3K2QA

Crystal structure of pyrophosphate-dependent phosphofructokinase from marinobacter aquaeolei, northeast structural genomics consortium target mqr88
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
418
structure length
392
Chain Sequence
IKNAFYAQSGGVTAVINASACGVIQTARKHPDQIGKVYAGRNGIIGALKEELIDTSLESDDAIQALIHTPGGAFGSCRYKREYERLIEVFRAHDIGYFFYNGGGDSQDTAYKVSQLADRMGYPITCIGVPKTVDNDLPFTDCCPGFGSVAKYIATSTLEASLDIKSMCETSTKVFILEVMGRHAGWIAAAGGLAGQSEGEPPHVILFPEIPFNREKFLERVDQCVRDYGYCVVVASEGAQYERFGVAPALANMVKQALGHKYHWAVADYLQRAARHIASATDVEQAYAVGKAAVEMALAGKQALMPTIVRDQAKPYRWSIGEANLSEVANQEKKMPIHYITDNGFGITQDCRDYLQPLIAGESFPPFDDGLPRVAKLKNQLVEKKLRTEFEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Pyrophosphate-dependent phosphofructokinase from Marinobacter aquaeolei, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET MqR88
rcsb
source organism Marinobacter aquaeolei vt8
molecule tags Transferase
molecule keywords Pyrophosphate-dependent phosphofructokinase
total genus 134
structure length 392
sequence length 418
chains with identical sequence B, C
ec nomenclature ec 2.7.1.90: Diphosphate--fructose-6-phosphate 1-phosphotransferase.
pdb deposition date 2009-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00365 PFK Phosphofructokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3k2qA01
3.40.50.460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3k2qA02
3O8LA 2F48A 2PMBA 2F2TA 3O8OB 1WEHA 2F67A 2Q4OA 3EHDA 4KXLA 2Q4DA 5AJUA 4LJKA 3O8OA 1S2IA 3QUAA 4MEJA 3BQ9A 4FYHA 3PFKA 2IZ6A 1PFKA 4KXNA 4JENA 3MAJA 4LJRA 4WL0A 3SBXA 1YDHA 1F8XA 1ZXXA 4NPAA 3K2QA 2IZ5A 2NX2A 4P5DA 4OHBA 4KXMA 1MTOA 4MCJA 1F8YA 2HIGA 3HNOA 2IZ7A 1S2GA 1WEKA 2F64A 2KLHA 4FYIA 4FYKA 3GH1A 1S2DA 1RCUA 6PFKA 4JEMA 4I4IA 1KZHA 4I36A 4A3SA 2F62A 4RH3A 4OHRA 5AJTA 5ITSA 3UQZA 3O8NA 3OPYB 3U39A 4HX9A 3OPYA 4LJLA 3F5MA 2A33A 2A0KA 1T35A 1S3FA 4PFKA 4JELA 2PFKA 1S2LA 3IMKA 4P5EA 4U1RA 4I7EA 2KHZA
chains in the Genus database with same CATH superfamily
1V7CA 1NBAA 3N28A 5EIBC 4E4TA 4F3RA 1V1RB 2G5TA 2O57A 2PG3A 4QEZA 1WP9A 1U90A 3JQAB 3KJQA 5KTRA 2C07A 4CM1A 4E3ZA 1N2SA 4HWRA 4WXMA 4OOFA 4UTNA 3SU8A 1CJSA 1L4NA 2R6AA 1CNFA 2GEKA 3BD7A 3O90A 3I9FA 4IHAA 4B4VA 4EPVA 2GCGA 5G40A 4HVCA 1H0KA 1WDWB 5JJIA 5I9LA 2XB8A 3A7DA 1SUIA 1CUSA 5FRDA 1I36A 5K45A 2D5CA 4QYXA 2O0LA 3IT3A 1W4ZA 1QBGA 5AVWA 2NO1A 5K09A 4Z54A 3MWDA 1FVFA 1N2HA 1I7DA 1BQ4A 1PZEA 1EUDB 5G0WA 1N1EA 2NU9A 4WZBE 1R6AA 4G8JA 1Q1ZA 3BGWA 2YZKA 1UBJS 4JLMA 2QM7A 5ECYA 5IJXA 3MGGA 3I1YA 2JCGA 4J3NA 1Z5GA 3SIRA 4BIIA 5IXJA 2DHDA 2WHRA 3DB1A 2BL4A 1A9OA 3ANTA 3GWZA 3K70D 4X92A 3NYQA 1PZFA 1Z6ZA 5LIPA 4EO4A 3EYAA 3MGCA 4YCSA 4CQLB 1PZHA 2OCIA 1DRVA 4CF3A 2PL3A 1RIIA 2J8ZA 2VBCA 2P90A 1J90A 3ASZA 3D81A 1PS9A 3KSDO 4RPIA 4ZDJA 4KN5A 4AY4A 2LE0A 1EDDA 4OJYA 3AZPA 3U7IA 4ND6A 2OUKA 4PZYA 4EF5A 2G6BA 2OCPA 1X9HA 4RVCA 3ZY3A 4TPKA 4OHBA 3NNSA 4W8OA 4YQFA 5JFGA 3U4MA 3INTA 2ERXA 5T3YA 4EKDA 2LR0A 1KVQA 4PR0A 5MHTA 5K51A 4FJ0A 3K9WA 4KQ2A 4LXUA 1ETHA 3W1VA 4NYJR 2HCFA 2B5VA 2OB2A 3FFBA 3LKZA 5KMGA 1PSWA 3I2JA 2V6BA 4PSUA 4IJKA 5B53A 5ILQA 3REFA 3FTPA 2YZGA 4I19A 4BGUA 1U0BB 3PHHA 4JMPA 4UREA 4ID3A 1U7ZA 4BUZA 4KK3A 4IMRA 4FW8A 2EF0A 4RTKA 2JAHA 3CZ9A 3JYLA 3G5UA 2OORC 2K6GA 4DDUA 1TTQB 2H59A 5JNRA 3UHJA 2J87A 2B30A 5I7OA 2D8AA 3Q5EA 2J0QA 1I2CA 3RS7A 4DV4B 1JU4A 1JT2A 3OQNA 1JGTA 1YZ3A 4ACAA 2B6HA 3WMEA 1U5BB 1US8A 3DFIA 4JP5A 3ZS8A 3AOEC 4EG0A 2W42A 3HA5A 3UQZA 3OZAA 1GEEA 1Y37A 1J33A 2WT9A 4FX5A 1EIWA 3R7WA 3RSCA 3LYAA 4KMRA 2NTNA 1GTJ1 5B6PA 3ISVA 5JS8A 1UXJA 5CLGA 2DH5A 3BSWA 3T7TA 4GR4A 4YDSA 5K3SA 2QVCA 2GZ2A 2RB4A 1J2EA 3LE8A 3SP1A 4F4FA 5LFAA 3HP4A 4Z4HA 3JAMA 1V7PC 2VP0A 4GQBA 4HAZA 3HVUA 3BIXA 4Q1DA 1NKTA 3QXJA 4MW0A 5KYGA 2HFKA 4GRIA 3SKVA 2XXAB 2FPIB 2JAOA 2YWDA 5HIJA 2UVPB 5C7OO 4ZCLA 1LPPA 1JJAA 1JLKA 3DM9B 1X80A 5ED4A 2H4HA 2Y77A 4ND8B 4C04A 2COUA 1EVEA 5ARCA 2ZB2A 4KVFA 4M9XA 1SPBS 1XNHA 5B30A 4EB6A 4MTCA 1SIUA 4KBYA 3EF1A 1JBQA 3RSLA 1IEWA 5ED0A 2XA1A 1I1NA 1U6KA 1LDNA 2TECE 1FDVA 1MB3A 4JI6B 3HEAA 5JWHA 3ADCA 1PFGA 3T41A 1YUMA 5EJ6A 4UCFA 3IQEA 3ZHXA 3VO1A 4KGDA 5D3KA 5HUHA 2P4HX 4NOMA 1FP1D 1LJ8A 2V58A 1ODTC 3MTAA 1BW9A 2HWXA 3D6AA 1SFRA 4GSYA 2X86A 4M7PA 3U9LA 4EGSA 5CXUA 2FNAA 2W6OA 2ZDQA 1O96B 2HD4A 2R11A 1EE9A 4WTOA 5B1EA 4HQNA 4NCXA 5UKDA 3QLTA 3IAM6 1TGYA 1JIVA 3R9XB 3D4OA 3ILVA 1JHOA 3VMMA 1W59A 2O5CA 1G7RA 3LP8A 3ETDA 1GAQA 1QHGA 3HJUA 1XRRA 2QUAA 3W04A 1J6UA 2GO7A 1DBWA 1Z6QA 3DF9A 5D01A 4J07A 1VSTA 1SB8A 4HMQA 1XDGA 2A86A 3LUPA 1NHWA 1YS1X 4U3JA 1E3LA 5DHAA 1QG6A 1Z62A 2PX2A 3BHNA 4CDNA 4DS3A 1FJXA 3MRTA 1GCUA 5KQRA 4DPLA 3AIKA 3EQ9A 5EIAA 3KR1A 2QI9F 3LUFA 4QT0A 3VJRA 2O8DA 5DNDA 2EP8A 1YFJA 1XD2A 3DMFA 2ANBA 1RXUA 3TSZA 2CN1A 3UXHA 1IMJA 2EJTA 1GTSA 4U6SA 4FMDF 1CLEA 1KZGB 4HPJB 5DM4A 4M8NE 3DG9A 3COWA 3MQ2A 3VRHA 1XROA 4QDZA 4XD7A 2FUKA 1U0NA 3CSUA 4UVHA 3MCAA 2EJBA 4M6WA 1MFPA 3AERB 4K6GA 4FNAA 3RSHA 4H35A 3KIPA 5INTA 2LP4Y 1NXTA 2CBZA 2HO4A 2W6NA 2I8AA 1KAGA 3ANMA 3CIOA 3QEOA 2JZCA 3QOWA 2PM8A 2EW1A 4R1TA 5K3FA 3TLGB 3FPCA 1T0HB 2AFIE 4CMHA 2O3SA 1U3TA 1UXIA 1XZJA 3SBEA 1XVLA 2QRVA 1NJ6A 3M70A 