3K2QA

Crystal structure of pyrophosphate-dependent phosphofructokinase from marinobacter aquaeolei, northeast structural genomics consortium target mqr88
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
418
structure length
392
Chain Sequence
IKNAFYAQSGGVTAVINASACGVIQTARKHPDQIGKVYAGRNGIIGALKEELIDTSLESDDAIQALIHTPGGAFGSCRYKREYERLIEVFRAHDIGYFFYNGGGDSQDTAYKVSQLADRMGYPITCIGVPKTVDNDLPFTDCCPGFGSVAKYIATSTLEASLDIKSMCETSTKVFILEVMGRHAGWIAAAGGLAGQSEGEPPHVILFPEIPFNREKFLERVDQCVRDYGYCVVVASEGAQYERFGVAPALANMVKQALGHKYHWAVADYLQRAARHIASATDVEQAYAVGKAAVEMALAGKQALMPTIVRDQAKPYRWSIGEANLSEVANQEKKMPIHYITDNGFGITQDCRDYLQPLIAGESFPPFDDGLPRVAKLKNQLVEKKLRTEFEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Pyrophosphate-dependent phosphofructokinase
publication title Crystal structure of Pyrophosphate-dependent phosphofructokinase from Marinobacter aquaeolei, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET MqR88
rcsb
source organism Marinobacter aquaeolei vt8
total genus 134
structure length 392
sequence length 418
chains with identical sequence B, C
ec nomenclature ec 2.7.1.90: Diphosphate--fructose-6-phosphate 1-phosphotransferase.
pdb deposition date 2009-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00365 PFK Phosphofructokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3k2qA01
3.40.50.460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3k2qA02
2KHZA 2A0KA 4RH3A 4KXMA 4LJKA 2IZ6A 1S2GA 3O8OA 3F5MA 3O8OB 1F8YA 2IZ7A 1YDHA 4HX9A 3EHDA 4LJRA 3MAJA 4OHBA 1WEKA 1MTOA 4A3SA 4LJLA 4U1RA 3O8LA 5ITSA 3GH1A 4JELA 1S2DA 5AJUA 1RCUA 1T35A 3SBXA 5AJTA 2F48A 4WL0A 2F2TA 1KZHA 4JENA 3IMKA 2NX2A 2PFKA 1WEHA 4FYIA 4I36A 4MCJA 1PFKA 4KXNA 3OPYA 3PFKA 3O8NA 3OPYB 3UQZA 2PMBA 1S2IA 2F64A 4P5DA 4OHRA 4FYKA 2IZ5A 1F8XA 4NPAA 1ZXXA 3K2QA 4P5EA 2F62A 2A33A 3QUAA 4PFKA 3HNOA 2HIGA 4I4IA 1S3FA 3U39A 4MEJA 4I7EA 2F67A 2Q4OA 1S2LA 2KLHA 4FYHA 6PFKA 2Q4DA 4JEMA 4KXLA 3BQ9A
chains in the Genus database with same CATH superfamily
1H4SA 1X1CA 1R4NA 4WN3A 4RIEA 2GZ2A 3DE7X 5KWJA 4CEHA 4GPIB 4JR1A 3B51X 5FI5A 3SYMA 1LDEA 1QMPA 4GX0A 5BMVA 2JGLA 2RCYA 1W25A 4TL9A 4OX9Y 4HDNA 3RANA 5IYZA 1G7CA 3CQ9A 1OU0A 1B6SA 1YI0A 3AG5A 4HDRA 3D3EA 4QE3A 3WA7A 3MMPA 5ARCA 3SZOA 4DJFC 3T5PA 4RY0A 1LTKA 3U31A 4BQPA 1EVKA 1GU1A 1T2EA 3BL8A 1WMEA 4ND8A 1C7QA 2H1LA 1JAXA 5D3KA 4LECA 5LB2A 4HNRA 3IHTA 3H18A 2C4UA 4V3CA 3DULA 4ZVUA 1XMSA 5JPCA 4UHJA 3P9XA 3HJHA 2PNJA 2AD5A 2H3HA 1F2DA 4X95A 3R5TA 5HCUA 4DXAA 4G4SP 1FBNA 2FUCA 2IEBA 2QJTA 5EQJB 5IM4A 3GG9A 1UBSB 3GFSA 3R5SA 2Y1KA 3WGQA 3U6BA 5CT8A 3FFBA 1XZGA 2OXEA 3OY7A 2XNDA 3O2SB 2IBTA 1NYRA 3HU3A 3PFBA 4RJLA 5L4SA 2FN4A 2I71A 4MUXA 1FFEA 2HHJA 5DTMA 4JFAA 5ILGA 1TEHA 2FOXA 4RZUA 4AZSA 4B7XA 4PINA 1RCUA 2DFNA 4RJTA 3T7CA 2ANCA 4TWRA 3OO1A 4CM9D 4UM9D 2YFYA 3SQDA 3TO5A 4A73A 2HNBA 2YIDA 3VSBA 3CINA 1QG2A 2R96A 2HK6A 4HQRA 1IHUA 2HUPA 1L7EA 1GO2A 4AYXA 4CKYA 4Q47A 1P1KA 2J9GA 2XMGA 2BFAA 2BI4A 2XMBA 3X1YA 1NBMA 2JIRA 2WJHA 4DJTA 2REOA 4MWCA 5CMLA 2YN0A 2WVJA 2CHVA 2OB1A 4I08A 2VXBA 3B1VA 3CRNA 2FHPA 4KTVE 4C4RA 5JZVA 1NIJA 2XGJA 4X60A 2W22A 3DZGA 2WZDA 4PAWA 3DMGA 5EMMA 1CB7A 4IIEA 1YNSA 1J70A 2J0UB 4D56A 5GV8A 1H2RS 1W0JD 1SK8A 5BNZA 1PLLA 2ZRHA 1IB0A 1K7SN 2J6CA 3HVKA 3A1SA 3ACBA 1NMXA 3CX4A 5DBEX 1NP6A 4HTFA 4RIGA 1GKKA 3A36A 2XYPA 2XITA 2V58A 3CG4A 5JCJA 1X1TA 1AUQA 3WAJA 1YKGA 3QZUA 2OPBA 2VZ8A 3GXOA 1JHQA 4FFPA 4NKRA 4WCVA 3RJ9A 3TKAA 2GCGA 4KN6A 2IU6A 5A9SB 3AF4A 4GU5A 2ZIUB 1E3WA 4RQBA 3T06B 2ZIEA 3A1EA 3D6AA 1YC5A 2UAGA 1KI2A 2NUTB 2QWXA 4GP6A 3RT7A 3WKCA 2AFIA 4BKRA 2XT0A 1QTRA 3LDHA 4N5HX 3B82A 4FCCA 3VR6H 4DUGD 3FI0A 2IYZA 4L0MA 1F0KA 1ZEJA 1NHWA 2GHTA 1M6VA 2PT5A 4D43A 1RRGA 2C7RA 4BMXA 1HEYA 3S55A 1GY8A 1T9KA 2XYVA 2JLZA 4YRJA 3VNRA 4WLVA 3O38A 5TGZA 2QAJA 4KJZA 1Z6YA 1G8JA 1WVIA 3AX6A 3DFZA 5M7EA 1OA1A 1IN1A 3QFHA 1XLTC 3ZX4A 5IDYA 2SECE 1TKAA 4O6VA 2C03A 2BJHA 2YH2A 1V5GA 4LHYA 2IXFA 1EEHA 1F4VA 2WJYA 2RG7A 1CNMA 4PO8A 3THRA 5DX1A 3UGKA 4HGPA 2PX5A 1NG9A 2CLMB 2CE7A 3JQFC 2W71A 3HUDA 1MDBA 2X7HA 1T9HA 4E30A 4B3MB 1JT2A 4MVJI 3PUYA 1LPOA 5CVEA 4ZMBA 4XI9A 3WOVA 2KE5A 4A6PA 2RI0A 4OX9B 1YD7A 1QZZA 3N8DA 3ZE1B 2HAEA 2EKZA 2HSZA 3NIWA 1G3QA 1B1CA 1T1EA 2ORWA 3VR0A 1RM4A 3E18A 5GIOE 1DX6A 1EZ1A 1XMPA 2V03A 4IDEA 3I2GA 3ZI4A 2P4SA 2C7OA 2EYUA 3BSYA 4QX6A 4V0ME 1JLSA 1VRVA 2R8EA 3OQIB 1MIOB 4GXNA 5KWIA 1XXLA 1H8ED 1S8OA 1HI9A 2OXFA 4Q6WA 2OBYA 3ENQA 4NNJA 3HY3A 4KLNA 1R8YA 3BGSA 3MQFA 2YXDA 5IC6A 1L5NA 4BO5A 1MW8X 5HRAA 2I91A 2QA5A 2QSUA 1P31A 4DV3B 3MHPA 4WACA 1D4AA 4JLMA 4L8WB 4BNFA 3HJRA 2HPAA 5DM0A 1X38A 3UK7A 2VLBA 4YRFA 1OFGA 2ZYSA 5JHHB 1F14A 3EUEA 1XHEA 1SPBS 1G20A 3K8YA 4PPGA 4HEA1 3EGOA 1O95C 4L9WA 3HEBA 3R7SA 3RKUA 1USWA 3VTZA 5KC8A 4HYQA 4PN7A 1T5HX 5EP4A 1MEEA 1FNSA 3ADPA 4OJKA 1U4NA 1QVVA 4A8JC 4PLVA 2ACKA 1CUAA 2WDZA 3JWPA 4TKUB 1H2WA 4CKWB 3CX8A 3KTAA 1F6DA 5IJ9B 3RC1A 4E15A 2A2ZA 2PX0A 1M8GA 4ZP1A 1LDGA 3VDQA 4YRAA 4ZYXA 4NG5A 3RRYA 1QJ4A 1TPYA 2R6FA 2FLKA 4Z1OA 3JVDA 4C6SA 1IUPA 2HCFA 3ILYA 4Q4AA 3BS4A 1J2RA 1GZ4A 3D6HA 4UCFA 4BNWA 5JD6A 3U56A 1BMFA 1N2ZA 3OCYA 4E09A 1REQB 3EFOB 1SR8A 1XX6A 4UHHA 2ZI6A 