4Z1OA

Hypoxanthine-guanine-xanthine phosphoribosyltransferase (hgxprt) from sulfolobus solfataricus in complex with alpha-phosphoribosylpyrophosphoric acid (prpp) and magnesium
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
176
structure length
171
Chain Sequence
YHIPSWDEIEDAVFSIGEALVKSNYIPDVLIAVLTGGIIPAKLLSDLLDLKVIRYIDIKFYRESKPVIRSVYTDSLEGKKVLVVDDVADTGETLEAVSNVITMFNPAKVMTAALYLKPWSKRIPDFYYKQIDKWIIFPWDKWDVVRENSNVPVDKKERFLNLYNQLLKIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hypoxanthine-guanine-xanthine phosphoribosyltransferase (HGXPRT) from Sulfolobus solfataricus in complex with alpha-phosphoribosylpyrophosphoric acid (PRPP) and Magnesium
rcsb
source organism Sulfolobus solfataricus (strain atcc 35092 / dsm 1617 / jcm 11322 / p2)
molecule tags Transferase
molecule keywords Phosphoribosyltransferase
total genus 52
structure length 171
sequence length 176
chains with identical sequence B
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2015-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4z1oA00
1ECBA 2XBUA 1U9ZA 4P3KA 4PFQA 4QRIA 1I14A 3QW4B 3EFHA 1BD4A 4RHUA 3S5JA 3OZGA 4P84A 3GGJA 1TC2A 4RACA 5JSQA 1HGXA 5ESWA 4F8EA 4WMLA 3LPNA 1A4XA 1A97A 4JLSA 2EHJA 1FSGA 5JV5A 1A3CA 5EUCA 1DQNA 1VDMA 1J7JA 1G2QA 5BSKA 1G9SA 1I5EA 1QB7A 2JKYA 2VFAA 3NAGA 4MB6A 3DAHA 4S2UA 4X45A 5K51A 4RQAA 5E38A 1NULA 2JBHA 1A98A 2PRYA 3OZFA 5IAOA 4KN6A 4P86A 2PRZA 1CJBA 1L1QA 4LYGA 1ECCA 1JLSA 1XTTA 3GEPA 4RHYA 1U9YA 4RABA 4RV4A 1XTUA 4WN3A 5KAMA 1QCCA 3GGCA 4X44A 5IPFA 5HIAA 1OPRA 1DKRA 1GPH1 2JI4A 1R3UA 3H83A 3OHPA 2DY0A 4M0KA 1P4AA 5HKLA 1BZYA 1STOA 2HCRA 3DMPA 1D6NA 4P81A 1ECFA 1HMPA 1VCHA 1YFZA 2WNSA 2GEBA 1UPUA 4LYYA 1A95A 3MJDA 1QK4A 1I13A 1QB8A 3MBIA 4RANA 3LRTA 1A96A 3ACCA 4RHTA 1ECGA 1IBSA 1P19A 3G6WA 3KB8A 3O7MA 1OREA 1GRVA 5KAPA 3HVUA 1Z7GA 1O57A 2H07A 4M0PA 1V9SA 1G9TA 4RQBA 1QK3A 1UFRA 1G2PA 3ACDA 4JITA 1ECJA 1OROA 4M0UA 2H06A 1AO0A 4OHCA 1BD3A 1ZN7A 4P80A 5ESXA 1UPFA 4QYIB 1DQPA 5BRNA 1PZMA 1NONA 1LH0A 4RHXA 4TWBA 3M3HA 1QK5A 4IJQA 2H08A 5BQPA 1JLRA 4RAQA 4RAOA 1VSTA 4LZOA 1ZN9A 2C4KA 4LZAA 4RADA 5BQOA 1I0IA 3N2LA 4ZFNA 1ZN8A 4LZNA 4P83A 4Z1OA 1DKUA 1P18A 1DBRA 1O5OA 2IGBA 3DEZA 1WD5A 2PS1A 1Y0BA 1XZ8A 2E55A 4FYMA 1W30A 1XZNA 1I0LA 1TC1A 3ACBA 4PAWA 4P82A 1L1RA 2FXVA 2AEEA 2YZKA 4QYIA 1MZVA 1XTVA 2P1ZA 2JKZA 1P17A 1QCDA
chains in the Genus database with same CATH superfamily
4PZAA 2ZI3A 4HEA6 3FVWA 4MKIA 3VPFA 3AVWA 3ZE8A 2D3WA 3DAYA 3PFFA 1N34B 5ILQA 1Z2PX 1JAIA 2P5UA 3IMKA 3TXXA 3MERA 1OFIA 3LC0A 2GN4A 4KRFA 1PWZA 4G5RA 3H8VA 2EG9A 4WMLA 1REQA 4LRYA 4UM9B 2FFQA 2H1WA 2O59A 1NUTA 3LT0A 5CNJA 4YT2A 1L5QA 2WLTA 4HQKA 1SXGA 3BXZA 1W76A 3TTWA 2PLRA 1ND6A 1YMVA 4FGJA 5DHFA 3GLHA 3U7FB 1UPAA 4U6NA 3QVXA 3O7WA 3GJZA 1SQSA 3U44A 1XMQB 3WXMA 4JGBA 4UKDA 5EXDA 2E1PA 1SCDA 3RIHA 4PYQA 5KYXA 4NG5A 3X1XA 3E6AA 1Z4IA 2F9MA 4WXEA 4LAFA 1SVIA 3KCQA 2XIQA 4IOKA 2O3UA 4GLBA 2WU4A 5DTIA 3V4ZA 4DUPA 2CXRA 3LIIA 1UFQA 1YQTA 1EUQA 4QUHA 3ROGA 5K4GA 2Z4TA 3L1IA 1X86B 3BE4A 1NKSA 3ZU5A 3CVVA 3REGA 4C4RA 5EC8A 3WFZA 1P0IA 4KQGA 3TO5A 1U5AA 2FEMA 1QO0D 1X1CA 1XJ5A 1W1UA 3VR4H 3NJ4A 1N2IA 3NT4A 1T1SA 4MW1A 5DU2A 3WS7A 2JFOA 5TDHA 5CDUA 3AFIA 1YDWA 2YJTD 4OUDB 1ISIA 1M1XB 2CWDA 3F7OA 3F97A 3P9NA 4FQ7A 3E53A 1T3TA 2MYTA 5BN3B 1YS2X 4LDQA 2V7QA 2ZVPX 5IWAB 2I62A 1SN7A 3ENKA 3DMTC 3JQFA 3VOTA 3W5VA 1EDBA 3DLIA 3KZOA 5KJ1A 5BYJA 4UEWA 2PE5A 3ICCA 2ZTVA 4C88A 3SZLA 4DILA 2ZOSA 1XRQA 3AHFA 3P2MA 4MV9A 4CQMB 1JHQA 5UKDA 4L7QA 3DXZA 4EUEA 4Q1FA 3TLCA 2FH5B 4U4AA 1TU3A 4JMPA 4HYQA 4FX5A 2YOGA 3I1JA 1JW9B 2DQSA 1GGVA 2IHVA 5D51S 2IOFA 3OCXA 4NF2A 4RS4A 2BSXA 4K8RB 2J3QA 1WF6A 3VHQA 1BN7A 4RO0A 4AM8A 4D3YA 5I7OA 1RXSA 4DFDA 3NLLA 2FMTA 4CG2A 1QO7A 4EKGA 4ZQIA 1G21B 3N0TA 1B8UA 3KJZA 2PGJA 1QV6A 2IYYA 1FVXA 2QAGA 1F7UA 2FGKA 5IVDA 1LPOA 2OAGA 1QQTA 3AV0B 3V1UA 5JAMA 1LJLA 1FYXA 3I05A 4MX8A 2BZGA 4AJLA 2O8EB 1N6PA 1CUCA 3KJEA 1DXYA 4MNTA 4RGQA 3EW7A 4IGEA 5EI5A 1VA5A 1P81A 1UJ5A 4G09A 5EQTA 3V6MA 4DGSA 1XEWX 1WZUA 2XX3A 4HYYA 4RFSA 3U49A 4BNUA 3I9FA 4LF8B 3F6SA 2JAUA 4JLKA 3C97A 4TUYB 4OI4A 2Z57A 1IXKA 2GZ3A 3STTA 4Q3KA 3S1LA 4Q21A 3P8ZA 4ZZ0A 5C7YA 4OU5A 1VG1A 2HXYA 5C5DA 5FQOA 4Q9DA 1VKHA 3BQ9A 3IOCA 3R9XB 1TO2E 5SY4A 4HAZA 3QLEA 3KL4A 1I0ZA 3M6MD 4AJ1A 1BDBA 1WHTB 2YZ7A 3IUJA 3PNOA 2UUCB 3I5UA 5AKLA 1MD9A 2H5LA 3ETCA 2GZ2A 3DZGA 5CFQA 4EQ6B 1B4DA 4U0KA 2CUTA 3O9VA 3WC4A 2EFYA 4EBFA 1I2AA 1PGNA 2HK6A 2FPSA 3M5PA 4MUXA 3MQ2A 4JJIA 1P74A 2KX7A 2B2CA 4R40A 5J58A 4TMTA 4D44A 5B7QA 4AO8A 4LVNA 3K0CA 2JZNA 1ZM7A 2X3FA 3SNKA 4BQQA 1T9GR 1XMIA 2FMFA 3W8FA 1XZBA 1Z5PA 3H05A 3H13A 1EXVA 2L69A 2BTEA 4FOPA 1A1VA 4QU5A 3IEVA 2MWMA 2HW8A 2GPSA 4UFNA 3DKKA 2HA2A 3RK0A 3PEVA 2L0XA 4CMKA 3CEAA 5LIPA 4NCXA 4UNIA 1NOJA 4H3KB 1NVXQ 1Q14A 1S9DA 5LMCA 1ONBA 5T7BA 3VHXB 3CNQS 3OHSX 2IW1A 1BX3A 1MB4A 1Z13A 5K2MA 3M6FA 3VDXA 3R76A 3QELA 4F60A 4HNAB 5A3VA 1HLDA 5HQJA 2AVNA 3OLQA 4TYPA 5KHAA 1EFPA 3U5TA 1B42A 3HRIA 4MA4A 3U4GA 2FZKA 3PDUA 1EB9A 4LFAB 4EKDA 4RYDA 3EWSA 5BR4A 5AKZA 4JGGA 3P0FA 3ZDDA 2XR1A 3DBRB 5JEEA 2ZWVA 5LUAA 2V0CA 3R7DA 