3K2QA

Crystal structure of pyrophosphate-dependent phosphofructokinase from marinobacter aquaeolei, northeast structural genomics consortium target mqr88
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
418
structure length
392
Chain Sequence
b'IKNAFYAQSGGVTAVINASACGVIQTARKHPDQIGKVYAGRNGIIGALKEELIDTSLESDDAIQALIHTPGGAFGSCRYKREYERLIEVFRAHDIGYFFYNGGGDSQDTAYKVSQLADRMGYPITCIGVPKTVDNDLPFTDCCPGFGSVAKYIATSTLEASLDIKSMCETSTKVFILEVMGRHAGWIAAAGGLAGQSEGEPPHVILFPEIPFNREKFLERVDQCVRDYGYCVVVASEGAQYERFGVAPALANMVKQALGHKYHWAVADYLQRAARHIASATDVEQAYAVGKAAVEMALAGKQALMPTIVRDQAKPYRWSIGEANLSEVANQEKKMPIHYITDNGFGITQDCRDYLQPLIAGESFPPFDDGLPRVAKLKNQLVEKKLRTEFEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyrophosphate-dependent phosphofructokinase
publication title Crystal structure of Pyrophosphate-dependent phosphofructokinase from Marinobacter aquaeolei, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET MqR88
rcsb
source organism Marinobacter aquaeolei vt8
molecule tags Transferase
total genus 134
structure length 392
sequence length 418
chains with identical sequence B, C
ec nomenclature ec 2.7.1.90: Diphosphate--fructose-6-phosphate 1-phosphotransferase.
pdb deposition date 2009-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00365 PFK Phosphofructokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3k2qA01
3.40.50.460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3k2qA02
3EHDA 4KXLA 3IMKA 3U39A 4OHRA 2F67A 4OHBA 1S3FA 4KXMA 4I7EA 4NPAA 1S2DA 2IZ6A 3O8OA 1S2IA 4LJRA 4WL0A 4JELA 3QUAA 1WEKA 4P5DA 2PFKA 4I36A 2IZ5A 1T35A 3K2QA 3MAJA 5ITSA 2F62A 1F8YA 2KHZA 3SBXA 2IZ7A 1F8XA 3O8LA 2F48A 4I4IA 3OPYB 1WEHA 4JEMA 2Q4DA 2NX2A 4LJLA 4PFKA 4MEJA 3F5MA 1ZXXA 2PMBA 4KXNA 2A0KA 4FYKA 1S2GA 3OPYA 5AJUA 3UQZA 1S2LA 3BQ9A 2Q4OA 2KLHA 3GH1A 3HNOA 1MTOA 1RCUA 2F2TA 1YDHA 4A3SA 4FYIA 3O8NA 4LJKA 3PFKA 4P5EA 2F64A 4HX9A 4FYHA 4JENA 4U1RA 4MCJA 5AJTA 1PFKA 2HIGA 2A33A 3O8OB 4RH3A 6PFKA 1KZHA
chains in the Genus database with same CATH superfamily
3CCBA 1ZM9A 2Z6QA 3EF0A 1BOFA 3C5VA 2OM6A 3EDYA 4BDTA 5KTPA 1E6EA 3EIEA 1U1IA 3FPEA 3HR4A 2FKAA 2GSWA 3UOWA 3P9XA 1W88A 1YI0A 3HA7A 4R8LA 3B7GA 1US8B 1DT3A 3EISA 3OQ6A 4LHVA 2Q6VA 1WZIA 1N6RA 2WIGA 5DWDA 1RHRA 1KMNA 1GNTA 1TJ5A 3HMQA 3RBXA 2F17A 1UAYA 5F9MA 2JGMA 1SXQA 2F1RA 5G2OA 1VG9B 4NZNA 5BOSB 1FYFA 4S2UA 2IZ6A 3O8RA 5F35A 3H2SA 1P39A 4WXYB 3GAZA 3NT4A 3DPSA 4H7HA 1VG8A 1SCBA 1U3VA 4P3XA 1E92A 3PC2A 1QHFA 4LNHA 1DXOA 5EHGA 2Q7OE 4D25A 3Q3CA 3K15A 2F9FA 5IU6A 1WEKA 2VK1A 1CLEA 4WLNA 5KYNA 1PDWA 4J7UA 4BP9A 4BX0A 2O2IA 3ZTTA 5MDHA 2IZ5A 4LRUA 1CNMA 2H18A 4KGXA 4BQOA 2WF9A 5FNVB 4EB0A 5IN4A 4O63O 2B1QA 1DFIA 3CLSC 2DMRA 3GQBB 3H04A 1V35A 4DC1A 3ONFA 4AMBA 2OORC 2PU5A 1U9JA 4OKIA 2GH1A 1BVHA 1QIJA 4NFSA 2X15A 1HURA 1OWMA 4KG7A 1YRLA 3I6ZA 2QEQA 3SD7A 4EYEA 1RAIA 3K96A 1O97C 1PVDA 4KAJA 1NW6A 4V0RA 2WK1A 4JOBA 4FFSA 1W0JD 2W2MA 1CUGA 4KE6A 2P9EA 4N6GA 3B3GA 2OY0A 2GCOB 4A8TA 3VKUA 1U2TA 1E2MA 1ZH4A 4Q3AA 4O2RA 4BNGA 4XSGA 2NVWA 1YKGA 3F9IA 5DVZA 1X94A 4U7FA 1HZJA 3BJEA 1CUXA 1SIBE 3F7TA 1A5SB 1W5TA 4RD0A 2BM1A 4JH0A 2UXDB 3VYUB 5FJJA 4NNPA 1K9VF 1ZRNA 4LJYA 5JE8A 2PLNA 4MQEA 3ZCXA 3BT7A 3HLKA 2WKWA 4G65A 4NZYA 1X7XA 1PQ4A 5A1JA 2Q9AA 4U2FA 1M10A 1TIKA 2YMMA 3BRWA 4K0KB 3GFSA 4NZOA 1RXUA 4AZVA 1CF2O 1GAJA 5JD6A 3AFHA 1V5EA 4MVJE 4DCOA 4WXHA 2QVLA 3VSAA 5CDUA 4NBSA 2YZKA 3I4FA 1G3MA 1NVBA 5H3HA 1W8DA 2PUVA 2YV4A 3BWMA 1QHEA 2AE2A 1GGMA 1EMDA 4ZOAA 1NVGA 1PW7A 1W0KA 2FK8A 4NK5A 4K6HA 1XAHA 4J7XA 1RWVA 4A3SA 3GRVA 5JXIA 3Q10A 5KQPA 2B4RO 5E0KB 5FXMA 4L72A 5KYXA 2GM3A 3IT2A 5ADVA 1YZVA 5TSDA 2UUCB 1QGUA 3OTQA 4R51A 1ISIA 2WT4A 1XQ9A 4BVFA 3H4MA 3FZYA 1CR4A 2GFHA 3RUAA 4D4HA 2PKWA 4JBHA 3DBLA 4URFA 2FDXA 5F9HA 1I3CA 4YPOA 3OT1A 1JSRA 5FFMA 1JDTA 5D3MB 3K0BA 3PWKA 5ELMA 2E4ZA 4QQFA 3VH1A 3W6PA 4AF8A 1JLHA 3LUAA 5JBQA 3PC8C 4S1PA 3O8OB 4QYIA 821PA 3V1TC 5CT8A 3BDAA 1HT3A 2CXSA 4G5HA 4M8LA 1C1YA 2EGHA 2ZYSA 3EZYA 4GX0A 4NJMA 4TT3D 4DCNA 1CDEA 1XD2B 2W4MA 5DRYA 1H2WA 1CSEE 1G19A 2MR6A 1RR6A 3EEBA 4I0WB 5B5SA 1WBBA 3ERCA 4I50F 1H2FA 3EY4A 3R3UA 4FUTA 4NCJA 2Q45A 1CD5A 1JQEA 3DR3A 4PYRA 3DEKA 3GRFA 2PKXA 1ZYUA 2YZ2A 4B3MB 4U9HS 4OL0A 2VZ0A 2JLCA 4IXNA 2NIPA 1ZINA 4C4ZA 4WZAB 4AP5A 3PITA 3ANTA 1ZL0A 1N34B 4DG5A 5AK6A 5MFZA 3E23A 5G4KA 1X7WA 4PYKA 1KORA 5AVOA 3EFHA 1VRVA 2IZOA 1HE2A 3SHOA 3T0GA 2ZE6A 3AERA 2UUOA 3OJCA 1JB1A 3IQHX 1FRQA 1HDIA 1IEWA 3FMIA 4CZ2A 5JQWA 1R7RA 2GKOA 1O9BA 2PFKA 4WA7A 4ZZ1A 4US2R 3GLIB 3PD1A 1VHJA 3KLPX 5JLJA 1QKKA 2VYQA 3AM4A 5IBCA 4AI6A 1X1RA 2R9VA 4O2AA 2HMSA 4BLRA 3LD9A 3IO3A 4PYOA 4NAHA 3RU2A 3JZDA 2X0EA 1QQBA 4O2BA 5AOBA 5FUBA 3TGWA 4LJSA 3L0BA 4OXKA 4YROA 1XOIA 2IZ7A 3CF4G 4UASA 3UVEA 4Z1MD 5CUQA 4L9WA 3ZWDA 1K0UA 3PE6A 1UT8A 1RLMA 3FWKA 3HLTA 3HUFA 1W36C 2IOQA 3DEAA 4JB8A 5ARBA 2CXUA 2GK7A 3P2IA 4QKQA 2BEUB 2NX2A 5GGXA 5LDGA 3N2GA 4I5IA 4LNUB 5DV9A 4AKEA 3MCUA 5BPHA 4AP6A 4B71A 3NIDB 2VXBA 1L1QA 1KWKA 3TGLA 4MI1A 3P4XA 2F3SA 3KHTA 2FZKA 5T57A 3MJTA 2IV7A 5J2UF 1ZR2A 1W8IA 3D1JA 1Z0ZA 1J7KA 1OAKA 1MJGM 3EW7A 4RYLA 1OI2A 1W59A 1WNTA 3KQOA 5DFAA 1F2UB 1CY2A 4BV9A 3FBTA 4RJ2A 2ZE8A 4RQTA 