5FPSA 1ETUA 4FP9A 4V0RA 5LCXA 2HADA 3UCEA 5JWOA 4ER0A 1WP9A 2ZXFA 3ET5A 1WZCA 4MKRA 1JZSA 1O1YA 2F43B 4NBWA 4NULA 4AZ3B 4BNHA 2A6PA 2XNDD 5F52A 4DXHA 2NADA 3M4XA 3A4NA 3LLUA 3PVCA 3S70A 2OL4A 3TOSA 1SCKA 4E33A 1E59A 4F9EA 2ZE5A 3HJUA 5IEBA 2W6CX 1VHLA 3T1VA 5F5XA 2X8JB 3QEJA 3VKVA 4BFUA 5GZ1A 1KAQA 4JLVA 2QTAA 1QX3A 3PA6A 3LMKA 3A3OA 5FYQA 2VA9A 1QLHA 1SG0A 1I30A 4J03A 3BKXA 4RKRA 3AUAA 1N2GA 2QY9A 5BR8B 1FIUA 4OUDA 4FBLA 2NVBA 3I8SA 4LG1A 1H23A 1W44A 2GCNA 2JD1A 3ZE6A 2FDCA 4ARIA 1YTUA 2IZ1A 5EESA 3PQ6A 3HSKA 3P5SA 5FL7A 1VHJA 2OMEA 3S68A 2LV8A 3K05A 4N7RA 1MX5A 5I9IA 1ZJJA 1XF9A 3V9AA 3FLMA 1JQKA 2E4VA 1ULTA 3GRZA 3GT3A 4EMTA 5EE3A 2BGIA 3RTGA 3ZVRA 3WRWA 1GPUA 1Q1AA 4FI3C 5AT1A 4ZOQI 1CJTC 1LCIA 3H1FA 1S7CA 3TKYA 2IGBA 3IPCA 1LZKA 1W76A 4W9NA 5HILA 3PLRA 5C52B 4YMIA 2V7QD 5MGNA 5FR1A 4B74A 3GLIE 3H11A 1PHRA 2Z3ZA 3JZDA 4GI5A 3SF8A 1PD1A 2OCAA 3M8KA 4JNCA 4LSMA 1K1EA 1LW7A 1X8XA 3KLPX 4I55B 1BQ3A 3BXOA 4M0LA 3ROGA 1N8NA 1VTKA 2JFNA 4BATA 1FYDA 3FKJA 2CLOB 4IFTA 4LTMA 4PIPA 4XIFA 1L5RA 4M4SA 1VFPA 1QFJA 2HCJB 3NALA 4WUVA 4XM1A 2JLBA 1YZKA 4QHYA 1Q2XA 4CV3A 1J9GA 2V3WA 4ZYUA 4HC4A 2YV1A 2XOXA 1W0KA 3LBAA 1CWUA 2C04A 4AN0A 4ZCTA 2IS4A 3IPXA 5EJ8A 2BGUA 3Q8WA 2GZ3A 4I19A 5ADWA 5IKEA 2HYIC 2F1HA 4JJ6A 4O5AA 2VF4X 3O91A 5AXCA 4DBVO 2GFHA 3OY2A 4NZYA 3AESA 4YV2A 1Q92A 5T41A 4EK9A 5KOYA 2RGRA 3B9PA 4H31A 3RWMB 3LUAA 3GGDA 4XLLA 4X7MA 2AR9A 3PS9A 5DB4A 4JFRA 2PSSA 4AJ9A 3EVZA 4C4ZA 1I5EA 4RIIA 1VKOA 1VXRA 5FB3A 1PS0A 5FBLB 1RFLA 4QSHA 4BQSA 3OE5A 5K0EA 4XCQA 4LSGA 4E22A 4LYHA 1T2CA 1HZZA 5B4VA 5JDIC 3O6VA 3NEYA 4ZAYA 4YJ3A 3EVNA 1GLVA 1UBTS 4QUBA 1CDEA 3MSXA 2IKQA 4X1YB 3N75A 4XCXA 2CXOA 2GM3A 3NDRA 5KJEA 4L4SA 3TD6A 2C92A 3UW3A 3BJRA 1DJOA 1MVNA 2I2FA 4LZNA 1AY0A 5ED4A 3DVAB 4PSVA 3RAGA 3WKBA 3KEFA 4A8HA 1ZOSA 1NKSA 1VJCA 3AB3A 4N82A 5D8DA 3JD0A 4YRTA 1AZTA 3BG5A 4D8XA 4Q7JB 5D3QA 3HVIA 2XWBF 5TMBA 1G4HA 3ZGOA 4BO0A 2K6GA 2ZSFA 1ZK1A 3TCKA 4FSHA 3IAM6 1R9MA 3EVDA 4B9AA 2D1YA 1HC7A 4UFPA 3IOMA 1Z5NA 4TTSA 3KB2A 4MUFA 4CLRA 1KFBB 1GGVA 2EWMA 5K1ZA 4M0FA 3WJAA 5MF6A 2DU8A 3EDQA 2FFRA 1BE1A 4OKIA 3TIXB 2JFUA 1ZGHA 2Q5FA 5JI3E 4MV0A 1Z6XA 1SCQA 1GEEA 1JDJA 2QV0A 2GUWA 2XUZA 1CP3A 3EQ7A 4HT3B 4XWKA 2PGXA 3AHJA 2CGEA 3PTAA 4AS1A 3KT3A 3TQSA 1D1SA 3U3MA 4PXYA 3L41A 2YWCA 4DR3B 3EDRA 3VVCA 4YJ2A 1C3OA 1I4WA 4YVFA 4EGAA 1UWKA 3UV3A 1A9QA 1SIUA 1TCBA 1VGQA 1X14A 1PK9A 3FDZB 4IG4A 3FI9A 4W5TA 2O7NA 1I01A 1W8IA 5AH0A 2AIRA 3VZBA 1W1UA 1SKYE 5DLYA 1HT3A 1YB5A 2EAUA 5CYFA 3E9CA 2O8CA 1BMFD 1QXSA 4UXJA 4RKYA 5JAHA 2JFZA 1ODFA 3BREA 3CF6R 1UP7A 1PHPA 1YKSA 2FX3A 3BHJA 4J0JA 1FFCA 2JGDB 1KORA 4HFJA 3GA7A 1Y63A 3P5BA 4UTXA 2WICA 3QLVC 1X7XA 1KQPA 2RGAA 4ZK6A 1I4TD 4FMBB 3ZCTA 2QM0A 1T1IA 3A4TA 3EZ2A 1XYVA 4OA5A 4OGFA 4CLOB 1PBTA 3K9CA 4Q19A 3LHDA 5IVHA 4URHA 3UA3A 1PL7A 4IS3A 1LSSA 1F2UA 2O2ZA 4F21A 1FA9A 1QHXA 4YH1A 2H7XA 4M1SA 4A6EA 1YV9A 1VLJA 3IE0A 1HM5A 4HQLA 5ALFA 1KI8A 4ZKDA 5A1JA 2FTKE 2AGVA 2P5TB 1HZJA 4RM2A 2B0CA 3NM4A 2HXGA 1RI2A 1SOVA 3H4IA 1NMQA 1WABA 4QU8A 4YS6A 1M2GA 1WDTA 4MQFA 1COWA 1DINA 5DCWA 5EIBD 1S3GA 3DA8A 1YIDA 3WIEA 4XYLA 3O4FA 4L6IA 4X00A 4TTVA 1SVNA 2ZYTX 2HXYA 3BH0A 2OR3A 4HUQB 4Z9FA 1XCPA 3L4BC 1GTMA 1SG6A 2VEOA 2LP4Y 4GEKA 1IUKA 2BZSA 1EG2A 1M2OB 3LT4A 1Y8QB 4WFIA 2OG2A 2I6GA 3AR3A 4EG0A 3AM1A 4R1LA 2EX4A 2GBCA 3HXKA 4D80A 3CA8A 1EPUA 1GNPA 4JVNA 5DNYB 3P9CA 4AB1A 2GD6A 3IP3A 3FNEA 5I3ZA 3WGMA 4WKOA 4DANA 1T43A 2ID7A 2V74B 5KNCA 1H1LB 1XROA 1LEHA 4FD3A 3TL3A 4GX1A 2OSBA 5HFNA 4C4TA 4B7AA 2FRVA 3MVEA 1TIBA 4H7EA 1CU1A 2FWAA 1UZUA 2ZRQA 3W6ZA 4I14A 2GAOA 2AZTA 3RFCA 4LI0A 5HOEA 4V38A 2FU5C 2VWGA 4JBHA 5CXXA 2QVBA 3DMRA 4XYMA 5I7FA 4ND7A 3KSZO 2F48A 1G5QA 1GTJ1 5EE5B 3KRTA 3WDSA 3TIFA 1SULA 4B8WA 4D8WA 1Z75A 1Y5MA 1WIWA 1YI1A 2GFQA 1P1HA 2ZI5A 3EXG2 2WYUA 4KK4A 1USVA 3QX7A 4I5IA 4L9RA 4RHUA 1WOMA 4IIHA 1M1NA 2R62A 4ZYZA 1TQ4A 4LXHA 1PZHA 4DDMA 5CHEA 1NHGA 1UT5A 4D5EA 1AV7A 4FPXA 2EJVA 1ZLXA 3DHNA 3RT9A 3V8QA 2ZJ3A 3B7WA 1ZD5A 1RXSA 1PJLA 3NFYA 4LCBA 1KS9A 1HKHA 4TLBA 3RYHA 5KOHB 3WHLA 2NAPA 5G0UA 4DPLA 4FNMA 3ZV4A 1M1YA 3S2ZA 3AUXA 1QB7A 1KI9A 1HRKA 3V4RA 2UV8A 1XCOA 3RS4A 4CV1A 4LMBA 3M7IA 2JLUA 4BNXA 1MV5A 1K8XB 2ROQA 1YRHA 4NBKA 1XPUA 1XDBA 1JKFA 5C8YB 2EKPA 4EQZA 2DPLA 2TMYA 3IAFA 4EHAA 3G2LA 5EL0A 3M6XA 3QOWA 4RZHA 1DKNA 5EJGA 1NUSA 3TAHA 4B3SB 2JFFA 5DMXA 2YIVX 4WESA 2XWJI 1J09A 2V8OA 3LDGA 3M4YA 3QF4B 4TV8B 2QW8A 5EWJB 1CUVA 2NZYA 3M5PA 1J97A 3ASVA 4BO3A 3R09A 1CHDA 3NHLA 2GYYA 1M0SA 4RA9A 3CCFA 4B33A 4G8BA 1BQ4A 3LD9A 2VDLB 2HGZA 3AHIA 1EAYA 3BDIA 4PLCA 4S0ZA 3FGZA 2XMRA 4G5XA 3TUJC 5J2UA 4S05A 3PQ5A 2DHRA 4RF3A 4X91A 5JZSA 4FS8A 4R1UA 4ND6A 4K03A 1HLDA 3OT5A 1ECBA 5A4KA 3CXUA 1GPKA 3LF2A 1ARZA 5I9TA 2ZSJA 4CLHA 4DLNA 1QC5A 4FN4A 1SKAA 4OYLA 2J3DA 3ZYZA 3KC2A 3H5VA 1Y6GA 2RHMA 1V96A 3B52X 2XR1A 4OH1A 1XTVA 3H2KA 1PW5A 4FMCB 2GK7A 2B37A 1XCBA 5BQ5A 4TT3A 3O75A 2J08A 1A8HA 1W8DA 1II8B 2AFRA 2H2GA 3NW9A 3QE3A 1ZOOA 3Q3EA 4JROA 2OGUA 4PQYA 4KPEC 1AK9A 5LYJB 5MDHA 3VU9A 4XWYA 5A5FA 2QJFA 1JYSA 1QOZA 3F6EX 5IEJA 3DNPA 4YRPA 2DB3A 2HA2A 1A2BA 5TXGA 4L4RA 3UK2A 4LSZA 5THQA 1CTQA 3HH8A 3SX4A 1B0UA 1Q0PA 1WD7A 5E6RA 1P9LA 