3AHIA

H320a mutant of phosphoketolase from bifidobacterium breve complexed with acetyl thiamine diphosphate
Total Genus 320
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
320
sequence length
802
structure length
802
Chain Sequence
VIGTPWQKLDRPVSEEAIEGMDKYWRVTNYMSIGQIYLRSNPLMKEPFTRDDVKHRLVGHWGTTPGLNFLLAHINRLIADHQQNTVFIMGPGHGGPAGTSQSYVDGTYTEYYPNITKDEAGLQKFFRQFSYPGGIPSHFAPETPGSIHEGGELGYALSHAYGAVMNNPSLFVPCIIGDGEAETGPLATGWQSNKLVNPRTDGIVLPILHLNGYKIANPTILARISDEELHDFFRGMGYHPYEFVAGFDNEDHMSIHRRFAELFETIFDEICDIKAAAQTDDMTRPFYPMLIFRTPKGWTCPKFIDGKKTEGSWRAAQVPLASARDTEEHFEVLKGWMESYKPEELFNADGSIKDDVTAFMPKGELRIGANPNANGGVIREDLKLPELDQYEVTGVKEYGHGWGQVEAPRALGAYCRDIIKNNPDSFRIFGPDETASNRLNATYEVTDKQWDNGYLSGLVDEHMAVTGQVTEQLSEHQCEGFLEAYLLTGRHGIWSSYESFVHVIDSMLNQHAKWLEATVREIPWRKPISSVNLLVSSHVWRQDHNGFSHQDPGVTSLLINKTFNNDHVTNIYFATDANMLLAISEKCFKSTNKINAIFAGKQPAPTWVTLDEARAELEAGAAEWKWASNAENNDEVQVVLASAGDVPTQELMAASDALNKMGIKFKVVNVVDLLKLQSRENNDEALTDEEFTELFTADKPVLFAYHSYAQDVRGLIYDRPNHDNFHVVGYKEQGSTTTPFDMVRVNDMDRYALQAAALKLIDADKYADKIDELNAFRKKAFQFAVDNGYDIPEFTDWVYPDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords Xylulose 5-phosphate/fructose 6-phosphate phosphoketolase
publication title Crystal Structures of phosphoketolase: thiamine diphosphate-dependent dehydration mechanism
pubmed doi rcsb
source organism Bifidobacterium breve
total genus 320
structure length 802
sequence length 802
ec nomenclature ec 4.1.2.22: Fructose-6-phosphate phosphoketolase.
pdb deposition date 2010-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03894 XFP D-xylulose 5-phosphate/D-fructose 6-phosphate phosphoketolase
A PF09363 XFP_C XFP C-terminal domain
A PF09364 XFP_N XFP N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ahiA03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ahiA02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ahiA01
1TKAA 1QGDA 4KXXA 1N0HA 4GM0A 1TRKA 3RIMA 1X7XB 1QPBA 3ZHSA 2G67A 3ZHVA 4GP9A 4WBXC 4JD5A 3FLMA 2EZ4A 3EXIB 2C3PA 2WVGA 2BP7B 4FEEA 2YICA 4K9PA 2VK1A 1QS0B 1KEKA 1PYDA 2Q29A 1X7ZB 3AHJA 1UMBA 1YHYA 3F6BX 1UM9A 2EZ8A 4MPJA 2JLAA 5C4IA 3LPLA 1UMDA 5HJEA 1X7WA 1PO7A 2WVAA 3EXEA 1V16B 1V11B 2O1XA 3IAEA 4K9KA 3EYAA 1PI3A 4KXUA 5EJ4A 4XEUA 5FEMA 1MCZA 1BFDA 1ITZA 2IHVA 3EXG1 5EJ8A 1T9CA 5HYVA 1T9AA 2JLCA 1V5FA 2Q27A 2BFCA 2R8OA 3HWWA 3FSJX 2X7JA 3HWX1 1UMBB 1YHZA 5I5EA 2EZ9A 4JU9A 4MZXA 1W88A 1W85A 2XTAA 2JI9A 1UMDB 5EXEA 3EXHC 1OLUA 4GG1A 2JGDA 2BFFA 1X7WB 3ZHQA 2Y0PA 4JU8A 2BFBA 3EXEB 3EXG2 1YBHA 4MPPA 2Q5QA 3EXHA 1YI1A 3AHDA 2JI7A 4COKA 3AHFA 1YNOA 4K9LA 2IEAA 2IHTA 2BEWB 4K9QA 2VBGA 5DGTA 5K6TA 4KGDA 2PGNA 4C7VA 4QELA 1V1MA 1ZPDA 1X80B 2V3WA 2W93A 2BFCB 2C3UA 3EXFA 3DUFA 1OLSA 5K2OA 3M6LA 2JIBA 1L8AA 3JU3A 2R5NA 3AHEA 1AY0A 4MPRA 3L84A 1Z8NA 2VBFA 1W88B 1W85B 4QPZA 2VBIA 1T9BA 1OLUB 2JGDB 2BFFB 1V5EA 3FZNA 2BFBB 2PANA 1OZHA 5EJ5A 3EXHB 2FN3A 2BEVA 4RJIA 1YD7A 5EJAA 3DVAA 1DTWA 2BEWA 5EXDA 4RJJA 2R8PA 3DV0A 2FWNA 5K3SA 4GM4A 1UPAA 5I51A 1POWA 1X80A 1V1MB 1OVMA 5I4IA 1R9JA 5DEIA 4RJKA 3D7KA 2C3YA 3EXFB 2UZ1A 5ESDA 3MOSA 3DUFB 1OLSB 5K6RA 1UMCA 2NXWA 2J9FB 3ZHTA 1V5GA 1POXA 2E6KA 1OLXA 4QQ8A 2VK4A 2XT6A 1TKCA 4K9MA 4JUDX 2YIDA 1PVDA 2BEVB 1U5BA 1WCIA 4D5EA 3DVAB 1DTWB 3DV0B 2XT9A 3M49A 1NI4A 3IAFA 2BFDA 3AHHA 2Q5JA 2OZLA 2PGOA 2JI6A 5HGXA 2DJIA 2Q28A 2O1SA 4GPEA 1X7YA 2EZTA 3LQ4A 1Y9DA 4JUFA 5I5GA 2UZ1B 3AI7A 1JSCA 2WVHA 4JUBA 3AHGA 4D5GA 1UMCB 2J9FA 3ZHRA 1UPBA 4ZP1A 3EA4A 1OLXB 5HHTA 4K9NA 4KXVA 2BFEA 5IMSA 3KOMA 1OZGA 4GM1A 1Q6ZA 3E9YA 1B0PA 2G28A 2C3MA 2BEUA 1IK6A 1OZFA 2Q5LA 4K9OA 4JUCA 2VJYA 5DGDA 1U5BB 3F6EX 1WCIB 2JI8A 2AG1A 2QTCA 1UPCA 1NI4B 2IHUA 1V1RA 2BFDB 3M34A 2VK8A 2OZLB 3OE1A 2C3OA 2G25A 2Q5OA 5AHKA 1X7YB 1X7XA 4MQ5A 3HYLA 3UPTA 3EXIA 1T9DA 5EJ6A 2BP7A 4FEGA 1QS0A 3AHIA 1X7ZA 3LQ1A 2C42A 2EZUA 1NGSA 1GPUA 2BFEB 1TKBA 2UZAA 2BEUB 5EJ7A 1UM9B 3OOYA 4Q9DA 5EJ9A 2PDAA 4KXYA 5ERXA 3ZHUA 2C31A 3LQ2A 2AG0A 5EJMA 3UK1A 1V16A 3EY9A 3M7IA 1V11A 1YI0A 1V1RB 2QTAA 4C7XA 4JUAA 1RP7A 4KXWA 5ERYA 3AHCA
chains in the Genus database with same CATH superfamily
4KXMA 3OQMA 2JK1A 2WYOA 1KDPA 4EAQA 3QX9A 3IESA 1ATZA 1JIQA 3MTQA 4E3ZA 2JHGA 1IHDA 1JHPA 3BH7A 3KB8A 3TZBA 3WHLA 5ADWA 5D3MB 5JXJA 1Z83A 3ZVNA 3RBXA 2C7GA 3E1GA 1E9DA 1E7MA 3E84A 3I8OA 3AB7A 1FF9A 2CBXA 2BSAA 7ABPA 5KVSA 4UC0A 2QLFA 4L4ZA 4R3NA 3HCFA 1P4GA 1RQGA 2YFKA 3FW1A 4KQ6A 3PP8A 4MRAA 5K3AA 2YC4C 4DLUA 3MJEA 4OI4A 4Q9LA 3HJUA 3O8NA 3WSVA 2IS6A 2EG9A 3VHXA 1GIAA 1UBMS 1H8HD 1NXPA 1WXXA 1FTNA 4D0GA 4PG8A 4RZUA 3IP1A 3U7QA 3DDZX 4DLVA 5E4FA 4CJXA 2FFBA 2OPBA 1QGOA 3JQAB 1KEKA 4JQCA 2X0DA 3WGNA 3K1AA 2QTVA 1CDEA 5F78A 1YVUA 4R84A 2BKUA 2OXEA 1VKHA 1L4LA 3R1IA 2GO1A 4RANA 3C41J 3WLOA 1PLLA 2BLNA 4L15A 5AI9A 2HW8A 4IV5A 5ERGB 4QOIA 1G4HA 1ZK4A 1NQAO 1UKEA 4GZ5A 3HLTA 4YA6A 3VV2A 1R6BX 4Z4GA 4IYJA 3WZLA 5BNTA 2ZPTX 5KOYA 1ZJZA 2GR9A 4PRKA 4MPJA 4K28A 4UEOA 1U94A 1WUTA 2CY0A 4N6NA 4Q9HA 3LK7A 4C22A 4B6FA 4CMKA 3LPLA 3QYJA 2IC5A 3GNSA 4Y7DA 4W7HA 2PS1A 1BMQA 1BFUA 3PNQA 4KI7A 4MVYA 5AKIA 1X7WA 1NJ6A 4QT0A 1CRLA 1D0IA 2Q5FA 3C7TA 3BQMB 5DSXA 4CTMA 5GIOE 5AVWA 1S7GA 1AHHA 1XC7A 1G66A 4KR0A 4BNUA 1JHOA 4NEGA 4NEHB 4OHPA 3C70A 4UMEA 3RPEA 2FR8A 