3K2QA

Crystal structure of pyrophosphate-dependent phosphofructokinase from marinobacter aquaeolei, northeast structural genomics consortium target mqr88
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
418
structure length
392
Chain Sequence
b'IKNAFYAQSGGVTAVINASACGVIQTARKHPDQIGKVYAGRNGIIGALKEELIDTSLESDDAIQALIHTPGGAFGSCRYKREYERLIEVFRAHDIGYFFYNGGGDSQDTAYKVSQLADRMGYPITCIGVPKTVDNDLPFTDCCPGFGSVAKYIATSTLEASLDIKSMCETSTKVFILEVMGRHAGWIAAAGGLAGQSEGEPPHVILFPEIPFNREKFLERVDQCVRDYGYCVVVASEGAQYERFGVAPALANMVKQALGHKYHWAVADYLQRAARHIASATDVEQAYAVGKAAVEMALAGKQALMPTIVRDQAKPYRWSIGEANLSEVANQEKKMPIHYITDNGFGITQDCRDYLQPLIAGESFPPFDDGLPRVAKLKNQLVEKKLRTEFEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyrophosphate-dependent phosphofructokinase
molecule tags Transferase
source organism Marinobacter aquaeolei vt8
publication title Crystal structure of Pyrophosphate-dependent phosphofructokinase from Marinobacter aquaeolei, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET MqR88
rcsb
total genus 134
structure length 392
sequence length 418
chains with identical sequence B, C
ec nomenclature ec 2.7.1.90: Diphosphate--fructose-6-phosphate 1-phosphotransferase.
pdb deposition date 2009-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00365 PFK Phosphofructokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3k2qA01
3.40.50.460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3k2qA02
1RCUA 4FYKA 2HIGA 1T35A 2PMBA 2F48A 4I4IA 3U39A 3K2QA 4HX9A 1F8YA 2IZ5A 2KLHA 1WEKA 4KXMA 3MAJA 3F5MA 2F62A 4MEJA 2A0KA 4KXLA 3GH1A 1S3FA 3O8NA 4I36A 4FYIA 3EHDA 1WEHA 3PFKA 4A3SA 4LJRA 4OHBA 3HNOA 2Q4DA 4PFKA 3O8OA 4LJLA 4WL0A 5AJTA 4U1RA 4FYHA 1MTOA 1S2DA 1YDHA 3IMKA 3OPYA 1PFKA 2IZ7A 1F8XA 4P5EA 4MCJA 2PFKA 5ITSA 3QUAA 4P5DA 4JELA 2Q4OA 4KXNA 2F64A 2A33A 4NPAA 3OPYB 3O8LA 6PFKA 2IZ6A 1KZHA 4RH3A 1S2IA 4I7EA 1S2LA 3BQ9A 4JEMA 3SBXA 2F2TA 3O8OB 4JENA 5AJUA 2F67A 4LJKA 3UQZA 2NX2A 1ZXXA 4OHRA 1S2GA 2KHZA
chains in the Genus database with same CATH superfamily
1KPIA 1CY7A 4OB7A 3PFGA 2R11A 2W4IA 4RADA 2ILTA 2MU1A 3WZMA 3QVVA 2OTCA 3GUCA 1NYRA 1EE9A 3OC6A 1EUCB 4OGFA 4V0MA 4KRXA 3R7AA 3ZIDA 5KJ1A 3FHTA 3U31A 3MD9A 3AUJB 4NYJR 5T67A 1YI0A 1LC3A 2HJ9A 4OQYA 4OHYA 5KNCD 3FRJA 2HJRA 2XVMA 4D9IA 4JODA 4MYDA 2ANBA 5BSRA 2K7ZA 4QDOA 3CX7A 4YDQA 1IUPA 4YQEA 1PD1A 2I7VA 3R5XA 3TD9A 3ZXIA 2DKOA 3L0OA 4BEVA 2X15A 3CUKA 4M8LA 3TL2A 1GCOA 1P1HA 2IX3A 1ULHA 5IJXA 2H1SA 4KXMA 5BQPA 3VU9A 4EFNA 3IGFA 1E3JA 1HEIA 3OCYA 4COOA 4GWLA 1YMVA 3LX4A 4HV4A 5LIRA 2OO5C 3S6JA 3C43A 5EIFA 1F6WA 4W8OA 3AV0B 1E2DA 3FG9A 1QOQB 2XAUA 3BK2A 2AMLA 4JH0A 5L7YA 4D46A 1N9GA 1OXBB 2Z8YA 4LWOA 4MW6A 3WNVA 3UGKA 1N5IA 2OHOA 1V6AA 2ZS8A 2ZT7A 3UBMA 2VJOA 4RKRA 2A9QA 2Y1XA 1P4JA 2Q6LA 3CIOA 4TQAA 4U5QA 4A3SA 4HUQB 4R2WA 5BQXA 1UKEA 3VAYA 1B1AA 6REQA 1G7RA 4NZYA 1UM9A 4OKNA 3DBVO 2H2IA 1NOKA 3EDQA 3V1YA 4A2WA 2O5RA 4RLSA 4KQ6A 4YV0A 3DDOA 3D64A 2P5YA 1LRLA 5AJTA 4IDFA 2V3VA 4UARA 4EMSA 2PLAA 3CLUD 4PZAA 3EZFA 5E3JA 2WIJA 2YZGA 3WHPA 1P2SA 1UBGA 2FPLA 2XWPA 4IWXA 1EXDA 4CEHA 4ZCPA 2H0RA 3EFHA 2XMGA 4L4RA 3KR2A 4UXJA 4MCJA 4NYMR 4BN4A 4HH3C 3UB4A 1E7MA 3IUBA 5KKCA 1D2CA 2UUPA 5CYPA 5I8PA 5ITSA 4ILEA 1AQUA 1GKIA 3MXTA 2J3MA 3D3JA 3KYCB 4JB3A 3OE1A 1XZPA 3BHIA 4BB9A 2HRZA 3NBFA 5K7SA 1O6ZA 3COWA 2N3ZA 2NNWB 1BJKA 2V6MA 4E5YA 2ZUDA 2EZTA 4KITB 3CY6A 2KX7A 4LVCA 1KNXA 4WXHA 3KJXA 2R8ZA 4A0QA 3PC4A 1LFAA 5LFAA 5EZ6B 3ZY5A 2ZS9A 2V8OA 1RZ3A 2V0NA 3PHJA 2UYCA 3C1OA 1P9RA 4M54A 4BUCA 1CDOA 1MX1A 2QRPA 1I14A 1YGPA 2CXTA 4BZWA 1VGRA 1JXMA 3OZDA 3ICOA 1O58A 1T3SA 3OQ1A 5FB3A 2PMEA 3WK4A 4KPEC 4O08A 3NGXA 1FPQA 5HBGA 2Q3BA 4NDNE 4U0KA 3IEKA 5BSGA 5JAZA 4CF4A 3GT4A 4B3TB 3EXG1 4Y2GA 2OSVA 3RUIA 3C87A 3KD3A 3JYQA 2NSDA 4MO2A 2QBYA 4TLMB 5AIAA 2IELA 4D2IA 4LJ4A 2BKAA 3B3AA 3RRFA 2XTZA 3N76A 3GPIA 2ZBRA 2IKSA 3GLKA 1I6LA 1P19A 4EGQA 9ABPA 2XDWA 3IBFA 5TY0A 1QDEA 1GQSA 4IJVA 2BFWA 2ZPAA 4NJMA 1BQEA 1Z56C 1GU0A 2XF2A 2YZKA 3P9PA 4M8IA 1YRLA 1B16A 1D4FA 5TXGA 3R7BA 1TUGA 3QPAA 4FZJA 3ETDA 2WY2D 1IK6A 1ES9A 2DQ4A 4PINA 5CHEA 4F86A 4NATA 1WZEA 1JJVA 1OH5A 3TI7A 3UV3A 1C4XA 3L0BA 3IDSA 1L8XA 1SFRA 5GOZA 1O6CA 4BMOB 2IHTA 2O2XA 2LDXA 5EPOA 4MPPA 4PNEA 5HCNA 1QHYA 1GL7A 1UBSB 1CJUC 1K08A 2DCUA 1HYHA 2BJWA 4QOHA 5C53B 4RGBA 3TLGB 4K3UA 1AN0A 2FZKA 1QZXA 3AYZB 3FD8A 1PZFA 4HQOA 2UXCB 2G80A 1RABA 5I9IA 1GFZA 3H7AA 3I1YA 1V1RA 1Z3IX 2OFOA 3W8NA 1C81A 1ABFA 1WPQA 1YS4A 2VZEA 3N0WA 4Q05A 3RM3A 2OVFA 1KDRA 1LC0A 2O7VA 5FPQA 2JC3A 4U6NA 1XCOA 3MCVA 3CYFA 3K1JA 1VSQA 2VDWA 5AVJA 2GD2A 3JYPA 4D4KA 4A82A 3K0BA 1H8ED 2CFIA 1XRSB 4YJGA 3C8UA 2B9VA 3II6X 3K71B 2Q4EA 3C5CA 4X7MA 1XMIA 1DXOA 3NTVA 1M7HA 4BKUA 1RADA 2VDJA 4J91A 1D2AA 1U2PA 4WSOA 5DB4A 3NP9A 5KNBH 3ANSA 1Y33E 2QE7D 3NM4A 5TQ2B 3P9SA 1DLJA 2XQFA 5L3VA 4J1NA 4QQRA 1SQ5A 3FKSA 3LP5A 3QEMA 3BGOS 8ABPA 4ECEA 2O1SA 4X6LA 3OICA 4BVLA 1HR0B 4JSTA 1W5TA 3L1KA 3L6RA 1VKNA 2AQ8A 3OTOB 3HZRA 4R1TA 4H1TA 3EHEA 4WFJA 3FNEA 2OD9A 1HYEA 2O3QA 5F9MA 3V1MA 2BEWB 4WT7A 1FE8A 4L4XA 1Q3KA 3GFTA 2O8NA 2I65A 4JKIA 3V7NA 3LHSA 1E7WA 3CUEF 2M2IA 2WPDA 3MJRA 4IVNA 4ITVA 4M98A 1ZGAA 3UK6A 5JZOA 1JB1A 5FD8A 