4HGNA

Crystal structure of 2-keto-3-deoxyoctulosonate 8-phosphate phosphohydrolase from bacteroides thetaiotaomicron
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
165
structure length
165
Chain Sequence
b'STINYDLSRIKALAFDVDGVLSSTTVPLHPSGEPMRTVNIKDGYAIQLAVKKGLHIAIITGGRTEAVRIRFAALGVKDLYMGSAVKIHDYRNFRDKYGLSDDEILYMGDDVPDIEVMRECGLPCCPKDAVPEVKSVAKYISYADGGRGCGRDVVEQVLKAHGKWM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-keto-3-deoxy-D-manno-octulosonate 8-phosphate phosphohydro
molecule tags Hydrolase
source organism Bacteroides thetaiotaomicron
publication title Structural Basis for the Divergence of Substrate Specificity and Biological Function within HAD Phosphatases in Lipopolysaccharide and Sialic Acid Biosynthesis.
pubmed doi rcsb
total genus 62
structure length 165
sequence length 165
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.45: 3-deoxy-manno-octulosonate-8-phosphatase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4hgnA00
2I33A 3ZU6A 2P9JA 3L7YA 4CE6A 2O9JA 5AVZA 3B9RA 1RLOA 1WZCA 1L7MA 4EZEA 1ZD5A 1XVIA 2X4DA 1F5SA 3WGUA 4BKMA 1T5SA 3OCZA 2IOFK 1Z4LA 3ESQA 4KX3A 4NFLA 3U7HB 2Q5EA 1ZD2P 1WVIA 4I9FA 3N28A 4YIHA 2JGAA 2R8ZA 4L6CA 3MN1A 3P96A 4C4RA 2FPXA 3MMZA 1Q91A 3HYCA 3U13A 5ALVA 4GXTA 1IWOA 3WK4A 2NO5A 4UARA 2IOFA 4XOUA 3QX7A 4Y2SA 1U2SA 3HLTA 4AP9A 3MPOA 1QYIA 1Z4PX 1Z4KA 3DV9A 4UAUA 1MH9A 3UMGA 3UM9A 4YIKA 3ZVMA 1Z5UA 3SF0A 2B8EA 2AGVA 3QUQA 3FZQA 1YNSA 2C88A 2FPRA 5ALZA 4XPZA 3ZUPA 2G0AA 1TJ5A 3EWIA 4O8CA 5IT0A 3OCYA 1U02A 1L8OA 5AKYA 3AR4A 3QUBA 4QJBA 3TLMA 2G06A 1RDFA 1L7PA 4OD0A 5JJBA 5T41A 5E0OA 5ALYA 3A1DA 1QQ6A 4BYGA 1Q92A 2C8KA 2W4MA 5AI0A 5AW1A 4DW8A 4E88A 3NUQA 2PQ0A 2Q4TA 4BX0A 4MUMA 4EELA 4YGYA 2BDUA 3I6BA 2YJ4A 4UATA 5AVWA 3M1YA 5AK6A 1Z88A 1S2OA 3L0YA 2RARA 4EX7A 5ALLA 5AKHA 2OBBA 1RMQA 4NV0A 3I76A 3W5BA 3OCWA 1YJ5A 4UMDA 