3IPXA 4ARSA 3E9EA 2CE7A 4EGSA 4F4UA 4W7IA 1ZM2A 2FFQA 5BN3B 3QU5A 1K7XB 1R64A 5ICEA 3PWTA 3FIUA 4C9BA 4ZCRA 1M76A 3LGXA 3V1YA 4EGQA 2SKCA 3VV3A 4PZDA 1AS0A 5IAOA 4XWOA 1D6JA 2Y0DA 2XOKD 4QYIA 1D5WA 4Z4FA 3A2MA 5EZ6B 1H8ED 1B8UA 2HXGA 1U80A 3GAFA 4WY5A 5BN4A 3DYBA 2IEGA 5FEMA 3WJ1A 1RHRA 2NPOA 4EG0A 3C8ZA 1N2XA 2AC7A 3MA0A 4Q4AA 4NBSA 4O29A 3EJ6A 3IJPA 5JZMA 2FI1A 2EYQA 2R6GA 4MJLA 1O8BA 1QFMA 3CR3C 1XQWA 3IHTA 2FKAA 3DDWA 2VNIA 3KKZA 1U7OA 1AHIA 3ZLBA 4ALJA 2P2GA 3EEBA 3HB4X 5L3VA 4KQIA 5HYVA 2Z2JA 4QXQA 2PMFA 1L7MA 3IFSA 3K2BA 5HE9A 5HF6A 1YAHA 4E31A 4F4FA 4F9EA 1Q84A 1QGED 3EASA 4BBPA 1ZY2A 3UB2A 1SPBS 3LCUA 3L0CA 4QX6A 3UGQA 1UJMA 2P9GA 2FSUA 4RHCA 2G63A 1H2RS 4HQKA 4X3CA 1LCIA 3MMZA 4QPNA 4MVWA 1H3FA 4INJA 2QLBA 4QGAA 1AM4D 3K5IA 3S2ZA 2YMLA 4PE5B 5F2KA 4ZVUA 3RVKA 1ZOOA 3HJCA 2XRMA 3C5CA 4J0JA 1PR5A 2CLKB 3HHEA 3LZDA 1Z0AA 4OOFA 1XOIA 2BDTA 4FEYA 5L4LA 2BUAA 2EC5A 2D5IA 1W1UA 1L2TA 2XV1A 3E9RA 4PG7A 3A4NA 4MKXA 3K20A 2P4QA 3MQ4A 4CV2A 1WZ2A 1U0TA 1QE5A 3KHKA 4HI0E 4L57A 4WASA 1OKKD 1IPFA 2XTAA 2JI9A 1HYHA 3Q7TA 4QYTA 3RUEA 1ACLA 5E4JA 1JB1A 4EFLA 5F5XA 3TIXB 4RUKA 4D8TA 3W5DA 1T9HA 1L3IA 3QEAZ 2OCDA 2RBGA 2PXAA 4G26A 4J75A 4JOBA 3TD9A 1UXOA 3HKEA 2ISCA 2K4MA 421PA 2I6XA 2JIOA 5DIZA 3PFHA 5H16A 1EVIA 4KVAA 1DBRA 1NLZA 3TSCA 4XQ0A 2ZBQA 3UTDA 2IOYA 3A1NA 2DSTA 4BX3A 2BJVA 1GPKA 3V4ZA 2BISA 5F9HA 1GG5A 3FTNA 1P1BA 3VVLA 2XEXA 1TT5A 5FL7A 1R37A 3JASA 4YRFA 2N47A 5HSGA 1B41A 1VZ2A 4Q3EA 3MJHA 4KWTA 3O26A 4Q12A 2RD2A 1U7TA 5FBHA 3UB4A 5A6SA 5CDGA 3CVWA 2QTTA 4DG9A 3UMRA 3PTZA 4OJNA 2H4JA 4GX5A 5DT9A 4DKXA 4WBNB 1SHTX 2IY7A 2E89A 4GMXA 2GEUA 2NZXA 2Z9BA 5AOBA 5B6PA 2IKSA 4L5CA 5JU6A 1FFWA 3ILHA 4UXIA 2C2OA 1CPYA 2GPSA 4AWXA 1WCYA 2WU4A 4DQDA 3H9QA 1ES9A 1DKRA 4E4TA 2XUQA 3A6PC 5GOZA 3JQQA 3UWOA 3TWOA 4EUFA 5KYUA 2IKQA 4UVIA 1T2AA 4LOAA 4NDNE 4OQFA 2IP1A 2O8EA 1RJ9A 1JALA 1JQJC 2P7HA 1XZGA 2NVOA 1IG0A 3AFHA 2YXBA 2B2XA 1KP2A 4R83A 5GZ6A 1GCIA 5A5GA 2XE7A 3T1TA 1BMFA 1KAOA 1IZYA 1E3MA 2YL2A 1DG3A 1HDEA 2JBWA 3EY4A 5EXPA 2VQEB 1VHWA 1KC1A 1YUNA 1LW6E 3RM3A 4P98A 5G0WA 4EDHA 1RRKA 1O0CA 1ZZEA 5DOZA 3JU3A 4G0QA 1JJ7A 3K9BA 4G25A 2I0FA 2OLKA 5CB4F 4CL8A 3SVLA 1I3CA 1OI4A 4QWWA 3RUAA 3G02A 4LJLA 5SICE 1V4NA 3BAFA 3VHQA 2XX3A 4EJMA 5ILGA 2IXGA 3K6RA 1OXVA 4QYSA 5DWQA 2EX4A 3SZMA 5ES4B 3TLAA 2JGDB 4MV0A 2PHZA 1C1HA 1RHKA 1ECFA 1YZVA 3FZGA 2W6CX 4I9FA 4UM9B 4ZDKA 4FD3A 4CL2A 1ZIXA 3WIBA 5BWCA 3RAEC 1XKXA 3RIYA 3W5SA 1P9NA 1E6CA 2GBCA 4HFNA 4PW0A 2ONKA 3EXHB 4AIRA 2VJMB 2QVZX 3C48A 5GV7A 4H9GA 5LDGA 1ZX1A 1HV8A 3EARA 1T5HX 1E79D 1YD7A 1Y80A 2KPOA 3OF2A 4IIGA 4NP6A 3U1TA 4BMPB 3ACDA 2X1HA 2QRHA 1YCFA 5AK3A 2ZJ8A 6REQA 2Z9CA 2ANCA 5KMGB 2E4UA 2ODWA 2OFWA 2BEWA 4JJ4A 3KJIA 5IMBA 2Q1TA 4UBJA 5H3CA 2PNJA 1YTLA 5T8KA 1KDOA 4KK4A 4YRKA 4GSLA 4KLAA 3IAHA 3H9EO 4HD8A 4K9DA 5F7ZA 1E2JA 1TMYA 3MF4A 4V0SA 5DU2A 1GQ2A 4E3WA 5IYZA 1KEEA 3KDAA 2ZBDA 3DTVA 1SVUA 3U3XA 4EB0A 4RFLA 4F4JA 5BNWA 4CM8B 3OQIA 4LCBA 4OATA 4R2KA 2OV3A 1J24A 2WDPA 1EP1B 3CWQA 4MS1B 1Q14A 4NHEA 5I4IA 2F9LA 3S40A 4HHEA 3GLIB 2IBSA 1KYTA 4LHXA 3BORA 1Y7LA 3OOWA 1ZYUA 4OYYA 5ISMA 2JCVA 1XTIA 3AB3A 4DUGD 3B8EA 1W73A 3OE7D 4P0TA 4XARA 1SHKA 3SXUA 7AT1A 4AKHA 2I6UA 3K31A 4M0MA 3N2LA 1G3QA 1P3JA 1WD7A 2R7MA 2R4UA 3QTTA 2QR2A 2V65A 2WOOA 4EH1A 3ANNA 1JAZA 1U3UA 2PUFA 3QLUC 5KNDD 3B38A 5L7YA 2CNOA 1E9BA 2L82A 3MRTA 3WYDA 4ESOA 2FW9A 1J8QA 2XDQB 1OAOA 4WZBE 5BWLA 1YQUA 1GNPA 1OT3A 4GOMD 4Y6RA 1IC6A 1KO5A 4EHHA 1M6HA 3HB1A 3ZLVA 4XLTA 2GX6A 1MJGA 3BGDA 3DD1A 2ETVA 1PWYE 3PZRA 1DC8A 3X1XA 5M2QA 3GFFA 5H7XA 4ONEA 1OV6A 1UINA 1UAAA 4EMBA 2IPNA 4GI3A 5BYBA 5DK4A 5C7YA 3D4BA 4ID9A 2A1UA 2EL9A 4O2BA 3EBOA 5IARA 4LDRA 2EBWA 4LZPA 3FMOB 2ID4A 3QELA 3DB2A 1USKA 4YCAA 3ZQ6A 3TL6A 5JH7B 2UXCB 1SULA 1ZGGA 1Q7TA 1TZBA 2YHUA 3JZFA 3DLTA 3UHFA 4W8HA 1EK0A 1MQ9A 2G82A 2HL6A 2DHDA 1C1YA 3QNWA 4G6ZA 4EW6A 2FDRA 1WY7A 3HKCA 4PONA 5JI3E 1TK3A 4UHKA 4LGYA 3HU5A 5FI0B 1F0KA 2DQZA 2X9NA 1N8KA 3A3YA 4F71A 2Z56A 4MRNA 8ABPA 4CU5A 3KYDB 5J4HA 3UJ7A 3BCRA 1L1QA 4IHJB 4NE2A 1PUXA 1II0A 5TEWA 2G83A 3LY9A 1WO8A 4RZ2A 3SJAA 1EAMA 4DWOA 3OZ7A 4DHWA 4D81A 3SX2A 1AB6A 4IQGA 3LCJA 4JJ7A 3OC6A 1KFBB 4UBIA 1WBBA 4I9NA 4PPGA 4RORA 1D4OA 1Q2UA 1TTHA 1J2TA 1XTQA 5HZHA 5KYVA 4ETNA 3OQJA 4P83A 3VJKA 4I08A 3FHJA 3QWHA 2ZOSA 1CS0A 3D8HA 2AXEA 4P3YA 1LPOA 2XZPA 4EIWA 4CCYB 2ETXA 1TAUA 1J20A 1PWZA 1TEXA 4IMPA 5DTJA 2GDJA 3KTOA 5K51A 3FYUA 2H06A 4S1TA 4NABA 5IZCC 5FQNA 5ECYA 1N1MA 2E4AA 3D59A 1ZCBA 1RXVA 2GK3A 1IN6A 2C5FA 1CQJB 2PSSA 3T06B 1GR1A 4N7JA 5EYPA 3CEHA 3KUCA 4OF4A 5F76A 3T3DA 1NXVA 3QVOA 1G4AE 1OXKB 2HIGA 2GD1O 5ITSA 2R5WA 4WOBA 4REMA 4Q7JB 2MSKA 4XCXA 2PZBA 1W48A 3A70A 5BSWA 3LECA 5FOTA 4BLUA 1R5OA 4DJ5X 1GZ5A 2D1QA 3ZEIA 3B78A 3GFOA 1XVUA 3FCXA 3FXAA 1VCIA 3G8AA 3IXQA 4GM1A 4JP8A 2OTCA 3O2QB 1FYVA 2OENG 4OH7A 3GVXA 2NU8A 5T4BA 4AICA 2Y76A 1SURA 2IVFA 4HN2A 1CDDA 1DDOA 3GMIA 5CA0F 2H07A 4I1VA 4ENSA 1FQWA 4E6PA 3WRYA 2BCEA 4R16A 5DNVA 5A04A 4JEIA 1J0XO 1FSSA 3WMRA 5LMNB 1Y5MA 3GLUA 1XZAA 5CR9A 3H42B 2QVLA 2VQSA 3PF9A 5EIBD 2WIFA 1WXWA 3LFHA 3IKTA 1JP7A 5KDDA 4TXNA 1A2BA 1HYEA 2K87A 4GGPA 1CNFA 4NYJR 4RA9B 3DHEA 1XZLA 3EE6A 1GG8A 1RAFA 1YS7A 5AOAA 4CEIB 4A91A 3L0ZA 1DIGA 1N0VC 2JGFA 5LD2B 