3RSSA 4QM6A 3H65A 4O1HA 1WB4A 3I6ZA 3JALA 5CM8B 2GT1A 3L84A 1T8YA 3V1LA 4TRRA 1EGQA 3EEBA 1GRNA 3I53A 3QLTA 1SBIA 4L0CA 1M8GA 3DNMA 2BT4A 4HGNA 5AKLA 3P9XA 1UWVA 3BHNA 3WWPA 5A1JA 1JFVA 2WV9A 3G9TA 4N3GA 2C5LA 5KJCA 2CVPA 3MINA 1R8JA 1V5GA 2NVUB 1QHNA 2DT5A 3G23A 4KYUA 4PPQA 3QVGB 4HNSA 3WLFA 2EP7A 2GVNA 4KREA 2CSUA 4RH3A 5EHZA 3QG5A 1R10A 3R3ZA 4U8HA 3RFXA 1O4WA 2ZSBA 3C6YA 3WWOA 3ZUPA 4TTAA 3VI4B 3ELDA 4B6GA 1EP9A 3LT2A 3ZR4B 1WXIA 1OV4A 3H9QA 1ZA1A 3I5YA 1WXEA 3RVSA 5TPWA 1UQUA 2Z04A 4UMVA 4EVQA 4JBHA 4D92A 2ZQYA 2MR6A 2GD0A 1OFGA 3WMWA 1X6VA 3V33A 3ZCSA 2QTVB 1NVXQ 2WJ6A 3CEAA 5B64A 1OT3A 1Z5ZA 2A57A 4RD6A 5SY4A 4WZAE 3V9PA 3ZZNA 4PN7A 3OOSA 5C5CA 4AJLA 3QJGA 1TTTA 1F51E 4YY3B 4B47A 1ZWLA 2ZAMA 3OTIA 1JH9A 3RKRA 3CNBA 2IU4A 3EEQA 1CU1A 1KI9A 3BXXA 3TR0A 3TG8A 4JWTA 3BHMA 1H1LB 1U7UA 1G0OA 4ZI7A 2ZIGA 1XZAA 1CZUA 5HVNA 1ZK1A 3A3YA 5FUYA 1WP4A 4P1ZA 2H11A 1JHPA 2WHEA 3DV9A 2WYWA 5AI4A 3UC9A 3ZIUA 2FEOA 2HCBA 4E1AA 1OXVA 1C29B 1Z68A 4A5SA 4EUFA 3AJAA 5E2IA 3CR7A 4HG2A 4B2LA 4DBLE 1DELA 1SKAA 2BOVA 4R8KA 3W6UA 2ZUCA 3RAPR 2ZT5A 1DXHA 1AC5A 4M89A 1N92A 1QHXA 4OQDA 4DJ5X 2R3SA 4Q39A 3G85A 5KREA 4UHBA 3L8CA 1AXEA 3TX2A 3RJ9A 2RI6A 1KR5A 4OM8A 2VDQB 5EKTA 4GUDA 1KAOA 2X58A 4LE1A 4L73A 4EFDA 4NWIA 4CV2A 1X14A 1LTKA 3DBRB 1K86A 5IMSA 4G5XA 1U1GA 3WGZA 1JFRA 2JB9A 2Z0MA 3IQDB 1PEDA 2AD1A 1YZKA 2R6GA 4DDHA 1FA9A 4ESHA 5HHTA 2XE6A 3JVIA 4NFLA 4DFDA 4TQUS 5AVUA 3LT1A 4PBSA 4X1OA 2JLVA 3VNRA 3FUXA 4A16A 4DV0B 3GXOA 3M4ZA 1JF8A 3EGVA 4TTPA 2Y2VA 3FTFA 2H8GA 5AW3A 2HCTA 2WP0A 1G60A 3HNOA 2C4KA 4PCAA 3SVLA 4B3FX 2Q5FA 2EWVA 3KQNA 4D45A 4YT4A 1A9TA 3DFZA 2JI4A 1J9EA 2APJA 1SPXA 4CMEA 1E2BA 3BJIC 2O0HA 4L8YA 3BB3A 3P5SA 4ON9A 1F6DA 4P3OA 1TFUA 3KJFA 4LE2A 1XNGA 3QWHA 2Z2ZA 3HL0A 3KDAA 1LB1B 3L7KA 2ZUUA 2YN4A 2ACVA 1HTWA 1SM4A 1J5PA 1R9MA 5IVIA 4RCZA 5I9BA 4YUXA 1Q1NA 2VC2B 4UM7A 4R84A 4DR4B 3I5UA 3TFWA 1P2BA 1WTAA 2GZ1A 3LQ1A 2RHBA 4OF4A 4WKBA 3QEBZ 4X00A 1CERA 1BDHA 3AERB 3L82B 1QHIA 5K09A 3M81A 1BWRA 5EJ7A 2GXAA 1BGWA 3T9AA 2E4WA 3QOYA 2VHUA 1QU3A 4Q9HA 4RPHA 3T7RA 4RLFA 2VDPB 3I04M 5BVGA 5TNXA 1XWIA 1OB5A 3ZHZA 4MR8A 1E61A 4FZ3A 4AIRA 3PQDA 3K5WA 2C29D 4LDRA 1DOHA 1EQ2A 5FTKA 2FFRA 2QDKA 1QC5B 3DUWA 4G4JA 5L6MB 4TVOA 4R1OA 1XNQB 1XNRB 2W7TA 2EFEB 3QOWA 3ZPXA 4INJA 2C00A 1NVAA 4KPGA 4TLCA 4IYRA 3TTXA 2JL1A 4N54A 5SY6A 1SC1A 3FWYA 4BS9A 4JEHA 5FAKA 1DBIA 2YIJA 3MWYW 3UA3A 1PK7A 1PJCA 1G20B 4MVJE 3BSFA 4NYIR 3T7KA 5CA1F 1I1QB 2FW8A 2RFLA 3C24A 1M1NA 4KXYA 3GJXC 2L0XA 3DXYA 1XEWY 2RHOA 1YQTA 4JEIA 1CZRA 1T0UA 1X0VA 4QBHA 4NCHA 3LPMA 4ND1A 1EVKA 2XGSA 2C5EA 3ZGYA 1D2NA 2JGLA 4QJ3A 3CW8X 2ZXUA 4AJKA 1B3RA 1WXGA 2FAXA 4DCNA 1L4YA 2JI9A 3GZJA 5K1ZA 1BFUA 4JSYA 1MNAA 4I4TA 3A3NA 4LNHA 2FA9A 3L92A 1I3NA 1GV1A 2G4LA 3L18A 2NLOA 1DC4A 5DXFA 1YC5A 2BF4A 4HADA 3UFBA 3WIVA 3ZK9A 2WIAA 4DR2B 1PDOA 1UJBA 1MIOA 2NUPB 4J6EA 3A11A 1MVOA 1CVIA 5EMLA 3TKLA 4NH4A 4X24A 1WZIA 5AVZA 1K75A 2FMFA 2J3EA 2X5OA 2XYHA 3UWKA 4YX9A 1GZ6A 2AOUB 5A4IS 5IEJA 1NAHA 3CRQA 3V4PB 4HZUA 1WEKA 2ILVA 2WI8A 1H2RS 4GLBA 4KDFA 3LGAA 3RBVA 2ZYTX 3UJAA 1N0WA 4UBLA 2H1IA 5B1YA 4JI8B 2VPIA 4LVOA 4CFSA 3ESAA 3QF7A 1NF2A 4OHWA 2ZJ3A 3IP7A 2FP4B 1XROA 4D5EA 1CR2A 2H1WA 3DLTA 4QE3A 3DBIA 2OT3B 3D8UA 3ND7A 1B0ZA 5IBRA 1DBPA 2WWVD 2OQRA 4J1TC 3EVEA 4BQRA 1MV8A 4GSKA 3EGDB 3SFZA 1T6BY 4F4UA 4LZOA 1X7XB 1MTZA 1NPDA 4O4HA 1E0SA 4TUYA 2AQHA 4U9IS 4AF8A 5FEMA 3L5OA 1MENA 2GN6A 4ISBA 4M55A 1CDDA 1SY7A 4NENA 4KRYA 5E1MA 4AP9A 5PNTA 3QMPA 2CHEA 3TOCA 4RD4A 4BWVA 1HLDA 1ODJA 1VDMA 1K4YA 2ISQA 4LYGA 1N8TA 1KOGA 2R87A 4WBNA 2NVWA 2HX1A 4JL6A 3TGLA 2PD6A 5TVGA 5IDVA 2E21A 1QGOA 4HR7A 2R8BA 2VEDA 1X1SA 4OUKX 2X6RA 2IYRA 4YGXB 1OVMA 4M1TA 4OMDA 1FDIA 1H6BA 1R8QA 2BFFA 5H83A 3SFVA 5HOQA 2AT1A 3PQ2A 3RG8A 4XB2A 1MV5A 2PRSA 2QHXA 3ED1A 3TOZA 1Q0QA 3BWCA 2QR2A 1U1FA 3QEMB 1HFKA 5DSTA 1FP1D 1HQYE 4ITUA 4G41A 2FFAA 5ENVA 3UMJA 4EWLA 1VPDA 4M0DA 2CDBA 1XIVA 3I83A 4PRZA 1E0AA 1P2FA 3TPZA 3E6AA 1OSNA 1THGA 3EFOB 4E5SA 1AO0A 2X1LA 3D4BA 1S9DA 4Q1DA 3HCWA 4XCXA 1Q7CA 2PIDA 4URZR 1YZLA 4C20A 2A9RA 4L72A 3H42B 4DG5A 3KOMA 4PHFA 2XDQB 3LHKA 4RSRA 2XHEA 4WESA 5EXEA 3NTLA 4JJ4A 5EE9A 2X1HA 4F8JA 1M1YE 3OECA 2ZLBA 1E89A 1L5QA 2H0QA 4DA4A 1OGYA 1ZH0A 4LRUA 1YFLA 4YVFA 1HOTA 3MLBA 4IG4A 4LV5B 1M8PA 2OCBA 4OBXA 4OQFA 3M6AA 2QAGA 4P7JA 5DOVA 1V1RB 4EI7A 3T3OA 1UZMA 3H5LA 1YR7A 3DAHA 1DMSA 1YKGA 3LIPA 2C4MA 1LQUA 4GMGA 5B2ZA 4I3HA 4CMCA 2RD2A 3ZJUA 4GOND 1ZGHA 4S1OA 4JP1A 4JJ6A 1JFFA 1JSRA 3H1FA 4LZNA 1G3IA 1KNQA 2XY4A 4NI5A 3SXPA 3SYTA 4V0SA 1UOQA 4BNIA 4FX5A 1SOWA 2QI9C 4JMPA 5I7EA 4A5OA 2QP9X 4UFOA 5F78A 4TKLA 1CJKC 2Q50A 2OZKA 2BP7A 2R7MA 4QX6A 4WNAA 3I2KA 3SZLA 5BQFA 2QTHA 3PEYA 2DU8A 5HJ2A 1KH2A 2XZDA 3D0OA 1BA3A 1W0JD 2XB4A 3ID6C 2OHIA 1Y8AA 3K2BA 1QO0A 1SOAA 3UUWA 4DCPA 2E1RA 1R0KA 2BV3A 3DV0B 2WE7A 4A9AA 4OHOA 5AM2A 2NV0A 2YWJA 2RKWA 2C1ZA 2G09A 2ZYIA 4XWTA 3HZOA 5AKEA 1JEYB 1U9IC 1QIHA 2MSKA 1UPFA 2YFYA 5DW0A 4KAXA 4DIUA 3HBFA 3B2QA 1LW6E 2PMDA 2PS1A 3U39A 4A1FA 1H4SA 3AVXA 2W43A 1CZLA 1P44A 4LOHA 4CQLB 3TCNA 4ETMA 4JJIA 5KPJA 1T8UA 2PJUA 4HMQA 1O03A 1SQ6A 3HRHA 2OA0A 3PCXA 3DTVB 2ZU6A 3D7KA 3P0IA 2ZTHA 4KNWA 3CQ9A 2B1GA 