3EXIB 1NAHA 3FF1A 4NQRA 5NLLA 2ONJA 1Q74A 4YAUA 4OJKA 3UJ7A 3WDMA 4HMPA 3BA1A 4CN8A 2D1QA 3D0RA 2AI1A 4P3NA 1Z0JA 4BMSA 2QBYB 3TM5A 3RWBA 1QXSA 2Q2OA 1DI0A 3UV7A 3N8NA 3DGFC 1I4OA 2RCYA 4J1QA 4KAXA 3PNQA 5K0FA 1CDEA 1P62B 3GR6A 3FHTA 5CAEA 4GMFA 3SBEA 3DYVA 3BZWA 3EZNA 5EWLA 1X13A 1D0VA 1PO7A 3O21A 5AK6A 2OD9A 5H16A 3A0UA 3K32A 4G9GA 2ZR7A 3UTDA 1CIPA 4DXHA 1BDJA 2O50A 1TUBA 4XIGS 4DBZA 3P5BA 4E0BA 3LI2A 4BWFB 4BZXA 1P2DA 1FYFA 1ZZEA 5JJBA 5K8LA 4A2WA 1BE6A 2O0JA 3JQQA 4NAHA 4O4LB 5HE8A 4F4FA 1K6IA 2GEDA 2QRKA 1HKHA 5HMMA 2C59A 4KKXB 5FV4A 3QBDA 2PKQP 4DDTA 4UCXA 4IQ4A 4J9VA 2DVMA 1MB0A 1W49A 2IE8A 2QNIA 1ZW6A 2ZYTX 3K9LA 2ZI4A 1P75A 4R0VA 3CF2A 1MG5A 1NC3A 4WLVA 4CTOA 1THZA 4JI4B 2GZRA 3NHSA 3A06A 3BTVA 2EVWX 1EXMA 2Y0CA 3EIEA 4FR0A 4J0QA 4PG4A 1ZJ4A 3I6QA 2LE0A 4M7OA 4OEHA 3SMVA 4K9KA 2HEIA 5H70A 1DJLA 1H94A 2EZ8A 5JEDA 5DV9A 1SHJA 3QVSA 2ZU6A 2P9TA 3U3OA 4ZAXA 2FPKA 4K3UA 3QU5A 4H7FA 2Y1GA 4B9EA 2J3KA 3LPAA 5JISA 1J07A 4LCBA 2EP8A 3D6TB 4EZIA 5BO5A 1RKVA 2FZGA 2ZYDA 3GP3A 4HLQB 4EO4A 5JDCA 2QM7A 4RKRA 3DMHA 4Q4JA 3QP9A 2B69A 4ZVLA 2HDNB 3VO9A 4GLOA 1J1ZA 1G3MA 4G84A 2C58A 4CQMD 1BMFA 1X2BA 3GRVA 4HNRA 3NAQA 2PRKA 4JA2A 5KTRA 4PINA 5K51A 3SLRA 4Y9RA 5FLEX 1NULA 2QK4A 1IH8A 2X4IA 4L0MA 4YN3A 3PXGA 3R9KA 3RVKA 3A2KA 3PD0A 4JT8A 5K45A 3K9GA 1VZ3A 2QNRA 4Y18A 1G5HA 3OPYB 1T1GA 4YRIA 1UK8A 2IXBA 1LXCA 4LJYA 4A6XA 5DYTA 2HV9A 5LPNA 4OGFA 2G28A 2VHCA 2WFLA 3QE0A 1JPNA 2AEFA 4ZQEA 4B17A 1C9DB 3RUCA 3KIPA 1DOZA 2I78A 1AURA 2OMKA 5U4XA 2PMEA 2BGUA 4PCAA 4FEAA 4REQB 4I9GA 2JIOA 2VJNA 4HWSA 4KIUA 3TAXA 3UW3A 4DWVA 5IYZA 4B3MB 1X1AA 1Q0RA 3ZE7A 1IRXA 5LUBA 3TI9A 4AF8A 3AHIA 2VP3A 4HHEA 1UBLS 1BZYA 2B8JA 3HKDA 4OHBA 4ZAVA 2HCRA 2QPAA 4FKBA 3RI3A 2GM4A 4DCUA 1X1SA 1MT3A 1SNYA 2JAHA 3G7UA 3NHYA 2Y4OA 2NU6A 4I50F 5E4FA 1E0AA 4OXXA 3D2LA 3P2KA 3DLTA 4PO1A 3ABZA 3GLFA 5SYMA 1N2HA 1JSRA 2WUWE 3KV3O 2DAPA 1JDBC 2P2ZA 3NATA 1E2QA 2I55A 4QVKA 3BHIA 2VPTA 1K4KA 3ZVNA 4D9GA 3VO1A 3TQRA 1TPYA 3DZFA 3WK8A 3WB0A 1XWFA 1VHWA 3HV2A 5AXAA 2AQHA 3PFKA 2ID9A 2O3SA 1YC5A 4YVFA 5GQSA 2OXFA 1UWKA 2LD4A 3RVPA 2XXAA 2YASA 1VJCA 4XJVA 5LN1A 2G09A 1FB5A 1T8SA 1NT2A 3GP8A 3KKQA 1M2VB 5AHRA 3SHOA 2GUWA 1ENYA 1XRRA 3N0RA 4HCJA 3LH5A 1L4FA 1NONA 2VH1A 2ZQ5A 3GH1A 2DH5A 4JWTA 1RBYA 2RDMA 1VMEA 3ESXA 3FYHA 1M2NA 3NM6B 4PXYA 3FETA 4AURA 4XB6B 4EJFA 3MK31 4X62B 2JIRA 3S5UA 2I3AA 5I6DA 1GFWA 2JZOA 3BMXA 1UKYA 4BAGA 1YH3A 1CZRA 4RSHA 1NPYA 1UPCA 4R1PA 1X8KA 3MN1A 3WRVA 4X1KA 2ZJ7A 1OAOA 3SQDA 2WJ6A 5AM4A 1CXZA 2E55A 4PXSA 4ZOCA 5C18A 1K0UA 4M83A 4BO0A 1QIEA 5KKNB 2DX7A 4P4SB 3B6IA 5GONF 3UAVA 3A9SA 4Q4JB 1ZNYA 3WJ1A 1KJIA 4V3BA 3DO6A 4UASA 2G71A 2VKTA 2B99A 4KXMA 4RZSA 3DKVA 3ZLVA 2P6OA 1ZI8A 3HA5A 3AMVA 4GP7A 4PLPA 1FZQA 4L5BA 5DIZA 2ZE8A 3D2CA 1DV1A 1WRBA 3NMUF 1O96B 5JJLA 3IP3A 4RH1A 2A5DA 2WJZB 1ZR4A 4X6LA 4TKLA 3OZAA 1JQBA 2AFVA 2BMEA 2Z9CA 4BGEA 1N9ZA 1N1GA 4MHTA 3BEOA 1LRJA 3QLVC 2WQZA 3EG5A 1DCMA 3PYMA 1CUBA 3CRW1 5H4GA 1B0PA 2PRSA 3FNBA 2ZIXA 3IE2A 4CM8A 5M5BA 1Z8DA 1C9JA 2YJ5A 5HIMA 1E1QD 3LS2A 4K0RA 5JBQA 1PJSA 1R5JA 4KXFB 4B5LA 5JS8A 2O8CB 4KE9A 4I2NA 1JR3E 4PX5A 3WK6A 3ZI0A 2H48A 3GX1A 3OPXA 4HEHA 1S2OA 2WIGA 2IYEA 1NVUQ 2C5HA 2IDKA 2IVZA 3LP8A 5EE3A 2WTMA 5BSMA 4DM3A 3EFOA 1J06A 1F1JA 1KP3A 1KY3A 2WEKA 1MO4A 4QTXA 2Z1DA 4HDKA 4LHSA 1CBUA 1IBKB 2ZPAA 1SUFA 3FTQA 4O2BF 4D82A 1K7CA 2R47A 4EY6A 1Z2AA 4WZZA 4RV4A 2GESA 1OR8A 2GB4A 4WK0B 4DY6A 1A7UA 1N5OX 2HLDD 2QDXA 4TLMB 2IF2A 3MD0A 4H7DA 5CDHA 3IDSA 1IE3A 1QKIA 2Y68A 5CAEB 4L02A 4A0FA 4ZT2A 5E6UB 1N78A 4BQFA 3GJ6A 2P4HX 4KMMA 4LXIA 2ZJ8A 4ZARA 3V2HA 2I6TA 4RTOA 1WG8A 4URXR 1NBME 2Y1FA 4MA0A 4KUGA 5CDSA 1SUSA 2QBYA 3PSHA 1WB4A 1N8TA 2WM3A 3OEHD 1GQOA 3IERA 3F2VA 3UXMA 2Q27A 1M2KA 5EINA 2BZSA 3TTVA 1OIVA 1XPUA 3OX1A 3DV0A 5I7HA 1FVFA 1S4QA 2PCLA 1KAQA 1VL8A 1NVEA 1TYEB 2IYRA 2ZU0C 4R05A 4AP5A 1VL2A 3QV1A 1JYSA 1RRMA 3WB2A 5IUNC 4IKPA 4ZWNA 4JITA 1JBEA 2YY5A 4E7PA 4EOGA 3HJFA 4WUTA 3P20A 1K88A 5HRUA 2LDBA 3CLTC 5CW2A 1N33B 2IU4A 4MHOA 3EA5A 1L5SA 4QYIB 3LNTA 3N70A 2IOQA 3SHWA 4IOMA 2BFFA 3WXBA 1YC2A 2RKBA 1GUAA 3I64A 3LDAA 4I9NA 4KR0A 3PJGA 4P36A 4MJ3A 5EXTA 3IGFA 3CIOA 3IPXA 3U4DA 2QJWA 2WSLA 3LCCA 4A36A 5HEKA 4V0OA 4B3RB 1FBTA 2QMZA 2R87A 3KYJB 4GMDA 1FYWA 4PLCA 3WWZA 1JNXX 5LA6F 5B2ZA 4NV3A 3WYFA 2HSZA 1E66A 3ESBA 4U5XA 1NM5C 1NYTA 3RFXA 5JCXA 4Q4AA 4BQEA 3B82A 3K70D 2PUAA 2C3UA 1JQKA 1SC1A 4MI1A 1O89A 2RG7A 1N9GA 2DKOA 3K2BA 3U31A 2ACEA 4MR8A 2NO5A 4HUJA 4PZ0A 1MF7A 1TRKA 1XT6A 4OOFA 4Y2GA 3UMVA 4KQKA 3PGXA 1YF3A 1QS0A 3WBFA 2VF7A 1BXRB 1V3TA 3HJTA 4L07A 1FP6A 1J2YA 4X66B 1QGUB 4LHEA 5BWMA 3ITEA 2XSZA 4ARBA 3JQBC 3AR9A 2IWRA 3QLJA 5BW8A 4HGPA 1UXOA 5JYEA 4RD1A 2XE7A 4HWPA 3MCVA 4XWYA 3JALA 1L4NA 1BXZA 3A6EA 5B30A 3GK3A 4LGVA 1G291 1SQ0A 3K1AB 1K86A 2Q49A 2PX4A 4OP2A 2OCAA 2ECKA 1YNSA 5A2QA 3CX6A 2A9RA 1HYBA 3AUUA 1U31A 1A4UA 3JWIA 4I08A 5FWXA 5BQ5A 4D8WA 4UOZA 5JMWA 2IZZA 1JG4A 1B8NA 2WWGA 3OF2A 3THYB 3C6KA 4PS0A 4MYUA 2NSYA 4ZEVA 4MYDA 4V03A 5HDBB 3PC4A 1KOGA 1KGDA 1JFTA 1N2OA 1XQWA 3HYLA 1ZCZA 2GILA 4POOA 2WKRA 4OYYA 3FGOA 5BSWA 4LS3A 3KZVA 4H59A 3HUTA 5FPTA 1XNQB 2B8NA 