3K2QA

Crystal structure of pyrophosphate-dependent phosphofructokinase from marinobacter aquaeolei, northeast structural genomics consortium target mqr88
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
418
structure length
392
Chain Sequence
IKNAFYAQSGGVTAVINASACGVIQTARKHPDQIGKVYAGRNGIIGALKEELIDTSLESDDAIQALIHTPGGAFGSCRYKREYERLIEVFRAHDIGYFFYNGGGDSQDTAYKVSQLADRMGYPITCIGVPKTVDNDLPFTDCCPGFGSVAKYIATSTLEASLDIKSMCETSTKVFILEVMGRHAGWIAAAGGLAGQSEGEPPHVILFPEIPFNREKFLERVDQCVRDYGYCVVVASEGAQYERFGVAPALANMVKQALGHKYHWAVADYLQRAARHIASATDVEQAYAVGKAAVEMALAGKQALMPTIVRDQAKPYRWSIGEANLSEVANQEKKMPIHYITDNGFGITQDCRDYLQPLIAGESFPPFDDGLPRVAKLKNQLVEKKLRTEFEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyrophosphate-dependent phosphofructokinase
publication title Crystal structure of Pyrophosphate-dependent phosphofructokinase from Marinobacter aquaeolei, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET MqR88
rcsb
source organism Marinobacter aquaeolei vt8
molecule tags Transferase
total genus 134
structure length 392
sequence length 418
chains with identical sequence B, C
ec nomenclature ec 2.7.1.90: Diphosphate--fructose-6-phosphate 1-phosphotransferase.
pdb deposition date 2009-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00365 PFK Phosphofructokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3k2qA01
3.40.50.460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3k2qA02
2F2TA 4A3SA 1PFKA 3OPYA 1YDHA 1ZXXA 4P5EA 1WEHA 2HIGA 3UQZA 4WL0A 4MEJA 3QUAA 2Q4DA 4NPAA 5ITSA 4FYKA 3U39A 1S2LA 4JEMA 2A0KA 2KLHA 3IMKA 4JELA 4KXNA 1MTOA 2IZ7A 2IZ5A 3O8OB 2PMBA 4LJLA 4I36A 3O8LA 1S2GA 3SBXA 5AJUA 3BQ9A 1F8YA 3HNOA 4KXMA 2F62A 2A33A 4OHRA 2IZ6A 4LJKA 4FYHA 4P5DA 1S2DA 4OHBA 2PFKA 4I4IA 2F48A 5AJTA 2F67A 4U1RA 1KZHA 3MAJA 2F64A 1T35A 3O8OA 4JENA 3PFKA 3OPYB 1F8XA 4HX9A 4PFKA 3GH1A 2Q4OA 4FYIA 2NX2A 1RCUA 1S2IA 4MCJA 4LJRA 4KXLA 3EHDA 4RH3A 3O8NA 2KHZA 3F5MA 3K2QA 1WEKA 6PFKA 4I7EA 1S3FA
chains in the Genus database with same CATH superfamily
2CLMB 4K26A 2HJHA 5HIKA 4D1YA 4RL4A 2HK7A 4JBWA 4GGPA 2FI1A 3A4IA 3A1DA 4D3XA 4BEBA 1UAYA 1GKUB 4OM8A 4MB0A 1E1YA 5IHPA 1X80B 4QBTA 2PDAA 5JZ9A 4R9UC 1QG6A 5JSZA 2HDNB 3PK0A 5TS3A 1CZOA 3ZW9A 4DZTA 4Z0TA 3EAQA 5CYPA 2PG3A 4F06A 5FL7D 1IMOA 2DWOA 1WUKS 4TMWA 3SPXA 3KQUA 2GS9A 3U9TA 3FOZA 2R7LA 1HE8B 1JQEA 3OJEA 4MYDA 4XUDA 2ZE5A 4XYGA 3KSAC 4I2NA 4AKGA 4MJ7A 3PICA 2ZRNA 1MG5A 1M6HA 4LY3A 4XVRA 1GN8A 3I76A 1J70A 1HDGO 5TXGA 2ZJOA 3EUAA 3QKWA 2QSUA 4MUFA 2D5IA 4EF4A 1GU1A 2L42A 4LV8B 4YB8A 1GZ4A 3COWA 5JVDA 5HILA 2WIGA 4RPIA 1WB5A 1JXQA 3ZCPA 1JJ7A 1IDN1 2Y05A 1KDVA 2LXNA 4MA4A 1RMYA 3QMMA 5JCXA 2P9ZA 3CEMA 3L0OA 2H54A 3H8JA 3ZWNA 4C08A 4ZICA 5CB4F 1P4SA 1KJIA 1WXEA 4YTEA 5IF3A 3GAFA 3BSWA 3O0DA 2VPPA 3CRMA 1TLLA 4CL3A 4YP1A 5B4TA 3LQ4A 1LWNA 2ZM6B 4M6WA 1C14A 1ZESA 3AMVA 2F4VB 1WDKA 4XAQA 1TVEA 1DCKA 1W88B 1RAEA 3B1FA 3HABA 1I3LA 5AYVA 3W8NA 2ZBRA 3O73A 1TJYA 1TAHA 2LDBA 3R24A 3BFJA 4AIRA 4K1LA 5AD1A 1OLXA 1OVGA 4LVNA 2CJYA 5T7BA 1QVRA 1CY2A 2GBIA 4B3MB 3NP7A 3CZPA 1U0TA 1L5HB 3EVFA 2CK3A 3CYFA 3LIPA 4NPHA 1JPJA 3W2FA 3MTEA 5IEBA 3P4XA 3L1UA 2EZUA 3CBGA 4B8YA 3DAGA 4NEHB 4WHMA 1L6IA 1NWHA 1TUBA 1NULA 1QPGA 5DRTA 5F52A 1JMYA 3O5AA 5E8RA 4B7AA 2OCDA 5BV8A 2O6HA 3OPYB 1V6CA 4E3WA 2ZT7A 1AGNA 1B93A 3OU7A 4TMKA 4CDMA 1FW8A 3KWFA 3QH4A 1Y3BE 3IUNA 2O3QA 1EVYA 3EIXA 1ZCBA 3L6DA 3WNZA 3KOXA 4BNXA 2HLDA 6YASA 1LCIA 1FRVA 1SUPA 2ZATA 5LJIA 5DX0A 5L7TA 4JFRA 3LDAA 3WAKA 4TTVA 2A9JA 3BHJA 2ZJ5A 4TS9A 4M76B 4B0PA 3A26A 4CHGA 1CY1A 1F2UB 1NR1A 1UBHS 4L9RA 3EEQA 5PGMA 1N3BA 3T52A 1XNRB 5MGNA 1TMYA 3KJEA 3N7AA 5CRIA 3IPXA 2O20A 2OM2A 3FVWA 2NZ2A 3L04A 5CG2A 2X0FA 3UT5A 2K2QB 3U37A 1YUBA 2OBFA 5A4DA 1U8XX 3K1ZA 5FTNA 1E1NA 4ONEA 5EE9A 9GPBA 1CQZA 1REQB 1N6NA 2QOEA 3II6X 5CEEA 4M0KA 3IIJA 5A5DA 3L41A 4Z9XA 4RPHA 1XC7A 1TK3A 1T34A 1PW5A 5EZSA 3EGEA 1A4IA 5KYWB 5ER9A 1AS3A 4FEGA 2W43A 3LNCA 4MGIR 2H5LA 3JVIA 3LGXA 3L02A 3A3YA 1QIFA 4M55A 3QHAA 3SS7X 2SECE 4EVRA 4HX5A 4MJ3A 1ZS9A 2Q6TA 3QQ5A 1BJKA 1XTIA 2WFZA 3B52X 3D4LA 3DKIA 3OE5A 2EGUA 3PQ4A 1ILWA 4CM5A 5IVHA 5ALLA 3ASZA 1D2GA 3A36A 4KVAA 3DV0A 3HFGA 4YMLA 3W6OA 3KXIA 4B09A 3PLNA 3SVZA 5FOSA 5DTMA 1QQ6A 1JALA 4PEVA 4Y2SA 3THXA 3WLKX 3RTCA 3NH6A 5CFZA 1G17A 3BRQA 1I3OA 1Y1SA 1DFHA 4BFZA 4BOYA 4C4YA 4EITA 3B9PA 3DOFA 4PZUA 4DMFA 3RS9A 4H1WA 4K87A 4DV5B 4OHYA 2G80A 2EQAA 3KAPA 3OWXA 4EAAA 2J31A 2QLBA 2B0CA 3E9EA 3WO1A 2AFIA 2BUAA 3TAXA 2XEXA 4FN4A 4HZUB 4RD0A 2FF7A 2Y93A 4BWYA 5JRJA 4Q5IA 2A1UA 1P2VA 2Z2KA 3QKSB 1K7EB 3CINA 5LQMA 4C7MA 3PENA 2Z04A 3OZRA 5T41A 2WSMA 2BGKA 3PQDA 4K9KA 2C59A 4LBWA 1YJXA 2WFLB 2JA1A 2QP9X 2QTCA 4I8DA 4Y8VA 1ZGZA 5IAKA 2CNBA 4AC9A 5AVOA 1PGOA 3V7NA 5K6AC 4MDEA 2QMOA 5AJUA 1L4LA 2F9FA 1T6BY 2QTAA 3ETJA 3O8QB 5LOVF 3DF9A 3SLGA 1L4UA 4B44A 4BNIA 1KY3A 1YJQA 2AC4A 3ZGNA 2Z09A 4GHWA 1NL3A 4WVLA 3T4XA 1P33A 2IUFA 4MR7A 4CMEC 3HJNA 1JQJC 4P80A 2I71A 4Y0NA 1LJ8A 2VSQA 3FOEC 4G0VA 1Y8AA 3LX6A 4HFJA 1D2AA 3AQIA 3K30A 3QZUA 2P6RA 3H1BA 1UL1X 1EE2A 1Z4QA 1M7HA 2V7VA 4MW4A 2FPMA 4P8RA 2R6DA 4X93A 4GPAA 1QNLA 2V7GA 3C45A 3FMOB 3QVVA 2CFRA 1TXGA 1NJ8A 1AHIA 2V6BA 