2P11A 3RFUA 2AMYA 4FFDA 3ZWKA 1AQ6A 4YCNA 1YDFA 2OM6A 5ALIA 1RPZA 3L8GA 1O08A 3E81A 5AW9A 5ALMA 2O2XA 4IFTA 4Y2PA 3PCTA 5AIAA 4DWOA 5AK4A 3KOOA 4BNDA 2WFAA 2FPWA 1ZD3A 1ZS9A 1J97A 1NNLA 3QUTA 4OCZA 4CF3A 3OTQA 4BNDB 2BDEA 1L8LA 1RC8A 3J7TA 3QLEA 3SMVA 3R4CA 5ALRA 3W5CA 4FE3A 2ZOSA 4IG4A 1RMTA 5AVUA 2VKQA 3DDHA 4HGNA 3RF6A 4OFZA 3AR6A 1N8NA 5FP0A 3PDWA 5AW4A 2QLTA 3E8MA 3NRJA 1LTQA 1X42A 2HX1A 4EEKA 3L8EA 1QQ5A 1NRWA 1TE2A 2AUTA 3E84A 2YJ3A 1YV9A 2D2VA 1TJ3A 2GFHA 3KC2A 3OPXA 3DNPA 4EENA 2NYVA 3ZX4A 4BBJA 3A3YA 3NIWA 5AVRA 5AW2A 3SKYA 2PKEA 3ZI4A 2I54A 5ALQA 1Y8AA 5ALWA 2C4NA 4Y2QA 3U19A 4JB3A 1ZOLA 3ZX5A 4HAIA 5AW8A 1Z4MA 3QU4A 4PNHA 2HSZA 2P27A 4EX6A 2PR7A 3U7GA 4YCMA 1EK2A 5ALSA 2QYHA 3QGMA 2B8JA 3WK9A 5AVSA 2YN4A 4HGOA 5AI5A 3FGOA 4CF5A 5ALHA 1T5TA 2HHLA 3AR2A 5AK5A 1XPJA 4HGRA 1VJ5A 5AM0A 3KDPA 2IA5A 2YMQA 4UW9A 2EATA 3ED5A 4UM7A 3EPRA 3FVVA 3A1EA 1RLMA 5AW6A 4L57A 1K1EA 3FPBA 4BX2A 1WPGA 3WKBA 3L0CA 5AW0A 2B1QA 3M9LA 4ZEVA 4KYTA 2MU1A 2ZG6A 1FEZA 3WK6A 4DFDA 3UMCA 4Y2XA 5AI4A 4ZEXA 3SLRA 1VFPA 2R8YA 2YJ6A 1Z4OA 2BY4A 1RMYA 3CNHA 5AW5A 1S8OA 3WK7A 1QH9A 1N9KA 1EK1A 1L7NA 4XE5A 1RKQA 4ZEWA 3ZVLA 2ZBFA 1U2TA 2FPSA 5A3SA 5AM3A 2IOHA 3CZ4A 4J03A 4I9GA 3ZW7A 2R8XA 3R9KA 3W5DA 4UMEA 1Z5GA 5ALDA 4QQFA 4Y2JA 2W11A 3A1CA 4BEVA 3ET5A 2FUCA 2I7DA 3S6JA 4NAVA 5AKZA 4JDPA 2OA0A 5AI8A 5AI6A 1NF2A 1RKUA 3IB6A 5ALPA 5AM1A 5AM5A 5AKKA 1SU4A 3WK8A 1U7OA 2B1RA 3U7EB 4UM5A 5AVVA 4AS3A 1KYTA 1JUDA 3ZWDA 3GYGA 3FPSA 1YMQA 2CFSA 3KD3A 3N07A 4C4SA 3ONNA 3ET4A 2OYCA 1J8DA 4MWOA 4XQ0A 3W5AA 3OCUA 2GMWA 3U26A 3EF0A 3NANA 4G63A 4NABA 4GIBA 3SHQA 3NASA 3OCVA 3ESRA 3QU2A 4BEWA 4YH1A 3OCXA 2WF6A 2G08A 3QYPA 4C4TA 3PGVA 5ALFA 5ALXA 3K1ZA 2DQSA 1QQ7A 2GHQA 1RLTA 2FPUA 2JAWA 2ZBEA 4H1WA 3WGVA 5A3RA 1CQZA 1ZRNA 3BA6A 4AS2A 5AW7A 1LVHA 1RRCA 5AKIA 5AVXA 1U7PA 1CR6A 2G07A 3QU5A 3N5KA 2RAVA 2HF2A 3L5KA 2WHEA 2I34A 