4TLLB 1TJ3A 3EVTA 2NIPA 2QG4A 4PIPA 4NCAA 4BB9A 2JFPA 4BJHB 2OZLB 4LY0A 1T4CB 2QK4A 3V3TA 3OX4A 2P65A 4BDTA 1ND6A 3AEUB 2G5TA 4U9UA 2QM8A 2O2SA 1NN3A 1NDHA 5JSKA 2G25A 1D8TA 1CZNA 1FTWA 1VB5A 2ZATA 3K9CA 1BS9A 3TKYA 1P9WA 5L6MB 3IUQA 2CW5A 3ICPA 1JDTA 4K1XA 5H0IA 1JHVA 2AJTA 3BRCA 5H02A 1ORIA 4C6RA 4TZ6A 1OXSC 1GZDA 1I6WA 4U7GA 1QFJA 2G1PA 3EEOA 4M0LA 4XWAA 1BEUB 1FTSA 1CK4A 2F64A 1JXOA 2AXNA 4H7PA 3SMQA 3AY6A 5HXAA 1Z5UA 4YUAA 5HA5A 1K0FA 4NH0A 4FSXA 3PQEA 1QR2A 2WUEA 5JPDA 4IJUA 2WTEA 2QGFA 4BAGA 4CM7A 3PL1A 3PF8A 2R8EA 2R84A 2HMUA 2Q2QA 2QLJA 1ISPA 3LCMA 1HTTA 2JF0A 5K0EA 3WVNA 5JRDS 1BJTA 1NGSA 2BFAA 2VHUA 3NHKA 3W78A 3HGQA 1XZDA 3MG9A 2AI3A 4B4WA 5ESWA 5CG2A 3E35A 5JNVA 1E61A 1BH2A 1ZGZA 4X63A 2AT1A 4UREA 4WKBA 3TW8A 2ZJ5A 3OCZA 2CV1A 2I2XB 5BRNA 4TTJA 3HI4A 1U9IA 1MX5A 4FYJA 1L5LA 2IRWA 1B0ZA 3EC1A 2C5HA 4I1PA 1QKIA 1QG6A 4AJNA 1Y4SA 2GK7A 3WNBA 1LPBB 5DB4A 3A9VA 3WV4A 4BNWA 4CM8A 4R8RA 1GITA 1W5BA 3GDWA 1F2TB 5DH9A 3VX4A 3RANA 3ZGVA 4QEKA 2TMGA 4FFMA 1QTNA 3FVQA 3EY9A 1T5LA 3MM4A 5KNCA 2JRCA 3VGJA 2HLHA 2QMOA 4GU5A 5LYJA 1A5TA 3O1IC 3SS8A 3AR4A 3W34A 4LF6B 2W11A 3NM5A 1JBQA 1E6KA 3BS4A 1M2EA 4JLJA 1W59A 1CERA 3FLEA 2SICE 5FV4A 3F5MA 5EP2A 1QGDA 1YKFA 1GARA 2CLIB 5LSAA 2BHTA 4RTKA 1EINA 4XB6B 1SBQA 3MCWA 3N8HA 4KXXA 4NZYA 4GHWA 4O2AB 5LU9A 4PG4A 1QE0A 4QREA 3RIMA 3O0DA 1EFPA 1LZKA 1PIWA 4RM3A 2ONZA 4ZVOA 2QTRA 1ESEA 1RP1A 1GZVA 1U8UA 4MGHA 3TRFA 3AU9A 2W22A 3EXIB 3BXXA 3RSZA 4ZEXA 3VBCA 5L53A 1DTSA 2II6A 3U3MA 1VE7A 1I4DD 1KAGA 1PLJA 1GU1A 4K9PA 4FYHA 4BKMA 2O2ZA 4BWGA 5LMZA 1VBNA 2EXXA 1BS1A 1TTQB 3H3JA 3QV1A 2OBNA 1I1NA 4KKVA 3GVIA 3OLYA 1CUEA 3F8TA 3P97A 4OU4A 1WU7A 3A27A 5BT8A 2QJRA 3WV5A 3J81k 3CTPA 3AVTA 2R5FA 5SZIA 3K0AA 1KFJB 1Z9BA 5FKJA 1VMAA 4OHOA 4S05A 4XA8A 4L9WA 3QITA 2HH9A 2XGGA 3FBGA 4IIUA 2PLWA 3FPSA 1UQUA 2Y4NA 3ZWKA 2ZSHA 3LKBA 3A4YA 3T52A 3FPAA 1TK2A 4QARA 4I4IA 5LA6A 3EUWA 4RH3A 1PLKA 1HO3A 4DY6A 3DKPA 1CJKC 1V9SA 2HMTA 4M2LA 3LT4A 3H5RA 3QE4A 4X5OA 2JGJA 5B58C 1ZQ1A 1ACMA 3T7CA 3IB6A 3G9XA 4YBZA 4BO7A 1AHPA 4GSYA 5BR8B 2Q50A 2ZUFA 2X23A 3FPFA 3SFTA 4ZANA 1TUBB 2GTHA 3PXBA 2J0UA 3PWZA 4U00A 4QBIA 1P2VA 5CNKA 4L5JA 4DR4B 2O1XA 4RVDA 1UFKA 3W06A 1ZJJA 2VEDA 4UU7A 4X41A 3N28A 1KMHB 3EZ6A 3MK31 5AW1A 4TUYA 1RQRA 3T3MB 1M2JA 2DBVO 1ODSA 1T5TA 1N5MA 1R4NB 1UCFA 2ST1A 3AZPA 3FNIA 3ND5A 4N7MA 2LD4A 2ZRMA 3FCUB 5IT9A 1RYNA 3HXMA 3B51X 4KQFA 1NQWA 2OORC 4U9HS 1TJPB 3ZWVA 2IXDA 3UTCA 1LB1B 2YWHA 1O95C 4QAJA 1IM5A 1XD2A 5JC1A 2YVKA 3NUZA 3JARB 4C4AA 5DYYA 1UUFA 2MINA 4S0XA 2C57A 4ESEA 2KLHA 4GPTA 1E1LA 1IZ8A 3WYEA 4IVQA 2NO4A 1DHRA 3AF0A 3C74A 2QAIA 4A2WA 1E9EA 2VK2A 4M49A 5KSYA 3R0ZA 2ZUUA 1T9AA 1KQNA 2R8RA 1RXIA 1R50A 3JW8A 3U3JA 1PL8A 4CKZA 1FU7A 1X7DA 1Z0JA 4MAMA 2DERA 3T3IA 2Q7OE 2BFCA 1VXRA 1DZ3A 1ZJ5A 2FZKA 4FXPA 4CV1A 3RGGA 4DLWA 5EIFA 3KD2A 3KHTA 1HDXA 5EJ2A 3BMNB 4AQDA 3FSJX 3ZNNA 3SQXA 3RLIA 3VDRA 4JR0A 2GKSA 4TKUB 3JAKB 2LR0A 1TO6A 3THSA 4BDSA 1MTOA 2Q8QA 3EGIA 4R9UC 2FH5B 3O82A 4G0PA 4DANA 3O74A 3NWBA 1AKNA 1TCVA 2EZ9A 3BWYA 2ZYUX 1S8NA 1USUA 3BFPA 4R31A 4JQOA 4YECA 1FMJA 2WMYA 1I7QB 3D6MA 4MEJA 4PLHA 4FILA 4GI7A 1F4PA 2WILA 3L6EA 3LX6A 4OFBA 5B2ZA 4C0XA 1FMFA 1KR5A 2IZ0A 2Q21A 4A8HA 1BHQ1 2CV2A 2D7CA 3QVGB 3MS2A 4Y1FA 4RGQA 5EXEA 1FDVA 2Q07A 3DKVA 4K6FA 4EVSA 4N3CA 1UANA 2BMAA 1OFHA 2BFFA 2A9JA 3AOEC 1UPXA 4I1RA 4I36A 1CEYA 1OYYA 1SR8A 3PHIA 1E2GA 3EFBA 3PNYA 1LSOA 4M0FA 4OLJA 5ALPA 5HG0A 4MW6A 5EKUA 3U9TA 3EZLA 4JDUA 4Z5XA 1A9ZA 3NEPX 4O4HF 3UANA 4TS9A 1CUXA 3AUYA 3WMXA 4HNVA 1CZUA 2UZ3A 4B6PA 2PUHA 4G85A 2DY1A 4B84A 2F1RA 3OJCA 4E2XA 4KLCA 1YUMA 3DL0A 2PYDA 4HDSA 1IEVA 2PG3A 5JISA 1ZUWA 2FZCA 5CHYA 2BEKA 4IPTA 4CCSA 1MN6A 5REQB 4EGFA 1MO6A 1DMRA 3SX0A 1Q1AA 1I2DA 2AEEA 2XB9A 1DKMA 2XTMA 2YZMA 2IHTA 1NTRA 3MT0A 3P0IA 2AI1A 5FBVB 3NJ8A 2HHHB 1RU3A 5DYWA 1IY1A 4B45A 4UU8A 3RVJA 2YIJA 3GBSA 3L41A 1ZD1A 4UQOA 1PDVA 3O2JA 3CXUA 3AVPA 4HLUA 3MTBA 4P5DA 5JNWA 3OHPA 3OP4A 1O97C 2I6QA 3KSDO 1QNLA 3FYDA 1YCHA 3E8XA 1CG6A 1FS6A 3HVUA 4GI1A 2SCUA 2EJWA 1XCBA 3TFOA 1P5RA 4D9EA 4G86A 2XVAA 4L4SA 5IFKA 3VYTB 3GJYA 4FTWA 2ZB3A 4TN5A 2JFWA 2EW2A 1TPZA 5GMOA 5KYWB 1GFZA 1TAHA 4WZBB 1R4AA 3JVVA 4YUXA 4QYXA 1N5OX 3U13A 3VOAA 1KMCA 4MVJH 1YKGA 2X13A 4MQEB 2P41A 4Q3KA 4I6GA 4RNDB 1NT2A 2Y1FA 4HEJA 5DCLA 5EHZA 4UAVA 5JSZA 4YY3B 3WKCA 5I47A 3BG5A 2ZUEA 4PM4A 3AKCA 1LKZA 2H2GA 3MVEA 5AHXA 1L4BA 1Z8NA 4MKGA 3NIGB 1DMSA 3QMWA 4N7RA 1BZYA 2HCFA 2V96A 3SZGA 3N2GB 3FTFA 3RYFB 3OQBA 1GAWA 2QRQA 1U2QA 3M70A 1OUMA 1WG8A 4ZRMA 3PUWA 2V03A 3K6SA 5FA6A 4HBGA 3BQ9A 4GNRA 1QGYA 1R0XA 3U6KA 1ABFA 1KO1A 1ONOA 4XDGA 4YMTA 1SVKA 2DFNA 5DTIA 3IHKA 1VGQA 3D43A 3TCXB 3NH6A 4AC9A 2XBMA 2O3TA 4P22A 4MROA 3KJEA 4Q3BA 3L4KA 3NBYC 1AQNA 3W5VA 1SQ0A 2FN3A 3D81A 1RJFA 4XR9A 4YP0A 1GVNB 1FUIA 1H85A 2RJ3A 1SIWA 2ZI7A 2ZR9A 5E9QA 3S8MA 3UK6A 2M6SA 5GJVC 4X91A 4YMUA 3VH4A 4JLKA 1C9YA 1AZLA 4MUAA 1EVQA 4FYYA 5EJAA 1CJVC 5FAXA 3ANLA 2AFIA 5TMEA 5TV2A 3ROKA 4EUSA 3QF7A 1LLFA 3HB7A 3UAZA 5A4IS 3UF0A 3IERA 2TECE 1ENPA 1ODJA 1NBME 2GCOA 2IDJA 2QF7A 2WTNA 3DL2A 3DV0A 3QOFA 4UMDA 2QR3A 4WKOA 4UUNA 5FP0A 1HE1C 3T34A 1HTBA 1I01A 2KM1A 1E2LA 1WB4A 1PJ8A 5EWLA 5F1OA 3UAWA 5I51A 1TE2A 2HC9A 2J9ZB 2OCLA 5AYVA 4ZU3A 3OFJA 2JFZA 