2DJ5A 2Z4SA 5REQB 2HO5A 3AG5A 1SOVA 1JPVA 4EZIA 3DDUA 1P1JA 2P6MA 2VOEA 4WINA 3I12A 3EISA 2QTLA 4J4HA 1N6KA 3IMGA 5H8WA 4FFVA 3WHPA 3BXXA 2BMEA 3I0ZA 3PTAA 2ZXUA 2XB9A 2H2AA 4PGMA 2I33A 2YWCA 3DDZX 4AY6A 2CDAA 1J09A 2B1RA 1ORHA 1XEXB 1K86A 2JK0A 1ZRNA 1TFUA 3PF9A 2HA2A 3ZE7A 3PF8A 3U80A 1Q1BA 1W8IA 2ZB8A 2YFYA 3CPJB 4LHEA 5HFAA 5KCZA 1JQ5A 1NBIA 3MINB 1E96A 3KC2A 5C1DA 3ABSB 1Y6QA 2FSIA 2WKPA 1D2MA 4MPDA 4NV3A 3L77A 3ISTA 5DNYB 1RRFA 3CH5A 4BRSA 3WGYA 3UPUA 1SBHA 4ND3A 1M2FA 1XQ9A 2Q28A 3B7WA 2IXBA 1R66A 2FP4B 3IODA 1KC1A 3WTCA 4YCDA 1XMIA 5DTIA 3N2LA 2BHRA 1JR2A 5CYGA 1E6UA 1ZVVA 1IHPA 1H5UA 1UBJS 3NFYA 1EK5A 2GNOA 1CIVA 2TMDA 4ZAGA 1A2OA 1I3KA 1SCNE 4BQQA 2YL2A 1X7YB 2EFCB 4CMJA 4JI7B 1V11B 1ZMRA 5SICE 4EVIA 4NXNB 1T4DA 2EAUA 3ZZMA 5K0NA 2C0QA 1B42A 1Q1QA 1R4MA 3AR5A 4KWHA 2GPYA 1H66A 2QPAA 3ELUA 2E4XA 2I22A 1G2IA 1OC4A 4K6FA 4XPIB 2WKRA 4ZV9A 3RH0A 1FTYA 5EWLB 3IGFA 4BFLA 3ONDA 4YRZA 3ICOA 3EGDA 4IAOA 5TPZD 1VJ1A 2QA5A 3WMRA 1WDMA 3DHWC 3LUJA 4C9BA 4XQ0A 1OX5A 3IHTA 3L7CA 5K3FB 1T1IA 3NYRA 2Q7DA 4DUZB 1S6YA 1B6TA 4YNBA 2H2DA 3LVBA 3CPSA 1M5RA 4REQB 1EZ1A 3D8SA 1DAIA 1A7JA 3L18A 1VSVA 2RARA 3MTQA 4CL0A 1E0DA 3DOJA 5F3RA 2Q8PA 9MHTA 1G16A 1N2CE 5DCLA 2VXCA 5DT9A 4ZQGA 2A0KA 1PTJA 2C4UA 2CDBA 5IDWA 1V43A 1BEZA 3UV3A 4QQFA 2ZWVA 4B3IA 1Y42X 3TSAA 5BVGA 1ODIA 4KQFA 1O4VA 3NJRA 1JSRA 2E37A 4GXTA 3W9UA 3W5BA 2CVQA 2PL5A 3SAJA 4PLZA 3T9FA 1ZW6A 2IELA 5JV5A 2ACEA 1U3DA 3LC1O 2FE4A 2J0EA 2JW5A 1L7AA 4Q4AA 4TVKA 3PEEA 1U4OA 3GFPA 2PPLA 4IMIB 2GN1A 5HR5A 4F60A 1D03A 2BM9A 4EG3A 5KYTA 1N78A 3D2BA 3H7AA 3FTNA 3NW9A 4C01A 4PWZA 2PLFA 1HV8A 3OF5A 3FFTA 1I5OA 1PT6A 4NF2A 3N8DA 2OPHA 4F85A 5LKAA 2QK4A 5ILOA 4L15A 2HBQA 4KN8A 1L5OA 2YRWA 2RBEA 1G19A 2Z08A 2QAGC 3WLMA 2GXQA 3T5MA 4EY6A 4C7XA 2QMEA 3CUSA 2ODBA 5D85A 2AMVA 3OZEA 4D8UA 5BVHA 5HW0A 4KPYA 1HT3A 3HA2A 4LJKA 1KEEA 3QYAA 5CVDA 1WHTA 2X5OA 4GMGA 4XYEA 2DKOA 2HC9A 3LT1A 5D5HA 1NF2A 2IHTA 5DMXA 2Q9UA 1FSSA 1RIFA 4BECA 4Y9RA 2OHOA 4NATA 3GQBA 3RC8A 2I6GA 4F72A 3KJGA 4BASA 1QHNA 3FBGA 3L0CA 4US0R 2AZMA 4ZEXA 4CM3A 3MS4A 4RZ3A 5L45A 1GA1A 1D8TA 1JEQB 4FJ2A 3EQ9A 3LF1A 1E5TA 3G2PA 5AUQA 1V4VA 2WY2D 4LFBB 1VPWA 2Q3DA 4XGKA 5EZYF 1JYEA 4KN6A 3IP9A 4OFZA 3C5VA 5FI5A 3IUJA 1GTRA 3LUGA 3RQIA 5F73A 2AR7A 4TYYA 1RHMA 2AI2A 3JZFA 3NWBA 5BYJA 2I3BA 3ISVA 5DT2A 3ZYCA 5CEFA 3CF6R 3N6VA 4RTJA 1DTWB 3F7TA 2CSUA 1GOTA 1T2EA 3PHCA 4IKEA 1QTQA 1XCGB 4RIHA 3V48A 1J1IA 2QGZA 1DDGA 2P1RA 1LFAA 4AMBA 1HGXA 4B6RA 3NHKA 4W4TA 1N0IA 2GEJA 2QTZA 5JY1A 3AP2A 4D9MA 4MEAA 4UVHA 4BX3A 3E7XA 4PAMA 4IDBA 1CULC 4OIMA 3ZCUA 4JFAA 2OV4A 1UOQA 5K0LA 1QP0A 1P91A 1XTQA 3H5OA 3QFRA 1QIHA 2HPAA 2RH5A 2TECE 3BULA 5B2FA 4IDAA 3CPHA 2EQ5A 2BFOA 4LHVA 4UTPA 2DHRA 3DMDA 3REFA 4OOEA 3RI3A 3VHRA 1MD9A 4ES6A 1XKQA 1PZXA 3K9LA 1XQWA 4OHUA 2WMOB 2UVQA 1BVUA 3OQ1A 3SHQA 1TJ3A 2QX8A 4Y9DA 3JAWB 4NJMA 5JECA 4FJ0A 1VHLA 4JJEA 2KE5A 1CEYA 2D4AA 1N2IA 4FYXA 4FE3A 1RXUA 5B6PA 1OXVA 1A8IA 2J5KA 2OXIA 2PMDA 4BYMA 3ZY5A 3N6RA 3LL4A 4FYVA 2PSSA 2VQ3A 4D96A 7AT1A 3DKRA 2GN6A 2H29A 3VYVA 5KQLA 4KIUA 2MCFA 3SEQA 4EFMA 1EHCA 2NUBA 5CLQA 1ZVQA 1R0WA 5E95A 4NONA 4ZVQA 4LJLA 3FPKA 1KSJA 5K3DA 4QFMA 1GL6A 3JQDA 4GOJA 1AB6A 4IVNA 3O8LA 4RHUA 3W5DA 1C1XB 2DTXA 1DAPA 3L0DA 3QEMA 3UNXA 4GNRA 3I23A 1MO4A 4AMVA 3BDAA 4G5SA 4IJWA 2HQBA 1NXQA 2MDTA 2W6MA 1N5RA 3G0OA 5HFNA 5DW0A 3N76A 2ZDGA 5AW7A 3TQQA 1KRXA 5FPQA 4R1PA 2PZEA 3I6ZA 3PXXA 3B20A 8ABPA 2Q3EA 4YBZA 3CN9A 4GE0A 4KAFA 1Y4AE 3F6CA 5E6RA 1UMDA 4QA9A 2ZJ6A 3GJRA 3DAHA 4GDFA 1GRCA 4H4CA 2BCJQ 3V4OA 5A6SA 3W4IA 1RFLA 1RJGA 4FB4A 3IUMA 3F1KA 1V71A 2OBYA 2BDTA 2ZJ2A 1BXRA 1THGA 2ZSKA 1W9HA 5E7MA 5I5GA 3VR6A 1VGQA 3BF7A 4QDJA 3T7AA 1CUXA 1N4AA 2RSLA 3UJ8A 1Y3AA 1EGVB 2R8EA 5GONB 3WLHA 4C3ZA 5FULA 4JL5A 5E6UA 3KUXA 3OVMA 4K86A 3GLQA 3RARA 1BIFA 3MWDA 3V2GA 3VTKA 3FB4A 3NOXA 3OJLA 1L5KA 3O3MB 4NZOA 1M1YE 3MCWA 4A26A 5KNDA 2I80A 5L53A 1XNJA 2V7EA 1JDJA 1IB6A 1KXJA 1M72A 2C8KA 1JVNA 2P5SA 3B1KA 4PPFA 5F78A 4W8GA 5AMXA 1KP2A 5LDDC 2C7GA 4I66A 4DCVA 2W6JA 2H9YA 3TZQA 1TQDA 3PDHA 2H4YA 1SBIA 3MW8A 4EUHA 1SVSA 1NUAA 3WYFA 4AX8A 2HSJA 4PLHA 4U2GA 3PQCA 4L8FA 2NU9A 3MGBA 2PWYA 3FOCA 2GRAA 4C30A 4W5OA 1XU7A 4JXKA 2XMSA 4U9IS 4XWAA 1XZCA 3GRYA 3OA0A 2I54A 2ZYWX 2IYSA 3E3NA 2WUEA 3DE6X 3K9BA 4FONA 3FH0A 2YIDA 3LWZA 3UKOA 2NXWA 4EECA 5IJWA 1TEHA 1MC8A 2VKQA 4I55A 5IJZA 2MYNA 3ZU6A 3I9V6 4YPVA 1PL0A 3RABA 1B16A 3OUTA 4PLWA 2BR4A 2BUBA 3OO0A 5FPKA 4BPBA 4PN3A 2FUNB 1PX0A 3EXHB 4PPYA 4B73A 1YVRA 1D07A 2W5UA 1XSEA 3HXKA 4YREA 4UEKA 1SXIA 3HL4A 4COOA 3NIBA 4A8JA 4KLAA 1WDTA 1A7AA 3KLOA 3L8DA 4HFNA 2QY6A 4QDTA 4YXWA 4AZ0A 3T3GA 2CLDX 4B0OA 2AHOA 2OUIA 3UXYA 4EZBA 4UBJA 4OHKA 3S5JA 1NVTA 1YA8A 3OMXA 3L8HA 4RDXA 2XADA 4R5MA 3DT6A 1K7XB 2AMLA 1QVVA 4FZ5A 2IEIA 3CZ5A 3C3BA 3ORQA 4CLHA 5L95A 3U39A 3IUBA 4ND7A 4K6KA 4DR6B 4UBOA 4D57A 1J0CA 1UDRA 3KPVA 3R09A 4YWJA 3UY4A 1TI7A 4ETIA 1X39A 3GDOA 3SIXA 3OQJA 2CV1A 2OCGA 2JJ2D 3EVZA 1NG9A 3Q5EA 1QWOA 1U2SA 4JXXA 4PSCA 5JARA 3DJFA 5TMEA 2CXNA 3OE4A 1O58A 2WDZA 2J9XB 3MRSA 1JT9A 2JJYA 2R6ZA 1I4DD 1N4DA 2HYDA 4TVBA 4GIBA 3BHNA 1D0IA 3ND9A 4DHEA 4TWZA 3W90A 3ZEIA 4B76A 1XGKA 3TF5A 4R8MA 5H4HA 4P4LA 