3ZKWB 5KINB 3HK2A 3EXIB 1SA0B 3SXUA 3STVA 5DNAA 4N9QA 1RWWA 1Y81A 3JZIA 4C3OB 1ZMOA 1SVIA 3DE6X 1WNFA 5JWRA 4RS4A 4KMOA 1T3LA 3TX2A 3KPWA 3R9WA 4MWSA 2OFPA 4LSGA 3ET4A 1U28A 2O2DA 5ECDA 3LY7A 5C3UA 3V7YA 1PTJC 1YZHA 3L0CA 3MTEA 4BWFB 4DPMA 1QKJA 1QFYA 3TB4A 3IE1A 1RC1A 2FSVA 4YGXB 3TTTA 3VPCA 3JQFC 1EFHA 1F51E 2FP3A 1VM6A 5CA1F 2B6NA 2H9YA 4MV1A 3WL4A 3S1AA 2A94A 3HEBA 4RHXA 4Z0NA 2OCBA 1Z6AA 2VHEA 3NFYA 3URMA 3QEJA 2AMJA 4MVJF 1TUEA 4WEQA 1AQJA 4DG8A 1QYWA 3CTPA 4XRGA 3U7FB 3AL3A 5FOSA 5CCEA 1QHHA 1YIAA 4NZZA 4W9NA 4D3FA 4C4TA 3MEQA 2D7CA 4CRWB 2MSDB 4UTZA 2OV4A 3C6ZA 4GI2A 3SG0A 1PEDA 1ACLA 2FWRA 3GJTA 3E61A 3P7MA 1H94A 3EZ2A 3MCTA 3EAQA 1YKSA 3NCTA 2YBDA 1ZXLA 3QFHA 4MUBA 4HAIA 3ICWA 5HF9A 3AEKA 1DPGA 3TCXB 621PA 4NMLA 2ZJZA 3VR4D 4I2NA 5FL7A 4LFBB 1D5WA 1GGJA 1IY2A 1PJBA 1OXKB 1T5TA 2VT3A 3UAOA 2ZSEA 5I4CA 3PNOA 5I45A 2HXSA 4J1QA 2PUEA 2VHVA 3PQ5A 1Z2AA 1QNFA 2YHIA 4TS4A 4DLLA 3KR9A 2CT8A 5LZ2A 2VRNA 3EASA 3E9EA 3LUCA 3FRIA 3EH2A 4YQYA 1SA0A 3UW1A 3ZY5A 4ARUA 2Z8YM 4DMMA 4RVSA 3F3YA 1EZZA 1EDZA 4IMPA 2V7GA 4YLEA 2Q9CA 3LK7A 4C7JA 4D4MA 5FUQA 1IQUA 1UT8A 1X0VA 3W5AA 5T57A 5I7SA 4QM7A 3IQIX 1GQYA 2Y99A 4OBWA 2HLPA 2AJ8A 2EYQA 1J8VA 2XNHA 1JDTA 4MWTA 4RV4A 3UGKA 3L0DA 1DS6A 4KO2S 3T7IA 5GV7A 1H6DA 3MCUA 3ORSA 4ZT2A 4Z2AA 1YTUA 1G5HA 1IQRA 3RVSA 2NZJA 1MJ5A 5DNCA 3HN2A 4QUIA 4ZEOA 1FLDA 2IHKA 5BT8A 3QU9A 3IJ5A 4GI1A 1XMPA 4MV6A 5H5JA 2ZJ8A 2AUMA 1DFHA 4HDQB 5E9JA 5GP1A 3V1LA 1QHHB 4LDJA 2JGEA 2YINC 1R4AA 1T4BA 1ZVMA 3EBLA 4AYTA 1ZVVA 2VF8A 1YAHA 3OSUA 3V8NA 2J1LA 1MAUA 4CPDA 3RGWS 1YC5A 2DP4E 3WMGA 2XR1A 1LWOA 3PC7A 3B6JA 1PV2A 1JR2A 1UC4B 2XNCA 1EINA 4GFDA 1P17A 3GJZA 3LCMA 3COSA 4OXXA 5JAQA 3IV6A 3EDCA 1ZR2A 5HSGA 2OORA 3PEYA 2H92A 3IO5A 1M9NA 4HRVA 4K9OA 3T9AA 3DNPA 3WZMA 1OHHD 2CJYA 1E77A 4PC1A 4EA7A 3NBKA 1P39A 1VE9A 1KVTA 1LZLA 1XK7A 1V8PA 3IP6A 2PS0A 4PX2A 2BFAA 1Q0TA 5GJVC 4GS5A 4MW4A 4POAA 4E1BA 3IIMA 1K7EB 1BHSA 2QHXA 3C3KA 1CFZA 3DOOA 3HM9A 2QRPA 3VZBA 1GPMA 5HK9A 3KSBC 3AF3A 1JXAA 1MEEA 3PPWA 4DR5B 4CEJB 4JL5A 3ZE9A 2J09A 4A2CA 5EJFA 4UARA 3VI4B 1P77A 1MQ8B 3U3ZA 3OIYA 1AO3A 4HL6A 1ISIA 4J7CA 3Q87B 2X2OA 4W7HA 1KP3A 4J4BA 4ZQIA 4UVIA 4BNNA 3KKEA 1GADO 3HDJA 1JTVA 3O7MA 1VOTA 5EESA 4P4UA 4J7UA 4EOGA 4EX6A 5KVSA 5JR3A 1N1MA 4RM3A 3UJHA 4NENA 2O8DB 5J2UA 2FKNA 3JR3A 1FVXA 4XVCA 2Q1XA 4UHCA 5JNUA 1T2FA 1OJLA 1U28C 1H1LA 1UUFA 4L51A 4QHYA 4Q9LA 3BXZA 2EKDA 1G0OA 1B73A 5HG0A 5HIIA 3RG2A 1H8HD 2OKCA 1JE1A 3WISA 4QBIA 5IBPA 2RBKA 4NBVA 2QL5A 2JHGA 1N2BA 1VLJA 2ZB4A 4R7TA 2VHTA 3C8UA 3LPAA 4Y30A 3ZHZA 4XUEA 2B37A 4JK3A 4OO3A 4DCPA 4DJTA 1SHLA 1BEZA 1QCYA 1RU3A 4Y2HA 4YUAA 1OYOA 4BZQA 3CO0S 1NE7A 4ZAYA 3EQ2A 2QTFA 1E5LA 3IR7A 5E8JA 3GAFA 3QLVC 2PMEA 2QN2A 3GEEA 3ZHQA 1E4EB 1LBIA 1PHPA 1T36B 1TMKA 2R6GA 3JQBA 1X8XA 1ZWLA 3KJFA 3LVRE 4IUCS 4NOLA 2QTLA 4Q93A 1PVOA 2VJLA 3IT0A 4QU5A 4LF7B 3GNSA 3OQIB 2ZATA 4C22A 3VVCA 8AT1A 1Y5LA 1R9JA 2PT7A 4QSHA 1JIUA 1EEXB 1OMOA 3NNNA 2QA5A 3BC1A 4YHBA 3DUFA 1E0KA 2H8KA 2O8BB 4IS3A 4KXYA 5K8LA 3S1AB 1X7ZB 1B6SA 1Y5MA 3IIEA 4IWXA 3UJNA 1V37A 4LRYA 3W8NA 1E79D 1WW8A 1CU1A 3DMYA 2VTBB 5BOSA 4LXIA 5A1TA 4IS2A 4R1UA 2OBMA 1LDBA 2AXEA 1H66A 1Z8DA 5CVVA 1QGED 1YS9A 4HD8A 4CG3A 2WIDA 3UJBA 1E0AA 2P91A 3K09C 4QEKA 5DGTA 1G5RA 1A9XA 2XMQA 4X60A 3VYRB 2GZDA 5EKSA 1HYBA 3MJ4A 4R2WA 2J67A 2M2IA 3C5CA 4BS9A 4RAQA 4DTIA 1TVKB 2QAGA 1O9BA 1QYRA 2QVGA 4GMFA 1QIKA 4HQOA 3ASYA 5HA5A 1MX3A 4IIVA 1D6MA 3AM3A 4QOHA 1TYEB 1H3EA 1PFWA 4YJ3B 1AU9A 3IP5A 4LA4A 5A5EA 3G9ZA 3K05A 1IY1A 3HGMA 3LX4A 4LZWA 3ER9A 4FBLA 4G1UC 2ZT6A 4HDAA 1CP2A 3TFOA 4BAGA 2AKYA 1OCEA 1D7OA 2FW6A 1N0VC 4ZQCB 4CV3A 3ROQA 4R0MA 2AQKA 4IDCA 1FE8A 5F9FA 3I34X 5K0NA 1EG7A 3LRXA 5AXAA 2WLTA 2BY4A 1KO1A 2FR0A 1OXUA 3F5SA 3KL2A 4BRWA 1DKMA 4RJ2A 4BP9A 4HXEB 2Q62A 3KHTA 2NU9B 3O2QB 2Y67A 3FCOA 3IR5A 4ZVTA 1GT6A 3FM9A 2C7VA 2SKCA 2VRBA 3SMQA 4QSMA 1DO0A 4DYVA 2OTCA 5CBPB 4HP8A 5HCUA 4QUJA 1KE1A 1AMUA 3P9NA 3X1DA 1YL7A 2BDEA 3GNLA 3SHWA 1AS2A 2BJVA 3TM5A 2IGTA 3PR1A 4EI2A 1W4CA 1GVNB 3N74A 1L7NA 2GAJA 1RZVA 3BBLA 3MK31 4NDNE 5K3BA 2C99A 3DEIA 3GUZA 2F4NA 4YDQA 1IUKA 3W4KA 2NUTB 2QPOA 1DHTA 4OUKX 2R60A 3V8BA 1DC5A 2Q1WA 1C0KA 5EJ4A 5DGIA 3BRWD 4YT8A 3PTLA 3VHXA 3IBSA 1C3JA 5K0GA 3G13A 1Q7TA 4NQZA 2HC9A 2IP1A 1BFKA 2Z2YA 2QLBA 5L95A 4RK0A 3DP7A 1DQSA 5JDCA 4NZYA 2RHBA 5BQ3A 3IHWA 1RRFA 4LYGA 3ILXA 1A5AB 4ASUD 5CCBA 4NFHA 3MMZA 5DP2A 1IEXA 3O9MA 4O0LA 1NBIA 4R69A 3GZJA 2WMOB 4LF6B 4GXTA 1LD3A 4H59A 4JLDA 1NY5A 1G6HA 3KOMA 1RP7A 1C3XA 2AJCA 3MTIA 4MK4A 3JU3A 2C4TA 5DHRA 3S29A 5LDHA 1WVMA 2C4HA 2YIJA 2I3DA 5FPYA 3OZFA 3PFWO 3SR0A 2KHZA 1IJKA 1YVRA 1TFRA 1SIBE 2WILA 3CPHA 3UICA 2P1ZA 5BY2A 3LBYA 1AKRA 2HHAA 1G8KA 5AM1A 3AI3A 1IM2A 1AOXA 4WPGA 3A4LA 3HJNA 1AGPA 3R77A 4RXMA 4B7AA 4HI0E 5CFLA 4X84A 2H1VA 2ZIWB 3JS5A 4HGNA 2Z8ZA 1E2IA 4QJ4A 5CJJA 3AWDA 3TBHA 3B6MA 3ZZNA 5FYDA 2E1RA 3FN4A 1I4TD 1U8UA 2PQ2A 4RDIA 1PR1A 2YX1A 4INPA 4LJ5A 2FMFA 1N7IA 5AM2A 1NURA 2WE7A 2JW5A 1JKMA 4PNZA 4JOQA 4ZMSA 3HXLA 5JRDS 5JJKA 4MV5A 4WT7A 4LHXA 3C4VA 3PNPA 1H4TA 4TV8B 1CQJB 4IZIA 2P2NA 2BBWA 2O7RA 3EXEB 3VV3A 5E6SB 1KI9A 1UC8A 3UC5A 5DCUA 5SZIA 1Y7PA 1KNQA 4PSAA 2GD6A 2O5RA 4X24A 