2JLVA 4CUJA 4WNAA 1XZNA 4WCVA 1POWA 5J3JA 1DE0A 3GQBB 1V1MB 1M1XB 1RLMA 1XLTA 3C97A 3VTFA 2V0GA 5DISB 1CEEA 2C2GA 2H1LA 3N9IA 2M1XA 5AR1A 1BHSA 2GZDA 2OBXA 3D7NA 4PYIA 5G3YA 3P2IA 2J48A 3H5TA 1T13A 4IFEA 4JEHA 3V4VB 2O6LA 3EIHA 1B00A 5LLTA 1RZVA 4MWOA 4PZLA 4M98A 1YK0A 2IYAA 2JJMA 3B5IA 2AQHA 1OLSB 3JALA 4WQMA 1IYZA 1US8B 3SF0A 3DDCA 4HRYA 5AO9A 5LQRA 4WOJA 1E2DA 3B6EA 5K6RA 4A5SA 2JBAA 4ZO8A 4V1CA 3ZJTA 5I7SA 4LNAA 2G9RA 5DLQC 5EMLA 1SAYA 2GJ4A 1JMVA 2WABA 2Z2ZA 4CGYA 3DDUA 2GF2A 3INYA 4QDTA 2H1CA 4WGFA 5H68A 1KZ4A 1OLXA 1W47A 1ZK3A 4S1VA 3NDJA 4UQPA 1W1WA 2FGKA 3OIDA 3ENKA 2XT6A 1W5EA 3K53A 4OHUA 1EE9A 3GEIA 3PA6A 3PHHA 4C7BA 1WIWA 3HU1A 5JRZA 1PGOA 5TXGA 5AD1A 2XMGA 3KQUA 3MUEA 3NBFA 4XR4A 1KARA 3LUDA 3EFOB 2PMBA 4DZZA 1F9AA 4D79A 4JJIA 3HCCA 4UD6A 1AVTA 1K92A 2F4NA 3AV3A 4NONA 3H5VA 4EB8A 4IXMA 4J4HA 1G7CA 1K4YA 3MOGA 2I55A 3WX0A 3X2SA 3BKWA 3IUEA 4G4SO 4PN7A 2YJ3A 4QGGA 5JWRA 2DC1A 1WXFA 1BD3A 3DVAB 3F3SA 3FOWA 2AJLI 4WX2B 5KVVA 2ZYSA 1QLWA 1GGVA 2VPXA 4X8HA 1F2DA 1YOVA 3IA7A 2XT9A 1MP0A 3ORHA 3WRXC 1PP4A 4HATA 4E5YA 1ZGHA 2VSYA 1UBTS 3NB0A 3AHHA 2ZTMA 5DGHA 1EPUA 4TQAA 3N70A 2WWTA 1F4LA 5BV8A 1L4EA 2ZXFA 4FNAA 1UKZA 3NT5A 1I32A 3UT0A 4ZHSA 4MDEA 1Q1NA 1H5NA 5C81A 1NDUA 3NMUF 3ED5A 2WAOA 1F1JA 2MYNA 3MERA 3ICEA 1ZD9A 2EATA 1AKQA 4U2EA 3TKAA 3ZE1B 2WSMA 2O0JA 1N8SA 5I7EA 3LXRA 4LYHA 3W2EA 3FMVA 2PD4A 2FUKA 4D2IA 2OOSA 5T57A 3PE4A 1RI4A 1X7YA 2QZZA 3SIPA 3LQ4A 3H87A 5THKA 2D13A 2WJYA 3RFUA 1RYYA 1MKYA 4OQLA 4TXMA 4U8HA 4MYDA 4YJDA 5FADA 4K3VA 3S2FA 4EKIA 4LJ6A 2FMHA 2M6KA 1QDEA 3ZY5A 3I01A 4EY3A 1YMUA 4I7EA 2I71A 1DAGA 3D3WB 5FPYA 3KEFA 4D5GA 3P9RA 3ONNA 4DV2B 5JCOC 1J5XA 1U3DA 2ZT5A 3G2LA 1KOLA 4OJMX 2ONCA 4RH0A 4PWYA 2UDPA 5E4YA 2R0QC 3C5VA 4XQEA 4OKSA 4PLCA 4F2PA 2E5WA 2OGUA 1RM4A 2O2JA 3QNUA 4MITA 2DUWA 1KA9H 1D7OA 5TJHA 3ADPA 4MMXB 4BFXA 4MGYR 4WJLA 3IKLA 4HNSA 4WV3A 5EMHA 3RRJA 4X9XA 4K5QA 3M4JA 1F0NA 2JZCA 1EX6A 3BRWD 3E9YA 3G1UA 2QE7A 3M1IA 4OH1A 4ZXFA 4BKOA 4QOSA 4HSEA 4LJ5A 4WEQA 1O94A 3BX1A 1SQ5A 5JLJA 4RTJA 4H35A 1THTA 3H13A 5KSPA 2ZPUA 3VKUA 3WYNA 3H0EA 3IUMA 2PBFA 5T41A 2QUBA 2PL1A 2JGEA 2PX3A 2PX6A 3CZQA 3BKXA 5AK0A 2F3PA 5HIIA 4UQLA 4PYNA 3HSYA 4Z99A 3PZBA 4B3CA 2PLNA 4C88A 1G5FA 4XIYA 4E09A 5IJWA 1I1QB 2CXSA 4TV9A 2HPAA 5J9FA 2Y1KA 1WLSA 3NAQA 4D0SA 1N1GA 1QWSA 1XALA 1YZKA 2A5YB 4XYBA 4DYVA 4OBXA 4J1TC 3U4AA 1SB8A 2I66A 2PIAA 3CGGA 2O3UA 3BWBA 4M38A 3RSHA 1UC9A 3OWHA 4RK0A 3RUPA 1A4RA 2DLDA 2X6QA 3JYNA 3NNDA 4GMKA 1ST2A 4CL3A 2C3OA 2XNHA 2A9KA 4V2UA 3FI0A 4WXMA 2ACEA 2WJWA 5C31A 2DUNA 1QAOA 4B4UA 1Z4IA 2Q45A 2XYRA 1PFQA 2VH2A 1VL1A 4PX2A 4IQFA 2GPNA 5GM2A 2IF2A 2D0PB 2M6LA 3GC6A 5KTKA 1GUAA 4ZAWA 2WU1A 4MJXA 1HDCA 4JI5B 2JD0A 1YSCA 3VH2A 3U3KA 2I8LA 4NBNA 5CAEA 3AM3A 2R96A 1SKYE 2REQA 3H1FA 2RGYA 2CN1A 3R40A 4L51A 1XZMA 3IIEA 1FUEA 2B4AA 4DRXB 5DN6A 3BSYA 2KE5A 3G6WA 4NAHA 1EFTA 1ZU5A 2X15A 4BIMA 4EEKA 1KFCB 2HF8A 2X2FA 3DM5A 5ALTA 4M0KA 1KVTA 2R48A 2OV2A 1Y6RA 3ETGA 1UQTA 3K1JA 3K6JA 4QUGA 4ZVTA 1ZVJA 3Q1KA 4A6XA 4G24A 4G1FA 1BA3A 1EP9A 1EX1A 2BFEB 3OMXA 3BJZA 3GRPA 1V25A 2AJ8A 2YINC 4AJLA 4W5TA 3QBJA 2Z2XA 1YCDA 2I1QA 4HS4A 2Q4OA 5FYDA 1GYRA 3I53A 4J76A 3G7NA 3TMAA 3EG9B 1O87A 2G70A 1YU6A 1L5VA 3GF4A 2W2NA 1PR6A 4B9AA 4E5KA 1G3UA 4PSKA 1SU7A 1XZIA 5HQ3A 5I7FA 1BGXT 1FEZA 3UAYA 4REQA 4IV0A 1REQA 4W9NC 4AT1A 2EKPA 5BMVA 4FGSA 3X2FA 5ERXA 2GN4A 4GX2A 1WVMA 1HWYA 3IJ5A 3JD0A 5IDQA 4V3CA 2HDWA 5AVOA 2BFPA 2I7CA 3MWFA 4UOZA 1J0BA 3FRIA 1ZIDA 3BAZA 3WWOA 3Q7PA 3S55A 3D5TA 4WKPA 4B75A 2XKKA 3NVAA 3UH1A 2ROQA 3M7IA 3RV3A 3SM9A 2UYOA 1LA2A 2K6GA 1QO0D 1QCYA 3D4PA 3UJHA 1QOQB 4U8GA 1HORA 3CRQA 3E03A 1X0VA 3D3NA 4KWHA 4ZV7A 2QMQA 3CF6R 4DSNA 1ZLYA 1HFJA 2H59A 2JFVA 3AHCA 1ZZGA 2P69A 2XWJI 5JARA 4LX8A 3B9PA 1YH3A 4IZHA 4X6YA 5IWAB 5LKAA 3AEKA 2OZKA 2ZE5A 1D1PA 1GPAA 3H11A 1C8VB 4ARVA 4BJ5A 1GKKA 2VJOA 2J6BA 1U3FA 1YULA 4IXDA 2R1VA 2ZDHA 4GM0A 4NEQA 3S28A 1BWQA 1C0EA 4JOSA 1KRHA 3ZY6A 3REQB 4DCNA 1XMVA 4TMFA 1DO2A 2OCAA 2VT3A 2WUVA 4E2WA 2R3SA 4F06A 3I64A 3NRCA 4TT3D 8ADHA 4H7HA 2WKRA 4HR7A 4AZ3A 1UZLA 1EDBA 1Z2AA 1ORTA 1QS0B 2G07A 3BTOA 1EVEA 2CMFA 1CYEA 4YAOA 3NM4A 3SICE 1W4AA 1OCEA 4L0DA 3A1EA 3C1UA 4E12A 4NIMA 4N12A 3RS0A 1BRTA 9ABPA 4G9EA 3UA3A 1D9ZA 2YWGA 4TMVA 1GRNA 1H93A 3ZLTA 4DQVA 3EG5A 3ND6A 4Q7KA 5EWMA 1YDFA 3W8NA 4B3HA 4PC7A 3ZNOA 1WTCA 1I10A 3MZ0A 5ULLA 4DBLE 4GLBA 3A9TA 4RZ3A 5LQMA 2MIIA 1GHTA 2POQX 3VJLA 3DL4A 2FE1A 1A96A 2F1HA 3DFUA 5CCDA 4Q9NA 3RYIB 3ZDFA 3IUPA 4JP3A 4E21A 1RLJA 1X8LA 3GA7A 3MJFA 2NP7A 3EIXA 1U28C 4AZVA 3ROQA 3R5JA 2ZRFA 3ZCQA 1E0JA 2I6SA 4HQNA 1R00A 4BO1A 4QVIA 3EFEA 3O1JC 4UAJA 1II9A 3HJTA 2VDNB 1R74A 4JLSA 5AW9A 3M4NA 4PQFA 3SC4A 3WZMA 4RTPA 4N82A 4ZD6A 3OQNA 3Q7EA 4LUCA 4LXIA 5F98A 1V16B 1QV9A 4M1OA 4FJ1A 3ZH2A 2PKQO 2WFZA 4Z4QA 1ZK2A 3BFXA 4GOND 5B12A 1J0AA 1EWVA 1GTL1 3CNOA 1JG7A 3AB8A 4DG8A 4RTLA 3CNNA 1M75A 2FJ0A 1YDEA 3O8CA 1IRXA 1G8GA 3UJAA 1KJYA 1XDWA 3T4PA 3WICA 2UUOA 3WLJA 2GBLC 1YUBA 3NONA 3T54A 3VZRA 1Q1BA 4EX6A 2O8BA 3V9PA 4XX0B 1CVRA 2WE7A 2WWXA 1L5HB 3TUZC 4FMBB 3ZX5A 2FPXA 1Z8DA 3PFBA 5EAIA 2UKDA 1GL6A 2A0KA 3UCEA 3HEBA 5FR2A 3DKKA 1EK2A 2Q0HA 3KQQA 5HM8A 2QMEA 1B16A 1CW2B 4J16C 4UEQA 2ENUA 1VJGA 3K1ZA 1Q6YA 3KKKA 4O8ZA 4X6XA 