3AHIA

H320a mutant of phosphoketolase from bifidobacterium breve complexed with acetyl thiamine diphosphate
Total Genus 320
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
320
sequence length
802
structure length
802
Chain Sequence
VIGTPWQKLDRPVSEEAIEGMDKYWRVTNYMSIGQIYLRSNPLMKEPFTRDDVKHRLVGHWGTTPGLNFLLAHINRLIADHQQNTVFIMGPGHGGPAGTSQSYVDGTYTEYYPNITKDEAGLQKFFRQFSYPGGIPSHFAPETPGSIHEGGELGYALSHAYGAVMNNPSLFVPCIIGDGEAETGPLATGWQSNKLVNPRTDGIVLPILHLNGYKIANPTILARISDEELHDFFRGMGYHPYEFVAGFDNEDHMSIHRRFAELFETIFDEICDIKAAAQTDDMTRPFYPMLIFRTPKGWTCPKFIDGKKTEGSWRAAQVPLASARDTEEHFEVLKGWMESYKPEELFNADGSIKDDVTAFMPKGELRIGANPNANGGVIREDLKLPELDQYEVTGVKEYGHGWGQVEAPRALGAYCRDIIKNNPDSFRIFGPDETASNRLNATYEVTDKQWDNGYLSGLVDEHMAVTGQVTEQLSEHQCEGFLEAYLLTGRHGIWSSYESFVHVIDSMLNQHAKWLEATVREIPWRKPISSVNLLVSSHVWRQDHNGFSHQDPGVTSLLINKTFNNDHVTNIYFATDANMLLAISEKCFKSTNKINAIFAGKQPAPTWVTLDEARAELEAGAAEWKWASNAENNDEVQVVLASAGDVPTQELMAASDALNKMGIKFKVVNVVDLLKLQSRENNDEALTDEEFTELFTADKPVLFAYHSYAQDVRGLIYDRPNHDNFHVVGYKEQGSTTTPFDMVRVNDMDRYALQAAALKLIDADKYADKIDELNAFRKKAFQFAVDNGYDIPEFTDWVYPDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Xylulose 5-phosphate/fructose 6-phosphate phosphoketolase
publication title Crystal Structures of phosphoketolase: thiamine diphosphate-dependent dehydration mechanism
pubmed doi rcsb
source organism Bifidobacterium breve
molecule tags Lyase
total genus 320
structure length 802
sequence length 802
ec nomenclature ec 4.1.2.22: Fructose-6-phosphate phosphoketolase.
pdb deposition date 2010-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03894 XFP D-xylulose 5-phosphate/D-fructose 6-phosphate phosphoketolase
A PF09363 XFP_C XFP C-terminal domain
A PF09364 XFP_N XFP N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ahiA03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ahiA02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ahiA01
3AHDA 1OLSA 2JI6A 1UPAA 4MPJA 2OZLB 3OOYA 2VJYA 1OZGA 3DUFA 2BFEB 1PI3A 1UMDA 1T9BA 2DJIA 2G28A 3M34A 3AI7A 5HGXA 3EXG1 1UMBA 2VBIA 2BEUB 5HJEA 1W88B 2AG1A 3M7IA 2AG0A 1U5BA 2UZ1B 3EXHC 3F6BX 3IAFA 1OLUA 3AHJA 1V16A 1B0PA 4MPPA 1OLSB 3EXHA 2QTCA 1IK6A 3FLMA 4C7VA 4GPEA 1W85A 1OZFA 3DUFB 4RJIA 4K9LA 1UMDB 1YI0A 4COKA 2NXWA 4JD5A 3ZHVA 1UMBB 1V5FA 2C31A 1T9DA 1UMCB 3D7KA 1YHZA 4QPZA 2IEAA 2VK4A 5I5EA 1Y9DA 1PVDA 5K6RA 5ESDA 2R8PA 4KXXA 2Y0PA 5EJ5A 5C4IA 1POXA 1U5BB 3L84A 4K9KA 3AHIA 3EXG2 4C7XA 2C3YA 1OLUB 1V16B 4RJKA 3EXHB 1MCZA 3ZHQA 1RP7A 4KXWA 1QS0A 5EJ9A 2IHTA 1W85B 3AHHA 1X7YA 4FEGA 3DVAA 5HHTA 1T9CA 2EZUA 1KEKA 1V1RA 2V3WA 2JLAA 1YI1A 4KXUA 4K9QA 4MZXA 2O1SA 4XEUA 4K9MA 3EXIA 2VK8A 2VK1A 3EY9A 1AY0A 4JUFA 1TKCA 4D5EA 4GP9A 5HYVA 1GPUA 5I51A 1NI4A 1X7XA 1Z8NA 2XT6A 5DGTA 3ZHUA 2XTAA 2JIBA 1X7YB 3DVAB 1YBHA 2FWNA 3FSJX 2UZAA 3M6LA 2G25A 3E9YA 3LQ2A 3RIMA 1UM9A 3EXIB 3AHGA 1WCIA 2Q5LA 4RJJA 2QTAA 2PGOA 4GM4A 4JU8A 1NI4B 2Q29A 2YICA 1X7XB 3JU3A 2JGDA 1V11A 1TKBA 1X7ZA 4K9PA 2JI8A 2JLCA 2Q28A 1DTWA 4JU9A 3M49A 1UM9B 2VBGA 5EXDA 4FEEA 1OVMA 2BFBA 1WCIB 1Q6ZA 1BFDA 2W93A 4JUBA 2O1XA 2JGDB 2IHUA 2G67A 2Q5QA 2EZTA 4Q9DA 1V11B 2EZ8A 1X7ZB 3DV0A 1NGSA 1UPBA 2BFCA 5EJ7A 2C3MA 1DTWB 2EZ4A 1T9AA 2Q27A 3UPTA 2IHVA 3KOMA 1X80A 1X7WA 2PANA 1N0HA 2BFBB 2C3UA 2BEVA 3EXFA 2YIDA 3EYAA 5EJ6A 5K3SA 1V5GA 2FN3A 2BFEA 2JI9A 1QS0B 4MPRA 5I4IA 2VBFA 2BFCB 3UK1A 3IAEA 1TRKA 2BEWA 4KGDA 2WVAA 1V1RB 1X80B 1YD7A 2BFDA 2UZ1A 3EXFB 3EXEA 1PO7A 4KXVA 4GM0A 2E6KA 2JI7A 2XT9A 4GG1A 2C3OA 2Q5JA 3OE1A 1QGDA 2EZ9A 2R5NA 3HYLA 1OZHA 5FEMA 5EJMA 3LPLA 1PYDA 1UMCA 3HWX1 2BEWB 3HWWA 5K2OA 1POWA 5ERXA 1V1MA 2BFDB 3EXEB 5K6TA 1YNOA 1QPBA 5EJAA 2BFFA 4JUAA 3AHFA 5DGDA 5IMSA 1ITZA 5AHKA 3ZHTA 4JUCA 4D5GA 5EJ4A 5DEIA 3LQ1A 3F6EX 1R9JA 5EXEA 2J9FA 1V5EA 4GM1A 3LQ4A 5I5GA 4MQ5A 5ERYA 1V1MB 4K9OA 2PDAA 2BP7A 3EA4A 1OLXA 3AHCA 2BFFB 4JUDX 4QELA 1YHYA 4ZP1A 3ZHSA 2OZLA 4QQ8A 1TKAA 2X7JA 4WBXC 1JSCA 3DV0B 2C42A 3MOSA 3FZNA 4KXYA 1L8AA 2J9FB 5EJ8A 2WVHA 2Q5OA 3AHEA 1ZPDA 2C3PA 4K9NA 2BP7B 2BEUA 1W88A 2R8OA 1X7WB 1UPCA 2WVGA 1OLXB 3ZHRA 2BEVB 2PGNA
chains in the Genus database with same CATH superfamily
4JKIA 3K0FB 4DEXA 1YVEI 3LV8A 4ED9A 4DGQA 2VYVD 1A7JA 1EWYA 1QUEA 1YKSA 4G5QA 5DBFA 4NX2A 1N8NA 3IEIA 3QUCA 4GYJA 1P29A 1RQ2A 3EBLA 5EVJA 3RADC 2JF0A 1RBZA 2VAXA 3UAVA 2CVFA 1X8LA 2NNLD 2XTNA 4ND8B 5DSZA 4MIKA 3LWBA 4IZIA 3T0IA 3VPHA 3WP0A 4EW2A 1Z5WA 5J59A 4JA2A 5ALGA 5C8ZA 4JOBA 5TPWA 2CDRA 3TEFA 4EECA 2Q3JA 4MITA 4W5TA 3O1JC 4RHXA 2WMDA 3KNZA 3CR3C 2R1UA 4B6PA 2ZGVA 4BIIA 1VJGA 4L95C 3QH4A 1M2JA 3M34A 4EHJA 2IYUA 4C01A 2QW0X 6AT1A 4UVEA 2FCRA 2ODPA 2IKSA 3BSYA 4J0JA 3TOSA 2A9FA 3ECSA 2H4JA 1N3LA 2J9ZB 2WTAA 3LXRA 5K4HA 1G38A 2J31A 4W1SA 3R6TA 1VB3A 4F92B 1VZ3A 3WL8A 1T5BA 1NWHA 2G80A 2W2MA 3O8BA 1ZJZA 2CCJA 1XTUA 1D6MA 1EXWA 2EIXA 4X3OA 1YCGA 4RSMA 4Z6KA 5I01A 4DFDA 4YHHB 2WK1A 4L7VA 3CEHA 3WV5A 1F8GA 5CNMA 1C0EA 3O3OB 1C9YA 1U5BA 2V6MA 1TZKA 2ZYTX 3D31A 4LXYA 3KJZA 3OIWA 5HTKA 5BT9A 2VUHB 3RUFA 4GSLA 1VMAA 4AP9A 1PX0A 2B94A 1XC7A 3PP8A 3KG2A 2VO1A 4LNUA 3RQSA 5FL7D 4HDNB 4UBOA 3KZXA 4BFUA 1TJNA 3DXXA 1OE0A 4US2R 5JO9A 4XSHA 4MQMA 1WXHA 2DC1A 2YXPX 4NPHA 3VNQA 1KFKB 1FUIA 3LF2A 1O9BA 4CL3A 1V48A 3MW8A 4J4BA 1D0VA 1DLIA 2D2FA 