3G9ZA 1IUNA 1H9BA 5E6RA 1OSNA 5B3KA 2FG7C 3UHAA 5JZBA 4S1VA 2Q99A 3DULA 4CZ2A 1V16A 4JR1A 1ECCA 1TZJA 3OZSA 2VHXA 2YRWA 1LBSA 5H0IA 4EAQA 5AMXA 1XTUA 1J1UA 5KIAA 3NDJA 1AA6A 2HDOA 5KYWA 1XCLA 3IT2A 1BS9A 1F0PA 2V6IA 1Z08A 2RHWA 1VKOA 2HUPA 1ICEA 1S3GA 4GFDA 4KB5A 4RU1A 3BK1A 5E6SA 2O2GA 2QPTA 3HJBA 2Q3EA 4TS3A 4N5IX 1I6LA 5JSFA 4S0XA 3O8DA 4RF5A 4ZVSA 3JZAA 4DQ0A 2VDMB 3HM2A 3TW8A 3U7GA 4QUJA 3T7TA 2R6JA 2Z6UA 2F1IA 2J07A 4URWR 1R9NA 2EFHB 2X5XA 3KU4A 3BMCA 1YTLA 4MUEA 2YL2A 4LX8A 2IPNA 5CD9A 1HEYA 1G8FA 2CKMA 4XJXA 1I7LA 2D1FA 1HOTA 1CY4A 3GIDA 2E85A 3H9UA 1PEYA 1GP2A 2FMIA 4M0PA 3V3KA 4P35A 1C7QA 1ACMA 3ZKAA 3GO4A 4IV0A 1H3NA 3G2LA 2JHPA 1KYTA 1H65A 3AEKA 4P31A 1B0ZA 1CS0A 1NF2A 5DHTA 1NVWQ 4BVHA 2CLFB 3MWFA 1KIMA 3LY8A 2DG2A 1GGMA 1VOTA 4R68A 5DW0A 3HLKA 3S2ZA 5DF1A 5AKHA 1YE8A 3TIXB 3K6SB 2PYIA 1N5IA 2REQA 3L9XA 1X1BA 3PTZA 1G38A 2I6GA 3LHSA 4E31A 3LBIA 2Q6LA 1YQEA 2QG4A 3I9JA 2RFLA 4TVOA 5ALFA 3TW6A 2WJVA 3EQ6A 4IH1A 1XDWA 3AVUA 2QVLA 2VWQA 2OESA 3P2IA 3RR2A 3BWVA 2FN9A 2ZRNA 3L40A 1GL3A 5IF3A 4TWAA 4LHZA 3A1DA 3CLSD 4K9LA 3FM9A 4IV8A 4EAAA 2WYIA 1MU0A 1BE1A 1FU4A 1K7XB 2DWOA 2AN3A 2G9NA 4BP3A 1YHYA 1MGOA 1N3LA 2I71A 4K81B 2O0LA 4OIFA 3J81A 3EZLA 4XGIA 5JZVA 2GRUA 4H7IA 3ZDXB 4RMHA 4AW9A 5IAAA 1GA1A 2PSEA 2B92A 4ZKDA 1U9ZA 4JVSB 3Q3HA 5LXTA 4DW8A 2QGFA 3NHRA 4H08A 1V0JA 3SOPA 3F6RA 2DWUA 2HCTA 2I3ZA 2VSFA 2WTEA 5EMJA 2ORED 2ZB4A 4IXMA 1UJ6A 1OYVA 2KS6A 2P2GA 2ZJ3A 1ORIA 4R69A 3TTYA 5IVPA 3AI7A 3R7WA 1DCTA 1E18A 1PR5A 3GFPA 1CNEA 2PJDA 1MH9A 4EYOA 1ZY2A 1H3FA 3UXEA 3E9RA 3TUZC 3DMGA 5IANA 3THXB 2V7WA 4O63O 3SJ7A 3JWHA 2XMCA 1JU9A 2H51A 1LUAA 4IHKA 4MV6A 4QBTA 5HQTA 3OURA 1EX6A 4ZCQA 4MARA 2BWJA 4KO3S 4MS3B 5AOAA 3IBGA 2ATXA 2VUIB 2FUKA 3KHKA 2ZTUA 4H1VA 4JSYA 4LC0A 5EKUA 2IV3A 3IPCA 1GUYA 4Q39A 3OZFA 3VTFA 1XELA 5FOUA 1KMHA 2NAPA 1ZNWA 2PRZA 3OMWA 1N6IA 1H2WA 2NU9A 1W88B 3LFHA 4PNZA 4CNQA 5B64A 3NCHA 4KQIA 3LW8A 3D5TA 5TQJA 5GMOA 2I8LA 5C4MA 3LZCA 1IN6A 3IAS6 5IJXA 3KPJA 3A26A 1RABA 4INPA 2P0AA 2QAJA 1K08A 4FOTA 1ORTA 1TF7A 2FJPA 5FI1B 2NX2A 3KPWA 4D97A 3TUJC 3KOUA 5C81A 3NOQA 5CFPA 3SS7X 1KDZA 2W2LA 1K7SN 1YFKA 3SQNA 1MO6A 3PK0A 4MV5A 4P7FA 1W93A 4G1CA 4WCFA 1E9AA 2ZIGA 1OPXA 2DQKA 3HHPA 2NLOA 1I13A 4QSHA 1FNDA 2I5PO 1Y7PA 2X4LA 2YNMD 2Q5CA 1IBSA 1NW6A 3VNVA 1MX3A 3QE4A 3D02A 3JQGA 2QTVA 4UAJA 2PS9A 4KWHA 2HGZA 1FNBA 2RJ3A 1US8B 1Q2XA 1C4WA 2XUPA 4OK6A 3OKAA 5D3QA 4OQLA 2PGDA 4DZRA 1X7XA 2VDNB 2C57A 2EKLA 4EW1A 1PR3A 2IEGA 3NUGA 1Z4MA 4M98A 3GHHA 3OJLA 1ACLA 3VR1A 2NQ2C 2YVKA 1ZQ9A 1HDOA 3CUWA 3GQVA 5EQJB 2OXCA 4P7GA 1M5RA 3MCUA 4MGEA 2A67A 1VKRA 4HUQA 1X7ZB 3ITNA 4BBPA 4DWJA 5FJJA 3QFTA 5EFOA 3PDWA 3BWDD 3UGQA 5IC5A 1AQUA 1ICIA 3BFPA 1XXHE 2G07A 1TZKA 2Y1EA 1D1QA 5EG5A 1UT8A 5FX2A 1F4LA 1HT2E 1JR3A 3AJ9A 3I2FA 4RA6A 1DBWA 4NZPA 1N1EA 4XUDA 4KQ2A 4PLZA 4R16A 4PZPA 2UYCA 4GLJA 3DH0A 4MUJA 3T95A 4JLDA 4P7KA 2WUGA 4MB2A 2XY4A 4S3MA 4BTLA 4ZZ1A 4YJFB 3VJMA 4XVCA 2FP3A 2QN6A 3A4IA 3TMYA 3TS1A 5EHZA 2IE0A 1BO6A 2JFPA 4K9SA 2OV4A 1MO5A 3QU9A 2AN1A 2ZRHA 3FN4A 1Q84A 3G1UA 2FHSA 5KTSA 1CVLA 1XTVA 2B1IA 3AEQA 4WNYA 3TD6A 1FFGA 3CCFA 3C8UA 1PFKA 2GLTA 1GPAA 3MJTA 3N5CA 5DTQA 5GONA 5T5QA 2NUAB 1YS1X 4KBYA 4LJAA 3TW0A 2ZBDA 3NEYA 4KDRA 4DVJA 3F5QA 4GOXA 1ZBDA 1HTTA 1BVUA 3VKUA 1YS4A 2QR3A 3PJRA 4H77A 1XHEA 1U1FA 3AEUA 5DSTA 5AH0A 1RC0A 2O23A 1OLUB 1AQLA 5JMOA 2GCNA 4FXPA 4ZEWA 1N9GB 3OSUA 3EZ6A 2A14A 2VP6A 3EA4A 3Q9UA 2FF7A 3R3YA 1CS4C 2B5OA 4RK6A 4U3JA 3DT8A 4FEEA 1TVEA 5AOVA 4M1KA 3UA3A 5H1YA 3L0YA 2JEYA 3D54D 5HYVA 1DX4A 2PGIA 4NX2A 4N6OA 2Y0PA 1A4RA 1KDVA 3WWYA 3DONA 2GF9A 1VSUA 1Y3CE 2W00A 4CXMA 5DOVA 3RVOA 4MWOA 1E98A 4WJZA 4NCBA 4TZ0A 1G42A 1AH2A 3GPIA 5JIBA 4KHZA 3I45A 1JDJA 3TXAA 4DVGA 4R8SA 4RY0A 4YO8A 3G3EA 2JBAB 4PYNA 1USKA 3H1AA 3ND6A 2PKEA 2CK3A 2QNBA 4TT3D 2O7QA 1RKQA 3LYLA 1AUVA 3PGVA 3W5IA 4AY5A 2GFHA 3NTUA 4UNQA 1PT5A 3C2QA 4M0FA 4CJXA 1X7WB 4FLFA 4FSXA 3HDVA 1A50B 4I5EA 2QG9A 3DTYA 5K3OA 2WVJA 3K0BA 4M54A 2DFKB 1PJQA 1VE9A 1AGYA 2NYUA 2FW7A 5AJWA 5FI5A 3VC2A 2JGNA 2OCXA 2OCIA 1RC1A 1NQVA 1YSCA 4Q16A 2PL5A 3K0KA 2IDMA 4OGKA 5KWEA 1P6QA 1OZFA 4CN9A 2WSSD 3NRBA 3PITA 3BFXA 3PR1A 4EJ0A 3LF1A 2HH9A 5ALVA 3QG5A 4JBWA 4XPZA 1ZLXA 2ZP1A 2R6FA 1TADA 4KQHA 4N8SA 4N47A 5JOQA 2G70A 2W2XA 3KSDO 5TARA 4LOAA 4KWTA 4M9XA 1KYIA 4KN9S 1Z17A 4CL0A 1S2LA 4TKVA 3BWXA 1M2JA 4Q15A 1PJTA 2A86A 4OKNA 1E4EB 1SELA 3DDUA 3O75A 3W9UA 3BXXA 3ADDA 1L7RA 3EPKA 1I7PA 2XZLA 5ADHA 5BV1A 3ZVMA 2J4DA 1VFPA 1TJ5A 5A71A 4EVSA 5KS2A 3GXBA 1EJBA 1V5WA 1YQGA 2P9QA 3GRRA 3OLWA 4WASA 4MYRA 2ZBFA 5EJMA 4AWXA 1JTEA 1R18A 3EMBA 3RNLA 4MW2A 4XPIA 2DRIA 1SQFA 1TM5E 1G3QA 4WKBA 5G2OA 4R9NA 1DELA 5DYNA 3OF3A 2LCIA 4IDNA 1JU3A 2QR2A 2R79A 2R8EA 2M32A 3T9DA 2V6BA 3SXJA 1W87A 1QKKA 4GI5A 2J9YB 1GZ4A 4HS4A 3V80A 3FGZA 4HEA1 3CE9A 4QRHA 2VNJA 1KWKA 2VTBB 2IYTA 2L19A 4RK7A 4Z4FA 1C9YA 5K2OA 4YJHA 3L18A 2D1YA 3WWOA 2P5YA 5HHTA 2R6CA 2ZYVX 1SKYE 1KJZA 3H2GA 1T1RA 4FBMA 4RS3A 3UB2A 3JAMA 1SOVA 1QAOA 3ESCA 4RKQA 1G7RA 5CX4A 5ITZA 5EJ4A 3DB1A 2XD9A 3NIFB 4EJSC 1BMTA 2AUMA 3JATA 2BUBA 3IAM6 3W0LB 4HYEA 4CQLA 5LOVA 2Z2XA 1UBCA 2RIRA 3K9CA 4KAAA 