA 1OKKA 2GWRA 5H9WA 3RJ9A 3MWLA 3BSFA 1ZMOA 5J5VA 4YV1A 5HKKD 1D0IA 1N0IA 3JWIA 3CW2A 4OMDA 4Q7KA 3S7ZA 2HJGA 4BVHA 4MA0A 4ZO4A 1KQGA 3CVXA 2VHTA 3PXDA 2G06A 1QH1B 3QTLA 2WUDA 3DF7A 3T15A 3VYUB 4CV2A 4UTVA 5EJ7A 3ANLA 3U1BA 5JBQA 3D0KA 1K7XB 5L4SA 1ICEA 3I61A 4CLXA 2FZVA 1FYDA 4NP6A 1JG4A 1UIRA 3GUYA 4Q03A 3GFGA 3QXGA 3LBNA 4PLVA 5BWCA 4F8YA 2VP4A 3CGGA 3UOWA 3FVTA 1M6HA 1ZONA 3KAQA 3TJZA 3STTA 2C97A 2RHOA 3Q41A 1HT3A 3PXXA 4B79A 3EA5A 2CFSA 3D5TA 3GB9A 2GAAA 1JBKA 1Y7HA 2JKVA 2VDMB 3ZJYA 1DZ3A 2OGWA 1V5EA 3K0FB 2HF7A 3C8ZA 1T8PA 3ICPA 3NCHA 5GADl 3CT4A 3NAZA 2XOKA 2YMMA 3GIDA 3A6GA 4ZA2A 4FB4A 1JKJA 3P9IA 4BVEA 3NVMB 4KQJA 2PZLA 3ND5A 2KI5A 2H2GA 2FW0A 4KGXA 1LDMA 3QPUA 3T4EA 4EKNB 2WA2A 1R18A 4V38A 5IU6A 1LDGA 2QTVA 4O4IA 4ZP1A 4LJ6A 5JOQA 5G41A 3NATA 1REQB 4DG8A 3W3ZB 5AHOA 4FBMA 1IMOA 1J42A 2ATEA 5A06A 3D7KA 2GF9A 2MR6A 4EW2A 1XZDA 2F1JA 2WHPA 2XPCA 3WGNA 4KWIA 3TTXA 4EUKA 3EVTA 3U7QA 4BGDA 3ABSB 3H5IA 3IVMA 1L0BA 4BEWA 3U7QB 5EXTA 3R20A 2ZWPA 3MCVA 4NQZA 1NR1A 5JJIA 5AI8A 1H23A 4FWIB 3SMVA 2FJUA 3GUVA 3ZGOA 1FFWA 1Y8RA 3LY5A 4CM8B 3MTAA 3H9GA 1UDRA 3P9XA 4OREX 4EJ2A 1UBUS 5K6AC 3T7KA 1OV6A 1YGPA 2JGLA 3DHYA 3P9SA 3QVOA 4Q82A 1VLJA 4DIOA 3CUKA 4EYKA 4Q16A 5DM1A 4EPXA 1RS0A 2Z5VA 1F8FA 3EB9A 4UJ5A 1KRWA 4F4FA 1QTIA 4LJ7A 4O3FA 5AW8A 4RPHA 1N8NA 2DPXA 2A9QA 3TS1A 3HVUA 4AJ1A 2JLXA 4K2HA 1HI9A 3O3OB 3O38A 4PZ0A 1TAGA 4DZZA 4GWLA 2GLXA 2QR5A 1Q7GA 1X77A 3C1OA 4OQFA 1Q1AA 2NG1A 4YBRA 1G63A 2QLBA 3ZQ6A 5JDIC 3O92A 3VR5D 3DUFA 4RHUA 5B3JC 5KOHA 2NUTA 2AHOA 2ZU0C 4LRYA 5BSMA 1JTFA 2WIFA 5FQOA 6NULA 4CGZA 4JJ6A 3MINA 2E5LB 3PHLA 3HYNA 1N1MA 1PSDA 1RXWA 4CNQA 2GJ9A 1C9NA 4RDHA 1P5JA 2XWJI 4FHDA 3IGFA 4RJLA 2GF2A 5I9TA 4LDPA 3ES9A 2W98A 4JAVC 4LS3A 1G20B 