5KSPA 4PYNA 5I9TA 3P9YA 4YMWA 1XRNA 2YUTA 5C2JB 2WSSD 3WIOA 2RHHA 3HB4X 4LY0A 4WERA 3CONA 5DNWA 5LN1A 4JEIA 1TTQB 5CYFA 3E81A 3PWSA 4PAOA 1QGZA 3V4VB 2YVKA 4PO9A 1N36B 3OIVA 4IFTA 1RPAA 4D8TA 3EUFA 3RYFB 5CM2Z 2C31A 2NVUB 1YB4A 2WAYA 3L6OO 4TS3A 1X15A 5CX1A 3IV9A 4KQMA 4DZZA 2O8EB 2OLEA 3Q3GE 4QU9A 1YE3A 2IU3A 1DL5A 2PRJA 1L7AA 2AR9A 2GA8A 3RG8A 1WMSA 4EITA 4YCNA 4DPMA 1Y8QB 1POXA 2VNAA 3FUVA 1LTQA 4K8RB 4GBED 3S5UA 1UJCA 4C7XA 2XQGA 1EDZA 1AN9A 1E2QA 5E4JA 2HDOA 1E98A 2GRUA 4OK6A 4TL8A 2YC4C 5DFAA 1AZLA 2GPSA 2FG5A 4JX8A 3TVYA 1UOEA 4TVSA 3PNYA 2IP2A 2MJLA 3AI1A 3X1DA 4MR9A 5TS2A 1VI5A 1ZJJA 1KE1A 3ICVA 5AI0A 3ULKA 5A3QA 2WTNA 4FSHA 4N5NA 1ZHOA 1JMYA 3OZXA 4PV7A 1NQTA 5JH7F 3C4VA 2II6A 2PZGA 1WOMA 1P8JA 2IEIA 2WBLC 2XUHA 2ZWIA 5K3DA 5TRTA 4BMZA 1NQWA 3K6RA 3TQFA 5I4KA 1P1RA 5BRNA 5DBEX 3TLBA 4LOKA 1PGOA 3RVNA 3NHBA 5CBPB 1WUTA 1YL5A 3WYGA 1VP9A 3VDMA 3T7RA 4C4OA 4ZA2A 2RGNA 3IV6A 3PZBA 5ALNA 4FNMA 3GX1A 2CXHA 4P36A 5TDHA 5IT9A 4HLCA 4HLQB 1C4OA 4X71A 4YXFA 3KQNA 1J7JA 4LYAA 4E0BA 3S7ZA 5ISMA 5D3KA 3BA6A 3CMMA 5K0FA 1V35A 1M8PA 4QTYA 3EARA 1II9A 1KZ1A 4MQEA 3BMNA 2WM3A 4GC5A 3GLFE 5CFZA 1JH8A 1FRVA 4AP6A 1TKCA 3TL6A 2BJHA 5HE8A 1Y5NA 2BELA 3RSSA 1Z2DA 2REXB 1TF5A 1XQ6A 5JLJA 1ZJWA 2ZYGA 2O2YA 3SHVA 4W5NA 1VG8A 2E55A 2I7DA 3CLRD 4EJ6A 3OTOB 2X9QA 2IEYA 3ZHUA 3TGLA 5K0NA 1WY7A 3COYA 3IEKA 4JJEA 5HRAA 5C8YF 4MUYA 3EYWA 3T52A 3M70A 2GD0A 3MBKA 4JYCA 1VJ0A 2EKQA 3NW9A 3WSWA 2IZ6A 1DRKA 2HPZA 1AOXA 2IEDA 3GVIA 1CV2A 2H9AA 1Y6JA 1TYEB 3D6VA 3HKCB 2FQWA 2IYZA 3E9YA 3M6LA 1QU2A 3LQ2A 1D9ZA 2ZRMA 2JHCA 3WICA 1CQIB 3IQHX 2A33A 2PS1A 4LX0A 4QYIB 1V5IA 4EHAA 1SOMA 3GG9A 5BUQA 3I62A 2QSUA 1PR5A 3B6MA 1G3IA 3B6ZA 3EXIB 1ESNA 3DONA 3M3PA 4FJ0A 5L7YA 1ILEA 2O0MA 3QLEA 1DOZA 1AQIA 1BW9A 3K7EA 5TIIA 3P0IA 4KJXA 3ZS9A 2AN3A 2HQSA 4HH3C 3D6TB 3V9AA 4NS4A 1LB1B 2QAGC 1PAUA 2GJSA 5DI3B 1QYDA 1Y80A 2ODTX 2PGOA 1QE0A 2XKAA 1FY2A 1FXUA 2H1RA 3BJZA 3IDAA 3RTDA 4YV0A 1AF4A 1YWGO 2ZM5A 3PHIA 1JIIA 1FIUA 2QRVA 5DW0A 2C4HA 2N1BA 3ILHA 1KO1A 2QD5A 3D6NB 4JXJA 4R0VA 4JI6B 4G0UA 1T6BY 1Z34A 3HGQA 2F90A 3TZLA 5AXBA 1QB7A 4ZQBA 1OC2A 1A7AA 1R0SA 3AVYA 3I2FA 1J7KA 2PL5A 3CZQA 4K9PA 4ENUA 2HWKA 3ED1A 1S96A 3JYHA 4H60A 4J6FA 3M4ZA 2HA7A 1CUVA 4PYMA 1B26A 2AL7A 4NVRA 1NQVA 4DQVA 4WK6A 3HFSA 3HVKA 3OZUA 3JAWB 2CV2A 1C4WA 4CIDA 5K8IA 2DQZA 1PZXA 1W0JD 1N5RA 2CUNA 1WMBA 3DB1A 1IK4A 4N0MA 1YZQA 1L4EA 1CY2A 2DG2A 2H0RA 3K9BA 4Q3NA 1BEEA 5FI1B 4NU8X 1KOFA 1TDJA 2AC7A 3EFHA 4LJ6A 5HWSA 1YRWA 3FVRA 2FUG6 1P8AA 5JNTA 2VPYA 2WP0A 3N05A 1XELA 5ELLA 5BW6B 2JBWA 2XXAB 1CUDA 2FHPA 4J43A 4PICA 3ZI4A 2WMYA 4DDMA 2C9ZA 4OKNA 3U3XA 1VGVA 5EHNA 5AJXA 2PLFA 2VHWA 5KQPA 4GOXA 1J4AA 3ANMA 5CCXA 4P7JA 2XCLA 1Z4NA 1LW6E 3HDVA 1W35A 4I50F 4LZAA 3K5PA 4Y2UA 3O8OB 4YDRA 1XAHA 4MPTA 2DEUA 4IUCS 2H9IA 3HXLA 4RSRA 2JGDB 3QFCA 2IHUA 3FZQA 4XGNA 1H3FA 5AK4A 1XTTA 3G0IA 2WE7A 3PNBA 4RGVA 3NVMB 1DFHA 3H2ZA 1YNSA 2XMPA 4K1LA 4WIAA 4UMFA 1VJTA 3S2YA 1V7QA 2PKXA 1WXGA 2JL1A 2QGNA 4HH0A 1XF9A 5KIAA 1SHLA 4W9NA 4JC5A 2WD7B 3CW2A 4AKGA 2H1LA 5GVSA 2DZDA 2IQ5A 4WI1A 1MJGM 5KWVA 4IUYA 3R20A 1XMOB 3COZA 5EP4A 3AR2A 3R5KA 4W82A 2QYOA 3ECCA 3UHOA 3WOHA 2I1VB 1U4NA 1T0JB 4MI3A 5KJ1A 2QUBA 1U5AA 2GWHA 3HJBA 4YROA 3A0UA 4RH3A 5SV2A 4I55A 3VOTA 1NR5A 1JHZA 5J3JA 3ZDFA 2PLNA 4MUHA 3UAGA 1TGYA 2C4UA 1FSPA 3FCEA 5K01A 1LV7A 4DILA 1IWPB 4L50A 3E7WA 2BT4A 1QB8A 3OPXA 1OX5A 4BX8A 3FETA 4KI7A 2Q5IA 3G2PA 4REQA 2TMKA 1F8YA 1YHNA 2XA1A 3IT1A 3R6LA 3NTLA 2OHXA 1V5GA 2DFTA 1JMKC 1NXVA 3AF6A 1G3RA 2OVFA 3ILXA 2WZBA 1NLMA 2QYTA 1AE1A 1M6YA 2UXCB 1E9BA 1G7RA 3F3KA 1DBVO 5ALDA 4IVNA 3UAWA 1TZCA 1UPXA 3HO1A 1EWKA 2WJHA 4O4IF 4D9JA 2X4IA 3VVBA 1YBAA 1E2GA 3QLJA 4OHFA 2O57A 3KAQA 5B2ZA 2AW3A 3GHHA 4KV7A 3RVKA 5IS2A 4RQBA 5JCJD 2HDNB 2IYRA 5I4IA 4XX0B 3AINA 2DQSA 1QSGA 3IJEB 2VN8A 1GTG1 4ITUA 3L1JA 4MR8A 1SCKA 3GRCA 3RS9A 3BHJA 4B09A 2I6FA 4LVOA 3PUYA 3Q0EA 3GT4A 5DASA 3URKA 3C45A 1PJTA 2PS9A 4MGKR 4E08A 4ZZ0A 3BK7A 3ZZ1A 3GROA 2BEWA 5EWMB 3QU7A 4EG4A 1EM8B 4B45A 3ZDQA 2HIGA 3A2MA 3EA0A 4E88A 1EZ4A 3ROTA 4H16A 1REQA 5B4TA 1IQUA 4GI2A 3SYNA 5BNWA 1WULS 2RGGA 5HX7A 3AQIA 1GAEO 1KDZA 2C8KA 2JANA 2WTUA 2PUGA 1MZPA 1Z8HA 4C88A 2XNDA 2DWCA 2EU8A 3DE4X 1JQDA 1R8YA 1QKKA 4WADA 3RT9A 2ZSIA 4ZYXA 4MNTA 5BYJA 3ZGOA 4LGYA 4W1QA 4WN3A 3PD1A 4I5FA 4PC1A 1T2EA 1UBTS 3ICOA 1MRNA 2O7NA 3MPUA 3OIFA 2WFMA 4IKPA 4IR7A 4ZO9A 5AKGA 1CR4A 4RL6A 2HJRA 3A1CA 3BWVA 1M73E 4RDCA 3KB2A 4JVMA 5CR9A 5FNVB 3WX0A 5LDDC 3ZWNA 3LPMA 1UZMA 3DHNA 3K31A 4BIMA 5G1PA 2HW8A 1QKIA 3D1VA 4QASA 4M88A 1KKMA 1ZH2A 2J7PA 3K8YA 4HVAA 3WLTA 4AG6A 1PYDA 1IUNA 1YC2A 3FG9A 3GJ8A 2AFVA 2CDCA 3CLUC 3KHTA 4YDSA 4BQNA 1UMCA 4TM7A 2YZ7A 1G4HA 2B5OA 3KL2A 4F4IA 1DZIA 1CUUA 1R0BA 1KJJA 4LJ9A 3NHJA 4XGRA 3IOYA 3TIVA 5CGZA 5KHLB 1CUHA 5FOQA 2Z43A 4RWEA 4JQZA 3SM3A 1ADJA 4OHXA 1QRRA 3CRRA 1HDRA 2YV1A 1G8JA 2BFDB 5EUCA 3T5GA 5K6AA 2X9VA 2V1UA 2AQHA 4RA9B 3TIIA 1BXGB 2KPOA 4WJKB 1NC1A 1BYIA 2J30A 4JJ6A 3MD0A 3TQHA 2G6BA 4NK4A 4EM6A 1IB0A 1LTHR 4JUAA 1OB2A 2I3DA 3KVRA 5A3RA 3R3SA 2W2QA 1AUXA 4BX2A 5IKEA 1W1IA 2JGEA 2UUPA 3LA6A 2NZ8A 5KBYA 4DV3B 5AP9A 1RKBA 3K6SA 1WVIA 1OTYA 4WASA 3G5LA 5T64A 4PS1A 1B4DA 3WLAA 2GEVA 4UZSA 5J2UA 4B3MB 5EHXA 4IG4A 4C7BA 2IYSA 