3GP5A 3WY9A 3MBKA 5CH8A 1DLJA 2ZJ7A 1IUOA 1FEZA 3SHQA 3I32A 4OFWA 1WS6A 2IIQA 4HDSB 4CI0B 1BDJA 2UKDA 4DCPA 1P5FA 4N01A 4R9UC 3R8FA 4PXAA 1JVSA 3DE0X 1ADGA 3EIWA 2WM2A 3B9QA 3PFFA 3QI7A 3AHDA 1NLUA 4BYMA 4REOA 3FHTA 2O1XA 1U80A 3DO6A 4OLHA 2CUKA 4OQDA 4QDKA 8GPBA 3QYJA 5AI6A 2BUCA 5B1IA 4A91A 1PFYA 1M9NA 2H51A 2JARA 3RAEC 5JSZA 1A98A 5JO9A 3GLHE 1ENPA 2ZSBA 1T2AA 4WT7A 4MS1A 5IN5A 5LXTF 1XZFA 3ZI0A 1JSLA 2YYAA 1C3EA 3IYLW 3PHJA 4CKEA 3N0WA 5ERYA 4LHZA 2J6IA 4BOYA 3KVOA 4GAEA 3QV2A 3KDSE 3M6VA 3GRPA 5LP6C 5G0SA 3L77A 3R3UA 1BOFA 3CZQA 5CFOA 3AR9A 3ZHXA 1N6NA 4JH0A 2AN1A 2OAEA 2BGRA 2RK4A 4MEBA 4C88A 2P6OA 3IERA 4PZAA 2B8JA 3RWOA 4GVLA 2BFFA 9ATCA 5EJ5A 2X0IA 4DR7B 3VO2A 1R0ZA 4QDJA 5IKXA 1DS6A 2Q1UA 3CCCA 4CHTA 3QVWA 4IMIB 3FBGA 3HI6A 5DW0A 4KEAA 3V1UA 1WKCA 4B6JA 1WO8A 4GYKA 3VQTA 4ZAZA 4AUNA 3TR6A 4Z2AA 2EFEB 4AJNA 1X1EA 2BT4A 2AOTB 5ANRB 3B20A 1RIIA 1R4NB 1UZNA 3UJ9A 1T3LA 4CEHB 2GWHA 3K53A 3QXXA 4HFRA 5AKZA 4OKSA 5H3CA 1ELOA 3U0VA 3VNBA 4F4UA 1GNVA 2O2HA 1Z2PX 4OK3A 1EBUA 1GVHA 4HDNB 5IYZB 3Q8MA 3GLRA 4WEQA 3BWYA 3R7WA 1RHMA 4ZO8A 3CPHA 4JT2A 4LHWA 5E1DA 4EEXA 1RZRA 3T95A 4JI2B 4PRZA 1RYMA 1M2KA 2O2CA 1ECFA 4UM5A 3IAUA 4ND8B 4R0NA 2G72A 1KJ9A 3OOWA 4MDEA 1HDYA 4WXMA 2JGFA 1WHTA 1E7WA 3GGJA 1G5TA 4F04A 5FEUA 3CVVA 2ZWAA 2W2NA 2B8WA 2QTHA 1PR2A 3FPCA 1Z5VA 4DXDA 1MT0A 3AOGA 3F6CA 3ZLTA 2OBMA 3N2YA 1U94A 5K8IA 1PNOA 4JLPA 3HCWA 3MB8A 5IT4A 5K8LA 4H1VA 1UDWA 1GPWB 1OZFA 2KW5A 2Y1LA 2QRUA 4NABA 5EE9A 3R76A 1GTRA 3UT5A 1OBFO 3VZSA 4D6YA 4BFYA 1UMDA 4LFCB 1PZGA 1GP2A 1EI9A 2A5JA 2ERXA 3QFRA 1MZPA 2XYQA 5EHGA 1LW6E 3AI3A 3IXQA 2WUDA 4MQUA 4NZOA 3KKMA 4YJFA 2ZWMA 3C5VA 5AJXA 4FX2A 4EQ6A 5M5BA 2B1IA 1RWWA 3K5IA 4RO0A 3QIVA 3LDUA 2F8LA 2O5VA 2QUAA 1VLLA 2VHWA 2XCOA 1TFUA 2YASA 4G6ZA 4HZUA 4RL6A 1UADA 2CYCA 3VISA 2X4LA 2HJWA 3V1KA 4EPWA 2WSLA 4MJ3A 2C5AA 3H6KA 4QOFA 1KOFA 4JIGA 1U8UA 1M72A 3IILA 4N8EA 5B64A 5AP9A 1VIYA 1Z4OA 5H59A 5DYNA 3R6LA 1I1HA 1AGYA 1RBZA 1U0NA 4MQEA 5F4BA 3PIRA 5IW8A 3D2LA 5G0WA 4RD2A 3E8XA 1MRZA 3LA8A 3Q2OA 1Z16A 2CCJA 4E21A 1JDSA 2JRLA 4HTFB 3UHOA 2DWQA 2DOKA 1QG0A 3AQIA 1PNQA 4G5QA 3K6SB 4D74A 4OLJA 3KK0A 5BWLA 4EHKA 2G36A 3SM9A 4B75A 3ETLA 4FMDF 1RTKA 3EB9A 1BS9A 3C7TA 4NV1A 2Y1OA 3A6HA 1V8DA 3CLUC 3CBGA 2HJSA 5DSTA 1EBFA 1R8SA 4KU4A 1JU3A 3W34A 1JEEA 2XQGA 1YMQA 4C5AA 1E3WB 4UBJA 2H2DA 3AJAA 1L4NA 3L07A 1AXGA 1OXUA 3DO8A 2WTMA 3LPAA 1Q20A 2IPNA 2AFIB 1QJCA 5FLXA 4R1SA 3K09C 1CEQA 3AJ9A 3KZ1E 2W2LD 4LZOA 4ND1A 3WO0A 1LH0A 4RCZA 3UQZA 1O77A 1UKZA 3FNIA 1M6VB 4QATA 1CR0A 1Z7YA 2FPSA 2WJAA 4N49A 1PDOA 1VG9B 2XQJA 1T4BA 1DOHA 1VRWA 2NW6A 5TB5A 3W2IA 4A4DA 3DBVO 3X1KA 2XKJE 4CZ2A 4I46A 4KMRA 4O33A 3S27A 1UJCA 2D2VA 1U7XA 2YFHA 3SQMA 1V4NA 1HDIA 4N39A 3TRIA 5EJAA 4DTIA 4M1TA 5A2QA 4BJHB 1KAHA 3EH1A 2RDMA 5HGJA 1A8SA 1KMQA 2ZBEA 1TZJA 3AOEC 4REQB 2AT1A 1SFRA 3SYRA 2CWDA 1UFKA 3H6HA 2FXIA 3LP6A 1ZWKA 3KD3A 1ZRMA 2R751 5CNIA 5IAKA 4ZAXA 5JZOA 1BDHA 3KR1A 2EJWA 2BZ1A 2EW8A 3PQFA 2WJZB 3VZDA 3HJFA 1E4EA 2QLNA 3CLHA 3GOHA 5FIUA 2IP2A 4EUNA 2CMFA 2PX4A 1NRWA 3H0CA 4F46A 5J40A 1KHTA 3TCNA 1MX3A 2JK0A 4F4IA 4YUZA 4XSHA 5KREA 2PPVA 1E1MA 1LV7A 2F67A 1OXXK 2IUSA 4NDNE 3RTAA 3T7JA 4C5CA 5CEJA 1ZQ1A 2NO9A 5HQTA 2C7QA 3EUAA 4DMFA 3M6UA 2WUFA 2RAVA 4B81A 1RKVA 3CWQA 4UTNA 3E03A 2XDWA 5KWVA 1KGDA 1NVMB 4K40A 4RK0A 4PFQA 4CDGA 1GGJA 5AVSA 3U44A 3WGGA 4CNQA 1Y1RA 4WN9B 2XRZA 1SUPA 3C8HA 4R2HA 3AEYA 7REQB 3WB2A 3H2IA 3N8IA 1EXVA 1KO7A 3DTYA 1FTNA 1CBUA 1DO8A 2C4KA 3I2FA 1EKXA 2CNWA 2QN9A 4IIJF 1EVEA 2B8EA 4P7GA 2A0KA 5EKSA 1Z4NA 1SHUX 2B4TO 2QRPA 3HBMA 3DXYA 1YL5A 3MFQA 4LMPA 1G20B 3Q1LA 4PXSA 4RBNA 2PLRA 3SZGA 5DSZA 5KYTA 1EBBA 2CKMA 3FW1A 1BVYF 2A0WA 4W1QA 5FA5A 3PHIA 4KO1S 4QYIA 4B3JA 4D9MA 3ASYA 3ZV3A 1NKTA 3WNVA 2JGKA 3CZAA 3P9KA 4JX8A 5DO9A 3WYEA 3RS3A 3RUDA 5DNAA 3VPFA 2XF2A 1QIHA 2PMWB 3ZS9A 4HF7A 3KTAB 4AKTA 4EPRA 3ZDAA 2OBFA 5AK4A 4PZ9A 2O59A 3DZIA 1YS2X 1ATIA 1JR3D 1W5AA 1JECA 4BNIA 1IG3A 1F0PA 4Q4AB 1W5TA 4XX0A 1QYRA 2DZDA 3THWA 2RHGB 2XXAA 2QXTA 3GR6A 3KQNA 1H2HA 4H17A 4CQNA 3ZIAA 1WBBA 1OYOA 1KP3A 1E0SA 2WRZA 3RBAA 3RTCA 3NRCA 3ILVA 5TEWA 1A5TA 4J07A 1B8OA 1E9BA 2OD7A 4IH4A 2IL1A 3RDPA 4AJ2A 3PICA 2C8JA 1H93A 1LB1B 2AJ8A 3FPLA 3GNQA 1GQOA 4LGYA 4YCBA 3W6UA 1PR9A 1NY6A 3DW3X 3VZCA 3DBIA 4D57A 2QLMA 1Q57A 2BH2A 2BFCB 3NR2A 3VXKA 1ZH4A 2F3UA 3K6JA 1P3Y1 4MWSA 2E5FA 5JZ9A 4HG2A 4LWPA 5GADl 5LJLA 4KFCA 1PJCA 4OUDB 4PLHA 4Y0NA 2I2BA 2WYIA 3CN7A 4KR7A 3PD0A 1X9IA 4BVFA 2CT8A 3PJFA 3W79A 4RPIA 1SUCA 3NHRA 3F3YA 4GNRA 1ZD2P 3ZV7A 2CLCX 1IIBA 1SZJG 2PMBA 2V5AA 2FRXA 5FOSA 3U49A 1RLIA 2LNDA 2FFBA 1NNI1 1NYLA 3LLMA 3UBMA 1ADCA 3ER9A 1DXYA 1EB8A 4YGXB 5BN1A 4X8HA 4EA9A 2IZ5A 2OZLA 2WM9B 4OQLA 3WK8A 4CFSA 4L08A 5AMXA 3V2GA 4EI9A 4J8PA 3FCXA 1YFKA 4BRZA 4Z3KA 3PLNA 1NASA 3RK4A 2WJPA 3H11B 3OWHA 2XW6A 1F5SA 3SF8B 3WGTA 2TSYB 5KNDH 2D1SA 3CE6A 4UMDA 1FNMA 2I4TA 5IULC 1JHVA 3GUCA 4TMXA 2AE2A 4KKXB 5AVUA 4QODA 5F7ZA 1KZYC 2GF9A 1JALA 4EA7A 5JMWA 1V1MB 1OYVA 4YT5A 1YONA 4U2GA 1HGXA 4R8KA 2AE1A 3PQ8A 3ZD9A 2NIPA 2H29A 5JUWA 3PUXA 3C3XA 1YGPA 3BD9A 3MRVA 2FETA 1L4EA 1TA9A 1TAHA 1ISIA 2ABWA 4RD4A 2CMDA 4BX9A 5IVKA 4Q1DA 2FEMA 4DCOA 2C0CA 1FQOA 