3WNDA 5HS4A 3I4CA 4ASUD 1F9AA 4B3TB 4TM8A 4TYMA 1NR5A 2Q1UA 3HR8A 4GH5A 3CXRA 2Q29A 1GPYA 2GDJA 2X13A 4QA9A 3SR0A 6PFKA 4B3MB 5E7QA 5DHPA 4KYVA 3PJFA 1F1JA 4FWTA 4BOYA 3ANMA 1RHJA 3NW9A 4H35A 4P08A 3SZLA 4F8JA 2BMWA 3NYQA 5EKXA 5KWJA 3L46A 1YQXA 1GGFA 2AI3A 1I1NA 1B14A 1GGJA 3KDPA 5JW6A 2QR2A 3JVIA 2GWHA 4KIWA 1R15A 1L4EA 2LV8A 3BWCA 3W05A 5JXJA 4NMMA 3M2TA 4I4TF 3T8YA 4MEJA 4DLRA 3ND6A 4AZTA 3TQTA 1B8OA 3I5XA 1ZG3A 1X7DA 4Z4QA 1I1HA 1R9NA 1VIYA 3MSXA 3OFNA 3BEOA 3B82A 4R0VA 1JVSA 1SCBA 4KXQA 4NONA 4PQGA 3ZYCA 5KC8A 2Z5GA 4DMFA 1I6KA 1XEWY 2K4MA 3E22B 2HIGA 1DXHA 3IUYA 4LC9A 4A23A 4D81A 3H97A 4G26A 4EGQA 3SS7X 2J0SA 4FFRA 3V1UA 4O4JA 4D8XA 2V4UA 4MUKA 4UAUA 1Q15A 3I2KA 4XR9A 4RLQA 3L05A 1K75A 1VDZA 3IMCA 4K28A 1LS1A 3A26A 3DBHA 3MUFA 2JGJA 1NTRA 3D4BA 2NVUB 3OP1A 3PI7A 4E09A 2C78A 2NVUA 3LQRA 2WLSA 3R77A 4KWTA 4R2MA 5G4KA 2R60A 1X7YA 3B3GA 1RI2A 1H5QA 2F9MA 2PCJA 4G63A 1WXGA 3LA8A 4LYHA 3PQ3A 1L7OA 3BD8A 2QQEA 3O90A 4Q00A 3RYFB 2O2DA 5KQLA 4UHDA 4GDFA 4DLAA 1YB6A 3N0RA 1Q3TA 1UPBA 1H1LA 4KQHA 3D3WB 1CUYA 1CDZA 5CVCA 1VDMA 1Z7YA 4EO7A 4OOFA 3LIIA 1GUAA 4CMJA 4QYIB 3L84A 4I8XA 2BAGA 3THXB 5AM0A 5BSFA 3LXXA 1Z63A 5HF9A 1T8RA 1V4VA 1CG6A 1YMUA 1KYVA 2ZANA 5JZVA 3U3DA 2IZZA 1FUUA 3O8OA 4C4XA 3F73A 4INJA 2TYSB 4HY3A 2I2XB 2ONJA 1RIFA 2AI1A 1G8KA 1P60A 5J9FA 3RUPA 2FSHA 4BP9A 2VF8A 4QTXA 1JQEA 2CYCA 5KOJB 1NJ1A 4LFAB 1A8IA 2QWXA 1UWVA 4TSFA 5SZHB 4Q24A 2R3SA 1XDUA 2OSBA 3EDMA 4MVYA 4H7KA 2A1TS 4UXHA 1ZH2A 3JARA 3SBOA 4DB2A 3E2IA 1UJBA 1D7AA 4XQCA 5CPFA 1DPGA 1RAHA 1GNQA 2HKIA 3AKDA 5TB5A 1IG3A 4NF2A 1H69A 5DMXA 1PD1A 4LY0A 3NGLA 4E5YA 4RY8A 2IHUA 1Q1NA 1SIUA 5JYDA 1J22A 1XI2A 3FPJA 4O5OA 2A35A 2FPIA 4DSZA 4EYOA 1E5LA 1NBAA 1TT7A 5LXTF 2FPIB 2OD9A 1FDOA 2PSFA 