1B6TA 2IPAB 3IR6A 5DXAA 3IKVA 3GV0A 3R76A 4BN5A 4M0PA 1TD1A 2ZDHA 3IQGX 1AUXA 3AF2A 2V3WA 2R6HA 1R8XA 1OA0A 2IXGA 3PDCA 3H2JA 1ZVKA 3Q0EA 4EARA 4EPRA 4E94A 5I3ZA 5CDHA 5IEJA 3ZD6A 1FRZA 3H42B 3FCXA 3W5SA 3CRNA 1HYHA 2CJFA 3GX1A 2I2FA 2WVHA 4QHSA 4XRRA 1IE3A 1J20A 4LXQA 3OT1A 5CYGA 3E5RA 2WB4A 2HIMA 4N54A 4TKUA 2B69A 5F4BA 5A0FA 2EZ4A 2Z4TA 3BPSA 1OY1A 1NNSA 4NICA 4HDKB 4ZT3A 2ZAMA 1EDEA 2VI5A 2XE7A 3PFHA 3H99A 4KNVA 5BN3B 1RXEA 2Q3CA 3BB1A 4C89A 4N49A 4TYYA 5C5CA 2OLJA 1OX4B 1F12A 5LB2A 2CYCA 1M6NA 2XOXA 3KAKA 1EK1A 1ZRMA 3NBYC 4JHXA 4BKOA 3NI2A 2HRQA 1QP0A 1JEQA 3HVRA 3C16C 4L8WB 1XDZA 1JQ5A 4LK2A 3AILA 4C5BA 3LQ2A 1JI3A 3S44A 2EFYA 1NKVA 3CSSA 1A69A 2BI4A 1WZ2A 4UNIA 1GPAA 2D00A 2P9EA 2W0MA 2WV7A 4HTAA 3KXPA 4ILKA 5AI9A 5JEEA 1ENOA 2QQEA 4KIUA 1GFZA 2FLWA 1XVTA 5DBHX 1LRLA 4HQLA 4M6WB 1NJSA 2OZEA 4LCBA 2I3GA 4JJAA 1URPA 5AJXA 4B3HA 1WVGA 4BVEA 5COBA 1AQIA 1T13A 4E07A 3CZQA 1YSCA 2IYEA 1FRQA 2VQFB 3ECCA 3RADC 1QV6A 4WD3A 5E9AA 3K71B 3ZNOA 2PKYX 3WG9A 4I1PA 1KKLA 1FRFS 4LXXA 4RCVA 5J4HA 1UEXC 3KJZA 4D6XA 3DAOA 2NO0A 2NVUA 5GVRA 3ZCVA 1SUWA 2F3QA 4OXIA 1NLFA 5AHWA 3T9CA 1A71A 4RGBA 3N53A 3EFOB 4RPCA 3DV9A 1ONSA 1K7YA 4WVLA 5C37A 5J2TB 3COJA 3B2EA 3MYYA 2ODNA 4QARA 5LM3A 4P3XA 3V34A 3LFUA 4WUVA 2QZPA 2WYOA 3JTEA 2FPMA 4IDAA 2VHJA 5H59A 1ZCJA 1B43A 4Q4HA 1XDDA 2HR1A 3W4JA 1R2QA 5EXSA 2CNWA 4DGSA 5DNWA 1PG2A 1MX1A 1JLHA 1IEQA 1XEXA 2ANCA 2J6BA 4LYAA 4PGGA 4OFZA 2WHEA 1LB1B 3K0AB 1I1QB 3ER6A 4C7MA 4DF3A 3A4VA 3L0OA 2HMUA 4MMZB 1JIXA 1QH8A 4HRYA 4R2KA 1E3DA 2PXAA 2W2KB 4DC9A 1KBQA 4CM4B 3F1KA 3HV2A 4WLOA 3F5FA 2R96A 3OTGA 3TMKA 4WZZA 1IOWA 3HE3A 2XGMA 2XT9A 1OVMA 8MHTA 1LXCA 3DZDA 4RPLA 3R41A 2ZRQA 2DFVA 4EP1A 1KS9A 2G9QA 2KBEA 3E82A 4Y2YA 4C14A 1HRDA 3GLUA 3IUSA 2OMEA 2FWPA 4IGKA 3SF8A 1FFAA 4QGBA 2XTMA 1V7QA 2Z9DA 2ZKLA 2GN6A 3A32A 3AJ9A 4MWZA 2H2IA 3SLRA 4AJPA 2D7JA 3WIVA 5KSWB 4LDRA 1YUBA 3NC1C 3VSBA 2A67A 4GYWA 4I5FA 2AQHA 3B8EA 3CM0A 4RZXA 3DD5A 3GPBA 2DPXA 2RGNC 3UJ3X 4DAOA 4QGSA 1H4VB 3THXB 2W58A 3KU4A 3ADOA 1XKLA 2HJRA 3QE4A 5JXJA 4CQJA 3ENQA 3S4YA 2R1VA 3GLHB 4GICA 2JJMA 4UU8A 1XRJA 3FTNA 1DRWA 4U7WA 4DY4A 1YZKA 2Y68A 1GILA 3W78A 3PCRB 4C03A 2JLVA 3L01A 5EE1A 3H5AA 2R0QC 4ZTUB 3DQQA 1TA9A 1K4KA 2ZRGA 1CIJA 1EQAA 5CYOA 4NCIA 1EPUA 4KZPA 4OKSA 5DBGA 3KJXA 2RHGB 3CB4A 3BGSA 9MHTA 1UKCA 3Q3CA 3TM4A 5L4LA 4QJBA 1GKLA 2PGIA 1RKXA 4M7OA 3UAGA 1C3EA 5C8YA 5BW4A 5AXCA 2X0IA 4NARA 3BILA 1IOZA 5IBRA 2QQGA 1ODLA 5JCOC 4HX2A 1C4XA 1QONA 1Z5OA 1KF0A 1RMTA 4MDEA 1N7JA 3HDTA 2R6R1 1C29B 2GGSA 2YNMA 1Q7RA 2UAGA 1M1YB 1RYEA 2P69A 2V7VA 4XI9A 1E2BA 1DCKA 2CFTA 2V8BA 3L18A 3TD9A 3UATA 3Q0TA 2QROA 3ZQKA 3N75A 2NV0A 4KR3A 1VLVA 1BWSA 4HYYA 1UP7A 1NI5A 3P0RA 1DQYA 1BMQA 2IU4A 2PS1A 3OU6A 2Q7XA 4MCIA 4LFCB 3SXUB 2C00A 1TYZA 3NH9A 2JAQA 2IS4A 4KRFA 2PL9A 2BRUA 3DMRA 4LJYA 1R00A 2AK3A 1QGAA 1J8FA 1XTIA 3H8VA 3MBOA 2NQ2C 1HNWB 1RBZA 1T5DX 4L0CA 4OLAA 1B7GO 4NESA 2W0SA 5HK8A 3ZHRA 4JIMA 5B5SA 3GROA 2H85A 1V5WA 2WIFA 5TVGA 4C2UA 4DPKA 3PNMA 2Y2VA 1JS1X 1NZFA 4IDGA 4L8FA 1NIPA 1QYVA 3MTGA 4M4SA 4Q1CA 2ZR0A 3W2HA 5LD2C 1P0PA 5KHAA 1QK5A 5DIFA 3EDQA 3VJMA 3LXUX 4JXKA 1PTJA 3U4AA 3D64A 3NAQA 1CK4A 3OIFA 1GCOA 3QY0A 1Z0DA 2ESRA 1NZDA 1STOA 2H4ZA 4EO9A 1HO3A 3WBBA 4EGJA 4QELA 1TAHA 3TZLA 5AW4A 1KJIA 2G1PA 3TUIC 4EMTA 3CXUA 3OCUA 5IZCC 2I4MA 3ZIAD 3DVLA 2QG6A 4ARZA 1GTL1 1M1YA 2X6QA 3OJFA 5LDGA 1JAIA 1J5EB 1GNSA 4ZI7A 1RBQA 1RXYA 1GUZA 2B92A 4D3XA 3CNNA 1KBOA 3PXXA 1X3SA 4DKXA 4KX5A 4JWKA 3G5TA 1WTCA 4LG1A 4TL9A 3EGCA 1G3MA 2EGUA 2G9UA 1L4FA 5IM4F 1PR9A 4MP8A 3CXRA 5EXPA 1QRSA 2FGKA 1A8SA 5FEMA 1NNUA 3Q88A 2AHRA 3RT7A 5JATA 2W83A 1UFKA 2PPLA 2YY6A 5G1OA 3U0VA 3HFRA 4KR0A 3FSGA 4BNIA 1UPAA 2PKWA 3CU5A 2MSEB 2C5HA 3T3OA 1DLIA 3W2GA 1E9CA 2H5EA 3O8BA 1J70A 3AONB 3N8GA 4MJ3A 4MRRA 2WB2A 1M2NA 3A6EA 1I3CA 3AF4A 4IVQA 4B5KA 5HNKA 1EQUA 3AO0B 3K9BA 5BORA 2GB4A 3BA1A 1K88A 4PRKA 4JLPA 2ZBVA 5B4TA 5E1BA 4B2LA 2QL9A 2IPXA 5BXYA 4FIZA 4N5DA 2D0PB 3EIUA 3JAWB 3VPBA 1XKQA 1MMFB 1NC1A 3PT9A 3QNUA 2FSUA 3E4DA 2C2XA 3ZQ4A 2GJAA 4I1YA 2UYGA 3WL3A 3JYHA 2H51A 1OTHA 1F2TB 4Z3OA 1KIFA 1NFQA 2A5GA 2J3QA 2UZIR 4QO8A 4R8KA 5FT9A 3WY9A 1XALA 3KM0A 2ZWPA 3VKGA 3H7AA 3WHLA 4OI4A 4O2BF 2FFHA 5ADWA 1ILEA 1FXSA 5AW5A 1JYEA 3AIIA 3O6VA 4KBGA 4OLBA 1J8YF 3ENWA 3ZTYA 5BSHA 1RPZA 1HA3A 1KEEB 3EXFA 4FDVA 1U7PA 2C7QA 2FJUA 1PJ8A 1Y7HA 2VSNA 5SZHB 5IG2A 3ND6A 4JI8B 3NMUF 1U9IA 4D3SA 2QQFA 4XIGS 4P31A 1M6YA 5AHKA 1U8CB 5EZYA 4EG1A 1A5ZA 4ESHA 2E6KA 3C3JA 4IQ4A 5EZSA 1J5PA 4NHOA 2VJNA 3JQAA 4TUYA 4U2DA 2BKLA 2FX3A 2Z1DA 3KR0A 4PZCA 1VHJA 2XNKA 5J47A 2P4QA 2VSOA 1CUJA 3T7CA 1USKA 4HG2A 4P22A 8LDHA 4CEJA 2GVDC 1P1BA 3C74A 1M74A 3BKWA 4NBLA 4MV7A 4W5JA 4AJLA 4QVIA 2UYCA 1TGVA 3I5UA 1ORIA 5DJ5A 1ZKDA 4DRXA 4E2FA 1E61A 3B1YA 3FMPB 1YDEA 3BTUA 4OM7A 3C2QA 1ESDA 1Z12A 1E4OA 2JFBA 4JP2A 5EQDA 1L8AA 1L4UA 3AL2A 2CDBA 2L18A 2OCYC 3O8QA 3R09A 5DRYA 5AD1A 5IMSA 5ARBA 1GITA 4BFXA 1A50B 3FFWA 1L9KA 3FA2A 4XE5A 5H82A 3ZE8A 4F9TA 2IRWA 1L7BA 1GGVA 1VL1A 5F7XA 3ANXA 2PA3A 1GUBA 4K5QA 4JC0A 3JQRA 2V03A 2WWVD 2PL1A 2XSZD 1ODSA 4A6DA 4IGIA 4IUBS 3WV5A 2HA7A 4EFDA 3HB4X 3PX2A 4LJSA 4XCVA 4Q48A 3HP7A 4BFWA 3FOWA 