1FUUA 2HQSA 3CKMA 5FI0B 5MN6A 1IG3A 1KK0A 1YIAA 5A4MS 1DAFA 1V16B 5GVSA 3F8SA 5BSUA 1YGPA 4WOPA 2OYRA 2EW8A 3AM5A 2AOUB 3IJEB 4FGZA 4E1AA 4RD6A 5K1ZA 3MTBA 1EX7A 4P54A 1HPLA 1P5ZB 2Y1XA 3COVA 4J0HA 1OI4A 4PQEA 3I3SR 4K03A 1USGA 2JCVA 3HR4A 1U1CA 4WTOA 5T4FA 3CZQA 3U9SA 2B8TA 2GYVA 3NYIA 1TJ4A 1BTOA 2FUNB 3NBZC 2POQX 4KFRA 7AT1A 1MRSA 4NQZA 4CM4A 1T9HA 1ZIOA 4L8GA 3TZHA 3E5RA 4CKEA 4EGFA 1OZHA 3SQXA 3F90A 1GHTA 1MXHA 2DJIA 3I2IA 2PWBA 3CX4A 5CMLA 4KPUB 4Q1EA 1I01A 3UK0A 4E4RA 2FX3A 2PXAA 5FL7A 4C1NA 4DDKA 1E69A 5AVYA 3ZZ1A 1Y5LA 2QPLA 3FSEA 4Q6WA 4K05A 2FE1A 3MTQA 2QUAA 4TSKA 1XJ0A 1T2AA 3HYRA 5AHXA 1DTEA 2MSLA 5I4CA 3VNUA 5ADUS 2OB1A 2EP7A 2KHZA 3ADCA 1UJNA 4KV9A 3RUFA 3F1LA 3OQ6A 1U0GA 1C7FA 2A94A 2VZ0A 4CV2A 4LY9A 2EFGA 4B0OA 3GEPA 4RHYA 1G8YA 1VE3A 2H1LA 4MVJG 1XDUA 1M8GA 2BEUB 4MEBA 4LYEA 3GVHA 3K6JA 3TPCA 3B6JA 1YR1A 4B8YA 4JYMA 5FLYA 3WZMA 4LJ6A 4C4TA 4YRZA 1E3MA 2HJ9A 1A9XA 1T5OA 1SU7A 3PC3A 3SOZA 3CVWA 1CNFA 4YMHA 2AX3A 1BJKA 5DIFA 4GICA 2I66A 3DD1A 4PTLA 1U98A 1JJVA 1U2ZA 2OFPA 1GEGA 1DXOA 1XHFA 2PZBA 3JRWA 4M9SA 4WY2A 1Z4OA 4KNWA 1NN0A 2EBHX 4GKAA 4JOQA 3AHCA 1M6VB 2GN0A 2P4QA 4L5IA 5BURA 1MORA 4EVQA 1MNAA 1AHIA 5SICE 1PFUA 3C8MA 1J70A 1SCUB 5ECWA 4Z53A 1QS0B 4D4JA 1XEWY 5ICMA 2XLBA 2I3DA 1TTPB 3LC7O 1COWA 1NQUA 4HC4A 2C7RA 1G2PA 5DHPA 2G1JA 3RTGA 4L4RA 3AF6A 1BDMA 16PKA 3LL7A 1E3IA 1RWPA 3LOQA 5IVHA 3E8SA 3EXG1 4MKXA 4F1JA 1I6MA 3NGLA 2QL5A 2X0DA 3BF8A 2W22A 4GI7A 1YI0A 5EPUA 1RPAA 4PR3A 4J07A 4K1XA 3MJRA 1GNLA 2X42A 5ITZB 1DRJA 4L8VA 2IPXA 4E5VA 3PNLA 4M0CA 3SEZA 1E99A 3KD3A 4X71A 3SR4A 5KQLA 4EPVA 4I4NA 4GZ5A 2PMBA 1MJGA 3O8OB 4XFJA 5TT0A 3OCWA 2FDCA 1MXFA 3OMLA 3T9CA 2CMHA 4AJEA 1JFVA 1MC8A 3FOAA 2VHQA 4LNHA 3LCMA 5B37A 1D3AA 2Q6IA 3FKSD 4EEXA 5FBWB 4UDYX 3HKBA 3T1TA 1KMMA 3FWKA 2DFDA 1SFRA 4BVJA 1ZM3A 4DLTA 2XNHA 4LBYA 5IF9A 5EKTA 4H7EA 4MEAA 2JA1A 4XE5A 4J0FA 3RS5A 2M6LA 4DG5A 1E79A 1GGFA 5FH9A 4PAWA 1H93A 2B4KA 3BQNB 1PBTA 1WWKA 2R7MA 4HPJB 3ZK7A 4RD0A 1FPQA 2PFKA 2CHFA 3L8HA 4O4HB 2FW1A 2O5VA 3STYA 4B3JA 1F2DA 3LQ2A 4K8OA 1GTG1 1NXXA 1O9BA 2XHZA 2YVAA 3L8EA 4NDZA 2QTMA 4XI9A 3WO0A 3M6VA 4ZI3A 2J3HA 2YZ2A 2GMWA 3AINA 5JAOA 4H4DA 3KVNA 2ZDQA 3EVBA 2R84A 3EC2A 1KRWA 4E2WA 1MJFA 3UK6A 2I0FA 2LW7A 3S44A 1T8RA 3OD1A 5HJ7A 3NOXA 3B6EA 2NZ2A 4QPZA 3DAPA 1SIUA 1VDMA 4L5JA 1H5UA 5JD3A 2EJTA 3HJAA 4MHSA 3UUEA 1E9FA 1N3IA 2V6GA 2QLTA 3WA6A 1SXJB 2D5CA 3TL3A 1Y3HA 1QIHA 2XKBA 3B38A 3T8YA 1XNRB 2FLWA 2JEOA 3IAXA 3KQQA 3B9PA 5ESDA 2R7NA 2WFZA 1XNJA 2V7PA 1UIRA 2OV8A 3D31A 4OK3A 1PNRA 3KTAA 1IZ9A 3IIEA 2F17A 1OBOA 1H1TA 5K6RA 3X3HA 1MAWA 2YQ5A 1CRPA 2A5JA 3W3AH 2BEJA 2AB0A 3L4SO 2A7QA 3LX8A 4JL8A 3FR7A 1ZGZA 3LO8A 2VATA 1ZK2A 3EGVA 3OBIA 4H7JA 1ZD8A 5ALSA 3GLRA 3MMNA 4KXWA 2IYFA 2QSJA 3TMAA 5JWRA 3IXQA 1SXJE 2ZTLA 4TQAA 3CPSA 3A6DA 4GWGA 3RYTC 1JYFA 1P0FA 2P5SA 3QK7A 4XUGB 4R83A 4E94A 5JWHA 3PDHA 3Q2KA 1O03A 4D74A 5KHLB 3SZ3A 3BXGA 4U3JB 1YJBA 4XFDA 2N1BA 3ONEA 1J0DA 2RK4A 3JVEA 3NYWA 5FT9A 3TLXA 3ZBQA 4MQ6A 4DYHA 4CF7A 2IIBA 1QLWA 4P3XA 3VR5D 1T5LA 2FJ0A 3P9IA 2RH4A 3F3YA 3AEUB 3QUAA 1V95A 4F92B 3G1WA 1K68A 1YL5A 3GMIA 5C8VA 3KT8A 5F2NA 4UARA 3FI0A 5GJWC 4HNAA 2X5NA 3TZBA 3O84A 2O8FB 4AZWA 1DIRA 1R5BA 3L7DA 4RV5A 4PSKA 3FHCB 1V1RA 3RHZA 1YR6A 2WHEA 1WLYA 1YBFA 4X6XA 4DUGA 2DETA 5E4YA 4PWYA 2X0KA 2JLUA 3M8KA 3CGGA 2WSMA 1ZN7A 2R6R1 1SC4A 1Q7RA 4HDAA 2C0PA 4S0ZA 3R9WA 1XAHA 4EGJA 4FOSA 4XQ9A 4MR9A 4D45A 3CB4A 1OUMA 1QHIA 2FRDA 4US1R 1HKUA 4DUYB 5IVKA 4EPRA 4YJKA 1EVQA 2QZ9A 5LMNB 2BKUA 3QW2A 1ZOSA 1K5PA 1KBQA 1MX1A 4GGMX 1MQAA 1Q1EA 1TKRA 5CFZA 3U7QA 1M2VA 4RA6B 1AMUA 4EMSA 5IYZB 4CDNA 1DBRA 4C07A 1TZCA 2IHKA 3TOZA 5KWJA 1HURA 1OAAA 4FPXA 2ZDGA 4DRYA 4G01B 5F7ZA 1GYQA 1IBRA 1M8FA 1XU4A 4IICA 3I28A 2VBCA 4ILEA 1A9PA 3D0QA 2BHNA 3VZRA 1K6JA 5CA0B 1J22A 1GU0A 1Q11A 2FE4A 3NWEA 1TQ8A 4XM0A 1W6UA 2AD1A 4ZCPA 1KFCB 4FZ3A 1UBUS 3VYSB 4ALNA 3A05A 4OV6B 3EDCA 1UC8A 2BCJQ 1P72A 4E5NA 3FYDA 5AJYA 4N9WA 2EHJA 2J5KA 2QP9X 1JYEA 3ZV4A 4HLUA 1JIUA 3D8RA 1M34B 4NONA 1AV6A 3JYHA 1SVLA 5FWYB 3OQMA 1M1NA 2O2JA 2ESRA 4FJ1A 1QH9A 2PEYA 4J1SA 3U1TA 4K9RA 3PUVA 1T34A 2R8ZA 3DL0A 1G6OA 3PIDA 5EQFA 5JASA 1IY0A 3LGXA 1PR9A 3AC0A 2BKAA 1OH5A 2X6RA 5HZMA 4INZA 1YR3A 1Z8HA 3OETA 2R66A 4E2XA 3L02A 4XDGA 5LOVB 2O07A 1U2PA 5F2EA 3E5NA 4CQLB 5DHUA 3JY6A 2R5FA 3EGOA 1Y3DE 4QODA 3H17A 2AI3A 2VJBA 3R6WA 521PA 4JJGA 3SYNA 2JL1A 4FUQA 4MW9A 2VDKB 1JDVA 2I1VB 4ARAA 4PG8A 4YUYA 3T0GA 2UUAB 3VKHA 3KKZA 1XA4A 3RSLA 2Q0QA 8LDHA 4N0MA 2XXBA 3OZEA 1K3UB 4FR5A 4HN9A 3ZV5A 3STVA 4RZ2A 1TVMA 3DKPA 2EQAA 2RGEA 4HJXA 4M9UA 4MYSA 5LLDA 1CDDA 3B3JA 1IC6A 5IYZF 2ZVQX 4M1QA 4MI9A 3CH4B 1BOFA 3KFXA 3H83A 5AJXA 4LE1A 3RWMB 2OGWA 4ATNA 3CTMA 4EGQA 2BI8A 5KDOA 2XOXA 2P8SA 3G89A 4I46A 2DTDA 1N8KA 3HRHA 1O2DA 4EX7A 2DULA 1LS6A 3CCBA 3MVEA 3R6TA 3C3KA 1UDAA 2LP4Y 3MRTA 3J80A 3D7MA 2JLZA 2Z8YM 2LV8A 2NZWA 3VH4A 1BWQA 2CDAA 2OCBA 4R2JA 5ER9A 2H5EA 2J0UA 3L7NA 1W94A 4TV8B 3B3FA 4X7PA 5K0GA 1FNNA 5GVRA 3SF8A 1OAKA 4JWKA 3S68A 1JG2A 2VBGA 3MCWA 4RQBA 5IJ9A 1D9XA 3GZTB 1B2RA 4P0TA 1NJ5A 2JS7A 5EL0A 2PWAA 4WUVA 2H0RA 3VGPA 1K27A 2BGKA 4B76A 4YC7A 1AK1A 