4NWIA 3LF1A 4D6YA 4QX6A 4AECA 3TN7A 4AJKA 5H80A 4YAIA 1D2CA 1H0HA 1ZG3A 4ECEA 2HRCA 4ITUA 1CHDA 1LUAA 2Y76A 3JQ9C 1RWOA 2NXJA 1HH4A 3AB3A 4JITA 2F43A 2QSYA 2R1TA 2QWXA 3FWHA 3IQWA 3M89A 3Q6MA 2C61A 4LYFA 3W7BA 4JGIA 4B43A 4EHFA 4FOSA 3G13A 2DHCA 5IBRA 5D01A 2JZOA 3OF2A 5CTAA 2RGCA 2QVBA 3FVQA 1TJNA 2P91A 5HJ5A 3QBTA 2QAGA 2QN9A 3ONEA 2W93A 3GWZA 3LCRA 3TQHA 2CVOA 2CNDA 5JSQA 1P3Y1 4FS8A 4P4SA 5SY9A 2J7PA 5FCDA 3QWBA 4ENRA 4WWHA 2QL7A 3TLXA 1YK1A 2V45A 2QRVA 4FJ2A 3AEKA 4I46A 4M38A 2A5LA 2YDXA 2CLSA 3MFQA 1DX6A 4N3BA 4KQ1A 4WUTA 5CDGA 1DUVG 2ZRDA 4OD0A 1V47A 4X60A 1HZZA 4IIBA 4X6YA 3V8EA 3PUKA 5B4TA 1WXXA 1ZVKA 2J0SA 5BSFA 4W82A 3DUFB 1T6NA 1MENA 2AWNA 2C0QA 2YS6A 2D5LA 2G8NA 2Q29A 2YASA 3LWBA 3MJEA 4MKIA 5EHQA 2GYWA 4OHPA 3SS9X 4QDJA 4WECA 3TMKA 2C5BA 1JPJA 1GG9A 4LEIA 1JAIA 4MRMA 5ALKA 4RY2A 1T2FA 3FWYA 4CTNA 4EKIA 5KX5A 3A9SA 3AQIA 3EA5A 2P11A 4GR9A 3RGWS 1EKXA 1HO3A 4ZD6A 1DRWA 2G6BA 1XCGB 4KMOA 4D4IA 2XUKA 1W6RA 4GOXA 4JVSB 1TIPA 3F5DA 4R9VA 1D2GA 1RQLA 5CVUA 4DUGA 3LY8A 4UUPA 5ABPA 3R76A 5C8ZA 1TYBE 5TRTA 1SUPA 4FYYA 5MN5A 3I9KA 4UHKA 4BUJA 4YMSA 2QMEA 4X6XA 4H7JA 1IZ8A 1IOVA 2EEPA 2RBKA 3DHWC 3L07A 1YOVB 2ZJBA 3LK6A 1E5TA 3MLEA 4IG9A 1G21E 4HQ6A 2FP4A 4WD3A 1YZ3A 3U40A 3M7IA 4LXTA 4P80A 4IJVA 1E32A 3G2PA 4A0QA 4DCVA 1F2DA 4PAQA 2FG6C 2KYRA 3I62A 1GGFA 1Y5NA 1Q1BA 1VDMA 4FGJA 5DLQC 3IUNA 1D2AA 1JLMA 1DBWA 1QO9A 2DYKA 2GD6A 1H69A 2IA5A 3BDVA 4GF5A 1FDVA 4XB2A 3U61B 2QBYA 2RCNA 2QW1A 1Z2NX 1NPDA 4G3XA 2A4KA 4KBGA 3GNLA 5JW6A 3CWZA 4MUXA 3JRWA 1XTRA 4X6LA 1FX0B 3BFVA 3OH8A 4D5GA 3NH6A 1FFWA 3I1FA 3KVYA 3PXEA 3ZK8A 1FDUA 1A5AB 3NTQA 5JARA 2R25B 3U7IA 1SEPA 3FNIA 3V7WA 3EVEA 1MUUA 3QOXA 5D5PA 2IH4A 1ZNZA 2Y92A 2C9MA 1KARA 2H1RA 1VRCA 5DM0A 4DLSA 5C52B 1HNWB 2JIZD 1YF3A 2P9ZA 1BWQA 5DM2A 3H4IA 4PQYA 3DTTA 1TF5A 3AF2A 2QSUA 3QVGA 3JQ8B 3HDGA 3O73A 5CDFE 5L7TA 4ZOLA 1K6EA 3KAQA 1CJBA 1QZXA 2VJKA 3O4RA 4HS9A 2Q49A 4HDOB 1XJQA 5TQ2B 4EKYA 3TD9A 3GYGA 3OI7A 1BC5A 3OTHA 4DQLA 3WX0A 1OPRA 1AF7A 1D07A 1WULS 2H0RA 3DCIA 1R3UA 3N3BC 3FBGA 4KXUA 4EM6A 1QIFA 1KIAA 1Y4SA 4OLBA 1Q16A 2BOVA 4DMRA 4K3VA 3EIWA 3B6JA 5B1YA 1NXQA 1EIWA 5J4LA 3M5WA 2R97A 3IE2A 3N2ZB 4Q1FA 1RBMA 2PX0A 3DULA 4DUZB 3FPHA 4RMJA 4V2UA 3CIFA 2V1XA 1E0AA 2JFVA 1XZHA 2O8CB 2Z2IA 3KAPA 5HKBA 2Q46A 3DE1X 7MHTA 3SLRA 5GY7A 2M1ZA 2OO7A 2EWMA 3EEFA 3IPLA 3D4NA 4IIEA 1RC0A 3EHEA 4GOND 4EI7A 4KE9A 5A3QA 3W9SA 3VRHA 5K4HA 1O95A 4OA5A 1HGXA 2SKDA 3OLCX 4GICA 3LA8A 4KTVE 2NO6A 3UFXB 4F45A 1C7IA 2WSBA 3EIOA 3EXIB 4D3FA 3UKOA 1E4YA 1NYLA 1YC5A 3RRYA 1UOQA 1I6LA 2Y9PB 2RB5A 4MDYA 1A97A 1PZGA 3HUDA 2Q3MA 3BFKA 4E4RA 3AX6A 3P9QA 1K63A 3Q1LA 1B1CA 2OLJA 4J90A 2CHQA 4NJEB 4IFEA 2VDJA 1GVNB 4X00A 3K1AA 1VOTA 5DXFA 4RVGA 4XJXA 2HQBA 5SYNA 2CSXA 7ADHA 2PRYA 1RP7A 2ORIA 2IUFA 1M83A 5CNIA 2BFAA 2RHOA 1JXOA 1O5OA 4S1OA 4C30A 3ASYA 4XX0B 5AO9A 2PXAA 1JDZA 2OHOA 1QNLA 2QL9A 4H08A 4NL4H 4RFVA 2WV7A 1ADYA 4PVCA 4OX9Y 3M2TA 4F6CA 1EGQA 1RKXA 2BEVA 3HY4A 1EK0A 2I7DA 3WKBA 4OJMX 3IKTA 5JDIA 4FS3A 3WK6A 1GQFA 4X3PA 3LAWA 2DH6A 2EIXA 3QW4B 2Z9CA 4R1UA 3V4ZA 4C4OA 2GTPA 4P5DA 3OZXA 3C6BA 3D6VA 1HFWA 5KYGA 3E5RA 4E3ZA 1GV0A 4KYVA 1EX1A 2PD3A 2Z1NA 4V0LA 4AF7A 4K7JA 3LTNC 4HX2A 2QPLA 3V2GA 2OWEA 2WWIA 1MQ9A 5FOVA 1IHXA 1F14A 4GWGA 2DUMA 2QXTA 3QEBZ 3LTEA 3MWDA 1NT2A 2Y77A 2V59A 4PG5A 3RIEA 2NUTB 1W96A 4BLVA 2AH5A 2O0KA 4DCGA 4Z2AA 3VX4A 1SR8A 2XE7A 2WT9A 1XVLA 2RHTA 5FUQA 3SIWA 4GL2A 3MK31 1AQUA 1N57A 2EFGA 2C95A 2FX2A 3BQMB 3JQQA 2PH5A 4JT9A 1BE1A 2OOKA 4C0XA 2CVPA 3ZDCA 3P9RA 4I1YA 1KAGA 5IN5A 1GYRA 3EUEA 4CM5A 2YN4A 4RVHA 4YY3B 2OEPA 4GYJA 3CA8A 3VHQA 3ZTWA 4P8RA 1TYEB 4QU9A 4FXOA 1W7AA 1SCIA 3OLYA 3F8WA 3FPAA 4ED9A 5ARDA 1KEKA 1D0SA 3LXUX 4MR7A 4YCJA 1GJRA 2F1HA 5C32A 2VDNB 4DS3A 2G5GX 2OFPA 3JQPA 1RXYA 1HDYA 5D7NA 2OORA 4B8YA 1GAQA 1K8RA 1JNYA 4IWNA 4PR0A 2GZ1A 3L4BC 3FPCA 3VNRA 3UWOA 4DIDA 4RCYA 3R0ZA 3FCSB 4M0CA 2FZVA 4OYLA 1Z36A 1YL7A 1SXJB 3V7UA 5JAZA 3O4HA 1C1DB 1U8FO 1RYZA 1TM2A 2OHHA 3F6CA 4DDKA 4JYZA 1FFCA 5BW4A 2VAVA 4DLLA 1Z8NA 3FVTA 5B2ZA 3BXFA 3W8RA 4P98A 3H5VA 5EWLA 1LDEA 3O8CA 3GDFA 4L5CA 3MM4A 3WVNA 4ZMSA 5HIKA 2X8JB 3S2ZA 1WXGA 2HTFA 1OD6A 1QRDA 2VXOA 3TUIC 1JAXA 2JH9A 2D00A 5DM1A 2E87A 3WYBA 2JLXA 2MTBA 1E3WB 3QKSA 4NCAA 2F64A 1S01A 1YL6A 4UUOA 1O1YA 3AU8A 5CT5A 1CS0A 1Q50A 2A92A 1RQ7A 5LMZA 3S81A 3EMBA 2QRLA 3HWSA 2QN8A 3CSDA 3FNBA 1JMYA 4XUEA 1GGVA 2JBWA 4L0QA 2HM7A 2HLDD 7YASA 4JXZA 3WMRA 1P6QA 1RM5A 2ZRAA 4J0HA 3X2SA 2AKAB 3CNOA 3IEXA 3IB6A 4WOKA 3FCYA 4WNAA 4FQ5A 5H1YA 5CA0B 2RGNC 4OHOA 5JD4A 1OREA 1P17A 4LYJA 3U39A 8ABPA 1CXZA 1N8NA 5KI6A 4K1LA 5DNEA 4EG5A 3K1ZA 2RGXA 1ETHA 2UV8A 1YJXA 2EJTA 1O54A 3HYSA 4Z9YA 3LS2A 3IURA 3R40A 4LZJA 3K20A 4KQ6A 4FFLA 4ZJZA 2DFNA 1W5SA 3C3PA 3CO5A 3AIMA 2OFXA 5DTRA 5KNCD 1REQB 2I1QA 5EIBD 1KMHA 1SUAA 4U6SA 1FP1D 1H0RA 2ZI6A 1GITA 1NR1A 4JU9A 2FPGA 3P52A 4FC7A 5J2UA 3QX3A 4KFTA 5AM5A 3GPDG 1NN1A 4XVCA 1OV6A 1G66A 4FBMA 1ZRMA 1D0VA 1J7JA 1XLVA 3K8OE 1GEEA 3I8XA 5FHQA 3PDWA 1GL7A 1O57A 3RIMA 2PSJA 3H2GA 3VKVA 3VU9B 5AQ1A 5CG2A 2MR5A 1VJGA 3PC8A 1GUBA 2XD4A 5M5BA 3I76A 2CY0A 2OOSA 4MUMA 1CQXA 3WLPA 2H1CA 2IKQA 3ZW7A 5KAPA 1R8XA 2XVXA 1DTEA 4RKEA 2O23A 