1SG9A 2V5VA 3NVDA 4C1BA 4DADA 1IHYA 2QZSA 2YWFA 1A82A 3N8DA 2ZPTX 5FOUA 3O8OB 3HYNA 1F8UA 4DV6B 2J07A 4CHGA 4BGVA 5BNFA 3FOEC 2HA2A 5AK5A 1N6IA 2MIIA 4KRYA 1ZN9A 2F7SA 2YRWA 5GZ3A 5IC4A 5B3AA 5BN4A 3BSYA 3GUYA 1P4GA 1P1FA 3W3AD 4PS1A 1CJUC 1OKKD 2QLMA 1MQ9A 4BPRA 3S2YA 4GOJA 4C21A 5KREA 2JANA 1R66A 5EZ6B 5REQB 2F9LA 2HYDA 4LZOA 1E1RD 5KQPA 1E3WB 1KEUA 2INGX 1W36C 1RWOA 3UUGA 1UBTS 2RJNA 4L9WA 5IJ9A 1UBMS 1D4AA 2RDMA 3RFFA 2GZRA 4GC5A 3SHTA 1R0YA 1RM4A 2XZDA 4HAVA 4EAQA 2PX6A 721PA 4U7DA 4ZYZA 3NTRA 3BM5A 4U0JA 2HK8A 4TMYA 2DWCA 1H2AS 2PAAA 3N2ZB 5IKOA 2PD6A 2H2AA 2KJQA 1XDWA 2G9VA 3OJXA 1PR4A 3I05A 4IFEA 4YCDA 3RANA 3W8FA 3HTXA 3FZNA 1AE1A 2HHJA 4RSGA 1K6IA 3ZGYA 1FP2A 3THXA 4MB0A 2PUCA 1R5BA 1Y6RA 2QX9A 1WUYA 2NYUA 4K9SA 1F14A 2VJCA 3I3OA 4QBHA 3UC9A 5ARDA 4CGYA 4MUFA 1XZKA 1IRIA 2XI4A 3I2YX 3O4FA 1SKYB 4XWTA 4DG5A 5M7EA 1PJZA 1QIDA 2J3EA 1SM4A 2RARA 1Q6YA 2W6JD 4X1YA 4LV8B 1A5SB 4MQEA 1V8BA 4KXMA 4KHZA 2DBRA 4LISA 2Z2ZA 4J0JA 3VR5A 3HA2A 4F8EA 2OG1A 2CFRA 2ZUTA 1ZNXA 1SCIA 1C0PA 1AUQA 3GPIA 4OMFG 3F47A 4OJMX 4R7GA 3VHQA 5LP1A 1FL9A 2OYSA 2VP6A 3DVQX 3P9CA 4DA0A 1I4LD 1S2DA 3OJCA 4J0FA 4L7VA 3S2SA 4EB6B 5IT9A 2ZB8A 2HMVA 3REGA 4WDQA 3DDUA 1T4DA 1Z8NA 2OM6A 2E49A 4Z0PA 1XWWA 2C20A 1M2OB 2C77A 3L1HA 4ZO9A 3K31A 1HLGA 3SM3A 5JZBA 1GPDG 3G0IA 4BFTA 5J5VA 5EJEA 2GTHA 4W8HA 2OPBA 4TWRA 3L7AA 2V6JA 3PUKA 5LYYA 2NU8B 3G6WA 5AKZA 2HJSA 1DC7A 3MUFA 4BV3A 1WLSA 3RF7A 3IFSA 3DBRA 1G55A 4UQLA 2E7ZA 4MDFA 3ODPA 3MRSA 1N4DA 2P35A 3ONNA 1PUIA 3G5MA 2O7QA 1H22A 5L7TA 3U19A 3ADBA 1GZSA 1RYHA 5A9TA 4L50A 1W5TA 4LPKA 3ZHCA 3EQ7A 3KLPX 4MLCA 2GZMA 5LA6F 1L5SA 4WMLA 1UFOA 4LZJA 4Q5IA 5LUBA 5KTTA 2OC4A 2XGOA 4LAFA 4NU6A 4RHCA 4B4DA 4EMBA 1T2AA 7AT1A 1ODCA 5GM2A 3I37X 5TSDA 3VHXB 1C7QA 1V1RA 4FQ7A 4P35A 1QB7A 4TTRA 4HR7A 5IBQA 3AW9A 3ZV5A 5ALGA 5ER9A 4MWGA 2GAFA 3EXFB 3H0EA 1HDRA 4DWJA 4B7XA 4EECA 1WXEA 2EVWX 3DJYA 3CISA 3NIDB 2QW8A 3LPNA 2GPWA 3N2KB 4HQRA 3AR4A 5AKKA 3B1WA 1TFUA 3A1EA 5ADHA 3LCVB 3EWSA 3TQIA 4M21A 3V7FA 4MUNA 1DCTA 3N5KA 2PX8A 1G98A 3NDJA 1SQSA 2F8MA 4M1TA 1K97A 4DR6B 3OPVA 5D6NA 3OIDA 3AFGA 4UKDA 4YRSA 4C4ZA 1HURA 1U0EA 4Z9BA 1RHMA 4DM3A 4FHEA 2IXTA 1E3TA 3BXPA 4MJXA 3HCOA 3UH0A 4MR7B 1M34A 5F7OA 1YU9A 1GTRA 3ET5A 1BA2A 3MT7A 1S8NA 3MJDA 2VNJA 5A4AA 3QKSB 2QLFA 3FFAA 1A5BB 4DG9A 5AW2A 2ECQA 1CQPA 4GBJA 2HWUA 4J16A 4PS0A 3VPHA 2ZYIA 3IAEA 3NYIA 2IF2A 3COYA 1XQXA 2CFOA 3BHMA 3QPBA 4QUEA 1WHTA 2JFUA 3KELA 4FFNA 4MQMA 3PEFA 4CHTA 3CNLA 2EZUA 4FOSA 3M9LA 3PHGA 1E1NA 3IC5A 3KALA 4OQPA 2CB0A 4DW8A 1XIVA 1ZGBA 1IY0A 1NZJA 4FCCA 4HWGA 4LN1A 4OBBA 4RYLA 5TGZA 2PWAA 2HF7A 1TJNA 4B2YA 3N39C 3OD1A 5IXSA 4B3BA 2ZTSA 3AC0A 4CMGA 3NV9A 1S89A 3AOEA 2J5BA 4NPCA 5L4NA 2W2TA 4U8GA 1FUEA 1O9GA 5FPTA 3OAAD 1A9TA 4AJ4A 3T9DA 4UBKA 3U4QA 1ESMA 3ZE6A 4X8OA 1K7SN 1NQVA 3A9UA 3BAFA 3K9NA 3LW8A 1F17A 1BE6A 2FMXA 1GZDA 3ONWA 3RV3A 2XXBA 3U7EB 2RGCA 1PLLA 2HIGA 1Z4NA 4ZEXA 3P97A 1OR8A 4KFRA 4OIFA 1RYZA 3TVDA 4DNXA 5JUWA 3WXBA 4GYKA 1D7AA 3HUDA 2C3YA 4HDMA 3UV6A 5CB6A 4YJFA 3EQZA 4PPNA 2ATIA 1P3DA 3AHGA 1VHLA 3Q9UA 4HXYA 4HWKA 4BX9A 2LKCA 4KRGA 2O2HA 4I4IA 2FPSA 3PQDA 1T25A 5A4KA 3EUAA 3OZRA 4W1RA 4HUQA 5EZYB 5DMHA 3RC1A 2YIDA 1YDGA 2Y1OA 1XZPA 5K9ZA 3LBNA 2NTEA 2BMJA 4EHKA 3HKBA 1YZLA 2V7EA 2V1UA 1RXWA 1HKHA 3AUTA 3LI2A 4P34A 1SMKA 2ZM6B 3BRSA 2VBIA 1UBOS 3ECAA 3U39A 1G5TA 4DNQA 2FDXA 4CMCA 5K4AA 4DDWA 1UK7A 1U1DA 3O3NB 1TYAE 1E7MA 4Y6PA 1GQ2A 4Z0HO 1OGYA 1BGVA 5DNEA 1Q44A 2DE0X 3B6EA 4QBKA 1G21A 4CT4B 1FDTA 2NADA 4QD3A 1KAMA 2V74B 2R25B 3GGSA 1LLCA 4LI0A 2WTAA 4R9NA 4YVFA 2D06A 3W2IA 3X2SA 4K9LA 4CCSA 2DF8A 1S3FA 1R0LA 1ATZA 1ZBQA 2HDOA 2JIDA 4TM8A 4ZOBA 1ZXBA 4ITRC 4OP1A 4ZK6A 2QOEA 2W2MA 1NV8A 4GZ5A 1D1TA 5FTMA 4HBZA 2GTPA 2XQVA 2I80A 4M9QA 4OFXA 5EP2A 3MLAA 4E2WA 3PQ2A 4RHTA 1YR1A 1KH2A 1MPTA 1P7VA 1WM1A 4QFCA 1RRPA 1XD8A 4B43A 3RAEC 2PE5A 3DW1X 4JGIA 2GCIA 5AM0A 2XLBA 3L1KA 4RF4A 1LVUA 1ADJA 4W7IA 1DO8A 3S55A 4P8RA 3NHPA 5IU6A 1QZUA 3QWIA 1NRJB 1XEAA 1GG2A 1AKUA 3NHSA 3KFXA 5EE3A 2RHTA 2BFWA 5JSZA 1SD1A 4CF7A 3BQNB 3NYRA 4D79A 2PUVA 3BF7A 3EIHA 3WIUA 2VZ8A 1WJGA 3KZOA 1CCWA 1RJFA 2PFGA 1SC3A 1VMKA 1GU7A 2MMCA 3L7NA 4I2VA 4O29A 1D04A 2OCAA 1ZI9A 1TUGA 3WXMA 2GYYA 5JT1A 4MW6A 2CLSA 2UZ4A 3UMJA 2XEXA 1V2HE 1C9KA 2VP5A 2IGBA 5FWYA 4UD6A 2X58A 4UDOA 4RORA 1UM9B 2W2LA 2Y4NA 5LQRA 2UYQA 2AMVA 2DG2A 4XPIA 2PUHA 2C2MA 2CB9A 1I5EA 4N0EA 1YDHA 3B85A 1F8XA 1EM8A 4JGGA 4NAHA 1J9EA 1DG3A 1R0ZA 3KYBA 4HDSB 4YO8A 5IDVA 4B6JA 4EK9A 1GQFA 1U3GA 2QRNA 1KYYA 3L8HA 4KG7A 2WG0A 4O2AF 5DZSA 3K2QA 2X3YA 1PX0A 3CR3C 2G71A 2AZDA 1EHCA 1Q1EA 2VUIB 4HH1A 4WLVA 4IL5A 3V5NA 4BVAA 3WQQA 5I47A 4WRRA 5KQGA 1H1TA 1N77A 3U4DA 5A3VA 5TY0A 5CB4F 1VBKA 1P4SA 1PWEA 4L57A 2CFCA 4M49A 2JCSA 5JAIA 3ROEA 5FUMA 4YWJA 1JMKC 1INLA 4PQGA 1P80A 1XJ0A 4WESB 5LSAA 1EAYA 2RJOA 4C0LA 1Y9JA 4OP3A 4ONEA 1TTHA 2PL5A 3B7PA 5KOJB 1E0SA 1USVA 4UDXX 1JHMA 2PGAA 4MPJA 3GUVA 4GSKA 1BDIA 4R2HA 3VR4H 4GPAA 4JEMA 4EBFA 2I8LA 2JLBA 3CE6A 3LA8A 3W7VA 5L6MB 2RAPA 4PPGA 4OHYA 1I3LA 2QAGC 4MGZR 4XVHA 4GZMA 4I99A 3L0YA 4I5DA 2PLAA 1ABEA 3NGXA 4OHRA 5MN5A 3ABZA 2DJ5A 3PXDA 1YF3A 5F76A 1ZD3A 3I53A 3JR7A 2X4LA 2R2AA 1JDZA 2JCBA 