5JS6A 1J56A 5TNXA 5ADUS 1DRJA 2VUSA 4DT1B 3QFTA 5CH8A 4XE5A 4BX9A 3ZWAA 2GVDC 3KQNA 4AZ0B 1KJQA 1CUDA 2SNIE 4X0EA 4RPHA 2X9GA 3E7WA 3A8TA 1ZN9A 1ODTC 2UYYA 1YHZA 4B32A 2DFVA 2VUHB 3A1FA 4KOEC 1ADYA 1BVRA 2ZR8A 1Y8ZA 1YS2X 1DIOB 1MR3F 3G9TA 3DEIA 4M9UA 3IH5A 1JA9A 1L1EA 2Y99A 3P9YA 4XWTA 1R18A 4OQZA 4ED9A 1GNQA 3I1FA 3FHOA 4E08A 1AUQA 3ECSA 3LUPA 1PDOA 3W3AA 1W88A 2HJWA 1M2WA 1KAEA 1ZK1A 1RWMA 3AUSA 3W5JA 4E4RA 4QTYA 4TSFA 1I2AA 4QBFA 1XU4A 1B42A 4CETA 3EXHC 4EPXA 3VKHA 1SC1A 2O06A 2ZFUA 3A2NA 4LA4A 3DNPA 1OLUA 2FE4A 3QVJA 3ZCXA 2GHRA 4HQLA 1F3LA 1U63A 5JBIA 4FMPA 4C6HA 2WFLB 4KTTE 2MSWA 5B3JC 3PFGA 4KO2S 1VLJA 4X54A 5IYZF 4AU1A 2Q3DA 1DOAA 3H5AA 3EQ7A 1IH8A 5DVZA 3H9CA 2FLKA 3QIAA 3NAMA 1ZHOA 1XNRB 1THMA 1YI1A 2GHTA 3DMNA 1O6CA 3L0DA 4RESA 4X71A 1GA6A 4XLZA 3TIIA 2GYYA 4RTNA 4UHDA 1KSGA 2GFHA 3EDQA 4US0R 3LLVA 3FPJA 3OURA 1TVKA 4A10A 4RY9A 3TOXA 1W5TA 3U4MA 3M5WA 1KOJA 2FMUA 2JLWA 2QTNA 3K0BA 3DEJA 3JAWB 1SKQA 3PWSA 2A5LA 4EG3A 4CLOB 4R2JA 1ML4A 3LPAA 1IXYA 2O05A 1UDWA 4WK0B 3QBDA 4XVRA 1T3HA 2KYRA 1BYIA 3WIEA 4EBBA 3COVA 1T0IA 1BQ4A 2BKAA 5IULC 1MGOA 3P1JA 4US1R 1K97A 9MHTA 4D46A 1NW3A 3UJ8A 2WG1A 4XEHA 2OA0A 1XTRA 4IGEA 1ZPDA 2IE8A 3DVQX 2PZAA 2HK9A 5BVGA 3KE8A 5A9RA 3AY7A 4RVFA 3MMPA 1RC0A 2NO0A 3DAPA 4UULA 5JXIA 2VXBA 3I6YA 5JAZA 2UYCA 4DW8A 2IXEA 4XGRA 4RWEA 3AESB 1AZWA 4PX5A 4UFNA 5G4KA 3C6ZA 1KIMA 2A0WA 3A32A 2QYTA 5IN5A 3ZTYA 1M5RA 2R68A 1W93A 9LDBA 3SEFA 5CPFA 4NTZA 4ZQCB 1V6AA 1RKQA 4QFBA 3JQ7A 5EXXA 1FIUA 1V2HE 5LB2A 3BHMA 1G3IA 1NN5A 3DJYA 2BN4A 1SBIA 4KE7A 4A03A 2JL1A 4XQCA 4B6QA 1A9XB 3NWPA 3WLPA 1AY0A 2WV7A 1Q95A 3RUDA 2NN3C 5CT6A 2H52A 1P6QA 3K9FC 2WF8A 1ZIPA 1I7PA 3CLSD 3MPOA 1VSBA 3ZR4B 3ICOA 1QCZA 3A3NA 2CLLB 1HE5A 2J46A 2ACWA 3H1PA 3I2JA 3K7EA 4GZ3A 1KS2A 5D51S 4ER5A 4F45A 1IIRA 1T8PA 2KBFA 4CDMA 2HCRA 4TS1A 4HUTA 3H8JA 2RB4A 2QY6A 4EPYA 3U3OA 3H7AA 1I7DA 1PTKA 2H4HA 2ZUVA 4C2UA 2XODA 3IUBA 2E37A 2YWFA 4HL6A 4IEEA 4Q7LA 1UP7A 1V95A 1U6JA 4GC9A 3BMQB 1TYZA 2OZPA 3B12A 4LK3A 1SQFA 3GR6A 4F9TA 4XOUA 3GAAA 4D4GA 4I1YA 4LXYA 4ZVQA 5FX2A 3D5QA 1WHSB 3TLJA 4BU0A 3CUVA 3A6GA 4QU8A 3M6XA 3AT1A 1H69A 5ALLA 2GAAA 1R9GA 2QN8A 1M1YA 3DONA 5HJ2A 4D82A 3ELWA 4GDMA 4D80A 2FWAA 3IB3A 4LZLA 1PVVA 5KPJA 1KJ8A 4LMPA 4LNUB 3OLWA 5T4HA 1CUIA 4QTTB 1UFVA 3DPIA 4FDMA 4YLGA 4DWVA 5IVIA 2EW8A 5LQAA 3O7MA 1Z28A 1Q0UA 3N2KA 4XWKA 1F8YA 3V8QA 4YP5A 4KQJA 1C1XB 4NNJA 3NBAA 4LECA 1NNI1 4W8OA 1Z4LA 2KX7A 2ON6A 3BIJA 3K8ZA 4BLSA 1JYEA 5EWJA 2L69A 1I2ZA 1UJBA 2X6TA 4JA0A 2AF4C 1XEFA 2YXNA 1FFXB 2ZVJA 3E53A 3ZQUA 3MTIA 2XCTB 1GGEA 2XWSA 2BYTA 2UU9B 4ARIA 4QRIA 5HUQA 1VBMA 3T1OA 1PE0A 1IJKA 2E2WA 2GN2A 1AC5A 5FPQA 3N7TA 1IBCA 4GYJA 1V7QA 5AXDA 3STUA 3IOYA 4MV3A 3ZZ1A 4XYMA 4BWVA 3DMFA 3G8CA 3X44A 4K6OA 5DHRA 1CZRA 4ZT4A 3U16A 4KIWA 1P1HA 2DQKA 3QKRB 3C5EA 2CD7A 3DHNA 3LHKA 1JPUA 5FB3A 1H9BA 3OPNA 1HT1E 4G0WA 4DHEA 1C81A 2V7QD 1NQTA 3DBRB 3G5UA 3D5EA 4H6WA 4IS3A 5AKEA 3QLUA 2WZDA 3T7EA 3F71A 4IEIA 3W90A 3K71B 4FM9A 1QH0A 3A1SA 3P9QA 4QDXA 2FDXA 4G4SP 3NO4A 2XYPA 3WGLA 5JNTA 4M8SA 2NQ8A 3ZDCA 4FMDB 3KQMA 2PUTA 5K03A 1DVRA 3KOOA 4E13A 3PDIB 4QGHA 3JZMA 5BPFA 1T3SA 1W1IA 3LPDA 5LD2C 4B4VA 2Y4OA 2BEVB 2HLDD 4X3OA 4MQFA 4RFVA 2PMKA 1M2OA 3L7CA 5F1PA 5FAKA 4TTVA 4GO1A 3II6X 2J3KA 3I9KA 3PS9A 4Q21A 1ZL0A 1EXNA 2QS9A 2XWQA 2OSBA 3DAFA 5ITZB 2YV2A 3DOIA 3G23A 1GZ4A 4J0QA 2VWQA 1ZNQO 3ACCA 4XCVA 3VX3A 4AZTA 4EM6A 1FLAA 2WSSA 4OX9Y 2VPZA 3CE9A 1W0KA 4X1IA 3AP1A 3N53A 4G1CA 4PRLA 1K9SA 1A76A 3BILA 1CF9A 4OJKA 1FTQA 4QEDA 4IOMA 3U61B 3EF3A 2RHDA 4ND5A 1HLFA 1U0LA 2R66A 1QYXA 1S5PA 2GN1A 3E6AA 4C6TA 1QHGA 3QW2A 4F8JA 1VL2A 1SKYB 2JI6A 1MXFA 3KK0A 4PSAA 3DM9B 2G0NA 3I5YA 4P4SB 1OASA 3IPYA 4TXHA 4NHOA 3N2EA 3KKNA 3HVKA 3MWLA 3B60A 2DJ5A 1LTKA 1CY2A 1ESCA 2OQRA 2YRWA 2DTXA 1M6VB 2X0JA 5SYNA 2OHVA 3PQ5A 3HCEA 4KDEA 4KYTA 1LDYA 1BXZA 3JZDA 4LYFA 1NQ5A 4OL0A 3QG5A 2VF8A 4IR7A 4CV0A 1YMQA 2ZITA 3TFQA 3I76A 3ZE6A 4WXRA 4AK9A 3AETA 4J7UA 3M4YA 4Q6WA 4WERA 2WRZA 5LVAA 3I2FA 4DR5B 4BFSA 5KOHA 5J4YA 2J87A 1KNQA 1ONNA 4ZP1A 4DMFA 1TZKA 1QLJA 3ON5A 5KQSA 1VCMA 4Q4HB 3UC9A 1PD0A 1OXBB 4UNSA 3LM8A 3W8EA 1VDMA 2GNAA 2XCQA 3P9SA 1SELA 2OKCA 1Y6ZA 3UMYA 5IZCA 2COKA 3HGTA 4MGIR 3H1GA 5SV2A 1B0PA 3QVUA 3W9SA 4HWKA 1XN1A 4DEVA 1EFAA 1IK6A 1S1CA 2Q5LA 3G2KA 2HTEA 3RBZA 1WUKS 4XASA 4TL8A 3W2HA 2G36A 1TB4A 1ESZA 3VYRB 1WOYA 3USES 4EHNA 1VSQA 2UZIR 3LT2A 4OKNA 2QT0A 2DVMA 4P4NA 1U2DC 4DXAA 1Q1EA 2ANBA 1GM5A 1JLHA 2FWJA 3K73O 4JL5A 2HGZA 3P7MA 1ETUA 2B0CA 1XYVA 4HQRA 3SLGA 1BEEA 2ODBA 2JGRA 5BSGA 3KCNA 5CFQA 3CYFA 3P5BA 5IHPA 3HK2A 3TIGA 3KQLA 4C4SA 1NI4B 2XEDA 1L4MA 4EO7A 5C46F 1M7BA 1D2RA 3EZ2A 2R65A 2PS3A 3AL3A 1COWD 1QHSA 3CVYA 1Z36A 4UZSA 1JQEA 2VSXA 2YS7A 3JWIA 4IILA 4TL7A 3T4EA 3N8KA 1SCUA 1B1AA 3JD2A 3OE1A 4RBNA 5EP1A 3UFBA 3WYBA 3B1YA 1C7EA 1OPRA 4EX7A 3UV3A 1NMQA 4D0RA 1I30A 5DNEA 1E4VA 4X85A 5A1TA 1M33A 2J3MA 2R6R1 1PR2A 4F0JA 1ONBA 1T25A 2RHBA 2VN8A 4RCVA 2C4HA 5FL3A 3VZDA 3UPTA 4XSHA 3OZVA 5D85A 3TIFA 3K9QO 3GH3A 1XU7A 2B4TO 1M83A 2D2XA 4ZHQF 3RUIA 1YJ8A 5G0SA 3G8YA 1MVLA 2H08A 3VC2A 1T24A 4W9RA 2ZRLA 1JG1A 2NZYA 4D0LB 4UTZA 3BMOA 4D9CA 3D1LA 3OA2A 4MWDA 4XH9B 2QX6A 1WXGA 2EZUA 3B9QA 1DP4A 1EHIA 3HQ4O 4ZPJA 4K1LA 1WNFA 1XCJA 