3NQ41 3HXMA 1A4XA 2QNIA 5FIUA 1BJTA 3FFAA 1M76A 3OFJA 3SBXA 2RK3A 4LN1A 5JRZA 2YHIA 5K2MA 1Y3BE 2BW0A 3DG9A 1KEVA 3MIZA 4G8BA 1VFPA 3F98A 1DQSA 3KBOA 5TLSA 1MXHA 5C51B 3BXEA 1EUZA 2C7BA 4MW2A 4PSAA 3R7SA 3W5DA 3ZVKA 1TQDA 3THYB 1YIAA 4UAGA 5DJ5A 1M1YA 2VT3A 2XDWA 4IYJA 4DLAA 1Q2UA 1ZH8A 1DRJA 2JLZA 3CR3C 4QU8A 3T7AA 3UAYA 5AUOB 1JG2A 4CODB 2WOOA 4S1VA 5LOVB 4MAMA 2BE7A 4G5RA 3L7IA 3D4BA 3OEWA 1V16A 4MVWA 2J48A 2WWWA 4M36A 5GM2A 5JD5A 3MYRA 4QGGA 4DV3B 5AK4A 3WLLA 3HZZA 4IMPA 4PS0A 5ENZA 5KOJB 3LUPA 4PONA 4JYCA 4E3WA 5AVRA 3B1YA 1NFFA 4KWIA 2OV2A 5I4BA 1D1QA 2RHJA 1QIEA 3CLUC 4MVJF 3EXEB 4DZRA 4TLAA 5EIWA 4AXXA 3ORQA 2O5RA 1Q95A 1ODJA 2GBLC 1KBOA 3ZV6A 4G85A 1FDIA 1KMQA 1K3UB 3QBVA 4Z99A 5FBKA 3FTEA 4PYLA 1CY6A 1PNOA 1PBTA 3VPFA 1SA0A 3WNZA 2AN5A 4YUXA 3R8CA 3UUEA 3GCWA 3FPBA 2ZSIA 4KAXA 1K66A 4KJZA 5E38A 1TIBA 2Q3LA 1G2QA 2HMTA 2W2KB 1YI8A 5AXBA 3U62A 1MJ5A 3L06A 5EP3A 1R6DA 3RYCB 4N01A 2Z2YA 3QU7A 1DKUA 1MD9A 2ATCA 2KQUA 3A1VA 4LJKA 4NULA 4CQMD 5JUWA 1ES9A 2VTVA 1ZGCA 2RH9B 3OY2A 5JTTA 4MOWA 1FFBA 1VL2A 1I0LA 2FVYA 1IN6A 4GI1A 1CY7A 3LXRA 4OK3A 4PWZA 3K4HA 4QREA 1JPUA 1OWOA 5AKEA 3BTVA 4RNDB 4KW7A 1XROA 3QLTA 1P2TA 4MP3A 1N2CE 2EZUA 5H0IA 3AG6A 1IEQA 3ECCA 1VECA 2QP4A 4MW6A 1BRMA 2VDQB 5HUQA 3LSYA 2A14A 3IAXA 2ODTX 4DHEA 3BD8A 3A14A 3LXXA 3DV0B 1FS4A 5PNTA 4EG4A 1ZKMA 3JQ9A 5CFRA 5A4MS 2CKMA 2W71A 4Z86A 3ZKWA 1PGNA 4KN5A 1S3SA 4GM4A 4L4YA 3D5QA 4E2YA 2W8BB 1SUWA 2OG1A 4A8HA 5I4KA 3TW0A 1U02A 3ZVNA 1W1UA 2BFCB 3DFUA 4MHOA 4FFMA 1J09A 4KXXA 1ZAYA 4KLAA 2TMGA 3E48A 3OUUA 1L7QA 3WBBA 3G2LA 4YCMA 3UW3A 2WIFA 3VR3A 2X1LA 1WCIA 1MOPA 3EG9B 3WA6A 4DSTA 2W70A 1QG0A 2IRWA 2QTFA 1NUTA 3VYVA 5CFOA 1DKNA 1UM9A 1JDUA 3OQIA 3OQMA 2CBGA 2H08A 1DQZA 1QH1B 1Y6RA 2GT1A 3PUWA 4ZO7A 4IIFA 2I6UA 2EFCB 3WBFA 2NZVG 1LH0A 1NURA 5JQGA 3WB0A 4BNMA 2I1VB 2WWRA 3MAJA 4K1XA 2B9VA 3RIGA 3DE7X 4DWWA 3N8HA 1N2OA 3F9RA 5AJZA 1A9OA 4G01B 3N8DA 3A4YA 3H1GA 4N5NA 4BQFA 1T0HB 4RJTA 5AW7A 1G7CA 4OAQA 1AN9A 1BGXT 1DUIA 1EDDA 3I37X 4XEUA 3WNDA 5IKEA 3OPYB 4Y1FA 3H5AA 3I9LA 2XW6A 3IRUA 4TQUS 3ZI4A 4A6XA 4CCSA 2Z3WA 1OFGA 1T1GA 2XUAA 4PINA 4QRHA 4WCDA 4HNUA 5BN3B 2VJCA 2SECE 4JODA 4DIMA 5KPJA 4PWYA 1AN0A 1JFLA 5EJIA 3HY6A 2J9RA 3DWGA 3D3JA 4OJQA 5C4IA 3BSYA 3IP5A 3K0SA 1UXOA 4RETA 3I01M 1ELOA 1Z34A 2OCLA 3BRWD 2G1UA 3OETA 4KIWA 1NVEA 1FUYB 2G80A 3NETA 4O1HA 1PG2A 4MXDA 5CT4A 3C41J 4DBVO 3T3GA 1IONA 2I3DA 3PF8A 3FF4A 3M1YA 4ZU1X 5B2EA 3TG2A 1W0KD 4PBSA 4Y2GA 2PLWA 1TTQB 5T64A 1CQIB 4N5IX 1VYHA 1JIUA 1XKQA 5JC8A 3E35A 4G0NA 1VPEA 1JJIA 2FSUA 5TPWB 2VRNA 3GXBA 1NVVQ 2IPOA 2VDWB 3E3NA 4MWZA 2OV4A 4DRYA 2GKSA 4J9VA 1RJWA 1JR2A 1MBZA 1ZNWA 1WMFA 1XRSB 2YV1A 3I1YA 3OP1A 5EMLA 5EMKA 5BVGA 4K3UA 3E7PA 4ZAGA 4A5OA 1DT5A 3H5OA 1A96A 2JCGA 2A9VA 3PFFA 2DWQA 3CZCA 1IUOA 4IIJF 4OMUA 3U3OA 2WKSA 3ZW9A 1K7EB 1W35A 4OK5A 3RVPA 4ZKDA 4CLRB 5B1EA 3MT8A 3DP9A 1XRLA 1YVUA 5LNK1 3W5CA 4O5OA 4YV7A 3KPUA 3KG2A 4AKGA 3KQTA 4ZVMA 1TNDA 2XMZA 1KAOA 5DPMA 3ND7A 4F06A 4U1RA 8LDHA 5JJKA 4HLUC 1Q7TA 2G1AA 4KDFA 3ZDRA 2R8RA 1WXHA 3R4CA 4ZVOA 3S70A 1YRQA 1IZ7A 1V37A 2HJ9A 2DQ4A 4XM2A 3F74A 3U4CA 4E2ZA 1Z6ZA 4Q02A 5LMNB 1OE0A 4N8EA 3DP7A 4RORA 3HADA 4YVFA 221PA 1KE1A 1WY7A 2WDZA 1XIVA 4KAFA 3DBHB 3ZZMA 3Q5GA 4LSZA 4DQDA 1PT6A 4DNFA 2DXIA 2AJCA 3HCCA 1JQ5A 4JB2A 4GD3Q 1QH9A 1SBNE 5B12A 1S4QA 2XEXA 5EZQA 5DTJA 2QTLA 4YT5A 1X7HA 4CF3A 1Y3CE 2DFVA 2R1UA 4OU4A 4QELA 4KK4A 4YCLA 1L4MA 4D3DA 1LD3A 3IT1A 1I4WA 3GFTA 3RJ5A 1WKVA 5L53A 1OTYA 1V5FA 2OXRA 4TS9A 4GX2A 1WZNA 2NAPA 3WIDA 3USES 5DTIA 3AR4A 4HI0E 5FWDA 4MB6A 5C53B 1SPBS 3RNLA 2VNJA 2C4HA 1HBJA 4HAZA 1IMJA 4R9SA 3HDVA 1Z0UA 1C0LA 1L4BA 3FW1A 4QUIA 4YB8A 1JHXA 5HBGA 2I7TA 3B3JA 3HPQA 3VJMA 1A9XB 1XA0A 2JIBA 1DKRA 2JI8A 3G82C 4Q1DA 4R0VA 1JL3A 4EK9A 3A4LA 1T5DX 2SCUB 3TAHA 4EECA 1NJ6A 4FKZA 3ZNNA 1I32A 2CZCA 2HJHA 5EE1A 4O2LA 5LKAA 1OX4A 2H2HA 1HXHA 3F6BX 1NN0A 3OWHA 2OGZA 1U7XA 2C2MA 1I1OA 1MF7A 3MMXA 4L5JA 2W6JA 2Y93A 4X41A 3IP9A 3CN7A 3OESA 1PFYA 4K26A 4IXTA 4PVDA 2O05A 4YMUA 2JI6A 3MUNA 1B15A 1MRZA 2F3QA 2IP2A 2PZMA 4JKIA 4KKVA 2QQ0A 5TQ0A 3SHVA 1LDBA 3ITKA 4B3FX 1LS1A 3AVPA 3IUYA 4XLLA 4OMFG 2O50A 1MA0A 4QNNA 4C7KA 4DM7A 3UGJA 1I2MA 4D82A 3Q6NA 2ZRFA 3EQ6A 2H8GA 4F91B 1P7PA 1K7FB 5B4VA 1BDIA 4CTKA 3E7XA 2XVZA 3DZHA 2GPBA 4HLNA 1JKIA 3E4CA 4EITA 4ZYVA 5JTUA 3IEKA 3PRJA 1NF2A 4TL8A 4TMFA 4F3TA 2OXTA 1DKMA 1WW8A 2BFEB 2IBMA 2Q9CA 1A50B 5EESA 3RBZA 2XCIA 4HSEA 4D8XA 3L4JA 4Q4HB 1XQYA 3TZ6A 4Q34A 3DLBA 1KOGA 5TE9A 2HT6A 4Q7MB 2HI0A 5AHWA 4Z9BA 2IU4A 2QT9A 2IPNA 1LDYA 3OHPA 4TMKA 4YRSA 5BMVF 1GRCA 1XMJA 4DQKA 1V3UA 1XMSA 1RT9A 2HIAA 4Y2RA 1F12A 5GPBA 1QO7A 1JDBC 1FLVA 3KKPA 1N2BA 1T8WA 3QU2A 3VAZA 1GN9A 2HN9A 3NHMA 5TT0A 4F9EA 1OBCA 2DR0A 2X6QA 3NAZA 3VUFA 1LDNA 1C3XA 4RXMA 2XF8A 2C4VA 4ZYUA 5KC8A 2ASEA 4WZAE 2FZEA 4F8YA 1DDOA 1RRFA 3UGKA 1I7PA 3DMYA 3RJMA 4TMVA 2OQIA 2UVPA 4Q1EA 1XX6A 4H7PA 4MINA 2FZGA 1B93A 4URVR 3IMEA 1UC5B 3ETNA 5EIAA 5HPYB 1G2PA 3L4BA 3QHAA 4DIKA 4IXMA 3GLIE 3B1KA 2ZTLA 3OZWA 2R8PA 4NPHA 2MJLA 4E12A 1J06A 5IEJA 2I4IA 2A9JA 5LIRA 4M8IA 2MHCA 2GFIA 3C87A 3E5NA 4OV6B 3AGPA 4PX5A 4UEJA 4Q4JB 4DPKA 1UDCA 4EL5A 1ZO8A 1AGRA 2A94A 4FEYA 4TL7A 