4POAA 2C8JA 2FPGA 1RBZA 2DP4E 4ML3A 5EMNA 2FEXA 1ZK1A 2N3ZA 1JAZA 2XA9A 3C1AA 3NDPA 4RIGA 3S8YA 1BAPA 4QQRA 2YCLA 1RHRA 1KYWA 4E51A 2CY0A 2QIPA 4E08A 4O8CA 4QPNA 3KWJA 1P7CA 2J87A 4W7HA 5AXBA 1GGNA 5ALDA 3MJFA 2R00A 3WGJA 2IKSA 3W2GA 2N1MA 2Q4RA 3GA5A 2FZ4A 3UMBA 1SCAA 1FE8A 4KO2S 4L08A 4BP9A 4ZAWA 3KJIA 4DBLC 1GWNA 1X7YB 4MLCA 1ZMTA 2QTNA 1G1AA 4HDNB 1PK8A 4EGCB 1RVV1 5F5NA 4B84A 3DPSA 2Z9DA 2FG6C 3WR5A 1FDRA 5C7OO 4FCTA 4N6NA 4GMHA 2NV2B 2P35A 4R9RA 4BNDB 3RS7A 4BU1A 4X1IA 5K9ZA 1T4BA 2WA2A 3KELA 2IU3A 1ATIA 2IU6A 5I7RA 1NTRA 4DANA 3FFWA 3SLGA 2VDVE 4TSRA 3GT4A 3PI7A 2WMDA 1RADA 2Q1SA 5K03A 5E7QA 1JE0A 1V5EA 2YHIB 3NFYA 3PHIA 2HMWA 3FBWA 4LWZA 1S1MA 2XMBA 1CJKC 3AB7A 3EZXA 5KPDA 1YTUA 1W4CA 5H3LA 1Z34A 1ODLA 4HDMA 1XVIA 3RS0A 4KITB 5K20A 4K1LA 1DUIA 1FNSA 1QR2A 2FA9A 2XOKA 1PEAA 1ZUD1 4X8OA 5ECYA 4YP1A 3PUJA 3SJAA 2JAQA 4AIRA 2OY0A 4X0EA 2M6SA 2JKVA 1SKYB 4CMEA 2YWGA 4WK6A 4M8NE 3NC4A 3V2IA 4UNRA 3ND5A 5FR1A 1XZDA 2I2BA 3WMFA 4C0WA 1XCOA 1L8LA 2W8BB 1BQEA 2YJ6A 3N8HA 1U3GA 4UM7A 1X6VA 5FTKA 5KTYA 1J00A 4PZDA 1TNDA 2I1WA 5JNTA 1XAIA 1C3EA 2HB6A 2IP4A 5HVNA 3PX7A 3GCWA 3HXMA 3BS4A 1UOOA 3KFVA 2WF7A 2ZAOA 2VEDA 1P9RA 3BD8A 3HXOA 1NZDA 1KRHA 3CVJA 3PNSA 1RCFA 2C03A 2PEZA 3D6JA 2O8VA 3EBPA 3VJLA 1XJCA 4BC0A 3Q9LA 1V9CA 4BX3A 3AZOA 2ZBEA 1U65A 3D7RA 4IDPA 4ECEA 1DPGA 4MGKR 2NXCA 4KW7A 2YOHA 2FN7A 1NSFA 4BOYA 4URVR 3U16A 2YZNA 1MTZA 2UZIR 1XMXA 1IHDA 1NV8A 4FKZA 2DZDA 3JQ9A 4RE5A 3WQHA 2AN4A 3K16A 1F5SA 4MLPA 5AM5A 3KB8A 4NJOA 1A5SB 4XVHA 4BV3A 5I3ZA 4BVGA 4WN9A 1BDIA 4CFSA 1W5EA 2FR1A 3LDGA 3DE4X 1UBGA 4HRXA 4RMIA 4BQRA 2WWWA 4F6CA 1PG0A 3NJRA 4WLEA 2O4CA 1PZHA 5CFMA 3BCSA 1Y80A 4URHA 1FXWF 1M73E 1NF9A 1WW3A 1A2BA 1MPXA 2HIAA 4PHCA 1C3OA 3QVTA 4WOKA 3RAFC 3Q8KA 2PUGA 3EVTA 1ZH8A 1BGVA 5IT0A 4ZTZB 1NYLA 3NHJA 5CTAA 4GR9A 1RPJA 5JFOA 3O92A 2JHAA 5IMSA 4RHFA 2QRLA 4ZZIA 4R2MA 4LF7B 1OT5A 4UEKA 3FSGD 4EX6A 4YT4A 1NVAA 2YR0A 1Z37A 2F6RA 5EHIA 3BMNA 4OFBA 2EGHA 2JCYA 1UT6A 4OBWA 3TI7A 3JD4A 3AL2A 2P9BA 2K4MA 2Q5HA 1PT8A 3FLAA 1ZQ1A 2FKAA 3FNGA 5F35A 3SU8A 4J2TA 3DL2A 5E7IA 3OCZA 1WS6A 3QOXA 5FA6A 3HEAA 4DB4A 1E77A 1P4GA 2Y6VA 1CUIA 1UJBA 2IRWA 4YXWD 1DKUA 4Z1OA 4H0CA 1E7WA 2QB5A 1VE6A 2R6AA 1X74A 1VLJA 3CLHA 1C2TA 3I4LA 4C03A 4GEKA 3U19A 1QYWA 4U02A 1V9LA 1UC5B 1N0HA 2WUFA 4ZXFA 3TTSA 1AKVA 4MS3A 1MZPA 1LC3A 3IMEA 2GZSA 3PLAE 2GZHA 4KXLA 1NMSA 1SPXA 2OK7A 3IMGA 2CGEA 2DF8A 1TUEA 1Q91A 1VB3A 4QDJA 3VR4A 4EG5A 1MLDA 4HADA 3C85A 2O54A 4ITRC 4O4JB 1BFKA 2M1XA 4RHCA 3U0VA 1VJGA 3IPLA 2OCGA 1NBOA 3C70A 1IB6A 1WMBA 2NZYA 4QUKA 4EY3A 3DV0B 1V6CA 3KPUA 3A6HA 4X65B 1SQGA 4HNTA 2VYND 3HDHA 2PS3A 3CPJB 1KXJA 2QZSA 2QLMA 1ZMBA 2G5TA 4UOQA 3QWHA 2IZ7A 2I4TA 1DT5A 4FFDA 4O4JF 5A4AA 2Y0DA 4IR7A 3CKKA 2A4MA 3DVQX 4L3VA 4GD3Q 4YRRA 1DC5A 3H5TA 2AG1A 2QTGA 2P6MA 2HI0A 1YASA 4QTZA 5E6UA 1U0JA 4S2UA 2ENUA 2X7XA 4QAQA 2ZJ6A 1SXJC 2EKQA 4O2AF 5A0FA 1A2KC 5HQ3A 5DNCA 5J1TB 4FOOA 2VT3A 1BCSB 1S2MA 1E9BA 1HZJA 3H5AA 1S2NA 5L4NA 1K6XA 3F98A 2AZ4A 3SI7A 2E1RA 4Z2YA 3QYJA 4QTUB 3KG2A 3QVVA 3SGLA 1F2TB 4OAPA 2RHRA 4QQ8A 4AIIA 5KYXB 5T8KA 1U2SA 3F6CA 2C61A 3QVGB 5JRZA 1ORDA 4HMQA 4I5FA 3K0FB 1V4BA 2A2ZA 2PRJA 4IIBA 3TE6A 3ZE0B 5HGXA 1WP4A 5KNDD 3QFRA 1ADYA 3FJ1A 3H2YA 4OO3A 1U4NA 3WGNA 1UDXA 2AN9A 3EGIA 2J3MA 4C05A 5KTPA 1N6OA 1U4OA 1CUZA 5BV7A 3ICPA 2C4UA 1T9CA 2WTBA 5BUZA 5EHXA 2O7SA 3TLZA 3H16A 4DR6B 1AHNA 1XRLA 5TQ2B 3HZZA 3OEEA 3SHFA 1SXQA 1DWQA 2H1IA 1RLIA 2IBMA 4GOMD 3GDWA 3JVIA 4LUCA 5CT5A 5K6TA 4Z7QB 4CIBA 1WMEA 1X1EA 3M6WA 3G0HA 1PW5A 3GXOA 4DCVA 3W3AD 3R4VA 1RZRA 5DNVA 1YQDA 5HUQA 3IQWA 1XO1A 5F21A 1EVKA 2G08A 4WAUA 1DADA 3EARA 3PU6A 3S81A 2ZBUA 5M04A 1EFTA 2K7ZA 3BTUA 4DSAA 1E3DA 1JVSA 2HM7A 2LVBA 3IV9A 4ZMRA 3OE4A 1NLUA 4QBKA 4HTAA 4AP9A 5JTUA 3C7DB 2HMUA 5FEUA 2VRBA 2H2HA 5DKFA 5KVAA 3LT2A 4S1NA 4TS4A 1NVGA 4P80A 2Y93A 3HVRA 3IVXA 4B43A 3WA7A 5F9FA 3SDBA 1L4UA 4FFBA 4TM8A 4B2PA 2WU0A 4FM9A 1F3OA 2BHTA 1QM5A 4JLOA 5EXSA 4J3FA 2ZUSA 1SMKA 2XDWA 3B6ZA 4JZYA 3IP5A 4C78A 4BFYA 4AS3A 3KPYA 3RCBA 1C2YA 2O06A 3DBLB 1ZJZA 1SBNE 1JT9A 4RL6A 5AQEA 1NNEA 2W2OA 1QDEA 3A2LA 3RVRA 1ABBA 2ZM6B 3IFSA 2M2IA 2C88A 2HYIC 3UWKA 2X9VA 3OMXA 5DTMA 4RKYA 1CJMA 5LOVF 2GJAA 3BT7A 3FCXA 3ASUA 1D03A 1SG0A 4ZN6A 4BQIA 1FJXA 1U9IC 1RMQA 1RS0A 2GCGA 1KAGA 2AG8A 3BH6A 3MRXA 4GMKA 4TL7A 5DI3B 3UW1A 4DSNA 3PXXA 2CF6A 2ZS9A 2RK3A 2VA9A 2CV1A 4DV6B 3OEED 1LNQA 3UO8B 2VAXA 3CSUA 2TSYB 3T12A 1NRXA 4X00A 4QFMA 1NPDA 1E1YA 4PWZA 4UEJA 5ALXA 4AZ0A 4LC1A 1W7AA 2I9KA 4RXUA 1UMBA 2OVFA 2CLCX 2VP5A 4MWBA 2ORIA 3M9XA 3SYMA 4DJTA 3QUCA 3GJ4A 1LV7A 3JALB 1WBBA 1P7PA 2IS2A 4DR2B 5JDIA 3PVZA 2PUCA 4K26A 4OCZA 3DQPA 2HRRA 1J56A 5HJ2A 4QSMA 1FL9A 4TMXA 3WTBA 1IM5A 3GOHA 1E1RA 2VK8A 3CF6R 1SBCA 4LSZA 4CF4A 2XNDA 1F6BA 1N5RA 4P4NA 4UDXX 3TE7A 3AIKA 2QT0A 5LQMA 4YAJA 4EI9A 1MVOA 2XCQA 2QD3A 1QH0A 4YASA 5KYYB 1V4VA 5ADVA 1Z7YA 1B76A 1VLMA 3GQBA 1FDWA 1OX4A 7MDHA 4KSYA 1A77A 1JUDA 2UVPA 1K66A 1OA1A 3FDZB 4NHOA 4NBTA 3RVDA 4TXHA 1PWYE 8OHMA 3FB1A 5ITVA 5TC4A 4C14A 4QXAA 4PXAA 2PIAA 5ENDA 3OPYA 5F5XA 1Z38A 2HY7A 3B5EA 3GFTA 4BJ5A 4IUCS 1MO3A 4P6VF 3CT6A 2D2VA 3FSGA 4RXMA 