5IAEA 4B83A 1IY9A 3CX8A 3PX3A 4P92A 3WV4A 3P5SA 2IUUA 1VHJA 4G56A 2J0SA 2WJ6A 1YFLA 3FM9A 3FYUB 1DUSA 3K0CC 2NU8A 2A9FA 3O8BA 3K0AB 2VUTA 4UBKA 1SO8A 1MHPA 1W85B 4GXRA 4B82A 1SB8A 1Q1NA 2NZYA 1RHRA 2BRUC 1AMNA 5I5EA 3M4XA 3QVLA 1P0CA 3EF1A 1EXNA 1C3JA 1VC2A 1GAJA 4OLAA 2V8OA 3IILA 5HZGA 5I4IA 2FXVA 1PK9A 2G1JA 3U16A 2EZ4A 2XXJA 5IT4A 5C1PA 1LUAA 1KZ6A 2HNBA 2C4KA 1K5PA 1DEOA 1P31A 2BAGA 4DNFA 2ODTX 1XXHE 3I9LA 3LA8A 1V16A 2X5XA 4GWKA 4D44A 2H9IA 4QJIA 2ABWA 1KZYC 5EJ2A 3NNDA 4XYMA 1M5TA 1MABB 5EUCA 4DRXA 4JVOA 1JE1A 4EYQA 4U4AA 4Z4EA 4E2FA 1I6KA 1TJ4A 2C5EA 4HDRB 1T9GR 2O8FB 1VZ2A 2JFVA 1JJBA 3IAHA 4R4JA 1VKHA 2BY4A 2P78A 3BMQA 2I66A 2R44A 2YWRA 4QOIA 2XWBF 3W3AD 2CXOA 3Q15C 4PRKA 3AR2A 3RFVA 2G5TA 2FFQA 2RAUA 1QVZA 3E15A 3OZBA 4HDNB 8OHMA 5KX5F 3U6BA 4F4IA 3LX4A 4EARA 5ED4A 2PQ2A 4Y18A 4CMKA 3L4JA 3UCXA 4QELA 1K2WA 2ZIAA 3ZE0B 2NZXA 1HZJA 1JA1A 3PYLA 1GITA 2OM6A 1PEYA 1DEKA 2G4LA 2CXHA 1ZL2A 2YHBA 2QXUA 4RA9A 4ECAA 1WKCA 3T3EA 1E5XA 1XNQB 2W22A 4LXGA 3OC0A 3QLVC 1U2GC 2AN9A 3W2TA 621PA 2W6CX 3PVSA 2YJNA 4XQGA 4I1SA 4WN9B 3OLZA 4HH1A 2HJSA 1KY2A 5TLSA 1KY4A 1RQRA 2ZPAA 3F5MA 2RK4A 4MVWA 3KL2A 4OHOA 4UMVA 4V0RA 3KKKA 4A16A 3GLIA 2BZSA 1OFGA 3AXTA 4IHKA 4UNIA 4Y1GA 5F1OA 2H17A 3LRPA 1XJWA 5FXMA 1VJCA 2VAMA 1RD4A 1OV4A 1J8FA 1ULSA 4WGGA 5LUBA 4HMPA 5DULA 4BO1A 1HZZA 1J7JA 3ABQB 4BWVA 5B3KA 1IEVA 1W2HA 4FNMA 2PMWB 3AUFA 1MO5A 2CHQA 1Z8HA 4ZRDA 1XDBA 4S0ZA 5K8CA 3Q3HA 1J8QA 4CM4B 2PRSA 2VYVD 5DCUA 3ZXYA 2FPKA 1RFGE 4MWDA 1VGVA 4RD1A 4AP6A 4ER3A 1X2BA 1GGFA 1RP1A 1Z7EA 4IIUA 1QO0D 1E3MA 2WTEA 3H17A 3L0YA 2CZCA 4KGZA 5JH7F 4D0RA 1N5IA 1T0HB 4KODA 2X2PA 3P9RA 2QIPA 1N7JA 1EX7A 4GX2A 3SE0A 3NP9A 4X7BA 1EPUA 1PSZA 4B79A 1Z33A 3RIXA 3A3NA 4PHCA 2BYTA 2ZULA 1QPZA 1ZNQO 1KNXA 2ZJ4A 3TX2A 5ALHA 3ZY6A 1CYDA 2FA9A 2FLWA 2HMTA 2VOJA 3INTA 1QR6A 3RS2A 3EODA 4DSAA 1M6NA 2PGDA 1DV2A 3IB3A 3NTLA 3D5QA 1G60A 1SC3A 3LIIA 1SCAA 4KYVA 3RRNA 2I4LA 4XX0A 4GM4A 1UZMA 5AVUA 1QM5A 4DCNA 1GIAA 2HV8A 3DNPA 4G5XA 2QVGA 2YW9A 1FFDA 3VH1A 1UPUA 4PE5B 4DJ5X 3IURA 4KI7A 2GYUA 4X60A 4BKPA 3LKBA 1SXQA 2QDKA 3RC9A 2ZRFA 1Z2CA 4YMVA 3I04M 1E3WB 5E1MA 1C7RA 5SV2A 1GQSA 4TXNA 3A9VA 4K28A 2X2EA 2WFLA 4ZI3A 1X86B 2HXSA 1H22A 3A1CA 4XD7D 2AD1A 1D5WA 2QX4A 4YUVA 1EUDA 1FLVA 4FHDA 3F9CA 5D1NA 1Z9BA 2O07A 4CL8A 1O6CA 1DWPA 2D2VA 1S3SA 3H0KA 4OHBA 3FVVA 1GN9A 5FI1B 1WX1A 5A0FA 1R74A 1EDDA 3HUTA 4LXUA 4CLXA 1KZHA 1Q57A 2WBLC 1FU4A 3MAJA 3THYA 4NENA 1HQKA 2C9OA 3WLSA 1YONA 1IONA 3IAUA 4CM9A 1CEXA 2E6KA 2F55A 2FEWB 3HGQA 3R8CA 1U0GA 1D4OA 1ZM2A 2EIXA 1FDUA 1SRQA 3AW8A 3CSDA 5AI4A 3FKQA 4BNJA 3GPBA 3AUAA 4F04A 2BE9A 5JDCC 1QGYA 2CZQA 3K9WA 5KSPA 2V45A 1F7VA 1GWNA 3OZWA 5LCXA 1L4YA 1W1WA 3HFRA 4DE5A 4XEHA 1JR3A 3FCSB 2BP7A 4H6XA 2GJSA 5DKFA 4BN4A 4B32A 1C7JA 3AF2A 3KV1A 2HQRA 2IV2X 4HV4A 3E2MA 4ZT4A 3B8HA 2VCHA 2FPPB 1AXEA 3U26A 2J5BA 2AIRA 2P2NA 1OU4A 3G2QA 3KWLA 5HK9A 5JFGA 3ETNA 1P8JA 3T3OA 1Z5ZA 3DR3A 1YZHA 2QRZA 1U8TA 1QGZA 4GL4A 5JZSA 2GT1A 3AWDA 3TSWA 3UC9A 2YXEA 1XPUA 2FV8A 4YAUA 2H2WA 4KQEA 2QP3A 4I1IA 1A04A 4CV1A 4E5PA 3MNFA 5IXSA 3MJVA 1U28A 3DW1X 4EB0A 2ZTMA 4FS3A 1R3UA 4R41A 1PZMA 3GO4A 5K6RA 1SKUA 2JD0A 3BXZA 1EESA 3OEHA 3IVAA 4HEA1 4E31A 3KYDB 4W1RA 4Q1CA 3WISA 3LCVB 1W4LA 4R81A 4KTTE 2IEDA 3IOEA 1FMFA 4D42A 1V11A 3MTAA 2KQUA 2Q8QA 3MJEA 5EJAA 1RMTA 3I1FA 5AVQA 4NH0A 2QUIA 3TR5A 4B34A 4EI8A 4OB6A 3HA5A 5IKPA 1VJ0A 3LOQA 1T36B 2OZKA 4ZOAA 4BEJA 1AUVA 2W2OA 3ILXA 3LP6A 1L7QA 3WHKA 3ZTYA 3DTYA 1M5UA 3BEOA 1EFKA 5BQOA 4TTPA 3KKOA 4YRIA 2YC2C 1CR2A 1U2PA 3D3QA 1VBKA 4JA2A 1XUOA 3E3LA 4JI1B 1DS6A 4NYIR 4LFCB 2NV0A 2HGZA 4REQA 4PX3A 4DRZA 1CDOA 2XDQA 4IDQA 1OLSB 4OXYA 4MI6A 1GPH1 4F8EA 2WQ7A 4F6LA 4Z3OA 4P4SA 5ULLA 1NUHA 1Q83A 4UHEA 2P4SA 1KE2A 2FWMX 1YR3A 1Z8NA 1BN7A 3BWBA 4EDFA 1QYCA 2EJUA 2VTVA 3DNMA 1S0UA 4G5OA 1LSUA 1EUCB 2FQWA 4BJ1A 4RYLA 1TVKA 1F17A 1X1EA 3M3HA 5AUNB 2KI5A 4UFOA 4S1NA 5DGTA 5EFOA 4AUKA 3U7HB 1B41A 3U48A 4I81A 1GZ5A 1TCUA 1NNEA 3UICA 3TKLA 1G20A 4KAAA 4KOEC 3SMVA 3VVCA 3A6FA 4MV0A 3RWOA 3TIGA 5C18A 5KOHB 1LK0A 5C1OA 3TQFA 3T6KA 1T5IA 4FGWA 5F64A 4BVEA 3WNBA 2Z56A 3DLIA 5BN5A 4KFCA 3MFQA 4G2TA 2X0IA 5GZ6A 4QPJC 3SQOA 2QENA 3NT5A 2ZIEA 4HQOA 1C3OB 3L0BA 4MDYA 5AI0A 2YOHA 3ISJA 5FRDA 4QPPA 1P2UA 3EJWA 4WKNA 2Z57A 5FR2A 1Z5GA 4HB2A 4OP1A 1PZEA 1ZMTA 2FW8A 4QSHA 3RODA 1PFQA 3EXEA 4DV1B 2Q6LA 2B37A 5JNTA 1AQJA 2YZMA 3IV9A 5FNVB 3ZYZA 2A6PA 1C8KA 1CB0A 5ILQA 2WPDA 3E9ZA 1FMCA 1RXCA 2AEJA 3AHDA 3ADPA 3EWIA 3K4PA 3MGCA 4G1CA 1AIPA 2N9UA 3CCFA 1CNEA 1LSJA 1T0IA 3O38A 4P4UA 4Q9AA 4A10A 4CUZA 5A3SA 2OCLA 2GM3A 4LKRA 4G0YA 1ZSYA 1CVLA 4ZYWA 4J0GA 2PGLA 4M49A 1MAAA 3AFHA 3JQ9A 4ASUD 4JDUA 1NQOA 3T8YA 2P8JA 5DASA 2B7CA 3TTTA 2HBYA 4KYUA 1YQXA 2HRQA 4K0KB 2GVZC 1GUYA 4YASA 5J58A 3NR2A 1GAEO 3LPDA 1NFQA 3BICA 1AS0A 4V3CA 1T2NA 4D3FA 5C7LO 1SIUA 5C4GB 3KE8A 3G49A 3CKYA 3MAAC 1DKNA 3LFUA 1U8EA 1DIHA 3ORFA 1FB5A 3R41A 4LSGA 5EMHA 4OSEA 2PL1A 2F17A 3NWJA 4YRMA 1I7SB 5F21A 3HTXA 2PUWA 1DTWA 3ORRA 5M04A 4BVGA 3GNQA 5HUQA 3MMZA 3TGWA 5K7SA 3K9NA 4WXMA 4XWGA 4UCXA 5IYZA 2C1EA 1HNWB 2FDRA 2QW0X 3DE4X 3F8WA 5E3HA 1ULBA 4MYCA 1LBEA 4N8DA 3ER9A 4Q01A 1E3LA 2ZSBA 5AJZA 4YP9A 2ZKLA 