2IYEA 1ZD4A 2JAUA 5AESA 2RB5A 1L7OA 2Q4RA 3L1UA 3D6JA 3KBBA 3AR9A 3N1UA 2HDOA 4CNQA 1L6RA 4DCCA 5ALJA 3IRUA 4F72A 3B9BA 4KNVA 2WF9A 1TA0A 4KNWA 2RBKA 2HEGA 2P69A 5ALUA 1SWVA 2YMLA 1Z4NA 2WF7A 2JAOA 3QNMA 5AK3A 2FUEA 5AIBA 2AH5A 4G9BA 5AVYA 1SWWA 2ZXEA 4BX3A 3L1VA 3KZXA 4UMVA 4UMFA 4L6AA 3L8FA 1ZRMA 4F71A 3WK5A 2YBDA 4KX5A 2YMMA 5ALEA 1RQLA 1PW5A 2GO7A 2HCFA 3I1YA 4Y2VA 4UAVA 2HF7A 5IS2A 1ZJJA 2C9MA 2MSNA 3WKDA 2G80A 4J2TA 5AI9A 5AM4A 3WKCA 5ALOA 2CFTA 4HGPA 1WR8A 5ALKA 3ZVNA 2G09A 2I6XA 2B0CA 4FYPA 2FDRA 4UU1A 1T9ZA 3QUCA 2B82A 3ZTYA 5AVTA 2R8EA 3WKEA 5AKXA 4UU0A 3N8GA 3PGLA 2ZBDA 2WF5A 3AR8A 5AICA 5ALNA 2FEAA 3QU7A 2HOQA 1RKVA 5AKGA 4KN8A 2CFRA 2CN1A 2B30A 4RESA 2YMPA 5AKLA 4Y2RA 2EARA 3E58A 3DAOA 2NO4A 3ZTWA 3BWVA 4CF4A 2FI1A 5AVQA 3FM9A 1VJRA 3I28A 4Y2YA 3QU9A 4Y2UA 3SKXA 2HO4A 2EAUA 2ODAA 3VAYA 3AR5A 3QXGA 3L0BA 2WF8A 5AKEA 5AHXA 3AR7A 1Z4IA 2YY6A 3IJ5A 3WKAA 5IT4A 1RQNA 2JARA 3MC1A 1Z4JA 2W43A 3AR3A 3F9RA 5ALGA 4OHFA 4UASA 4B6JA 4HYTA 4Y3UA 2YJ5A 4Y2TA 1O03A 5AW3A 2WM8A 3R09A 4RETA 3EF1A 2C8LA 2G1AA 5A3QA 2I55A 5ALTA 3NALA 4NWIA 1Z4QA 4YCLA 4HGQA 3B8EA 2GHTA 3SD7A 1YS9A 2YFYA 5AM2A 3NAMA 3U7FB 3UMBA 1TJ4A 2HI0A 1XP5A 2ZBGA 5AKJA 3L8HA
chains in the Genus database with same CATH superfamily
4ZVKA 1XKQA 4MV0A 4ZA2A 4WL0A 1JAHA 2PEZA 3P27A 3QRWA 3PQFA 4KRXA 2E82A 2OQRA 2AE2A 1MQAA 4CE6A 2ECPA 4NPAA 1RLOA 4GF5A 4JROA 4L76A 3RS4A 3WR5A 4D9MA 3JRXA 1BWPA 2GEVA 2G7ZA 1ZMXA 4DGSA 5DBIA 1BJRE 3E3MA 1G3UA 4IZ6A 5UKDA 4CM3A 1RBYA 4CKBA 4EHKA 1Q15A 1REQA 4PWZA 4DLUA 3IDQA 1ZD9A 1GVHA 1QFZA 1EH5A 5CLHA 2Z5VA 3DPSA 1U7DA 1NQTA 2YNMA 4E94A 3ZWVA 4RH1A 4V0MA 4C1NA 3RGGA 3ZBQA 4NFLA 1HT2E 4JITA 1RRGA 1ELOA 1KO8A 1GO2A 1ZYUA 3EQ7A 2PT7A 2ZSAA 3JWGA 3KT6A 4DNXA 3FSEA 5AXCA 5BMOA 3QG1A 1E2IA 1NG9A 1LX7A 2HUNA 1P1KA 3T34A 5JPCA 1F3LA 1K27A 2BCJQ 4HTFA 5IM4A 1JF8A 3M82A 2QUHA 3LSTA 4GICA 5HCUA 