1R88A 2XOEA 1K7SN 2TRSB 5LQJA 4E11A 1WEHA 4GPZA 4CMCA 3MTQA 1YVUA 4PSUA 1WOYA 1O08A 3IV7A 3Q1KA 3HCEA 2G9UA 1CR1A 1TYZA 1V45E 2QLNA 1KYIA 1EFPA 1W59A 2LBPA 4FYVA 4K81B 1PT5A 3PIIA 5E3HA 3PYXA 5I6DA 1YRLA 4NBTA 4YAUA 3F49S 2LNDA 3WK8A 3IQIX 5H9WA 1RHJA 3OWHA 3TZQA 4W1RA 1KI4A 2PKEA 5C8XA 4FWTA 4MWEA 2FETA 2VLIA 1LRKA 5FOTA 5KTYA 4B3RB 3TIFA 2P2YA 1DKLA 1Q0ZA 4QYMA 3E6AA 4L5IA 2VDJA 3BJRA 3ZU3A 3PC6A 4XWGA 1GFZA 4DDWA 5DM0A 4RTMA 4MRMA 3MS7A 1T8UA 1YS7A 2FZLA 1CZKA 3DOEA 3OSZA 3IAS6 2LPMA 3LXMA 3NANA 4MINA 4XIYA 5AW1A 5F3WB 2CT8A 1M66A 2BTQA 5C5CA 1UAYA 3G2HA 5K8CA 3B1FA 3OZTA 1KEWA 1ORDA 2R0QC 1CQZA 4HHEA 3ZCTA 1VJCA 4KFCA 1K8QA 1N5MA 1XZPA 2XV1A 3EIXA 3ETDA 3I8OA 3KQQA 3LW7A 3Q8XB 5JI3E 2VR1A 4ZAYA 4IIBA 1ZGCA 2VBCA 3P52A 4MV7A 1CY1A 4UMEA 5TJ9A 2ZJ0A 3FNIA 1WZIA 1ZNZA 2YV5A 1FFGA 3GRVA 3MUFA 3HN6A 1DEOA 4QBKA 4JJZA 1NLFA 2ZIWB 3PQ3A 3K0CA 1NXWA 5I9SA 4ZVKA 1I80A 2OMKA 1EJ0A 1FNBA 2QG4A 3ID6C 3QY9A 4EZIA 1SBQA 2W6JD 4YREA 3C5WP 1RYMA 3BXGA 1RRGA 2QW1A 1D6SA 2O5CA 5IVIA 5AKXA 1LI4A 1QIEA 5L6LB 3HB5X 3TMYA 3D6MA 1Y7PA 1HT2E 4FHGA 3GLIA 3JALA 3W1VA 1LNZA 1X7WB 1SCQA 4I6JA 4V0SA 5CXUA 4W9MC 4G97A 2PMEA 1P4RA 2BUAA 1K66A 3DMRA 4WOKA 1DINA 4MGYR 3ADPA 4AJLA 1C2TA 1JA0A 4KWEA 2X1HA 3WL7A 4XVHA 3ZIAA 5IZ4A 1L5OA 3H5AA 1CJKC 1NONA 2CJWB 3LOPA 5E38A 1L7OA 3NKLA 2G5CA 5B6IA 4MPJA 1PS9A 3GN2A 5FAKA 2ONJA 5TX7A 1WEKA 1QCZA 1HLDA 1ISGA 1M2VA 4YAEA 3D0RA 3U40A 1JHXA 1H9BA 3ZHYA 1NF3A 3LUJA 1Z35A 5EERA 1SUFA 3RIEA 2YMQA 1GTMA 2QTFA 2VJNA 1B8OA 3V7FA 1O6GA 1S01A 3KLBA 1FVHA 3Q12A 1J70A 2FFQA 1R8JA 3IUSA 4UNPA 4Y1RB 1WLYA 3N6XA 2EJWA 3C6KA 2CL7X 2JGIA 3B7GA 3BXZA 4J7UA 1UMBA 1NQ5A 1Z29A 4V3BA 5WRFA 2Q5EA 1RKQA 2XRFA 2ZI4A 3T1NA 2WIBA 3JQAD 3LCVB 4YCMA 3HR7A 1ETHA 3CFYA 3PDCA 4U0KA 3N2GA 4NE9A 2P9ZA 4ZV9A 3WBBA 5GP1A 2C92A 2AG1A 1I1HA 2AI3A 5GONB 5I7WA 3KQPA 3NORA 1I6KA 1US8A 3QOFA 3LY7A 1U3VA 2FWRA 2O6HA 5CU7A 3ASUA 1M2WA 3W3AD 1DIOB 1SC6A 1J8DA 3KWJA 4MYUA 3TCXB 3AYZB 3Q8WA 4DA6A 1B0PA 1XD2A 2DSTA 3I9V1 4UE2A 4WVLA 3RKUA 1MAAA 5D5HA 1C3OA 3FDFA 1KJYA 4RD4A 4FR0A 1X38A 5F7JA 5BSFA 4KI0A 3RWBA 3RYIA 3C39A 2MMCA 2K87A 2B8JA 3BRSA 3M2TA 2YDXA 1IM8A 1JG1A 3LCUA 2PWBA 5IC5A 3PFGA 4TV8B 3SVLA 1R0RE 5AJHA 2F1OA 2OG1A 3MMXA 3JQBA 3KBBA 4GPEA 4MW2A 2AR7A 3WFIA 5DBIA 1XB2A 1Y8RA 4EWLA 3WMEA 4TKVA 2GCOA 2IP1A 3FUUA 1YO6A 4R2KA 1PUXA 3JARA 4KC0A 3DHEA 1E1MA 4K86A 1Z8FA 2QX8A 4FFBA 2FSFA 4FN5A 4DQUA 5HPYB 4RMIA 1R0WA 1E8NA 1YHZA 1TI7A 2QU8A 2J07A 3B36A 1SM4A 2XADA 3PQ6A 2YN2A 5IH3A 3D3WB 3B6EA 2GD6A 1FRZA 1A5SB 2MSEB 5TPZD 1IM5A 5CCBA 1SWWA 3E9RA 3GAAA 1XMXA 2G1JA 4QQNA 4Y0NA 1FVXA 1FS5A 2VDWA 3TX2A 1FMLA 3FOZA 2AWOA 2Q3DA 3CLTC 4RZQA 5DYWA 1E5TA 4Z3DA 5AM3A 4RTQA 2HQBA 4XGKA 3Q9SA 2IS2A 3CG0A 2CEAA 1QCYA 4HWTA 4KXNA 5TVGA 3B82A 3KSUA 4HQFA 4DMFA 4OU4A 4EPYA 1TZ2A 5KO2A 3THXA 2IBSA 4A82A 1KYXA 4D3SA 5C46F 2QE7A 1D4AA 2ZTLA 4JK3A 3KALA 3BIJA 1NNEA 2P5YA 3F71A 3GF4A 2VYQA 3GRYA 1XRPA 3R5SA 2G71A 3UWOA 1QDUA 1QKJA 2ST1A 3F6CA 1YVPA 3WWCA 3KD2A 4PZ0A 3X2EA 5EJ9A 3QQPA 1H2HA 1K9VF 4GVPA 3JQGA 3UV3A 4M8LA 4EFDA 4LV8B 3IR6A 1EK2A 4M7RA 4XDZA 3DOIA 1XQ1A 3PGLA 4N3NA 3WGUA 1Q7EA 1ECGA 2AOXA 1Z4KA 3AVWA 3A1NA 1L4YA 4B3XA 5C3MA 1W29A 5EIAA 2YHUA 2V3VA 1LS1A 5LP6B 1R6XA 1OFGA 1NZFA 1U9JA 3ANYB 2RGNC 2C4KA 1UDWA 3L43A 1IQ0A 2BGIA 4LZOA 3VYUB 2A0KA 1E3SA 3JTEA 4Q4AA 3DFUA 3AJDA 1UOOA 1T8RA 1X87A 2IIQA 3KCQA 1ACLA 3QVVA 2FPPB 1NYLA 2C54A 5H68A 2W6IA 3SF8A 2C82A 4KQGA 5JDIA 4RZSA 4FFVA 5CIQA 1E59A 3Q3CA 1M2OA 4E13A 2XQKA 5HOEA 4KR6A 1V6SA 4ARZB 4KSYA 4B4UA 3JD3A 5LQKA 1JG7A 3HBMA 4DCTA 3F7MA 3WKCA 1IH8A 1H1LB 3STYA 5BRJA 3AUKA 4KOAA 3OQMA 2D1TA 3STWA 1LKZA 1YASA 3UB2A 1YBFA 2RG7A 5CDTA 4TLBA 3F0TA 2BCEA 3B1KA 4EA8A 2XIQA 1T2NA 3TG8A 3F5QA 3NHPA 3OX4A 2FEOA 4BLQA 5JHGB 4MKZA 1X7XA 1Z08A 2YJ6A 4OJMX 1ZWLA 2HO4A 3UHFA 4TUYA 1XVUA 4J0FA 4HSEA 5EZ6B 5AVKA 3HEAA 5L51A 4CF7A 1KYTA 4EY5A 1UJ6A 5TLSA 2XYGA 2R65A 2VCYA 1EG7A 1QGUA 2Z1MA 3JWIA 1W49A 3H7AA 1FXWF 4P22A 1UEIA 4QU0A 4M1EA 4GH5A 5J63A 3U3MA 2B9EA 3CG4A 1P62B 2RONA 2Y1OA 4C1BA 4RF5A 4IHAA 2GKGA 1LJ8A 1LPSA 2IW3A 3NAMA 1YB2A 5E7QA 2AD5A 2ZDGA 3M4NA 5K03A 4R0NA 1DQZA 3DHWC 4TXJA 4YRTA 5CAEB 3U16A 1SRQA 2BR4A 1XPRA 2H4HA 2DY0A 2BEJA 5IHXA 1ZD4A 3E2IA 2ORVA 3INYA 4GX2A 1QZ3A 5D3QA 1G9SA 3D2CA 3WWDA 3BUSA 3LSYA 2JFPA 1EQUA 1SD2A 1KP2A 1IN5A 5TT1A 1RPTA 2E48A 3BICA 5ENVA 4L74A 3KELA 4XLLA 1GZUA 1PF7E 3CLUD 4HWGA 4IF4A 4DL9A 1CPYA 3NONA 1BE8A 1AKUA 1IAQA 3MZ0A 3PS9A 4II2A 4KN8A 1FFAA 2A4MA 5IM4A 2QUIA 3P19A 3QE9Y 3TDNA 1NXSA 4PPFA 4HLUA 3T5BA 4OY3A 5AIAA 3PC7A 3TO5A 1Z7GA 4NICA 5LLTA 4ID9A 5DKFA 1C9NA 4MO9A 4IRUB 3ZY3A 2YVQA 2P6RA 1AIPA 3ELWA 3THOA 2B0CA 1O7JA 1NRJB 1UJNA 1GGJA 1ZCJA 3EC1A 1QV6A 4NAUA 4DG5A 1WHSA 3S40A 3L40A 3FPBA 2PZKA 4LF5B 2IS4A 2YFYA 3V9PA 2YZGA 3DR3A 4PPQA 4QYXA 5B12A 1WV0A 1DTWA 4C6RA 1SC9A 2HQRA 3FJYA 3KIPA 3LQQA 4MAAA 1OF1A 3H5OA 5JXIA 1EK5A 1OTXA 3BK1A 4GPAA 3N2NA 3W2EA 1FDUA 4G0OA 2OFWA 4N6OA 3VR2D 4CEJB 2EBHX 3HA2A 3PNMA 2JFFA 1UBGA 1ZKMA 4D92A 3F4BA 5TSDA 3BA1A 4MQBA 4XB2A 4LVCA 1CY4A 4PG8A 4HT3B 4D8YA 3P0EA 5AI6A 3OFND 1EP1B 1THMA 3Q7TA 3G2NA 1FDRA 4V1CA 5K20A 3P2IA 5E6RB 1JTFA 1RC1A 4IDCA 3UWSA 1LDMA 3HKBB 5C1IA 5KVAA 3VR6A 1EFKA 2AQIA 2QAGB 3AB7A 3O6VA 2NZXA 3B6JA 