3LGAA 2Y4NA 5IW8A 4WZBE 1ZK2A 2HWWA 2XQGA 4XLLA 2AJBA 1XMVA 2HDWA 5FUWA 4M88A 4URUR 4RHFA 3RYFA 2XXBA 1LJLA 2LWIA 1XEWY 4OH1A 1PWYE 3JYQA 4NL4H 5K4AA 1DAOA 1OAKA 3MD9A 3V80A 1MVOA 4J1TC 2ORWA 2SKCA 4QOFA 4LC1A 4K03A 3CZMA 3D81A 2DPLA 1AKWA 4MV6A 3GXOA 3EEIA 2C94A 2D2FA 4OOFA 1DUVG 2Q4BA 1XE3A 5I48A 1Z3CA 1RXWA 1RSZA 5FLEX 3QX3A 3UHJA 1XMJA 3HJCA 4X3CA 1QGED 4Z4FA 4ITVA 3QF7A 1UCFA 2IXGA 4ERNA 3PFGA 5KJFA 2AX4A 3R77A 2IVFA 4CDNA 4BZXA 4FNOA 4NU8X 3MRTA 3GHHA 2FPWA 1Y6FA 2KSQA 4X1KA 3TD9A 1FBNA 2JRLA 2K4MA 4ZQEA 1MG0A 1ZUHA 1W0KD 4Q9DA 1XRRA 2PT6A 2NUAA 4N6NA 1B43A 3AEUA 4R0NA 2O0KA 1HT0A 2O57A 1GAWA 1GTG1 2P69A 1NXOA 2WAXA 1C1XA 4S1OA 2D62A 2ZE6A 4OBWA 4P58A 4Q93A 3FSJX 1P2SA 1N5JA 3MEQA 4GMKA 4LC9A 3TTVA 1XWWA 3W9SA 4BNVA 3B48A 3CX4A 3JWJA 5KC8A 1VBMA 2H1FA 4YT4A 2BKVA 1NASA 4YRTA 1YZYA 2BI4A 4B6PA 2PXCA 1SHUX 2EW8A 5LLTA 1TQ8A 2AFRA 5T4HA 4TMTA 4PC6A 2ECFA 3AI1A 1E9CA 3INYA 3W34A 5JEDA 4V3BA 1G5FA 4JSYA 5TJHA 5JZMA 1UXGA 2H06A 2IY9A 1CUEA 1UQUA 3HKDA 3O7WA 3U4IA 2NG1A 4IIVA 2HMSA 1U7UA 2VVTA 4RSMA 3ZWXA 3N8HA 1DNPA 1BMFD 1P9LA 2VNSA 4UVEA 5F7OA 2XCLA 4P0PB 4X1YA 2ZTUA 1E1RD 2CB9A 3ZV6A 4B9AA 1AKEA 1NNSA 3K6SA 1FDWA 1R0ZA 1WB6A 2AXQA 1J24A 1QFZA 1N1EA 2CFOA 4RJKA 5F1KA 4NBKA 5CDSA 5HOEA 1SXJE 3K0SA 2J0QA 2EF0A 3DHYA 3H3FA 4G07A 1S2MA 4HVTA 2C5FA 1J5XA 1JB9A 3F2VA 5IN4A 3LBFA 2BELA 4DBLC 1RVV1 1CIPA 4XR9A 2C8JA 3K8QA 4E15A 1IHUA 2A4MA 4PANA 2GHIA 3BXGA 3KBOA 5K8LA 1O4WA 2WZCA 2Z8YA 4AW9A 3A6PC 2ANCA 3HR8A 3LUAA 1ZOSA 4AWXA 1LSSA 1R8XA 1V2GA 3P8ZA 4TXJA 4XWTA 1K63A 4CLRB 1M34A 3GC6A 1E1QD 2XUIA 4V0SA 5EXPA 2O05A 5JCOC 1IPFA 2H92A 1NMSA 1T0BA 2C2HA 3GG9A 3IHKA 3W4JA 3RLIA 2D4HA 3IAS1 3FE2A 3QE2A 3QXGA 1WNTA 2I34A 5FL7A 5K3BA 1YFJA 1N8TA 1AGRA 2B8WA 2PUVA 2MINB 4RV4A 1LK5A 4J0FA 4FFMA 1QK4A 4BX0A 2HLHA 4K9OA 1GNRA 5L3RA 1HQCA 5AVJA 2B36A 3THRA 2QTVB 1L2TA 2XJ4A 3TR6A 3W6NA 1DQYA 4EHFA 5LMZA 3FAKA 4YCNA 3U6KA 3ZN2A 1PR6A 1XOIA 3A25A 1GAXA 1NR5A 3B6JA 1Z6YA 4GP7A 2Z2YA 5EP2A 1KI2A 1R16A 1Z45A 1MFZA 3L8CA 4OMCA 2HRDA 1SK9A 1C0LA 3MS2A 2I5PO 1JJIA 3VYWA 4KSYA 2R6GA 3WLFA 4GYWA 5HZKA 1NAIA 5AHRA 2WI8A 4GSYA 3EPJA 4OQZA 4DA4A 3CU5A 4IL5A 3VBCA 2EW1A 4AMYA 2IZ1A 2GHQA 2PBFA 3URKA 3NT4A 4KPGA 3I4FA 2ZETA 5IX8A 3E9NA 3IQZA 4DCUA 3BBLA 3MJFA 1HNNA 4R2WA 4XD2A 3QEKA 1TPYA 3LECA 4MVJD 1XTPA 3NM6B 1HBJA 3WLNA 4LBYA 3F5FA 4NBVA 3U7EB 4B7CA 1UF9A 1SD1A 2R6CA 1DINA 4GVLA 1ULZA 2QF7A 1USVA 4OGGA 4U6NA 3D5EA 3P26A 1O08A 4J4TA 4RELA 4UUBA 3ZI4A 3EUWA 1WZNA 4DRYA 3L6OO 1NX9A 1PHPA 4ROTA 1WQ1R 1Q2UA 3HCRA 1ZH6A 4ECEA 5LZ8A 3VHXA 4CMHA 1N33B 1EK6A 1JHUA 4DZZA 4G84A 2A9PA 4KXMA 3UT6A 1K8YB 4W8OA 5C1BA 1NMEA 5B7NA 1ZD4A 1PD1A 2YKGA 1SC9A 1DBPA 2GTHA 4IIYA 3IJRA 1X7WA 5CNMA 3JRNA 2J3DA 5KTMA 2XLBA 2PZAA 3LLSA 3D2LA 3TDNA 2X14A 1FNNA 4EMTA 1J2UA 4EO9A 2I2DA 5L4NA 3FYUA 3ZWWA 2CJFA 4GXQA 3LBIA 4QUDA 3HU5A 1EX9A 2CF5A 5K3EA 2ZRMA 4KRXA 2WZDA 2PE5A 1V35A 2G71A 1LTKA 1OYYA 5D3KA 1KAQA 4INJA 5B64A 4Q1FA 3RYTC 1V5EA 2JD2A 2QQ5A 1O77A 1R0RE 2JBHA 5J59A 1KPGA 1JIIA 2F64A 3H65A 2PS3A 5EERA 3EWAA 4YGXB 1T4GA 1JAYA 3ACCA 4R8VA 3ROFA 3VR2A 3ROPA 3HR7A 3WDMA 3RBZA 4W6ZA 2NACA 1Z74A 2P11A 4EKYA 2FW7A 3OMWA 1U9ZA 1UK7A 5K4HA 4M86A 1ZWLA 4UNPA 4CV2A 3KK0A 1Z29A 1TVMA 3HB5X 2CUTA 3AOEC 3BFPA 3AYXB 3NFRA 4JN6B 3SFZA 3ROGA 2BGMA 2ZUWA 3JU3A 2PN1A 4DMKA 2FJUA 4OL9A 4OLBA 3CT4A 2X8LA 3GLSA 4CDRA 4D02A 3MWYW 2VP0A 3LC0A 1L1FA 3ETLA 1OXBB 2XMZA 1DRKA 3GFTA 3RSZA 3A58B 3KEFA 2H1VA 1FBTA 3X1WA 4WESA 3OKFA 4G1BA 2FN7A 1Z38A 4ESVA 3M5DA 1FYVA 4BVBA 1NFRA 1KIAA 1ECFA 2VK8A 3PUVA 4LG1A 3GBVA 3LY7A 5CVUA 3LP8A 2E6UX 1OXTA 2BKUA 2GAOA 4QUBA 4AUEA 1ISFA 1CVIA 1OMOA 2GR9A 1JLLB 1WEKA 3B85A 3I9MA 2J30A 2YWHA 5AKKA 4D97A 2REOA 4A0GA 1CRWG 3OHSX 4EG6A 3OTOB 4TTTS 3V97A 5KOJA 3CEAA 1XHLA 5E38A 5K01A 3AILA 4NQZA 1J2RA 4WN9A 3Q10A 1BE6A 5JI3E 1WEHA 1BE0A 1XZPA 1DARA 2WG0A 1Q11A 2OKCA 2PSHA 1T9ZA 3DYBA 2CWDA 3A4LA 3A8TA 3IT2A 2W00A 4BKMA 3E05A 2I99A 5T5QA 1YQ9A 2FLKA 3AERB 3I1JA 4GQAA 4R69A 2C5BA 1H8HD 4MQEB 4OFBA 3HDYA 4QFDA 1Y82A 1R37A 1ZKMA 1GU7A 1Y48E 1Y7TA 3C4QA 1MF7A 3CF4A 3LF2A 5IM4F 2IOFK 4EG0A 1V7PC 2HSEA 2QD4A 3PD1A 4JUAA 1KA9H 3S0JA 3H5IA 4CM4A 3AM1A 3NVAA 1E1CB 4G6ZA 3TW4A 1SB9A 1P1BA 1WMBA 2FE1A 3ZZUA 2BFMA 4BEWA 2V6IA 1L7EA 2JLSA 1CE8A 3FPAA 3K1YA 4ZT3A 3FPEA 4HH4A 4B2IA 2XE7A 4XZ3A 1GNLA 1SG6A 3NCTA 4R8SA 1DL5A 3CM0A 2P0EA 1ZHOA 4R1MA 1ZINA 5J5CA 2WWXA 1AN9A 4WZZA 2PZMA 3EG9B 1EFCA 1UBCA 2OXRA 3EDRA 3IVCA 3KX2A 5ALOA 5DU2A 1TZKA 5FI0B 5HZMA 1NVWQ 2J45A 4WJZA 1NXWA 2TSYB 2D8AA 3L8GA 3LLCA 3IFSA 4F5WA 4Z1MD 3RYIA 5AW3A 1XEFA 1X9IA 1HTBA 1ZUD1 4NCJA 3JYHA 1TM5E 1KJNA 4KFUA 1L7RA 3JQAD 2CV2A 2YWGA 2IYEA 3P9ZA 3W78A 5KTYA 2D2IA 3EVCA 4PYKA 1N7GA 1SXJB 2HTEA 2VP9A 2XOXA 4QATA 1A77A 4WLNA 3V4VB 1Z88A 5EA2A 1E3IA 5DN6D 2DQKA 4LQCA 4MWGA 3COSA 2PY6A 1E3QA 3UGKA 4CM7A 1I33A 1T2CA 2OQ2A 1CJUC 3ROTA 4DQUA 4MNTA 4W9NC 5A2QA 3IEMA 2XGJA 3U4CA 2JZOA 1E3WA 3R0VA 1X7XB 3M6IA 1SXHA 3DDHA 3LWNA 4H1HA 1PGPA 4IMRA 4NJEA 3K09A 4IDNA 4V0LA 4EHNA 1AK9A 1YE3A 5E0KB 3AF6A 2F3PA 2RGDA 4GGMX 3UV7A 3T99A 2XCRB 3FNQA 3NHWA 5BN1A 1Y81A 4CODB 5AW8A 3HWRA 3CUUA 3RFTA 3CVXA 3AX6A 3DL7A 4YJFA 1YRWA 2DHQA 4LS3A 1ODKA 