2BCGY 3M6VA 1M6VB 3QU5A 1GLNA 1UT8A 2X5NA 5FV7A 3JQEA 3P96A 3LU1A 1KFBB 4N5IX 1FMLA 1W9MA 2JLSA 3H3FA 2H1FA 3N39C 3ZDYB 4B76A 4C7MA 4LSMA 2WU3A 3GMSA 1CNFA 4IZHA 3OCUA 3TNDA 2DUMA 1SUIA 1WSAA 2HFJA 2JZNA 3C7AA 4ZMBA 3TLYA 5HMMA 4FS8A 4WOKA 3SHWA 3QVGA 3MBIA 1WF3A 5AI6A 5DOZA 4QUGA 1UBTS 3FYSA 1K8RA 1R0BA 1X7YB 1DBSA 4DCOA 4LJ9A 4ADSG 2V5AA 3IB3A 2ZG6A 3DWGA 3ZK8A 3K20A 4CVNA 4L4UA 3RBXA 3NKFA 4QELA 1TO1E 3BA1A 1JIXA 1P1BA 1E8NA 2G5TA 3IAUA 1QWOA 2VSNA 3ZQKA 5BXYA 1DUVG 2Q0XA 2QTZA 4YI5A 2OCGA 4CZ2A 3RV3A 4CNQA 4QFCA 5IFLA 3H5WA 1UOPA 2VZ0A 1G3MA 3GGGA 3JD2A 1CULC 5DBFA 3QNUA 4AG6A 3W34A 1TKRA 3K9QO 3L7NA 5F98A 4YALA 4F5DA 4ZVSA 4CWAA 2Z2KA 4YJHA 2C4WA 4B7XA 3M4XA 3OZUA 2B21A 2WM2A 4WY5A 2Q7XA 3DFIA 4LYFA 5K0GA 5JTTA 2A5LA 4V02A 4GPAA 4RZQA 1GQYA 2ONYA 1J8YF 1V5EA 2RH5A 3W3AA 1CD5A 1AB6A 4HH0A 4QHSA 1HEUA 1BNCA 1I7LA 1TQHA 3VOTA 4YXWD 3G2PA 3JPYA 5KAPA 1ZVMA 4HI0E 4Y9TA 3VH1A 3R3HA 3L0SA 5AJYA 3T6KA 4FFRA 3OQIB 2FG7C 2BFNA 4PYIA 2PZFA 1VCHA 1KKUA 1R9GA 3VC3A 1RXYA 3ERCA 2HZ7A 2XJ9A 4MS3A 4TYPA 1ZI6A 1BU5A 4K6OA 4KUHA 1SZPA 2W2KA 2VEOA 1J09A 1EDOA 2GHRA 3MMSA 3CONA 4M6WB 1Q0LA 4U5XA 1GUDA 1BHSA 4N39A 1CUSA 2XMCA 3ICPA 4RFSB 3KQSA 4IO1A 2WAYA 1TU3A 5JQWA 3ENKA 5ALUA 2GLXA 2VWPA 3O31A 1ZU4A 3OIUA 4HZUB 1AJEA 4CG3A 2FN4A 2EFCB 1QYVA 2G72A 3VVBA 2IS6A 4EJMA 8GPBA 3HXQA 4A6DA 3NAQA 3SC2A 5EE0A 3STVA 2VYCA 1VHDA 3T1YB 3VYRB 4IJUA 2XWJI 1K92A 3QX3A 2NTYC 1QB7A 4MLCA 4IV5A 1T35A 3IPLA 5JO9A 5IS2A 3X2EA 3OJXA 5FTNA 3HBAA 4GSLA 3TSAA 3GLGB 1CWUA 4FJ0A 2CDRA 1OBHA 2HUPA 3AWDA 3BMNA 4I4TB 3I30X 3NORA 2OSBA 2QORA 3DZDA 3E1GA 2OENG 1D7AA 3U2QA 1IQUA 1LW7A 2G17A 2IUTA 4MKGA 1ULZA 3FFTA 1X3LA 2OOKA 2H4WA 3ZKWB 4JT4A 1KTVA 3L1UA 4HLDA 4W99A 5E2AA 2COUA 2CNWD 3LUAA 4WK2B 2F4VB 2YVKA 3THYA 3INTA 1YRWA 3IX7A 3L6BA 4EY3A 3OA2A 4OH1A 2Z58A 2W2LD 1SUCA 4ZCSA 3GV0A 1OLXB 4RQTA 2BFMA 6ADHA 2C7VA 1J1UA 1QKIA 2AZMA 3JZMA 2H4JA 2RH8A 4R6XA 4EJ0A 2Q5EA 3M1IA 4K1LA 5FUVA 5TT0A 3OPQA 3NP7A 4J16A 2P6PA 4XI9A 2V9PA 5ERXA 1XLUA 3HCPA 2BFBB 2DY0A 4L6CA 4RPIA 3HYTA 5DBGA 1JHRA 3ZGOA 4EA7A 2DSTA 4YRNA 5C5DA 1K2VN 3NRBA 3BZUA 4NCBA 1SIBE 1W5AA 5JJCA 1YA4A 4IJMA 4MO9A 1N33B 1G5FA 2QNBA 3HN6A 2QA5A 3FX2A 1ITZA 4FWBA 3PVZA 1RLTA 4YFVA 5LZ5A 4F56A 1TM1E 2JBAB 4TZTA 2IZ7A 4ID3A 3H75A 2XYQA 4NENB 2RJNA 2AC4A 3V4OA 4HN9A 2O8EB 4BZXA 2J3HA 1COWA 2C7BA 1P0CA 2DMRA 2VTDA 2WHPB 3DDHA 3E9RA 3BA6A 3EGDA 3JD0A 3IT3A 3OOYA 3WL6A 2ZRLA 3JASB 1YZHA 3KEFA 4CIAA 3MQ4A 5EZSA 4M1ZA 2XQIA 4BCCA 3AI1A 4RSHA 2WHRA 2C7PA 1ZD4A 3ISTA 3VKUA 5AKJA 3P9IA 1X74A 1KMHB 2A9OA 5AI8A 5LQAA 4E0BA 4EJSA 3IUJA 1PJ2A 3E7XA 2AG5A 2I33A 2PMWB 4P31A 3T12A 4G97A 4M8NE 1G16A 2M6LA 1OV6A 2E4AA 3DYVA 3N75A 1JBKA 4JL5A 4ENRA 1V11A 2R5WA 4Q1VA 2BEVA 4OAPA 3EFEA 4GR9A 4FGZA 4YCCA 3ICQB 3KB6A 3ISJA 3LA8A 2XE4A 4M9CA 3G88A 4K7JA 1F7VA 1QOPB 4U4AA 5LP1A 4DA9A 2JG3A 3LQ2A 1RAHA 4R9RA 3H11A 4MVCA 4B43A 3F7TA 1BMQA 1V4BA 4DQKA 4UU0A 3QP9A 1GITA 2GEUA 1A9QA 1ZM7A 2IF0A 4JLSA 3V4SA 1X15A 3GO4A 3X2FA 3B6IA 3BOSA 4YRLA 1KVUA 5CPFA 5FYDA 4DJFC 3KQQA 1PNQA 2X5XA 4H4EA 1U6KA 2YV2A 4QICA 5JU6A 1NL3A 1HWYA 5JMTA 1C5KA 2LPMA 1ZIYA 4HC4A 4N12A 5LP6C 3HJNA 2ZWVA 1A9XA 1IOZA 2FI1A 3OTWA 3P45A 3KJHA 4B6PA 4BBAA 1CRLA 1UXIA 4NBWA 2ENUA 3V8QA 4EP1A 3LGXA 3F4BA 1W1WA 3A3PA 3HUEA 2BUAA 4MTLA 4BMPB 4F8YA 1GPLA 2MIIA 4QJBA 5D86A 3SLRA 2RH9B 5HKKD 1JPVA 3ETHA 4GVLA 1E4EB 3GUHA 2BFFB 3HBMA 2VNJA 2I6SA 5DSZA 3PQFA 1TYCA 1AMNA 3U09A 1AQIA 3W3ZB 4R7ZA 3B9BA 4YQFA 1OLOA 1IBSA 4Q7JB 3A4LA 1VJCA 3DT6A 1NIPA 1I3MA 3GCXA 3T5DA 4WZBE 5LSAA 5FUQA 3PL5A 2P2CA 2X6QA 4C5BA 3MB8A 2AI1A 5U4XA 3MQ2A 1VJRA 2GM9A 1FJGB 1ADCA 4LV8B 4E5VA 3CEJA 1FDRA 1NY5A 4E15A 5JAIA 3ZWCA 1I51A 2VSXA 3P2YA 1VXOA 3M9XA 1AQYA 4EPTA 2X7JA 5IT5A 1XMQB 1RYZA 5DNVA 3U3OA 3KQKA 3D6NB 3ITEA 3A1NA 4P3XA 3WJ7A 1QIDA 2FOLA 4OA5A 1P4RA 1ZIXA 1J8QA 2CBXA 2V8BA 3BMOB 3IMGA 5KYXA 4RF5A 2CYAA 4R9NA 2YFHA 5JLAA 2AEFA 5TS3A 4D4LA 4TZ6A 1ZMXA 4E5MA 4C0SA 4O4JA 4LFAB 2RGUA 4XSVA 3SM9A 3OCJA 5M5BA 4MTCA 3UO8B 4D9MA 2P2NA 3VR4A 4UVEA 2R85A 4MGEA 4O4JB 5KQPA 2GDJA 3M1AA 4CKZA 4LECA 2H7CA 3SQMA 3GDWA 3RAFC 1XA0A 2P9QA 3L1JA 4FGJA 4TMXA 2UUBB 2QUIA 4OVKA 1RPZA 4BGDA 1V48A 2EJUA 2NVUA 4EVIA 4IFTA 4YT8A 2GI4A 3W5AA 3BWMA 1JA0A 3G5LA 3HJTA 2Z3ZA 4QJ4A 2ZUTA 4HMOA 4ER5A 4U7FA 2XMSA 5B7PA 1W4CA 2BM8A 2GARA 4C0WA 1N2CB 2CVQA 1S8FA 1FMTA 5LWQA 4N40A 4UEWA 2NO9A 4IHJB 2IH2A 2O19A 2ZCJA 4BNTA 2QRQA 4HAUA 5C1DA 2QSZA 4EHHA 5CH3A 4OO3A 2B8TA 3ANXA 3RR2A 3DWIA 3NT5A 2ZZMA 4XD7A 2QYTA 1YZQA 3LV8A 4E08A 2N42A 3G1TA 3RRMA 3P4YA 2WT8A 3DM9B 3AM3A 3CM0A 4MYTA 1VE7A 1LDGA 3LUHA 1ZRMA 2I71A 2VJAA 1MP0A 3L46A 4R2MA 1RWXA 2FOIA 4E5UA 1AGPA 3A0RB 1EFLA 3DFFA 5KYGA 4FKBA 1T4MA 1R6TA 1Q6ZA 3M6IA 3BCUA 4BMYA 3N0TA 2FQWA 1ZNXA 2YWBA 3RUHA 5KNLA 4DR7B 1BVUA 4FGSA 4G0VA 3NWEA 1W96A 2QRGA 2D62A 1MD9A 2P0EA 3PRKE 1JVBA 3ZY6A 2I5PO 4FOTA 1R16A 4C0HA 1OLSB 1U7DA 1KJNA 2QMOA 4X66B 3T38A 1Q11A 3C7KA 4DA8A 1E2GA 1JJAA 1C0LA 1X7YA 2X2EA 3K6RA 5EHGA 4MVYA 1K98A 4B35A 1JILA 5LZ7A 3UW1A 4YRTA 3R76A 4YRAA 2WF9A 4GOJA 1C14A 2UYYA 3UUEA 5EJ8A 1KMMA 1WULS 5DNWA 1O0SA 2JFZA 2YRWA 3NYQA 4M7OA 4Y2JA 1PX0A 1L5FA 3FFBA 3V8MA 2HU2A 5IAGA 2WFAA 3WNDA 