1TJ4A 3E9ZA 1VLMA 4N8SA 4TTIA 4UQPA 1K6IA 5AQEA 4ND6A 4BLUA 1ENZA 4ZHQF 3PU6A 3PQ6A 4BU1A 4L28A 1ZGZA 5FI5A 5JCPA 5ERGB 3TXYA 3HEMA 4DUGD 5F7XA 3C16C 3C8UA 3AZQA 4RXUA 3H2ZA 4TZKA 5CFPA 1LLUA 5EJ9A 3TEFA 4LDZA 4X1IB 1I5OA 1WTAA 4W5HA 2WTEA 3RYHA 1W0CA 2G4CA 4M7WA 4IHJF 4NF2A 4DQVA 3A58B 2O0HA 1CY1A 4JELA 2VSOA 3IX7A 3MILA 2H11A 3VO9A 2VF5X 1EFAA 4CKWA 4MCIA 8GPBA 4G5GA 4V02A 1NUHA 1Z2AA 4G1UC 3WL4A 4D4JA 5KTSA 1AJEA 2GERA 1F5NA 4KO2S 4U39A 4UM8B 2CFCA 2D7CA 4I81A 2DQZA 1PJZA 2QTHA 2QJRA 2RGNA 1V71A 2MSEB 4I14A 3TX6A 3JD0A 4ARZA 4X5OA 2OAP1 2PSEA 4P2GA 1XF1A 1UPBA 2OD9A 4XB6B 5ALEA 5E3IA 2JBAB 3GCZA 4BQEA 3OJ0A 1IXKA 2GHRA 3HG7A 2IHUA 2Y0EA 1RABA 4ZEXA 4BN4A 2FSPA 3MWLA 3P1JA 1PAUA 3D81A 4UU7A 1X0VA 1HE5A 1C9JA 2EYQA 2Q5QA 4C22A 4DT1B 1SKBA 3H3JA 4HDSB 2BFPA 3TL6A 1U9IC 2P2GA 1HDGO 3R6DA 3F71A 4C4AA 4YCDA 1G6KA 1SBQA 1S9HA 3TI9A 4JJ4A 2Q3BA 2NTYC 1AZLA 1HE1C 1XRJA 3H11A 4Z0TA 2CLIB 1G3QA 1KERA 4RPKA 1LB1B 1GPAA 4OIFA 3TZKA 3LT5A 2HBZA 5K03A 1N3IA 3R77A 1QHIA 4FU0A 3WMWA 3HA3A 1HKHA 3ETJA 3I58A 3TRFA 4B75A 2ARKA 3DLHA 3HWX1 3KYIB 1E5XA 4BMOB 2B6NA 2GLXA 4UCWA 4PSCA 3TLAA 2IXEA 4JVOA 3IAEA 1EB9A 3O0DA 2I9KA 4ZI7A 3H84A 2WFMA 5I51A 2C9YA 3HKEA 3H75A 2P6UA 2C03A 4B4VA 3K09C 3D8BA 3QKRB 2NPOA 4W99A 3DEFA 3ET5A 3G2NA 1FYXA 4CV1A 2J6HA 4QSMA 1U0LA 4OI0A 2X9LA 1ARZA 1KZYC 2CEAA 2GCGA 2P2CA 3LIIA 2WZBA 4EUEA 2A78A 5J4HA 5P8WA 2ZCVA 2XNHA 3OJFA 2A35A 2JLRA 5FBWB 1BCSA 2H1FA 4DRZA 4MW9A 3C3CA 1AGNA 4DR4B 4C07A 3D7SA 3K32A 3Q5EA 3B2NA 2G70A 3BTOA 2FWBA 3CT6A 3DEJA 3OSUA 5H8WA 1QMGA 1O95D 3HHPA 3R7FA 1E3DA 1T0UA 3HABA 4PAWA 5LU9A 1R0SA 3MINA 5CLHA 1BGWA 3PFKA 3GK3A 5LBTA 1PR9A 3AEUB 3ICWA 2R1ZA 3GLVA 3KR1A 1ZEMA 5ALJA 4QUBA 4ZGBA 1NQWA 2PZLA 2RGWA 3DZIA 4B40A 5ALVA 5GZ1A 5FWXA 4HDRA 5KAMA 2HJRA 3Q6IA 3EASA 5AJTA 4GYYA 3RVKA 3H19A 5EHNA 2GBLA 1ZU5A 4R2IA 3CF0A 3BWCA 5IVIA 4W7IA 4WLOA 2JNWA 3HCNA 3R0IA 3FCAA 1G60A 3D43A 1E0SA 1R4AA 4DPLA 5SZKB 1J4AA 2XUHA 2ZWOA 1Y6ZA 2QMZA 4AJJA 1YTUA 1NATA 4EQ6A 2R48A 1WMEA 4XLTA 1QSGA 4RZSA 1JHPA 2W2QA 4B9EA 4FCTA 3R9IA 2N1MA 2JI4A 2OV8A 4NOLA 2R3SA 4OGLA 3AOGA 4TXLA 5EIHA 2A1IA 1UK9A 1BJKA 3WK5A 1SB9A 1UDWA 1J2RA 3SFVA 1PE0A 5DLDA 2O8FB 3R0QA 2GPYA 3R6TA 3JQ6A 4N0QA 4AU1A 4WRRA 4BNLA 4YRNA 1SOVA 5AVYA 3ZWCA 3R3XA 2ZUVA 4CLEA 1GCAA 2E55A 4TUYB 1IQUA 5DHPA 3CW2A 1P8JA 2GD0A 2XY4A 3UTCA 8ADHA 5KQMA 1Z17A 2XKAA 5HEKA 2AEEA 2GN6A 1FBNA 4DV5B 1OXMA 1T0IA 4FFNA 2VRBA 3I9NA 3ZLTA 2W58A 4UBNA 3PZRA 4D98A 1Q6YA 1TD9A 1UOPA 3E3MA 3QJYA 2PSFA 2YY7A 4LYGA 5KS2A 2XLCA 4ALMA 5CNJA 4IX9A 1QGOA 4IIJA 4W63A 3ZU6A 4DWOA 1OX6A 1RYYA 2VP6A 2HV8A 1M2OA 3JWGA 1RP1A 2X8AA 2OXIA 3VKWA 4MMYB 1N8TA 4UAUA 2E6KA 4JR0A 4EH1A 4F9GA 5AP9A 3VVCA 5YASA 4B3DA 4JQYA 1EXMA 1Z4QA 1OOEA 4KKXB 1A4UA 3CLSD 3EAQA 3EOBI 1QV9A 2QPTA 4MQFB 2LDXA 4OH1A 4LOAA 1LFAA 2QW8A 1CVIA 3QK7A 3NBYC 5DTQA 1ZU4A 3DLTA 1XC7A 4GP7A 1Z2EA 2YWRA 4WEOA 1C4OA 2X4DA 2RAPA 5ALMA 2O0MA 3DFMA 4RSHA 2LRHA 1JKXA 1O97D 3F67A 5A5GA 1R6AA 3ESXA 2IYVA 2PMFA 4EMTA 2C9ZA 1G3IA 1XWIA 1GUFA 3N0WA 1O4VA 3MCAA 2RGYA 3LC7O 4Q9IA 1PTJC 3KM0A 1H2ZA 2QJOA 4KSCA 4MB2A 5DYWA 4A1FA 2QXYA 2R00C 4M1KA 1PWHA 2LGJA 2I4LA 2BP7A 3GH1A 4EPRA 2B5OA 3EXFA 1DG3A 1Z4OA 5HFNA 4LKOA 1U8AA 2PO5A 3F6YA 3L0SA 3NS7A 4G0XA 1K7XB 5CHYA 2WUGA 5EHZA 3GLGA 4J6FA 4RGYA 4RQUA 3TKYA 2E85A 1AQ6A 3QFHA 3B1FA 2P90A 4IHAA 1GZ6A 2ZULA 4LPSA 2CFOA 1T4BA 2W2NA 1J8MF 2ORED 4HAXA 4OXYA 4ZRMA 5TV2A 3ZZTA 1A8PA 3TBHA 5TS2A 2IEZA 4XD2A 3W9YA 4YACA 3V9PA 3NJ8A 4IQ4A 1YA8A 3QNUA 2D06A 4H7EA 4OA8A 5FOUA 3ZDZB 3RYFB 4L8YA 1TL7C 4E5SA 3H42B 3EG5A 3U3JA 3NR2A 1RZRA 5ADUS 4EJSB 2GEJA 3FCCA 3ROEA 3H9CA 4XJSA 3D7KA 1CEEA 2ZQ5A 1U94A 2BVNA 2IH2A 1BGVA 5DHSA 4AMGA 1T3HA 2MYUA 1KZHA 3H5WA 3SNKA 1C41A 2CBZA 3RNOA 2G36A 3L3BA 4LX8A 3COVA 3HXQA 1Z2CA 2IK8A 4PAOA 5E6RA 4A10A 4MVCA 4XGRA 4BO3A 1RXVA 1V5IA 1JU4A 4DABA 3DO8A 3PGLA 3MELA 3LXMA 4RTPA 2FUEA 4CN9A 1DWQA 5CYFA 4FXPA 1GUZA 3A3YA 1ZZEA 2NVOA 3EFOB 4IXDA 1YIOA 3HYCA 3LYAA 4ZTBA 5TGTA 1NASA 1MABA 2C29D 2REBA 2ZSBA 4WN9A 2OXCA 3FYUB 4XCVA 3C4VA 3CV3A 4HDKA 4H3KB 1QYCA 5JBNA 1A7KA 1CBUA 1DJQA 1NR5A 3EGCA 4X1KA 4M1EA 2BFDA 4HLUA 2QENA 1G16A 3TCXB 5BY2A 3BAFA 2G1PA 3ANYB 3P9IA 3LSTA 1X8XA 2H1LA 2C3UA 1C3JA 3GHHA 4ARCA 1GYQA 2OL4A 2WP0A 3RFXA 4OI2A 3LQRA 4B74A 1I24A 4LTMA 1MCZA 2AUMA 3AUXA 3UANA 1ZXLA 3TECE 3ZH9B 2GAAA 2WVHA 4Y30A 1UBEA 3QGMA 4LBVA 1SXJE 4EELA 3AXSA 3TXXA 4LY9A 1KH3A 3BL6A 3WO1A 1SVMA 2VHTA 2F8TA 4GVPA 2Z98A 4I4IA 4F5EA 3K5WA 3MCVA 2G4LA 1RYHA 2QUBA 5LQAA 1RW4A 2P9QA 4NNJA 2ID7A 2OAGA 2IXDA 3ZE7A 3ZZ1A 4N82A 2YIVX 1VM6A 1T1JA 1ZZGA 3L77A 4FVTA 5HDBB 3HA5A 5DHAA 4FGSA 1C30B 1N9KA 3HP4A 4ZEVA 3VHRA 2XMSA 4M1QA 4UUQA 1G2OA 3G2OA 4HHEA 4TYQA 3FDZA 1Z9BA 1T5SA 2PA3A 4CPDA 1NP3A 4YBRA 4JYPA 5KSYA 3D8NA 2O3UA 3AT1A 3FWNA 1IK6A 1XXHB 5REQB 4BVGA 4DUYB 5FL3A 3SR0A 2OSVA 4ZHQA 2PRSA 2HCBA 3HZRA 1EBUA 1BEZA 2DSTA 2GCEA 1Y7TA 2K5UA 3PFCA 3QLEA 4UBLA 1D8AA 2ANBA 2WSLA 2QJTA 1P0FA 1MB4A 2YS7A 2P6NA 4V0OA 5ARCA 3UN1A 3WFJA 3NBQA 4GP9A 4CMBA 3DOIA 1E8DA 4UNSA 2CXTA 1EWVA 4DIOA 2WA2A 2WVAA 4JT8A 5CDTA 4C2UA 3MJFA 4EGFA 1PP4A 3FDIA 4R54A 2IOYA 3R5TA 2DCUA 2CZQA 1CE8B 1KKLA 2XUOA 3MCTA 4X7RA 3U49A 