3L8CA 3UK1A 4KBFA 3KC2A 3PENA 2CDNA 2HJGA 4RZ2A 3WYGA 2YR0A 1F0KA 3EPHA 1T15A 2MSWA 4IIEA 1N34B 2C9DA 1R0CA 1OFUA 4LY0A 5CA0B 4FHCA 5KYXB 2V9CA 2WHPB 3CX6A 3OPYI 1BKYA 1QQ6A 4UEWA 2ZI6A 2X3FA 4JKOA 1BW9B 1S2OA 4UDYX 2VQSA 3TIVA 1SK8A 1Z0ZA 2HBQA 3BFXA 4KP7A 1XAGA 2RGXA 4OY3A 1P6UA 3N8KA 1JG4A 3OOWA 3I0MA 4DWVA 1ZLYA 2E48A 4JJ8A 4U2KA 4RM2A 1BE1A 3H2IA 5FJJA 4D82A 4ZICA 2JI4A 4WA8A 4AROA 3T1NA 3TBKA 1ID1A 2QN7A 3ACCA 3TZ6A 4CIWA 5SZJA 4NCKA 3CWQA 2O7NA 5JYCA 3MGAA 4WY2A 3FGOA 3PQ6A 3TW6A 1C41A 1PL0A 3GD7A 5FQOA 4AVYA 1EE1A 3BCHA 1PJAA 4GYYA 3TJZA 3VDXA 3RK0A 4ENQA 3QA9A 3ZKAA 4ERXA 5TNXA 2GN1A 3CYFA 4ED9A 3F6CA 2O2XA 3LUGA 3CG0A 1FJGB 1CY1A 2YHSA 3O1IC 3R3ZA 4KH0A 3NX4A 4RAOA 3P71T 1MT3A 3DWEX 4LRXA 5HRCA 3S5JA 2GCOA 2V4UA 2GNOA 2RH9B 4DJEC 4NOJA 1KWKA 2R8YA 3GRAA 4O4HA 1W1IA 3UAXA 3EW9A 1C5KA 5CT6A 3AB7A 3KYCA 1MF7A 5AW3A 4PFSA 2ZUUA 3DSRA 3M3DA 4FHGA 1O5TA 5EKXA 1ECLA 1G9TA 1UAGA 5C1PA 1F2DA 5AI8A 4D0SA 1HR0B 4K26A 2HUPA 3I01M 3ORFA 1AQ6A 3LBFA 4KB5A 3AL0C 3DH0A 4HWTA 1T1EA 4PSVA 3FR8A 3C1AA 1L5YA 3LH5A 1EP2B 3O0DA 4BMCA 2ZYRA 5KIAA 1L5ZA 3CV3A 1GKIA 2IV7A 1XD9A 3JVDA 4URZR 1U9IC 1T4CA 1UJBA 2YOFA 2OV3A 1DAPA 3D1VA 3DEYX 4HNUA 2QD1A 2O0MA 3V2UA 1Z2CA 2F1KA 1AN9A 1MV8A 3IULA 3QKRB 1RQGA 3PRJA 1ESNA 3EJWA 4U7GA 3T3PB 1EVIA 4DDTA 4B48A 5FA6A 2PJZA 1ZXXA 5LNK6 5M29A 1Q21A 1KC1A 2VXOA 2FQWA 3HC7A 1P29A 4U9IS 4CQMB 3HCCA 4EYEA 1NQAO 1ZC4A 3BIWA 1E69A 3L8YA 4QTZA 3SEAA 3UCFA 3Q0IA 2B34A 3VOBA 5HTKA 2WWIA 2ATEA 4BX3A 1YB7A 1YB5A 4UMDA 1IXKA 1XA0A 5EE0A 3RVKA 3PICA 1SD5A 2R48A 1GO2A 2L17A 2CL5A 3HVIA 2Y1WA 4GGPA 2VDNB 4P93A 3CZRA 3HHEA 3ZXYA 9LDTA 4OGKA 4KVGA 1GYQA 2BM1A 5BUZA 2XGGA 4JEHA 5KNBD 4GDFA 2C3OA 4XDGA 1VIAA 4H7KA 2R00C 2JS7A 1A9RA 3LQRA 4N9WA 2VDWA 2P2DA 1BJTA 4NV0A 1DMSA 1KL7A 5DTQA 4RTNA 2WKQA 3OMLA 4A2PA 2YC4C 1QRDA 1TVCA 1KZ4A 1M1NB 2BMEA 1NVWQ 2WV9A 2WU1A 2A4MA 3GJXC 4U4AA 5T64A 2IYZA 1FDOA 1GEGA 2Z1NA 4UU7A 5AXBA 5EMHA 3ZK8A 4RPJA 3QBVA 3KE9A 3WGJA 4FGWA 4HO1X 1FQWA 2BCJQ 5HX7A 2GO1A 3KKLA 3RRYA 2JEZA 2HQBA 3OTOB 4MUJA 5D84A 4ZI3A 1CFJA 4MZDA 2NT3A 2PQ0A 1SC1A 3HLKA 2XMDA 2REOA 1VBNA 4UHEA 3CURA 1RWQA 3HBLA 4BNLA 2DB3A 3PXEA 4F11A 2HRCA 7YASA 3G5AA 4D9KA 2AOUA 2VKTA 2EERA 2L42A 3MN1A 2P0YA 4QUKA 3SZGA 4WQMA 4EW1A 5I7WA 1B76A 3AR8A 5EPUA 4RY2A 3B78A 2P1RA 4H17A 4I1IA 1XTTA 1HRKA 3NRJA 4P82A 1KI6B 1Y33E 3TDKA 1V5EA 4B46A 4RGVA 1E2LA 3B53X 5HF5A 2ZBUA 4EHIA 1YVPA 4GKVA 4Q05A 2ZCUA 3MS4A 4RIFA 1GNRA 2O0HA 4HDCA 3DTTA 3DDHA 3EIOA 1ORVA 4L27A 4WXYB 5BOSB 1CS4C 1NBMA 2DECA 1SCDA 3UJ8A 3QVVA 3PJEA 4EJ6A 1XWIA 2QUKA 3BGIA 1M2EA 1Q12A 5KWSA 3NJ8A 4JQOA 4D1YA 1LVGA 1WW2A 4DARA 4JI4B 3KXLA 4IOKA 1SQFA 4MZXA 2D2XA 4PXYA 4KLRA 4OQZA 1MTZA 3WYBA 4UQOA 4F5EA 4YRLA 2PNFA 4CVNA 4P4NA 2OCXA 1U2SA 2UZ3A 1E2MA 5CJ2A 5DHQA 1UIRA 3FMOB 5TPWA 2RGYA 4HLNA 1Z5VA 4TVKA 2XCUA 3A4NA 4LUCA 4A16A 5DH9A 3WGVA 3LKVA 2WDPA 1ECGA 4I3FA 4EPYA 1XJ5A 1GQSA 2QR5A 4P33A 3WYNA 1EFTA 4EG8A 1IDN1 2PV0A 1VMDA 3ZCUA 3HRKA 1YZNA 4HNAA 5E0KB 2BKEA 3AF6A 5CA1A 1UK8A 3NWBA 1DHRA 2XVXA 1N5MA 3OJEA 1NAIA 1I6MA 2FQXA 3V4SA 1AY0A 3I0ZA 1BCRB 5CH5A 3DW3X 1VB3A 2NPFA 3E05A 2OFWA 3K0EA 3WRXC 4KSYA 1W0KA 2I66A 1ZCZA 2AEEA 2VF4X 4DREA 3W9BA 2EBUA 5EINA 1S7GA 5EMKA 4IICA 3TLBA 1U9YA 5K0TA 1NVDA 5J2UB 4OYLA 3I62A 4FFBB 2APJA 2I99A 2ZSDA 1DEKA 1FMCA 3PJDA 4HPWA 4O2RA 3MM4A 4QNRA 3ZNQA 5HXAA 4F0JA 4IMJB 3OQOA 2QQ5A 4ZYVA 1LK0A 4AK9A 1KMCA 4E03A 5JSHA 1T9KA 2JKVA 3EHEA 4ARSA 2LCIA 1XZ8A 5IZCA 2VAPA 3F8TA 4IWYA 5KNCD 2HV9A 3ZS9A 2NUTA 5IFKA 4K9NA 1SKAA 1GQQA 1K8ZB 4FWIB 2ZGVA 4S12A 2F9FA 5BV1A 1GZ5A 1WPXA 2HSEA 5LPNA 1WDMA 4XOUA 1HQCA 4Y2XA 5DX1A 2OHJA 2I2AA 1XAJA 3EZNA 5DMXA 1EIZA 3CZAA 2CVHA 1TLFA 1E7WA 1XHLA 1P19A 2E4AA 5E1OA 1D4ZA 5JBIA 2WD7A 1YT5A 1T36A 3TXXA 3UXMA 5JLJA 1CJKC 4R1LA 2O9JA 4IP0A 3JTMA 3LOUA 3G7SA 4IQ8A 4J9VA 4OXYA 3V00A 2IHZA 3KLMX 4HX9A 2X8JA 5JMTA 1C14A 2KM1A 2VYQA 5IFLA 1DADA 1EJ2A 1Z13A 2AWNA 4GPBA 4O1IA 1NW6A 4MVJA 1E89A 2G67A 3DNFA 2ZUEA 2BFEA 4ZO6A 2IS1A 3AUAA 1QAMA 3DBIA 4BEBA 1NN1A 1S9DA 3FPJA 1KERA 4TX1A 5E1DA 7ADHA 1RI2A 4EVQA 1CULC 1G19A 1EXNA 3BEDA 2EW2A 3ND5A 3OF3A 5CIQA 2IU6A 3VR3D 5JHHB 4IOJA 2WVGA 1Z7EA 4H1TA 3QPWA 3UMYA 1KFBB 1L7DA 3GEDA 1C1DA 1KJ8A 5F3WB 1LDGA 1BN6A 1ZISA 2A9KA 2IE0A 2X9NA 3H5TA 3R3WA 4Q3CA 4Q66C 3H4MA 5JCOA 2RGRA 1ZI8A 1XHEA 4C20A 4HADA 4ZGGA 2QT0A 1P33A 4UAUA 4WIAA 3ENKA 1T1RA 4JBLA 4I14A 2R87A 2VHXA 1XDSA 1N3IA 2HTFA 2WKSA 3A04A 2WWFA 4JT8A 1M6VA 4ME6A 4ARAA 1NT2A 4QOEA 3IUYA 1TW2A 3OOHA 5CFRA 1GN8A 5LVAA 4PCUA 4DC1A 3OM0A 5EQJB 5HP4A 2IV3A 4GVPA 3BIFA 1D0VA 3N6XA 1GRVA 1WO8A 4XQ0A 3IEPA 1E66A 4ROTA 4YASA 1PT6A 2VF5X 3VTFA 4AZ3B 3I61A 4I9GA 2PJUA 2VJPA 4MQFA 4PZPA 1EK5A 2XWJI 1VPTA 1WR8A 4FC6A 1W46A 3R6DA 4M0MA 1J24A 2OUIA 4HGZA 3HUUA 3LKBA 4MUXA 3BMOA 5AVKA 2CFSA 3WYAA 5B58T 3FD8A 2F43B 1XZDA 1R4NA 3DVSX 4EDFA 2IK8A 4QAQA 2XMBA 4M1MA 3OZDA 4HB0A 3X1WA 1JWAB 2QVYX 4HYEA 3VTZA 4CR6A 4RKWA 4MIYA 3L05A 3PZRA 3REQA 3IODA 1RQRA 3IIJA 4M37A 5IRCD 3FZQA 1N6RA 2OG2A 4YN3A 4EG3A 2AE2A 3OKFA 5ITZA 2DPMA 4DA8A 4B0OA 1N25A 1NQ5A 4TTSA 4ZYUA 3B3JA 1AK9A 5CBPA 1TEXA 2N1BA 3EUWA 1DKLA 2X1MA 3OCVA 3UXYA 3JYPA 4BEJA 2R1UA 1ZN2A 2WZBA 1W2GA 