2FWMX 3M1AA 2O2CA 4ZDJA 4DN6A 4OGLA 4B3MB 1D7AA 4GKAA 5IKEA 3I45A 1FDOA 3FRHA 3TI7A 2IWRA 4Q05A 2OHXA 3EF1A 1RACA 3LWBA 1WAMA 4FOSA 5G0TA 3LSTA 1A9QA 5HZGA 3EIOA 4LRTB 3GK3A 1LJLA 4TUYF 1C3EA 1GZ3A 2XYQA 3U3ZA 2R85A 3PPWA 2FW1A 2ZLBA 4JXJA 4F8YA 3KLMX 1OIVA 4KREA 4LN1A 2E49A 4B47A 3WP0A 4D3DA 2LDBA 4F3KA 3GPCA 2DX7A 1XVAA 1Y1PA 3KX2A 4MLCA 4MWTA 2WWRA 2AG0A 3LQ2A 4IG4A 4BS9A 4FK8A 3R9WA 1LDGA 1YR6A 2G9VA 2PTGA 2X4LA 4A8JB 4E5PA 1B93A 3BGIA 1FCJA 4A2PA 1VE6A 5M04A 1L9KA 2QDKA 4AKTA 2GPYA 3GEEA 4DV0B 4AB1A 3QLEA 4WE3A 3O1HB 3T9FA 3E3MA 1UDAA 2PPLA 4N8EA 1YZUA 2OD7A 3D3QA 3AF4A 4WZAA 1B76A 1T4DA 3CU5A 4LV6A 1K89A 1N9GA 3P71T 3IQHX 4MUXA 2EFJA 4PF1A 3M3HA 2XUPA 1NLUA 4D9NA 2G8NA 4IX9A 3PRKE 4DCJA 4YCBA 1TRKA 3NWOA 2ZJ0A 2AMFA 1LPMA 3V2HA 4DMKA 3UJ9A 1CC1S 4DUYB 2Z95A 1LNSA 1K2VN 4LDNA 5AFSA 3L7LA 2FUNB 3ID6C 3DOUA 4OHVA 2O8FB 5EJFA 3V1MA 1MX1A 4CYMA 3WWCA 3JQPA 2PEYA 3A3OA 1T2EA 3ESAA 3PQ3A 4K7JA 3MWDA 5FT9A 2XYGA 5AUQA 2CLCX 4F72A 2H5LA 4N0PA 5EXSA 3R8FA 4EQ6B 4UNPA 1UK6A 5LN1A 1EMDA 2F3QA 2YOGA 5DHFA 2YN4A 3RYHA 4QQRA 3EWSA 2A1TS 5JJIA 3ASVA 4TLBA 4R69A 2BPOA 4L8VA 5FI3A 5LMCA 3N3AC 2D4AA 4MWEA 3R6TA 3NX4A 4ALKA 1YI8A 2WMNB 3GWZA 1A8QA 3BCSA 1NONA 4UM7A 3TRKA 1Z3IX 3MGGA 3EVEA 4KXFB 4R2WA 4RD1A 1IDN1 4B5KA 2D5BA 1FJHA 2BELA 2A35A 1JSLA 1S8AA 2HF2A 1N5RA 3OCJA 1BHO1 2CXPA 3E48A 4IQ0A 5BO5A 1KYQA 5KYXB 2PKQP 3PQ6A 4DIFA 1LPNA 5HCUA 1P2DA 2JGKA 4C7MA 1K7FB 2VZ8A 3QJ5A 3ZD9A 1XXHA 4H7DA 4DQUA 1X1QA 2F00A 3WGTA 3LDGA 4D43A 5IJ0A 4RTMA 3RW9A 4DVGA 4AJ9A 1PD1A 4NCHA 5AW5A 3RAJA 4ATNA 3GDOA 5DT2A 2JCYA 4ARAA 2VTDA 2QPOA 2GOYA 2RI1A 4MKRA 4NAVA 3CB2A 2FPPA 1T2NA 3O8QB 3OE5A 1MABA 4TMWA 5DULA 3UFXA 5KNBA 4PICA 5B1YA 4K6CA 3OLVA 1AKYA 1MF7A 2B37A 1FP7A 1CIVA 4HN4B 4HTFA 1QTRA 5IUKC 2EF0A 4NU6A 2FFAA 5HOEA 1GTSA 4YJ2F 1YK1A 4I5IA 1E96A 4HH3C 1GA4A 1L5WA 2XVYA 2O54A 3L1UA 1GUZA 1M8GA 3EQZA 4UNIA 1FE8A 3R2JA 1HNZB 4X84A 5G4LA 3DEFA 1A9SA 1IDOA 2H48A 3COYA 3EW7A 1IQUA 3UYKA 3T7KA 2HIHA 1VMDA 4M60A 1WUHS 4FQ5A 3W6NA 1MENA 3V3KA 4J49A 4Y1EA 4UTRA 5IJXA 4AUKA 2OORA 2A9VA 1P1FA 1SBCA 2JLCA 1QB8A 3UO8B 1E1NA 1XTKA 3TPFA 1TKRA 1FFBA 1NRXA 1S01A 3NT4A 4RY0A 4ILEA 3TEJA 3IDSA 2H00A 2R8OA 4BCCA 3I9FA 2GWRA 4Q3AA 5JD6A 2WNHA 2VLIA 2YOHA 3HKDA 2QMZA 3PD7A 4K2AA 3GP5A 2IU3A 1V8PA 3ORSA 4JR2A 1V37A 2C2YA 4UD2A 4P53A 4U4AA 1JLKA 3KVYA 4AO6A 3D6TB 4H15A 2ACKA 2ZE8A 3RE1A 4YAWA 3HL0A 1V35A 1ZMBA 5IC6A 4ODIA 1L5GB 3EDYA 1TD9A 2FSHA 3Q9SA 4BE4A 3L5OA 4IMIB 4P31A 5B1SA 1DKPA 2ALJA 2I2CA 2NUPB 1XCOA 4ITVA 1RYMA 4RJ2A 4RKFA 5JIBA 3EIEA 3ZGLA 3OZFA 2WWHA 3G17A 4BUJA 1W85A 4FZ5A 4IF4A 1XNGA 2FR1A 4G5SA 2F3RA 1ZC4A 3RLFA 2CF6A 2Y1LA 3K09A 5JJCA 1RWVA 2XECA 1WKBA 3HN7A 4H4EA 2O5CA 2YN2A 3NOVA 2CCJA 4PGFA 2WTUA 1CT9A 3PICA 4MV5A 1Z63A 1MW9X 2I7DA 3RC3A 1JHMA 3PIIA 4PBRA 1ZVMA 4C06A 2ZRCA 4R1OA 4ZYXA 3UGJA 1RLIA 4ZZ0A 3STXA 1XQVA 5JNUA 3FNBA 5FOXA 2Q6OA 2RH5A 3BJMA 3R5FA 4XD7D 1UMKA 2Q9BA 1AKEA 2V45A 3AOEA 4FWTA 4YIKA 3MTGA 5AKLA 3ND9A 5K09A 1E0AA 4Y6GB 3MMSA 3VNRA 4FX5A 2J0SA 1G55A 2HRZA 3ZBPA 3DOCA 5CDHA 1I6MA 4MGEA 4EZBA 1WF6A 6REQB 4G8JA 1JEQA 1CZKA 3FG9A 4S12A 4YDRA 1L4UA 2BEWB 2IZ1A 5GOTA 3EEFA 4CQNA 4PG6A 4GW3A 3K0HA 3OJXA 2CZQA 5DK6A 3CUYA 2H7CA 4GBGA 2PKWA 5BWBA 1E9SA 1WJGA 1XP8A 4ZCLA 2YTZA 1OFTA 2ZRDA 1VPWA 1LBQA 3DTVB 1CUCA 1V8FA 2PT7A 3FFXA 4QELA 5LQKA 1OILA 3FM9A 3R24A 5FL7D 3PFKA 3D4OA 4PAMA 3LZCA 1ZLXA 5TMDA 2CT8A 3KFLA 2Z9DA 3I0MA 3SNHA 2O8DB 1MRSA 3IIIA 4NENA 1L0BA 1C0KA 1GO2A 3DNFA 4H1VA 4RWZA 4ZJUA 3B3QA 5KOJA 3QUBA 1GN8A 4FSDA 4MRMA 2C88A 4KEAA 1IWPB 1UBKS 4ER0A 1WUIS 3DUFA 3WWYA 3NW9A 2WJIA 4ZI7B 3KVNA 5DHAA 5SY6A 3OM9A 1XJQA 3LLUA 1GQYA 1QRAA 1E98A 1EQAA 1RLUA 2X8JA 3HVHA 4UASA 4XVUA 5KSZA 4HLQB 3PD1A 5BYJA 1TO2E 1E0DA 4Z8XA 5A4JA 2K2QB 2GGSA 1OGJA 2P0YA 1T2CA 5LL6P 4MPRA 1LLCA 1DZIA 5TS2A 4F4IA 1SXJE 2HF9A 1UKCA 2W9XA 3CN7A 1Q77A 3L8FA 4PYKA 1WM1A 5JAOA 2VBIA 2VQ3A 1E3DA 4BP9A 1RBMA 4ZTZB 5C1PA 1GXSB 4OJYA 2CMGA 2C97A 4FQ7A 4BZWA 5BSVA 5FNVA 1ZL2A 5IBQA 3HV2A 3TDKA 5FI5A 3H1TA 5L3RA 1NASA 3FCEA 1BYUA 2QROA 2W0SA 4BFWA 2QQEA 3KQPA 4Q3NA 4OIFA 3WISA 821PA 4MPTA 1MIOA 1JEDA 2NO7A 5DLEA 2PWBA 1ONPA 1F06A 3JQCA 1NT4A 1YR8A 5AKZA 3B36A 4N65A 5HF5A 1ZOLA 1V6CA 2X4GA 2UUAB 3M3PA 1UKYA 1CHNA 3WJAA 3AJ9A 1GGMA 1I6LA 2Q9CA 3HCAA 1XTBA 4IV8A 4JC8A 4M1KA 5EXDA 3MAGA 2EX0A 3GMSA 2EV9A 3OZIA 1E2PA 4GPAA 4Y30A 4ZQFA 3ZOZA 3LHSA 4GSKA 2V3VA 1QV7A 1VCNA 3N07A 3ZDAA 1XCLA 2ZI9A 3EGOA 1Q12A 2P2LA 4XGIA 4Z9XA 2BR5A 1M2FA 1PZXA 2B25A 1QKKA 3NALA 4XX1A 3VM6A 5LZ4A 3VKGA 4KV9A 1Q0TA 3VOTA 3KAPA 3K0SA 1I7LA 4BUCA 1GQOA 1QG2A 4NU0A 4GMGA 3PHGA 4J3JA 2F1IA 2XMSA 4UCFA 1E1QD 3EWNA 5JZSA 5DLYA 1AMOA 1K7EB 4MLDA 1LDNA 1OGYA 4W5RA 2XAAA 5B7NA 2QTLA 5ENDA 2UZ1A 2WIJA 2H16A 1U90A 1VBKA 1BROA 1GLNA 2IDZA 3FTPA 1PL6A 3ZG6A 2BGIA 2F6RA 1GV1A 4IIDA 2WV9A 3P9ZA 2YXPX 2YHBA 1WDWB 5IASA 3RYCA 2C9DA 3ANXA 1JR4A 3RVSA 5D1HA 1CCWA 2HZ7A 4Y2GA 4DNFA 3C3CA 4RF3A 3VQTA 2B4YA 1G7SA 4MDYA 1JG2A 4OK5A 4ZPXA 5EYPB 1A8SA 1SUDA 1U3CA 1AUXA 3Q7SA 3K35A 5CH5A 5BSTA 4DS3A 1TKCA 2OK7A 4H1TA 5JD4A 1EA5A 1LVGA 4JX9A 5KU1A 4K9MA 1AURA 2NU9A 3UC5A 3LPNA 3GLKA 2PYIA 3EMDA 2V5AA 3ZGOA 3LJKA 1QJCA 2ZE7A 1D4ZA 2NU8B 4I4TB 3VAYA 3BXHA 4HMOA 4O4LF 4OHXA 2RFLA 1SBYA 3DZCA 