6Q21A 1RM3A 3ICCA 4RL4A 4EZIA 4BQSA 4L6CA 2ODPA 3G8YA 1A8IA 2QX4A 2XRFA 1HE8B 3QX3A 4DPMA 4TTIA 3AL0C 2V3VA 2F8TA 2J3HA 3CWZA 4P4SB 4LBWA 4LXGA 4JB8A 1ORHA 3SY8A 4Q9IA 5THKA 3N0VA 1R0WA 1NW7A 1E89A 2XYGA 4UARA 2CXXA 2AJBA 5JMOA 2VK2A 2HNBA 4PX9A 3QX7A 4IUBS 1GL9B 2EP5A 3HLTA 3CE9A 1QYIA 4KFSA 1KYWA 5DP2A 1QUFA 1WXEA 4UAUA 1U3TA 4F6RB 1VA4A 4RIHA 1VLVA 4PC2A 3VAAA 1ZC3A 3UM9A 1YHZA 5EL0A 2OQ2A 4ILKA 3AX6A 4LOAA 4EQ6A 4KKXB 2CXOA 2AJLI 4R1PA 4W5WA 5H82A 1I2DA 4MQ5A 2V3WA 2HLHA 5DK4A 4FLFA 1Q74A 4AJIA 4U7FA 2W2KB 3ADPA 5ILOA 4A82A 3RADC 5AK0A 4YV0A 2J85A 1C81A 1H3FA 1T36B 4IX9A 4O4IB 1D8AA 3GELA 2UUCB 1TK9A 1G21A 4W5RA 2E4VA 1Y34E 4O33A 4PGGA 1OAKA 3OJOA 1COWA 1IQUA 3SJUA 3OPQA 3CO5A 5A4KA 1W0KA 2WHYA 5M29A 1SVIA 1ZEJA 2X5OA 3SYTA 5T57A 4QEKA 4TV9F 5I7SA 3GNTA 1VIYA 3AYZB 3ZVKA 3BAFA 3PNKA 4H3SA 4PLZA 2Z1DA 4ARAA 1QLWA 3FOFC 4M8IA 3W5JA 2B7BA 2RHCA 3N2NA 3BWCA 5H16A 3RT7A 1IL0A 1ZITA 2B4QA 3OIFA 2XDQA 1NI3A 5EVJA 1ZDMA 1RXVA 2Y66A 4KLNA 3UHFA 3VZSA 5BN5A 1OPXA 4MEJA 1N2CB 1A7JA 1NJSA 2VWPA 3F90A 3I2FA 3TLCA 5K5EA 1N36B 4WN9A 2QF7A 1DKQA 1PG0A 1VZ2A 1MOZA 4U8GA 2OEPA 1WSWA 2WWHA 3CO0S 3BXZA 1Y8CA 1FPQA 3O91A 2MSLA 2YIDA 1UBGA 3EA4A 1AHPA 4CG3A 4YRJA 2BFFA 3WNCA 1GKYA 3ESCA 3HCDA 3TOVA 1OYYA 3ZV7A 3BHIA 4N3NA 2A92A 1MV8A 2P3OA 4CLRB 4QOJA 4ZALA 4R2JA 3UQYS 4EQZA 3VOTA 1DJNA 3LWZA 1PUXA 1R50A 1SG0A 1AOXA 4RJIA 2AVDA 2G88A 2ANCA 5BSVA 1PBTA 3SQDA 2A84A 3EZFA 1EU1A 1MC8A 3K9BA 3QMPA 2JJ1A 4IO0A 4OMCA 1DXQA 4QIHA 3VXKA 3FCCA 1VHDA 5F4BA 5JHHB 4CR8A 4INAA 2XUJA 5BQ5A 2GAOA 4DT1B 4E11A 5F7OA 1J1UA 3M49A 3I42A 2PKQO 4OGGA 2BI8A 3UICA 1JE0A 2EIXA 3HCNA 5A0FA 1OTHA 1WTCA 2ZCUA 5GZ1A 2ZOSA 4EABA 4GS5A 5JJLA 4I8IA 3GJ3A 5H3HA 5JAPA 3DDOA 2L18A 3BA1A 2FQYA 4HGNA 1GNTA 3RSQA 1JHQA 1HF3A 1I1HA 1J8VA 3A1FA 2CLHB 3C14C 2ZIVB 3CM0A 4RUKA 2W2PA 1R66A 2FFJA 5DJ5A 5KNBD 2I0FA 5JQGF 4BGVA 1EJ2A 1P61B 