5LQDA 3BBPA 1M0SA 1QLHA 4CKZA 3EOZA 5FPTA 3M81A 2G9ZA 5A7GA 1MDBA 3BA1A 1L1EA 3WLNA 1EUDA 2WFZA 2BVNA 3DVAB 1PNQA 2BMVA 2NPIA 4A3SA 1QHXA 1GCAA 2YWGA 5D00A 5J4HA 5LP6F 4YJHA 1W2HA 16PKA 1MENA 4N76A 1SAYA 5JBIA 4XI9A 1ORTA 1SKYE 1FMTA 2WYIA 4G5QA 1N2JA 2AEMA 3LY8A 3KQWA 5KU1A 5GIOE 3AEQA 2VN8A 1RBZA 5B1DA 2GT1A 3WQHA 3EXIB 1VA5A 1R1DA 1PFKA 2H4HA 3SHVA 2D6FA 4HNAA 1TKRA 2HLPA 3RS4A 5REQA 2I9PA 3ZZNA 1N1GA 3C1AA 2IUYA 3T3DA 3WLHA 3KBOA 4OSEA 2V1UA 4B6PA 3FCXA 3SEZA 2RH4A 3PGVA 1FFXB 1KKMA 2QAGA 4PVCA 5FBZA 3RBAA 2VZ9A 3GLQA 5B12A 1DIOB 1Q1BA 5IH3A 2G88A 4GHWA 4ZCMA 3CNOA 1V9SA 1CK4A 4P84A 1S02A 2XUIA 1XL0A 3OWHA 4JOSA 4KQIA 3CN9A 1ZVVA 1LSJA 3NTOA 4TMFA 3WLJA 1QF9A 1DAKA 2IXFA 2AE2A 3AUXA 1SHUX 3JXEA 3LTEA 3EXEA 4HGZA 4MTCA 4ZYXA 1YVPA 4MMXB 4DIKA 2ZCVA 3LVFO 1RW4A 3EWIA 1F7UA 3HEAA 4I55F 4X1IB 2CC2A 4KR6A 3ST7A 2VHVA 1AUPA 5DLEA 5EE1A 3FJ1A 3DDZX 3VYTB 2HHHB 5JE8A 3X1XA 4RMJA 3U4GA 1V3QE 4JLMA 1NBMA 3KB6A 1FS6A 1QCYA 1GZHB 1T5HX 3T5MA 1Y0BA 1ST2A 1WW2A 2IYRA 2QMQA 5IC6A 3CZ9A 3V48A 4LRWA 1VCMA 2GN8A 3AR9A 4PFJA 3FGZA 3IPAA 1P91A 2UDPA 1Q6YA 4EG3A 4LWOA 2IEGA 2WVAA 3F4BA 4MW2A 3W3AA 2GJKA 3NNNA 4BMCA 2D06A 3JAWA 4Q1CA 4KVGA 4IHKA 1RQLA 4JP2A 1BCRB 4MWOA 5K45A 2V6MA 1MQ9A 4TQAA 4HNHA 2ZVDA 1YZQA 1A8HA 1TMGE 3KYCA 1NKSA 5J1TB 4TZ6A 5ERXA 2C4HA 5K8TA 2W4QA 2P2CA 3JTMA 4LMPA 1W85A 2ODTX 2WDZA 3L1VA 2WSBA 3HCRA 4RAOA 4DXAA 1GA6A 1XXHA 4TV8F 1E2IA 1OF1A 2Q3EA 2RCYA 4E4YA 4X93A 4EPTA 4YRDA 2XD4A 4DMGA 3W5BA 2PUJA 2QXYA 3SNHA 2X0FA 2XWQA 1CY0A 1DWPA 1L5HB 2EQ5A 1NLMA 2FUG6 2PXHA 2KQUA 2VBCA 2J0UA 1WZCA 3BRWA 3LPLA 4JKIA 4N1AA 1NG1A 1A4UA 3VVBA 5K0CA 4ITVA 4UZEA 3DBLA 1QHNA 1LDBA 2FX5A 3EXG2 1TM3E 5DXAA 3PNBA 2PMEA 2OTCA 2Q0SA 3QFRA 3VBEA 5A2QA 5AKXA 2G82A 1AKYA 