1QLHA 3F7NA 2VPQA 1U9ZA 2PAAA 5JCJD 2AWNA 4I8XA 1Y6JA 3PE3A 1ZD9A 1E6KA 2B34A 3CGWA 3GAZA 2PCLA 3DPIA 1Y4SA 3OA0A 3D5QA 3PFCA 3RTDA 3S0JA 1T2CA 1RBQA 3DTVA 4KQ1A 4M3NA 4P22A 4JLOA 2Y0PA 4R51A 3DVAA 1N8KA 4NCNA 3MELA 3UMSA 4L9RA 1YJCA 5JVDA 3AVPA 1ISIA 1DG9A 4D4HA 2ZKIA 2X7HA 3SQWA 4HTFB 4IIUA 3MGKA 4RACA 2VF4X 1XTPA 3D43A 3LKBA 3ET4A 5EXTA 2ATXA 3Q3GE 5K3AA 5DHUA 1LLDA 1ZVQA 4XRGA 2VYVD 1XD2A 1SUWA 3CNQS 1WU8A 1SCBA 4K6KA 4MAFA 4MMYB 1P5HA 3HG7A 4BX2A 2IUSA 5F73A 2GJ4A 3T3NA 4OHBA 5NLLA 4EPXA 4FONA 3A1DA 3NO4A 3IHLA 1FP6A 3RIGA 4CTJA 3UXMA 3DBRA 1Z8DA 1G17A 3R0JA 4QYXA 4F6RA 2OBLA 3E82A 5AHKA 2ZYSA 2LKDA 2PTHA 1OLXA 1TYZA 4KJXA 4TXNA 3SOZA 3BQNB 4H9GA 3QE0A 3TECE 1L5HB 4LSWA 4K9SA 1HLPA 2Z8ZA 4Z1MA 2DHRA 5LKAA 2QSJA 1OF1A 2H48A 1QH9A 1XMJA 3IV9A 5EPUA 1IMOA 2IPAB 4BP8A 1FDUA 4L0DA 3H9UA 2AVNA 3ZHYA 4LV6A 1EP3B 2OVBA 3QX7A 3BEDA 4HNGA 1P31A 1VPLA 3WYFA 1UP4A 1XR3A 1LF5A 1WP9A 3LFTA 4KO1S 5KVQA 1VE5A 2VP5A 4K6HA 5FL7A 3ZQ4A 4DADA 4LCEA 3BKXA 1T1SA 5JWRA 3IC5A 2ERYA 1B6GA 2AUNA 5BYJA 3KTAB 2Q2NA 3V4RA 3T1NA 1NULA 4G0QA 2I91A 3KZCA 2QN9A 4BO5A 1MLDA 4TV8A 1VL8A 3ZJTA 1OGIA 3HJBA 3C6XA 1QH0A 2D0OB 1PJZA 3CG4A 3Q7IA 1KGSA 2IYZA 3K1ZA 3WMEA 2I67A 3AG6A 4WXYB 5E7QA 4LGMA 3VJKA 1IZ8A 4L0QA 1ZJZA 1GV0A 4EW3A 3HVHA 2OHHA 1YOVB 4W7HA 3WIEA 1BDIA 1ND6A 4YR9A 1PT6A 2Q41A 5FLEX 5KQSA 1OFUA 1BW9B 3DEFA 4F4IA 1T3HA 3AP3A 2RCYA 2AN3A 2NZJA 3BRSA 1ATZA 3KQLA 3ZHOA 3GEDA 4EY4A 5BUQA 3MWFA 3KB8A 3AJ8A 1I3KA 1RI4A 4CJXA 5HA5A 1A5SB 3OLZA 1JQEA 4XGKA 3LK7A 1DBQA 4G2TA 1XD9A 5LYYA 3PNVA 2H51A 2PGDA 5IJAA 5DISB 1UPUA 2W2QA 1G1AA 1MOQA 4AWBA 1E3TA 3BD8A 3EGWA 3MTGA 4IXTA 3X44A 1EFVB 5DCWA 3THWA 5CBPA 3VC7A 3KSAC 2UZ1B 3GP8A 1EBFA 4TLBA 2CUZA 3VR6D 2D1RA 2AFHE 5IJ9B 4P0QB 1YUBA 4AN0A 2WTMA 4MIOA 5FUBA 1K63A 5B3JA 4MKIA 3FLEA 3SXJA 3ZU3A 1EP2B 3ZCTA 1SU6A 4KL8S 5FEUA 2FDRA 4P98A 3WDSA 2IEGA 3STHA 1T5SA 2OORC 4HDAA 4DLLA 3ND9A 1KK0A 3OLWA 2CDNA 2JFPA 1QRAA 3IAS1 2ACEA 3HJUA 4QU5A 5KEIA 2G0AA 1EXWA 2Z1MA 2F62A 4M1KA 5HJ7A 1VHQA 3LS2A 3OPNA 4MGIR 1NW3A 4UUOA 5IG2A 3W8RA 2CK3D 3L01A 5B2EA 1FP4A 3HYSA 1OH7A 3MOSA 2RSLA 3ASVA 3L8ZA 1CUFA 4KHZA 2EIHA 4N8EA 4QO8A 2QLJA 5ARCA 2VJNA 3TQSA 1MKYA 3W5JA 4C7KA 3L06A 3HEMA 5EESA 3QJ5A 1QYWA 3OO0A 1U0TA 1VJDA 1SVOA 2NPFA 5JPDA 2V0GA 1XN1A 3UGQA 2C9OA 1P9OA 5AD1A 2ZSJA 3NVAA 3HA2A 3IVMA 1R88A 3THOA 1WRBA 2LNDA 4ZT6A 1GTSA 1ZK2A 1ADFA 3T7TA 1EK5A 1T5OA 3C8DA 4Q9AA 3E22A 4L57A 4MARA 3VOBA 3X1KA 4CMIB 2IE8A 3G82C 4HAVA 4WD3A 1A2BA 3VDRA 1ZICA 2PS9A 2PX8A 2Z6VA 3GJYA 2PFGA 3H84A 3I2YX 1DC6A 2OV4A 3QFHA 1B2RA 1XVVA 2FXIA 2NXEA 4FP9A 5AKGA 4CIXA 4YP5A 4NV1A 4XQCA 3DCYA 4J0JA 1C9EA 1F12A 5CITA 5HZMA 4OQ4A 5KYXB 3AEQA 1C41A 1SG0A 3F73A 4GHWA 1ZIPA 1KETA 2C5AA 2NSJA 3RIXA 3IP8A 5I9NA 1T8PA 4BP1A 2DWCA 4HEHA 4Z0PA 4DM7A 3ZZMA 3M3DA 3FKJA 5EOVA 1T3TA 2B6NA 3UAGA 3VR6H 5EJ2A 3EPRA 1G38A 1V1MA 3AF4A 5K8VA 3B85A 5IBQA 3UA4A 2IZ1A 3PQ6A 2DLNA 3OPVA 1GDTA 3KL4A 3OFSA 4Q4LA 4U8GA 2ZB2A 1EG2A 2HL6A 3F4KA 1KBOA 1J97A 2CKMA 1Z4IA 3HACA 3IAS6 4JBGA 3TE6A 1A88A 1ZZGA 5KNDA 3A31A 1C0EA 2HT1A 1AUPA 2NIPA 2YVLA 3DE3X 4KHPB 3WAKA 1BJTA 1CETA 1ZK0A 4GW3A 1RQPA 1OX6A 5DHQA 2AZDA 2CWDA 5K51A 1QP7A 4M7PA 1WB5A 5ALYA 3UHJA 1YRYE 2DPYA 3EJWA 3DOHA 4WA7A 2J3QA 2X0KA 3GFVA 5SZIA 3BB4A 3QWAA 3O0DA 4K86A 4DDKA 1DG3A 5GY7A 5B5SA 5JAUA 1ZCZA 4G5SA 4EHLA 3F6SA 3FPEA 3L7CA 3PQ5A 1N77A 4N3AA 1IDOA 2R2AA 4EM6A 4I1RA 3F6RA 1STOA 1U5CA 5E6RA 4BPRA 2IWRA 4AB1A 4NX2A 3ENZA 2C4TA 4GBMA 1I30A 2QZ9A 3R4VA 4NESA 3TJRA 1J56A 2RGYA 3QHPA 2I76A 3AF0A 3REQB 4E2FA 3PR3A 2QRVB 5BW8A 5F1PA 1QIKA 1HT0A 1JDPA 4TMYA 4M8KA 3Q3JB 5LZ2A 2B5OA 3HLTA 2CVFA 2XB6A 4ME6A 5FA8A 3FUCA 3HKBB 1P1KA 2YIMA 2IHVA 5D3MB 4AQDA 1QH1A 3K70D 2WJGA 3QIVA 2EKBA 3DJYA 5DV9A 1FQOA 1IY1A 1YHNA 2NV2B 1VMIA 3OJEA 4HB4A 4MV8A 4MUKA 4WK4B 4XAQA 1ST3A 5ULLA 2WEKA 1YR1A 1OPXA 1JAIA 2CMKA 3RD5A 3NDBB 1F48A 2PX0A 4RKFA 4ENUA 5JNUA 3LL4A 1PL7A 4U7HA 4U63A 1SC3A 1WUJS 2PGAA 4JD5A 4OXXA 1KQFA 2VPTA 3NEAA 3I6QA 3WHLA 2GN0A 1V5IA 2KLHA 3N07A 2FDCA 2J31A 1XL0A 5C37A 1ISMA 1RLMA 4F96A 2IU6A 2FUG1 4NICA 4MEJA 1XJ0A 4G5FA 2I4IA 1C0IA 3BXHA 4KWCA 4PQFA 1PVOA 3IJPA 4OU4A 4UD6A 1XMPA 4PGHA 3RIMA 1ISJA 5CLLA 4IMJB 3CWZA 4CIYA 3NUGA 2ZYGA 1NQOA 4ZQFA 4PBRA 1V47A 4IZOA 4D9CA 1OGJA 1S8NA 3GMDA 3OZFA 3B36A 4ZJZA 1Y5NA 3NYWA 1I4OA 2ZR9A 2WSIA 3GIDA 1PYDA 3LY9A 3O8CA 5FX2A 4X92A 4WN9A 4BRSA 2HHJA 4R98A 4PRLA 1WXDA 2WSBA 3HVJA 5DLPA 3EDMA 4IOLA 2C2OA 4WIAA 4Z9FA 4EL0A 5LL6P 3S2ZA 1HDRA 1K7YA 2ZVPX 4RY8A 5DTMA 1UK8A 4BLTA 4XYGA 1YHYA 4I14A 4G4SO 2IY9A 4E33A 3PFWO 1B8PA 4R4JA 3WMRA 4ZYZA 1QLJA 5CPBA 3R7WB 3IMKA 2WE8A 3AR3A 4R41A 4CKWB 1BSVA 1L7DA 2CC2A 2CL5A 3BG5A 3RU2A 2B69A 1W76A 1U3VA 2VP6A 3CVVA 1NXPA 2ZDHA 3IPXA 2P6RA 5IANA 3THRA 4H7PA 4LYAA 4ZEMA 3PYXA 1QF9A 1TAQA 3SZRA 5H3HA 5CHYA 4CEHB 4BO6A 4M46A 2FSSA 4AYWA 1QG6A 1MDFA 4R1SA 1HE3A 4RGYA 4MS1A 3OMXA 4O2AA 5KNDD 4EB0A 1RFLA 3Q6MA 4K03A 4EENA 1GAWA 4EYEA 1MT3A 1BW9A 1RRFA 1D7OA 1TA9A 4MVJD 4U7DA 2CXQA 3GLVA 3NDJA 2C2GA 2PJRA 1FNCA 3PJRA 3P9CA 4ZI2A 1RKUA 2Y3IA 3MUOA 3P2EA 3UUGA 1D5CA 5A5VA 4RM3A 4XUDA 1ZJ6A 3T9FA 1FFDA 4V0OA 1QQ5A 3KUKA 4HEQA 1YZFA 5CVUA 2ATIA 2CMFA 2HU5A 3GNTA 