1S2LA 3QXJA 4OQYA 3LLCA 3ZWNA 2BP7A 3S1LA 4KO8A 5LNK6 4PYLA 2J9FA 4FOTA 1YOBA 1VKZA 3ZI7A 3ZCSA 1CD5A 3AESB 3AR5A 3C14C 2DQYA 4DB4A 3KEMA 4L0DA 2G28A 1ZYUA 4RZ2A 2HF7A 4UEOA 1TXGA 4UMEA 3WIVA 4Z53A 5F51A 2POCA 4FHEA 1CV2A 4GVPA 4FYJA 1FP1D 1F17A 4JY7A 4PYJA 3GP3A 4R9SA 4ZMRA 3RU2A 3FB4A 1N1GA 2WWHA 3ZZ0A 2P5SA 3RCBA 4D3ZA 3LHIA 3N8GA 1Y82A 1GDDA 1JHUA 1ODJA 4XVRA 1TVEA 5BR1A 2Z8XA 3JQAA 5J47A 2GBPA 3O8QA 1ZD1A 5EE0A 3N59A 4JVOA 2GPNA 4JAVC 5FOTA 3TRJA 5HUHA 1QV6A 2CXXA 1P6UA 3QVLA 4RELA 1TJPB 4RW0A 3W6NA 4CM4A 2B20A 1R9NA 1S4QA 2CYBA 4JKIA 1BDBA 4J4BA 2BM1A 3EWNA 3M34A 1U8YA 1RWXA 1SY7A 1MTZA 4CLRB 2W8BA 1OIVA 3HI4A 2BIFA 2CNWD 3LCRA 2H63A 4IDOA 4IUYA 1YE8A 4X63A 3NVKI 1QGAA 4L9AA 4XYEA 1X8KA 2R4TA 4MMZB 4HMPA 5LQNA 3GDFA 3NHMA 1P0MA 4IQ0A 3E82A 3DPUA 3HEAA 4YJ2B 1RZRD 3EZ6A 1MRSA 2H0AA 4HQNA 1C3OB 3IOEA 4B4WA 5C7YA 2M6RA 3UF0A 4C0HA 3LW8A 3H8JA 2IXGA 2UZ1A 4R2WA 5DV9A 3T99A 5TMDA 3UAYA 4D8YA 3AUSA 5EPOA 1HNWB 1FS4A 3IQFA 4IF4A 5ERGB 2SNIE 1U28C 3I1FA 4FOLA 5CDUA 4NOKA 3PHGA 1RAGA 2ZSIA 3OVMA 4L15A 3BWMA 2XQKA 3PYLA 5F76A 2EKBA 3WLJA 5CJPA 1L7NA 1PKEA 2ZBFA 4G5SA 5FWNA 4KO4S 4N1AA 1OAKA 4W7HA 2X5XA 3WGUA 4INAA 3T0FA 5AVTA 2ZUFA 1DCTA 2FMUA 1X7XB 2GNPA 4AXXA 4WCFC 3ER8A 1UBUS 4X90A 4F86A 1QYVA 5JH7A 4NCBA 2HQOA 1VSUA 5H68A 4AICA 1NFFA 1XJ5A 1FDOA 1A2QA 5CLQA 5HF5A 2YJZA 5LQJA 3A1FA 3N70A 1L7OA 3A4VA 3AGQA 2A5DA 4NV3A 2Q8NA 5IUKC 3Q7PA 3TB4A 2VZ0A 4JIMA 3ZE9A 4XIIA 1GPDG 1OT3A 4HN4B 3WB9A 4TZKA 4XR4A 2HJRA 3DEAA 1H5QA 4C4XA 4H4CA 5K6RA 2WABA 3A3PA 4DSNA 2XLCA 3BMCB 3JR7A 5DNCA 3HABA 5TQ0A 3AUTA 3U39A 2VJKA 1O97D 4LBVA 2DEUA 4ENPA 3JQFA 4MQFB 2I6UA 2KI5A 3IQZA 4DCMA 4DZRA 3SWWA 2IHVA 2P3QA 2CDBA 5CFPA 5ADVA 1NF3A 1DQRA 2XJ9A 4EYQA 3AGPA 1NVKA 1KSJA 1CSEE 1ZHHA 2DY0A 1HOXA 2E82A 1GTZA 3L7CA 4NHEA 4U7PB 5ALRA 2QP3A 5KINB 1LQ2A 1Z0UA 1OJLA 2ZJ1A 2ZK7A 2F3SA 3KSDO 1EVYA 4J0KA 1T8YA 3MB5A 4G85A 4N3GA 4J0DA 3V4LA 4ALIA 4B4DA 4IJMA 4Z7NB 4KXWA 5HVNA 1PAUA 3ZWAA 1P74A 3E3LA 5LR6A 2XA9A 3NS7A 4ZOLB 3LUCA 1E18A 4ZN6A 3R0IA 3WRXC 3Q2KA 5KQGA 2XNJA 5BXQC 4KK3A 1UC4B 3D64A 3FNHA 3UC5A 5LIRA 2E5WA 2OLKA 1EFPB 1YU6A 2ATXA 2Y77A 3ELUA 3NBXX 3NVDA 5AJHA 1FLNA 3VNQA 1RPAA 1OXTA 2OD2A 4YCSA 1F7UA 2VATA 2Z9DA 1VSTA 2UZAA 2ZB7A 3WK5A 1FUYB 5F3RA 2EDAA 2R47A 3R9IA 1O95A 1A8QA 3G59A 1W4AA 2YV3A 1UP6A 2YWGA 1VCOA 1YS4A 2C59A 3I0MA 4XTRA 3TIGA 5KNLA 1SN7A 4KN8A 1PSWA 3QOFA 3URKA 2YJ4A 4XQ0A 1H3FA 4YLGA 5F9HA 1PK7A 3LQ1A 2H3EA 4ZHSA 4ME6A 1HK7A 2D13A 4R2IA 3V7WA 1XU7A 4AKSA 4LVOA 5FAKA 2I4LA 1M1YB 2J3MA 3TM5A 2EZ9A 1GVNB 1YHZA 5FPQA 4HX2A 4C3ZA 5IUJC 1Z6PA 3GPCA 1Q17A 1M10A 2B4RO 4JCOA 5HG0A 1GZ6A 3QTLA 3UBTA 2J31A 3R6TA 2Y27A 4Y2YA 2IHBA 2RKOA 1YRYE 3BGIA 3FD8A 2J3HA 3MGGA 3MTIA 1P0PA 4E4TA 2H57A 2JI4A 5K3OA 1H4QA 3BBPA 4MUIA 2OVBA 4GOJA 5EUQB 1KQGA 2L0XA 1TCCA 4WBSA 5JCOC 3WGYA 1THMA 3ONNA 1D2RA 1ES9A 2ZVJA 3SR3A 3UH0A 2O8NA 2XMPA 5DM60 3GJSA 2LZ0A 4BV9A 1N2JA 2ZI9A 1JTFA 3T7AA 3BGWA 2ZI4A 3IDZA 4DTCA 4V1CA 1UPFA 4P4UA 5I9LA 5JANA 4ZVSA 3M5WA 4MULA 1ATZA 3ENNA 3OFND 4RA9B 3AO0B 2Z2XA 3CNEA 4V0QA 1Y1PA 4Z0TA 5J2UB 3QX3A 2YZKA 2CUTA 1GG8A 2V7WA 2ZYUX 2COUA 1U63A 1SC4A 3EASA 4QU9A 4B7ZA 4IXMA 3VKGA 3OJLA 2OT3B 1YJQA 4J91A 4TMYA 1JFTA 2A88A 1QC5B 1IMJA 1V11A 4QGHA 3A27A 2FSPA 4DA8A 4HPWA 2G0NA 3S8YA 1Y5RA 2TECE 1VLHA 2Y93A 3HVRA 2RHHA 2B3DA 4JJKA 4PFKA 5DRTA 2PPLA 1EFAA 3IA2A 1QOQB 2Z8YM 4XB1A 2SKEA 2FZEA 4EGJA 5IHPA 2Z43A 3SQXA 1M8KA 3TX2A 4CF6A 2VYVA 1N5LA 2OV4A 2WU0A 2YHAA 3I6YA 3DOIA 3E5HA 3NYWA 4ZOBA 1YDFA 4IYJA 4POOA 7ADHA 4IMJB 4LGMA 4CMAA 5CT4A 4NJMA 3VU9B 3VSCA 1HFKA 1E1QA 2QZ9A 2AF3C 2QVLA 1SXJC 1HV8A 1MW9X 2UVDA 3Q3CA 4NESA 4DRZA 1YVUA 4EHFA 5FHQA 1BO6A 1GAQA 2NSLA 2CFCA 2YC4C 4F84A 3OPQA 3K1JA 5E6RB 3QBEA 4XD7D 1EUCA 3KPYA 5KAMA 5D5PA 5LIPA 3A6PC 1L5KA 5L9AA 2QYOA 2H9YA 4HGRA 1UOEA 3FMPB 4KNYA 3EIQA 3VDNB 2P0EA 1OH8A 3DOHA 3PE4A 3EN0A 3IUSA 4DMKA 2OP1A 5AVYA 3U4GA 2ZR8A 2G4CA 4U7JA 4YCMA 1RZ3A 1N2IA 3IR7A 2N3ZA 4XVHA 3DHVA 4MRAA 1AXRA 2LTAA 4R8SA 1YZQA 3MTAA 4I4LA 2QTCA 4XWWA 3ABQB 2Y1FA 3HK2A 1KYIA 2ZWPA 1IZ9A 1H5UA 2HF9A 5JSZB 3D5EA 1E2HA 3QXGA 4TYQA 4Y30A 2ISSD 4HO1X 5JDIA 1FCJA 2RE8A 5EWMA 4MS1B 5JIBA 1K98A 1QANA 3L0OA 4R40A 1KDVA 4I50B 1N6KA 2FUEA 2OXCA 4UU8A 2ZSEA 3L7NA 4QDOA 2B78A 3LPMA 3RHTA 4CKEB 2P3OA 4UFNA 2E18A 3FA2A 3WX0A 2K7FA 3LT1A 1UM9A 1TDJA 3N5CA 2ID4A 4HQKA 2WQ6A 3DT9A 4B6OA 5HM8A 4K86A 1IZ0A 2YHBA 4WEOA 3RRBA 3FDXA 3FUWA 3VHQA 1V5IA 5JXIA 5L53A 2ATIA 1XXHA 5EPUA 3GPLA 1JIVA 2BFFB 2PZ8A 5A5GA 2O2XA 3U9SA 3VBEA 1Q22A 3DCYA 3OX4A 4ZT5A 5C3MA 2ZXUA 4M1KA 4O4JF 4AY5A 5UKDA 4LI3X 3UHFA 1PT9A 1WEHA 3D3JA 4YWJA 2EARA 3Q7RA 1EWRA 3NHJA 3MCVA 4KPUA 2XX3A 4YO8A 3FKSA 4RQAA 3H9QA 4PM4A 4DM7A 4H9GA 4FUQA 4EYGA 1V2GA 4Q1CA 1RYZA 3TLGA 2VEDA 2X19A 2UZ0A 2ZI3A 4YRGA 2N1BA 1Y9JA 3KJFA 4PX9A 3CVWA 5D6OA 1TZKA 3LPCA 5HDQA 4L72A 2YZ2A 3VR6D 2JLRA 2AXNA 1GILA 1K88A 2OC4A 4ZQIA 3KSAC 1EAMA 3B3GA 3G2IA 4TMTA 1N6PA 3WBBA 3Q15C 1OGIA 3W4IA 1S7GA 2WT8A 3QMPA 3UXHA 5ESWA 1WHTB 3DNMA 4IY1A 3ORRA 1SCBA 4EO7A 3MEQA 4BFXA 1ZR2A 1RZVA 4P3KA 1NXQA 4XGQA 4XIYA 2IPLA 2FSFA 1TCVA 1OV4A 1LBQA 2HWUA 4L16A 4I1SA 3S3TA 2W6PA 3N86A 4MGIR 1HT1E 1NJGA 2DTDA 4YRRA 