3OPQA 4LNHA 1EB9A 3RG2A 3ZX5A 2JGAA 4JUBA 3ZBQA 4B7ZA 3ND5A 4RFSB 1B8PA 5C3UA 4MB2A 3GWZA 4W5WA 1E1KA 3W79A 3JQAB 1V5WA 3ISTA 2Q8PA 4W9NC 4PONA 4GOOD 4P1ZA 4B47A 4BQFA 5JFTA 1UPBA 4RAQA 1XNQB 2IOQA 3EZLA 3IIJA 4O59O 3UMFA 1BVHA 1B7GO 3NATA 4AICA 3ZHOA 1SCUA 1GZDA 2RGWA 3IDZA 1YTUA 3QYPA 2ZTHA 1I2ZA 4JV5B 3DFMA 1VLZA 3QG5A 3UPDA 5EHZA 1J20A 1IE3A 2R25B 3ZZTA 2ZXEA 1I3KA 1FUKA 1H5QA 4Q4CA 3R6WA 2OCXA 2QUKA 1G60A 2GD1O 4WY5A 1Z2EA 3A4MA 6ADHA 4ESOA 4CT0A 4WT7A 5KYTA 4WK4B 3DPSA 1L7BA 1T8YA 4G8CA 4H0CA 4AJJA 5IVHA 2Z6UA 2C3UA 2Z4RA 4GAEA 1NTOA 2YIDA 5CB6A 1R18A 4HGZA 4PQEA 2QRMA 1SD5A 2X9GA 3GBSA 1AB6A 3ESBA 3PDUA 3B60A 1CYEA 3EVCA 5AUPB 5L9AA 2IXBA 2DLDA 3DFFA 3CWZA 4ISBA 3S2SA 3CX7A 3WA7A 1Y8AA 2QZZA 5C7OO 1RXYA 2P65A 3EG5A 3LBFA 2X3YA 2XY4A 2NZVG 4CKCB 4OK5A 4BVGA 3QSYA 4CNBA 4QRHA 1PDWA 3CGWA 4GEKA 4C7KA 1F20A 2C2KA 1Y7IA 4HL6A 2PNFA 1T3SA 2GN4A 2NZUG 2WHXA 1DWQA 4MS3A 3NDRA 3NP7A 2BFCB 4MLCA 3NM6B 5A2QA 1NSTA 3ZCSA 2FR8A 1MA0A 1OSNA 2H08A 2ESRA 1QTIA 3L9XA 2RBKA 1W94A 4RVOA 2J08A 3WGZA 4F3TA 1CUEA 1AT1A 1DIAA 1WLSA 2LDXA 3CRMA 1KJNA 2ZCUA 4PZEA 5ALHA 2AHRA 4EL0A 1JT9A 4TLEA 2YTZA 4M1SA 2HY7A 4B82A 3SVTA 4AKEA 4DCMA 2AB0A 3RS0A 2DYKA 2VZ9A 3TZEA 3BGSA 3W90A 4BRZA 2OECA 3P5SA 1KK3A 1H3NA 2UZ1A 3OX2A 4I2VA 3SQWA 4AWXA 1MX5A 1R0ZA 3EEQA 3GLRA 3NEAA 3EXEA 2JJMA 5HK8A 4KR3A 3RC8A 4FS3A 1SU8A 3P4XA 5JZSA 5MN6A 4DJ5X 1WZUA 3WGNA 5DM2A 2VDRB 2ZDQA 3U2QA 4UQPA 4V0LA 3MS4A 3TCKA 3VZDA 1DKNA 1CERA 1QX4A 4FR5A 4AF6A 4AN0A 4MI1A 3VR5A 1KF0A 3DOFA 4FMCB 4X8MA 1SVMA 4DTIA 2X0FA 1NM5A 2I7XA 4KQ1A 1XTRA 4MVJM 4TKZA 4S3MA 2B69A 3R7AA 1OH5A 1G9TA 1KMHB 1U7ZA 3ENZA 1NW9B 1LA2A 1WP4A 2RBEA 4OL0A 4R6XA 5BNFA 2YCBA 3D0KA 3P27A 3ZN2A 2M9MA 2C95A 2QA5A 3AL3A 2GHIA 2J87A 2JJ2A 3VVCA 4WY2A 3ZH9B 4D0RA 2WSMA 3R5FA 5JMOA 3IQZA 3QX8A 5EJMA 4CGYA 4M7OA 3ENNA 1EFVA 4V2IA 2N1MA 4MO2A 4QUJA 3M1IA 1YOVA 5G0VA 1U04A 2GEKA 3R3JA 4JCOA 4MV8A 3DL4A 2FR1A 2NW6A 1YXMA 3QKWA 5FA6A 5ECDA 2G4CA 4QG3A 5F1OA 1K08A 5K6AC 4HNQA 1LV8A 1JAIA 3GH3A 4R5HA 3PE3A 2PGAA 4YB8A 3CVOA 3NBUA 3S4YA 5I47A 3FFWA 1NQXA 3CZ9A 4UAUA 2YR0A 3GR6A 3S1AA 4O02B 4EG6A 4YGXB 1TM2A 2AFIB 4ZANA 2V74B 3BXHA 2WV9A 1DI0A 1PBNA 3G8DA 4EZEA 3AEUB 3DLHA 3H6KA 1WPXA 2JPDA 4B6EA 2F8TA 2QNBA 1XN4A 3H5WA 4KO3S 2GS9A 2LKCA 4PSKA 3V3TA 2PIAA 1AF7A 1GSHA 4V38A 3EUAA 5A7HA 3K0BA 3PENA 5DWQA 4WMLA 3QUBA 4IMJB 3QHQA 5SY6A 3P5BA 1Z7EA 3E8MA 1XTVA 2P77A 4GLJA 2AMLA 4ZQCB 3C3WA 3OY2A 4JUCA 1Z0DA 1T25A 3AJAA 3GFBA 1BDBA 3G49A 3IVXA 4GECA 5DX1A 3AOEA 3MJFA 1QF6A 5I7AA 3CLTD 3OZSA 1Z2CA 5HUJA 1X92A 4I1IA 5DGXA 4MW0A 1YJBA 2CXNA 3NBZC 3LFUA 1I2MA 1R9JA 3DUWA 3O94A 1L5WA 1K3FA 3E3AA 5TE9A 1OI4A 3F9IA 3H04A 2VT2A 1P18A 4X1KB 3P2OA 4FFLA 4KODA 5IAKA 4RHFA 4KIJA 4WZAB 5B58C 1GZ4A 4KH0A 1CCWA 3KSZO 4ZI2A 1WNFA 1J33A 2E1PA 3LP6A 1GU0A 4GGOA 2PEYA 4I3FA 4K2AA 1T8PA 4ZOLF 1HETA 4DT1A 2ZBPA 1EVQA 1Y8ZA 1NSYA 2CLFB 5FORA 1XLTA 3JVUA 1P0MA 3ACCA 2NMVA 4MRRA 4KGVA 3IVGA 1ZMRA 2ID4A 1XHFA 1XEAA 3RVLA 2GCNA 4PN3A 4IJWA 3FDZB 2NT4A 3NTXA 4E46A 4RXMA 1RW4A 3WB9A 1FNCA 1OH8A 2C94A 1TM5E 1K68A 1ZI6A 3E2PA 1YB7A 3C14C 4DSAA 2ZWMA 1MENA 1WDLA 3BMQB 3CA8A 4Q9NA 4GMKA 4I4TB 4QOFA 1H22A 4DLLA 2PFKA 4FW9A 1TKAA 4CBVA 4C7JA 3MT8A 2FPLA 5CFRA 1K89A 1XDSA 2VDMB 3IB6A 1Y7LA 1A97A 1BVUA 5T4HA 5FLXA 2P2CA 2Z1NA 3DVLA 2ZYSA 3TPFA 3L1IA 4MW6A 5TQ0A 5BQXA 2WM9B 4G0ZA 3RUCA 4LV6A 1M8GA 3K0CC 2WVHA 3WFZA 1C0KA 1RYNA 1PWYE 2LWIA 2QT9A 5COAA 2H6EA 2ORIA 2IDJA 1H69A 2QI9C 5MFPA 3BXFA 5C53B 1T4BA 3HL4A 3IDQA 2F48A 4OG2A 3PTAA 2WNSA 3RRYA 3FOWA 3GD5A 3N8DA 1U7UA 1TMOA 1EFAA 1K06A 4P82A 3OQIA 4HEJA 1E77A 3IXQA 5H4GA 1BCRA 1QLWA 2H2FA 3L6DA 4G0QA 1MB3A 3AWDA 1WVMA 1F5NA 5KNCH 1BJRE 4DMMA 4BBAA 4DA9A 4NOJA 2OHOA 1M10A 1AKVA 2WOJA 3T4UA 3D02A 2B4AA 1SHZA 2BBSA 4NMMA 5E1OA 1Z4MA 3HLTA 3LY8A 4UBLA 1JR3A 1TIKA 2O3UA 2P2DA 3DNMA 3OMWA 4C0SA 1V41E 5JSHA 2CHFA 1Y82A 4BY9E 1SVUA 1I4EB 3HLYA 2R9VA 4MJ7A 4F1KA 2X77A 4WBNB 1CIPA 2XUJA 3GZNA 1XNHA 4X6UA 5LXTA 4D42A 5BR4A 1R9NA 4E2XA 1YCFA 3IE0A 4LW8A 3V4SA 2J6BA 2ZYRA 2VWPA 4BNYA 5C18A 2R68A 1FMFA 1F0PA 4M6WA 1SKUA 1Q3KA 4J0GA 5FCDA 3EJWA 4LIPD 3ZV4A 4DCUA 4AN1A 4BO4A 3GLGB 2G28A 1JJBA 4R7ZA 1RI5A 1T34A 4DIUA 4I4NA 3T3IA 5BMOA 3INGA 4S35A 1B6TA 1QORA 1RLTA 2EP7A 2V6JA 2XKBA 2JG3A 2V58A 3INRA 1QYCA 1IN7A 5CA0F 3IMFA 3LHSA 3CVUA 2CUZA 5K7SA 1QHIA 4V3CA 4UU0A 4QJ5A 3LKBA 1MTOA 1WSWA 2IBMA 4B48A 2Q2WA 2IH5A 1X1BA 2P7HA 3BCSA 4CW7A 2CHVA 5L3SA 1RLMA 1OBCA 4Y2VA 3RWOA 1SOVA 4WXHA 1T0BA 2B4YA 2QM8A 1R15A 1KZ9A 3OJFA 3TLCA 3W2FA 1MW8X 1DUSA 1UDCA 3GJRA 1GYRA 4B3IA 4Y2YA 2CXQA 5EFOA 2KYRA 2ZTSA 3EXHA 3JYPA 4EQ6A 1R27A 4UUNA 1MA3A 2IYLD 3EFBA 2VA9A 2C5FA 2IZOA 1C0PA 4KOEC 1JDZA 3SHOA 4JOQA 2YVLA 3JQBC 3UJ9A 1ZK1A 3UMCA 4B7UA 2X0EA 3Q85A 1G4UR 2GSDA 3NO4A 1NXXA 1SB9A 2ZWVA 5E2BA 1XZAA 1XCOA 2Q62A 3K9GA 4NU6A 4N18A 1U8EA 2WMOB 4DUPA 3QV1A 1HFJA 1IUPA 1MJNA 1WJGA 3VTFA 1Y3CE 3CN7A 3DYIA 4JD5A 3ZHVA 2P75A 2QJRA 4KV9A 3RAFC 1OWPA 1OYWA 1ZHHA 3LU1A 5SYNA 1I7DA 1K4MA 4EYEA 1RQPA 3PGVA 3B7PA 1ILWA 3BL5A 4QU8A 3U49A 2VYFA 4HWOA 3FOFC 1SJ9A 2IEAA 1I6WA 3MERA 2TSYB 1Y9DA 1U8FO 3PCXA 1QVAA 3SS8A 5K3BA 5DM1A 2XZOA 3VDQA 4FDVA 3TMKA 1ECCA 2GERA 4UQOA 3TAUA 1U5BB 2O0LA 3KJFA 1H2FA 3OLWA 4V0QA 4HXEB 3RFUA 3RSLA 