1YB4A 3D4IA 5ELLA 4DC0A 1TA4A 4LC0A 3AI1A 3OD1A 3W6ZA 1E1CB 1Z6XA 3TK1A 3U48A 2XD9A 2MYPA 3G3EA 1WOMA 4CTNA 4R0VA 4MTLA 3VKWA 1FYWA 5CRIA 1TUGA 4YRDA 4R41A 1Z33A 1ZRMA 4OAOA 3TLGA 5HM6A 3SGLA 2I2FA 1J39A 2B36A 3M49A 4ZVKA 4BO4A 2RG7A 4BTVA 2VP2A 3TBFA 1B73A 1ZDMA 3I1JA 4YAGA 4CMIA 2Q5JA 2XQKA 3FTCA 1G4UR 1V1JA 1ZD4A 1R0BA 2I67A 5EI5A 1O5IA 3BF7A 3SJBA 4D8VA 1PWHA 5DP2A 4EBFA 4ZDIA 2XGOA 4GPBA 4WFKA 4XLLA 1FRZA 5F35A 2V9CA 2XBUA 1Q7GA 5E0OA 3TS1A 1S1MA 2JD2A 3Q5EA 4LF5B 3WRXA 2GK4A 1LVHA 4BEVA 2D3WA 1BA2A 3Q3GE 1RBQA 5JPIA 3C8HA 4BEWA 3KVOA 2EL7A 4J94A 2P68A 5CT5A 1AA6A 1YAJA 1Y9DA 4V0NA 1TCBA 3MWJA 1P5ZB 1E2KA 2QVYX 1G2QA 1STOA 1NVEA 2UYQA 3VZQA 4C89A 5A3RA 5KCZA 4MV9A 2WP8J 1SUEA 4IY1A 1QK5A 3B5JA 4R4JA 3T12A 4RK7A 3UENA 1IU9A 2HX1A 3YASA 4CGZA 1J06A 1JMKC 5T5QA 4BQQA 1D0SA 2C03A 3AR2A 4DCPA 1ENYA 3OZWA 4ZKEA 2YJTD 1GEEA 1W2WB 3O8DA 4M9CA 1AMNA 4QECA 1CUYA 2O19A 3ZJ4A 1CXZA 3V1NA 3CUSA 2B92A 2QT9A 4H0CA 1E3WA 4O59O 1JI0A 1WVGA 2YVQA 2CZGA 1FDUA 4C14A 3QTBA 7ADHA 2VNSA 4IDOA 2JCSA 1GWNA 5JCOA 5AIAA 3DVSX 3AI2A 1AD2A 3KHSA 2PZEA 1OR8A 1PQ4A 4MYUA 5GONA 3TM4A 4BGIA 4C4XA 5FUMA 2B0JA 4DIEA 3U56A 5EOVA 5JS1A 3N0VA 2M9MA 1FRVA 4MR8A 4DGSA 1JEYB 3JQBC 3ZXSA 3GNLA 3H5LA 4ZYWA 2JD1A 2CYBA 5CVTA 2WF5A 3OEHD 2IQIA 4WLEA 4EHAA 5MGNA 3ECCA 3K9HA 4EVQA 5EA2A 5KPDA 4M4SA 4B17A 4BN5A 5DWDA 4H27A 3X43A 1WQ3A 3UUFA 4TKVA 1VI5A 3ZDDA 2DULA 5D01A 1ZESA 1QGAA 3I0ZA 5ALNA 4Q9JA 5ABPA 4TV8A 4EG1A 2EFEB 3EGDB 2GARA 3OY7A 1XQXA 3IRUA 3OZUA 1A69A 4YT4A 2WI8A 1Z39A 2BL4A 1DKOA 3ZYCA 3PJRA 3E9DA 3SIWA 3FMPB 2ODAA 3DE2X 5LYJB 3THYA 1JXMA 1T2UA 1XRRA 3HE3A 3X1WA 4B3FX 3GLHE 1ZICA 5AQEA 4H3VA 4EARA 1I94B 4JCOA 3W77A 4P7KA 4YQFA 4ZYZA 5JDIA 3WGGA 3O3CA 1D6MA 1EZZA 4KLRA 3AKDA 5D3MA 2J45A 3D0OA 1QH8B 4NSNA 1IY0A 2CK3A 2PZJA 2V7XA 4TPKA 3CW9A 3R8CA 3SQOA 2FX5A 1FJ2A 3ZW9A 3IVGA 3IULA 4CM1A 4L3OA 4GKJB 2RGGA 3DD5A 3QHAA 4J1TA 1VPDA 3NYQA 4F4HA 4YRGA 4O3FA 3TQTA 3WK6A 4O63O 5J58A 4JBWA 5I9BA 3O4HA 1Z73A 1F9EA 3AEQB 3I9JA 4UVEA 1XYGA 1USWA 1SC9A 1ZINA 3CNLA 4HDKB 4TROA 4CN9A 1GPNA 3G9ZA 2WTXA 4NZ9A 2PFGA 5HDBB 3T61A 3JQAA 3JSAA 3DLPX 2P2ZA 1RM3A 1TF2A 4IFBA 5DHUA 1NJ2A 1Y5RA 5ALHA 5C34B 3ZV6A 5ITVA 1DWQA 1PBTA 4YPFA 3M6AA 4CW7A 2GN8A 2BCJQ 2AOVA 5BXQC 2C2HA 3HXKA 1TKBA 4X44A 1L7DA 3KQTA 3M6VA 4LSZA 4DNPA 4AYTA 1R15A 1P2TA 1TDJA 1JHUA 5KVQA 3CZAA 3E3NA 4EJ2A 4KQMA 3LLMA 2CSUA 2KJQA 1J7JA 4BNDB 4ZALA 4Q19A 3BD7A 3KT3A 4M6WB 3DLIA 2V6JA 1FSGA 2AN5A 3OX3A 3PR3A 3QE2A 5ALEA 5ED4A 3NDIA 1H9AA 2BGMA 4E6EA 3CF0A 2VPWA 5FI1B 2C00A 1HZJA 2MWMA 2W2PA 3BXZA 2VT7A 3RU2A 1SUSA 2NT4A 5GIPE 4TMXA 3QZUA 4FSHA 1QHEA 4JKYA 3VPGA 1TW3A 2DBYA 3OF5A 4EYQA 2J0UB 4FYMA 3VO8A 4HDRB 3ESYA 4P82A 5CFLA 4QNMA 4W9NA 3WOVA 3T0FA 4XQGA 5U4XA 4YMLA 1LX7A 2RGBA 4DQKA 1CDOA 2YMMA 5FBLB 2VF7A 3W9UA 8LDHA 2I29A 1DKNA 1S4QA 2VA8A 4IEFB 5BN5B 3KYIB 4H77A 2JAPA 4NFSA 2I9KA 1NW8A 1ZI8A 2HU7A 4QRDA 1ZQ9A 2RHWA 3E27A 4PWZA 3EYWA 1MB9A 3DT8A 4XUDA 1YMVA 1KXZA 5ECDA 5K3DA 2YC2C 4L22A 5BW6B 1TC2A 2G67A 4QDJA 2PV7A 5KNCD 1WBDA 5L3QB 3J81A 3ITEA 2LPMA 4EO9A 3IAAA 5ELMA 3IPCA 4C01A 2QUHA 4B2YA 2C3PA 5JMWA 3FJYA 5P21A 3U3RA 1ESDA 3BZWA 2RI6A 1S02A 3UIEA 4Y2UA 4I5FA 1JQKA 2G0TA 3RAPR 1SM4A 2H1FA 1X7ZB 3PGKA 3OIGA 4NXMB 2G1JA 2PZ8A 1LJUA 1NW9B 1YRWA 1QE3A 4JLOA 3ZCRA 3WADA 3TX6A 3FHLA 4KBYA 5I6DA 3UV7A 2WJGA 2M32A 1GUDA 3BDIA 3WGQA 1HK7A 2L42A 4CEHB 2COUA 4Z2YA 3OZDA 1SCDA 1A4UA 3NQ41 4EHLA 2G6BA 1A98A 1XRQA 3NGMA 4FUTA 2BSXA 4FFDA 2JI4A 5BSEA 3QPCA 1RW4A 2XSZD 4A16A 5CB4B 5BSUA 3ZWMA 3K8YA 5D84A 2I3ZA 2P90A 3Q9NA 3SHFA 1Q44A 4C0KA 3AF2A 1EXDA 3EODA 9ATCA 3R9KA 4BIIA 3R0XA 2UUCB 3E3OA 3EQ6A 1SC6A 1EP2B 4KKXB 2DAPA 3T3HA 3S8YA 3EVCA 4RS4A 5J2UF 1XNJA 2XYVA 5CD9A 1J5PA 1II8A 4PVCA 4RPKA 1CUAA 4L6IA 1DXYA 3UHJA 1C14A 4C20A 4Z1MA 4HDSB 3GJTA 4B6SA 4NDZA 3AERB 1UF9A 3FCCA 1X92A 5EJ4A 1P5FA 2PUGA 3CUKA 3NBUA 1D04A 3S8EA 4QC2A 1ITZA 3C6YA 1QF9A 1XK6A 4WBNA 4ZQGA 1JHDA 1UJNA 1NX6A 1O08A 1KJJA 2ZIVB 3DOOA 2HDNB 1KI4A 3EA5A 3QP9A 4KUHA 3EGXB 4ALIA 1IVYA 1UP6A 1VC2A 2EP8A 3RU3A 2F90A 2QGNA 1JEEA 2VJCA 3GBPA 4KSYA 4NMWA 5I7VA 2GBLA 1F2UB 2P5UA 3D4NA 1IAQA 3MD9A 2BRUA 3TBHA 4B7XA 2CYCA 2IEZA 3E9ZA 1OIXA 2A9QA 4KSCA 2IY8A 5LPNA 4X66B 1VYVA 4CG1A 1SO8A 1SCAA 1ZMOA 4KIGA 5BN1A 4U6SA 2JLYA 3J7TA 2O8VA 5IUNC 5IXYA 4MVJP 3EWAA 2P35A 1B0UA 1J1IA 1PGPA 2W2LA 3WFIA 3W5BA 1SXJB 3L7JA 1VL6A 4G09A 4DC9A 1GL3A 3FYHA 4CXMA 4B3SB 1VXOA 3F74A 3HWX1 4J16A 1DB3A 5E9AA 3V55A 1HGXA 3U31A 2FPKA 1NNLA 2FTKE 2DWOA 4P3XA 1Z7WA 1TOAA 4JN6B 2C1XA 2IUTA 4KK3A 2FZ5A 3NYIA 1P2UA 3KEMA 4JU9A 1VDZA 3EX7C 3OT1A 3FOFC 1BW9A 3HSSA 1NATA 2I1LA 1IOZA 1ZSVA 3NWEA 5JSZB 2VHEA 1BWSA 4ZO4A 1ORDA 4I50F 3LG2A 3U4DA 3DBLB 5FBKA 2PRZA 3COWA 4PS1A 4F4CA 1RZRA 2PGAA 1I1OA 1T6NA 2WHXA 2ZSJA 2AJCA 2JGDA 2VNJA 3OMLA 4QTZA 5D5PA 5SYMA 4FZVA 2RBKA 1T6BY 2ZJFA 3H4IA 3T1VA 4XJXA 1L8LA 4RHTA 1PR4A 2R6HA 4JLNA 4TMZA 1IBRA 1P77A 2DECA 1AQUA 4YCJA 3K9GA 1Y6FA 2SBTA 1DJNA 4UAUA 1XMXA 4C0AC 3HG7A 1X86B 3EXHA 2J32A 2PJZA 3GELA 3I0NA 2VJMA 3H19A 4H60A 2IU0A 4BECA 1GU0A 3C7CB 4GP6A 5DV9A 1GT6A 1E6LA 4COKA 2IOQA 4DREA 4AN4A 4KZPA 1Y0BA 3VNQA 1HEIA 1LRJA 4N0DA 5DGXA 3SJCA 4C0SA 4HB0A 5AK4A 2ODEA 5KMGA 4BMYA 1YIAA 1EJ0A 2HZBA 1HF3A 1LC0A 5JCJD 1JL3A 