1G6Q1 2AOVA 2XBUA 3G7UA 3IHLA 2BGTA 3KELA 4RGVA 5DZSA 3RSOA 1E1KA 1FJ2A 2ZJOA 2BTQA 3PJDA 1X80A 3DC7A 4KH0A 4U3JB 2EGUA 2FLVA 1BCRB 5FPHA 1ANKA 1K1EA 1W85B 4P5EA 4DTCA 3U44A 3O3NB 5G1NA 1P0PA 1TMGE 3HPRA 5AKKA 3R9XA 3JATB 3QVOA 3MD0A 4C4PA 5FNVF 1HNZB 4YT2A 1OASA 2A5DA 4RKFA 5ECDA 1HNXB 2Q5FA 1FFXB 3S29A 1EESA 4GE0A 3UPTA 2HFKA 2Q4RA 1ZJWA 5BQXA 4UMVA 2CXOA 4CMIB 1XPOA 3RRXA 1KE2A 4K8OA 3K6KA 4F2PA 1KSFX 2J0UB 2X77A 3LCUA 5EY5B 2HMWA 2J4FA 4CLOA 3UHOA 2O2JA 3ZWVA 3IA7A 3NLLA 1ZI8A 4RSGA 3V8BA 1VJ5A 4UEWA 4ZV4A 4OG2A 4EF5A 2AZ4A 4NENB 3SJBA 3VR3D 2ZRCA 1U0SY 3JQRA 1R15A 2XNJA 1Z6XA 4TVKA 2BKXA 2YKGA 1E3TA 2C2KA 2ZBPA 3IILA 1GU0A 3ZE1B 2EQBA 1XKLA 1M72A 3CUEF 5IKXA 1NYQA 3ADKA 2D2VA 3KCQA 4RESA 2FMXA 4PICA 4Y1EA 3CNHA 2IFTA 2X3UA 4XIIA 1QK3A 1Y63A 2C5AA 3ELWA 2J3DA 2GEVA 2CDBA 2EDCA 3ESRA 2XWSA 3Q1KA 1NZFA 4U5QA 5COBA 2R8ZA 1DINA 3BORA 3CX4A 5K3BA 3TBFA 4BNDB 5K0TA 2BLNA 2KBEA 3EZ7A 5IK2A 4JLSA 2XIJA 2QYHA 5WRFA 3EVBA 3UJCA 4AIRA 4MGEA 1FUUA 1UJ5A 3F7MA 1T2EA 2ZRHA 1K86A 4JEIA 3WLJA 4RKRA 3M4XA 1G4AE 3MRTA 4WKBA 4ZTUB 3DAGA 4ZEWA 1TECE 5TGZA 4HX5A 2PUDA 2IYLD 3BTUA 1OXXK 4C7MA 4ETIA 4LWZA 1ZVVA 5AJYA 1O6BA 2HHLA 4D9MA 1SHKA 2X8BA 5IDVA 1YRBA 2I6QA 3HK2A 3JWPA 3MS7A 1TKAA 1VSBA 1FFHA 3K6JA 3O75A 5IAKA 5DU2A 1XNQB 2XB6A 3QQPA 2WSSA 1LF5A 1QFYA 1N2GA 2HXGA 2XA1A 2FY8A 3JW8A 3CGWA 2HAEA 4CQLA 4BJ3A 2ZR7A 5FEUA 5IWAB 3O83A 3KHUA 4PF1A 3FFBA 4PX2A 2Q3EA 4LF9B 1Y1LA 2CVQA 3FCXA 3NP9A 4ZALA 3SJCA 1CEXA 4GZ6A 4DZZA 5B7PA 1ZHOA 1R0RE 3I1IA 3U3DA 3EX7C 3KUUA 2FUNB 2AFIB 4BB5A 3BQNB 2OUIA 5JI3E 4UUBA 4IVNA 3MXTA 4WOBA 2VP5A 1PVVA 2WLSA 4KACA 3ZDBA 3T1VA 3FCUB 3MTQA 3DD1A 3VSDA 1Z25A 3W3AH 1E5QA 3Q2OA 4EJ6A 4V1CB 3MVEA 3MMSA 2HRBA 3O3MB 2XJ4A 3UXYA 4TRJA 3ZUPA 1T8YA 3B2QA 1P1FA 1U9IA 4BRZA 5JXWA 5MN6A 4QXAA 1ZGAA 5KVVA 4PY2A 3JD3A 3LC1O 4RFSA 4TS3A 4NEHB 3HZHA 4KXVA 3I2HA 3UGQA 4GZLA 4IZ6A 4NG5A 3WL7A 5FWYA 3U60B 3OX1A 1UBSB 4B83A 3UUGA 3QX8A 3ZIDA 5C7LO 3I4LA 4P2BA 5DN9A 1DPGA 3H5LA 1OZGA 1IHPA 2HBYA 3RVMA 1Q7EA 1H1LA 2IEDA 2I2AA 1A88A 1CVLA 2X22A 3EJWA 4KR0A 2CYCA 4D5EA 2BI4A 1O5TA 3A6PC 3UV3A 5CGZA 3UCXA 4EPWA 3A3PA 1SCJA 3RC2A 1HUQA 1Y9JA 1NHGA 4L07A 3V7FA 1M6YA 1VXOA 3I2FA 4IDHA 2C58A 1SQ6A 2ANCA 2V7XA 3EIUA 3K09A 4HRAA 4KI7A 4C6RA 5HXAA 4CEIB 1M54A 3HRHA 4AXBA 2BIFA 4TV9A 5TY0A 2CFTA 2XMGA 2FQQA 4FHFA 3QVLA 4KZPA 1YZKA 3W5UA 4QHYA 1FNBA 3EGOA 2IEYA 3K7EA 5KHAA 4ZTZB 1XTUA 3U7JA 3AEZA 3IDQA 5HTOA 4TWIA 3V4PB 4RK4A 1I36A 5CW2A 5B6IA 1DG9A 2JI9A 3FUUA 2ZRJA 3J7TA 4INOA 1E3QA 1ZMRA 3CB2A 4RW0A 5KJ1A 4I5EA 2VBCA 3A6ZA 3RS3A 4OHWA 3PDJA 2P7IA 4IJKA 2RGBA 4NESA 3SS8A 1S2IA 1C7FA 4FDUA 3CONA 3KL4A 1U9ZA 1VJRA 4IZOA 2OVBA 2ECPA 2WPDA 2VXYA 2CHVA 3HMKA 4F38A 2DHDA 3DZKA 3T0IA 3HR7A 1LJUA 1LPNA 1QYWA 1SBHA 4GO1A 4J0KA 4JLBA 2VJNA 4WGGA 1DJNA 3RO7A 2LTAA 3NHBA 1GNPA 1V43A 3QBEA 5AM0A 1QTQA 3ZJUA 4MK4A 1UBHS 5H70A 4ZO8A 3UA3A 4F8JA 3LZCA 5CVDA 5FH9A 1RJDA 4EBFA 1GADO 2BGLA 2Z2KA 2AXPA 3JTMA 4HQLA 2VNSA 4XFJA 1U3CA 4IQGA 1EFRA 1BFKA 2M2IA 1A2BA 1L4UA 3QVSA 4ACBA 3BPSA 4HUTA 1MZVA 3KWLA 4MV6A 1QU3A 4WKCA 2GNAA 3IP6A 4WBXC 3GRPA 3Q3HA 3FMFA 2NUBA 1XTZA 2E4UA 4UHFA 5BP7A 1OC2A 1Y4ZA 1SBCA 1N0WA 3AUTA 5LBIA 4CG3A 2C4UA 1F2TB 4OSPA 1QBGA 4FD2A 3ZDQA 1CDDA 1VP3A 3CRZA 3PUJA 4EHDA 1YR7A 4C0KA 1W93A 4MWEA 3IDFA 3BA6A 2FR0A 3PKZA 4BATA 2XAAA 3IEIA 4E70A 2JJ1A 3KDSE 3M6VA 1PNRA 1K2WA 2YH2A 1XYGA 2FJPA 3PSAA 2EFEB 4IMIB 1F0NA 3EZGA 4PG8A 3NM5A 4YUWA 4BMDA 1KZ9A 1MEOA 5EHIA 3KKMA 4YA6A 1T36A 3NATA 3OZFA 4WI1A 1SO8A 5SZIA 3OQOA 3B9PA 2YXDA 3JYPA 4OHUA 3GUVA 2YXNA 1NV9A 3OEYA 4KSYA 5TVKA 2OA0A 2Q5LA 3FGNA 5B3JC 3CUYA 2I65A 5LCXA 3RE1A 1KEPA 2RGUA 3UAWA 1LI4A 3ZNQA 4W9NC 5BT9A 4EP1A 3ZG6A 2FA9A 2PCJA 4BJ1A 1HRKA 1T4CB 5AM3A 1CJCA 3UAGA 4ZDIA 1V8PA 1QVVA 3VH2A 3O94A 2B4YA 4G5FA 4OQEA 5ALIA 4KGDA 4YJFA 4G4IA 5JSZA 2YWJA 3O2SB 3P9PA 3JU3A 3WNQA 1BD3A 1UFVA 1ZM2A 3IQXA 3E2IA 3OIFA 4BZQA 3M70A 3MTBA 4IZHA 5K3CA 3UO8B 3IT3A 2ZB3A 1TYDE 2BAGA 4S1NA 3W5AA 2L19A 1GYPA 4Q4DA 3HTXA 5AM4A 4B45A 1JP7A 3M1AA 3Q3VA 4B7XA 3VVMA 3KKNA 1F6BA 3RK4A 5IJXA 4WZBB 1NN3A 4BBZA 1PTJA 3MAAC 3OE5A 4FINA 5J5VA 2XUIA 2WVJA 4K2HA 1ZRSA 2MSLA 2R00A 1ZIDA 2PV0A 1CEYA 1XZQA 3MMNA 2HSZA 5LBUA 1Q44A 1IRXA 1YFKA 3EDMA 4U4AA 4EB6A 1CUVA 2I5PO 3WBKA 3F46A 2YY5A 4HNRA 4JI0B 4PXAA 4AZSA 4W8HA 4KQCA 4DNOA 5B58C 1NPTO 2C07A 4IH4A 4N4AA 3PJFA 2X13A 3E9CA 1RWNA 1HNNA 2EQAA 2JGLA 3LLCA 4MRRA 3SLGA 1DOAA 4RA9B 5ITWA 4ER7A 3QYJA 2PJDA 2QYSA 3IDOA 4RY8A 4X63A 5B37A 4E1BA 4EGCB 4CT4B 4K9LA 2TRSB 2WG1A 5FA5A 2ECQA 2PO7A 5JSKA 2H5LA 5DASA 1YTLA 3JY6A 4M89A 4D8UA 1GRNA 5BT8A 3DZCA 2BWJA 1ECPA 3WQBA 2IDJA 2WSMA 1AG9A 2YYYA 1P33A 4G1VA 5BN4B 1US8A 2VP2A 2XQIA 3B9RA 3DV9A 2P9YA 1ISFA 4G0MA 4G9BA 4HKTA 1HRDA 4PIVA 5EJAA 4CV3A 5JR3A 3AY0A 4EUNA 2DGDA 1RI4A 3TW4A 1YL5A 2UZ1B 1D6SA 4FWTA 5DMHA 3UICA 5BOSA 2ZK7A 2B82A 2J07A 4JN6B 1U8XX 1W1IA 4ILKA 3DCNA 4X9XA 4E51A 4L57A 4TYYA 1OIWA 3WV4A 3Q7TA 2OFOA 4F84A 4JQCA 2JGFA 4LJ6A 4OP3A 4HNHA 4ZZ2A 4BP3A 2F1OA 4M9SA 5GM1A 5K4GA 1QPGA 1RAHA 1YA4A 1E6KA 3EMDA 5FNVA 4G84A 2EP5A 3GQBA 4IBOA 1IM2A 5HGXA 4MMZB 3HYNA 2HF9A 4DLRA 4GKVA 3KJEA 2BLLA 1E3LA 3ITNA 3BL8A 3C7AA 1LZKA 1H3EA 4D02A 