1X0VA 2BEWA 3R7FA 3W5UA 2O7VA 4BL5A 2QXYA 1R6TA 1WOMA 1ESDA 1I7LA 2Q9BA 2YDYA 4YFYA 1KJWA 1NW4A 4CTMA 4UOEA 1MN6A 4IQ4A 3FSGD 1UMCA 1VHDA 2ZRGA 2FSHA 3K5WA 2FZCA 5LZ5A 2R8ZA 4QARA 1OI7A 4HVAA 1ICIA 4FSDA 4TUYA 4F9TA 2WYUA 1C3EA 5HZHA 4M7RA 3AR9A 5KNBH 1H93A 5BR8B 2PCJA 1E4OA 3K32A 4EW2A 4UNRA 1VA4A 1Z3IX 3JAKA 3L6BA 3PE3A 4OLJA 4OYYA 5CLGA 1N8NA 1QTRA 2Q5EA 1KJJA 2H18A 3A9SA 2X58A 3NHSA 4RHXA 1OLOA 1KWGA 3LHIA 2QZPA 1N5LA 2ZUSA 3HGMA 3IBTA 1ISGA 3WGKA 3HBMA 2FPPA 5G1PA 3TRFA 4GR5A 3DE3X 1PV4A 1P81A 2V55B 3H6HA 2X0EA 3RSCA 3VUEA 2YJTD 3K2QA 2YQZA 5AKIA 2B5WA 1P73A 1PK8A 1GVNB 3CQ9A 4BLWA 2AI3A 4PYRA 1CUSA 4TMXA 1DT5A 5CIQA 1P7ZA 2NZ8A 1J2JA 1D6MA 2QQEA 1M54A 4JEUA 1N6LA 4X8HA 5BYBA 4DCMA 2E49A 3RAEC 3KTOA 4A3SA 2PBLA 2FY8A 1LF0A 2UUOA 4EW6A 4PLFA 3DOEA 2BKLA 4HH0A 4UHDA 2BOVA 4G86A 5LBUA 1LS6A 4YPFA 5CA0A 2AR0A 2X5NA 3COJA 2JK1A 5AOCA 2XKAA 4U2CA 3G88A 1GRQA 3JQBC 3LUBA 3MD0A 4TN5A 2IDMA 1LI4A 3E8SA 5CW2A 1PE0A 2UV8A 1H6BA 1VSQA 3RVLA 4JX8A 5A4AA 3NORA 1NYLA 4XUGB 1GKLA 1NQAO 4JWTA 1L0BA 4W99A 2E5LB 3OPMA 3ZK7A 2IS1A 5EE0A 1YI8A 3G9UA 3LHDA 3KJQA 5JMOA 1VKNA 1BMDA 1F9AA 4OATA 1Z47A 2QRVB 3EULA 2Q41A 1NBME 3R6TA 3RYHA 1K7FB 3CZ4A 3NHAA 2H5IA 5FLXA 2XMPA 1HQDA 4MB6A 3IQFA 1SC4A 1TU4A 3AHGA 5SYAA 3SBXA 3TJRA 2P2SA 1VCMA 2X3UA 1NIJA 3G2IA 4ME6A 4EQ6A 4YMGA 2ODAA 2HO4A 2GCEA 4MYSA 4HS4A 1N0WA 1QCDA 3N7TA 5THXA 5JNWA 1XA0A 4J91A 1TIKA 3S29A 2QB5A 4HCJA 3MPOA 2F62A 1X74A 1R88A 3GJ6A 3HSYA 3MJRA 1Z5NA 2QTHA 4Z99A 2L0XA 4FEEA 3VR4A 3QU9A 3RVPA 3CUWA 2HMUA 3T34A 1QE0A 2NAPA 5SYMA 1OXKB 4YRSA 3V4SA 2R5WA 2YJ6A 3L0ZA 4PZLA 3DLPX 2Z9CA 4MVYA 1R4NB 5ALGA 2JEYA 2LTAA 3G6KA 4LYYA 3G0GA 3EH1A 4FJ1A 4FW9A 1EDZA 1E9DA 1OA0A 3FKSA 2CBXA 4Q03A 4A82A 4AECA 3IKMB 4XOIA 1L5WA 4EYEA 4WKCA 3WWCA 2DHCA 5K20A 4Q3KA 1C3OA 1SIBE 1ZNZA 5AM3A 1YRBA 1P1IA 1XD9A 2Z8XA 4US1R 1KO8A 1J2EA 1YZKA 4L2IB 3AY0A 3BJRA 1RS0A 3GT4A 1QV9A 2D1RA 1VP3A 1ZIOA 4Q3AA 3P5BA 3R0XA 2A5FA 3BB4A 3UTCA 3KR9A 4X63A 3I6IA 3Q3VA 3BZUA 3DLAA 4NU0A 2Q4OA 3V2HA 2JJ1D 1GTZA 2FGJA 2FF5A 3E5HA 4XDYA 2FYTA 1E32A 3W7VA 5KKCA 1IBSA 1ISSA 5ARCA 2PT9A 1V3UA 2Q0QA 2QD5A 4XM2A 3EIHA 5BNWA 2ZWIA 1Y5NA 4P3YA 1A8HA 4P54A 5BWNA 1U98A 1GKKA 1DAHA 1NPYA 4N1AA 5CX1B 1LW6E 4RADA 1GG8A 4QGGA 5I7FA 1KMCA 4KO3S 3OZTA 4FUTA 2HA3A 4LF9B 1QCYA 1TJNA 1GT6A 3OF3A 1B3BA 3OEED 4N3BA 3U7JA 4DTCA 4FWTA 5JSQA 4ZZ3A 5K2OA 3HACA 1IULA 3KU4A 2VJNA 3A7EA 3OJOA 1WMSA 2APJA 3LBAA 421PA 4E08A 1SQSA 2G28A 3AIKA 3L93A 3GPCA 3UKDA 4N82A 1KK1A 1P3DA 1YZNA 2WD7B 1WF6A 4GXNA 3RRJA 3TPCA 4B7UA 1I9GA 3FDZB 2JAOA 2CVOA 4X6YA 4OXRA 5HIMA 1TOAA 1EVKA 1KEUA 1TB4A 1V9CA 4QAJA 3NANA 3EEOA 3NKVA 4HF7A 1JH9A 4K6MA 1GPWB 5JZBA 4BFCA 4XOUA 4TGLA 2Q4DA 4YX9A 1EU1A 1JHPA 2O8NA 3G2KA 4PYNA 3QVSA 5HF6A 4YP6A 1UC4B 1GXSB 4EX7A 2WINI 4RFLA 5DHTA 4MRPA 1PWZA 2GK6A 2QUHA 3F4KA 4CT5A 3AO0B 5HSGA 1Z28A 3IT1A 4GEGA 4L73A 2QN1A 4OU4A 1X14A 2NSLA 2MOKA 3R20A 4A2WA 3IO3A 1G5PA 4H3SA 5ELXA 2I7XA 4BFTA 1K88A 2X9NA 4X8LA 2QAJA 5EXXA 1B1CA 2JGDA 2HCRA 4FFBA 4C20A 4YPOA 1N2HA 3L84A 3E7DA 1UJ4A 2EU8A 2HADA 5HQTA 1EYZA 2PPVA 1MT0A 2NVOA 4GMXA 4QQKA 2QBYB 4KKVA 1C8LA 1E2PA 5ALMA 4O2RA 3TOZA 4DR1B 1D6JA 2HT6A 2JGEA 2QLLA 4L4XA 1VIMA 2PJDA 3NEJA 1KQPA 3Q12A 4JP8A 2CJPA 2DUWA 3REQA 3QWAA 4TS4A 3K5IA 2GEDA 2OQVA 4OQFA 4L78A 3H2SA 3SI7A 2C3MA 2QPTA 4I55F 1W6UA 3STWA 1WDWB 5KNCD 1RJ9B 2IODA 3TBHA 1AKYA 1T2DA 4TZTA 1OFHA 4AQDA 2FOLA 1YULA 3U9SA 4JB2A 5CXSA 3RF7A 4JR0A 2PX2A 4JVSB 1NW5A 5IVIA 4YV7A 1FFAA 1MVNA 4WLVA 3VPSA 2AG1A 2G5PA 5EE3A 3GCZA 2PWZA 3T06B 4ILKA 5CJPA 2ODPA 4ZCMA 3GRVA 2J9FA 4LZJA 2IC5A 2IJGX 3RR2A 1RE1A 3L8YA 1G66A 2QLTA 3NJ8A 4KN9S 4QX6A 3A6EA 5EHQA 5GPBA 2EATA 1EIWA 1J56A 3TW6A 3NLLA 3UAGA 3NHMA 4AJ1A 3BILA 3AUUA 2HU8A 3IP1A 4JXJA 4MCAA 2IGBA 4FLFA 5JHGB 5EN4A 2ZT6A 1XJ5A 3EDCA 4HXYA 4NAHA 1WLYA 3UXMA 4E4RA 1OD6A 3K8OE 3OC6A 5B3JA 3VU1A 3OESA 4OCZA 1JILA 5G40A 3PUJA 2AQHA 4Z0HO 3E1GA 4PF1A 3FDXA 3FY4A 4C0QC 4F38A 1G4AE 3DEZA 4MCJA 1S9HA 3SM3A 5IT5A 1KPIA 4HLCA 4JDPA 4WGFA 3H2HA 2CEKA 2V0NA 3MCAA 2ETXA 3NH9A 3Q40A 3QHQA 2C2BA 4C4XA 1Z2OX 3CEPB 5BMVB 5IDVA 4BFWA 3SBEA 2NXCA 1N2JA 4WK0B 3DZBA 2C9CA 3D54D 2GEUA 3TOVA 2BDUA 1P1HA 1P9WA 1EM8B 1ZOIA 1G8FA 2OHGA 1OFVA 1XDDA 5LWHA 2H1OA 4G1UC 5E6SB 2QRGA 3U5TA 1H0HA 1U2DA 2JJ2A 4J43A 4NY1A 4CMCA 4Q7KA 4E46A 1QRUA 3ZCTA 5FWNA 3AL2A 4H7IA 5ELLA 4CLRA 3DZFA 5E3IA 2B1IA 1N6PA 2FEXA 1GVHA 1MEEA 1BFKA 1TT5B 2PX6A 3NM4A 3AF3A 4FIZA 1QRAA 3HPRA 4QBKA 4E11A 2Q2VA 4XDGA 3OWHA 4WCFA 3CLRD 4K9DA 5A2GA 3QUSA 3PQEA 3QV2A 1QTNA 4PU0A 5TQ2A 2VLBA 3HSKA 3UQZA 1EK0A 4HJXA 3EVNA 3USCS 3H6GA 1T9HA 2NT4A 3ZZ0A 1NUPA 3P2JA 1JEJA 1CFJA 3K0FA 4O63O 4WKBA 3F6PA 1SVMA 4O2AB 5E4TA 4BFYA 2PLAA 3CPEA 3ZLBA 4H17A 2QRNA 1NM5C 2Y1OA 3I4CA 5GM1A 1OB2A 4CFYA 1KMHB 1QH8A 4IDHA 4UMFA 5DNVA 1YOBA 3NETA 4HKTA 1M1NA 1WXWA 4DYHA 4DLXA 5JRZA 3BJMA 3FHJA 1I13A 1Z68A 2H2IA 4IDFA 1NONA 1P18A 2KLBA 1YIOA 4DM4A 4ZEVA 3B12A 4OHCA 2ST1A 1R8YA 3I83A 1PV1A 4DAEA 4TXLA 4MAMA 1SWWA 2UZ0A 3F4LA 3LQ2A 1G3IA 4EF6A 4G0UA 3REOA 1I7DA 1I4EB 1X1RA 1P5RA 2H65A 3ZWPA 5EE5B 4H9GA 3GT7A 1SUEA 3S4YA 4YCSA 4DQLA 1Z6GA 1MO6A 4WUVA 5FV7A 4ZI7A 1JSLA 1IEQA 3DS8A 3PFNA 5TARA 3S3TA 1HOTA 