1XN4A 3K0HA 4HWTA 4GI7A 3TRKA 2HW8A 3EMDA 3HTXA 1H85A 3TZHA 2ZWAA 2W2OA 1KAEA 5CDYA 1RVDA 1S1MA 1P1IA 4DZZA 3D1LA 1BKYA 2ZUSA 4DLUA 4GM4A 4L5CA 1VE6A 1NU6A 3HKBA 3WWZA 4B7CA 1EIZA 1LWNA 3CW2A 1E0JA 4QU9A 2VN8A 2I2WA 5CEEA 2G63A 2WAOA 5HXAA 1PUXA 2X3YA 4FDAA 4QPPA 4XA8A 2KE5A 1REQB 2IXEA 3KPJA 3KXPA 4MUYA 1V7PC 4GVPA 1THMA 4JR0A 3F6EX 3PUWA 4DIBA 3SFTA 3M5DA 2GAOA 3ZHVA 1WETA 3LJKA 1K4MA 2OR3A 3GT7A 1RQGA 4A03A 4QBTA 1U8UA 4GZ5A 2BEUB 2HRRA 4CGZA 1NUUA 1U80A 4LJSA 2IODA 3QKIA 5DW3A 3Q72A 4JMLA 5K0LA 2ONKA 2CF5A 5JISA 4HQKA 5KIAA 3KZMA 3WYBA 3G0IA 1QQ6A 5AJZA 3MYYA 4D97A 3V97A 4L5BA 2VS1A 2FHSA 4PAQA 4O29A 1YJBA 4JBIA 4S2UA 1ZNYA 2TMKA 1YJ5A 3CBGA 2BR5A 3EXFA 3NTRA 4ERXA 1UXJA 4N6OA 4D9FA 5FJJA 1IN8A 1NZJA 2QGZA 3NIBA 3BMNB 1UBMS 1JMVA 4TV9A 2NO1A 3UOWA 4J49A 1K2WA 3TLGA 4MHSA 4BB6A 2AN9A 5ER9A 1NV9A 1ZQ1A 4HTFA 2YW2A 4IIHA 3IBGA 4AECA 2Z08A 4F06A 5BR7A 1MHTA 5TARA 5J5CA 2PT5A 4OAOA 4ALNA 2Z5LA 3G2KA 5CH5A 1PV2A 3AEQB 3KR1A 1DJOA 5EZ5A 1O0CA 2H5JA 3KB1A 1LFDB 3BH6A 3H18A 3QA3E 3BB1A 4ZC1A 3MT7A 4RYDA 1X19A 3HB1A 3I64A 3AY7A 1UP6A 2O4CA 2YUTA 3OIDA 4YCJA 3TIXB 1GCGA 2IPOA 3C5VA 5GONF 4F8EA 3KHKA 3R5HA 2QVXX 4WFKA 1IAVA 3NTUA 3WOHA 5J2UA 1KHHA 3MTDA 4WLVA 1E2PA 2ZITA 4RHEA 3D4NA 3MTBA 3SIPA 3UK7A 3PXAA 3OQNA 1MW8X 2C8LA 4GXNA 1CJTC 1KEPA 4INAA 4ND8A 5JS8A 2OXRA 121PA 1GZVA 3VHRA 1Y0BA 3FCYA 4YRMA 5GTDA 4YP9A 3QKUA 3DD5A 6ABPA 4ARZB 2DP4E 1H69A 2VBGA 4MQLA 4F3YA 2ECOA 4DM4A 2HMSA 3I8SA 1U2DA 4PPGA 1Z3CA 5REQA 3HRKA 4YFYA 4OJMX 3S29A 3U37A 1MGOA 1WB6A 1CUJA 1TM3E 4RH0A 3EQ6A 1US8A 3ECSA 4DDUA 5DRYA 4RIGA 4Q37A 2V7QA 3E3LA 3I8OA 2XWQA 3O94A 4HRXA 3EVZA 2NT3A 3Q9SA 3SZMA 3SSAA 4BECA 4ID9A 4ESOA 4WE3A 2GZ2A 3MCWA 3OTHA 4Q24A 3WB9A 4CEIB 4H3KB 5J4HA 1NBMD 3H3XA 4RTQA 5TQ0B 1KDOA 2VHJA 3M2PA 1TRKA 2WV7A 3QPCA 3OEED 5D87A 4ENWA 1IHPA 1F1BA 2O3SA 1TC2A 5CFNA 3BERA 1J9ZA 2ZYHA 1USWA 2VDNB 1D4ZA 2I03A 4AS3A 1IZ7A 1NNSA 1YR9A 1YRHA 1FFSA 4NYIQ 3T3EA 2A9JA 3N8KA 5BO5A 3G2JA 1GFWA 1JHUA 1Q7EA 1PZEA 2VQ3A 4G0OA 4XCQA 3EA4A 5TF0A 3T41A 1J23A 1QZUA 1BXGA 5CAEA 4W5RA 1RRCA 3ZV5A 4CV0A 4DLPA 1V11B 2JFGA 1AO3A 1G18A 1NRWA 4GO1A 1NYTA 4HB2A 4X8LA 2EC5A 3HCFA 4OKSA 4R16A 2G9NA 4P81A 1M5UA 1PHRA 1Z06A 3EWNA 1T2NA 1H2ZA 3Q3VA 1R18A 1WZNA 3U7FB 4TM8A 3DKIA 2XNHA 1FLVA 1W4AA 3ONNA 1KJJA 4KODA 3QE4A 4P2BA 1ELOA 2HLHA 3O9ZA 3QSGA 4ISCA 5HFAA 2GHIA 1FDOA 3I2HA 1DINA 4TRNA 2IIQA 1T0IA 1HLGA 4UEOA 3TL3A 4L6IA 4JK3A 1ODSA 1UJNA 1Z7GA 3LMKA 3GAAA 3K1AB 3DE5X 3QNMA 2FJUA 1NQTA 4V1CA 1NXOA 2WUVA 3VDXA 2LCFA 1CK4A 4Z51A 1MIOB 2NUPA 2C54A 4F38A 1B73A 3UANA 4CLEA 2PUWA 3N2NA 2VNIA 3QKWA 2WILA 5EYPB 4B6SA 3DOCA 3L8EA 3KPUA 4OXNA 1K5DA 4FM9A 1D2MA 4ZV9A 1OY1A 2QTNA 1HKUA 1I8TA 3NRCA 4XRRA 2JGNA 2IC5A 3CC8A 4I4TF 4JFRA 4ZOEA 4Z3DA 2NU8B 2MT9A 1ISPA 4HGOA 2Q9CA 1NX9A 4E88A 3F7OA 2DPGA 4LAFA 1P29A 3SD7A 3KWMA 1UWCA 3CJQA 1MJNA 4M1MA 1BYUA 1PL6A 4WNCA 2C1XA 3CLVA 2Q6OA 1I1NA 4G67A 1MPXA 1L3CA 2ADFA 3H16A 4FQ5A 4Y0VA 4XYMA 5AJWA 2VLBA 3RKSA 4E13A 4PSUA 4UCWA 5CXXA 4A0GA 4CYMA 3SZUA 1QR2A 2A0FA 2A5GA 4RQAA 5BQOA 5HP4A 3IAFA 1DOZA 1Q1ZA 3V6MA 1UBJS 1IPEA 3I76A 4HGZA 4B73A 4MP3A 2FMIA 3QPBA 1U1IA 3IP5A 4DHEA 3AHIA 2OFPA 4O2BA 1G42A 2J9GA 4OTZA 1C7RA 2WVAA 3GDFA 5AXAA 4EUNA 2HJVA 8LDHA 2ZJYA 4O4IB 4QGHA 1AZSC 2CL7X 3LOUA 4LXXA 3WNZA 1UPCA 2GCOB 1YVDA 3NHMA 5FWDA 1B3BA 3CKLA 3VZQA 4Z8YA 3TL6A 4TWIA 4EKDA 5J23A 2J6IA 1XHFA 4C3UA 3OIGA 1MU0A 2PYDA 5I4BA 1KTIA 1UJ5A 2WQ6A 4MX8A 3VPXA 4UTZA 1HDXA 1G1MA 1F6BA 1DU4A 1KAMA 2Z4TA 3Q2KA 4HDOB 2FB9A 2ZPUA 1SXIA 4JJ8A 3A2MA 4BO4A 3L6OO 1VJGA 2R0QC 3IBTA 1RBMA 4A0FA 1QONA 1TNDA 3FGOA 4W9NC 3ESQA 3FJYA 3H5IA 2R8XA 1T2EA 3M5WA 4NZOA 2GS9A 3VR3D 1C4KA 1VYUA 4QPZA 1ZSVA 1CY6A 2EL7A 2HQBA 3AGPA 4KBFA 2WMNB 2X0IA 3CB4A 3HDGA 5BT9A 4NC9A 4PNHA 1E92A 3ZW7A 2H54A 2W6ZA 3F5SA 2HI0A 2EJVA 1U8AA 2GR9A 1Q2UA 1QP8A 3WLEA 2GXQA 1M2JA 1S2LA 4EY8A 1MQAA 2IBSA 4Z9XA 3FTPA 5FTWA 2HUNA 3U4HA 2PL5A 4X54A 4HX2A 5ARDA 1PKXA 3Q4GA 5HIAA 2C2HA 3KETA 2IK8A 1AKQA 2PQ0A 4TRJA 2R1TB 3G0DA 4MUJA 2OCKA 5HF8A 1MRNA 2BHLA 3SU8A 4BMVA 2C57A 2XMZA 4JDUA 5AK4A 3O84A 4M0LA 2RHDA 4XGRA 5IH7A 4P4SB 3B1WA 4OL0A 1KAHA 1UMDA 1SULA 1XPJA 5JNTA 1P4AA 5LC1A 3HH8A 2DERA 3J7AC 3BAFA 2ZE5A 4GLJA 3OQPA 3INGA 5KDDA 3H1PA 3U44A 1G55A 4EZIA 4FHEA 1RLJA 1NA5A 3NX4A 1MX9A 4IJWA 4LHWA 1Z0AA 3CS3A 5AXCA 3ZNQA 3T15A 2CVHA 1DX4A 1JPUA 1XZGA 3QKSB 4PLZA 3U7QB 2ST1A 1IN7A 3LCRA 4Q93A 4X6YA 3SJCA 4GE3A 2XHZA 4F4DA 4LGVA 4B75A 3U7QA 3DE1X 3EZ7A 3ONDA 1YL6A 4IFEA 3L93A 1ZUD1 4DLXA 2CYCA 1GP2A 1SUDA 5JSKA 3GJ6A 3HO1A 1FSGA 4L1KA 3P0EA 1UK7A 4TMVA 4OLFA 1YFKA 3OQHA 4XJTA 1YIDA 1JHZA 2DSNA 2QP3A 2Z98A 3ZDXB 3Q9LA 4G2NA 2D1SA 1FFWA 4INPA 4MWBA 4QXQA 5K6TA 1TRHA 4H6PA 5CA0B 3IIIA 3K15A 2DFVA 1M0SA 1GFSA 1SC6A 2I4LA 3BREA 1DJMA 1NLYA 3E9YA 4F5YA 3LCJA 4QPCA 3ZZ1A 1E2FA 3E3AA 1IWBB 4L5YA 2JFWA 5CX1B 1FRFS 4LMBA 1ISHA 5F77A 2I6XA 1A72A 4CLRB 1H5QA 1TT5B 4BWGA 4D80A 3K4HA 4HS4A 4R8MA 2AN4A 3UZUA 4DANA 3UXYA 1TAGA 3NAZA 4I6GA 2ASEA 2WD9A 3H6GA 4F9FA 1NVGA 4HUQA 4Y9UA 2XXAB 4DMHA 5HRUA 2YNMC 1ENOA 1NLMA 2A4MA 1HSZA 4LBWA 2DBZA 3F6CA 4WX2B 3SBEA 1ZR2A 3MERA 3Q7SA 5DBOA 3TUJC 3N7TA 1CHNA 2IPXA 4YJ2B 1Z6TA 3T1VA 1I7NA 