5LSAA 3PLAE 4YK7A 2Z6QA 1D2MA 4CXMA 2C31A 4DIBA 2GAOA 1HRKA 1KK3A 1W4BA 2DRIA 3H75A 3K1YA 5HYVA 1NL3A 3AF1A 4ZJYA 1VPTA 3FNFA 1X1SA 4EWLA 2QVCA 4UBLA 5FNVF 1S2LA 1CW2B 3DOHA 3SLKA 1DCKA 3SXUA 3TFQA 1KJIA 2CLHB 3GQBA 1HE5A 4H4EA 2W2NA 1NBMD 2DWCA 3K1AA 4R9SA 3RTGA 3V4OA 1UFRA 3KELA 3Q2KA 5LZ9A 1J0BA 1PFWA 2ESRA 2PQ6A 2JFGA 1NVVR 1Y8AA 2ONYA 4BO6A 3NKFA 4YROA 2NUAA 5A04A 4CMIB 4WUVA 1E63A 1X1DA 2VAWA 1C3JA 5GAJA 3QFTA 2JZOA 3E5HA 3WDKA 1KR5A 1ARZA 3MCZA 5BWNA 3FDIA 4B0PA 3DOFA 3HB9A 1K89A 4E0BA 1VPVA 1O95C 2XZTA 1KQPA 1AC5A 2DUNA 4CMHA 2CW5A 4YALA 1R6AA 3K5IA 5JC1A 1BW9A 2VYVA 3U39A 4EJFA 1Y4DE 4FKMA 1Z47A 2O3UA 3D1JA 4YS6A 2BKUA 4C06A 2QRNA 4M8IA 4OGGA 2HBQA 3VH2A 3ZDRA 1KI4A 1U0HC 4A92A 4UTZA 5HM8A 4CT0A 1M2WA 2YOGA 3KKNA 4JH0A 1KR2A 4JELA 5HBRA 2GNOA 2GPBA 4EAAA 2JZNA 3AUKA 3H5RA 1F0NA 4WKNA 1IBMB 2ZIXB 2AFVA 1ZUWA 2BFWA 3GGPA 2BKVA 1GT91 5EHIA 2HHJA 1RHRA 2PZEA 2REBA 1G5IA 1KNXA 1RTKA 3B12A 4WV3A 4HZGA 4BNZA 1XMQB 2JHFA 2HTFA 2I4NA 3HU3A 2G8LA 1UK6A 3A6HA 3AF4A 2ZRPA 5GZ3A 4UEOA 2IOFA 2DCMA 4U2GA 3SJUA 3ZUPA 1MOPA 5JCOA 4C3ZA 4UNNA 4EY5A 3ZLVA 9LDBA 4KFCA 2JIDA 4BPRA 3VZRA 2CVFA 3ETNA 2RB4A 3L77A 3N0WA 3IQZA 3PHIA 4QBTA 1ATIA 5EQJB 1TTTA 4M1EA 1R9GA 1YDFA 4ZQHA 1UT5A 3QW4B 1M0TA 2D1SA 3G5LA 4P2GA 1BROA 1N6PA 3SSAA 4BLOA 2FGJA 5DIFA 4B17A 1BEUB 4JNCA 3IIIA 5HBGA 1RI4A 4X1KB 2PMKA 3LI2A 3ZZ0A 2PUFA 1P17A 3PFNA 4F3NA 4C29A 2G6TA 3TINA 3HMKA 2OY0A 2EBHX 5BQXA 1XIVA 1KYZA 5KYGA 1ZY2A 4KBFA 4I7EA 3CXUA 1EE2A 3ZGXA 4G67A 3N5KA 4UUNA 5E0OA 2AW3A 4AJKA 1XMIA 2QRKA 3DWFA 1CY6A 1XALA 3FTPA 2IP2A 1QRAA 1QYDA 3LO8A 3KQUA 2F2TA 4LJSA 5IT4A 1SG9A 4LHYA 5TGDA 5HILA 1N7HA 3KX2A 4L50A 1TVKA 1XZCA 2BI7A 2FWAA 2NYUA 4JT2A 2D5IA 4OHPA 4A1FA 1Z5UA 2IXDA 3AJAA 4L16A 