4M3NA 4UQPA 5EESA 3M6IA 5ALZA 4WBSA 3AESB 1KI6A 2OZPA 4M0KA 1KSHA 3RO7A 4EY5A 4MRSA 1G4HA 1HMYA 5I9BA 4ND7A 1JTVA 3KWFA 3IHTA 5J2UF 3UICA 3F8TA 4G0PA 4Y1RB 3RRFA 3LRXA 5TJHA 4L6AA 1PIWA 2OGTA 4B33A 1SBHA 4YMWA 3PICA 1KJJA 2BBSA 1DKLA 2O6HA 3BHNA 1HNZB 3PL1A 3HL4A 1P5FA 2I7TA 3NRJA 1ZHOA 1L8QA 2FK8A 5AJUA 3KXLA 2BFEA 1BXKA 1NGSA 3PE4A 3KR9A 4I5IA 2R8XA 4Q3DA 2NZJA 3MTEA 4HX5A 5AIAA 3HO8A 4XLTA 4P2BA 1KQOA 1J9ZA 1HQYE 4DAOA 2ERYA 2HQ1A 4DA4A 3BH0A 2NUAA 2IV7A 3S7ZA 1P2GA 1M66A 4EYQA 5TNXA 1F8GA 1L7PA 3LHKA 4NOJA 2CWWA 4N82A 2IYXA 4D8UA 1EIZA 3H7AA 3WL8A 4DOMA 2IXTA 1XJQA 2OPHA 3V3TA 3ZQUA 2H4XA 4IL5A 5C8DA 3M9LA 4M7WA 3OTOB 3SXUA 3KQSA 4YB8A 4UE2A 4ND8B 2HU7A 4C7MA 1JVBA 5HS4A 3PBKA 4L95C 2MINA 1B43A 1SCBA 3QXCA 4HDKB 3I6MA 2CLHB 3U3XA 5AOBA 3L3BA 3ZQJA 5JFTA 2FSFA 4E5KA 1CFJA 4KIGA 1XZNA 1I0LA 2RAUA 4H0NA 4DNXA 5TSDA 3TZ6A 1ZUNB 3Q3IA 4CM6A 1KJNA 3ZD7A 2C2YA 1WLSA 1XFDA 2IQ5A 3FPFA 4GOND 2BHSA 4EPTA 3CIFA 4ZVNA 5I7AA 3ZWXA 4Z7OB 2NVUA 1CPYA 2YWXA 3DTNA 4EG8A 4Y8VA 1L9KA 4OG2A 4OTZA 4W99A 3QH4A 3VU3A 1ONOA 4JCOA 1F2VA 2P9EA 2NTYC 3C0KA 4GSLA 3VC1A 3ISVA 4D5EA 4NESA 5B4VA 3QXSA 2C5EA 4M1YA 1F0YA 4MKRA 4M2LA 3HPQA 2PV7A 3NO4A 3R0IA 1QANA 5DI3A 5JALA 4BLQA 1L5NA 1WZNA 4WA7A 1QIFA 4EPXA 2YJZA 5K8JB 2JJQA 2H2FA 3PNYA 2I91A 2W9XA 3IX7A 4LNUA 3L0OA 4KBGA 3SK0A 3MXOA 3CUUA 3U4QA 3JCZA 3EJ6A 3BRWD 4CLRB 4A10A 2QLNA 3EGXA 3K3PA 1MAHA 3EGCA 4PAOA 3GCDA 4AJHA 2HPHA 3KXKA 3LDHA 2IT1A 1PNVA 4KQWA 1SB8A 3HBMA 3IJPA 4NNPA 2DPHA 1JLSA 1OKKA 4J03A 4JR2A 3EEBA 1N0VC 3H0CA 3KT6A 4FFBB 4L28A 4E7OA 1IUKA 4MA5A 3ZC3A 3JQBA 3O0TA 1A7KA 4AC9A 2YJ4A 3V4OA 4EKIA 2DR3A 4UDOA 2CVZA 3T1NA 3UMFA 1QRSA 2FQQA 2O2CA 1F8XA 4LOHA 1GILA 1XXLA 4UNSA 4I55B 4LV8B 3W8NA 4G1UC 2BEWA 1I2BA 1TLTA 1XZIA 3QWAA 1T3HA 2FPUA 2NTJA 2UAGA 3E1SA 3LT1A 2OLEA 3L7MA 4FFSA 1I10A 3FAZA 4MS4A 4ZALA 1E2HA 4I6JA 1T0JB 1UZLA 2IHJA 1BYIA 2PJZA 3NHAA 1WHTA 1YB6A 4MV4A 2Q1WA 4NK4A 3W2HA 1Z39A 3LXUX 1EBUA 3EIUA 1R0CA 1UZUA 3N75A 3QMVA 3GRFA 5ALYA 4MPJA 2XKKA 4L3WA 1XI2A 3V4VB 4YUVA 4IM7A 1UT5A 1LFDB 2G9RA 3QKRB 1V7PC 3R9XA 3QI2A 2CXTA 3OY2A 2J6HA 2QTRA 1DFHA 4FDMA 3PB3A 4OLAA 3FCSB 2NP6A 1JVNA 2QN9A 2ODEA 4NENA 1JIJA 2BC9A 4II7A 3QHPA 5H9WA 3QLVA 1I33A 2P2SA 5EUQB 1VXRA 1G3UA 3C8HA 2VQSA 1VRCA 3GRPA 4XR4A 4PNHA 2VQ3A 1ESDA 1RCUA 2Z2KA 1PQYA 4HI0E 3VDQA 4BNNA 4K5QA 2B4AA 5AW3A 3PHCA 1FVOA 2OQRA 4LZZA 4BLVA 5K01A 1Y3IA 4QLBA 2JGEA 1GKIA 2OFXA 1UAAA 1ZI6A 1DQYA 4DZZA 4TLCA 5IZCC 4FB4A 3D7LA 4LRUA 2DHDA 1MR3F 1ZN8A 4DSUA 2CSXA 3H3FA 3D4LA 4Y2XA 3VAZA 5G0UA 2MTBA 2J5BA 3GCGA 1YB4A 1XB2A 1T8UA 4CBVA 4GKBA 3UWPA 3V4PB 3UJNA 4MR7A 1XJWA 4FYJA 4DLSA 3OM9A 3AHHA 3KJGA 1DVRA 2AJBA 1SU6A 3TLGA 5KVSA 3HRKA 4P82A 3BBPA 4WRRA 2H2AA 2J08A 3IO5A 3BD7A 4TWZA 4YGXB 2FUCA 4GQBA 1R64A 4EBBA 5HF9A 1R6BX 3MB5A 1G8GA 1ZHFA 1U28A 1NWCA 3FYTA 3OIFA 1TGYA 4MQ4A 3P2YA 1K8XB 1LPAB 5IUKC 5J9FA 3ZY2A 2B5VA 4EZBA 4UMEA 4OQQA 4CLOA 5KSOA 2ADMA 2C83A 2PBLA 4BKQA 4RACA 3TZQA 3ONDA 1AHPA 4UW9A 2Z4RA 2XGSA 1E62A 3EXFA 2H2WA 1W34A 3IB3A 3R44A 4MUHA 5DWVA 3HCRA 4O4JA 4GM1A 3B9QA 5EE0A 2YBEA 3KR0A 5GV7A 4ZJYA 1IATA 1C8VB 3IBYA 3ICOA 1Z16A 2P4UA 3R3VA 2YFHA 4H0FA 3W2TA 2G77B 2QQFA 5EAIA 4BQSA 1RRKA 3LQKA 4U6QA 2YY7A 4ZYUA 2P4EA 3M3DA 4HFJA 5F51A 1Q1AA 3PD1A 1G19A 5FB3A 2QRMA 1CX9B 2G1KA 4TUYF 3JARB 3E82A 4BO6A 4IXDA 4N5LA 5EE9A 2HSDA 1M74A 1NNUA 5HILA 1OBCA 1X87A 2AW3A 3U48A 4DV1B 1RHJA 4UNNA 3ER6A 2IVFA 2JGDA 3IR5A 2CHUA 4DLXA 4J29A 5AW5A 4L50A 6PFKA 1C1XA 3SYTA 4BRSA 4EYGA 3W5SA 3I12A 4NDAA 1EFDN 5IK2A 4RPKA 1HE2A 3JR3A 4AT1A 2H7XA 1I1QB 4HQ6A 1GN8A 1T36A 3DHEA 4NH4A 3PC7A 3RU7A 3WOHA 5BQXA 5HNKA 3FMFA 4FNOA 5I48A 1CJVC 1KMCA 2H9AA 4BQPA 4FWTA 3FSJX 1ST3A 1RJEA 1P6UA 3VOBA 4ZHSA 1M2HA 1N2BA 3DTVA 5BOVA 1L0BA 2IXDA 3A0RB 2HRCA 3FKJA 4JBGA 1SUDA 1JQ5A 2PIDA 1OAOC 2QJTA 3WTCA 4UCFA 1J8MF 1Z5GA 4G6ZA 4RVFA 4EJSA 2XVYA 1P8JA 5C34B 1XZGA 1M72A 2B82A 4O3FA 1P19A 4WACA 4WN9B 2CCJA 2H57A 3LP5A 3COWA 4AK9A 3EZYA 1JFFA 1B0UA 3DO5A 4HUTA 4GWLA 1H5NA 2YWDA 1ZGGA 1VJDA 1FMTA 1YQWA 2VAWA 2WZCA 1UBFA 3E84A 1WZIA 3EEFA 5TQVA 3B9RA 3AVQA 4DLVA 1L5WA 3EHEA 5I4KA 1D5WA 1IHXA 4MULA 1DAMA 1DXHA 5L7WA 5EWMB 1JDTA 2Q7XA 2X7HA 5TPWB 1NDHA 1ZMOA 2F8TA 2HNKA 3DTVD 4B3TB 2G04A 3WLSA 1DQPA 1W44A 3ZHSA 4MITA 3BDVA 1TAGA 3KKLA 2O2HA 4KYUA 4NAUA 4W1PA 1SHLA 1KDOA 2QTTA 1NXVA 4Q19A 2BIFA 3OZTA 4QXRA 4RZHA 1HV8A 1VSTA 1M5TA 4NU6A 1MJGM 2DTEA 5DK4A 2GEUA 3WG9A 2C98A 2GSDA 4K9DA 4Z3OA 2D5LA 1KJWA 3I3OA 2WHRA 5EZYB 5HOQA 3A6PC 1L7QA 2HZ7A 2VP2A 3KYBA 1Q0LA 4FYWA 3K5WA 2J1LA 5DEIA 3SZMA 3UM9A 3GLIA 1P18A 1S7GA 1ZU4A 2WRZA 4BXOA 4DM7A 1D4FA 4G5HA 1Y0BA 5J2TA 2RJOA 5FWAA 3LM8A 1AT1A 3H7IA 5AI8A 3MZ0A 4IJKA 4B75A 2I6SA 3IEKA 4U2KA 4MIYA 1WD7A 5A5VA 5CYPA 3V8MA 7GPBA 3L0SA 4I4IA 4MCHA 4YIKA 1Q0SA 2RAFA 1Y9EA 2A59A 3S40A 1AN0A 4JEIA 4K6OA 2I80A 4EQ6A 5F12A 2ODAA 1JSLA 3TEJA 2MSDB 4XDHA 5ARDA 3V7FA 2CZGA 4JELA 2DQZA 2ZIUB 3ZDYB 2FPOA 5J4YA 1CQWA 3DEAA 4AMYA 3WRXA 3MTIA 5KQSA 3H1BA 2CMFA 1GU1A 1VMKA 4RVDA 1AF4A 5LQDA 1DDOA 2QN3A 3DBHB 1TAHA 3JD1A 1NN3A 3S28A 2GARA 3N3AC 4JI0B 3VR2A 4WKCA 1A72A 2DWCA 4YAKA 3NHFA 1GQRA 2JBHA 3LUBA 3UAXA 