4G5OA 2W9XA 3SNHA 1F60A 4LZNA 1S02A 1Z2AA 1KK2A 4F4UA 5J4HA 2VUTA 2Y71A 3U6KA 1G8SA 3A4IA 3ASYA 2O54A 3HA5A 1LWOA 5D51S 5AM1A 2H85A 4U2CA 1C30A 2YYAA 3A9SA 4RX1A 3ROQA 5A2GA 3AM4A 3O4IA 4DBLC 4ZHSA 4XD2A 2GK6A 4CV3A 2IH2A 5F33A 1DG9A 1K0UA 3BZWA 1BS1A 3BD6A 3OZCA 4BRSA 4JZYA 5KSZA 3L0SA 2Z9CA 3P8ZA 2P78A 1ZESA 4OGGA 2N75A 4FBGA 2OCDA 4QNMA 1KVUA 3Q5EA 4YRLA 3SDZA 2HA5A 4D0GA 3VH4A 3IAAA 5JJKA 2F43A 4QOEA 3ZWWA 1I10A 3IUNA 3KD3A 4FS8A 2O6LA 3IJ5A 4FE7A 2ZJAA 3UJNA 2B34A 1WAMA 5EVCA 3PJGA 4PNEA 2O0KA 1GQSA 1UXIA 2FUG1 1YR2A 1PEAA 1RADA 2Z0MA 1HLGA 4GMFA 1IZ0A 4JHXA 2VP4A 3BEDA 4KXUA 4LJ4A 5CX1B 1M7GA 3VR1A 3KE9A 1PK9A 4P3NA 3WRVA 3ZVLA 3LI2A 2A1UB 2DGDA 2O2DA 1Y1RA 3K1AA 4LDRA 4NU0A 1YA4A 5ALIA 2Q8NA 3NJ8A 4B46A 3E70C 4MYDA 2ZB4A 4LC1A 5EMNA 4Q82A 2YY7A 2V7WA 5F21A 3O38A 2R6DA 4MLZA 3VYRB 1H65A 1RAHA 4WX2B 5ANRB 2ZI6A 4UFNA 2IUYA 4Z9YA 4G1MB 2H8KA 5HCUA 4PGGA 3PQDA 4Z5XA 4FBLA 1TUEA 2MYUA 5BR7A 1EX1A 1U6IA 4N8EA 1UJ4A 4MR9B 1O9GA 1ZNYA 4UXHA 1M1NA 2WMNB 2OV3A 2SNIE 2H2AA 3R2JA 4M7PA 3KT3A 3BH7A 3FW1A 3RF7A 1DJMA 5JJIA 4NP6A 4Y6SA 4BLPA 5ESXA 3G0CA 1FDVA 1ULUA 2LD4A 1C3JA 2JGFA 1UFOA 2XNDD 1V96A 4LXXA 5ALQA 4ZAVA 2WTMA 1ZGBA 1KBOA 4WZBB 1KJQA 2XNHA 3U7GA 1GPMA 1N25A 2R7AA 4N8SA 3AKDA 4BJ6A 1Y4AE 4ARCA 1USIA 3PEVA 4QT4A 1X1RA 2C0QA 3MJ4A 4UREA 5IAJA 3ZE8A 3F78A 4ZVNA 4X00A 3VC2A 1WXFA 1MB9A 4HF7A 3FTPA 1FYEA 1C3XA 1QJCA 2FLWA 2P27A 2XD4A 4F2HA 2BMJA 3TSOA 2HMYB 4RS3A 3ZV5A 4C4TA 1GA6A 1XVAA 1EH5A 1JXQA 2HRDA 3DDHA 1W8IA 2ZR8A 3NEYA 2EQ5A 4GEGA 2NU7B 1JHUA 2HMSA 4OQYA 4UUOA 3PXGA 4ZEMA 1R37A 4PGFA 3UA4A 4RPJA 5AVTA 1P9WA 2J7PD 1UBEA 1Q0TA 4KMMA 2ZI9A 1UK9A 2QY6A 3BMNB 4M49A 2YS6A 4GGPA 1SZPA 3SX4A 2J4FA 4RD1A 5DTQA 1L8QA 3MWEB 1H2AS 5LP1A 2YUIA 4LE0A 1ZGZA 4HLUC 2CFOA 1Q1EA 2PZLA 2YRXA 4JWKA 1VIDA 5A3VA 1HEIA 4QNRA 1KNXA 3KSMA 5DSTA 2H4FA 1DAIA 1RE0A 3NIWA 5J5VA 3L8DA 3GMIA 4NCKA 3DNPA 1EVLA 1VYUA 2GM3A 3LH5A 3ADKA 1X74A 3UUFA 1Q0RA 5AW0A 3MINB 1XA3A 4HADA 2AMJA 2X2PA 5EZ5A 4FXOA 3OPMA 4MKFA 3KZCA 2H8GA 4MWCA 4Q3AA 1F0YA 4DBZA 2QTMA 1IG0A 3OIGA 5AMXA 4CQMA 1N2EA 1GIAA 1GKKA 4FI3F 1VTKA 1W8DA 5LDGA 2UU9B 2NG1A 1JH9A 1FU7A 5P21A 3ZXUB 5CW2A 2HJHA 4WFKA 2D1FA 3D7NA 3KPYA 3WMRA 2D7JA 3C41J 1RAEA 3M6FA 4QHTA 1R4NA 4PXSA 4IOKA 1BW9B 1N2CE 2QIPA 2JNWA 3TAXA 1VIYA 4KL8S 421PA 2DH6A 3VISA 4JXKA 2XXBA 4W5RA 1QTNA 4B2PA 3NHZA 2CK3A 5KU7A 1BXKA 4TL7A 3I1IA 5EE0A 3UZUA 1E4EA 2QRVB 2NSYA 3DW1X 1GU1A 3AR9A 3ADCA 2WJVA 1TK2A 4P3KA 4CU2A 1MIOA 1USGA 2ENWA 4H18A 1KWKA 1ZN8A 3RLIA 3F2VA 3VZCA 3Q41A 1COZA 2R6GA 4JELA 1BIFA 2NYUA 4M9UA 4BB6A 4MS1A 2WKSA 1AUVA 1RYZA 2GZ2A 1RXWA 2HCFA 1YCHA 3FMOB 1FZQA 4EH1A 5L3QB 1M0TA 2KW5A 2QAJA 1XCJA 2FWMX 2RI1A 3LZ6A 2HL6A 2EZ4A 3IQDB 1N57A 3K0HA 3TXYA 1H9CA 3PJRA 2Q7DA 2B3TA 5K3EA 2YHIA 5LLSA 4RF4A 3PFCA 4UD6A 2XCUA 5BQFA 1W76A 3L6UA 5MN4A 5DN9A 3EF3A 1LLUA 1XDUA 521PA 3FVWA 4AJOA 2ON6A 1VKZA 3IAUA 4PLHA 5COBA 1OHHA 3CNEA 4YK7A 1JPJA 1N2JA 2HEGA 3OJCA 3HV0A 2BDEA 3L0BA 2BF7A 3PYLA 2VL7A 1TQ6A 3NBFA 2GXAA 3TZBA 5CVTA 1WSDA 2MYPA 2OHVA 2D0PB 3BWCA 1M72A 3FR7A 3GPIA 1RRPA 2FW0A 3HCOA 3KK0A 2Y6UA 5JR3A 1DZ3A 1XZHA 4PNZA 5LFAA 5DX0A 3QHAA 2PX5A 3AILA 4C3OB 1Y0BA 2VQEB 3N9IA 3AW9A 3QI7A 1G2QA 2GN8A 4HC4A 3R3UA 4MVXA 3TNJA 3HVIA 1GVNB 2UUAB 2CWWA 4FPXA 1NJ6A 2VZLA 1TL7C 2CVQA 1KU6A 3C6XA 2ID8A 3PFBA 2GZMA 1Z5UA 5BWCA 1MQ9A 1Z9BA 2X8JA 2P8JA 4LUCA 1KE2A 3WP1B 4LOHA 2ZZNA 1QS0B 3IPCA 3QEOA 2FR8C 1EDOA 1P2UA 5U9CA 4LOLA 5TEVA 2HT6A 5D84A 3TTVA 4G0NA 3WQRA 1DLJA 4J3NA 3GT3A 2WY2D 1TF2A 3ZIAD 3AT1A 3ZK8A 1C29B 2NO0A 4KE7A 1HKUA 1CDOA 1SZCA 3TLMA 3UGTA 3FB4A 3UICA 1OFIA 1GR0A 1IZ7A 4I55B 2NOAA 2ID7A 3PLNA 1N2CA 5CW1A 2ZRCA 2R60A 5E8RA 3Q7SA 2Q3BA 4G0MA 4KIUA 1EYZA 2HT1A 2E82A 3GZJA 4JR0A 5IYZF 3VI4B 2PH1A 1AA9A 2C9YA 2PL1A 2JB9A 2UUOA 3WNBA 3IB3A 5AK6A 1YKGA 3OZFA 4GBMA 3VI3B 3IAS1 3UT0A 3TG2A 1J5EB 3OT1A 4C6TA 2P9QA 3ZH2A 4GG1A 5EEHA 3PK0A 3W6NA 1TM1E 4GWKA 3GLHB 5CP8A 1IJKA 1XZCA 3L02A 3O84A 3GGGA 3N59A 2BZGA 2JFGA 5LZ8A 1OZHA 3HKEA 4WBSA 1P6XA 2R751 4I1VA 3U39A 4DWJA 3QITA 2X6RA 4ZMRA 4CU5A 5FR2A 2E6UX 4Q3LA 2WUDA 1H4VB 2E4YA 4AY4A 3S8YA 1K2VN 1W46A 2A59A 3C3YA 3L7IA 4H6PA 3F4LA 4WDRA 4E5UA 3O83A 2WJ4A 4MR8B 2OVBA 3ZNOA 1UBSB 3OCXA 4RJTA 1MHTA 4B79A 1RVDA 3L8ZA 1DU4A 1DJPA 1JIVA 1GCUA 1SK9A 2BMWA 2IPNA 3HM9A 1ZAYA 4FUTA 1UPTA 2BEWB 2WZQA 3CKKA 3KHKA 5AM5A 3T5DA 4ENRA 1D0IA 1KVSA 4KUEA 3B1XA 1NVDA 3FUCA 3NWBA 1REQB 1QC5A 2MINB 1W1WA 1BZYA 3I01M 2QBYA 4PZZA 3WMXA 2C5SA 4B6JA 5IASA 5KTMA 1G8YA 4I5GA 4YRBA 2CF5A 3MT0A 1ABFA 2P3LA 4UM8B 1TM3E 2AJ8A 1YZGA 2CYCA 2E5FA 1A7UA 1CRLA 1YIDA 2F62A 5THKA 4Z4IA 3FSEA 2ZS8A 4CKXA 1XBTA 2ZIXA 4QDZA 3V8QA 2ZS7A 4Y1EA 5EIEA 2ZU6A 3M6UA 4LMAA 2Z5GA 2QD1A 3V1LA 1BROA 5GY7A 4AUMA 2Y1FA 1UANA 2X0NA 4HS9A 2QRLA 4JI8B 1B1CA 2IYEA 4J0KA 2I4IA 2NACA 4MRNA 3QA9A 4ALKA 4RNCA 4AMUA 3VA7A 4C0LA 1JECA 1MZVA 2ZG6A 3AOEC 4M89A 4ZVLA 3SMQA 4D5GA 3LA8A 4ZVPA 5L8VA 4JODA 1WSBA 1U7TA 2CE2X 2D1RA 1CUAA 4PPGA 5EJ4A 1ZOLA 1I1NA 5HZKA 2QE7D 4DC1A 2FHSA 5KNBH 2J9FA 4R8SA 4C07A 1JG6A 2IL1A 2OCLA 4X9XA 2P2GA 3VGPA 4MLPA 2FFBA 4G5GA 2YIJA 1BMDA 1EGMB 1HT3A 3WNVA 5HRUA 1C8BA 1I9GA 2R2AA 4OHRA 1RACA 3L1HA 3JWGA 3UANA 2BFWA 1J0XO 1CE8A 1NR7A 3UG6A 2OSVA 1R3UA 3EWNA 4QLOA 1XLTC 2PH3A 