4J16C 2VJYA 1XCMA 3RS5A 3UKOA 4FI3F 4M6WA 3ZEAA 5E0OA 1JPJA 2QEQA 1H2FA 2RJOA 1LS6A 3IV7A 3PDWA 2WWXA 4M36A 5SZKB 3HKCA 3LGSA 3NHBA 2PKEA 1YV9A 3Q6IA 3V4LA 4E7PA 2A3RA 3ZDBA 3L3BA 2EKPA 2CHUA 1O4VA 4GMFA 4KUEA 2XT0A 1ZK3A 3LX5A 4KLNA 3I01A 3QEOA 4JHLA 2WWGA 3LBFA 1ZM3A 2VXCA 3NPAA 1GUZA 4MVXA 3AY3A 2CXPA 3EY4A 3OQMA 1RXWA 3WJAA 1W7AA 4IDPA 2JA2A 4KSBA 2JAHA 3O26A 1GA4A 3PE4A 5K3FA 5BUZA 4EQ6B 3K32A 3VKGA 4TTVA 2XEDA 2HU8A 2FJ0A 4B6RA 1AOXA 2YMMA 4Q82A 4RHYA 3WZLA 2NOAA 4MWGA 2DGDA 2XNCA 2XYGA 4E30A 1YQQA 2XB8A 2HV9A 4B5KA 1BVRA 3L4BA 5ELLA 4LRQA 1DWPA 3T7DA 2A8YA 2WICA 4QDKA 4XQGA 4MR8B 3N6VA 2CJWA 3ZE7A 2K2WA 4I9UA 3EN0A 3U4MA 2DF8A 1AS0A 1PEKE 3PC7A 4PTLA 3JWGA 5GZ6A 4HNVA 5K2OA 1XTVA 3LTNC 3Q3HA 1VPWA 4MUEA 3NVMB 2RB5A 1XCBA 5AJUA 5GJWC 1FZQA 2CCKA 4HNHA 4EARA 1VP9A 1OOEA 2EX1A 2TMGA 3BDVA 3HFGA 2NX2A 5ALDA 4AMBA 1SO8A 3G89A 4V0QA 5ANRB 5EYPA 3VNQA 1HE8B 5DYTA 4BVFA 2F90A 2FPGA 4FK8A 1HE5A 3KU1A 3EIXA 1XEXA 3GNSA 3ZXYA 1DAGA 1DCMA 1Z2NX 2Q2VA 5AUOB 2JLBA 1DWOA 5D01A 5J2UB 4URVR 2A0YA 1U8FO 1L1EA 1XU4A 2BONA 3SF8B 2VTKA 3DOUA 1RXEA 3BPSA 2W58A 4HAXA 4JVNA 5D3QA 3NHKA 1JA1A 5A03A 2BF7A 1U8YA 1XTTA 3EG5A 4X20B 4H4DA 1FXSA 1WKBA 2K5UA 5FBHA 5DGIA 1O57A 4HPXB 4DCVA 4CT4B 1P18A 4I55F 2JIQA 4ZDIA 3U3XA 3LF2A 1U4NA 3EIUA 3BH7A 4J0GA 3WLPA 3EIWA 1ZN9A 1NDHA 5CNKA 1MQSA 5CU7A 2AMYA 1LU9A 3E05A 4KO4S 4C88A 5LNK1 3TW0A 3IYLW 1WDWB 5LBIA 3A70A 4U7PB 1JLLA 3I0MA 4NBLA 3STYA 2P40A 2RBGA 4BQNA 4KC0A 5CB4F 1TB4A 1C8LA 4KWHA 4AS1A 1FVHA 2EJTA 1Z2PX 2D5AA 2XXBA 1GTZA 1Q83A 1QS0A 1QWSA 1WHSB 2WKRA 1YK1A 3EOAI 2ONZA 4JITA 1BKDR 3AINA 4LDZA 1SU7A 3OAAA 1PR0A 1JRLA 3EVGA 3TX6A 5KVAA 1H4QA 4E31A 4QEDA 1PO7A 4ZEWA 2VO1A 5K0NA 3ZYCA 1C3VA 5JV5A 3QMMA 1ZN7A 2BVNA 2DUUA 1OU0A 2ZI5A 3O2QB 4FMCB 3W5SA 3ZZUA 4Y2RA 4E2ZA 5HM8A 2O1WA 1N75A 2Q4DA 1SBNE 4FYYA 1Z4PX 2QW0X 4FSHA 3LC2O 3ZHQA 3HK2A 4QYIA 2Y6VA 3PT9A 2ZETA 3W9UA 3BTUA 3CLHA 4HS9A 1KERA 3KVVA 1M8KA 1O97C 1S2NA 2JKZA 4ZDJA 1GTVA 5E4YA 5CDGA 2O4UX 1YZ3A 3KP1A 2ZI3A 2JCBA 1KMIY 3ILYA 3N59A 4D6YA 1OE0A 2YMQA 3GGPA 3P0RA 5HS4A 4P5EA 1E1CA 4JLMA 4S1NA 4OI1A 1TJNA 2IYSA 3HCNA 4XUEA 1U90A 3AEYA 2GNOA 2H17A 2UUOA 2YBEA 3VTKA 4I4CA 2VHVA 3OZTA 3GF4A 3GEEA 3LFUA 4PRYA 5CVDA 2GPTA 3BJEA 2FEAA 3EEYA 3UC5A 1A8HA 2VHZA 4KXFB 5H3LA 4ZJPA 1W2WB 3DO6A 3G2MA 4XCVA 2KMLA 4IOKA 3PEUA 4R9SA 5FNVB 3RRZA 3T35A 4YP6A 3VYVA 4O1MA 1QFMA 4DLKA 3FCXA 4N76A 3EUWA 2W2LA 4RVFA 1R6UA 3C3JA 3TTVA 4GQIA 3BILA 1KZ4A 5IASA 4MRMB 4BLSA 1JE1A 1QKKA 1UWLA 5BUCA 1CUZA 2JFYA 2HKIA 2REXB 2D4AA 4PFSA 3BFVA 1Z2CA 2J7PD 2PK3A 4OD0A 4D0RA 2SNIE 5K8CA 1VLVA 1DRJA 4S2EA 5JMPA 4LJ7A 1YVPA 1GLVA 1SHUX 3ETLA 3JZFA 1FSSA 4PSDA 1RC8A 4BMDA 3EXEB 4YO8A 3HA7A 1ZBDA 3HRIA 3OFNA 5IVDA 5JARA 2P62A 3PG5A 2OQ2A 3QU4A 5IJWA 3AVQA 4MEBA 3CWCA 4N5LA 4YJDA 2DBRA 3L43A 1A7KA 3S81A 4N0DA 4NHOA 3RG2A 2NAFA 1M1UA 2PAFA 3IT0A 3PZBA 5FLKA 4D3YA 1H2HA 1H8EA 2H4ZA 3IEXA 3QHQA 4OHRA 1H1LA 1OBVA 1Z0KA 1L4FA 2O2SA 1U0JA 4AKHA 4RIEA 2JHAA 3ZDZB 1IMJA 4UNIA 5B6JA 1ZQ9A 3TB4A 3OO1A 1E6CA 1MX3A 1RI3A 2QTCA 5H02A 4NNPA 3RYFB 4EJFA 2F55A 4G1BA 1UFKA 2QX4A 5K99A 3X1WA 3NBMA 1CIJA 2FQQA 2JEZA 3HBJA 4FNMA 1NVVR 2NZWA 2F9FA 4G8JA 2HBQA 4RCVA 3SZ3A 5JYDA 1A5BB 3IUNA 5L3QB 1FVOA 1BXKA 3BRQA 4B3MB 3MB5A 3KC2A 4ZRDA 3CNLA 4H7FA 2P2SA 2GSDA 3A4VA 5A9SA 5HTOA 2H92A 3WLKX 4B4DA 4DIOA 2VHXA 4LF7B 4IUCS 4LZJA 3A1EA 1P2GA 4ER3A 3OHPA 5HTKA 1FTYA 2AH5A 2BFEA 2B7LA 2HHLA 3QLVC 4IGIA 3A1WA 1MEOA 1Z37A 1XRNA 2JIMA 4TVBA 4EYKA 4JQCA 1R37A 2GN9A 2HEIA 3N2IA 4HXYA 1M1XB 4L95C 3WS7A 2J3KA 2HPHA 4BNFA 2O3RA 4BMNA 1Y8CA 5ARBA 2G9VA 1VHJA 4LMAA 4XWWA 5MFZA 2BMJA 4N5MA 3A06A 2DHQA 4FQ8A 5DT9A 1V3VA 3H8WA 2QM0A 2VT2A 1IZ9A 1FFGA 1X13A 1E5VA 4QL3A 4XX0B 1PT8A 2YC2C 3PJFA 4C6HA 1YULA 1BEUB 2OXTA 1P61B 1V3QE 3BN3A 3GDGA 3INRA 3R6DA 1NUHA 4QLOA 2JGFA 1JVNA 3MIZA 3WRVA 1Y1LA 4DMGA 3U80A 3EPLA 1I7QB 4BZZA 1YCHA 3IURA 3DKVA 3BTVA 1N2GA 5A7GA 3FSRA 2NNLD 2QVGA 3AIIA 2CXHA 3U3RA 1EDEA 3G2IA 1JMKC 3MSXA 3EIOA 1T8TA 1NPYA 1Z0DA 5EJMA 5TQ2A 4EJ2A 2P3QA 5JECA 2ZK7A 2ZJOA 4K9DA 3TUZC 3K35A 3PCTA 1JZQA 4KGZA 1L7RA 1RQ2A 1WHTB 2ECKA 1YR6A 3ZDEA 1K89A 2GAFA 3C6ZA 2YDXA 4Q1CA 3SX2A 3BX1A 1D1SA 2AK2A 2CXNA 1QE0A 3I2JA 3JVUA 3I3OA 3TS1A 3TVDA 3VJMA 4LDPA 3NUZA 3OTQA 3MUEA 3TPFA 3FAZA 2OBXA 3MM4A 4FT4A 2JVIA 4RHXA 2VP4A 3L8HA 3P27A 3S2UA 3UFXA 5JXJA 1UMBA 2NUTB 5JDCA 1XZJA 1UXKA 4D8YA 4NU0A 4FMBB 5KVVA 2VHYA 1JG2A 1N25A 4H7HA 5A4AA 3BIFA 3EGOA 3SZOA 2R65A 1QG2A 1POWA 1R74A 3C45A 1SKMA 3FLMA 3PXBA 1DKQA 2EW8A 4G26A 3O93A 4NY1A 3GP5A 3GR6A 4GEGA 5BSWA 1A8QA 4CKCB 3KQHA 5C2JB 3DE2X 3BICA 5ED0A 3VRHA 3HLYA 4B34A 4CMKA 4KR2A 4I66A 4B31A 4ZAXA 4HO1X 4PWYA 2YJGA 3PPVA 2FWIA 5EERA 2WF5A 2P79A 3RROA 3M4NA 3RYIA 2WUDA 1G8PA 1M2EA 3OZSA 1XBTA 3DVRX 2XVZA 2B4YA 2NN3C 5B4UA 6REQB 3ZV6A 3CXRA 3LWZA 1SXQA 5IW8A 4KXXA 4H6XA 4J29A 1U4SA 1M34E 1EA7A 2CEKA 3FOBA 3DQQA 3OURA 3QEJA 4DLWA 3A6KA 3W5UA 2NO7A 2OD7A 4IS2A 3REOA 1BCRB 3GMIA 4O2RA 1T9KA 5IYZF 3QU9A 2G9QA 2FSHA 4Q0MA 4CR7A 1UDCA 4FYVA 5EXXA 2H63A 4B84A 4F5WA 3PPYA 2WKWA 1TPZA 3MD0A 3ZZTA 4KGXA 4DKJA 4BP9A 2QRLA 3BXGA 1T6NA 3WO1A 5AVQA 4JC8A 3OF3A 1G3UA 1YE3A 5JXIA 1RNLA 3AXTA 1NF8A 3EOBI 1GA6A 