3SBEA 1P5FA 5K3AA 5KCMA 2ALJA 1FTNA 2NZXA 2DG2A 3Q88A 4P5PA 4FKMA 2P2SA 3O0TA 1QF7A 4Y9RA 5TDHA 2CV2A 4QXMA 1U3DA 2ADOA 1Z0SA 3HN2A 3IT0A 4CIXA 1AO3A 3UBTA 2YV2A 3GF4A 3BWEA 4UHJA 2GCOA 1JU3A 3NTVA 1XV5A 1GKIA 3OCXA 1A71A 5HE9A 1M1ZA 1ULAA 2EU8A 1OWNA 1B4DA 4GOMD 3YASA 3R0JA 1GSHA 1QVAA 3IV7A 4HB2A 2Y1DA 4HMOA 1KZ1A 2PXHA 4RYDA 4D3YA 1L8XA 1CK4A 4IYRA 1PK8A 2OPHA 5JASA 2DE0X 1C9EA 3PD7A 2O2GA 4KQJA 4MTLA 4HB0A 5LN1A 5ALSA 4IIVA 4XQGA 3VC7A 2IU6A 1Z4LA 2A86A 3R5FA 3V55A 3QFTA 3EPLA 1I5EA 2XTAA 3CUVA 2WKQA 2JJ2A 2ZJ1A 3PC7A 3CLUD 4MV8A 4BX8A 4YRGA 2Y6UA 3K1YA 1Q1NA 4Q3NA 3AUAA 3K72B 1WVIA 5JMWA 5JZOA 3GEPA 4YTEA 2IEGA 3EVGA 4LDNA 2ZIFA 2JAOA 3OA2A 1OY1A 4UE3S 4NRDA 1R4ZA 4H60A 5KSOA 4IPTA 5P21A 2NO7A 4W5JA 4ENSA 4NNOA 1WUKS 2VSXA 4R1OA 1W4LA 2Y67A 4N65A 1D7AA 1QX4A 1J56A 2A30A 2X8LA 3GZTB 3S99A 2UAGA 4M2LA 1IIRA 2CYAA 2DPLA 2WBLC 2ZYGA 3CBGA 3QU9A 1CQWA 3SZRA 1FFSA 2Q2WA 4DAEA 3AEYA 2A88A 4N0DA 4JBXA 2G5PA 4H31A 4E46A 2AF4C 3OOSA 1YQUA 3DD5A 3QMWA 1N1EA 3FTDA 3NP7A 2EX0A 4IRMA 3S8YA 2GO1A 3QEOA 1F51E 1S8AA 2QY9A 5D3MA 3AHIA 4ZPJA 4KXYA 4BTLA 1GN8A 2OK7A 1YHNA 4FOPA 4WK6A 1OXTA 3O8OA 4MUAA 3AIKA 1YGYA 1E2FA 1VBNA 2R2AA 2WAAA 2BT4A 1HMYA 1LS6A 2XCQA 1RYMA 4RLFA 2BSQA 2POCA 1XD2A 3PDIB 2ODAA 3W3AA 3QLVC 3OIDA 4YLGA 5KB3A 1U3FA 2DT8A 2I2XB 4E5MA 4HS4A 4YPVA 3CRRA 3D1VA 2WJWA 3KB2A 1LSJA 3TOCA 1QWOA 3OJXA 3HJUA 4L9SA 1GUDA 4B2LA 1RXIA 4GMKA 3MJHA 1XJWA 5K1ZA 4LCBA 3M6UA 4KYUA 4UE2A 3CCFA 2VHUA 3E58A 2VA8A 3L92A 3I42A 2D1YA 4Y2YA 1E7QA 5K8LA 1FPQA 4R2XA 4WZAA 3RKUA 4B5KA 2BI8A 2I2WA 4GXQA 1SUIA 1F5SA 1WU8A 2YC4C 5I7EA 5DHFA 2C1XA 2YWDA 1B2LA 1LPSA 1OAOC 1QZ3A 2EFJA 4IS2A 5DT2A 5KOIA 1JDJA 1WIWA 3DAHA 4BN5A 4P4GA 1CDZA 4EW2A 2PUFA 1TF2A 3WP1B 1DV1A 3GLIA 2PKEA 3ND6A 1R66A 1KEWA 2CFSA 2AXNA 2P79A 3I2KA 4YONB 5IAJA 2ZS8A 3F2VA 4LMBA 4ZGWA 4E0BA 1K0FA 3TVTA 4YIKA 1KI3A 1B2RA 1X1CA 1XTTA 3IQFA 3HJGA 5E9AA 2VRCA 3UMBA 4QDZA 1K3FA 4L6CA 3U17A 1V6CA 5ERYA 4AKSA 3RROA 2JH3A 3U7RA 1ODTC 3DL7A 3Q2IA 2J33A 4XQ0A 5KSWB 1GWNA 3MJSA 5BSRA 1C8KA 1KQNA 4F97A 2BEUA 5SV2A 2PUJA 3BRCA 4LNUA 1OVMA 4QG7A 4B3BA 1EM8B 2E5FA 3G8DA 3HCAA 4EPVA 4X97A 4Q4CA 5IDWA 2FPMA 3T4XA 1X8KA 4CDNA 1ZGGA 4UDOA 4WESB 1ECGA 2V54A 1SUFA 2Q2VA 2HSGA 2FUG1 3A7EA 4BJHB 3NHRA 2K7FA 1F20A 2FCRA 4Y7CA 1NUQA 3TOSA 1RZRD 3RVSA 3FYTA 1L7EA 1D4ZA 1WXEA 2G0NA 3E1GA 3T7DA 4BIMA 1J8YF 1NRWA 1F2UA 3GRCA 1FNNA 3ZZNA 5IG2A 4NYJR 3UCEA 2JGDB 1LBTA 1N7JA 2QR2A 2G67A 2WHPB 1JG7A 4OAOA 3HDHA 3TQQA 2P9HA 5DWVA 4J0FA 3DCYA 4LF6B 3B51X 5DGCA 2X86A 4FDTA 5EXSA 3BXGA 1Z38A 1R16A 4P7FA 5AK3A 3TNFA 4JUFA 4OXRA 1HSOA 3C8ZA 3EWAA 3QA9A 4KOEC 2WY2D 5L40A 1LX7A 1L8AA 2OMKA 3ASUA 4HNQA 3NYRA 5U9CA 4B7CA 4C2TA 3A6HA 3IERA 5A04A 1N3YA 2LVBA 4OXIA 4EVSA 4IDEA 1Q7RA 5G02A 3L9WA 1PR1A 3Q2KA 1U0GA 2B8NA 4YJHB 1Q12A 1DAIA 2NW6A 5LOVF 3A70A 1AKUA 4LRSB 1X19A 3LUDA 4E30A 3PTAA 2P3OA 3PR2B 4Q00A 2ZXUA 4LJRA 3G5TA 4TYWA 1LCIA 2PQ0A 4RSMA 4LF5B 4UPEA 1LBHA 1SAYA 3IAUA 3K1TA 3M34A 3DUFA 3AKEA 4P0TA 4L76A 3WLQA 1MC8A 1RFLA 2CFRA 3KEOA 1X42A 4KAAA 4I9UA 2K7ZA 1MIOB 3FGOA 3CC8A 4UHDA 5BQFA 5JS6A 3G49A 2RK6A 1Z0AA 2E1PA 2WJPA 5CVCA 3AR2A 1A2OA 1KO5A 1XZIA 1Z37A 1H05A 4MB0A 3ZWAA 3TSAA 1CT9A 3UIEA 3IAS6 3K6SB 1IJFA 4WW0A 5BUCA 4C3OB 5J3JA 4UZFA 3TDKA 2FWPA 4ZVKA 3ULKA 5JANA 1B8OA 3GZNB 4A6DA 4CJXA 4TTQA 4FI3C 5AI0A 5CFLA 2XVMA 2BZ0A 3GA7A 4NABA 5DM60 2BKUA 3QLUC 5JRJA 4Q82A 2BMJA 4RIFA 1YOVA 1WZCA 2F00A 16PKA 4HZUB 4U2CA 3WTBA 3GDHA 4YRAA 1XNGA 2QOEA 4YQZA 1K06A 4HN2A 1V3QE 3BMQB 3ZHRA 4M0PA 4LHZA 1N0VC 1A5BB 5EE3A 1D6NA 5H16A 2QZPA 3LFTA 3FHOA 4FFVA 4N5DA 1E5DA 1RLJA 2YICA 5CB4A 2C2YA 1RLUA 2Q9UA 3QF4B 5LQKA 3BH0A 3ZQ4A 3KO8A 3QWAA 2XJ9A 3ROKA 2N0SA 2Z08A 1C1XB 3PEUA 2CMHA 4CR6A 2FWJA 3TCKA 2BHLA 4ZAFA 4RK1A 5TEVA 1FX0A 2AVDA 1U3TA 3RPEA 3LPDA 2BJWA 5K3FB 1OV4A 1CWUA 1G6OA 3AHGA 4GMGA 4R9NA 2MINB 3HE3A 4JYMA 4YDRA 3ZOZA 2P5UA 4JI5B 1IB6A 3PDUA 2CD7A 1E64A 3EVAA 4FHGA 5FI3A 5KU1A 3MBIA 2LUOA 4JKYA 3ANLA 3KE9A 4I4LA 3U7HB 1T8RA 1W46A 5FUVA 4CT0A 3STUA 3TRHA 5LZ9A 3S1AB 1G8AA 4ZQHA 5EFOA 4AX8A 5CH8A 5HUJA 4W8GA 4TKVB 5I01A 3DDNA 3JQ8A 4H2DA 3WGGA 1M1UA 1EFVB 1GRQA 1N9ZA 2QUJA 4AKIA 3CKYA 4FLMA 5AVQA 4EWLA 1DRUA 1VSUA 4EUKA 1CP3A 1DDIA 4Z7NB 5JRDS 2FDRA 1AQIA 5TQ2A 3L0IB 1DX9A 1V7CA 1B42A 3ORHA 2Z04A 4O0LA 3FFTA 4R8RA 5CB0A 4E5UA 4OXQA 4BAZA 3IEMA 3O92A 1JEYB 1CKEA 2PRJA 5TT1A 5J4VA 1IBKB 1J0DA 1GRRA 4MJLA 5EZYB 3H8WA 3T5TA 2AHOA 4CU2A 4AQDA 4FMCB 4UEQA 4R0MA 5B3JA 3N0RA 5BNFA 3TBKA 2DFKB 4MI6A 4ER6A 1QCCA 2CLOB 2LXNA 2R11A 2VJQA 4W9NA 5SZJA 5FHRA 1X0XA 1WPXA 1I6KA 2AJLI 5JBIA 4JBNA 1BZYA 3E8XA 4R8VA 1P5JA 1ZD8A 2YW2A 3DMNA 3LOUA 3PIIA 5M29A 1FRFS 1NBOA 2SKCA 3D3NA 5GTDA 2O0LA 3BJZA 3L6UA 3LK7A 2PRIA 1LBIA 2O5VA 4WFJA 2OLKA 3WDLA 4BWGA 1QAOA 2PQ2A 4BVEA 3UFXA 5EXXA 3G02A 2ECFA 3TLKA 3A4TA 3EXIA 2P3SA 5HFAA 5JAHA 2H63A 3KR2A 5KYVA 1RRPA 4R81A 1W4ZA 3MTGA 4N41A 3RYIB 2HHHB 2PS3A 3IAAA 2JFYA 4FYMA 4PAGA 3B13B 1PJRA 2A0YA 1ZW6A 2JBHA 1E96A 2DBYA 2PGLA 4RLQA 421PA 4EHJA 4OATA 3MCWA 4EG3A 5IK2D 4DR5B 3NH9A 4NJEA 5F5LA 3VPDA 1A72A 2KM1A 3RARA 1A4IA 1GA4A 3E6AA 3NYIA 3OTIA 2G1KA 3CR7A 2WQ7A 3FPSA 3OQJA 3P97A 4RK7A 5I7VA 1MT3A 1WKCA 2DY0A 1T5BA 