4PQGA 5E7MA 1AVTA 1XQWA 3KR9A 5ILOA 5TT0A 5E9WA 1ZJ5A 2AS0A 3GDOA 3DGFC 4MKIA 4BMSA 2VHEA 5JVDF 1FA9A 3BOSA 2RGBA 1VXRA 4GICA 1MGPA 4H27A 3ISJA 5M7EA 3PFKA 4BNGA 3EPHA 2B61A 2BKVA 1PFYA 4G5SA 4YMTA 3H87A 3IIKA 3PITA 3IHWA 2IPXA 1EDBA 3LBYA 4M86A 1B2LA 1PNOA 2R8RA 1X7GA 2CW5A 2FWAA 2GNOA 2W6ID 4WINA 4K6KA 5HKAA 4BCBA 1ORWA 1WZEA 1LPNA 2XBUA 1FLDA 1YHYA 2VHYA 4LRUA 5CG2A 4IIYA 1MO4A 3GXOA 3KXPA 3HCCA 3ZBTA 4CKEB 3EQ8A 1OJLA 3THYA 4MQ4A 1P75A 1I33A 1M67A 4YMSA 5CNKA 2WAMA 2C42A 4S1NA 1PP4A 1Z88A 3N58A 1P1KA 3A3NA 3VYTB 1ZXBA 4BB5A 3OLCX 3QVLA 3WLMA 1MUUA 4E31A 3QMMA 4H1TA 1C80A 3M0EA 2PJRA 1LEHA 4EFNA 4H6VA 1EFPB 1TT5A 2CVOA 2QEQA 4RADA 3HXMA 2ZJBA 2PXCA 2J9GA 3OX3A 2IHYA 1NVVQ 3OTQA 3TINA 5AICA 3K2EA 1ATZA 3VZBA 4KIWA 4MGEA 1VHJA 3IBFA 1YRHA 3QYFA 1SKQA 2XNKA 5CVEA 2Y1CA 3MUEA 2IELA 2VTBB 1NBME 2BGUA 2FSPA 3UKJA 4R69A 1EGQA 3BF7A 1EVYA 4RNDB 5JAPA 2WJAA 1S3FA 2V9PA 4F1WA 2NT3A 1TAHA 1IY1A 2C20A 3HYRA 2R5FA 4FFMA 5HM8A 1ZHFA 1DDIA 1M54A 3E84A 1JQKA 3LRXA 5CM8B 1YF3A 3A4LA 3VNSA 2DY1A 2NZWA 2KMLA 2Q50A 1GLNA 4UTZA 1VPTA 4TV9F 4QSHA 4ABYA 2XODA 3PX7A 2DPMA 3E15A 1Z4JA 2HLNA 4Z2YA 5HK9A 3F98A 2D74A 2B3DA 5BPHA 1E2DA 3IRUA 2QD4A 1WE2A 4QX6A 2ZW9A 5FF9A 1L9XA 3BSSA 1JQAA 4PG5A 3REGA 1LBTA 2ZJ2A 1QU3A 2F17A 2WIKA 3FHJA 5AVXA 1FU8A 5DK6A 2UDPA 3IHTA 5LA6B 1XRLA 3NFRA 5DNCA 4J0HA 1RJDA 2WTBA 1P9LA 3K9HA 1BFKA 1T8TA 1ESDA 3HMQA 1NQUA 1N4DA 4HATA 3A3OA 3LD9A 3IELA 3X44A 4LJAA 2QR2A 1ENZA 1TF7A 4PHTA 1Z7WA 2IVFA 5HJEA 1MRSA 4B74A 3NPMA 2ENUA 4PW0A 3GLIB 1Z26A 3CIFA 1B3RA 3CSDA 1HTTA 3JALB 1Z0ZA 3OLZA 4QJBA 2XD9A 4R8RA 4X93A 3TXXA 3L6CA 4DLUA 1JLLA 3PR3A 4ENPA 3EXHC 3SQNA 1TGVA 4UHFA 3ZJ5A 5A3JA 3KR2A 3L4SO 1A9RA 3C3AA 1K5GA 2BF4A 4G5YA 2H1CA 2KWIA 3MVEA 1DCKA 3DAHA 3KRTA 3SLKA 3BDIA 4CTMA 2ZKLA 5AK0A 2GAFA 4Q03A 1L4UA 1N2HA 1TJPB 2WIFA 1NBHA 3C3KA 3QJGA 4OQZA 1M1XB 5B1DA 4H3KB 1QFYA 4MHTA 3GCGA 4GF5A 2COUA 1IUOA 9MHTA 1RLOA 1NY6A 1ZGGA 1M2VB 4Y6QA 5MN5A 4O25A 1UBFA 2BLLA 3BVPA 4A8TA 1ZH0A 4G56A 5E3JA 3LYHA 4BGIA 4TTAA 2XXJA 4ZC1A 3OQPA 5BYKA 1L4FA 5TF0A 2DQYA 3VR6D 2V5AA 2ZE7A 4QATA 2NTEA 1BXRA 4MH0R 4GNRA 1BVYF 3KU4A 4KHPB 3DKRA 1XMJA 1UMBB 3ICPA 2E87A 1A2OA 2POQX 3MFQA 3SSAA 3USCS 2IY9A 4DE5A 1AHPA 1BG6A 1RQXA 1KS2A 1XUOA 4QPZA 4EEZA 1IEWA 1U0SY 3RVBA 3Q0IA 4RS4A 2CBZA 1M6EX 2GXUA 3EAGA 5DHSA 3I8XA 5COQA 4G0PA 2YL2A 3LL4A 2CL5A 5C1DA 3G6WA 3RTAA 4FT2A 2V0CA 3RRXA 1OI2A 4OHPA 5HG0A 1M34E 4AX4A 1S3SA 4FXPA 1FC0A 3VKUA 5T3YA 2O3RA 13PKA 1U9ZA 3K9LA 4JP2A 3WFJA 3P2KA 4OHCA 4QE3A 3STXA 3D9QX 2QLBA 2VOJA 4H3SA 1MCZA 3ZDZB 2JCBA 3QA3E 2HHHB 1C3OB 2BRUA 5IXSA 4OHZA 1SKMA 3EISA 2IV3A 2I6XA 5LQUA 3RYIB 3QOYA 3A1EA 3TTUA 2ZVPX 4P31A 2ZYUX 3GAMA 5J23A 4KXWA 1BN7A 2XF8A 3KKMA 2NV6A 3JQRA 4KQFA 3IDOA 3TLXA 2QP4A 1RWPA 4IWXA 4EHFA 3BN3A 4XVCA 1N5LA 4ANFA 4V39A 4QT0A 5CG1A 2YY6A 1X7YA 1AG9A 3DVAA 1LBIA 1G64A 1Y8RB 2A14A 2ZUWA 4TKVB 2GCOB 4BMYA 4XWYA 1O97C 3IULA 1E0JA 3R5TA 4O0MA 3M9WA 4YP5A 4EZBA 1IRIA 3HDHA 4O4LA 2EQAA 1R8XA 3ML1A 4O63O 2W37A 1YFKA 4C4ZA 4G0WA 1T4MA 4FFBB 3ROKA 4CKYA 1ISFA 2JEZA 3HSSA 2WJWA 2XMCA 3F9RA 4OHKA 3REFA 3D64A 3WGMA 2XR1A 4A91A 1C50A 1PGNA 2C2ZA 2DFVA 3KEOA 3L8EA 5FULA 3W06A 3QWFA 3OFKA 4H4DA 3MHTA 3ZWMA 2VRCD 3DL2A 4K9MA 1XP8A 4POOA 2ACKA 1CW2B 2V7PA 2VDWB 1JIQA 2X86A 5BORA 3E8SA 1U8TA 5DHTA 1E6EA 5BVGA 3IP3A 4YUAA 1E1YA 2FQQA 1PS8A 1Q1ZA 5EWLA 2HA0A 1USUA 1JF8A 4Q18A 4LXTA 4BFYA 1XKTA 4H31A 4BCCA 2GLUA 2KLBA 4JUFA 3THXB 3KEQA 1U98A 1EUQA 1DKPA 3ZK7A 4CCWA 4MYRA 2ZR7A 3AVPA 3MQFA 4GP9A 2O2XA 1CVIA 1E3TA 1NVKA 3GLQA 1QIDA 3R09A 5CNIA 1U8UA 2PN1A 2WFLA 2P9FA 4KW7A 4N0EA 2JLZA 1JU9A 3JQ7A 3JQGB 1U8ZA 5AOBA 2XTAA 1WS6A 3ONNA 3T7EA 2JIQA 4M8KA 2PYIA 2FW6A 4YJ2F 2WIDA 3NT4A 1BXZA 1D2AA 3VR5D 4B8YA 1KK0A 4E51A 1WUHS 3GFVA 4R9RA 5E6SA 4ZVTA 2P2NA 2AK2A 3PDWA 5DWDA 3UAYA 4RH1A 1IBCA 1P2VA 1SBZA 9LDTA 3GNLA 3UK0A 1PR6A 5KX5A 3RYHA 4Q4AB 5L4SA 1VE6A 2HPHA 4B7XA 4CR6A 3J81A 2ZRNA 2NVOA 3SF8B 4XEHA 2OILA 1HC7A 3JWHA 5TMPA 1MDBA 2FKAA 1M2OB 2PKQP 2JJ2D 3IA2A 3KX2A 4PBTA 1UJBA 1F8XA 1GCAA 3NVDA 1O2DA 4K9SA 1A9YA 5F4ZA 1RFLA 5K0ZA 1JQEA 2VJKA 2GJKA 4QECA 4PU0A 3F1KA 1CZLA 5BXQC 3PHHA 5DYGA 1HH4A 2W6PA 3H4VA 5JXGA 3L9WA 3SM9A 1T5HX 3ER6A 4QEZA 4DAEA 2Q3EA 1T8SA 3D4BA 5ARCA 4CDMA 1ZVJA 1CQJB 1X7XB 1OBFO 1SURA 4KB5A 3RUPA 3VU0A 5BYAA 5C7IO 3A7EA 2BTEA 4TUYB 1JNXX 4JQCA 4Z7JA 1EKXA 5T6BA 5EA2A 4BQSA 3SR4A 1Z0IA 1DFIA 1PW5A 3WAJA 1HLFA 1Z56C 4D4LA 4DRXB 5LZ2A 1QGUB 3ZTTA 4AIIA 1R5NA 4TROA 4EKNB 1QYIA 3RPEA 1FYVA 4J2HA 1BA2A 2UZ4A 3DHYA 2RMKA 2EFGA 3RSOA 1XDBA 4F72A 3SXUA 1HSOA 4BMCA 2WUWE 2GNPA 1FNNA 1SKAA 5CVVA 4EYKA 2DFKB 1HPLA 1U2QA 5J2UF 3SIRA 2DWOA 2PTGA 5AM2A 2OFXA 1FFBA 4WCDA 4BVBA 4CMEA 4EUKA 1G2PA 3BMOB 4JLUA 4OQQA 5BOSA 2OR3A 2ZE8A 5JBQA 2GEJA 4OHWA 3RJ9A 5G0TA 4IDDA 3FNRA 3MC1A 5KTTA 3H0EA 2WYHA 3WYNA 2D6FA 5CLFA 1MF7A 4V0ME 1QE5A 4U5XA 4Y7CA 2B7LA 2C2WA 5AVYA 1XQVA 2IDZA 4G4GA 4JQYA 5EUBA 4YP6A 2Z57A 3EQ7A 4QYWA 4L5BA 3DXZA 4FMBB 4UFOA 2JASA 2QTHA 3ZV7A 1CXZA 1RT9A 4Y0VA 2BI8A 1MVOA 2MYTA 1KQNA 2Q5QA 4ALMA 1QWOA 5BN5A 1SXJE 3GDGA 4NQZA 3WO1A 5B55A 3SR0A 3EHEA 5EXPA 3F2IA 4PRZA 4EYGA 1JKFA 3BFXA 3F73A 5CIWA 1XV5A 1GPAA 1J9ZA 1QG0A 2EP8A 1WHSB 1K8XB 3Q98A 3HJGA 4O5OA 4P4GA 2OY0A 4RIGA 1P77A 2X13A 