5CBPB 3ND9A 3S2GA 4MVJM 1YS4A 3ORFA 3GC6A 4G1FA 2FSPA 4QGAA 2WU8A 4Q7JB 4R2LA 2YUTA 5GQSA 4NAVA 3VU3A 2Y4OA 1XVIA 2UUOA 3H84A 3VKGA 5EC8A 3MT9A 1E8MA 3P9NA 3I9LA 2F59A 4GOKA 4JL8A 4NENA 1EFLA 1LI7A 3PE3A 3KJGA 4PXAA 4KG7A 4ZCQA 5ARBA 1HDIA 4PNEA 2UXCB 1CVLA 1Z36A 2H7CA 1IJKA 2V7TA 2G07A 3IDQA 2YJ5A 3MJDA 4I1RA 1KDOA 2QY6A 5AK6A 5FPYA 3VZDA 5JAMA 1M2VB 1N5JA 4AY6A 3AW9A 2C2XA 1ZSYA 4UM5A 2M32A 1DKQA 2PLRA 3G9ZA 3T3MB 2FE4A 3RRMA 1J8VA 1W73A 2WSSD 2YXNA 1SIBE 1VCHA 2H06A 5LR6A 1FQKA 4DUGD 4BNLA 4RM3A 4F1JA 2XY4A 4EY3A 5IH7A 4AY5A 2BBTA 4BNKA 1JQ3A 1KRHA 1K5DA 1KPGA 3D6MA 3IR6A 4MQFB 4TMXA 5EXXA 2HLDA 4ZVTA 1R9MA 2HB6A 1E3TA 2OXRA 2XLCA 4ALKA 4N3NA 5CCBA 4BLPA 2RHCA 1BTOA 3NFRA 2O2XA 2CDAA 3O1HB 4A2QA 4NU5A 1U6JA 4ETIA 4HVCA 4LY9A 4TSKA 2JLSA 2VQDA 3I01A 2FPPB 4KCGA 3ML1A 2O2SA 1F38A 1FIUA 3E8MA 3NRCA 1QZTA 1GQYA 2FA9A 2X0RA 3HI4A 5ELMA 1L5SA 1VL6A 3FNQA 3RVDA 3UH1A 3EQZA 3U3OA 2WUWE 4R1OA 2WJJA 1Y1TA 3RFXA 4YT4A 1ZN9A 4YXFA 1YNOA 2B98A 3O4FA 3M9LA 2J59A 1Z2EA 3OY2A 5CK4A 4D6YA 4WKOA 4JYZA 3AESB 1SCJA 1TQ6A 1SVKA 4MULA 2FFBA 4H6WA 4LFBB 3WSWA 3R40A 3OQIA 4MR9A 1XAJA 3SU8A 1ZSNA 5TVGA 4IR7A 4BV8A 1XRQA 3SWWA 1E94E 4OD0A 2YCBA 2VZ8A 3ETHA 1M66A 2FSVC 3KM0A 1I2CA 4WAUA 3FWZA 1O4WA 3ORHA 2J85A 3TLEA 2G83A 3W6NA 1KC3A 4WASA 3VVCA 4DR2B 3AHFA 4UM8B 2ODPA 2DFLA 3AINA 5CA0B 3QMMA 3GJZA 5AYVA 4ALMA 3RDPA 1NW7A 2FH5B 4O2BB 3UPTA 4R6XA 4TTPA 4CM6A 2R79A 1CULC 1T2EA 2BELA 1Z5VA 3CRMA 1VHDA 3BFXA 3KZNA 3NH6A 4B3XA 4EPVA 3UHJA 4P7KA 1TKAA 2AYZA 3KTDA 1SR8A 4HX9A 2N75A 4NBWA 4KPUB 3IIMA 3CLSC 2CXUA 1Q7BA 1R4AA 2GZRA 4O02B 2N3ZA 4UMEA 3UWOA 1P6QA 4LF9B 2PGXA 3R23A 1LK0A 4L8GA 3OLCX 3WNCA 4G86A 5EESA 1QYCA 1OXSC 1FS5A 4JI8B 2Q5HA 3A14A 1Y9ZA 4BTLA 3RVQA 4QVIA 4BO8A 3DJYA