2OO5C 1EX6A 2YHSA 4XX0A 2J85A 2ZTUA 4G4SO 2VQFB 4JIMA 1QLHA 1YQWA 2EBWA 2PHZA 4MGYR 4PRZA 3ZE6A 2BM9A 4F3KA 3U19A 3G5AA 3PQEA 4HGOA 4KUEA 3N9IA 4HMQA 1AK9A 2FQWA 2BCGY 1JA0A 4JQZA 2CLMB 2WSSD 3QBDA 3WK4A 3Q0IA 5BUZA 1MDBA 4L7VA 1VJTA 1WOMA 2HZBA 3E5MA 3JRXA 1WDMA 1OWLA 4IDQA 3RU3A 4AY4A 3KKEA 2J6BA 3DUWA 1G9SA 4MAAA 2WAYA 1W87A 3U0BA 5EZ6B 4Q9AA 5IXSA 2R6JA 2YDYA 3ZX4A 3AB7A 2E21A 3F1LA 4NV3A 4HWOA 2GLTA 3TPZA 3KDAA 2J3MA 4ME6A 3VSEA 1UT5A 5EQDA 1QC5B 3E9MA 3R09A 1WD7A 4GM1A 3D6FA 1DO0A 1QDUA 3U3KA 2DHQA 1AUXA 4EVQA 4FB4A 2XI4A 4O5AA 4Q9LA 2QQ5A 4OQPA 2NUTA 4MJ7A 1PU2A 3R0VA 1U7UA 1NVMB 3C48A 4DBLC 1GUYA 1NP6A 3BXHA 1L1FA 6CHYA 3T35A 5AW6A 3CYFA 1RQRA 1YKSA 2DPGA 2NNLD 4JOCA 5BNZA 4UMDA 1EFLA 5DEOA 5LD2B 4K28A 3S3TA 3GY0A 4C0WA 3LO5A 2NT3A 5ETJA 4L74A 1XVIA 2E4XA 1RC1A 4IJQA 5HFJA 2DR2A 4GS5A 4N0PA 1S2OA 4MQMA 1EB8A 5IEBA 2JGIA 2RAVA 1DARA 1MX3A 1J21A 4GKBA 4LXIA 3C70A 3H0EA 2YWBA 3SHFA 5JZVA 4BEBA 4XM1A 1MO5A 1E2NA 4QOEA 5JPCA 3U1BA 4CCWA 1OFVA 4YAJA 4DWVA 4A8PA 1Q21A 2YZGA 3IESA 1WBJB 1PNQA 3RLIA 2QUKA 5DYTA 3WRVA 2IHBA 5M3BA 3LF2A 4XWTA 3SYRA 1UFQA 3H9EO 2PIAA 1C1DA 1NMXA 2WYHA 2WWTA 3H2IA 4FMBB 4ZCMA 3DGEC 3SHWA 4LQDA 1U81A 2ZBGA 4WGFA 2CL5A 3G0OA 4EENA 4MVJP 4EIWA 3OJOA 4FFWA 4I5DA 3O1HB 1XZJA 2XUDA 1Q0HA 2NO1A 2DP4E 4MWGA 1UBTS 1Z28A 3B52X 1MFZA 4JJKA 3NIWA 2X8JA 1P74A 1J07A 3X44A 4I1OA 4US1R 1JIKA 5GJCA 3RRMA 5KC9A 1ZSVA 4U8HA 2V7QA 3UKJA 4D0LB 1E3WA 1QOZA 1FQOA 5H9VA 2XBMA 1LJ8A 3F5FA 3ZCUA 4JZKA 3KTAB 3E7DA 5DGTA 2WPDD 4JXKA 4E5KA 2P0YA 2R7AA 5AKJA 2NXNA 3VPSA 4OXNA 4F9TA 1Q11A 4JNKA 1MVOA 3ODPA 5BN5B 3F90A 2NVUB 1KY2A 2O5EA 2V1UA 4BY9E 4LCJA 2IS6A 1LTHR 1EWKA 2XMPA 2DM6A 4YWJA 2ZUEA 2Q9BA 2NNWB 1UWLA 1DSSG 1Q0UA 1H4VB 1W19A 3PC6A 3SZOA 1FMLA 1GZSA 1EFRD 1XTPA 1EVYA 2Q3JA 3C7TA 4OLJA 1XCMA 1QQTA 3M9LA 4QOIA 2CLKB 3GQVA 1DKPA 2WICA 1IN5A 3NEJA 2CT8A 4FK8A 5FOXA 1TQHA 1BU8A 3N2YA 3MF4A 4KXWA 3T41A 1HM5A 1REQA 3TLYA 4AYWA 4GWLA 1VLHA 2YOHA 4E1AA 2X5OA 1U0RA 2WYIA 4IDGA 1XKXA 3SNHA 2PBLA 2O3SA 4GMDA 4XWOA 1YVRA 2C97A 2VPWA 3U0VA 2JJ1D 2QI9F 4J1QA 1BD4A 2R60A 3C6KA 2ADMA 1DIBA 1NI5A 3BK2A 3O8LA 3P0HA 3B1JA 2C4MA 3PVSA 1F4PA 4QGBA 1JGTA 1J2TA 3LQ2A 3VU9A 2EQ5A 4J0IA 2X2FA 1XTVA 2DAPA 2QRUA 4DHWA 2C96A 2CYBA 5K3EA 4M1MA 3WA7A 4B3XA 1QQ6A 4UJ5A 3FY4A 2IPXA 4KC0A 2P40A 1JA9A 2Q8QA 3QLVA 3KAKA 2BONA 4ZANA 4OJTA 3PTZA 1PR6A 2YNMC 4BECA 3JYOA 4CMGA 5BSVA 2A0WA 2DB3A 1AHNA 4F92B 1VMEA 3R4VA 3BFPA 4HFJA 3VH3A 3BMOB 4RVNA 5JMOA 4HH1A 3THYA 3KOUA 1ZP6A 5DF1A 3TRIA 3MD9A 3T3HA 5LOVA 3ZI0A 3NRCA 1V8DA 2VPIA 2WZQA 4XPIA 3WLNA 4B8ZA 1OAOA 4N49A 2O8EB 1T8TA 2FMTA 4AVYA 1DAHA 1G5PA 1TMKA 2MSKA 5DNYB 2XMQA 3DFIA 2XKKA 2PTHA 2R47A 1L5LA 4LMRA 1JS1X 4UM9D 4CL0A 5KOJA 1WUTA 1IG3A 3ASZA 4FM9A 3GEIA 3LJKA 3C24A 4PNZA 5DBGA 2OHIA 4TKLA 5IHXA 3WTCA 8OHMA 1YASA 2J1LA 2XRZA 2HPZA 4DCSA 4ZMBA 3EXEA 3VZBA 5E4JA 2FOLA 2I03A 3LUFA 2WU1A 4X91A 4LV5B 3RUHA 2J0QA 4BLOA 3V8NA 4E13A 4YP7A 2PXXA 3RFCA 2ACKA 2YY6A 3IFSA 4Z5XA 2X7JA 3D5TA 1FA9A 4MGKR 1VSVA 2B98A 4YFYA 5AW8A 3T1QA 1DHRA 1EXVA 1OBVA 2CXHA 3NU1A 4JAVC 1SBTA 1GQOA 1QYRA 1SVLA 4ONEA 2W2KA 2R4UA 1N0HA 2V3CC 2ZTSA 3H2BA 1YAHA 3RYCA 4LF8B 3ZE0B 4P0PB 3OLZA 4RD6A 3CTMA 2H9AA 1YCFA 3PPXA 1QDLB 3EDCA 1NSYA 4WK4B 2WG0A 1Z6YA 3COPA 4FFPA 3NWOA 2IF0A 1RWBA 2WWXA 5TX7A 2XXBA 3JD2A 4QTYA 4RADA 5DLYA 3D8TA 3VMMA 3WMXA 4WCVA 4JGGA 3NHPA 3LV8A 1EK2A 2CNKA 3U31A 3IBFA 1ZUNB 4K86A 4MUIA 5LIPA 2KMLA 5HZHA 3BXZA 1RFGE 2K2QB 1EHYA 4XARA 1RQGA 4ESVA 5DHQA 2CMKA 1DG1G 2D0DA 1E9DA 2JEYA 3P9NA 4ZRDA 1Z4NA 3GLFE 4U8GA 1Y8QB 3DV0A 3KJFA 2VWPA 4XWYA 3ORRA 2X2EA 3E82A 1UXGA 2CXRA 4M7RA 5LSAA 2IDKA 3BJMA 3KHKA 3JASB 2PSSA 2ZIUB 5F1YA 2C9BA 2NZJA 2OUKA 2W8BA 3P0FA 1LXCA 1PZFA 5A6SB 2BFCA 1JILA 1JYEA 1NY5A 4RVDA 2WAXA 3PX7A 1PR5A 1M1XB 3C6XA 3D4LA 4LXGA 4UW9A 2F3RA 3JWIA 1C0IA 1UXKA 1I7SB 3U09A 3H8SA 4XIJA 3EG9A 5I3ZA 3CX7A 1XGKA 4J9UE 1XZ8A 3L8YA 1RVDA 4PYJA 5BUQA 1YS9A 1I80A 3RTBA 1AUVA 1U8ZA 4RZHA 2C1ZA 1MVNA 3IIKA 1QH1A 3I9V1 3JQBC 3VZRA 4CKEB 2DQYA 4F60A 4KCGA 2QRKA 3RUEA 3CUWA 3PLNA 5K8JB 1PSZA 1HQCA 1VIYA 1WP4A 4MA4A 2AKYA 2UYHA 4JT4A 2G0AA 4UQOA 5G0UA 1TC2A 1B3RA 1KDZA 1ZI9A 1XZKA 3AR9A 2E5LB 1XEFA 5FA8A 3SFTA 1NF8A 2ZREA 3AB8A 3OCCA 2HWUA 5CTJA 4BMVA 4MO2A 3PENA 1TAQA 3KZ1E 2PUTA 2R751 3HB9A 2D2FA 1UFKA 5C3MA 3OPYA 4G09A 1EWQA 2NU7B 2V8OA 1U7TA 2NXCA 1GR0A 4I9GA 4J3NA 2PX2A 4QJ5A 4NBNA 4WZBE 3HCEA 1DUSA 3DE3X 3SC2B 5BN3A 1GVHA 2LP4Y 1RTTA 2X4GA 1NUAA 4D8VA 3JQAB 4J0CA 4B46A 1IY1A 1ZNXA 4U5XA 4JKOA 3VZCA 4JP8A 3GIWA 1RM0A 1N0IA 2Q0QA 2Y1XA 1GZHB 4GZMA 4J6EA 5D86A 5EXTA 3WXMA 3OC0A 3HH8A 3NBZC 4AUEA 5HJ7A 5CCXA 2JJ2D 3S2UA 3W8FA 1GQRA 3QLUA 4X20B 4EATA 2GARA 1QMPA 5F2OA 3AI3A 2HWWA 1KXZA 5DYYA 5MN4A 4FGUA 4G0WA 1RZUA 3SDBA 4EJSC 3KOMA 4D92A 1X9HA 4JVMA 2EJCA 4ZCIA 3CUKA 3S8MA 1E3IA 1J5PA 1YAJA 4YXWA 2W48A 3THOA 1JHZA 2PVPA 1KDVA 5BPFA 1GKUB 1CQIA 3GBVA 4IVQA 1AKNA 4P7JA 1W4AA 2RHMA 3A9WA 2EWVA 3LL4A 4H6WA 2ATIA 5IC5A 3ZDDA 1V1RB 3ZBTA 4V24A 2VDWA 1AK2A 2IYOA 3LKBA 4GLJA 3HXTA 4P31A 5E2BA 5T5QA 2ZYDA 4PNEA 2ZJ3A 1IB0A 1NX6A 4YJDA 2XTJA 5ITZB 5CXSA 5IVDA 1ISSA 3B3QA 3MHPA 1I3OA 1OILA 2RI1A 2GI4A 1SG0A 1EK5A 3C85A 3DEYX 4II7A 