3OICA 3U1BA 2HCJB 4NESA 3S0JA 2AZXA 1ORWA 3PFCA 1L7VC 4V1CI 1SZCA 4TXJA 3R5HA 4L27A 4ZFNA 1BFKA 1N6RA 1TYDE 1N8NA 2PSHA 2RCNA 3B1KA 3KOUA 2QD2A 2ZUBA 4OQYA 2YXDA 2OGZA 1G8PA 1JJAA 5KKAA 4BB6A 3EUAA 4MS1A 2UZ0A 1Z6ZA 3OQOA 1CQZA 2D7JA 3E3AA 3N86A 2B8JA 1J42A 2QX4A 4ZOBA 4ZTBA 5TQ0A 4DJEC 1SCIA 2PQ0A 3O8RA 3QV2A 4UU0A 1P61B 1JBKA 5BWOA 3GOHA 1SUAA 1Z18A 2HDHA 2JFQA 1FRQA 2C3UA 1P31A 5BY2A 2HCBA 1KEVA 5DYIA 4INPA 2DOKA 3NKFA 3NKLA 3ZKAA 2X9VA 1UOQA 4R8MA 1GGJA 4CKXA 3P45A 5J2TB 1DBIA 1E3QA 3GRZA 4QTXA 2CVHA 3LSYA 3ST7A 5AKYA 4FMCF 3CRW1 3JALB 2O7VA 4E51A 3N58A 3NTOA 2F9FA 1JSZA 2D0IA 2DUJA 1ILEA 4HUQB 3W6UA 1R1DA 2A1IA 1EBUA 3AHEA 3E2MA 3Q3CA 1FDWA 4GNKA 4LJ7A 4K88A 4QJ5A 3RUCA 2XDQA 3K70D 3PGXA 1ZA1A 4IKPA 1NI3A 4QHTA 4ALLA 1L7EA 3TO5A 2IUEA 3UB3A 1WP4A 1JHXA 2WHQA 3ICWA 4F3RA 1H5QA 5LP6F 2QN1A 1YB5A 2REXB 2WFAA 3GZ4A 2NW6A 3LH5A 3RWOA 1QCDA 2B4QA 3DMPA 5JCJA 3K32A 4TYWA 1JAXA 3FSEA 4BPBA 2BH9A 2NTJA 3C98A 1DBPA 5BW4A 3QIVA 1TU4A 2CL0X 2YZ7A 3CH4B 3A6FA 3CC8A 3NOOA 5DHPA 2HJHA 3FOEC 4IDDA 2RIRA 4MVJF 4LXXA 4MUFA 3Q41A 2IIQA 2X2EA 1WDLA 3BB4A 4PLPA 4EI8A 1C9KA 1HEYA 3PRHA 1GLGA 5JH7A 3JATB 1P0CA 4IF6A 2IELA 3C4JA 2WA1A 3I9LA 3TQSA 1PG2A 1NBOA 2C5SA 3Q0TA 1RZ3A 4RJJA 1X87A 1CHDA 1P44A 4FR2A 4OUDA 4WY8A 3WGOA 3ZPXA 4UUAA 1LV7A 4G67A 2VI5A 4TM7A 2FR0A 4M53A 3EZGA 1ILWA 4XZ3A 1S3IA 3NDBB 4KMRA 4PTLA 4AY6A 2EG5A 4IHJA 4DM7A 5I01A 2GCEA 1OVMA 2BBOA 2G4VA 1IHOA 2J9GA 2QI9F 2PX2A 3NHAA 3RARA 3FYTA 4F8EA 1I4WA 5HIMA 1MEOA 3ZVRA 4JWTA 1RE0A 1T4GA 3UATA 1MAHA 2BIFA 2FG6C 2FSFA 5JMTA 1YZGA 2J33A 3DO6A 3G8BA 3N8IA 8MHTA 4GL4A 3H2GA 4YNBA 5ECGC 3V4PB 2FPWA 4B87A 5ALFA 5KNLA 1JHQA 4OB7A 4RCYA 4AS1A 3CG0A 1U2GC 2GXSA 5JAMA 1WSWA 4U2DA 4B33A 3CNEA 4CCYA 5FPHA 5JNRA 2BMWA 3VU1A 3GRYA 4BKRA 2XA1A 4IFTA 4YO8A 3W0LB 4EVRA 3MGKA 5CK5A 4KHPB 2PTHA 5FCDA 5AWFC 4WRRA 4N49A 1HNXB 4JJZA 4O02B 5C5IA 1EHYA 1FXWA 2AR7A 1BVYF 5EY5B 5F52A 3CZMA 1G7TA 3K2IA 2AW3A 3RR2A 2GJKA 2YZ2A 1RFGE 1BX3A 4ISBA 4Z0PA 1S96A 3SVTA 1N2EA 3OIUA 1DG9A 3TEMA 4Q18A 5K3BA 1NF8A 1ZBQA 5K0TA 3V8VA 3T1NA 2RC6A 3RBVA 2ZB7A 5B1EA 1YZ3A 2JNWA 3NAGA 1KK2A 3PA8A 4OPMA 3R8XA 2O2HA 3REGA 4CCWA 3ZUPA 4KR3A 1NQVA 4B6RA 4Y0NA 4DY4A 3DUWA 1HDYA 2IEDA 2XQGA 2ZAYA 3A31A 3AILA 3B9BA 2PVCA 3GAMA 1EVLA 1KL7A 2QM7A 1GTRA 3HTXA 1J6UA 3L8CA 2WBLC 5E9WA 3QLVA 2WJJA 1C7IA 1C3JA 1H2XA 1ZONA 4EHDA 4Y18A 3TFWA 3QHQA 4YALA 4RA9A 4TLCA 5EKSA 5L4SA 5FPTA 3ZCVA 4CEIA 3EHEA 2AZTA 2PPVA 4URVR 4JL8A 2FQQA 3QUAA 5D00A 4KTVE 4TV9B 4CG3A 1KZGB 1GPLA 2QRGA 2OZLA 3VRHA 4A92A 1T4CA 1ENZA 1JVNA 4LISA 4DLSA 5C9ZA 1GQSA 1H3EA 1WV1A 3PI6A 4BLOA 2YUIA 3AEUA 3D6JA 2VJLA 1RMYA 3IT0A 5HGXA 3H6KA 3VU9B 1XD9A 4GI5A 3IKJA 3ETJA 4OQPA 5FTNA 3WLRA 3QOYA 3ZK8A 1A5AB 2DQSA 4BX0A 1JFFB 1NWCA 5TPWB 4LCJA 2V7WA 5AVJA 4TWBA 2ZRAA 2AG8A 1T5DX 3IIJA 3L0IB 4F04A 2FEXA 5H83A 1UPUA 1O6GA 2H9IA 3CCCA 3S2EA 3G1TA 5K3CA 2WJ4A 1U0FA 3KU1A 1FQOA 2GDZA 2QTGA 1XL0A 4LDJA 3LW7A 3AFNA 4GPD1 2Y1GA 1NPTO 4FOLA 4ZT2A 4LDPA 3ZBQA 4CZ2A 1MC1A 2R6FA 2YZKA 5CFPA 5IX8A 2XCOA 4CODB 1HMYA 3GVHA 3V46A 1DEHA 1U8FO 4GKKB 5A5VA 2ZIUB 1FRFS 4B4KA 1PL7A 1GAJA 5GY7A 4UATA 1E32A 1NYQA 3DHWC 3UPDA 4W5QA 3VR1A 1FZTA 1T2DA 2H0RA 2ZETA 4H7JA 4YHHB 2FPGB 3FNQA 3HVJA 3HWSA 2F3TA 1SOVA 3F2IA 1NP7A 3LWNA 3MQ2A 5TGZA 4GWKA 2HRQA 2OYSA 1WDTA 4P08A 2H65A 2P9QA 5ENZA 4YAIA 2XDWA 3RT1A 4Q16A 4MINA 4A8JC 3LVQE 1G5RA 3AV0B 3FHTA 4NE9A 1N6IA 1Z5ZA 3EVFA 2B2CA 4RJTA 2E82A 2EKBA 4LZZA 4UOQA 1VKJA 4EF6A 2IHKA 5C5EA 1FJGB 1DIRA 1IULA 1VJDA 4RF2A 2O2IA 2WPDD 2XUZA 1U5BB 3D3KA 4REQB 3W8DA 4HEHA 3V34A 4D3FA 4D44A 1VE3A 1F2TA 3NHZA 4J2TA 4RZHA 1W5SA 3G88A 3GIWA 2HJGA 1YR2A 1CJCA 5BSHA 3C6BA 4HVCA 1FVHA 2NVBA 1KDZA 5I9TA 3RHFA 3ULKA 2Q0SA 3BA6A 3ZXIA 4DB4A 1KTVA 2BFDB 5K8IA 1QPGA 2RJOA 2PKEA 2WG0A 3ONEA 1T2VA 3SVZA 3UG6A 3VVBA 5CA1A 2NTEA 3EPHA 3CKLA 4KR9A 4CBVA 2OAGA 3SDSA 4ZEOA 4ZMBA 2J9YB 1U0NA 4F2HA 5C3MA 3MWGA 1R4ZA 3RC7A 4Q5IA 2FB9A 4W5NA 1K7CA 3H5WA 1OBFO 1U2ZA 2Z5GA 2Z8ZA 3AEKB 5AHOA 4ZAFA 3EPJA 1J1UA 3RS8A 3H11B 1HDIA 4YX9A 1M73E 1W35A 1SMKA 3ASUA 1PR3A 3WQHA 2R8BA 4F86A 3MCAA 4DV1B 5IP5A 2CL6X 2ZS8A 5FV7A 4AZWA 2H29A 2WNIA 4KPUB 1TQHA 1R6VA 4TVOA 5JQGB 4A6PA 2QZ9A 3LE8A 3ERCA 3EXIA 2JIZA 3CHYA 1SA0B 1JKJB 1XELA 1A9RA 2PAFA 2NYVA 4LQCA 4A0GA 1V4BA 2MMGA 4IAOA 2ZR7A 1L1RA 1OYVA 1T0HB 2AOUB 3DFMA 3PLNA 5HF9A 5CDTA 1P1RA 2N1BA 3G0OA 1PNRA 2J9RA 2BZGA 1N2IA 3O47A 4IGIA 4OHFA 4L6AA 1NHGA 3M83A 2G88A 2MJLA 2NU6B 1E3JA 5K0NA 1A9YA 3LY5A 4GWGA 4H6XA 4UNNA 2ZCJA 1O9HA 2A67A 4EG8A 4PSDA 3U0BA 2G3YA 4FEAA 1Y9ZA 3HHPA 5L6LB 3B82A 4G5FA 2JIQA 1HQKA 3MC1A 1HLDA 4B2IA 1RADA 5HP4A 1NR7A 2GO7A 3HDTA 4RLHA 4L4UA 3X1DA 4DIMA 1DBSA 1PF7E 3BSFA 4QM7A 2EERA 5DN6D 5HBRA 4ARCA 4WFQA 5IH3A 5DM70 2ZT6A 3NCHA 1VMIA 2H8KA 1EBFA 5I48A 5FXMA 3H17A 4KXYA 1UC4B 2H5EA 4Y1RB 2GZ3A 3ZC3A 1RIIA 3JQDA 1H65A 4HQOA 5AI6A 1UWCA 4QKQA 1DKQA 1TUBA 3CPHA 5SZKB 2DETA 5AW2A 1JHAA 1U02A 1FL9A 4LXHA 3NP9A 2PL9A 1X3LA 3U40A 3RUHA 2AA3A 4JKIA 2G04A 3PDHA 1GNVA 3OI7A 4GVPA 3AF6A 1ZD3A 3TMYA 4RELA 3GUZA 1KMHA 4KO1S 4MO2A 3FTQA 4R8LA 1K8ZB 1WQ4A 5CLGA 1HRDA 4CMGA 4FBGA 3P2EA 4BNGA 5DCYA 1JQ3A 3D8TA 5IAJA 1R4NA 3KXKA 1NXQA 3LHFA 5C7OO 2B6NA 2C59A 3TG8A 1AGYA 1J21A 1XPJA 5F51A 1WEKA 1OHHA 2Z5VA 4HFJA