3NHSA 1XEXA 4TYMA 2G9QA 2D4HA 3FYTA 3WHPA 4EA7A 2BR5A 2BUCA 5EJ7A 4ZHQF 1DAMA 4XCXA 1DTWB 4RPIA 3HB1A 2H4ZA 2WU0A 4YUZA 4Y8VA 4PX5A 3UJ7A 4DXHA 2NO1A 3R4VA 5TGTA 1S2LA 2AZTA 3BXEA 4URXR 1ZLXA 1BHSA 4ZU6X 2DKFA 3OA2A 4EO7A 2PUCA 2ADMA 1SQ5A 4JJ8A 3KOMA 3ENQA 1INLA 1G9XA 1VCHA 1X3LA 4MV4A 2PWZA 1L5NA 2KM1A 3GFQA 3ZC3A 2IIBA 3CIOA 4M22A 2ZQ5A 4NL4H 4AG3A 4CQJA 4V1CB 3N0WA 2FFJA 3EASA 7REQA 1P2DA 4JJIA 5JISA 1E20A 3GP3A 4CDGA 2E37A 1B93A 1N7HA 1W25A 4XJSA 3ZWBA 5JALA 1DCTA 1E9VA 3L92A 3DPUA 1LZKA 2IOHA 2NO4A 3N2KA 2G9RA 4HD8A 3A6JA 4A10A 4BOYA 2VQ6A 3KSAC 1V7ZA 4QC2A 2AXPA 2XX3A 3RRZA 2LV8A 5FUXA 1ZZGA 1FMJA 2H1FA 4LY3A 4B3BA 4N1AA 3DYVA 1JFLA 1KI6A 3TSCA 3KDAA 1JJAA 3ZZMA 1GV1A 2ALJA 2WWIA 2BAGA 2V5VA 2JI9A 4QOJA 1RZVA 1WW2A 3BS4A 1U4SA 2YYSA 4LE1A 3WAKA 3LW8A 5B4VA 2XT0A 1OAKA 1SCUB 4P83A 3KQVA 2LRHA 3BXXA 3E05A 3JSXA 5IBQA 3WISA 2O50A 1JR3D 2EGGA 5CB4F 2DULA 1IBLB 4Z4FA 4TTQA 3QJYA 3UK1A 1NVVR 1J0BA 4XJXA 4LDQA 4DKXA 3DVSX 3WWOA 3SS7X 2RJOA 2Z5FA 3PXCX 1XA0A 2RJ3A 2ZWAA 4NU5A 5JSYA 5KOIA 1BHJA 4ER6A 4O2BA 1Q0HA 3QFHA 5ALJA 2XWSA 5JAIA 1LX7A 1IM2A 5DNAA 2FMXA 4IG9A 2PYZA 4C0JA 1SHTX 4CLEA 1N6NA 4V0MA 2QZSA 1FUEA 1Q74A 1YGPA 4MI9A 1EM6A 1FXSA 1USVA 2ZYAA 3W5VA 1R9MA 5MHTA 2YINC 2OGSA 4Q7MB 4TSRA 3Q7QA 1KDRA 1AK1A 2H1SA 2JKZA 4MIEA 2YDYA 3RB8A 4Z0PA 4DG8A 1EVJA 3GVXA 4LQDA 2C3OA 4N0QA 4ZCSA 4P81A 3D2AA 1Q50A 4OA5A 4RD6A 3NBXX 4IIXA 2IK8A 2R11A 4DM7A 1E60A 3T9BA 3NBKA 4LYFA 1RBQA 2QRZA 3FDIA 3OZDA 2BDTA 4HX9A 4ZXPA 3WGOA 5FTJA 4DXAA 5F77A 3M1AA 1IWBB 3GCXA 4MS3B 4ALNA 2O9JA 2X6TA 5F5NA 1NUAA 1O57A 4HSGA 1QE3A 4L8FA 2AE2A 4KRYA 3RAJA 3CLVA 2BBTA 1PLJA 1ZOIA 3WBJA 4OJNA 1YJ8A 2YV2A 4MV3A 2GA9A 5AVRA 4YPVA 2IIVA 2ORWA 3OX1A 1ADYA 1B41A 4GDMA 1G8AA 2CHUA 4YLGA 4CKZA 4C6SA 4EY4A 3AVXA 2FJUA 2GSWA 3KEMA 2CSXA 2P67A 2XJ9A 3SAJA 3O47A 5JS1A 2R5WA 2H1IA 4TL9A 4RVCA 1I4OA 4RY0A 3NWPA 4L2IA 3EXEB 1JU3A 2VPIA 1E2LA 1DXOA 2AOUA 2BI7A 3L8FA 3KKQA 1G19A 1DQYA 3BM5A 3ESYA 3RK1A 1UF9A 2AC2A 2TMYA 2WYVA 3NI2A 2CKDA 5EJAA 2BFFA 4HGOA 3UHJA 3AHFA 3RGGA 4PYQA 3EULA 1JAXA 3A58B 4WXYB 1HNNA 3BHNA 5DGHA 5DGDA 2UVQA 3IP7A 3GA5A 1NV8A 2G1KA 4YMHA 2O8CB 2MU1A 3I72A 3QTBA 1QNLA 1CX9B 1GUAA 5ADWA 1NN0A 3N7TA 4OXQA 4B33A 2Q6IA 4L78A 2BMVA 1PNVA 3COPA 1IOWA 4KPUA 2A67A 4J91A 2PR7A 1MO2A 1HWYA 1A71A 3NDIA 4JC0A 3HQ4O 4QSMA 5CFMA 1KXZA 2GYWA 2FK7A 3C8ZA 1EFVB 3D1LA 4D4JA 1QMPA 1YOVB 4R1MA 1JDVA 1XFAA 3OT5A 2B5VA 1F2DA 3OUTA 3Q3EA 4O1IA 5F78A 4C5CA 3PBKA 4CM7A 4CUJA 4E30A 1Y7HA 4O4HA 3UJHA 1L0BA 4OKSA 4JT2A 4KNYA 3NC4A 5DMXA 1NMEA 2C00A 2IYVA 2IHNA 4OM7A 1JDPA 1UBNA 2FG7C 5AD1A 1Q57A 2PAFA 2OZEA 4GWGA 1U1GA 2Z6VA 4N7JA 3NFYA 4POAA 1T0PA 2ZJYA 4EGQA 3SCZA 2QMQA 4J0CA 3HBFA 3CXUA 3ETGA 3OIUA 3FGNA 1OLXA 1LC3A 1MFZA 4FQ8A 1O97D 4HV4A 2RAVA 5GIOE 3GUVA 1YSCA 4RTSA 2GPTA 4DOMA 4AT1A 5AW8A 2C2HA 5AXAA 4D8VA 4F71A 4AQYB 4QDJA 2Y2UA 5HIMA 3FPEA 3PE6A 3CE6A 1Q7BA 1CR0A 4LMBA 3HFRA 4BLRA 4TTVA 5KJFA 1ZNQO 4G1CA 1H94A 1KYYA 1NOKA 1JQJC 1VOTA 2NYVA 3B9RA 3QXJA 2RK4A 4GRIA 4LXHA 2BPOA 1O3YA 4XQEA 5TVKA 4BWYA 4EMTA 3VR0A 3I4FA 4MW1A 2ZUEA 1IBRA 1R0KA 3SU8A 5DX8A 1QH9A 1K2WA 4MI6A 2XRMA 3A9VA 3L46A 4DKJA 1SUWA 2P1ZA 5KZMB 4GW3A 2SKEA 3WGGA 4RYLA 4R1QA 3UMJA 3EGDA 4QAQA 4R40A 5LMCA 1FPQA 4KO1S 1Z8DA 2QT1A 5ED0A 1K88A 2PBFA 4KXYA 4KN9S 3DZGA 3ENVA 1Z4IA 4Q3CA 5DRTA 1CG6A 4TLCA 3WWYA 4EB6A 2Z30A 4YIHA 3L7MA 4BO6A 1RAAA 3E23A 3KVYA 3QVGA 3KDPA 1BDIA 3CRNA 3DVRX 4ZDWA 1GT91 5KQLA 3UA3A 4DJFC 1NPTO 4YACA 1Y3DE 4UDNA 3CE9A 2FQXA 2BEUA 4XD7A 4DT1B 3C7DB 2A5DA 3Q7IA 1ZD5A 4AZ0A 2QR3A 1A77A 4WOCA 2RHDA 1L7MA 1OPXA 2CDNA 4DGSA 1HG0A 3CM0A 1KJWA 2JLXA 1ONNA 5LR6A 1UPAA 3HO8A 3JYNA 3V4FA 1WMFA 4Y2TA 2MTBA 1L1RA 2DR0A 1P2TA 3PXUA 1Z5GA 3QVKA 3AU9A 1ZMOA 1TIPA 1UM8A 2VCHA 3KYBA 3CUTA 3JVDA 4MVJH 3UJ8A 4Q3BA 4EFMA 3NP9A 2OM2A 1RTTA 1KAHA 5DOVA 1TEXA 4LZLA 3DUFA 2ZRFA 1GG2A 3K70C 4O08A 2ILVA 2O2IA 1ZICA 1BJKA 1VQ1A 4NQRA 5TQ0B 1XMVA 3T3EA 3G9UA 3OBIA 1U2SA 2V8OA 4B3TB 3PZRA 1Y9ZA 1GTL1 4E3WA 4EPVA 1IHOA 2WF5A 5I3ZA 5IFLA 1ZR2A 4KVGA 2HJWA 5AK5A 1V9CA 1YTLA 1TYBE 4UVDA 2FSGA 1T2DA 4UAGA 4FHDA 5E2IA 1Q0PA 3OQIB 4TYWA 5JAOA 5LXTB 4QUKA 1BCRB 4NZOA 2NSJA 2UZ0A 2K2QB 1ZXLA 2HK7A 2VHTA 4JX9A 4K1XA 4FJ2A 4EKDA 2GASA 3RS3A 3T9CA 5BWNA 2YXDA 4CQMD 3EVNA 4AYXA 2D0DA 1OLUA 1XZFA 1V16A 3DR5A 4BASA 5BQPA 2ZUUA 4I1UA 3WXBA 1OA0A 3HABA 2HYIC 4G2NA 2CDAA 3M6WA 2I22A 3NBQA 3GZNB 1IQRA 3V55A 5LQMA 2FX3A 2PS0A 3AKZA 4F46A 3TFQA 3DLTA 4WLUA 3AH8A 4Z4QA 4CMHA 3IPLA 1L4GA 4ITRC 3EEFA 1P1BA 2HHLA 1W96A 2WJ3A 4MVJI 4ZK6A 1WXWA 2BONA 3REOA 3EWSA 3BH0A 4LXGA 3ZS8A 2W7TA 4D98A 3EZNA 4N3GA 4DJEC 4FQ7A 2H63A 4M6WB 4QUGA 2ZBDA 3LUKA 2SCUB 1J49A 3D8BA 5FUYA 1Z74A 2CK3D 4DV2B 4BN5A 1QO7A 1Y37A 1AD2A 3U3DA 2J6HA 2GAAA 1Y4SA 2JAUA 4OB7A 5A0FA 3RV3A 1QFMA 3H9QA 4XYBA 2CFSA 3ZHZA 1A5TA 3TB4A 4WJLA 4XVUA 1GU7A 3JPYA 5JSZB 3L4JA 4BE7B 3FCAA 3DP7A 1D2GA 5BV0A 1FTSA 4PCAA 2EX1A 2XB4A 2P9BA 3RU7A 1E1RA 3PDJA 5I7UA 2PZAA 3PUHA 2YWJA 1RM3A 5L3SB 1OX4A 2JIPA 4IOMA 1KZ6A 4U7DA 3X0DA 2ICAA 4FE3A 4RABA 2HZBA 4DMUB 2R86A 3FRJA 1GTRA 2BRUC 1B8VA 2JHAA 3L05A 2YIVX 3P71T 4J1NA 4L8VA 3EXHB 3I2IA 4AJIA 1JE0A 3GBPA 1XYYA 4JBHA 3H1BA 1ENYA 4F38A 3T7IA 4UUBA 1QQ6A 1N6IA 2RKWA 1OHHD 2V55B 2V7VA 3KXKA 3O2NA 4X85A 