1GPUA 2GAIA 2VO1A 5LA6A 2UXDB 3THWA 1BZYA 4OQNA 1L5YA 4DARA 1KDYA 3CNLA 2Z6AA 4M1ZA 3W3AA 3RUHA 1OZAA 3ZNQA 1E2UA 1CY0A 1GQRA 1HSZA 4I6JA 2B6NA 3AETA 5C9ZA 2WF9A 2AOUA 4KREA 3DCIA 2PTHA 4FDVA 3UN1A 4NOJA 4E7OA 4KACA 5J5VA 2OK8A 1QFYA 5MDHA 3ZUGA 1YSCA 1Z0ZA 1N77A 3JY6A 2IEYA 4D99A 3V8EA 2QUBA 1QCCA 1E6WA 1JKJA 1OE0A 3ZHVA 4BXOB 2QJWA 1JP7A 2CGEA 2DOKA 2V4MA 3AU8A 3DEKA 1PG2A 3H5LA 4LRQA 4N5IX 5COQA 1AXGA 3WLTA 4B3TB 2PXHA 2BKEA 2EKPA 2QRMA 4PLGA 5ES3A 2Y92A 1D7AA 3TLMA 4E5UA 4YAKA 3KYCB 2AJCA 4OQPA 4UASA 5M5BA 1WF3A 2CLSA 1RKBA 2EARA 3T1OA 1QHHA 1ZK3A 3NBKA 2J0UB 1XYYA 3LQ1A 4B6EA 2W2KA 1SZDA 4KWEA 5YASA 1E89A 1EI9A 5A6VA 1FFXB 4MS3B 4OYHA 2QGFA 3DV9A 4Q7JB 2VYVA 1P4GA 2GUGA 3RKUA 5BV2P 3U1BA 2F8TA 4F86A 3AEQB 3QENA 4AUMA 1QNFA 2QTWB 3TD2A 1C41A 3DYIA 2CV0A 3KKEA 3VPFA 3VKVA 3IEVA 3HCOA 1U65A 3TLCA 4UAGA 3EE6A 1S8OA 1YKSA 2V58A 4QRHA 5D2CA 3PNYA 3VH2A 3X1MA 5GV8A 5JCJD 1EA5A 1PR3A 3BRSA 3PR1A 1Z62A 4QYWA 5BSTA 1OWOA 1JNXX 3SYKA 5HRAA 1YNSA 2ZJ7A 3H16A 1G7SA 1NW7A 2QZ9A 3E27A 3HH8A 1IYZA 2XUQA 2XRFA 2Z2IA 4KFTA 3TRJA 1N6IA 1PFKA 1QX3A 4N7RA 4CF4A 3JQAB 2Q2WA 3M33A 4X0EA 3RUAA 1P1CA 3ZHZA 2OWDA 4YRLA 4DT1A 1F5NA 1U4NA 4HD8A 1TTTA 3H1FA 3ANYB 4BP3A 2IS6A 5ALXA 2PZLA 2H0AA 3QSGA 1CDEA 3W2GA 3LD9A 2HMVA 5D5PA 4KXQA 1HFKA 4GVXA 1GP2A 2CDNA 3BMCB 4OHFA 4WACA 4XUCA 4OK6A 2P5YA 2H2HA 2R00C 4CKXA 2P9HA 1UK9A 3WJ7A 2WJ4A 1I6LA 2GI4A 4XD7A 1G21A 2FW9A 2HXYA 5BR7A 2CT8A 3QJYA 3OTHA 2XI4A 1Q1GA 4RV5A 1D4AA 1XLTC 1A9OA 2FUG6 4Q05A 5EL0A 3SDBA 4IINA 2YWJA 1WUIS 4P4GA 2OV8A 1XDZA 2JI6A 3N2NA 1JYFA 1L7VC 3IAFA 3IJ5A 3P2MA 4QECA 4KQCA 5FA8A 1WSBA 4BMXA 5CIYA 1RXEA 3O95A 3OOJA 4UVIA 4DV6B 3MFYA 1T3ZA 4MULA 2Q5OA 4DYDA 2ZZMA 2DTEA 2RHBA 4LYDA 3BH7A 3LBYA 4CDGA 4U2KA 4H27A 2VNHA 1BC5A 1G2PA 4PPGA 3DEHA 2VYCA 1YGYA 4PQGA 2NPIA 4AXXA 1R5OA 1F0NA 1A9XB 1GLVA 1VI5A 3GFRA 1IDOA 3GGJA 3D3KA 3EMKA 1K5GA 3IDFA 1ZRMA 4CF3A 4EPYA 4DQXA 5K03A 3QXXA 1OI3A 1U7WA 4JP5A 3ZVMA 3FGNA 4C76A 1U0BB 5FBVB 2ZS9A 2CFTA 4KQJA 5P8WA 4P5DA 4RAQA 5G0VA 2OUKA 3BCRA 1KEKA 2BIFA 3W9YA 3K9FC 1GYRA 2PCLA 3PRYA 1ZJ5A 3QLTA 4NP6A 1Z0FA 4PGAA 4TV9B 3TRIA 3VPDA 3BAFA 3KDSE 4Y7CA 3AFMA 3RM3A 1BS1A 3F2IA 2VWQA 3EX7C 5EEGA 4ZP1A 4ZAZA 5KTKA 2QVZX 1UKEA 5KMGB 3M1AA 1P1KA 1WKBA 4R51A 2FPXA 3TIFA 3IEIA 1NGSA 1AKVA 2GM9A 1YZVA 3R8FA 4Q1EA 1T1SA 4K2AA 3BMNA 3M9XA 4IFTA 4N01A 1EWKA 4OJYA 1IXRC 4UTOA 1F6BA 4HVCA 5K6AA 3LVFO 2DULA 4DCJA 1W4RA 1W44A 1XMOB 3EC2A 1X7ZB 3M4ZA 3RS8A 4W82A 4YN3A 2WG1A 2QU8A 2XUHA 1A2QA 5IZ4A 4R84A 4MWCA 4RKQA 4CMEA 2B4RO 4KLRA 2EX0A 1P60A 1UJ6A 2NN3C 5H9VA 1DXYA 3PR3A 2C4WA 2YJZA 1Y8QB 3QPDA 3ZU2A 4ZVMA 4BMCA 1HETA 1HT2E 2JGKA 2QVLA 1IH8A 2Z5GA 1BVYF 5AHOA 5TEVA 4Y2YA 2C5LA 5DPMA 5DNUA 1UWVA 1DKLA 1OXSC 5GJBA 3CMMA 2QTRA 3IV6A 4R54A 4MUAA 4TTAA 1PFVA 2NUTB 4XKJA 3PWKA 4L74A 3FYHA 3QX8A 5BY2A 3B8EA 3OT4A 2ACWA 2VC2B 4BGIA 2HK9A 2I3ZA 3HBAA 5K0TA 3LO8A 4KO2S 4W9MC 4L02A 2XGGA 2FVXA 2Y9PB 2ZW9A 3M6WA 2VXYA 2A59A 4WBSA 3IIEA 3JZDA 3DSRA 5KYVA 3K70C 3BCHA 3W4KA 1RBYA 1X9GA 2RGXA 1A5SB 1GRNA 1XL1A 5DTEA 4EHBA 1S2LA 3A6KA 5IC4A 3A28A 1Q6YA 1W94A 2AN3A 4TN1A 3SQDA 5LQNA 5FUYA 5ICEA 5HNKA 1QIIA 4GX5A 2SNIE 4ARUA 4FILA 2O2YA 4GP9A 4RVCA 4WI1A 4M0PA 2QZZA 3UMYA 1D1QA 1NMZA 3K16A 4BO9A 3OJWA 1DAMA 4NFLA 2A7XA 4BNDB 4TM7A 3FDFA 1IIRA 1V1MB 1J9EA 1EXMA 5BV1A 2RGEA 2ACKA 4I19A 1GQOA 2WV7A 3F7MA 5LQDA 1G0OA 4HRVA 4HMQA 1UK8A 2ILTA 2X40A 1O6FA 3LTEA 4PYIA 1G5RA 2FPGB 4PLPA 4Q4JB 2XWPA 4JY7A 2P9EA 4PZCA 1MZPA 3UOWA 2NQ8A 1Q5PA 1QBGA 2GA9A 1DG1G 1SXGA 1NMYA 2QRVA 3G0CA 4HI0E 1L4BA 1G1AA 4C89A 1T25A 2AXNA 1Z4MA 1O6ZA 1URPA 3A2MA 3HNOA 5A1TA 5TMPA 2AN4A 5U4QA 2H6EA 2J32A 2Q0XA 4IO1A 1FTQA 3ZGOA 2VATA 3F9IA 4I1VA 4JT8A 4G9GA 4ASUA 5LBTA 4U5XA 5EQJB 4B8ZA 3WK9A 2YN0A 4BAUA 2P40A 1S8NA 5CW1A 4X3OA 1I5RA 2HA5A 2JI4A 1HE2A 2WD8A 3L7BA 1IVNA 5AKZA 1E64A 5E7IA 3R9XB 4CLEA 1K3UB 1TZMA 1YZUA 3D7RA 3MT0A 4RZXA 5JO9A 3NHFA 3LC2O 2P3QA 3TRHA 4M3NA 1WMAA 2JFWA 4LYAA 3FX2A 4CE6A 4JP1A 3T7JA 1XBTA 3OSZA 2NNWB 3O84A 2V6MA 3KZNA 3WTBA 4KRFA 4HBZA 4QHTA 2OCKA 1P4AA 1MNAA 1YNOA 1T2AA 3P9PA 2DEUA 4ETWA 4X71A 2R8YA 3LL7A 4L8VA 1Y3IA 5ABPA 3WWYA 4IRUB 2PUEA 2H7CA 1JG4A 2R2AA 4HXGA 4KHZA 3LPLA 1QIJA 1NZFA 1K27A 1Q7RA 3DBOB 1SHZA 4J9UE 1SQ6A 4B6OA 3DG9A 1UT6A 4MR9B 2CHGA 3TIVA 4RETA 1EIZA 4S2EA 4L2IA 4CQLB 2P9JA 4RULA 1J07A 3O03A 1M0TA 3VKWA 3GJYA 1LVGA 2ERXA 4AX4A 2ZZNA 2QAGA 3ASYA 3ECAA 5K4GA 1A9SA 1I2CA 2AZDA 2CLOB 1QGDA 5B53A 3R75A 8LDHA 1GJRA 2CCKA 3H18A 1T9DA 1Y4ZA 5EWMA 3K6RA 5JTTA 2I87A 4Q9NA 5ARDA 3GMTA 3SICE 3TQRA 5AW1A 2ZSIA 2PKEA 2ID8A 4DYVA 2IYUA 1MJHA 4LZZA 4UM9B 1E6EA 2GLXA 3NONA 3VI3B 4AZSA 4LOAA 3DZGA 3FTQA 3QVOA 2CVZA 4OQDA 4DC9A 3HKEA 4HK4A 1EXWA 2WTAA 3L0SA 2ZIXA 3LYHA 4HN2A 5FPTA 2W0MA 2W2LA 3N2KA 2PT5A 2G9ZA 2CZGA 2WJVA 2PLWA 3HDGA 5TS2A 4B7ZA 3BH0A 5KVCA 4GMDA 2IVZA 1TDJA 5MN6A 1NF3A 4E22A 1PEDA 1QFSA 5EYPA 1IQRA 4V24A 3AUSA 4Z2AA 3IL2A 3K35A 3NHJA 1ZL0A 4D9GA 1QGUA 2I4IA 5KOJB 1RZRD 2FEOA 4IXTA 2FUCA 2GK7A 2J3IA 3PG5A 3RQSA 3TXAA 2NTNA 3FDZA 2VH5R 4Z3KA 3BRWD 2NPOA 3JQGA 4UPVA 5MN5A 1JAZA 4L9SA 2I4OA 4KJXA 3DOHA 4GEKA 5AM1A 2F43B 1E2JA 2PVPA 2V5AA 1RYNA 3PA8A 1XXLA 1YAJA 2XAUA 4CQMD 1CZKA 