1NVVQ 4YREA 3ZWDA 1JU9A 3AU9A 3FWHA 4Q4JB 1OC4A 4J0EA 1E5XA 3TZBA 2FU5C 3UWSA 1JB9A 3QHAA 5LXTA 3S8YA 3E0XA 5T4HA 3VHRA 1MU0A 3QLUC 4ZI5A 1EGMB 1VG0B 2O05A 2WPNA 2DHEA 2VP3A 2QWXA 3BRWA 3F1LA 1FYEA 3Q15C 4LXTA 4BMNA 4F3KA 3GLFA 1SVUA 3IQHX 2IVZA 5CU7A 2CEKA 4H16A 2DLDA 2AK2A 4ZTBA 4R71A 4YRKA 4C4OA 2A9JA 1EZ1A 2F64A 2DRIA 2QX7A 2R1VB 3GLHA 1P2UA 2VOEA 4FOTA 1RQ7A 2DFPA 4FYKA 1EMDA 4D45A 5DYYA 2V7XA 2ZE7A 2GTIA 3O3CA 3RV4A 3OLQA 3PC8A 3WMXA 5B58C 1XMIA 4WCFA 4LOIA 3I23A 3R20A 2QMEA 3PUHA 4O4IA 2O3QA 1SHJA 2PBFA 4MGIR 4E7PA 4AN1A 2Q46A 3D6HA 3F46A 4TSFA 3U6KA 2PTHA 3DC2A 2Q5FA 1V11A 1JQAA 1WCXA 3EXHA 2E37A 4JBXA 1XMVA 2Q7DA 1G38A 4ENWA 1E3IA 3AIOA 4M8SA 4LF4B 3ZYCA 1TKRA 1YTLA 4I6EA 3RJMA 4K0RA 1SK9A 5B3LA 2FLVA 5TF0A 4ZO7A 1T2UA 3PSHA 2X15A 1C0IA 2H5JA 1N6KA 1GUFA 4RPHA 4JJKA 3B1JA 1E9DA 1FFSA 3H2KA 4MWDA 4D81A 2GPJA 2X7JA 1CXZA 3CW8X 1GTG1 4GBED 4PO8A 4CV2A 1LUAA 4E70A 4AMYA 2EZ8A 4FZJA 1RXVA 1EHYA 1ZM9A 2E4VA 2M6RA 3MJVA 3VZCA 1B3RA 1XC7A 3RAGA 4QQ8A 1MB9A 2QTTA 3UAVA 1NXXA 1JEJA 3A6HA 3EZ9A 1IK6A 4S1PA 1KAHA 2XYRA 2VT2A 4NP6A 3EGDA 5LP6F 2QMHA 4NI5A 3UYLA 1R8SA 3ZWAA 2QKYA 4G1BA 3PDIB 1PYOA 5DGXA 3SCZA 4PLPA 1DV1A 4QGGA 1USIA 4COKA 1VGRA 4JLBA 4A8HA 2GN4A 4ILEA 3SYLA 2AJLI 2ZVPX 4NMWA 4JBYA 3K30A 2GRUA 3F4BA 2AFHA 3EC1A 1GU1A 1VHTA 4OMDA 4Z9FA 1ISSA 1L5RA 4EVRA 1OLXA 1OFUX 3CH6A 3S7TA 3LIIA 1RQ2A 1DEOA 3UVEA 4B2IA 1JEYB 1QGZA 3RYTC 1TUBB 3ENVA 1MXHA 2GNAA 4GNRA 1E1KA 4LGVA 3CUTA 1IWPB 4RVGA 4JX8A 4JROA 4KXFB 2Y4OA 3V2HA 3KOZA 3QJYA 4DQ0A 3AF1A 1FU7A 2Z5VA 3W4IA 1F2UB 4AMVA 2AL7A 5FFFA 5TMDA 1X94A 5K0JA 2J9YB 4ZQEA 3BL5A 821PA 4WCDA 4L9AA 3P8ZA 4BX8A 4GO1A 2NXEA 2ODPA 5KWJA 4IIFA 1IWOA 1U8YA 2JGNA 2D2EA 2YWCA 4MLDA 1P6QA 4JB8A 4V0LA 3ZH9B 4F46A 4R3WA 3HKDB 4BDSA 3RRBA 4DIMA 5CA1B 1QHNA 3ETJA 4IJVA 3ZG6A 2CJPA 5DLDA 5KDLA 3WNZA 2PCLA 4FDTA 1Q7EA 3SS8A 4QOSA 5FBVB 1X9IA 2YFQA 3OQ6A 4O4JB 5BWCA 3LNCA 3SYMA 3AESB 4MHOA 3I5AA 1KIMA 4XM1A 1W85A 5EPOA 4DBLE 4AIRA 3DC7A 4OQLA 5D5PA 1K4MA 1TKAA 5C51B 1A76A 2NW6A 2H7CA 3CX8A 3K16A 4EHAA 5BPHA 3EVBA 3BXEA 3OX4A 3WLPA 2VLBA 2ZUDA 3R5KA 4H6PA 2HNBA 5LU9A 2WZDA 1Q92A 1U3UA 2W93A 4BJ3A 1Q77A 2VJOA 5C80A 4DB4A 2JIZA 4JQCA 1QM5A 4O02B 1W6RA 2PN1A 3A27A 3UG6A 1JKJA 1X1TA 1D09A 1WUTA 2J0UB 4RL6A 2PH7A 4IFTA 1K7CA 1Y8CA 2OV6A 4JXJA 1LK7A 1TM7E 1L5FA 1YOVA 2E85A 2KQUA 2VUHB 4R9VA 3L84A 5BT9A 5LLSA 3RHSA 4D99A 3FUVA 4Z49A 4NPHA 4RZSA 3ZE0B 4IEFB 3GGDA 2BEKA 2GBLC 4IKEA 2BM9A 4FMCF 1VJTA 3GAAA 4DEYA 1M8JA 5KOHA 3KETA 3GLRA 1H65A 5CM9C 3K5HA 3AP1A 3G82C 1JQLB 4I4TA 1K3TA 2X19A 4YLGA 4HUTA 1IN7A 3DZGA 3ROMA 2WKRA 1JPVA 4EGFA 4U7HA 2XDAA 3AV3A 1XAHA 1CUXA 2I6FA 3UN1A 5KNCH 1MJGM 1H3NA 4I1SA 1DIOB 2DUJA 4EMSA 5MN6A 2MWMA 1FFCA 3FPFA 1X9GA 1Z38A 3D4BA 1VCMA 1YRYE 2Y0PA 1VSVA 2QX4A 1X1CA 5DK6A 3VO2A 1R88A 1GDHA 3C98A 1VPEA 3S3TA 2ZYGA 3FVRA 4C07A 1KZ7B 2XUOA 2DXIA 1VGQA 1Y1SA 3D43A 2Q3LA 3FUCA 4TXHA 3JZDA 4XDZA 3D1LA 2WOOA 2W4MA 4DMGA 1DU4A 2ZJ6A 3ON5A 4IF4A 1FF9A 2ID9A 3CS3A 4H7FA 4LDNA 1E6CA 1RD4A 1YONA 4MS4B 3IUBA 1I4EB 5AYVA 1CR1A 2XJ4A 1ZD2P 2FQQA 5HS6A 3O3OB 4A8JA 3L02A 1KEWA 4WCFC 3F67A 2XECA 4TT8A 2NT4A 4XFJA 4GW3A 1ZJ5A 1NNI1 2C59A 1Y42X 3RU7A 4UUNA 1U3FA 2P6RA 1X7HA 2VQEB 1EEHA 4C4XA 5CFOA 4UTOA 4U00A 1LPNA 3DFZA 4RMJA 1D4FA 3AGQA 3UFXA 1BDJA 2BUCA 3TNFA 2QE6A 2F9MA 3D7MA 4PW0A 5FXMA 5DULA 3UJCA 1H2YA 3EIWA 3PKJA 4NYMQ 5KTMA 3LQ4A 1P9OA 4DLBA 3MS7A 1ZN8A 4R5MA 5G3YA 2YJ4A 3P0IA 1OXVA 3PFIA 1FPMA 2R1TA 1PT5A 3BMOB 3RK4A 3CNQS 5FPHA 1A9ZA 4G5YA 3RM3A 4OI1A 3FVTA 5HZKA 2A57A 2QS9A 2GNPA 3PGKA 2QR3A 3R6TA 4ZOCA 5CAEB 3ZU2A 3OIGA 5REQA 5LLTA 1G20B 3KSRA 3VJKA 2C4MA 1D2AA 1A8PA 1HE8B 3RWOA 4ETIA 5JXWA 5K2OA 4JYMA 5EXTA 1FY2A 1FK8A 2AG8A 1ZL2A 2WOJA 3TPCA 4K0KB 5TC4A 2V96A 4MITA 4QYMA 2RKBA 3D8RA 4OATA 5F2NA 3TWOA 4N6NA 3TTVA 1KGSA 4KE6A 5C4MA 2AFHB 1UP6A 3QNMA 5A3SA 4TLDA 4Y2TA 3TSCA 4K1LA 3FIJA 3T4PA 2VRCA 3ESRA 3C5WP 1KTVA 2PBRA 2X4GA 1CQIB 5HKLA 3MFYA 1WXQA 2PKQO 1R6XA 3JD1A 4BXOA 4CL2A 2QTCA 1OV6A 2EIHA 3IHLA 3WWDA 2ZUWA 4LBVA 2KI5A 3HXOA 1ISRA 2OWEA 4A36A 4NE2A 3COVA 2XUFA 1JDBC 3M6WA 2V7QD 1YC2A 4OB7A 5HFAA 2CF5A 3DHVA 4YNBA 1H9AA 3SGLA 5DGDA 5AW0A 1KO5A 1SKBA 3H2YA 3QWBA 1FLVA 3MCVA 5IVDA 1SUCA 1VE3A 6PFKA 2QAIA 3FI9A 1LNZA 3N2IA 3L4BC 4OLJA 5EJMA 3VKFA 2AKEA 3ETHA 2H18A 4M0KA 2KPOA 1RMQA 1AIPA 3IX7A 2QNIA 3O94A 2PGOA 3VNUA 3IL2A 5FTKA 3JWJA 3ZW9A 5FAXA 4YXFA 3OIVA 1WZIA 1TX4B 3D4PA 1ANKA 3FZYA 3LS2A 5D3QA 3R74A 3BMNB 3U1BA 1D2CA 4L2IB 1JV2B 2FUCA 4BO8A 2HLHA 3K0KA 4OAQA 4UOZA 1H5QA 3HR4A 1AHHA 4DSUA 2BMFA 4M3NA 1UAAA 1S7CA 3QMMA 2WTBA 1TU4A 2GK3A 2DOKA 2IHUA 2G9ZA 3KOUA 3L7LA 1XYGA 4UC0A 3SC2B 1EFDN 1EI9A 2QB5A 4M9SA 4NV3A 1BYUA 5DYWA 1D03A 4ON9A 4BYGA 4EJFA 2I7TA 3U31A 2RI1A 2ZAYA 1KE2A 4D9NA 1BE0A 2BHSA 2PVCA 4IUYA 1RRVA 1TIBA 4OQMA 3GI1A 4HQKA 4OB6A 4Y3UA 3SY8A 1T5OA 3RABA 4LSWA 1EDOA 4I4CA 1P73A 5TGTA 2AXPA 4OJTA 3E9NA 3UIEA 1NU6A 2QR2A 3HS3A 3R5SA 1APBA 3H5VA 1LPAB 1LF5A 1QHYA 2CLFB 2GYUA 1FMFA 2AMYA 3DTVD 3W1WA 5LU8A 4LVOA 4U7TB 2FCAA 4AJJA 2VTEA 3H9JA 4KSCA 2WU0A 3RTGA 4JSRA 3DM5A 1A77A 1V2GA 2WJGA 3EK2A 4PQFA 4QU0A 2OO5A 1KI4A 5ALPA 1R37A 2OP1A 5LMCA 4M53A 4RUKA 2Q5JA 5AQEA 4YP7A 