4CWAA 4ER3A 5FQOA 1JG3A 5G0SA 1Z6PA 4QFDA 2JHPA 2FN8A 2H7XA 3HBNA 2QSZA 4YWJA 4BNIA 2WP8J 5EHGA 1BGXT 3TD9A 3B9QA 4GUDA 3AVVA 4M1KA 5AO9A 4QARA 4N7BA 3FCUB 1WKBA 1IJBA 4QICA 1I14A 4M0FA 4TLAA 5JMPA 3ZZUA 2Y9PB 4QPDA 2HHCA 3JD1A 4CM4B 2GLXA 2VKTA 3LQYA 1H6CA 4NG5A 4WOJA 3R3XA 3KETA 5GM2A 2FZ4A 5J4KA 1KA9H 2JFZA 3GUUA 4LBZA 1UAAA 3Q2IA 2ZYDA 1NMZA 2BKXA 3HN2A 2E4XA 1Y42X 2YWFA 4J2TA 2H5IA 1H8EA 2I3ZA 1BNCA 2YXNA 2MDTA 4N47A 1JG4A 3FGZA 3OPNA 4XEUA 4RF3A 4KQCA 4B76A 1TO1E 2Z2JA 3FWKA 1V2HE 1UDXA 2C2YA 3FOCA 4AXBA 3GP5A 1OFVA 2QPAA 3AY0A 4W99A 5CT4A 4F4HA 1L1FA 8LDHA 2GF0A 5KYKA 3QY0A 4QEKA 1IN1A 4JLVA 3VR3A 1YR8A 1WMEA 4BTEA 3BERA 2PD6A 4O8ZA 2ZB2A 4L9WA 4XDGA 2VZEA 1BMQA 2DWUA 3DV2A 1DADA 1GPH1 3DE3X 3D3JA 2B7CA 2C99A 3DEIA 3L8CA 4L4RA 1NQOA 2WRZA 3CBQA 3FTQA 1C30B 2PGIA 5ARBA 5IBCA 4YUVA 3H75A 2FPWA 5LVAA 2ZIFA 5TC4A 2ZYIA 3NHRA 1XCMA 4JVOA 1J21A 4M37A 5LC1A 3TW8A 4NYIR 2IEBA 5GZ3A 1VMDA 1C14A 1VJDA 2CFIA 1F0NA 4JEUA 4QFCA 3LPCA 4YRRA 4Y3UA 5ITZB 1HE8B 3B78A 1L7RA 2I1LA 2FWNA 1HLPA 3JYLA 3I2KA 4IDQA 4YJ3A 5KAMA 4LFCB 3OQ6A 3TLGA 1KEVA 4QYTA 3HI4A 2F43B 1XVTA 1YBVA 4R7TA 3FSJX 4NFHA 2I9KA 2XYVA 4M1QA 3LVBA 2I4RA 3QENA 2XRYA 2GF2A 5IFKA 4M99A 5HF8A 1F2VA 2JD0A 4Q1VA 1GPLA 2QRUA 1JRLA 2PX2A 3AL2A 2PPVA 3MM4A 3CPHA 2C5GA 3MSXA 3QFFA 1JL3A 4MP6A 2HRCA 3GJXC 2RC6A 4Q1CA 5EI5A 4AZVA 1Q1AA 1IPEA 1N6OA 3O7MA 3LLMA 4HVTA 4KIFA 4WOBA 4Z0TA 5ITZA 2NVWA 2PD4A 1J39A 1UKEA 1QWSA 3H8JA 2GZRA 1HE1C 2QDXA 4EFLA 5LKRA 4D57A 1XHEA 4IV5A 2KS6A 3RC7A 1TA0A 3BFVA 4IVPA 1G0NA 3V1UA 5JCXA 5I9MA 4HYEA 3W5JA 3LLUA 3ZVKA 3QE3A 1E3LA 5ADUS 3KZMA 1TD1A 2ECOA 3DDOA 5AVOA 1C5KA 1EWRA 1M1NB 2CSUA 3IIMA 5E6UA 6ABPA 1I30A 2ILTA 4E1VA 3IMCA 1FUYB 1SBTA 3QBEA 1UXGA 1V11A 1WKVA 4LQLA 3KP1A 2FGJA 4NECA 2JHFA 1SQSA 5EC8A 1UH5A 3WRYA 2ZXFA 1ONBA 1CRWG 4NPCA 2H29A 2J0VA 2DTDA 1SQFA 4KDCA 4RIFA 1FYFA 4XM0A 3QJ5A 2GK4A 2O8DA 5BO5A 3OAAA 3DLCA 3T7TA 1Y9EA 3UJCA 3V8RA 4E94A 5IKPA 4BGDA 1Z06A 3CUKA 3ZJ4A 3NM5A 2P5SA 3FTCA 4CMEC 3IS3A 5KNBA 4W5HA 2I66A 1U1FA 2ZI3A 5JJBA 4AS1A 4WK0B 3UFXA 1LPPA 1MJGA 2PAAA 4EGSA 2GJ4A 4QUDA 4BE9A 3SK0A 3W2IA 3ZGZA 4D3YA 5AKHA 2P6MA 4UULA 2Q0HA 2SECE 1DIRA 1G8HA 2J48A 3N5CA 4XSVA 3SBEA 5JAHA 2RCNA 3GOHA 3I4CA 2H92A 3TVTA 1RIFA 4YAGA 1AO3A 5DN6A 5E7JA 3WLQA 5B2FA 4W5OA 1ZW1A 1QP4A 5JIBA 2P3SA 3STVA 4UNSA 2HTFA 1OREA 2QZ9A 3OEWA 4L28A 5HJ7A 2TS1A 5JQWA 2WUGA 1JHVA 1SVIA 1VB5A 5B7PA 5C51B 2VHUA 3NIGB 3I5MA 5DP2A 1D1SA 1U31A 3TAHA 4EELA 2VPPA 1JFFA 1O95A 1PV2A 1U3DA 1XIVA 5AXDA 2AUNA 3ICWA 2LDBA 4L4YA 1VLQA 4MGZR 5FD8A 1IIBA 2EF0A 2VP6A 1EUCA 5GIPE 5JCPA 2GHQA 2XZTA 1ONOA 1G5TA 1U0RA 1W9HA 3PRYA 2Z2XA 5LYYA 4MRVA 2P3OA 2I76A 1RXVA 1PN3A 1RTKA 3C8UA 3FWHA 4LRSB 2AHOA 3H9GA 2XQIA 4HBZA 1P44A 2HRBA 3KYCA 3PPWA 2O2HA 4CDNA 2C84A 4ZJYA 1Y6GA 1NWCA 2AFHA 2GZ1A 4CCSA 1NBWB 3WZLA 2O2JA 3MAJA 3U09A 1P0FA 2GAOA 1R4NB 2PANA 3WBKA 3GJ6A 2PHZA 1FP4A 4D0NA 1E8MA 2GBLA 3T5TA 1ND5A 1N0HA 3VDXA 4M0DA 2V7UA 4J1TC 4J29A 1W5SA 1KJ9A 1P19A 1TUGA 3A1DA 5JNLA 2PUFA 1HA3A 1S1MA 1X86B 4FX2A 2ZI5A 2WKWA 1E4EB 3ROXA 1Q2XA 1G0OA 3B53X 3ODGA 4NFSA 1IEXA 2RHTA 1Z47A 4FT4A 1COWA 4KWHA 2XPCA 1P5RA 2YW2A 1MIOB 2HEIA 4ZCIA 1H9AA 4ONEA 2OWDA 1T36A 1N5OX 1IULA 4GI3A 4JH0A 5EKXA 5JEDA 2MR6A 4BVAA 1DB3A 1CHNA 2VSFA 4MS1B 4WD3A 1RYBA 1E79A 3IBYA 3QTLA 4KWCA 4HNGA 1CZNA 1KPIA 1UBOS 3IMKA 3WHIA 3AUSA 3NMUF 4TWZA 4YRMA 2O5EA 4L07A 2JK1A 2YHIB 2I80A 1RJFA 3NHLA 1LLFA 1Q17A 1Z07A 2GJ8A 3TZKA 3DMGA 3WLHA 1W34A 3VPSA 5A5DA 4AKIA 3ICCA 5JARA 5IUNC 3PXEA 3MAGA 5DLDA 4HRAA 5FI5A 2ATXA 4P4TA 1NNSA 4QG7A 4RHTA 2EW1A 5CHYA 2WAXA 2ZCJA 1GL9B 1KI3A 3BQ9A 4P4NA 1FL9A 2Q2NA 2CC2A 1ENOA 4IDPA 5KC9A 3OJOA 4JT4A 5B3AA 3K70D 1K3UB 1B8UA 1TT7A 1A8IA 3AZOA 3HLKA 1XKLA 3K35A 1FVFA 2BLNA 4MJ3A 4UHJA 2XT9A 3ND7A 3SICE 1MU0A 2E85A 1EP3B 3HC7A 4PN7A 4RIEA 1IN8A 1SA0A 3DC2A 2BM8A 2XQFA 3GRKA 3K05A 3MHPA 9ATCA 2X0RA 3WJ7A 1UWCA 2R5NA 2X8JB 1UC4B 4Q0MA 3RVDA 2GR9A 5A6SA 1YL6A 1LCIA 4FGLA 5H02A 2UYCA 3GPBA 3IURA 4PSCA 5MGNA 2HN9A 1UJ5A 3QQ5A 2Q49A 4M0PA 4REMA 4C1NA 3H5VA 4ZTUB 4P2BA 2I2CA 3AUAA 2G0AA 3SJCA 2ONZA 1XSEA 1QQ7A 2X5NA 4NOMA 4H17A 4Z4HA 1E0SA 2R6ZA 4QXAA 5AYVA 3W9SA 1V26A 1WZCA 3GJYA 1LJUA 1Z2OX 4B6QA 4LECA 1WQ4A 1KNQA 4LGMA 3ACDA 3OCYA 1N2CB 4EMSA 1GPNA 2CXPA 3FDJA 3I04M 2AA3A 5KHOC 4Y98A 4E1AA 3CKYA 3ESCA 3KJGA 1LF5A 2B2NA 1VJ5A 1VZ2A 3AJEA 4WUTA 5FOVA 5C8VA 5IKXA 3GNTA 3PFFA 4E12A 3AIIA 3OT1B 1U2PA 4BVKA 5F35A 2ZR9A 1GA4A 4R68A 2HADA 1J0DA 4MVYA 5CLJA 4OMCA 2AI2A 4LMPA 5B2EA 2YRFA 2JAHA 1JB9A 1NOJA 3LT1A 1G3MA 2WYWA 1YZYA 1X13A 1G2IA 3EQ2A 3DBHA 2A3NA 1A04A 2FDXA 1CC1S 1OQAA 3BRCA 5DBHX 2QN2A 4AD8A 1CF9A 3C43A 4FQ5A 3DEYX 3TCNA 1GKLA 3KLNA 3UAXA 2XGGA 4QQRA 4UCWA 4NYJR 1OI7A 3O0DA 4LHXA 3LQ1A 3IBSA 5DEIA 3RM3A 4G9EA 1A4IA 3WMWA 1VRCA 2OHGA 3LG2A 1EBFA 1G16A 3U31A 4KEAA 5EN4A 1HORA 2K2WA 5CA1F 5KWEA 5TR9A 2AN4A 3IDSA 3TQOA 1JLRA 1O54A 4NZPA 1FLVA 1QC5B 4KSCA 4U7WA 5JQGA 2QBYB 3QM1A 4X84A 4PYJA 1E0AA 3CZAA 3GU3A 5DF1A 3TZ6A 4A4DA 4Z7OB 4RHEA 1E6LA 3P9XA 3OLVA 3RSCA 2ZITA 4LXUA 1KERA 5IH7A 1BU8A 3UWPA 3EA4A 3L18A 1KQ3A 5GAJA 1LI5A 4L0DA 4DS3A 3JQ8B 5IPFA 1TRHA 2XHEA 1OAAA 1V4NA 3DLIA 3BQMB 3HKDA 2HCJB 1CJBA 3K8ZA 5DE3A 1Y6RA 2F2TA 4GPD1 2J0QA 4UATA 3ME5A 1OGYA 5LB4A 4EY6