3ESRA 3I45A 4BV3A 3LPNA 4PSVA 3L3BA 1AUOA 1PQWA 2MT9A 4UHJA 2ZRPA 1LY1A 1X1TA 3VR6H 3CGWA 3R0JA 3P9CA 1W0CA 5GONF 1PT8A 3WMWA 1Z6PA 2YN4A 4EG4A 1GXSA 3H5NA 1H2BA 1R6AA 1IUNA 4URZR 4OHZA 1CHDA 1VKRA 2H85A 4A4DA 3EUEA 1QYRA 4X7RA 1IN7A 4IV0A 3M3DA 4BX9A 4N5MA 5KQSA 4EQZA 4RTOA 2IYTA 5BQXA 3A9RA 3P94A 4X97A 3RSQA 1BMFA 3N5CA 2IYLD 4FR5A 1YOVB 4GX0A 1E1RA 2FRXA 1J90A 4M9CA 3FVQA 5CB4B 2EIHA 3O2JA 3HFJA 4TWJA 1JIQA 1NI4B 3GUCA 1JQDA 4ICIA 4YDSA 5I8WA 3UJNA 3QTTA 3GLGE 4F3NA 3ONFA 4M2LA 4F4CA 2XYRA 4WOBA 4Z54A 1SZJG 4NBWA 2G1PA 4MKRA 1V4BA 4N9WA 4ZAVA 1GNSA 1Q7GA 5NLLA 4HN9A 2WPNA 1S2DA 1XPJA 2IPMA 1YCGA 2AS0A 2BTQA 3QUTA 2PFKA 2OCAA 3ZD7A 3EZ9A 5DGDA 1U2TA 5ALPA 3NIGB 3ON5A 3GQVA 1Z6QA 1XZKA 3AJEA 1VYHA 2GSDA 4TKVB 5DXJA 5BQPA 1T8SA 2OBBA 1EWRA 3ADDA 1FYWA 4H0NA 1E1QA 4FOTA 1T5OA 4CR6A 1RJ9A 2BMDA 3PSAA 3EZXA 3ESCA 1TGVA 3BJIC 4L07A 3BF8A 1DO2A 2FTKE 2H48A 2OHHA 2ZJ1A 4JVNA 2A5GA 1SVKA 4JODA 3RC1A 1KERA 4ZOEA 4XFKA 4F9EA 1AJEA 2NXJA 2V6JA 5B2ZA 1W4AA 3G6WA 3IKLA 4IJQA 1RPJA 3HCAA 4WEOA 4JI4B 4JBYA 4NVRA 3NMUF 1XQXA 1ZJ4A 3E9RA 4UTXA 2EWMA 5H1YA 4RABA 1W35A 3AI2A 2JH8A 3FETA 4Z6KA 1NVKA 2G7MC 4ENVA 2K2WA 1SVUA 3UWKA 3U3DA 1R8JA 1F4PA 5IJXA 3ZIAD 3OTWA 3U3RA 4FM9A 3CEJA 1JAXA 3C3XA 1MENA 3H5TA 1NPDA 3HNPA 2A94A 1KDTA 1HTWA 3OEYA 3QVGA 3R3WA 4EJ6A 4F2WA 5I7EA 3K1TA 3PC6A 5TPWA 4CG2A 1XU9A 2J46A 4LQLA 4ABYA 3LT0A 1A5AB 3UXEA 3UUEA 4R71A 2FX2A 2JARA 3ETGA 1JLKA 4L16A 2AOVA 3FCEA 4F46A 4G0MA 5T3UA 3EFBA 4C05A 4R8KA 4RUKA 5AVYA 1Y6RA 3G1WA 3Q72A 5BMVA 3ULKA 1ZNWA 1E9AA 5EGNA 1INLA 3WXBA 3U7GA 1KETA 4LNUB 1L5GB 4EF5A 1RQLA 5KBYA 1X15A 5A9RA 2PUAA 3NEYA 1YDHA 4UUNA 5FWDA 3ESDA 3JQQA 5E6SA 2F9MA 4AZWA 4F2PA 4IDCA 2PUGA 5HKLA 4KR6A 2VK4A 4GBGA 4R16A 4RZUA 4X44A 4TTJA 3D4NA 1NLZA 1IJKA 3BL8A 3RTGA 4B3CA 4LYGA 4DDVA 4NPAA 5KTSA 3TLZA 4IOLA 3L4SO 2JBAA 2JFPA 1R9JA 1TT5A 2YH2A 3KNZA 3OTGA 4MUHA 4TKUA 4I4LA 4D9KA 3MT7A 3ONVA 2RGNA 4G0NA 4M0MA 3F5DA 4X90A 6LDHA 3IMKA 4PX9A 3W1VA 3D59A 2WT8A 3V6LA 1U1CA 3BWEA 4KXNA 1E99A 2C2ZA 3GLRA 4GT1A 4UULA 4GDMA 1VIVA 4IIHA 1YZ3A 5T64A 4AI6A 1NHGA 3TI9A 3VDXA 3PHGA 4A8PA 1NQTA 3JQ8A 4WKPA 4O2AA 4G2NA 1CF2O 3N7UA 4PLYA 2GKGA 2VDWB 4ER5A 1DXOA 4HWSA 1U9CA 1VMKA 5JASA 1TZJA 4XSVA 3H9UA 3GRFA 1PAUA 4BB6A 3ZWOA 3D0RA 3HB4X 4EMSA 2XUDA 2WV9A 1XTTA 2X1VA 4GVPA 2YTZA 1HT1E 4LJ4A 2BEKA 1GQYA 2DH5A 4HYEA 1RM5A 1T3GA 2CC2A 5FX2A 4PCVA 2TMYA 1WZCA 5CXUA 5LOVB 4KIFA 1XP8A 3BIFA 3OZVA 4N3GA 3SHVA 2UUBB 4F4UA 1R4ZA 3OZSA 4NHOA 4RD3A 1CD5A 3BK1A 2Q8NA 2KS6A 4DMHA 1IZ8A 1GILA 1RRPA 1CJVC 1AF7A 2GPNA 3OLWA 4MHOA 3H5RA 2P30A 4GI1A 2G07A 4EGQA 4MHSA 2OAP1 3DDOA 4S12A 5CPFA 5BQ5A 1FVHA 1MAUA 3PR2B 1LDEA 4H1VA 5IZCC 2Z1MA 3EVGA 4NBUA 1DDOA 2HYIC 2F3TA 4JI5B 1O5TA 3T1YB 1EP3B 3KQWA 5DM1A 4F3YA 3IRUA 2XB8A 3X1DA 2ZYUX 4FOOA 4E32A 2W8ZA 2QL9A 5FB3A 4DGSA 4U7FA 2WWHA 4PNEA 4X6XA 1EEHA 1LPBB 3VVLA 3EQZA 3RAFC 3R1IA 3IBCA 3H2ZA 3U61B 5BOVA 4BPRA 4UQLA 4CKBB 5IWCA 2IXFA 4NCIA 3FTDA 5F33A 3HZRA 1YQWA 4C3UA 4C2BA 1VL5A 4NS1A 2X3FA 1XAGA 3B89A 2I65A 1JMVA 3C7CB 1MRSA 2GN2A 3GJSA 3K0CA 4BBJA 5J5AA 4F2DA 3PUYA 4EJFA 2ZROA 2CMGA 3HS3A 1U3FA 4JP2A 1G8SA 1VI6A 2Z5FA 5K3AA 4D4KA 1TLTA 2PZFA 2QTFA 5BR4A 2ALJA 1D3AA 3IOBA 5K0BA 3PHLA 2I9KA 1LKZA 4O1MA 2BRUA 2DGDA 1M76A 2IXEA 3AYZB 3G1TA 4OK5A 1VL6A 3DZHA 4FT4A 7ABPA 1GG9A 3B78A 2ZTLA 4HFRA 4LW8A 4RKYA 2CXRA 2J0UA 1QZUA 4ENRA 4DNOA 4Y2PA 1H8HA 5K8IA 3HKBB 1JIVA 4FKMA 3QQPA 4MA5A 1QF6A 1CQIB 3CWCA 1BXKA 1RWNA 4MS3A 1NNI1 4KQIA 1VQ1A 5B57C 4LHYA 2V7TA 3L7LA 4YJ3B 3UJ6A 4D6PA 3L92A 4I7EA 3GJ5A 3W5SA 1DI0A 3ONEA 3AU9A 3C15C 4FSHA 1YUNA 2B82A 3C39A 1I30A 2FQYA 3HBFA 2D5LA 4DS3A 3MUOA 5LU9A 1OFIA 4N6OA 1OPXA 5D51S 2Q1WA 3EYWA 3GJ0A 2NQTA 4JB3A 1ADBA 1CUJA 4MA0A 5E9AA 3TO5A 4P0TA 4GPZA 3I28A 3W5VA 5CAEB 3NTXA 2GXSA 3EOBI 5DGIA 3A7DA 5FBLB 4QTYA 4KSBA 4Q48A 3IE1A 2NZUG 4HFMA 4BN0A 2OVFA 2PRKA 3LVQE 1E77A 4RE6A 2NSDA 1BQEA 4K7JA 1ZJZA 1HA3A 2CYBA 3IHWA 3E5RA 5A7FA 2HLNA 1EP1B 1EFTA 4MRMB 4QXOA 3KHUA 4A73A 2ZOSA 3N75A 3FPGA 2EBUA 2C9BA 2MYUA 5AXAA 1KRWA 1TF2A 5A9SA 2O2IA 2E4AA 1N6OA 1RWVA 1U2GA 2VZ8A 3QLVA 2I0FA 4ISBA 5LZ2A 3BMCA 5CDFE 1Y4DE 2O7NA 3KOUA 3QPUA 3Q7IA 1PLKA 2OCBA 3EQ7A 4U8HA 1CVRA 1R6UA 1IIBA 1GA6A 3GD7A 1EA7A 3OX4A 3IEUA 2VHZA 5B58T 1I2ZA 2XUGA 4YAIA 5LYJB 4NBSA 1G5TA 3R2JA 1TAGA 2HF8A 4IRXA 4MPTA 3UVEA 4OGKA 4D98A 3HUFA 3CVUA 4AF7A 5CK4A 1F8YA 1NYTA 1C2TA 1SELA 3N8KA 2ZSEA 2E4WA 3DC2A 4KO1S 1L7OA 2AUTA 4XE5A 1W4BA 1K3FA 3L6CA 3NM5A 2B4QA 4RK0A 4D9CA 3JALB 2DRIA 2VDOB 1ZQ1A 1CERA 4M7PA 1S8FA 1M1ZA 2D2XA 2EYQA 3DLBA 1OCEA 3FSGA 3GFBA 4EKEA 5A02A 4MUJA 3I6MA 1T26A 4BQSA 2VQSA 2WR8A 3EC1A 4EY8A 5HM8A 2EEZA 3WIVA 1OJ7A 2ZR9A 1W6RA 2FJPA 4YRJA 1DTSA 3HP1A 2P75A 3PHIA 3QBTA 4R1QA 4EBFA 4LYEA 1ATZA 3EGOA 4GC5A 4QYMA 1E1LA 5CCEA 3GEHA 2J6HA 1IE3A 2QD2A 4W7SA 2NO4A 3GFSA 4MQBA 4UOZA 4F3CA 1SHJA 3A11A 3OOYA 2ZITA 3TCXB 1S9DA 2GZ2A 1W0JD 5JYBA 6ABPA 5J2UB 4LBZA 2F9LA 5EESA 2W0SA 3HXPA 4OQ4A 3E3AA 4TV9A 4BGDA 4TZ6A 3K5HA 3N3BC 3U3ZA 4NBTA 1IBLB 3AFNA 3PNOA 3IIKA 4CRWB 1LU9A 3Q7QA 3TQSA 3DM9B 1CU1A 1Y7IA 2YZKA 1U7HA 2Q2OA 1TCVA 1AMOA 4U0JA 2PKXA 1G64A 4KFRA 1QG4A 2YWFA 3SC2B 3UF0A 4DQVA 2IK8A 4J3NA 4MMXB 3S7TA 