2P9FA 5B7NA 1MDFA 3CB2A 2JFPA 1JJ7A 2OQRA 6REQA 2QM3A 2PH1A 3AZQA 4J29A 4G8BA 2GMWA 1DT3A 2IDKA 3QEBZ 3G7NA 3OZUA 3ZY2A 5LQKA 4K3VA 1NM5C 1RYFA 5DT9A 5DLQC 4AKGA 1QE0A 3DP9A 2IQIA 1CZUA 1YR6A 3H4TA 4FKMA 3B1KA 4EEKA 4O4JF 5TQ2A 1MJGA 4FYHA 4CEIB 2GCEA 3RUEA 4GPIB 5AI4A 4IH1A 4B6SA 1ZJJA 4ALNA 2DR0A 3L06A 3DFFA 4EJ2A 4JC5A 4V02A 4C01A 3AKZA 2ZS8A 3TL6A 1VI6A 3EVFA 3CX7A 3WNCA 3OCWA 2BV3A 1T6BY 1MNQA 3K20A 1V1MB 2NSDA 4GX2A 4KQMA 3WA6A 3O93A 5EHQA 4PEVA 3L7OA 4FN5A 1T2CA 1NW5A 1NUUA 1HTBA 1YBHA 2JGIA 3K9QO 2BFOA 3Q9LA 4EVIA 5LQDA 3FOFC 1WB5A 3AT1A 3DAYA 2V45A 2C58A 3FETA 5AUPB 2J3LA 1OTYA 2O59A 1NVTA 3H5LA 2AOTA 2ZREA 2I8CA 4JLSA 4UUAA 5J40A 5ABPA 2C2KA 1EHIA 3PNKA 1RT9A 4OMUA 4KO8A 9ABPA 3RW9A 1DC6A 2X7HA 2PKRA 3WMWA 1VL5A 1K0UA 2OAGA 1Z56C 1OFIA 3I0NA 4Q1EA 1T1GA 2FEAA 4CLOB 2GDZA 2WMYA 4Y18A 5AI0A 3A1CA 5EP3A 5FBKA 4JI3B 1QQ7A 2YC2C 5E6UA 1WAMA 2B7BA 5AVQA 2X5OA 4J0DA 1H8EA 4M9UA 5H3CA 2Q4TA 3PWZA 2I2CA 4GPTA 3ZC3A 5EHNA 2IYTA 2GXSA 1CF2O 2CXHA 3JY6A 3M6IA 2PZBA 3K6JA 4GOKA 1N3YA 3Q7QA 1XCJA 4MRVA 5EKTA 2C7GA 1UC5B 4DQUA 3GLFB 3GA7A 2O4CA 2C9CA 2R86A 2XQGA 1DDOA 3I76A 3OBIA 2JCYA 4OU5A 5HPYB 3KZ1E 3JVUA 4AQDA 1TTTA 2NO4A 4TWIA 4M1ZA 5IM4A 4MVYA 2AN5A 1OF1A 2Q9UA 5ICFA 3BXGA 4S2EA 5C32A 5CB4B 1JFVA 3ETLA 3I8OA 4X1OA 5BOVA 1JHPA 3MUNA 2PUAA 2FPGB 2W4IA 4GLFA 3KAPA 3W3ZB 2C9YA 1M2HA 4RVFA 1N2JA 3WOVA 1UQUA 1I7NA 3Q8LA 4HBGA 4NRDA 1GZUA 3G02A 3ONVA 1UBGA 2QGZA 2ZAIA 3WAGA 2ZWMA 3T7DA 1G2PA 1RAIA 3IXQA 4KI0A 2C9BA 3NBAA 5LB4A 5K8UA 1QKIA 2I7VA 4LZZA 3QA3E 1GPH1 1MLDA 3NIBA 4ZO4A 5BQPA 1RI3A 2I22A 2OHGA 3QEAZ 3LJKA 3LX5A 2G63A 3C8ZA 4IXTA 1UPFA 2PO5A 1CEXA 1P1HA 1W4RA 3P2IA 2WRZA 4EWLA 3ORRA 4DUPA 2HOQA 2YH2A 3P1JA 1H69A 3LVFO 4G41A 4IVPA 4M89A 1X7WB 5WRFA 1Z7BA 3TTUA 4G5HA 4R2IA 4BRUA 3K8YA 2W8BA 3ZEAA 1HSOA 2IPLA 4MAAA 3FCYA 4EITA 1QS0B 2FVYA 4IHQA 4KQKA 1QX4A 4HB3A 1JKIA 2OXEA 1BHO1 3PKIA 4BB0A 3LLMA 2G9NA 5K0CA 2E3JA 1KDRA 2XAAA 1S96A 2NSLA 4FSXA 5B6JA 1XGKA 1VA4A 3AHIA 4X54A 4B76A 3I6ZA 3ROTA 2B9EA 4G56A 1Z73A 3U4GA 3B9QA 1F5NA 1FSFA 1Q84A 1SUPA 4JNCA 3PG5A 4UZSA 3LCUA 4XEUA 4KCGA 1I80A 2IZ6A 3M5WA 3NJRA 3GXOA 2GJ8A 2XUQA 3HVKA 4MTLA 4BQOA 2R8BA 1IBLB 3GPCA 4WSOA 3FBWA 3PNYA 3RVBA 1G63A 2B5OA 2C2WA 2CHVA 3NBFA 1RABA 3EEBA 2Q9BA 4Q9NA 2HU8A 2GPNA 1WMDA 3B9PA 1TUBA 1WWKA 3CZ5A 4IAOA 4XYMA 5JOQA 2R5FA 1GDTA 1XB2A 2QVBA 5A3JA 2PR2A 1PJRA 2B1QA 2DLNA 4OI2A 4XR9A 1YQTA 1KU0A 1XZAA 2HDHA 4A4DA 2QSZA 3E7DA 4KR2A 1NP7A 3IV7A 1EX9A 4G25A 1UM9A 4XFDA 4NBUA 3IAFA 2BGRA 1PP4A 3V7UA 3CQ9A 4DTCA 3GDFA 3M1AA 1DNPA 1V43A 5A4JA 2LPMA 3DCNA 3H9UA 3JV7A 4BMZA 1ORRA 1VZ3A 3V8RA 4UAJA 1G3UA 1K06A 1WEKA 1Y34E 1L3BA 2ZKIA 2YWBA 4FK8A 5CFPA 4C6TB 1MB2A 1G6Q1 1U0SY 3I52A 4WZBB 1SVOA 3GH1A 2ETVA 4G0ZA 2H1FA 1FNDA 2IYSA 4X71A 3FSJX 1POWA 3LT5A 4X1IA 3RSQA 1IBSA 1MOPA 3SBOA 3IKTA 2O50A 4BO9A 2HRDA 1JX6A 5EVCA 4D4IA 3LC2O 5JNSA 1XMSA 3DXFA 5JSFA 1GPJA 3ZUGA 4D0LB 1ZH0A 1QCCA 3RBXA 3SSMA 1ZGZA 4PLFA 4HS9A 3EVDA 1Q50A 4CKWA 3JZFA 4HC4A 1DJLA 2KMLA 4G1CA 5FH9A 2ONZA 2XUHA 3HNRA 5TQ0B 2PV7A 1X7DA 3TI7A 5BRAA 1J00A 1RJWA 3O4GA 2CMKA 3MINB 2VHUA 3H6HA 1KJNA 4F9GA 1PR6A 3C5VA 2AF4C 1HQYE 1LI5A 3FKQA 3KKQA 3ZZ1A 1RM0A 2P6NA 5I9TA 4DUYB 1CEEA 4EDHA 3C3CA 2BLNA 1UMBA 2B1IA 2ZR9A 1LSOA 4CM8A 1U3CA 3TOSA 2YXNA 4IV5A 4D8XA 3U3XA 2P2YA 2VWPA 2XT6A 3N2EA 5I7FA 4B3IA 2CEAA 2PRZA 1PN3A 1YOVB 1GZ3A 3RS5A 1BXZA 3PQ7A 4N3CA 1I32A 2IVFA 2H2HA 4UM9D 5F7JA 3TQQA 2VYVA 3OZGA 4Q7MB 4QNMA 1NYLA 5DM2A 1OT3A 1YZYA 2Q27A 2X5JO 4B9AA 2FZEA 4AN0A 4PG5A 1K63A 5LJIA 2EZ9A 4N82A 5JSYA 4TSRA 4UUQA 1GT91 4C7BA 3FYUB 2FETA 4FVTA 3BS4A 2X2EA 3EFBA 1GQOA 4UNNA 4HJXA 2GXAA 2WG2A 2Z6AA 2TMDA 1Q0QA 3T38A 1SH7A 5G1NA 5KJEA 3PSAA 4YDRA 1KZ9A 3VPSA 4AZ0B 3JATB 5CLQA 3E70C 3E5NA 3GP3A 5BR4A 3M1LA 2QTNA 2GWHA 1DBPA 4RZ3A 3EPLA 1Q15A 3PDIA 3LUKA 1HLDA 2NSHA 4LX0A 1BX1A 4S1VA 3RUFA 3KVNA 1S0UA 3AVQA 4G86A 4IX9A 4NJOA 3ZWOA 5FBRB 3SE7A 4RPGA 2ZS7A 3WGGA 2Y9MB 4IRMA 3QU5A 4XR4A 4NY1A 4IO1A 4BWVA 3RBAA 3AB3A 2WJVA 4UZFA 4W5WA 1KOJA 4WBNF 4JUFA 4OOEA 2VL7A 3ZDBA 2HCBA 2AC2A 5GWXA 3SEZA 1OPRA 1H3FA 1RKVA 4L4SA 1GUDA 5M3BA 4FINA 4B3DA 5HWSA 2V7QA 3N8HA 1PTKA 1GCIA 3IMGA 4B83A 1WA5A 1Z29A 2ECKA 3I39X 3OCYA 2IH2A 3L6RA 3AEQB 4OGLA 1M7GA 3D59A 1EBUA 1Z8HA 1JBEA 2EWMA 3QVWA 2NVUB 4RFLA 2FFRA 1BD3A 4MMXB 2PWBA 4U6NA 1ZIOA 4KWIA 2QD2A 4QYTA 5D00A 2CFIA 5LD2B 3KPJA 1WX1A 2VR1A 4CDMA 2XDQB 2OSBA 1L7EA 4FXOA 2YZ7A 3TJMA 5LA6A 4FZ3A 2VTKA 4L76A 5COAA 4X61A 2FVXA 4K9DA 3FIUA 1OFHA 1A9PA 4B6QA 5AESA 2IXDA 5MN4A 4L7QA 1XZFA 2LZ0A 5DK4A 3A0UA 5SZKB 3GGCA 3SSOA 2N46A 2ORED 3PXGA 2PRJA 3UWMA 1DC8A 4M88A 2JDID 4JLOA 2OCGA 2X76A 3IEUA 3QM1A 4R51A 4YYEA 1BDBA 5EJ7A 1MO5A 1JIKA 2NTVA 2NAPA 3NP7A 3FPAA 4LRWA 3V4LA 3OU2A 3BUSA 2G25A 3AJAA 4EI7A 1ODKA 2H63A 1ONNA 3QE3A 3ILHA 2QP4A 2CYBA 2OXRA 3DKIA 4CLOA 1ORTA 2A5LA 2W2KA 3IPAA 5CG2A 2EJWA 5KNDA 3Q12A 1U7OA 2L82A 2WYIA 1R27A 2P6OA 3GN1A 1Z83A 3OC0A 1CYDA 3IESA 5GADl 4CTMA 1NP3A 3B82A 4PYNA 1ADBA 1O97D 4KIJA 1KJJA 2ZDGA 1N7GA 4MW1A 5AO9A 1MN6A 1U04A 3NG1A 4XX1A 4HVAA 1ULSA 3WWCA 3O8NA 4B3JA 1VRVA 5ALOA 3WLHA 4OJNA 3GLIB 1IM8A 4CI9A 3N0WA 3R0IA 3TGPA 5FUVA 3TQHA 2AD1A 4YMVA 4FLMA 7GPBA 