1N2CE 2BCGY 2XAUA 3R7AA 4NH0A 1XDSA 5F7XA 4XIIA 1WUJS 4F85A 4W1QA 1UKZA 4JUFA 4GL2A 1NBMA 2Y27A 4DLZA 2WM2A 1KH2A 4NL4H 4RD4A 3REOA 2NGRA 3RAPR 4BQOA 2Z5GA 2HJRA 3I1YA 1GR1A 3A1SA 4IP0A 5T8KC 3FRHA 1UWLA 3P32A 4HD8A 2B7LA 4KI0A 2VNSA 1KNQA 2DPGA 2XVXA 2MU1A 3DWGA 3GEBA 1DARA 4P3PA 1SXJA 1C14A 4IG4A 4B81A 4CFZA 4RZUA 3UFBA 1LPMA 4LY0A 5KNBH 2PVSA 3C39A 3WGQA 2F67A 5BSEA 2IUEA 1IY8A 1FP2A 3AI3A 1TQ2A 2WYVA 4OMUA 3MSCA 3GLTA 1G18A 1QJ4A 5ECDA 1VCHA 3NEJA 1B3RA 2R3SA 3HNOA 1XZMA 3KU1A 4IG9A 2BGGA 1F7VA 2WDPA 4LI0A 4QJ5A 1YQ9A 3KTFA 4LXUA 2OK8A 4CIXA 1U8TA 4OKSA 5JMTA 2XBLA 1C50A 2QM3A 2JANA 2A0XA 3QXGA 4YV2A 1YZYA 1V43A 5KAPA 2ZB8A 2ZRPA 1P39A 2Y6UA 3N2GA 3KOWA 4N49A 1OFUA 4LWPA 2Z2ZA 3BZUA 1QG2A 2IX9A 2O3TA 3ILVA 1YUMA 5EJAA 2ERXA 4NYMR 4U2CA 3IDZA 3V7NA 3R7FA 2NPFA 2GJ8A 3MELA 3O5AA 1QWSA 4JJ6A 2ZSBA 5CM2Z 1NI4A 4R8RA 3O91A 3P27A 3TL2A 3V48A 4ZI2A 1OFVA 2I8CA 2Z5FA 1N5DA 1UPFA 1WQ4A 4F0JA 3UV6A 1OE0A 2C7QA 4L5AA 4RMJA 4D5GA 4C43A 2A1TS 1FRVA 1USVA 4IJQA 1Q77A 3EXHB 4ZT5A 4RPIA 3AETB 4MCJA 3PJDA 2WPNA 3PFWO 3T3DA 1K3TA 3MT8A 4M1SA 3GWZA 3NBQA 3OOEA 3TRFA 5J3JA 3T1YB 1X9HA 2HTEA 2QJFA 2V98A 3IAEA 4KHPB 5AIBA 2DLNA 1R0RE 3ECSA 1RW4A 2F9LA 3L06A 1KY2A 1X8LA 3KJQA 4L0QA 2Q1YA 3W9BA 3K8OE 2Y9MB 3RASA 1MP0A 4PX2A 2QSZA 1JR2A 2OCYC 3T38A 3UEOA 5TMPA 3MGKA 3CR3C 2CVQA 2WJHA 3DNMA 4N3GA 1K7EB 3ZXIA 2R1TB 3DOHA 4DT1A 1SCUA 1PN3A 2GXQA 4BN0A 1TCBA 1FFHA 2B1QA 2C9OA 3NU1A 4TGLA 3DAGA 4Y98A 2PZGA 5FTJA 4CTNA 3KSAC 1KBZA 5JSKA 3S4YA 3D6FA 1C9MA 3ED1A 1OWNA 3A58B 4YHHB 4OSOA 1E9DA 2DFNA 3BL5A 1H9AA 2J9FA 3FE2A 4PAGA 1T8PA 1NBHA 5EIEA 1M3SA 1UMBB 2NN3C 4ZEXA 4ZTBA 1EAMA 1MHPA 5AK4A 1BQ4A 3VU9A 3ZWMA 1U3VA 2EATA 2CLEB 1MDFA 4XIJA 1X38A 1YWGO 2Q6KA 1P2FA 3PA8A 4O4IB 3A27A 1PLLA 3L93A 4OFXA 2NU6B 1R4NB 2VDUE 3ANTA 3JQ9C 1U2RA 1DV2A 2XUQA 1NYQA 4GO1A 5IAGA 4A6EA 5CB6A 5LZ4A 4TXMA 1NBIA 2JAOA 3H8WA 3O74A 4C01A 3DR5A 3RSCA 3K0EA 4BNVA 2L17A 4X1YB 5EIBD 1WW2A 4S1TA 4D6PA 3NORA 3ULKA 2B9VA 2OD2A 4DWOA 5LP1A 3CRMA 2ZTSA 4A6PA 4BB9A 1PNTA 2BEWB 4AUMA 3F78A 4Q66C 1CHNA 1G8JA 4FFOA 1WOYA 5HG0A 3ZTWA 3C6BA 1SK9A 2RG1A 5D3MB 2VPXA 1NY6A 1PR6A 4K9NA 3UK1A 4A16A 1G5TA 4QELA 4QGSA 3A9CA 3DE1X 4A0HA 5D84A 2ZI7A 4ZPJA 3NDBB 3HXPA 4TT8A 5JO0A 3WNBA 4WXYB 6NULA 1OJ7A 4Q48A 1R0WA 4DLBA 1XAGA 4ALKA 1Q15A 3HE3A 3VR6A 4MS1A 5IASA 2IUUA 3MWKA 4RA9A 4HGQA 1SVOA 3VTAA 2Z98A 3WICA 1WE2A 1KDPA 1PU2A 2WAYA 2QTAA 1PS8A 4HH4A 4XGNA 1IBCA 5JH7F 5FYQA 5JU6A 5A04A 4DMFA 1SUCA 1DRWA 3GNQA 1E2LA 5ALQA 1KBOA 1AQIA 3HCDA 1F6DA 2FW8A 2PT6A 3GVIA 3KP1A 4US2R 2O8FA 2EIHA 2I4MA 2Z04A 1NJGA 1Y3FE 3BUSA 5AVZA 3AB8A 2R6HA 1ZC4A 4I55A 4NTZA 1PEDA 3ZH9B 3QLTA 4PLTA 3MG9A 4FDTA 1ULAA 2IY8A 1MVLA 4BCCA 1JKXA 3EC1A 3RTBA 1FS4A 1OBVA 4F21A 1T3SA 1XG5A 3GUZA 3QJGA 1ODFA 5LB4A 2PSDA 3I53A 2XTMA 1B8OA 1LBQA 1O6BA 1WA5A 3OFJA 1NFFA 3AY0A 5A6VA 1QRUA 2F3UA 3HDYA 1UP7A 2ZETA 4CV3A 1P77A 2X0NA 1ABEA 3TJMA 1PGPA 3CB2A 4OQPA 2Q0HA 5FNVA 2V4MA 2V65A 1L7XA 4HFNA 3CO5A 2BJHA 3JVUA 4RK0A 4QUDA 3LQFA 1E1QA 1ZIDA 4RDCA 2FN3A 3L7OA 4LYDA 2O20A 5I9IA 4CMHA 3KUDA 3VPHA 4D9FA 1R9JA 4H1WA 1OWLA 1YA8A 4MOWA 2PD4A 2Q1UA 3QPCA 4GOKA 5DX1A 3X0DA 2KQUA 4D0SA 5LA6A 1UM9B 2W6ZA 2IXAA 4DPKA 3W5DA 1Q19A 2FFJA 3PWZA 5CRIA 2QE7A 2XH8A 4RWZA 2JH3A 2QI9F 3AZQA 1Z83A 4LHWA 2GJKA 4QGBA 4BGVA 4OHKA 4MZDA 4QATA 1P0QA 4FYKA 2SKCA 4IO1A 2OAP1 3MEQA 4HPWA 5I47A 2QDKA 1IQUA 5AKJA 3JAWA 2NO4A 3PFGA 1W2GA 1JEOA 1M1UA 3ZWDA 1JPUA 4CTKA 4ARSA 4F6RA 2I1LA 4B44A 5JO9A 4DA0A 3FTNA 3ASYA 3P94A 3K6RA 4J91A 2HHAA 621PA 3MWDA 4N41A 1NVVQ 2OGSA 1PQ4A 3DEFA 3V7UA 3WQBA 3LBAA 1FMJA 3DJYA 3Q7PA 4J7XA 1M2WA 1EFRA 5F1OA 3TLEA 1KI1A 4QGAA 1HC7A 5BRJA 4G5OA 2PUFA 1I5RA 4CE6A 5A9SA 1W9HA 5FHQA 1AY0A 2HNAA 4YJ3B 3TPFA 4H31A 2HJGA 1CF9A 3HU1A 1KMNA 2Q9AA 4ENQA 2XCSB 5KOJB 3FPCA 1VCOA 2B8WA 2E4WA 2BY4A 3P9YA 5B4TA 1QQAA 2R60A 2Z08A 5I7VA 1J2TA 1L4KA 3AUYA 4Y2TA 4AROA 3JV7A 4HFMA 1Z3CA 4ZI7F 1WCYA 4RKEA 3V8VA 1L8AA 1QVAA 3RABA 1Q3KA 2Y1CA 2PM8A 2DPXA 2J7KA 2MMGA 2OECA 1IJFA 4TYQA 3JAKA 3C6YA 4NBNA 2LPMA 1U28C 2ATVA 2PUBA 3CJQA 2C4MA 3RFTA 1QO0A 2YY6A 1VPEA 2RH8A 3SX4A 4LZLA 4A73A 2EFJA 5EMMA 2JJYA 3G02A 4JCCA 1N2CB 3MT9A 1B1CA 3D1VA 2CLKB 4OA8A 3RSQA 2QLFA 4OHFA 1KSFX 3HWWA 2Q4EA 3LHDA 1FW6A 4A8HA 5ANRB 2BELA 2Y92A 3EDQA 1TMOA 1QOZA 1U6KA 1FUYB 3U2QA 7REQB 1FK8A 3P96A 4Y7CA 5JVDA 5CD1A 3T9BA 2CNWA 4B5KA 4W5RA 4XWGA 3EODA 1IVNA 1SJ9A 2SCUB 5IZCA 2AOTA 3QEOA 2ONCA 5EJIA 4QOEA 3IB6A 5FOSA 5LD2C 1IDN1 4JP1A 3TZLA 2FRXA 4BMVA 4WDRA 4B6RA 3D6UA 5LFAA 1HQDA 1RKUA 3RBZA 4C08A 4ARIA 3FZYA 2P30A 5EIAA 4CF5A 3FF4A 4NYJR 5CDYA 2WHQA 3KZ1E 5JXHA 3SC4A 5HM8A 3LCJA 3GLGA 5CT9A 3WYNA 2X0FA 1ZCFA 3KTDA 1SXJD 1XD9A 4FN5A 3TQOA 1Y4ZA 1H66A 2YFYA 1ZM9A 3FFBA 4KODA 4KVAA 1QPGA 1T0UA 1Y7TA 1ZICA 4HAIA 3TNDA 4DIDA 3HGQA 1U8CB 1G55A 3WLJA 1E58A 2VF5X 5DBGA 4I1OA 4CI0B 5CLFA 3VVCA 3E5HA 2FQ1A 5T4EA 2OXIA 3NHLA 4PHFA 3BYZA 1RVDA 2C5GA 4GDMA 1EEXB 3CUTA 5EE5B 4R1LA 4Z1MA 3FDZA 4A8JB 2REOA 2EWVA 3DZBA 4HLDA 4IJWA 3THRA 5BMOA 3FCAA 3T9EA 5EJ5A 3HABA 2YIDA 4F91B 1Z4JA 5MDHA 1WDWB 2QRVA 1U1DA 3AV3A 4RFSB 4LJSA 1SCQA 2E21A 1AXGA 5YASA 3K92A 1QV7A 3KL2A 5CR9A 