4NMLA 2ASVA 2BBOA 1N4DA 2EFYA 2IQ5A 4LTDA 4ZAYA 4EGQA 2XKJE 3ET4A 2ZYRA 1ZSNA 4CLRA 2NLOA 5LP6B 4Y6GB 2J3LA 1EVKA 3FYUC 4BLQA 3B5EA 2YZNA 4CM4B 4H7IA 2EV9A 5ALWA 5EN4A 3TEJA 5A02A 5L45A 4ZQIA 5DNAA 3NVMB 1WLYA 1LQ2A 1XZEA 3MQFA 4FX2A 1SVWA 2H7YA 1QHHB 3JARB 1UMBB 1Q1EA 1JECA 3LUBA 4KVAA 3SX4A 1UDBA 1XQVA 5I8PA 3A0UA 2R6HA 1HLFA 2NTJA 2QGFA 4G36A 1XWWA 1BVRA 4KQHA 3PFBA 2OFWA 2W6CX 3FN4A 4JI8B 3EBOA 4I50B 3RQIA 2JGRA 1KHTA 2X0FA 3M0EA 1SHJA 1NQTA 1T6ZA 3CM0A 3O8QB 4RX1A 4JJZA 4FTWA 1P0CA 2V0NA 5CA0F 1Y9EA 2IDMA 5ALOA 3SZUA 4XLZA 3U6BA 4NIMA 4O4JF 2Y1WA 3GLHB 2NXEA 3DBHA 1KNQA 3PIDA 4GQAA 4P3YA 1JIXA 3VR2A 4CUZA 3OQPA 2D74A 1JI0A 3Q40A 1QS0B 2PZKA 1Z63A 3W6OA 1NYRA 2Z95A 4LZWA 2ZT5A 3WGIA 3OY7A 5AVKA 4AF6A 5K0GA 1RXWA 4OUDB 4QRIA 2P5TB 4K5QA 4FZJA 2W6IA 1F1JA 2NZUG 2YN2A 3ZWPA 1AXGA 3TIIA 1FDWA 2A8YA 3E9YA 1UWCA 1SULA 5L3QB 1V0JA 4D81A 2PR2A 1HMPA 4R83A 2VRCD 3KOWA 3BK1A 3DOJA 5DNVA 3K70C 5B64A 4IOJA 1PKEA 2O4UX 4OFWA 5C1PA 1SHTX 2JLYA 4KI0A 4DQXA 3A2MA 1ZOPA 3RIYA 2W11A 3DKRA 1IIBA 4Z7OB 5IZ4A 5JMTA 1A9XA 4EGAA 5IPFA 3QV2A 3KHSA 1GPJA 1JR3E 4FIDA 1GHTA 2SCUA 4W6ZA 1IUNA 8MHTA 4Q66C 2LWIA 3ZDYB 3VTFA 3WJ7A 1NLFA 2OO5A 3E7WA 5T41A 4B85A 3KOXA 3WWCA 4PGAA 2GF2A 3AFMA 2IE8A 2ZI9A 3EW9A 3TIFA 2XIQA 2JFHA 4WQMA 2EFDB 4R69A 3AETB 3TM5A 1JHVA 2XADA 2I2BA 3BQ9A 3BGWA 3WK9A 4D96A 4KREA 3VZDA 3VC1A 2ACWA 5EXDA 2YQ5A 3SQXA 1U28C 5J63A 1B0ZA 4WKNA 3ZUGA 4Z7JA 1HDRA 1T2NA 3A7DA 3GG9A 3PHGA 5HOQA 2RIRA 3FNRA 2OAQ1 3EEIA 3KSZO 1NBME 1RJEA 2PL1A 4IGAA 1T2AA 1PQPA 5BNTA 3OSZA 1UJCA 4FBLA 4LKRA 4PBRA 3QXHA 3IA2A 5JAMA 3LKDA 5AI4A 2HY7A 2P30A 1NW4A 4CKCB 1SC3A 5T4FA 2BFEA 2F8LA 4MW0A 4JR1A 3QXGA 4MLPA 4V0NA 3WV5A 4LCEA 1ZUD1 3NBXX 2DVMA 4HX9A 1ZIOA 2YHBA 5HJEA 3HJAA 4HWPA 5IMSA 1IBSA 3CPSA 1C0EA 4Q4HA 5ISMA 3HL4A 1I8TA 1Y3HA 3L0OA 2GCNA 1KSGA 4RTRA 1OZHA 1QKJA 2ZJAA 1ULSA 2Z9DA 2N9UA 4CL2A 1DLJA 3SXPA 1PRYA 1UBRS 3IIJA 2OBXA 5DBOA 1BKSB 1DC6A 2QV7A 3W5VA 5I4IA 3PGXA 3CB4A 1LK0A 1NT4A 1ZK4A 2A1TS 2B30A 2FMUA 4LA4A 4XX1A 4D3XA 4GECA 3NONA 4K81B 4TTAA 3UH0A 1TFUA 3B6KA 2YX1A 5THXA 4RNCA 1IE3A 1M73E 1QHYA 2G9ZA 3H1AA 1PWEA 5G0TA 4ZO6A 1DAEA 2M1XA 1QVZA 4X92A 2F3PA 2ZU0C 5E7MA 4BMZA 1WV1A 3C45A 1LEHA 4OBBA 1TYCA 2D5CA 2F7SA 3H9UA 3NASA 4N54A 1V26A 4QC2A 4XVQA 1JFTA 4BMYA 1E2PA 1W48A 3CLHA 4LOHA 4UD6A 2JD0A 4FC6A 4J1NA 4Q4JA 3TG8A 4HWRA 3NOOA 4ZXFA 3RLFA 5BWCA 1T2DA 5HS4A 2MYPA 1SZDA 2X4IA 2ZRLA 4FGLA 4P4NA 2PUGA 4TXNA 4DARA 2DCMA 2XLBA 1AV7A 4OM8A 4ZI3A 1WPGA 3C0KA 1OZFA 3OQNA 3FPKA 4OQNA 2FN8A 2OSBA 4IIYA 5AW1A 1B0PA 2XH8A 4X1IA 1YXMA 4YRRA 3MTEA 3WGHA 4DR3B 2FUCA 5E4FA 4BZXA 4E5NA 2E6UX 4OXXA 4HEHA 2WG2A 3NTRA 5BV0A 1KI1A 1OR8A 3HNPA 6LDHA 3SOZA 4XYEA 2FAXA 1NVTA 2D2XA 5B1IA 1IOZA 4UHEA 1T9KA 4BNVA 2O7QA 5JZMA 2V0GA 4LFBB 3OU2A 1J5XA 5HILA 4QUJA 4DOMA 4I55B 3VPGA 5DGDA 1Z8HA 4ZJYA 2EYUA 2PK3A 3ZR4B 1EXNA 1UP6A 2GZ3A 2J4DA 2V6GA 3OT4A 4JC4A 4MVYA 3AXTA 2JBAA 4Y0NA 3ZJ5A 4IJWA 4CKBB 3IAM1 2J3QA 2P69A 1PFGA 3BM5A 2P6RA 1B3BA 1R6BX 3DAYA 2ODNA 4UE6A 3RT1A 4EYGA 1HYHA 1P7YA 3UB2A 2VF4X 3F97A 1E1LA 4N9WA 1UXIA 4G86A 4MYRA 4HDSA 4PO3X 4DT1A 4CGZA 4TXJA 4BNKA 2XECA 2J3IA 3GFQA 3M6WA 2WWYA 2D1SA 2O20A 1L3BA 4LOKA 5ALYA 3RC9A 5A7GA 3Q41A 4ZDWA 2ISQA 1Y8AA 4DLYA 2G9RA 2P9JA 4MUHA 4BKRA 3UT0A 1N7HA 4JLVA 4Z3DA 4PLWA 4FCWA 4FIZA 1PSDA 3ZHTA 2O8DB 2B1JA 2EVWX 4WACA 4EA8A 2UZAA 4MHSA 4REQB 3WSTA 1Y3FE 5IXYA 2QLMA 4RTMA 1VRWA 2IXBA 2MSNA 1B43A 4QQ8A 3IJPA 4IRUB 4KFRA 5FI0B 2QYOA 1N2JA 4ZVVA 1QOPB 1BNCA 2E82A 1T6BY 3ZBPA 2P1DA 2I8CA 1R0WA 4BWFB 2BKLA 3CISA 3FD8A 5AW5A 4GI2A 4IGFA 1XPJA 5DX1A 2CNBA 3ANMA 3T9AA 3QKRA 3BC1A 3FB1A 2YNMA 3VU1A 3EXAA 2D0OB 4CNBA 5CA1B 1FTSA 3S28A 1D2NA 1CETA 5IAEA 3E15A 1QE3A 2YC2C 1TO1E 1FUIA 1UK6A 4TTRA 5EINA 4DCCA 3LHIA 2X0DA 1QG4A 3UATA 3GT4A 2Z83A 4NU8X 5FQOA 1MC1A 2X7HA 4L6IA 3NORA 5GZ3A 2C3MA 3NPAA 5ILOA 3PNQA 2AWOA 4AS2A 2C7GA 4KIUA 1YWGO 2QUAA 3KP1A 2BBTA 2I3GA 2O2XA 4IZIA 4ZI2A 2ZM5A 3NKLA 4BE7B 3AEUA 2HRZA 5BSUA 4PZYA 3T52A 2G72A 1VPVA 4RDIA 3NDRA 1RU3A 4L27A 1X77A 1BE8A 3H0CA 4G97A 3CSUA 2Q5HA 4J03A 1R88A 1JLRA 3T7JA 3JRNA 1NLYA 3IKMB 5A9SB 4KQFA 2ILVA 3ZDEA 3GUYA 4XQEA 1DGQA 4J0QA 4QOGA 2PGIA 1Y7PA 3TQRA 4NY1A 1XTIA 3SVZA 1STOA 2QLJA 1QZUA 2RHHA 4B76A 2ID9A 2ZSKA 1ODLA 4IHQA 4BKUA 5AUNB 3TS1A 2WPNA 5JS8A 4QYWA 4XJTA 3V7NA 3A06A 5HK8A 5CDYA 4PSUA 4AD8A 1Y4UA 3H4VA 5EC8A 2QD2A 1FYDA 3FZEA 4KQGA 5KMGA 3VSBA 3GIDA 1YS1X 5EEGA 1BEEA 3BMXA 3NJ4A 5ITSA 1NBHA 1Q0ZA 1KO7A 7MDHA 3F5QA 5HP4A 2HNAA 1GPKA 2O8FA 4Y2QA 2RK4A 2JRLA 2ZCUA 2ZSJA 4I9HA 4TGLA 3UAOA 3QRWA 1SIWA 3CHYA 5TMBA 3ZBUA 1AURA 1SCUB 1Z2PX 2Q1YA 2G83A 3HNRA 4TUYA 3D8RA 4UVHA 1PTKA 3GJTA 5JLAA 5E3JA 1L5QA 4Y0AA 3W2HA 1N1GA 3DL4A 3H3FA 1KJYA 2EGGA 2OENG 4RXTA 4MEJA 3EGDB 1OLXB 5SYAA 5AUPB 3I6BA 4EG7A 3WL6A 4XQ9A 4AMYA 3AM5A 5C4MA 3FKSD 2PWAA 2PH1A 4MRAA 2MWMA 2OLEA 1JXAA 4ALNA 1U4SA 2B7BA 3H5TA 1M7HA 3JV7A 1KYZA 1VCNA 5CIWA 1RYEA 3IEPA 3G0IA 1SCAA 2VJOA 4HD8A 1T2VA 3FMPB 3OUTA 4M46A 4YI5A 1XRNA 5I7FA 2ZB2A 3PEVA 2IS2A 2V5VA 2WJ6A 3Q9NA 2WUEA 3P26A 3DFKA 1QB7A 3VVBA 2DOKA 2JFWA 3DPIA 4FX5A 4GEGA 4MQFA 2DF8A 3KUXA 4Q7JB 4WY8A 3I0MA 5ESXA 4E07A 1FSPA 2C9CA 3GA0A 3IS3A 4MI9A 2UYOA