4C2BA 1XQ6A 2VCHA 2X5JO 4IDDA 1LDMA 1M2GA 1S3IA 2ZSAA 3DXZA 4QYMA 4AJEA 4MAMA 3S28A 3LZCA 3TZCA 4LFCB 4GI2A 1Z26A 3JYLA 2VDKB 3IXLA 1G5HA 1I2CA 2Y67A 2B8NA 3RSHA 2Z5VA 4MW1A 2IPMA 4GFDA 5BR1A 3HNPA 2W2XA 2YJ6A 2JRLA 4YJ2F 1G5QA 4QVIA 2Q1YA 3LQKA 2D2EA 2AKAB 5A02A 5JHGB 1UFRA 4ECAA 5I5EA 2RARA 4KE6A 4US2R 5KVCA 2EFGA 3HVKA 3KKZA 4BP3A 1F4LA 2ZBEA 2C77A 4PGGA 2V7UA 3BFXA 1H9CA 5EWLA 5B4VA 2NTEA 5JH7F 3QBEA 3HP4A 1G6OA 2WM9B 2CVZA 4XEUA 4B7UA 2IUFA 4AULA 3HQ4O 2SCUA 3R0ZA 2YZ7A 2A7QA 1SZJG 3LUPA 3MTEA 3JQQA 3GUVA 5ITZA 4YPFA 3BJZA 5JY1A 4TZ0A 4RS3A 3I39X 4HHEA 4WBNB 2PFSA 5D7BA 2BGJA 1WXQA 1ZZEA 2IIBA 1YC2A 1CUBA 1XZIA 1GRRA 1WA5A 1WHSA 2HK9A 4OQLA 4P3YA 4DWJA 2D1FA 4KR6A 1J7KA 5DHPA 4CCYA 1CEYA 2B30A 3WK8A 4DM3A 2JGKA 1KAGA 2AXQA 3F98A 4RU1A 3A9CA 1E2JA 1T3LA 4B4KA 1CC1S 1DEOA 4M0UA 5B53A 2WNIA 5KTMA 2AK3A 4Z99A 2FPKA 2PGXA 7GPBA 1GPKA 2HWWA 3NBUA 1OFVA 2QL5A 4S05A 1A4UA 1P7ZA 2GKSA 2WJHA 5DCUA 1PR9A 2ODBA 3F3MA 2ODNA 4Q3DA 2GBPA 3JARB 1UQTA 3G6WA 3RS3A 3CB2A 4BZPA 3AIMA 3ESCA 4J1SA 3PQ7A 1N6RA 5C1OA 5JI3E 1W34A 2Q1XA 2VRCD 1EZZA 1QK3A 2NMVA 1HV8A 1WDLA 2ZJAA 2Z43A 4A1OA 4KR3A 1TMGE 1TC1A 3QBTA 2EHJA 1T2DA 4KIJA 1XMXA 3G0GA 3TJZA 3Q7RA 2DR3A 2GQ0A 4C3ZA 3OKAA 5DHRA 4B4OA 3Q10A 1U9IA 2R8OA 5B3JC 4DEXA 1P5FA 1G2IA 2CF6A 2ERXA 2DRIA 2ZYAA 2QZSA 3GLRA 3NATA 2E1PA 3OD1A 4PGMA 5FPYA 5TQ0A 4GM1A 1V7ZA 2ZT8A 4GP6A 5HKAA 1CLUA 2EYQA 4N5NA 3P52A 4C30A 4OMUA 1S96A 3B9QA 4OP1A 4BMXA 4DNPA 3E1SA 1YUNA 1ZEMA 1Q74A 4KPFC 1KYYA 1TXGA 1LNQA 2A9PA 5KJFA 1EKXA 5F64A 4WCVA 3BD7A 3KT6A 3PHCA 4AZWA 4C4TA 1Q7BA 2O8CA 1LF0A 3JQ7B 4N9WA 1CJBA 1O89A 4Z7JA 4F9GA 4ZCQA 5K3SA 3IVXA 3ZE1B 2QJWA 4PG6A 1ULBA 4BYGA 2F43B 1U7TA 1OAOC 2FF5A 1E0DA 2J30A 4PLFA 2HPVA 4Q12A 3EVTA 2O2GA 1QANA 5FI3A 2BBOA 1U0NA 5DM1A 4MDYA 3KM0A 4ND3A 4XUGB 4N47A 3MCAA 4RTMA 2BKXA 2I66A 1ODLA 3Q11A 5AYVA 4V24A 2ONCA 3B6KA 1Q7GA 5SYAA 1SVWA 3A32A 3ORHA 3DO5A 2EW2A 1XDBA 2R4UA 4HRAA 5I7HA 1E5DA 3OI7A 3TM5A 1KSJA 1YAJA 3JWIA 3PC6A 3QQPA 3B8HA 1GR1A 4M0KA 3UM9A 4OJNA 1YNSA 2F1RA 2ZB4A 3SQOA 5IK2A 2HJSA 2X22A 3ZWDA 1QFZA 1RJ9B 5EP2A 1D1TA 5JT1A 1ZJ5A 1O6BA 2W8ZA 5JVDB 4ML3A 5EG5A 5HBRA 3CZMA 3VM6A 3BMCA 5K6AA 1C8BA 3KYJB 1R8SA 5JXWA 3X3HA 1R15A 1IJEA 1T5BA 5I4IA 2OMKA 3HDTA 1IRIA 1ZK4A 2HCRA 2YOGA 1II9A 3CXUA 1KK2A 4GYYA 1C3JA 4JQZA 2Z8XA 1I36A 2HEGA 3L9XA 4Q66C 3S70A 3NDPA 4MI3A 2BYTA 1KRHA 3SC3A 1H1DA 1GUYA 3AJEA 3N0XA 3RVLA 4BJ5A 1K7CA 3OE5A 3OF5A 1MA0A 2FPIB 3W9BA 3LA6A 3RF6A 1VL6A 1ORHA 4RV5A 3R23A 2DB3A 8OHMA 1M1YA 4MW7A 4CQMD 2M6KA 3RHZA 1NMQA 3RYCA 2WD8A 3A2NA 2GK6A 2IYLD 5E1BA 4C08A 1ODCA 3FI9A 5F51A 5DNCA 1VLHA 2CBGA 3F6BX 3DEZA 3LQFA 4GH5A 5LXTA 2NUAA 1R4MA 1SKYB 2C2KA 3N2GB 2EX4A 3M2TA 1V5WA 3RLFA 2B4KA 3I28A 1G6KA 3UJPA 5J1SB 3C5WP 4DR1B 1BMDA 1Z15A 1MJ5A 4HH4A 4HCJA 3L7LA 4MYCA 2OBNA 2J08A 3R7LA 5CDHA 1DKPA 1YZVA 4L4YA 3ILVA 1F2DA 3JATA 4OG2A 2BSQA 1KQGA 2CDAA 1QYCA 4WV3A 3U7RA 1W88A 1E1RD 1QG0A 1ZMTA 3DL2A 4GS5A 2P1DA 3H2SA 3Q8LA 4G0WA 3ZU6A 2Q07A 2Q6VA 4Q7MB 3WV5A 3BXZA 1XU7A 2CJFA 3PPWA 4KE7A 4NHEA 5IXJA 1JHAA 1GN9A 2AZ4A 4GRAA 1ETUA 4EUHA 2JI8A 2JATA 4FR5A 4U7JA 4HNUA 3NBYC 1KKLA 1V1JA 2QXYA 5FI5A 4JJZA 5KC8A 1DNPA 1EFCA 1RYEA 2X2FA 1K6JA 4LVNA 2RIPA 5AM4A 3E0QA 3K9NA 5KYWA 4F93B 5EIXA 4CFZA 3TRJA 2Q4RA 5F4BA 3BXEA 3S2GA 1RLOA 3HM9A 3RS9A 1QTQA 4G23A 4XE5A 1NI4A 5M3BA 3FPKA 4DV4B 1A2KC 1DKNA 2HA5A 3GW8A 1K6IA 3GLHB 3LQYA 4G37A 3BRWA 4ZI7B 2IHYA 1YK0A 3GLTA 1PFWA 1FFAA 1TQ2A 2F3TA 2P5TB 2R44A 3EXHB 1JHMA 5IP5A 1N32B 3TXAA 3PGVA 1RAAA 4KP7A 1PSDA 3WGQA 4DCUA 1UQRA 4YRQA 4AZ0A 4YV1A 1ZOOA 4BTVA 3UJNA 4K28A 5A06A 4RD0A 4J75A 3DAOA 4WBSA 4IIDA 4DR3B 4I55B 1DAPA 3D4IA 1RM4A 2REQB 5ALMA 4IWNA 4PS1A 4BFWA 5E95A 4PTZA 5B36A 4RIIA 5LU9A 2WFLA 1PBNA 4KQMA 1O5TA 2ZPTX 1M6WA 1U98A 1XQVA 2QG6A 1EWVA 4OOFA 1PJAA 4H7DA 4RMHA 3ZDQA 4M86A 5JO0A 5KVSA 4F85A 4OFXA 5SY9A 1UDXA 1K3UB 2YV1A 2PU5A 3VH2A 1VE9A 3CH4B 5LOVF 1L5YA 3SJZA 4HGRA 4JLNA 3GLFE 2FMTA 3D8RA 1BDJA 3IAM1 1XAIA 3KAPA 3WLLA 5LMZA 2GA8A 1GVHA 5F3WB 1JNXX 1X9GA 5P8WA 4S0ZA 4CEIA 3HHEA 1WCWA 2AA3A 3FDJA 3KVYA 4GPEA 1KF0A 4M1SA 1FTQA 4PCUA 4UBNA 1U8EA 3B52X 4Q7KA 1BC5A 1YB7A 3VU3A 1TD1A 2XUAA 3TKYA 2DHCA 1C80A 3R24A 1T1EA 4DJEC 1DEHA 2E4YA 4JLPA 1C1HA 1N2OA 3AUUA 3RBAA 5K3DA 5DYNA 4BKQA 5AW6A 1I2ZA 1Y6RA 2IP2A 1JI0A 3LPAA 4GNKA 5CW1A 5TIIA 5JMWA 2FSUA 1TUBA 2FZEA 3D5EA 2RHMA 2OUKA 1ZS9A 2AN5A 2H9AA 2WQZA 4X0EA 4G81A 3OKFA 5GP1A 4D41A 3IP6A 1COWD 1YI1A 3HI4A 5BSKA 2PZAA 2QX6A 4AM8A 2ODTX 3W9SA 4L4ZA 1SG9A 1Y5MA 4HATA 4YREA 1O87A 3D4OA 3G49A 4DA0A 4TWJA 2ZSKA 3PQ4A 4JP8A 4MIKA 1CQXA 4WLEA 4E1VA 1GDHA 5EXSA 1CEQA 4KLCA 4X7BA 1YB2A 3HB7A 1AQJA 4LEIA 1F38A 2XIQA 3VXKA 1ZJJA 1VI6A 2PZKA 4M22A 4NK5A 3D6MA 3WK6A 1TDJA 1XYYA 1WY7A 3D3WA 4IGKA 3W7BA 1G8JA 2WYOA 3D3QA 4KDCA 3N8GA 3A4TA 4YCLA 1VCIA 2G1UA 1SZDA 4NPAA 1F9AA 4ZHQB 1DWQA 5LQRA 5THQA 3T34A 3WGLA 1HK7A 3MA0A 3C97A 3NV9A 2P9EA 3OZVA 4DCMA 4IILA 2V65A 1N3BA 4I6JA 1KYTA 5EMJA 3STTA 4CMHA 5KDOA 4AY6A 3D8HA 4W82A 5A05A 3UCEA 1SWVA 4RDIA 4MW2A 1NVKA 1R0WA 4UUNA 4RSMA 1VLMA 3AEZA 1MRZA 4KAAA 1VHWA 4J90A 4TYYA 1GQOA 1QOZA 3C3DA 4Q3CA 5IC5A 5IJ9A 3OQBA 3ZH2A 2WTAA 2BN4A 3AKEA 4AXBA 5CFQA 2R8YA 