5ICSA 3CXUA 3GELA 4UNNA 1L5QA 4IIGA 2KWIA 5JJ5A 4ZXPA 4JR1A 1M66A 2VK2A 2TRSB 2AOXA 1XTVA 3TL6A 1DOHA 2H0QA 3IKVA 1EKXA 5JAUA 4EG8A 3BD8A 2A1IA 3KBBA 1GGKA 3DAOA 2Z30A 2YRFA 5EMKA 1RM4A 5HM6A 3VXKA 1VJ5A 5E4FA 4A0RA 4MUMA 2QPOA 4COKA 4HWOA 3NASA 4LDZA 4HPWA 1C3VA 1H4VB 2O1XA 3K4HA 4XIFA 3ML1A 1F38A 2VNIA 3Q9SA 2F2TA 1FJ2A 1OBVA 2OWEA 2C0CA 1OAOA 4QEKA 2HDOA 4UUOA 5CCDA 1W1IA 4KZPA 5AI9A 2WSYB 3TNDA 3SNHA 4V0QA 3SQLA 3AKCA 2YV3A 3QKIA 5JDCA 5HRUA 3PFCA 2JA2A 1IOVA 3SDZA 3W6PA 3CJQA 4PG5A 2R85A 1NN1A 5GP1A 4NDAA 2VTBA 3K9QO 2IYFA 1LZLA 7YASA 4TRNA 5FTJA 4F5DA 3M82A 2I67A 3D4IA 4MWBA 4B74A 4WZ6A 2PAFA 2PRYA 3SGLA 5A3QA 1QH1A 2JF0A 1US8A 2VCEA 4GH5A 1D2RA 2BCGY 3ZQKA 1UEXC 4QLOA 1B26A 2QSZA 1U90A 2QJOA 3EB9A 3PGA1 4JUDX 5FO0A 2MR6A 3X1YA 4ZCPA 1QZTA 3UEOA 1ITZA 1Z16A 4OXXA 1H9AA 5IKOA 4XYLA 4G0WA 1O9BA 1IFXA 2LDXA 4O59O 2OE2A 4B6QA 4E07A 4TLAA 3TFOA 2CLCX 5FD8A 3TLJA 1T6XA 3I73A 3PI7A 1VG8A 4PHTA 5FNVF 3UANA 1JHVA 4F91B 1LTQA 3GROA 4BB9A 3ANNA 4RSHA 2A5LA 2WAYA 5GJWC 2QORA 3UUFA 2GZRA 1GAQA 4F56A 5FEUA 4BNDA 3NDBB 3WRXC 4DXHA 3G02A 2Z5LA 2IEGA 1GGJA 3UWPA 2FDCA 4L5IA 3RCBA 4BBAA 3U62A 2GAFA 3RVMA 5DM60 1YR1A 2C57A 4AO7A 4X66B 2NV2B 1ZGHA 2IIVA 3ANSA 2ZU0C 4MUEA 1F20A 4ACBA 1FVOA 1KF0A 4D6XA 2JJ1A 1QFXA 2VP4A 5DO9A 1BGXT 3R7NA 4DC0A 4F4FA 1Z26A 4L72A 3UWOA 3IEXA 2HNKA 1F12A 3G9XA 2L69A 1ABBA 1HE4A 1N2CA 3R0IA 3SFTA 1Z5UA 1SUWA 4ILEA 2X1LA 3E3MA 3MTJA 4OQEA 2WEKA 5IUKC 4E94A 1YV9A 2I03A 4Y30A 3UCFA 4OVKA 2H3EA 3DL4A 4NYJR 2AEFA 3T35A 4YRFA 4KWTA 1TUGA 3P4YA 1EE9A 2Z95A 3R9XA 3Q8XB 1EB8A 2X86A 4JGBA 4MW1A 3QKUA 2AMFA 3IUYA 3OEEA 1DRWA 4MYTA 3QTBA 1HDOA 2O4UX 3PU6A 1FTWA 3V1YA 3ZGYA 4CKWB 4E7PA 2M98A 4EA9A 3WIDA 3N8GA 3K70D 1XTUA 3BKWA 1AKTA 1VG9B 4Y2VA 4MIYA 3WWZA 1UEJA 5DI9A 1GM5A 3IPAA 1L4EA 1JT2A 1WVIA 3CJRA 4XFJA 4MWEA 3WJ1A 4U3JA 3TJMA 2EZ8A 3A37A 1ZRSA 4M0UA 4NNOA 1CUHA 2ZSFA 3GCWA 1P5FA 2KW5A 3S2UA 1E94E 5ALTA 5TT1A 3T7KA 2IPXA 1N8KA 1UM9B 5DB4A 3PXDA 1HM5A 4KG7A 3WE7A 2AI1A 4EEKA 1SG0A 1P6QA 3KKLA 5FA6A 1H6DA 2ZRAA 4ENTA 2CL6X 2PHZA 3IC5A 5JR3A 2EYUA 2HZ7A 4P5PA 2JGLA 3WLIA 4MR9A 4XVCA 5LN1A 2DFLA 1AV6A 3WGUA 4C21A 3CLUC 4KBGA 3U4GA 3AW9A 1EGMB 1QV6A 5JC1A 4R5HA 1RYBA 3VA7A 5KYXB 1ELOA 4MRAA 3O75A 4X54A 2IQIA 1T4CA 5H4GA 1L7NA 2GN4A 5P21A 2Q7OE 5EMJA 1Q84A 3TGLA 1U8FO 3MQ4A 2IXTA 1G3MA 4HNQA 4KXVA 3TOSA 4ZV4A 3Q7TA 1HORA 1TCCA 1ZXXA 5EIXA 1JFSA 4H08A 1ZAKA 2ATVA 4M22A 4EUEA 5BURA 1UODA 1YH3A 3CRZA 3ZWDA 2CY0A 3NHRA 4KN5A 1Y9EA 3AZQA 3CEHA 5I7WA 4UTVA 1VIDA 4PGHA 1JBEA 4BKUA 2X7XA 1U6KA 4X1IA 3V8NA 3D2AA 1Z7YA 1U8CB 2DBVO 1L1RA 3FHOA 4MCIA 5EZQA 3RS5A 1SURA 3CLVA 4WOKA 2V3CC 1YK1A 5AK3A 2RC6A 2XCTB 3EPKA 5KSOA 1ZOOA 3M1LA 3KWJA 1ZNYA 3QRWA 4JI3B 5KNCA 2GB4A 1SCKA 4RS4A 2BSQA 3UATA 5IT9A 2N75A 3OCZA 4ZOBA 4BE7B 1KAGA 3OP1A 4JBGA 4LMBA 3VGJA 4BMVA 2F43A 4JYCA 1BMQA 1DAEA 1M2NA 3N07A 3TNLA 2VDKB 2BCEA 1V9SA 3ADOA 4LYFA 4JYZA 4F2GA 5BNZA 1L5NA 13PKA 1Y8RA 4TMZA 1E6LA 2XMRA 3SZUA 1QRTA 4ARCA 2LCFA 3G79A 3JQCA 3UAYA 4WD3A 1CG6A 2RB5A 1ECBA 4KNWA 4EUKA 3L4EA 1TF7A 2QHXA 2BJHA 2Q21A 1R0XA 1VKJA 4X91A 1BCSB 3B5EA 5DHAA 1JQKA 1RXYA 2IYAA 2A92A 4INZA 2QYSA 4C03A 2V97A 5BT9A 2R4QA 5CBKA 2JVJA 2P4EA 4J1TA 1ANKA 2PX0A 1WBBA 4NV1A 4FYHA 5ENVA 1DIRA 2LBPA 3V8QA 2FVYA 1CR0A 3E5NA 2VJDA 4ZQFA 2OFFA 3HFSA 3LK7A 4G5FA 3OCJA 5BN3B 5JWOA 5LSAA 1BX3A 3DMYA 5JD5A 1OIVA 1A95A 1A5BB 4LOLA 4E5SA 5BV7A 1FFYA 2IPNA 5IMSA 3BXFA 1UDBA 5AXDA 2OHIA 3QVXA 4DGQA 4AN1A 1DUIA 4LRYA 5EXDA 1FFEA 4B1FA 1Y1QA 2CUNA 3BWMA 4PC7A 2OYSA 2PQ6A 4B46A 1ZNXA 4TKVA 3PL5A 1FCJA 2VPQA 3IBSA 3A6GA 5JCPA 4N5HX 4GQIA 1KYIA 1YQUA 3OOEA 2BI7A 3P71T 4HNHA 3D8RA 3WSWA 4ZGGA 2OQIA 5TQVA 5KX5B 1W36D 2YMMA 5HTOA 2WHPA 1MT3A 1KJQA 1V5WA 3I39X 2A3RA 3PT5A 4NBLA 2DPXA 1SD2A 1ZN2A 4AT1A 5EINA 1FXWA 1VYUA 4LRTB 5C34B 4DUYB 1H23A 5FDFA 4BFVA 4R7TA 2J3JA 5A4IS 4TRRA 1EVLA 5M3BA 4CCYA 3UWSA 1VBFA 4PCAA 2GOYA 4EUFA 3UUWA 4B40A 3VOBA 1SQGA 4ARIA 3LX5A 2FW1A 3K6KA 1A8QA 4AJNA 1OROA 3PZRA 1GG5A 1I8TA 3V4PB 1G7TA 2OY0A 4DV2B 4RLSA 4ZI7F 3GJ8A 4WFQA 1M7BA 4AJKA 3M5CA 1KYTA 2P9QA 3CX3A 1KYQA 1M1YA 1K08A 2CLLB 4OQLA 1E98A 1T5BA 6CHYA 1LEHA 2GILA 4GGOA 3I92A 5TF4A 4RZQA 3GLHB 4X00A 3DDCA 3MGAA 4F6CA 1KS2A 3GEBA 1FP1D 4PAGA 1X1QA 1OB5A 1F2TB 1TZ2A 1WL8A 3LAWA 5KHAA 5JROA 1ZUNB 1P7CA 1V3TA 3FOAA 4DIDA 4KQWA 5JH7B 4EDHA 4RVDA 5KSYA 1TFRA 3LKVA 4I8XA 2G0TA 1W47A 2HSZA 4XWWA 1SFRA 3HM9A 1PJ8A 1MTOA 4D82A 4E51A 3LUDA 4O2BA 3LHKA 4QUAA 3VV3A 5JCOA 2CNOA 1LC0A 3E48A 1NN3A 2H5JA 1SIWA 2XNHA 4YFVA 1FDIA 2EFHB 5DSTA 3VM6A 1QIDA 2V03A 5JCZA 1UBTS 4JKIA 1BCRA 1JFFA 3WGZA 5LP6C 4RXUA 1NE7A 4RZIA 1V7QA 3TOXA 1OTXA 3MAGA 4WNCA 1UJNA 3RSFA 2ATEA 3IVRA 4PHHA 4AYXA 3WOVA 2L82A 3O7MA 3HI6A 1YBMA 1DPGA 1HFEL 1XDUA 5AM5A 5IU6A 4CEIB 3QNUA 3MWLA 3F7OA 1Q14A 3KQTA 3SR0A 5C7OO 1ISMA 2JAXA 2XW6A 4JI0B 4BX8A 2OECA 1WZ2A 3SIWA 1S96A 4Y1EA 2O1EA 4B8WA 1VI2A 4UDOA 3V6MA 4WY5A 5IVDA 3CNHA 4ZCQA 5A7GA 4GUAA 2I91A 1QUFA 3KALA 3KYBA 3QX9A 3T5CA 4MAFA 2DUJA 5F3DA 5GINE 1RYZA 2OBXA 3G8AA 3UC5A 4PCUA 4DANA 4NFHA 5DHFA 2OK7A 5D84A 3OEWA 3U44A 2RBGA 5IAOA 1PNRA 5JFOA 2R8BA 5JATA 4ND6A 3BA6A 3QXHA 5JMTA 5AK4A 1KFCB 4YI3A 5CEJA 1EK1A 1JFLA 3ZU4A