2X86A 1TAUA 4PX2A 1FVXA 4E5DA 3QITA 3T5TA 1NF9A 2O0HA 2Q0SA 2PV7A 4Y1RA 3A0RB 3FZYA 4NR0A 4UD6A 4YJFB 3JVUA 2ZRJA 2XTMA 4NQRA 4PWYA 2QRKA 4EQ6B 4PX5A 1VECA 4YA6A 2L17A 4ZI7F 1NLYA 3KQYA 3ZVLA 3ROTA 1U3GA 2KJQA 4UULA 2IA5A 3FX2A 1ECLA 4MQ6A 4W5JA 3QLEA 2QP4A 5JQWA 1PJZA 4M9ZA 4QXQA 1W2HA 4HP8A 3Q8KA 1ZINA 1LNZA 4BX0A 1IH8A 1SC3A 2WSMA 3IQIX 1GTSA 1XJQA 1YE5A 1DCMA 3HYNA 3G0GA 4MQEB 4UNIA 1L2TA 1CB0A 1QWSA 5SYAA 5HHTA 3IMEA 1E9DA 1PQWA 2BFMA 5FOXA 2LPMA 4WA8A 3WMFA 5D7BA 3QI2A 1KSHA 1LX7A 4R68A 1HDOA 1H1DA 4F3NA 9LDBA 3HQ4O 3IURA 3WAKA 1FJGB 1BX0A 1BHSA 1BWQA 3V8NA 4PGGA 2WHXA 5HIMA 1TYEB 1UQUA 1YA8A 2HU5A 2EG9A 3L02A 5AESA 2PUDA 4INPA 4RTOA 5FTWA 5BT9A 1SCJA 2JFOA 5JQGA 1LC0A 5AI9A 4A82A 1HRDA 3I34X 2P5YA 4JUCA 4F2PA 3LX5A 5EIHA 3NHWA 3CPEA 4G41A 3UMCA 1T91A 4FHDA 5K8UA 5DYYA 2UUCB 4OHYA 4R1TA 5JNTA 2PEYA 4WDRA 4LEIA 2AVDA 1Y6RA 5J5VA 3ZCRA 4YY3B 4CPDA 5FYDA 3PC3A 3N2LA 5AVQA 2BR5A 4FGUA 2AYXA 1QZUA 3HXPA 2DSNA 3AHEA 5DGCA 4ZTBA 5IP5A 5BW8A 5KJ1A 1MB2A 3EISA 4NHOA 1E5XA 1R74A 5KDOA 2NP6A 4AJKA 3NPAA 4A0HA 4EO9A 4CL8A 2AMLA 3LUGA 5EHNA 3EDMA 3W3ZB 1DEOA 1WUHS 4U2BA 4DIMA 3Q9LA 3TINA 2VSFA 2PMFA 2F3QA 2R8PA 3HU1A 5AK3A 4I99A 4UD2A 1FBTA 3WLOA 3E4CA 3K0AA 5F33A 4O2AF 3OZDA 3OPYB 1E4EB 4ZFNA 4D25A 4ZYTA 3ICQB 2XVXA 3GLIB 4Y9UA 3ZGLA 4JJEA 3MCWA 2X1LA 5B12A 3LW7A 1UOPA 5JTTA 3TGPA 1E2BA 2EZ4A 4ER7A 4KE9A 4LWOA 4YYEA 1ZR4A 3CF0A 1U3UA 1U8XX 4W63A 4Z4IA 2IODA 2WPNA 3L6CA 4AJIA 2G09A 4AZTA 4YV0A 4MDHA 4DV7B 3VHLB 4TVSA 1FQJA 2VTVA 3FVVA 3C3DA 3V8BA 1VYVA 5H83A 4MQMA 2HHLA 3X3HA 1QE3A 3EZNA 4JVLA 2WWRA 3U44B 1G8GA 2C9BA 3IALA 2B98A 5CTAA 1ENZA 2JLSA 4GS5A 3S2FA 4BNKA 3W5IA 1VHTA 1XHFA 5LUBA 4B4OA 4N54A 4EYKA 1IY9A 1UEXC 4QSMA 4EUHA 2B69A 5B3JA 3V1LA 5B30A 1OFHA 4YP5A 3FGPA 2GN0A 1ORWA 3JYQA 4DDWA 3LCVB 4BN4A 1Q15A 2FCAA 1N5OX 3ZJUA 4O2BF 1V47A 3VVBA 3QFSA 3KHTA 2QTRA 1GR0A 4RCYA 1G38A 3BIWA 4XIGS 3E27A 4DCCA 5ALYA 2Y92A 3A4MA 4OJNA 1CLUA 5AUNB 3IBTA 3QELA 4H6WA 4G63A 1GGNA 1KYZA 1N2HA 3B6JA 2CXRA 2HY7A 1W4LA 2VHVA 3KZXA 5M04A 4GLFA 1EFHA 2VFAA 3AXTA 4TKLA 4DCGA 1U1IA 2J3EA 3P4YA 5T3YA 1Q0LA 4G1MB 1VSQA 1CYDA 8ABPA 4AG6A 1JRLA 1Z39A 1BHJA 1FTSA 4QQKA 3RASA 3DV0B 3FHCB 3KQLA 4XX0B 4X20A 1UZAA 2ADMA 5GVSA 2XXAB 3UC9A 3UOGA 4TYNA 3A1CA 5TVGA 1RCFA 2X8AA 2QR2A 1UBEA 3D3KA 1VL8A 3R23A 3UMYA 2AOVA 3CR7A 1DKLA 4KX3A 4ZCIA 3L1JA 1QP0A 2PKEA 4CCAA 4J29A 3LKDA 5JXJA 5I7EA 4NIMA 2HTFA 1N3IA 4FWBA 3VMMA 1L7VC 2OCXA 4RPCA 3CRMA 5LQDA 1AOXA 3EHDA 4OQFA 1TKBA 2X0KA 4JI5B 3SC2A 4ZVTA 1Y9ZA 1A9XA 3DBOB 4WA7A 4ZU6X 3ST7A 1PF7E 3CEJA 4FZ3A 4WXRA 2BFDA 2C0QA 5D51S 3USCS 3BDAA 1XZBA 3L40A 4G97A 1QHYA 3U4CA 1GL3A 1JG2A 1HE2A 1H6CA 4CMKA 2C97A 1VL1A 2VYCA 2Z1MA 1P91A 3HJNA 3OKAA 5E2AA 4LYYA 3KFXA 3MUOA 5CNMA 3OQNA 4GOXA 3EFHA 1NVFA 1W85A 3KV3O 5JNUA 4QNNA 3SMQA 2PH3A 1C3XA 4QECA 2YYYA 2Y8EA 3FJOA 1RXVA 1ZM4A 1ZN2A 1WTCA 1AKWA 2AK3A 2ZBVA 5BSKA 3IEXA 2IX3A 2JFHA 1I2DA 4HJRA 3JYNA 4H77A 4PG8A 4EHJA 3BICA 1D8AA 5AW9A 2PX6A 2ZTVA 2D0IA 3I3OA 4L7VA 1E5VA 1NJ2A 3IDFA 4QYXA 2R9VA 1GL7A 1J7JA 2Z4TA 2FI1A 2PO5A 2XCUA 3HLKA 1ULZA 5LP6A 1KIMA 1X77A 3DFUA 2PUBA 2IHYA 1YIAA 1RKXA 2HPVA 3COJA 5LMCA 1MB0A 4JC8A 4CQJA 3M2TA 2Y0CA 2FFHA 2A67A 2OBXA 3DKIA 3ZHTA 4P0PB 1JR3E 3BAFA 3OQBA 4CTOA 3D3WA 1UDXA 5ALKA 5KDDA 1YQUA 1HL3A 3FWHA 3JQGB 2ZSKA 1OB2A 2IS2A 4F2DA 3ITEA 4OFZA 5BNWA 2C31A 4HLDA 5DT9A 4LV5B 4CF3A 4PRYA 3CUSA 2W6ZA 5A7HA 5U1PA 1RYFA 4MI3A 3NONA 4IINA 3HN6A 2GD2A 1T9GS 4XM0A 2J7PD 4V0OA 3I0NA 2XI4A 3DZDA 4PPNA 1GXSA 1WHSA 2P77A 5H3LA 2AN9A 2BP7B 2P2YA 5LXTA 3SICE 4BRSA 5A6VA 1OGYA 2ZYWX 1NBAA 4UZEA 4RTPA 5GIPE 2Q3HA 2DCMA 1L5LA 1J99A 2BBOA 2GKGA 4FDLA 6ADHA 2HXSA 3S5UA 5IAAA 2UXBB 1NW7A 2QX6A 1VP9A 4NJOA 5KOJA 3MWDB 2I33A 4C76A 4MV6A 2BSXA 5LYYA 3KYJB 3OHPA 1D9XA 1ST3A 5K0ZA 2AN3A 4NI5A 2NPOA 3JX9A 3UTDA 5L7WA 1U9YA 1HE1C 2P2SA 4BFWA 2NZJA 3BMOA 3THYA 4Y2JA 3UXEA 5E6SB 1IQRA 2DPMA 3HCDA 5HIJA 2HWWA 5C1OA 3WKEA 4DT1A 1KDZA 3JQAB 3OF3A 1PV1A 1AC5A 1WUKS 1IY8A 3HCRA 4L50A 1V6AA 1MIHA 1XZPA 5EIWA 2WD8A 1CR6A 1ZKMA 3T1QA 2JKZA 3B1ZA 5ALQA 4CM4B 4UHCA 3R74A 2HYDA 4BNJA 3QVMA 4Q12A 4M0CA 3GOQA 5AHXA 2EKLA 4H4DA 2F6RA 4LCEA 4B5KA 1I7SB 1FFYA 2R1ZA 1IBCA 4QUKA 3LVBA 1GHTA 2R97A 2W8BB 2VQ6A 4FC6A 1SQ0A 2VJMA 4YRCA 5ICSA 4XCVA 3UFBA 2PQ2A 5BQOA 5JJKA 2ZE7A 1MJNA 1RABA 4LJKA 1M6YA 2GDZA 3TXXA 1V8BA 2ZOSA 1O94A 2I66A 1KGSA 2GN1A 1Z4KA 2P11A 2C82A 2FX2A 5FFFA 5AW0A 2DX7A 4FDUA 5AOBA 1G2OA 2P7IA 2R5FA 4C0AC 3A05A 3ND6A 1HQDA 3HUUA 1J5PA 1LBTA 1FRZA 1T5DX 3DDWA 5EWLA 2IU0A 1Z8FA 2B9VA 4P98A 5EFZA 3H7IA 3L8EA 2MYNA 3U7QB 3W3AA 5EXTA 4QLBA 4UHFA 3B12A 2C57A 3JVEA 3OBBA 1SUEA 3PQ2A 3ODGA 3R20A 1F4PA 4MW5A 5F5NA 4BVBA 1KARA 1KBOA 4YRSA 4KBFA 1N2OA 3QBDA 3IV6A 1CCWA 1Z5ZA 2IHTA 3HCPA 1FRNA 4M9RA 4QUEA 3SQNA 4ENRA 3EPKA 3SEAA 4CUJA 3I92A 4EB0A 2HJ9A 3L0IB 1BCRA 1JA0A 1STOA 2RAUA 5FADA 2FR8A 3UTCA 1T1GA 4RCVA 3RC8A 4D3XA 5DTRA 4CLDA 4L73A 4JXJA 1TEXA 3K09A 2EL7A 8OHMA 4NFSA 3WYDA 4BL5A 3SKYA 5JH7B 2PFKA 4K9KA 1FP6A 3ZHBA 4RTJA 1L4BA 3ID6C 4A6DA 2HBQA 2AZMA 3F1LA 5JYDA 5D00A 4KNVA 3LCJA 3FDJA 2JEZA 2Y4OA 4JK3A 5ICCA 1OQAA 3AUJB 4PQRA 1R5JA 4KAJA 4ZRNA 3EUWA 3GFVA 2YYSA 3L6EA 4KCGA 4EY8A 4I6GA 