2ZDGA 3BZWA 4B6RA 5IDVA 2P75A 1SH7A 1RI5A 2H1IA 4GFDA 4OP2A 3TXAA 2IYSA 4BMYA 2CK3A 2IW1A 3EMVA 5C3UA 4DQXA 5KX5B 1P7VA 3K6SA 2RGWA 2WD9A 2RAFA 2XA9A 4MVJM 2HGZA 4K1XA 3S5UA 2BF4A 3RVQA 2YOHA 4AXXA 2MYUA 3AU8A 1X0VA 4Q19A 4BNYA 1G8MA 1S9DA 3GFQA 4ZJUA 3ZCPA 5LKAA 1SHJA 2XIJA 4XUDA 3ZI4A 2C0CA 3CVOA 1U3WA 1FNSA 3B12A 3DZJA 3HBMA 3LUPA 4JB3A 4BVJA 1CZNA 4LE1A 2LZ0A 2HSZA 1RAGA 2PEYA 3AMVA 2ZYWX 3L4BC 4J0HA 2DCUA 3K9QO 1JZTA 3N0WA 3NS7A 2IP4A 5J5VA 1KE1A 3JASA 1ZZEA 4HI0E 3MWDB 1OJLA 4HDOB 2D54A 3EY4A 4IVNA 3RCBA 5BURA 4ZU3A 3QVOA 4BU0A 4MK4A 2ARKA 4B47A 1JHRA 3O4JA 3IKLA 4X8MA 4F5YA 5KOHB 1T5TA 3VPSA 5JJIA 2QTBA 2B92A 1M2GA 1OY1A 5GONB 3TGPA 2FP4B 1GKLA 2BGIA 3TRFA 3O4GA 2VSOA 4H1HA 3H97A 4COOA 2NZVG 1JMYA 1V6AA 2PBZA 5DVZA 5JNUA 4RD6A 3SCZA 4UOZA 4C0BA 1XCLA 1JIXA 3ZNPA 3EMBA 2R9VA 1WCIB 2OCKA 3CCCA 3ZV5A 3G0OA 1EFPA 2JRCA 3Q85A 7GPBA 3GRKA 3QEMA 3WKBA 1QG6A 1EX7A 4NOLA 4TXJA 4ZZ0A 5L6MB 1CV2A 4N82A 3H75A 1RXIA 3HJNA 3V80A 3LKDA 3WNZA 5HHTA 2RONA 4YCJA 2E85A 1GWNA 3B9PA 4ZT5A 5T4FA 4ZOEA 4ND8B 2IHNA 1GZ5A 4UULA 3QOYA 1C0IA 2N9UA 1LJUA 3DMHA 4IEEA 4QHTA 2P79A 5AI4A 2ZB2A 5EJ9A 4D0GA 1CZKA 2E4YA 4I50B 5IXYA 1RQGA 1UJNA 3JARA 1JLLB 4F21A 4IF4A 1Y8RB 3N87A 5EIWA 5FT9A 1TVCA 3JYNA 4MLPA 4DADA 3U3XA 2WZQA 1PT5A 4AULA 2H29A 4HLUC 1U2EA 4RSRA 3RS7A 1R5JA 4PCLA 3WGHA 3S1AB 4MYUA 2V7TA 5HS6A 1XQ1A 4MW0A 4LYGA 5T5QA 3PD7A 3R3SA 4AIIA 4QOIA 1KPHA 1Q1BA 4UNPA 1Z5GA 1N7IA 2XNJA 4R1SA 1ZL2A 2G8LA 3DDUA 2LIVA 4ZPJA 3X3HA 2GRAA 2QU7A 3BH6A 5FL7A 4YRLA 2GCEA 2DUMA 1CRLA 3O2NA 4NBSA 2HREA 4JDPA 2OA0A 3PC7A 3K31A 3ZXXA 4MUEA 2GA8A 2MJLA 5A3JA 2V97A 3UT0A 4HO1X 3H11B 2V8BA 4G9GA 1W8IA 4XRRA 3KZ1E 1OASA 1UXIA 3G9QA 1KYTA 2BFPA 2C2MA 4HAWA 4RVNA 3TZQA 5EJ4A 3GYGA 3NC4A 5C8XA 2C5HA 1E2KA 3O3MB 3BREA 4PU0A 4LJLA 1JT2A 2BKUA 4PQEA 5DM60 3IEXA 3JQ8A 1M5TA 1TX4B 2IP2A 4JQSA 4NNPA 4KITB 5B4VA 3B6JA 1T3TA 