4CM4B 5MGNA 2HLPA 4EHNA 1AOXA 4LGCA 4LZAA 5AJZA 3RV3A 2FPWA 3ROXA 1I0IA 3VX3A 4DEXA 2I3BA 1ZXBA 1K1EA 2Q4DA 3S70A 2FLVA 5KMGB 3A1UA 4G07A 1GYRA 3KEMA 5DBIA 3VU0A 5KBYA 1GUZA 4FI3C 3ZD9A 4G0VA 1DJMA 1P9NA 2WQ7A 4JB8A 1BYUA 1CULC 2XTNA 4LYHA 3S3TA 1DMSA 3C45A 3O2SB 4LDRA 4BLPA 1GITA 5I9LA 5CPFA 4U7WA 4WK4B 4B73A 3OEYA 1X7XB 3DFKA 5ERXA 3DE5X 3WSTA 4C20A 4CQJA 4LOKA 4Q3EA 1YCDA 3V4SA 3CX3A 4UHKA 2ZUTA 4DQDA 3KEFA 4YX9A 3T5MA 2R2GA 5ADWA 5KEIA 1GRNA 1DEOA 3CUEF 4J16A 1WUHS 4XVQA 3IP7A 5K0SA 3FGNA 4UHCA 1ITZA 1KI7A 1OZGA 4J0KA 1B74A 4R2XA 1J7KA 5L53A 5LQJA 2Q5EA 2ST1A 1YS9A 1ZWLA 1UJ4A 2ON6A 1GNPA 1CV2A 1ODSA 2XNJA 2ABWA 4NDNE 2O1EA 1PG5A 1OWMA 2CLIB 4HV4A 1DC3A 1ORHA 3QOYA 6REQB 1YMUA 1QG0A 1X19A 3B2NA 4MIKA 1ORWA 1XTJA 1CUEA 1H2HA 3CBGA 3DZHA 4R8VA 2RI6A 3VR4D 2FP4B 3IPAA 3LGAA 5F2KA 2GD1O 2J9ZB 2Z30A 1JIKA 3R5XA 5FBZA 4MAAA 3MGCA 3WMWA 2Q45A 4FI3F 4ZRMA 2LGJA 5FI3A 4LQDA 3SC6A 2ZBRA 4OLFA 3M4YA 1AGRA 1G7TA 1VSVA 2CXUA 3CF0A 1NMQA 3CY6A 4ZHQF 4NJEA 1WETA 1K4MA 3D8BA 3ZV3A 1EE9A 4NS1A 1YBMA 4DLWA 1EA5A 2VH2A 4DDWA 2IOHA 3HKEA 3LWDA 1X7HA 3F7NA 1J20A 1FFXA 2ZAMA 2DQ4A 3HUUA 4IWYA 3KQMA 2MHCA 2XB4A 1ENOA 3AU9A 2QQ5A 3H4IA 4RYLA 4AUEA 3GEDA 5JR3A 2XGJA 4MQFA 1Z5WA 4MPTA 4QDUA 4CL8A 2NZXA 2XBMA 1KE2A 4LYJA 3HZHA 3IA7A 4K6MA 2OQVA 4GKJB 1BCSA 1UFOA 2XTAA 3FYCA 4WCDA 3T5CA 4KK4A 4BLWA 4ED9A 1J2UA 2W48A 1YFZA 1RHQA 2A57A 5P8WA 1F8YA 3GLHB 5J47A 2CB9A 4L6CA 4W9NA 3BSYA 3EVNA 2ZCUA 4KE6A 1B0AA 4KTTE 1PFYA 3V4LA 5FOTA 1E4EA 4IUDS 1KGSA 4IZ6A 4QFBA 4RBNA 1OREA 2FOLA 4QBFA 1CWUA 4TKVB 3ZX5A 3PC6A 1YGYA 4EECA 4YJDA 4HRVA 4YALA 4LNAA 1DQRA 2JLCA 1Q92A 1QHYA 4N5HX 4GU5A 1DU4A 4BMPB 4DCPA 5IM5A 3UOAB 4F5DA 4EI8A 1GTSA 4X7BA 5JY1A 5KTKA 1T6ZA 1Y9JA 4NOKA 3L6UA 4TQGA 1DS6A 3NP9A 1C4OA 2L2QA 4IXNA 2AVDA 2DR0A 3BTSA 2NXJA 2AC2A 3CONA 4BFUA 4DSZA 1Q7CA 1QX4A 2GFIA 2ZGVA 1KZGB 1KJQA 1P0PA 1A27A 2JIZD 3IOBA 4KPGA 1I2CA 5F5LA 3TQSA 5CB0A 4DRXA 2VC2B 5SZJA 3ZR4B 3ZCUA 1QYXA 1W5SA 4Q4CA 3T7RA 4MVJF 2HR1A 5FUWA 4HGRA 3NCTA 3Q0IA 4M8IA 3EGDA 2ZLBA 2I76A 3VZCA 1KKLA 3ZLBA 1F3LA 3B20A 4I66A 1F17A 1PGOA 1L7AA 3Q7IA 1EBBA 3BBLA 2B37A 3OA2A 3C3XA 2VXBA 1QYDA 2Q29A 4Q03A 3TRKA 1GAWA 4KSCA 1D4AA 421PA 1H4VB 1M6HA 1XCJA 2JFGA 3ET5A 3PUIA 4WFQA 2QRQA 1CIVA 2YKGA 3LWZA 1CEEA 4L15A 2F1OA 3H1FA 1PV1A 3KYDA 1FTNA 1O95D 2BR3A 4UBLA 2ZJZA 1QKJA 3DHNA 4D80A 1K63A 2CYBA 3GJQA 4N7MA 2H0AA 1XWIA 4GI1A 4NMHA 3SZOA 3P9KA 2D2XA 2ZZKA 3CR8A 3LVQE 4WXRA 4XX0B 1QGZA 1W1WA 4AP6A 5BVGA 4FYPA 1NFRA 1WPGA 2PGNA 1QV9A 3WVNA 4EJ6A 4P22A 4NP6A 5JDIC 4G0WA 5IAKA 1K0FA 4YY3B 2F59A 4NZYA 3UJ8A 2QMHA 3IE0A 1PJ8A 2VPQA 2ZUEA 2G6TA 3RGWS 4EO9A 5B5SA 3RYCA 1RTKA 1MJ5A 4U2BA 3CPEA 4V0RA 2QQ0A 3CJRA 5KYUA 1I8TA 1PYOA 3ECAA 1ZA2A 2CDCA 2VUTA 4RVUA 2O8DA 1RHKA 2X6TA 4CR7A 5JNWA 3B3GA 3ABRB 4N76A 1XK7A 3QEMB 4HK4A 4IVNA 1U9IA 5DHSA 4Q3CA 4IRUB 4OPMA 3OAAA 4HTFB 3G5TA 3A9RA 4RD3A 3QUTA 1YRAA 4JJ7A 1QONA 3UKOA 4XD2A 5F4ZA 2K2WA 3WHIA 4A8JA 2ORYA 4HMOA 5F73A 3I5XA 4DXAA 3E03A 3OHPA 1BX0A 2HFJA 2M6KA 3CNNA 4U7GA 4DPMA 5EWJA 1R4ZA 1BH6A 1OTXA 1JKMA 4RZQA 2GX6A 3DPUA 1UF9A 3L9WA 3VPSA 1L5YA 1IHOA 1S4MA 3MINB 3T3GA 5ESRA 1RM4A 3QI7A 4DEYA 4FMBB 4YBRA 1MPTA 1OMOA 3AUFA 3KLNA 3MOIA 4R1SA 3CVXA 1MVNA 1XK6A 1YZQA 3ENQA 2J6BA 2I2DA 3E9DA 3PXDA 3ITDA 1ZVKA 3RTDA 1E0KA 1RYDA 3IP8A 4NYIQ 3FHOA 2YC2C 3PVSA 4FT2A 4AFNA 4E6EA 5KB3A 3QV2A 1W59A 2WD9A 4TMZA 2V7VA 3AWDA 3O8QA 4JVLA 4YJ2B 1JL3A 3TTUA 2LIPA 2PX2A 3DZDA 3FLEA 4GT1A 4H7KA 5KCMA 4AVYA 2WABA 4AYTA 3I39X 4CEHB 4ND1A 4ON9A 2YX1A 3E18A 3NTQA 1W9MA 2C8KA 2V96A 3ED5A 3QTBA 1XZEA 1ZINA 2H8KA 4FHGA 2KWIA 1RIFA 3IPRA 3LAWA 1PHRA 2DPYA 1TZBA 3VR5H 4FSHA 2PVCA 4EHFA 4DA8A 2JFNA 5TVGA 4MAMA 1VDZA 1W8DA 1Y8QA 8AT1A 3ER9A 5C8YB 2JARA 3OJ0A 4YQEA 3ZOZA 1EJ0A 1DAKA 1H8EA 1IHPA 2OV1A 3OZWA 3TQTA 4YAIA 1TVCA 3WLQA 3IHLA 3E9CA 5CXSA 3TM4A 1M10A 3BGIA 3TQQA 4DLNA 4W1RA 4C5CA 2YZGA 1F1BA 4ZYYA 2UZ0A 2FUG6 3GT7A 2UXBB 2PBZA 1E5TA 1W4AA 3NWPA 5KOHA 1II8B 3AJRA 1YCFA 3OQIB 1GCUA 1P17A 1JQLB 4H4CA 5CVDA 4YV0A 2IYWA 1QCZA 3L4JA 4OJTA 4UPVA 2HL6A 1KP9A 2JCBA 3R3UA 4N5NA 4RWEA 1IDOA 2P9FA 3WZLA 2RH5A 2UU9B 3CGWA 2VNHA 1BFUA 1V6SA 2CVFA 5AICA 5J2UB 3W7AA 2RONA 1Y3AA 2Q2NA 1OXBB 1IG0A 1JDPA 2ZUWA 2I03A 3UMYA 1XF1A 2C82A 1YKFA 3DB2A 3E0XA 4MRPA 3SF8B 3ZCSA 4G36A 1EQ2A 4EEZA 2JVKA 3B8EA 1G8PA 3RSOA 4AF7A 2PJRA 1TK9A 3OU6A 1TM3E 3P9CA 3TIIA 4KP7A 3W1WA 4L1KA 2RI1A 3KE9A 5DW3A 4XRGA 4ZCLA 1VLQA 3I09A 4QPJC 3RF6A 2OBLA 1T36B 1A2OA 2F1KA 4BEWA 4PPGA 4JC8A 3AR8A 5THXA 5MGBA 2H2GA 4UOEA 4AI6A 4X5OA 1KVTA 3FRIA 1TRHA 1EG7A 5U9CA 2DPMA 4ZODA 1TCCA 5A5GA 1N7IA 2L82A 1EUCA 4PQGA 4H6XA 3HKBB 4P2GA 3R8XA 3NJ8A 5TMEA 4E2ZA 2BN4A 2A1IA 3OZIA 1HX7A 4JDUA 2BUCA 4ZAZA 3KKMA 4TKMA 4ERXA 5CX1B 3M6UA 3T5TA 2BDUA 1OPRA 221PA 4BTEA 3UENA 3OJOA 4CLXA 1A04A 3HWRA 3BGDA 2GD2A 4A8TA 1SVNA 4TV9B 2G4VA 1Z8NA 4XEUA 5AW0A 3CUVA 2H7YA 1W4ZA 2W2MA 2XZPA 3MRSA 3TLAA 3UXHA 3AEKB 3DC2A 1N5KA 4HOYA 4UZFA 3IPYA 3X2SA 3KXDA 3NTRA 2F4VB 1FFSA 1NLMA 1P9WA 2PPLA 2C4VA 4U6SA 2XA1A 3JQ6A 1R50A 4L5CA 5JARA 1F2UA 4O59O 1Z26A 3GFGA 4OP1A 5EJ8A 4YA6A 1J21A 1O8BA 2AOVA 1T6XA 3WWDA 1SURA 2OFFA 1CUHA