2GR9A 3TRKA 5C1IA 4X6YA 1LA2A 5TQ0B 4LXYA 4CG3A 1XLWA 3GGCA 1ODTC 1C4OA 4FDMA 1E7YA 3QVGB 2SKCA 4TWIA 4XQEA 4TQGA 1KK1A 1DBQA 1AUXA 1R0LA 3L9XA 3KT6A 3L5KA 5IARA 3PU6A 5F9FA 5IAGA 3WMXA 1DC4A 5YASA 2A9OA 2C3OA 4MV1A 4OAQA 4NXNB 1ZOIA 3ECAA 8ATCA 4UPDA 1HT0A 1FDSA 4GMXA 4U2EA 2NACA 5D2CA 2PD4A 3V4SA 1WXIA 4PG4A 4B4UA 4EEKA 3OICA 2GWRA 3AV0B 3HBLA 3ZHYA 1NTOA 1P77A 2JATA 5EP1A 1LF0A 3HR8A 3LT5A 1R6UA 2V1UA 2OCGA 4TSKA 1NI4A 4K9LA 1F6WA 5G1NA 1EE1A 3MTGA 1N77A 1CY0A 3K15A 1NRXA 3OPXA 4NCHA 4BLWA 4MVJA 4JQCA 1DKQA 1ONNA 1BJTA 1T5OA 1ZFNA 2W4IA 2XKAA 3ITKA 2YNMA 4TV9B 5KVVA 2JA1A 4PC3A 2OV3A 3RI3A 5JBIA 3EPJA 3U4AA 2JG3A 1D2MA 2ODAA 2HHAA 3PPIA 1CT9A 2PY6A 1YOVA 1VE9A 2Z2YA 1KH1A 2K87A 3OF2A 3VOTA 3LPNA 4DMLA 2CXQA 3LYUA 4TTJA 1H8HD 1CUIA 2PRZA 4HHEA 4DMHA 1T9CA 4A8JB 3ZCUA 4QT4A 5CBKA 3MOSA 2SCUB 3OOSA 3ZCQA 4C6TA 1FYVA 1PJTA 2DECA 1P39A 4M36A 1UMKA 3D59A 4C0JA 2Q7OE 1PG0A 5DEOA 1BKYA 5FFMA 3DLCA 3JQQA 3OQMA 2P90A 3IP1A 3RV4A 3T1HB 4QDTA 4Q02A 4K1XA 4C7OA 1U6JA 1P2TA 1ZIPA 3NJ8A 2ZS8A 1DAGA 3E7PA 3BE4A 3GK3A 3BWDD 3O8OB 3PCTA 3D2CA 5E7IA 1MEJA 1NOJA 4KODA 1OV6A 3HP7A 4FKZA 3RREA 3TTXA 3E3MA 3ZKWA 4EABA 1JB1A 2B82A 2M6LA 4AMZA 5JADA 3AL2A 1BE0A 4TRJA 1FFDA 2GF2A 2Z57A 3MJEA 4JC0A 1Z5OA 2XMCA 2YDXA 5T5QA 2FMXA 3ANSA 2WFMA 1RM3A 2HF2A 3UOAB 5KSOA 1KETA 1FS6A 3A32A 4LNAA 3RF6A 2PZMA 1YVPA 4FR2A 5CB8A 3LOQA 2BEWA 2HDNB 2V7XA 4DA4A 1HY3A 4PLZA 1JFRA 5CIWA 1CUHA 1Z8HA 1MOSA 3BWBA 5B7QA 2F9FA 2I7VA 1JVNA 5D86A 1KVTA 2JIOA 3T7KA 4ONEA 5IF3A 3E8MA 4B3TB 1AA9A 4EJMA 4BLQA 2YRXA 4HQ0A 4PLYA 1O08A 3CRRA 3IQGX 1CNFA 4JQZA 4NS1A 5TLSA 2Q5IA 3U40A 2OGZA 5BSRA 1D8TA 3T9BA 4KQXA 1ZKDA 3MCTA 4GR9A 3Q11A 4N5IX 2A1IA 3VOSA 1O94D 2C5HA 2CXSA 3E05A 4KQ1A 2HJGA 1V11B 1NQXA 4QNMA 3AVTA 1TM1E 1J8YF 1GRNA 2IOYA 2XTNA 2AG5A 2V7BA 3L6BA 4Q1BA 3UHPA 3AIOA 4HLQB 3WWOA 3QKWA 2OMKA 1W4BA 1CE8A 3DD5A 4EHIA 4LYAA 4MGHA 1RSZA 2HJVA 2KQUA 4GBGA 4DIDA 1IXSB 1W30A 4TMVA 5JASA 1ZMTA 3ZWYA 1LQUA 1SG9A 2GTHA 3HKDB 1L5HA 1N2BA 2W11A 1L4YA 4KFUA 3T3HA 2DFKB 1CQWA 721PA 4NJMB 2I4IA 4ZD6A 3L92A 3N8KA 1UPTA 2XZOA 1BXRA 4MKFA 3PGXA 1AHHA 3FUVA 3IO5A 1FP7A 4LXTA 1ZK0A 4NBUA 1UCFA 4ILKA 4GGOA 4KBYA 4HPJB 4Q66C 3HRKA 3E0XA 3GLQA 2G06A 2QMZA 4ND2A 1EUCB 3VOAA 1M5RA 1R88A 3ZS8A 1JH9A 2BTEA 4FLMA 4Z86A 2X1HA 1XD9A 4RL4A 3DTVD 4TWJA 1C7IA 4LQ4A 4PLFA 1T4DA 1FU8A 1L3BA 5EYPA 5AHOA 1YASA 4GP7A 4KAAA 3D2AA 4WBXC 2YXBA 3N74A 2CNLA 2GETA 2QPAA 4HS4A 2Q0XA 4B47A 3FZNA 1JZTA 2X8WA 3K94A 2CEKA 5BOSA 4FEEA 4WFKA 3D6MA 3TFWA 1DRUA 1MGOA 3MW8A 1P7PA 1Q0RA 1S8AA 1E9FA 3QSGA 3W06A 4AW9A 5B58C 4DEXA 1DWQA 4CMCA 3DS8A 4Q3NA 3VR5A 4DV2B 4PQEA 4MIOA 5JAQA 1AQYA 1GD1O 3JYHA 4UM8B 1T8PA 2PL3A 2ZJZA 2Q3EA 4CIWA 1PGPA 2GPWA 3PWKA 3QP9A 2GCIA 4MK4A 4P2GA 5DT2A 3TNDA 2GDJA 3MJHA 4Y1GA 1U0OC 1U7ZA 1NV9A 1IN6A 1UM9B 1J4AA 4YT8A 2XUHA 3IXLA 4DV0B 1U3VA 5BOVA 4ARCA 1M6HA 1VBMA 4PZDA 3E22A 4UREA 5LZ5A 4CGYA 3QMWA 5C7LO 1FRQA 2NV2B 4DLSA 2VTBA 3R9WA 4DC9A 4Q00A 1WDMA 3JYPA 3PGKA 4KZKA 4QBGB 4F8EA 2X9NA 3MAJA 2PWPA 4OHKA 2D5IA 1E2FA 2IF2A 2IOHA 2P9YA 2PBFA 2J46A 2PKWA 2ORVA 2WUWE 3PJGA 4U2KA 3TZCA 3BBLA 3VKFA 1Z0KA 3LP5A 3ABSB 3BTUA 2XHZA 1G6OA 4G5RA 4KPUB 1UC9A 2GRAA 3KCNA 4I4TB 4KXQA 1SHLA 4L6AA 4OI2A 4QHTA 1IC6A 4MKXA 1FNCA 4MV3A 4LDPA 4P7JA 5K3BA 3O9MA 3TLGB 5BN3B 6NULA 2JGRA 3N76A 4A15A 4MH0R 3KR9A 1P1FA 3JARB 3A3YA 3K0KA 4ZRDA 1GARA 1R27A 4G0NA 3NXSA 4D1YA 1DNPA 3ABIA 4LNUA 3TMKA 2HJHA 4OOFA 3L6RA 1KEPA 1LLDA 2D00A 2VHUA 2ZIAA 1CK4A 3ABRB 4JUAA 5JAPA 3O73A 5FBWB 4WD3A 3ZD6A 2PYZA 2CLIB 3PHHA 5CCEA 1U28A 3CXRA 1C30A 3T15A 4BJ5A 3OEHD 1B74A 1TYBE 3M6LA 1PR5A 5CIYA 3JASA 1XTIA 3RGWS 1A96A 4AMVA 4BLTA 4YXWD 2WWXA 3AVOA 3R3HA 2GJ9A 1R1DA 4KUEA 2R0QC 3GFQA 1JPNA 1R66A 1DAEA 3ADKA 3AEUB 4DLRA 3KQUA 3BERA 2G5GX 4F0JA 2A86A 3ONFA 4WCFA 4HH1A 4M7RA 5HPYB 1VI6A 5M29A 1QGED 3QEAZ 2Q3MA 2NTJA 3ZU3A 5D7NA 4EW2A 4L95C 1AZWA 1MABA 4Q9NA 4Y1RB 2QTMA 3WQSB 4P4SA 2JFXA 2JD0A 4OGWA 4YNBA 4BQNA 4CE6A 4RA6A 4PO9A 1ZU5A 1QAMA 1TADA 1Z4JA 2PT7A 3R0VA 4KV7A 4TLLB 1K63A 3E1GA 3EAQA 4YRNA 3LCCA 1E89A 2J5KA 2B0JA 5DGTA 2VP3A 3CVOA 3ADCA 1JV2B 2J0QA 2CEAA 3SX0A 4B87A 4DR4B 5KNBA 4DKXA 2Z58A 5T6BA 1V8PA 1P3DA 3NHZA 3H5WA 4B6RA 3KVNA 2JANA 3G7NA 5TGTA 5KBYA 2AFHE 3KD2A 1YQWA 5JFOA 1RJDA 2H2FA 1J2TA 3CH5A 2YWFA 4B3IA 4F3CA 1RXUA 5F2KA 1KERA 2A9QA 4UTPA 3NCTA 1RWMA 2QX8A 4KAFA 5ITZA 3QPAA 4YAFA 1PJ8A 4TXJA 5JY1A 4MB0A 3RJZA 3KQPA 5AICA 4BCCA 2KLHA 4X8LA 3K8OE 1B2RA 1D1PA 2WV9A 1XJWA 1WU8A 3NETA 3OUUA 2WA1A 4GM0A 2DT8A 1DQPA 2O0LA 1ESMA 2FPWA 5IJXA 1Y6FA 3HFJA 4WERA 3BQNB 4F12A 4N4AA 4WOPA 3KP1A 3ZZ1A 1ZSVA 3VHXA 3GF4A 1ZUHA 3HKBA 4RJ2A 1C3LA 1E4VA 4AF8A 1Q77A 1XE3A 4FFNA 4OSEA 1Y0BA 2FW8A 5FWYB 4HJXA 4BV3A 5JQGB 1L0BA 4FD2A 4B71A 3IKTA 2J3QA 4KMMA 4ZO6A 2DR2A 4M0EA 5K3FA 2OZKA 1JQLB 4R41A 3NIFB 3V8EA 2Z95A 3BRQA 4M89A 1YQGA 4PCUA 1TU0A 4LVCA 1D2CA 3UVEA 3UUFA 3CZRA 3LL7A 3H1PA 4I1OA 3WI7A 2JVIA 4BVJA 1M0EA 3BH7A 1RMQA 2JJ1A 1H2AS 1WXGA 4D4LA 4BNUA 4JCCA 1QHGA 1WE2A 2ATVA 3LVFO 1GGKA 1SQFA 3I76A 4JOQA 5C18A 3K1AA 4QG7A 4RF4A 3LY5A 3RIHA 2RJ3A 2LVBA 4NMHA 3TEFA 4BV8A 3A3NA 4YGYA 1TPZA 3OIUA 3QKRB 5L7YA 4OO3A 2BVNA 3CKMA 3PJEA 2GBFA 3K0AB 4WNYA 