2ATEA 3DEYX 5JARA 2YYZA 2HDNB 3KV1A 4FFNA 4JC0A 1E6CA 2B34A 3BM5A 4LYJA 1MGPA 1MD9A 3L7NA 4AKTA 4O08A 3IC5A 2O0KA 2QORA 3FMGA 1W48A 1ZI8A 4PQRA 1H66A 2G1KA 5K3AA 5DXAA 1BDMA 1IUOA 4F8YA 2PZMA 3SHQA 4F38A 1AS3A 4TV8A 3Q15C 4L02A 3AU9A 5DDIP 1T9GR 4L15A 1MHPA 2GXSA 4KSCA 3GLGE 2LCFA 16PKA 1MFPA 2ODBA 4NCXA 5LQUA 3IP8A 2EGUA 5LZ2A 1WZEA 4FOSA 3WNDA 4JJIA 3TQOA 2IS1A 1BW9A 1DIRA 1YQUA 4A2WA 1UZUA 2UKDA 2DQSA 1I13A 1S7GA 3DULA 3PFHA 4MVJH 4BE9A 4YR7A 1Z35A 4QFDA 1S96A 1ZHHA 1QF6A 3SX4A 1RWKA 4YAWA 1GLVA 2FLKA 2ECFA 2V3CC 3WLIA 2H1VA 1FJ2A 1DI0A 3GPIA 1D1PA 1HT3A 1JSRA 2A0YA 5KX5A 4O4JF 3IKMB 1GKUB 4KSYA 1J23A 1TI7A 1I0LA 3FTPA 5AKIA 1WBJB 3RVPA 1Z0DA 3SXPA 5PGMA 4S05A 1XDWA 3IAS1 2G5TA 3W7VA 2DBVO 1OIXA 1ONPA 4KQ9A 1VSQA 2QWXA 4XLLA 3D54D 3QU5A 1OVMA 1ZM3A 4ZICA 4QRHA 2VAXA 5JS2A 1ULZA 3JWPA 4HLDA 4AKHA 1U8YA 2G28A 3EOBI 4UFOA 1DMSA 3CH7A 3PXXA 2CLDX 1BS9A 1VJ0A 3DOEA 3KBBA 1KFEB 3PI6A 2O3RA 3QWHA 5EGSA 4DPKA 2B36A 2HXGA 2ZI4A 3IRUA 3PEEA 4IDPA 2WTUA 4PO8A 4DA4A 1EWQA 3OHPA 3UB2A 4O5AA 1ZNZA 2PRKA 2PU5A 3CKMA 3NDRA 1Z9BA 3Q0TA 5HBRA 5IVIA 5F64A 3KLBA 3TTXA 4BN0A 1DKNA 3A9UA 4KUHA 3LTNC 4YT2A 5HXAA 4UUNA 4LDNA 4QEDA 2JAOA 1SIBE 1EFPB 3RSHA 1FOEB 1FSGA 1QVWA 3QX8A 2FUEA 4J16C 3ILVA 1XAHA 4ZEOA 1UPTA 3LP8A 2AH5A 2B98A 3D6MA 2ZXEA 2WSSD 2I9PA 5G41A 3H17A 3ABQB 4XIIA 4GXRA 4C7JA 3ZW9A 1A9ZA 1FSZA 2M98A 1HDIA 4PRKA 4RS4A 4EI8A 4ER7A 4R71A 1YQWA 1YDMA 3ID6C 4FYXA 2Q29A 4QULA 1NJ2A 3WK5A 3PQCA 5KYWA 1GIAA 4JUBA 4OHPA 4PZAA 1F6WA 2WWIA 3L07A 2VYCA 3H3JA 1NUTA 5TQ2A 3PJRA 3AI1A 2GFIA 4Q1EA 4RFSA 2DQYA 2ZE7A 2BBOA 3AVPA 1C9EA 2C9MA 2H07A 3L6CA 4JFAA 1W5AA 4OJTA 4NX2A 4QEZA 1G291 3P2IA 2GLTA 4MYRA 4M7RA 3DQZA 4QDOA 3WKCA 4NCKA 4Y1EA 1JDNA 3Q0IA 3GRZA 3T52A 4EPXA 3Q7SA 3OBIA 1XRSB 2RH9B 4IJ6A 1DMRA 4Z4EA 1C2YA 1CZHA 3G2QA 1NOKA 5ALKA 1XLWA 2BMEA 3T06B 2AL7A 3NHJA 2KM1A 1DTSA 3OT1A 5EE3A 1N0IA 3AJ9A 