1TVKA 5FWXB 3FA2A 1FP7A 4JQOA 4MPTA 1ARZA 6CHYA 4EYQA 2OGZA 3TZBA 3F3SA 1FVFA 2DFNA 3RAGA 4LNAA 3HY4A 2C84A 2P6UA 2B35A 2GF9A 4O5OA 2W2NA 1SMKA 2PNJA 2EBWA 4UAVA 2DYKA 1IATA 3HM2A 4NMWA 4TT3D 3ES9A 4V39A 2CUKA 3UPTA 3INNA 3O73A 4RFLA 3NYIA 2VWGA 3G02A 3F67A 5BV0A 3AM1A 1R8XA 4A10A 2WWWA 3B6MA 5HCUA 4DQ0A 3WLMA 2HU7A 4EUKA 3MCTA 1DBRA 1NJSA 1GTRA 1RE0A 5TDHA 3X1XA 5F2NA 1HNNA 4PNPA 1HE1C 4FT2A 4WK0B 4GLFA 5ADUS 2X77A 2PT6A 2GDZA 4CLDA 4YR7A 4CT0A 5C46F 3M6LA 3TLEA 2QTWB 2IXAA 4LBYA 4B6EA 3ZJ5A 1RC0A 2VYQA 4ARZA 4OIMA 2EG5A 4BN0A 1QTRA 1YL7A 4W7IA 2ZREA 2JGJA 4W8GA 4B9AA 2IP1A 2XCIA 4QBGB 5AOVA 1KIFA 1UKYA 3UHPA 1OXKB 3VMMA 1AKMA 1M0TA 3RQIA 3HYRA 1WTCA 1U02A 4G1VA 2JGAA 5FT9A 1LV7A 4WXPA 3QUCA 4RZIA 2H7YA 4Z4CA 2Y1OA 1FNDA 1XYGA 5KTPA 5C4MA 2CJPA 3F0TA 1Y3AA 1HT1E 1UANA 1NN3A 3O4JA 4U2FA 1MNQA 3U7EB 4ASUD 2FLVA 2AFIB 3KPVA 1K66A 1ZXBA 3JVDA 3ZVRA 5ELXA 4DQXA 2PE5A 3O4FA 5DVZA 3QW4B 5I7AA 5ESXA 3KCNA 5DN6A 2ZTUA 4AT1A 2DTDA 4G1FA 1ZCJA 2HPZA 4CF5A 3H5TA 1TLLA 1BHO1 1LJ8A 2D5LA 4OMFG 4Y30A 5K0FA 1N6OA 2XV1A 3E9NA 3WFJA 4FC7A 4F0JA 4QRHA 1GL3A 1EWQA 1DGQA 3AVVA 2HXSA 5DYYA 2M6RA 1JHVA 3F74A 2RHWA 1PGQA 3BTSA 4PAMA 2OGSA 1KOLA 3DZGA 3FYUB 1O95C 2P9TA 1I01A 4Z3OA 4K1XA 3MJDA 3QHAA 4DCTA 2FW7A 2GN4A 2OPBA 2YINC 3A6GA 3GHYA 3LOPA 5E0KB 2OHFA 4W5JA 5IM4F 3MJSA 1Y7IA 1XI2A 4LF9B 4S1VA 3I37X 1I7SB 2AW5A 2CXUA 2Y66A 3OSUA 3OKCA 3RRBA 1R5BA 4ZP1A 5HWSA 1IOWA 1JEYA 1RZUA 2DWPA 2GF0A 1WLSA 4IFIA 4L8FA 1NXVA 1LUAA 1ZH4A 5IDQA 2IGTA 4HSGA 2Y27A 3BC1A 3GNLA 4MLPA 1KJIA 2OCLA 1X8XA 1ZH8A 1OASA 3NH9A 3WRXA 4TLDA 1W36D 5HR5A 1YBFA 2X9VA 5MFPA 3PJDA 4FX2A 4OX9B 2BC9A 5E7JA 1EVEA 1P60A 1KMNA 3P9KA 1E1QD 3T7AA 2P4UA 4A36A 4RENA 5AW1A 4MDEA 3WNQA 3DHEA 5L4NA 5IAOA 2BMDA 3BMCB 4J94A 4XM2A 3DO8A 4KG7A 2HHAA 1IDN1 1V8BA 3I01M 4H3HB 1LBTA 1XALA 1SXHA 4WKCA 4XPIB 4IMRA 3SSNA 1GRQA 3WL4A 1NDUA 2WPDD 5JASA 3DPSA 4EAAA 4Y1GA 1OX4A 1EFRA 1AKUA 2BZGA 2GUGA 2GA9A 3BXPA 5E9JA 2BM1A 5U9CA 1NMEA 2J7PA 4G4SP 1QG4A 1NI4B 2J48A 5JLJA 4EHDA 1BJRE 3P8ZA 1JG3A 2BCEA 1PQ4A 4OLJA 1OFIA 5DASA 3BE8A 1V16A 2IHZA 2CNKA 4Y2HA 5WRFA 3IR6A 3W4IA 3KELA 4R1MA 3GLHA 1QV9A 5CA0A 1JEQA 4RDCA 1PEYA 5AHRA 3QVLA 3BT7A 2CL6X 2HQOA 3VHXA 3VNAA 1EK2A 5KWVA 1PKEA 1NATA 1SU4A 1VQ1A 1KBQA 3UJBA 4HX9A 1MC1A 3CMCO 1WMEA 2ECPA 3IDZA 5I7RA 2PZBA 3AONB 1NXQA 2AR9A 2HDNB 1NWCA 5TS2A 1QVAA 4XR4A 3WL3A 4BY9E 1XQ1A 4NP6A 1CCWA 3GZ4A 1OA1A 4L50A 3RFFA 4LRTB 4CETA 2YTZA 3FPFA 3SBDA 4ZYLA 4N01A 1BHQ1 1GZDA 2E4ZA 2VI5A 3WLNA 1G6Q1 4B1FA 3QKSA 4CKWA 5DM60 2UYOA 3WADA 1OI7A 5JSZA 3ZBQA 4BASA 2FWJA 2R00A 1K0UA 4DPKA 2WM3A 1KFJB 2FE1A 1LNZA 2QUKA 4HZGA 3PTAA 4DT1A 4CDRA 5BVHA 2QYHA 1H8HA 3BD9A 3WLTA 4D98A 3KJGA 2Q49A 3GCWA 2AR0A 1XCPA 3OWOA 1GZHB 2LIVA 2I2FA 5AVKA 1UBLS 4LJ8A 4C6TB 3C0KA 2IQ5A 1EVZA 3JQDA 4HDKB 3WRWA 2IVZA 1TZ2A 2R1TA 5DEIA 4CTNA 1QIJA 4QBIA 4HZIA 4BGIA 3D8NA 2H7VA 4C7XA 1S8OA 5F21A 4HYTA 3V7FA 4JIMA 2GCEA 4D4GA 2HMWA 4C06A 1W5BA 4R3UC 1R66A 2GMWA 2WJZB 4XUCA 3SDSA 1QSGA 1YL5A 3GLIE 2QMQA 2I4RA 1ZGGA 3R0XA 4KIWA 2G1KA 4QDXA 3TOVA 4EHBA 3BCHA 3P26A 4FXPA 4EH1A 4RTPA 3TO5A 4CL3A 5ECGC 3PDIB 1IEVA 2QVBA 4RZ3A 1MJFA 3F49S 3EWIA 4E11A 1F06A 5LQMA 1AB5A 4G85A 5D84A 1M72A 2JW5A 1R4NB 3F9RA 2OMEA 1PDWA 2O07A 2HRBA 5C8VA 2PUCA 2OV2A 4CKBB 4BQSA 5EE1A 4II7A 4L16A 2PX2A 3V34A 3HJGA 4I99A 4UHKA 1UPAA 2C5BA 3VO8A 3IQIX 4C03A 3L6EA 5KTOA 1VRCA 4OK3A 3HC7A 3UMVA 1E9DA 4RF2A 3F1LA 4UBOA 3UXEA 1TM5E 2GVZC 3IHKA 4I7EA 4C7OB 4G9EA 4FHDA 4Q16A 4KV9A 4B17A 2W48A 4RTOA 4GKVA 4UU1A 5FA5A 2WZBA 1QRRA 3COVA 4AKTA 2Z9BA 3V4ZA 1CLEA 2Q4BA 1RI5A 1JEJA 1ZRNA 2XVAA 3OG9A 4FC6A 5HQJA 5I8ZA 2OPHA 4DLAA 3TXXA 1K5GA 4JU8A 3TSZA 1RAFA 2VH5R 2ZYRA 4JX8A 4D3ZA 5F1KA 1TGYA 2VSYA 4JNCA 4YCNA 4Y1RB 2UVDA 5MGNA 3VNUA 2BI8A 5FHRA 1WMBA 3KYDB 3TQIA 2WSMA 5HK8A 3PBKA 1XXHB 4X3PA 4KQ9A 5CLFA 5K45A 1Z5PA 1KI2A 3I62A 4Q5IA 3BE4A 3HS3A 1XKQA 3QOXA 1WUTA 2IYEA 2D6FA 4AUMA 1E1KA 1P77A 3O2NA 1PL8A 3OLVA 4IQ4A 4OJKA 1HURA 5KYVA 3X0DA 4ZI7F 2MR5A 5G4KB 3KYIB 2F3QA 5COBA 5JVDF 1FMFA 1KYVA 4G63A 3W8DA 1EX6A 1TYAE 3QXSA 2VJKA 2Z5FA 2WC1A 2LCQA 4BO2A 2AFHA 3CSDA 5BN5A 2BTQA 3GN2A 4P38A 1DIAA 3KQMA 4C0KA 5G02A 3SLGA 4DAEA 5TV2A 5EJ9A 3O1IC 4NXNB 3NHZA 1P33A 2FPMA 1QU2A 2LKCA 1IRXA 1CV2A 1ULAA 3CZ9A 1NKVA 1AF4A 4JR2A 4LJAA 4ZQCB 4C4OA 4J2HA 4OFWA 1X87A 2HO5A 2HSDA 1NVDA 2VAMA 3K73O 5CVVA 1TU0A 3EDYA 1XJ5A 4PO3X 2I4TA 3I4CA 3RVBA 3Q40A 1XRMA 1K06A 3V8RA 1FIUA 1XZBA 2XMQA 4ZOBA 7YASA 5LM3A 1QP4A 3AM5A 4X91A 4R2LA 3KEGA 3VZCA 5KSWB 4YLEA 2X76A 5DBIA 2A9KA 3VA7A 4KIGA 4LJRA 1R64A 2QF7A 1E1YA 1GRCA 2ZRFA 4DLZA 1F0PA 2E48A 3T5TA 5DTEA 2V7BA 1UBFA 1UEXC 3O8OA 1OROA 3WP1B 4HX5A 4RE5A 1CUYA 2BMAA 3CLSC 3MILA 2GAAA 1E3DA 2Y0DA 3D2LA 4KJZA 5FBQB 2GBIA 4ZCMA 5JSFA 2XW6A 4G9GA 2BCJQ 2EGUA 5ALNA 1XA3A 2ZIXB 4FFSA 2RGXA 5BN4B 3N74A 5T8KC 3MGBA 4ATNA 4CI9A 5L4SA 4PNZA 3LNTA 1O96B 1TEHA 2V1UA 1MAUA 1PE0A 3UYKA 1G6HA 5A3VA 5A62A 3Q15C 4YAEA 3WIOA 3RBZA 3PDCA 5ITZB 5L8VA 3NHAA 3T3HA 1V6SA 2V3WA 3K6SB 1BTOA 2BGRA 4BEBA 4PPFA 1HTTA 3R3JA 2ATEA 4WW0A 1PGOA 5G41A 5T41A 3T7JA 3CIFA 3RWMB 3E53A 1VBKA 3WLQA 1NJ6A 2I2BA 4O4JF 4P7GA 4RUKA 5AW5A 4DGSA 1J8FA 5B6PA 4QGAA 1IQPA 1ZLYA