1Z4QA 2WD9A 5A04A 4ENVA 5K6AC 1XEWY 4HN2A 4LOJA 5E9JA 4DG8A 1V35A 3ENWA 1M33A 3EG5A 4F5EA 2I1VB 1MO6A 1N7IA 1AGRA 1O4WA 2WWWA 3L0DA 1H9BA 3VH3A 2X5JO 3UMMA 1HFWA 4ZJUA 4YT4A 2GHIA 1OAOC 4OIMA 2BE9A 2R8OA 3B3AA 3RC7A 3KJHA 4EJ0A 4J1TC 2W37A 3AB7A 3NHSA 2ZR7A 1UOOA 1BOOA 2QMHA 1X8JA 2INGX 2O0MA 2QM7A 3FZEA 4Q5IA 2C8LA 3DMFA 5BRAA 3S44A 3EVBA 4CQMA 5BUQA 1VI5A 1NMYA 2P65A 4D0RA 2M2IA 2I6XA 5KNDD 3L18A 1TQ6A 2JAXA 1TM5E 2VDWB 4XZ3A 2ALJA 2WFLA 1X1AA 1YRBA 2OD9A 4HNAA 2R7KA 2ZVDA 4RNDB 4GKAA 3JR3A 2EHDA 4ZDKA 1KO1A 3E7WA 1A71A 3QGMA 4NS4A 5G4KA 5HKOA 3QELB 2MTBA 1NQTA 1IBLB 3COPA 3M3DA 4CXMA 4B31A 1F8XA 4HDCA 16PKA 3LK7A 2JFWA 1NYTA 1EK6A 1L4LA 1MOPA 3LQQA 3CKYA 3PXAA 5EZSA 4TL6A 3DLPX 3U1VA 3HCAA 1GKLA 1D2GA 2O4CA 3N8NA 3ZY4A 5BQPA 3GZTB 4ZDJA 3HB1A 2J9RA 1G18A 1U0TA 4X20B 1Z07A 4OK5A 3WDLA 4N47A 2JHGA 4CBVA 1SXJA 5FTJA 4OSOA 4W5QA 1YCDA 1T8RA 1TQDA 5DF1A 1NP3A 3HPRA 3K30A 1KYWA 2B6NA 1JZQA 1TVKA 4EX6A 4FR0A 2ZCJA 3LVQE 4BV2A 3W2HA 4DNXA 4PZPA 1HTBA 4CR6A 1PX0A 1K5DA 2VRBA 4Y6QA 2Q45A 2J9YB 2EX0A 1CC1S 4XWAA 4UNPA 1OLUB 1IOLA 2V65A 2FYTA 3KKQA 1AS0A 4QJ4A 3SC2B 5CXQA 3LKZA 1UQRA 1CVIA 4RDIA 4BNDA 3HDGA 2E0IA 1J07A 5HKKA 1HLFA 5BN5B 4D42A 4Z4FA 1QGUA 3AIKA 2GJ8A 3MWGA 4FWIB 3CX3A 1JDBC 2MSLA 3BVPA 4FYVA 5EMJA 3FR7A 4E5YA 2J4DA 4OHVA 4UDYX 4ZVKA 4G37A 2C9DA 4E7OA 3WRYA 5B6IA 3TBKA 1GRRA 1XXHE 4OXQA 4HH0A 4LF4B 4RSHA 2ATEA 1H2YA 4ZCPA 2GYUA 2ZAIA 3DHWC 4TSFA 2WSIA 2AXEA 1JJVA 1NT2A 5JBQA 1KU0A 1XZJA 1UJ2A 3R7NA 1F9AA 3P94A 3QHPA 3TJRA 5T3UA 5KYVA 1Q74A 4E12A 1BHQ1 1WTAA 1K8YB 1PEDA 2O06A 4PYMA 2ODTX 2RGUA 4QNRA 3F47A 3R7AA 1EUZA 1Y4ZA 3ETGA 4XVUA 2RARA 4OJQA 1TRKA 4BE9A 5LP6B 2IEIA 3MIIA 4B48A 4TZ6A 4B3FX 2K4MA 3KQVA 3O84A 4TWZA 4FYXA 5EVCA 2Q41A 4GOKA 4C20A 1XRLA 1L5SA 3IP7A 4OATA 1OLSA 4LTDA 2WZBA 2HSEA 2XZTA 2VA8A 3I9V1 5DYIA 3VUEA 2VYQA 4LZWA 3H2BA 4G0UA 1L9XA 3PNQA 3JRXA 5KSYA 3CF4G 1XZNA 2V54A 2WUVA 3GH3A 3IB3A 3GUVA 2R7LA 3ILSA 1Z4LA 3WGVA 2C3MA 2VQ3A 4OYRA 3HADA 1O0SA 2ES4A 2O5EA 5A0TA 1V7QA 1WHSB 2Z30A 2M1ZA 1F12A 1UEIA 1FDUA 1MBZA 4KQ2A 1U5AA 3V32A 1B42A 4EWLA 2H31A 4FSXA 4GYYA 1XTTA 5TMEA 2NT3A 5L6LB 3M6WA 1YBHA 1N75A 3OAAD 4YMVA 3WGJA 1EXNA 3GAZA 3F0TA 4ZC1A 1IY0A 2FUNB 1C4KA 1N5IA 2XT6A 3NM6B 1GSAA 3HWRA 2AQ8A 1UWVA 2BI8A 1GPYA 4R8LA 3W1WA 3N8HA 2YHIA 1ECPA 3OEYA 1RI5A 1KYXA 4QC2A 4ZT2A 5TPWA 4B17A 3B48A 1BC5A 4M8NE 3BMOB 2Q5LA 4O4JA 4R98A 3RJTA 4MI1A 3THYB 2H00A 4Z99A 5LZ9A 1OH6A 3E9EA 2OUIA 2QTTA 1JXAA 2WZCA 1DHTA 1B2LA 5BY2A 2W2OA 2A57A 3IBFA 4BTVA 2IDMA 3I4CA 1JTEA 2PGOA 3O47A 4GZLA 4DABA 3O26A 3LCMA 1K4YA 2DJ5A 3D6FA 4ZEMA 1NAHA 4E51A 2ATCA 2PT9A 2QPOA 3NIDB 3UCXA 2WM8A 5KYGA 4PAQA 4HV4A 1C3JA 1L5YA 1USUA 3N28A 4HK4A 4TT8A 3R75A 3KTDA 3RLFA 3VTAA 3QYAA 2GARA 3AWDA 4CUZA 2DG2A 3K5WA 5TDHA 1T8TA 4XTCS 2PD3A 1SVUA 3AINA 2HB6A 1I4EB 1QBKC 1HL7A 2P67A 4N6OA 5ESXA 4DPKA 5IT5A 4Q21A 1I3KA 1FQKA 1Q16A 3KLBA 5JYCA 3V8RA 5KO2A 3PITA 5HJ5A 2QX4A 2CLDX 4EZEA 4NCAA 1ZH6A 3OZVA 4X62B 2YR0A 4F11A 3C24A 2M6SA 4NYJR 4X44A 1BEZA 3RU3A 1X70A 1YRQA 3ZE8A 1DXQA 4QKQA 2N75A 3G0DA 5I5EA 2B1GA 4GICA 1GQ2A 3HO6A 4AO6A 4DHWA 1NC3A 5DULA 4MUBA 4A8PA 3MWKA 5H02A 4KGZA 4NAVA 4NNPA 1KL7A 4Y1EA 3M2PA 3C4JA 3H9CA 4D4IA 1WVGA 4F2GA 2C9YA 1I6KA 1QHHA 2YMPA 2GZAA 1T3GA 4OFBA 5EJIA 4EY3A 9ABPA 2J1LA 2IT1A 2VHYA 3SZLA 2QF7A 1BCRB 2FJPA 1FW8A 3CH4B 3FCEA 5ES4B 3Q8LA 3PFCA 1XN4A 3VDRA 3R6WA 3R5JA 1O5IA 5TNXA 4YMGA 3IP8A 1Z5WA 1TCAA 3ON5A 4ISBA 4UASA 5A9TA 4E08A 4ZHQB 3QE9Y 5CFMA 1NVBA 1WUYA 3Q88A 3FSEA 3GI1A 2XB9A 5CK5A 1E9CA 3GJ8A 3LXUX 4C21A 3BULA 3EE6A 1W4ZA 1XP5A 5C0OE 3RHFA 1JXMA 3KZMA 1JT9A 2WSSD 4U7TB 2ZZKA 4AVYA 4EB6B 1TUEA 1WSDA 3G0CA 1VXOA 3DD1A 3D4OA 1ULUA 4NZPA 5DYTA 1K2WA 2Z98A 3IPYA 1R50A 4BP8A 4IIXA 1SZPA 2XCRB 3RJMA 4FMDB 2YWXA 2Z6UA 2IITA 3BFXA 4PEVA 3VH2A 3VNSA 4CTJA 5I4CA 4JQSA 3GCDA 2FP4A 1KJYA 4MIYA 4DC0A 3C0KA 1ZUIA 3QWHA 2CSUA 4RKFA 3LCUA 1E9AA 1WKVA 2GJKA 4LJSA 3WBKA 4ZEVA 2FUKA 2W7TA 3U7EB 1W49A 2JBAA 3RVSA 4A9AA 1VE3A 1Q12A 4UHEA 1Y3BE 1XVUA 4CCWA 1E64A 1T6NA 2R3SA 3EEIA 1K5HA 4RACA 4YTEA 5D1HA 1TTHA 2W4MA 5ALLA 1QYDA 2E6KA 2X9GA 3K1TA 3RODA 1FDRA 4QVKA 2FN7A 2AXPA 2FSVC 2QLBA 1O7JA 1ZD9A 1T36A 1GLGA 3JPWA 4B3XA 4MPJA 3GFOA 2IWRA 1X7DA 4KBGA 4YRKA 4RE6A 1GYQA 3P0EA 3NUQA 3M6AA 4DYDA 5AI5A 1YCFA 2Z6VA 4KB5A 1YGYA 4HAIA 4KAXA 4FJ2A 4UDOA 5IXSA 1QK5A 3AONB 1FP4B 1N8KA 3DDCA 2Q9BA 3FSGD 1Z7GA 1IM8A 4XWGA 1WXQA 1YOVB 4COKA 2YV5A 2UZ4A 3FTEA 3BEOA 1JMYA 1ECCA 2CMKA 3OIVA 1ESDA 4O2AA 1CY1A 2MMGA 2WJJA 4PCVA 3O31A 1IBSA 1QO7A 4A10A 5HBGA 2YXPX 4KYUA 4C6TB 1E8DA 2DPYA 2PMDA 4UBOA 2NU8A 4JZYA 2K5UA 2VJCA 1ITZA 1JBQA 2I4RA 2P6MA 3IAS1 4M8LA 5KYYB 1R0CA 1RYDA 1ZNWA 3M1AA 4ENQA 5EHXA 4C7OB 2DFPA 5AQEA 3NKVA 4JJ7A 3GDHA 1G7TA 2JFQA 3LL4A 5CRIA 5DGIA 2H1FA 3ZY5A 4G07A 3ZKWB 2X0RA 4BY9E 5C7OO 4OI4A 3QHAA 1US8A 3LX4A 4IGEA 1ZC4A 1ZMBA 3OKCA 2P9CA 3NWBA 4DLKA 3MJTA 4YAGA 5GJVC 1AUOA 3G88A 1UPCA 4H0CA 2HA3A 3C39A 4LGCA 4O2BA 5HF9A 3EGXA 2WVHA 2QI9C 4FW8A 4NSNA 2BEWB 1E3EA 1P73A 4QXRA 1EUQA 2GKSA 4A2QA 4MGYR 2G63A 3W5DA 1V1RB 4J4HA 2EJBA 2BD0A 2D8MA 4D99A 2VNAA 1UOQA 1NLFA 3E4DA 4UUOA 4Y98A 5IC5A 4JU9A 4QM7A 1YRAA 2REBA 1CRZA 2Q3BA 2ZATA 1PQYA 