1NMZA 1SBNE 1L7PA 5BV7A 1KYIA 2EEPA 2IHJA 1SGWA 2AOXA 5H80A 1IJEA 1LPBB 2ODWA 5F35A 3NW9A 2HW8A 2V8OA 3CNHA 3U0BA 1RCTE 4D44A 1Z0AA 3LDFA 4G1FA 5C34B 2BSAA 3W2EA 1AQUA 1XKTA 4O0MA 3AVUA 4YPVA 2W48A 4C4AA 4CKBA 1YVEI 3KQKA 3E3LA 5FA5A 3L7KA 4YT5A 5EUCA 1WMSA 2AB0A 2Q2WA 1T26A 4UMEA 1H5UA 3O9VA 3FWPA 1Y5NA 4O2AB 3T99A 3EY4A 2QSYA 3NRCA 3ZCQA 4CEHB 5ICGA 2MSCB 5HILA 3T0GA 2Z9BA 3MUEA 1Q11A 1VMEA 2POCA 4GXNA 4QKQA 3CRZA 1G18A 3OTWA 5B37A 1JDPA 2ZULA 5AI5A 2YBEA 2F2TA 4RMNA 3Q3VA 1DC4A 1BE8A 2CMHA 2VUUA 3A31A 4ZVMA 1MGOA 2DTXA 4JJIA 1CB0A 3EDOA 4JXXA 1U2DA 1P9WA 3G9TA 1DL5A 121PA 2NPIA 3C0KA 4FR0A 4X5OA 3T1OA 3TB6A 3AY0A 2JGFA 4KSBA 4D0NA 3TF5A 2ZIAA 3G9XA 1LJUA 2BEUA 3QVTA 4YRGA 3GA5A 4PLCA 4OHMA 4LJ7A 5JU6A 5KWIA 3CRQA 3GMTA 1Z2DA 1BS2A 4GWKA 3E15A 2WYUA 4G5GA 1AQLA 2HJ9A 4MUKA 1YA6A 1BX3A 1DT5A 3C3EA 4EABA 4QHTA 3MA0A 3QPDA 3QNWA 4N8DA 1Y1RA 1WG8A 1TM5E 1D1SA 3QU2A 5K03A 5KTNA 4JFRA 1GQRA 1NY6A 3VR0A 3NETA 2QTRA 1KQ3A 2QE7A 1H42A 1L5VA 3HL0A 2WUVA 3HFSA 4UJ3A 5HE8A 3SD7A 3ROKA 4KO3S 3LHFA 1HE1C 1MV5A 3R23A 1KORA 4O1HA 5YASA 4F1WA 5LDDC 4U2FA 1HFKA 1ICIA 3TRDA 4Q12A 2BAGA 2VATA 4RDHA 4U2EA 4A6PA 1EP9A 2ODBA 3NAMA 4ER5A 3FVWA 1JBKA 3CN9A 2ZJBA 3OLXA 2CGEA 1TRHA 1QF6A 1JL3A 4GLLA 1X1DA 1PL7A 2XZPA 3IKLA 4LHVA 4E88A 1T5HX 1UR5A 4B4UA 2W7TA 1V1JA 5DEIA 4DNPA 3JALA 4XSHA 4MVJG 1VFNA 1V8DA 2OZLB 4DRYA 1YBVA 2IZ7A 3ADPA 2VNAA 2PU7A 3TQFA 1DIHA 4QUAA 2GA8A 4NR0A 4GF5A 4XH9B 2ZJOA 5EQFA 3PFBA 2JI9A 3FXAA 5EE5B 1R74A 3TLMA 2HPAA 2IP2A 5BMVB 2ZJ4A 3CFYA 2WWWA 1GPNA 3CZMA 3X43A 4DQLA 2AF3C 2AG1A 3SOZA 1HDGO 4RNCA 2HRZA 5AHOA 4LBZA 3Q85A 3VMFA 2C4UA 5T4BA 3SZ3A 3M3PA 3T3NA 4DHEA 1SCJA 2FPRA 3LHDA 5AJTA 4AXXA 1AXGA 3AY6A 4P98A 3DKRA 2B9VA 3ZE2B 1NX6A 3OPYB 5TQ0A 1AGNA 3IRUA 4W7SA 4W1SA 4GOXA 5LA6B 1UPTA 3K0FB 3PEWA 3N0RA 1VJCA 4V1CB 4WZAB 1ES9A 1QUFA 2J5KA 3OZWA 5F9MA 5L45A 1B3BA 2ZROA 4H3SA 4TQGA 1W8IA 3ENZA 5K8JB 3AETA 1Q95A 2VJKA 4C05A 4KFTA 1Z08A 2DR2A 1EFKA 2II6A 5G41A 2Z3ZA 3BH7A 3I3SR 3BWVA 1I51A 4KDEA 1PHRA 1POXA 3BGOS 3N07A 3K09A 1YGYA 1OH6A 2MYNA 1K6EA 1RYNA 3E58A 1AGRA 3OFNA 2GHIA 3U3OA 3O31A 4DOMA 4BEWA 4OPMA 3Q8WA 5F73A 1R15A 4HGQA 2JFGA 2ZE8A 1F8GA 4N0PA 5JEDA 5H0IA 1UODA 4HFJA 4XWWA 3FDZB 2NV6A 2AMLA 3F3MA 4D42A 5CNKA 4O1MA 3RSFA 1N5JA 4F4JA 3VPXA 5A03A 2DTDA 3JVIA 4KXQA 3CA8A 1PWYE 3ZJ4A 2XKAA 4ER3A 3ORQA 1EA7A 5KHLB 2OE2A 2RAUA 3USCS 1AUPA 1XR3A 1E2EA 3K4QA 1WCV1 3IOCA 3NBUA 4S1TA 1V96A 1A8QA 2WJZB 2YMPA 3F8SA 1M1YE 4MULA 3WLKX 4A8TA 4BKUA 4DLWA 3U5TA 1JFFA 3ZJTA 2UUOA 3C24A 3D1JA 3UA4A 1M33A 2A88A 2WUEA 3FZEA 3HDYA 5FUXA 5HQJA 3VPDA 4BO0A 2V98A 1CUWA 4ZDIA 1I7QB 2P68A 2FEPA 5LZ4A 3RHZA 4ZOQI 3RSOA 1T10A 3PFKA 4GP9A 3SOPA 2A9QA 3F6BX 4JJZA 2YL2A 3HJGA 4WZAA 3ZDXB 3K5PA 5B2ZA 2RGBA 1QGUB 5FJIA 3UO8B 3VV2A 4JJFA 4W1PA 5DYTA 4DR2B 4XWGA 4AMUA 1NUQA 3ESZA 1L7OA 1ZU5A 3NHBA 1QR6A 4XYBA 2O48X 1ZJYA 4A23A 3FPLA 4WL0A 2IIBA 1PW7A 4R8MA 1YNOA 3HPQA 1UMCB 3GJRA 1KYXA 1I01A 1P0QA 3MWYW 4G5RA 4CFSA 2P4EA 3CLUD 2ID8A 3ABOB 4XLTA 3C7DB 1KDVA 3FNRA 3HA3A 3CKMA 2AQ8A 4DIBA 2O20A 4ENRA 4R5HA 1REQA 3RQIA 3ZI0A 1D1PA 3BDVA 2O8BA 3JWPA 3OKPA 4QXRA 1QK3A 3K2IA 4RA9A 4E4YA 4NLLA 5AXDA 1JW9B 4JSTA 2PMWB 3LSYA 2ZQZA 4M76B 1L4GA 5J4LA 4TN5A 4URFA 1XQYA 2IYPA 1VSQA 1K1EA 1KFEB 2G77B 2I71A 4S1NA 5JWOA 3IIKA 1UFVA 2OC9A 3IUMA 1EUCB 1PQ4A 1RCUA 3TCNA 4E6PA 4DV0B 2QP9X 4DCCA 3NKLA 1Y89A 3B48A 2V55B 3PYXA 1E9VA 4C88A 4IIJA 3KFLA 3PHBE 2GR9A 4O2LA 3SZUA 1GRQA 2WTEA 4TV9B 4WOKA 2ZZNA 2YWHA 3H05A 1IOLA 1F3LA 2R6CA 3GBSA 4KQ9A 1ZGGA 3FPHA 4X44A 7REQB 5JJ5A 1O54A 2EJUA 4OMCA 5EPEA 1G6KA 1ZUIA 2A5JA 3UOAB 3V4ZA 4X8LA 5ECGC 3ICEA 4MQ5A 4FMDB 1JU3A 2K4MA 3N2KA 3GEBA 1FRVA 3YASA 2JFZA 3IP1A 1BU8A 2W6PA 1JQBA 2O1SA 2ZRMA 3LV8A 5JPDA 3DEZA 3V9AA 1F7UA 3LY9A 4AJHA 4F2WA 2IU3A 2ZETA 2C0CA 3FCEA 3KTDA 4Q18A 1N2IA 2PYDA 4PRLA 4R2JA 4H77A 4ARCA 2UUCB 3IAS6 2C97A 4BQQA 2QN3A 2V9ZA 2RGNA 3O84A 5T6MA 4JJ6A 2X6RA 3LL7A 4Z4FA 3IAM1 2CLDX 4JV5B 3OZSA 2J9XB 1YQ9A 1LC3A 5ANRB 1YQUA 1C7IA 2PSHA 2YN4A 1I6KA 1HEUA 3DMHA 3GJSA 3I09A 3L5OA 3NHZA 4R16A 3WE7A 4DJ5X 3DE4X 5GONA 1ZD5A 3FYSA 4ZCPA 1NUSA 3UQYS 5G4LA 3WBJA 4G6ZA 2X0EA 4U2CA 4DIDA 4GVLA 3HSYA 1G60A 1DELA 2HB6A 3B51X 3RBVA 3QLVA 4LZNA 1DZ3A 2WU4A 3R8CA 3SDSA 4PX5A 3SR3A 2CXUA 1Z6TA 3U9TA 4KLZA 1NA5A 4KE7A 1KA9H 1Y0BA 4AUEA 6NULA 4E22A 3BIOA 3X44A 2EJVA 4GEGA 3T5GA 1FP7A 1XPUA 1RXSA 1TMGE 3OVMA 4RQAA 5T8KA 1M83A 2PT6A 5JSKA 4PZUA 3EQ8A 4FX2A 2O06A 2WFLA 1RZUA 4IYRA 1GD1O 4FEYA 521PA 3OX3A 4D0RA 1P5JA 5KHOC 1RWNA 2PSJA 3WP1B 4NTZA 4ZV7A 1ZMBA 1Y6GA 3FF4A 3I9V6 3COPA 4H3VA 1QBKC 1TK2A 1WQ4A 2ZYDA 3T3MB 4AKTA 1CHDA 3NKFA 5KB3A 5L4SA 3WNVA 2FA9A 4KO4S 3QH4A 5LXTB 1ZDMA 2FXVA 1TA0A 1CUAA 2YKGA 2XJ9A 3U61B 3L9WA 2D59A 4ABTA 1ACMA 1O96A 5FPSA 4DJFC 4DXAA 1VE7A 1Z6YA 5BR1A 1ZMRA 1DTWA 1N32B 5E2AA 2NYAA 1LKZA 3MAJA 2FG7C 3C7TA 1C7ZA 1R0BA 3V4VB 4YRMA 2B2NA 5JAHA 1MRSA 1PKXA 5ESWA 3SHOA 3HXTA 3RYFB 4Q6BA 1M8PA 2ORIA 3EZ7A 3AW8A 4HQ0A 2O2CA 4MYHA 3T7KA 5HKAA 1P2FA 2SKDA 4CU2A 2GVZC 3ZK7A 3FDZA 5JCXA 3ICPA 2MDTA 1M1ZA 2ID4A 5JPCA 5P8WA 5HIMA 3RT9A 4KQEA 1P8JA 5EC8A 3QUSA 1FIUA 1DARA 3SKXA 4LDPA 1QZZA 3KO8A 1X6VA 3TK1A 4B4OA 1NG9A 3WB0A 3NALA