2ZVQX 1IXYA 2VPZA 3KYCA 4ID9A 2F8SA 2H2IA 2QLLA 2FPOA 1NVWQ 2XE8A 1E79A 3EXFA 3NBZC 4NBLA 4RVGA 3RFXA 3WIUA 1ID8A 5ECDA 2M9MA 3TMYA 1A9TA 1T4MA 3CU5A 3JQRA 5K2MA 1W6RA 3O9ZA 1QK3A 1WMAA 4C7BA 4ZI3A 4B4VA 3ZE0B 4LOLA 2OTCA 1Y1LA 3A6GA 4WH0A 3TLJA 3H0KA 1U0EA 3UY4A 3GH1A 4N0PA 4F3KA 2ECKA 2HMAA 5EIXA 2ZR9A 1P4HA 1R7RA 3HYLA 1RPJA 4M9CA 1L5HB 1T35A 3MA0A 1JAZA 3DL0A 3W4KA 5K45A 1GV0A 4G4SO 4J0CA 4L3OA 4E3WA 1OH5A 1OY1A 3ZHSA 3IVGA 3QWBA 1PZFA 2QD1A 3AZQA 4IXWA 2IGTA 5CYPA 3D54D 3SX2A 4WI1A 3WZ2A 4ER6A 2XE4A 3ITNA 3QTBA 3FUUA 4EHLA 4MHTA 5EUBA 5C8YF 4QOGA 3IHLA 3KPWA 1YULA 2OEPA 4WJLA 5L3QA 2RHDA 1WDWB 4JB2A 3LNTA 4YP0A 3IEMA 2PNFA 2B7LA 4MUEA 2QUZA 4OHXA 1R4AA 5CM8B 4YRQA 1JIKA 4TV8F 1N6IA 1KJ8A 2HV9A 5DNVA 4D2IA 1VE7A 1Z29A 3T41A 4E94A 1G3UA 3T1OA 3LQ4A 4I5DA 3RADC 1TO1E 1ZHOA 4M7WA 2IZOA 3EF1A 4I66A 1U2PA 3Q6IA 2V8BA 3THSA 4JLBA 4A36A 4QGBA 5CFRA 2HN9A 5THXA 2AJCA 1XQYA 3PQ7A 5LUAA 3DZBA 2BRUC 3FOBA 5C4IA 5FQNA 1CFJA 4R2MA 2QMUA 2WU8A 5ENZA 4KQCA 2HM7A 4ZQEA 4FMCF 1JJ7A 2QD2A 2QTWB 4LBYA 2D1QA 5BV2P 3ADBA 4G0YA 3ENKA 3QSYA 4MZDA 2W6JA 4GMFA 2VTBB 1ZQ9A 2C5FA 3RUEA 5LYJF 3K5PA 2AR0A 3VRHA 4I1RA 1RXWA 1OGJA 4KXVA 4N3CA 3UENA 3ZBUA 3U4QB 3SVZA 3CLTD 4R16A 1TCUA 4RY9A 1K27A 3CKKA 1DGQA 2CVFA 3MIZA 2X0FA 1BSVA 1DEHA 5EHZA 1ZUD1 3MCZA 3OZ7A 1PT8A 4Y2VA 1LBHA 2QE7A 3INYA 4C4PA 5CX1B 4RHTA 1NUHA 3FMVA 1RAIA 3T34A 1YZTA 4RQTA 4HB4A 1E2EA 5DU2A 2VJDA 3AEZA 3EPHA 2B5OA 1JMVA 3GN2A 4RD0A 4AZ0A 4KGVA 5DNUA 3EDCA 1MXFA 4LNUB 1KJNA 5AYVA 2XBMA 2QVCA 2MYUA 1O5OA 3SKVA 2IE0A 4DLTA 2BW0A 1Z34A 4RJIA 1Q91A 1OIXA 1ZGGA 4P0TA 2B4AA 1FMTA 2BOVA 2GPSA 3AZPA 1PU2A 2PMEA 4FGKA 2ONJA 4BUCA 4JUIA 1U0FA 1UJBA 2B94A 2C2OA 4KXFB 5JJ5A 3S1SA 3F1KA 1U0HC 2IHUA 1HNNA 3WSTA 3JASB 2AZ4A 4FFWA 2VJNA 1IHYA 4HNHA 2XTAA 4G5HA 5EUMA 5H4GA 4RTNA 4H6VA 1VCHA 1EVJA 2J5XA 4UATA 2I34A 3LG2A 1VL5A 4WCFB 2G80A 4JLOA 4EG1A 2PZLA 3KB1A 3QU2A 2RB5A 3KSRA 1OA0A 4URWR 1NF8A 3L49A 3TWOA 4JN6B 3G5LA 1H65A 3OZSA 4ZOEA 2F2TA 1UKAA 2YYZA 1WPQA 4TTIA 4XJVA 3TLKA 4RA6B 4Z6KA 1AK1A 3T5BA 4A0QA 4EFDA 2Q2OA 2PA0A 4P35A 1KKMA 1TW3A 2NNLD 2ZT5A 1GITA 4Z4CA 4U3JB 2PJDA 3EXEB 3RTDA 5DZSA 4JGIA 1QQ7A 3UICA 5JMPA 4PPQA 3EVAA 1S2OA 4FZRA 2W42A 1GGHA 1YVRA 1HMYA 3O8NA 2IDKA 4KV9A 3R7LA 5DEIA 4E13A 2C8VA 1TZMA 1RRFA 3IEKA 3MWEA 4PZYA 3OCWA 3AW8A 5BSVA 1JJAA 3RNOA 4OTZA 5ITZB 1ZI8A 1SK9A 1GUZA 4L76A 3TNYA 5B7NA 2Z4SA 3NHFA 1SVWA 2WLTA 4LUCA 4EFKA 1VKNA 4CEJA 1QDLB 3K32A 1EZZA 1M34A 3B36A 3GLVA 2YQ5A 3PQ3A 4HNVA 2QJWA 3MJ4A 3EF3A 4BAGA 6ABPA 3ES9A 1EFUA 3A6JA 2WG0A 3KQMA 3QNMA 4W7IA 4G1CA 4EAAA 4ITVA 2NYVA 4PHTA 1LDYA 1NRIA 5FNVB 2Z6QA 1FOEB 1BW9B 3HKBB 3QA9A 4ZVVA 4DIOA 5KVAA 5E8JA 1PDWA 2VPIA 4JOSA 5IM4F 1RRMA 2RHBA 4PU0A 4M1MA 3W7AA 2FFQA 2WQZA 3B1KA 4B8ZA 2BZ0A 4CT5A 3GUZA 3HPQA 1FRFS 3H0EA 5AW6A 1SURA 5KTPA 3NIBA 4MVJG 1Z73A 4RGBA 1NSYA 1K9SA 4BU1A 4W1PA 5CA0A 1SQ5A 4Q9AA 3ENZA 4H3VA 1RWPA 1YVDA 1SRRA 3LY7A 4R5HA 2RFLA 4DADA 4KGDA 3HV2A 4FB5A 2O14A 2ZG6A 4BMOB 1OZ0A 4XWOA 2PZBA 4HUTA 2PLWA 2C2XA 4CFZA 4MITA 4RHYA 4DF3A 2AQHA 4PVDA 1DRVA 4I0WB 3EF0A 2NG1A 1Q95A 3REFA 1JAYA 1DRJA 1JW9B 2XZDA 4AI6A 4FOPA 1ZA1A 3AFHA 3P9PA 5DCYA 4X24A 1W94A 2NYUA 1UBCA 2E7ZA 2XNCA 4XWTA 4M3NA 2E1PA 1QH8A 2ONYA 2X8LA 4G0WA 5IJ0A 1EYZA 5FI0B 2QUKA 3I6BA 5CLHA 1U9ZA 3LFUA 1SXQA 1YQXA 2W93A 2IZ7A 2B8NA 1PUJA 1NQVA 3C5HA 4MRNA 5EXSA 1NR7A 1PGJA 1WUJS 2W6JD 3PRHA 1MHPA 3WWCA 2NTYC 3LPDA 3R6DA 2YZGA 2H5IA 3NHYA 3QW2A 3JATB 3QLJA 1W36C 3UN1A 1OBVA 2JVJA 4LRWA 4C0KA 2ZRGA 4X1IA 1Q0HA 3SYKA 4CQMB 1SUFA 1EVQA 4D9JA 3R2JA 2VI5A 4UBIA 3R3XA 3R5XA 2WVAA 3KOWA 4JELA 4CWAA 3NV9A 5GTDA 2D4AA 2JCVA 3DT6A 1QUFA 3AYZB 3MZ0A 4RWZA 2WFLB 5LQKA 3T3MB 4HNAB 3DP9A 5ESDA 3RYFA 4ZYVA 3LTNC 4OHFA 2G9ZA 2OILA 5G4KB 1UBJS 1FLAA 1KP2A 2WWTA 1QS0B 1G1AA 2ECOA 1E58A 4DPMA 2WWYA 4Y2HA 2WK1A 1IRIA 4ITRC 4K3UA 1S02A 2O2GA 1AZLA 2X22A 1EVZA 4LKOA 5DXJA 4L5YA 2D0DA 1Z25A 1WCV1 2Y0DA 2Y68A 3EQ6A 1XMQB 1TTTA 3MGBA 3AM5A 4P3YA 1OMOA 2BJVA 3W1EA 4Q05A 3OKFA 1HDGO 3NTVA 2QRGA 3FTCA 2OA0A 3M4ZA 3A1DA 5K7SA 2VHZA 4A23A 1RBYA 3H4TA 3NORA 3U7FB 1LPPA 1SXJB 2QW1A 2R85A 3COZA 5G1OA 3AG6A 2WFZA 4ARVA 1TKCA 4BEVA 2FJ0A 1VC2A 5H0IA 4LX0A 3T94A 4D41A 1TVKB 1DXOA 4G26A 1NXWA 2WILA 5I3CA 4R01A 3TCXB 3VDXA 4ZPXA 1U6IA 3EPPA 1GGFA 4DWWA 1EDBA 2BM9A 2AW3A 4G86A 4QPPA 4A5OA 2C9MA 2JIZA 4Q4HA 2YW2A 3KWFA 3EMDA 4RLSA 5E4FA 3T35A 4YXFA 5JRZA 3SVTA 2P2DA 2BYTA 2VYNA 3DUFA 2QTFA 2ZLBA 1SZDA 2RHJA 4JC4A 1ODIA 1PS8A 2CDCA 4AP6A 4BASA 2I3DA 4BNDB 4DM3A 2SICE 5KTSA 2AKYA 1Z2EA 2WP8J 2JCSA 2DBYA 4K0RA 4O25A 5CM9C 4LHVA 1GTG1 1UANA 2ZBPA 3SLKA 5FH9A 3DV9A 1Q83A 1HE3A 1R8XA 2EFGA 4TYWA 3AY0A 4ZXFA 2DUNA 2RK3A 1I3LA 1QMGA 1Y4UA 3P9RA 1MGPA 2PSJA 4KDFA 5CCBA 2QM3A 1YFZA 4C05A 2DR3A 2WPDA 4CLEA 1GCUA 3LHFA 2GZSA 3D4BA 1HLPA 4W8OA 4J3NA 4B7CA 4Q16A 2PUJA 1DC7A 1Y89A 2F3PA 4NBNA 2ASVA 3RRNA 1U7HA 4I7EA 4QYSA 3RUFA 4W5RA 1S96A 1Z4IA 3NOXA 4IQFA 4EW3A 1U2QA 2R6HA 2A7XA 2FZKA 4Z49A 4ZI2A 1QVZA 5D85A 4FJ1A 1WETA 4E11A 3QOYA 2R4UA 4CM3A 3BWEA 3ZWPA 6CHYA 4KACA 4KSYA 2IYWA 4W7SA 5C46F 3IIEA 2CFOA 3V1MA 2XUQA 4OMFG 5MN6A 5IUNC 4ZU1X 4EA8A 5IDWA 4FXPA 2H48A 1NNEA 1DV1A 3ZGVA 1E3QA 1UF9A 2BEJA 2C9CA