3BDIA 3GFOA 4G0OA 1O94A 3NV9A 2RG7A 4RF3A 4AMGA 1M8KA 3A04A 1XRJA 4M49A 3ZD6A 4BTLA 4JR0A 1H5UA 4D98A 1RQ7A 4I9HA 1YUNA 4WCFB 3EH1A 3HB4X 4A8HA 2XIQA 4U00A 2FDCA 4YT5A 5ALNA 2JCSA 1RTTA 1TVKB 1GNQA 2Q2WA 3IUYA 1B1AA 3CNEA 1ISJA 5D5HA 3WJ1A 4B40A 4F45A 2XEDA 4IOKA 3L1HA 3TQCA 1GQ2A 1K5PA 2CXSA 3AHIA 5JC8A 1HZZA 4QYWA 1H4TA 1PZGA 2BKAA 2JFUA 1LJ8A 1K7FB 5EZ6B 4JP8A 3SLKA 1PR1A 4URHA 1KMHB 3B48A 2W93A 2GOYA 4HFRA 1V4BA 2C8JA 4KDCA 5HBGA 3UA4A 4WJLA 4MGZR 4KQGA 1J24A 4N0QA 4HY3A 1I1QB 2Q62A 4CF4A 1XHLA 2QTLA 1M2EA 1JXQA 1YQTA 1VJRA 2I3AA 5FA8A 1K3TA 5T8KC 1SQSA 1FFWA 4EJ6A 1HQCA 3O4HA 4MVJP 4L4YA 5KAMA 3RQIA 3FYCA 3VI4B 1PFVA 3NBXX 3PVCA 3GLTA 2HCJB 5CNMA 3THSA 4P4SA 4XGRA 5KDOA 1EX6A 3DD1A 3BMQA 3P9XA 2VHWA 4K6FA 4LCBA 2FFAA 5DNUA 2PGOA 1WMEA 1NUQA 4D92A 3VZRA 2JARA 3PWKA 1F9AA 4JSRA 4QSMA 3FCYA 3KOWA 2CNDA 1N4AA 2JIOA 2X4LA 2XCUA 4OHFA 3WRWA 1Q7TA 1HDEA 5P21A 4RIIA 1EPUA 2CBGA 2X3FA 3KFXA 1EB8A 3MYRA 1WEKA 1ZGZA 1DIBA 3DXZA 3E3LA 3ORRA 2F8SA 4YHBA 2AJTA 1UBMS 3FBWA 4MB2A 3BIXA 3URKA 4ITVA 2EF0A 3CF6R 2YIMA 2Q49A 1M2VB 1Y33E 3B5IA 2GBPA 3ROFA 3IO3A 1IOZA 1NT2A 3HO6A 4PXAA 3ZQKA 1DC7A 1AVTA 1O96A 2UZ0A 3ZW8A 2I91A 2W6PA 3UMBA 2YJZA 1Y6RA 5IAAA 3TLGA 1PD1A 1Q0UA 2A1UA 4KE6A 2HK7A 1Y82A 3MS7A 3RC9A 5IAKA 3TQQA 2QTNA 2V6JA 4N54A 4E4RA 2YHIB 1O2DA 2CHFA 2ZUCA 3CXRA 4JMLA 4RLQA 4XGIA 3T7RA 3WWCA 1OW3B 1ZJZA 1MEOA 1SVWA 2GDZA 4DA9A 3T1QA 5FWYA 1SVMA 3HMKA 3PHGA 4MUHA 4WLVA 3GLVA 4IQ8A 2QVGA 1GP2A 1BGVA 2PUWA 3D8TA 3QX9A 3AWIA 5FH9A 3AM1A 2XF8A 3FH0A 3NTVA 4IP0A 4PLGA 1Q0ZA 2QMOA 5DIZA 3UENA 5DKFA 3TSZA 4BAGA 4BZPA 1VLJA 1I3OA 4E14A 3RJ5A 1P0PA 1T6YA 2QTRA 5HTOA 3RSOA 2LCQA 2OAGA 2ACVA 1QZXA 4I46A 1E7RA 5IN5A 3KJXA 3WQRA 3U0BA 2W7TA 1XZFA 1WVIA 1XZKA 2A4KA 1GCUA 1T91A 1UKVY 4KUEA 1DADA 3FMPB 4AKGA 2GM9A 2R60A 1DX4A 1SVKA 3ZVRA 2C2HA 1E8DA 2VPXA 1PVVA 4IQGA 1HORA 1JTEA 2XAAA 1WD5A 4KMMA 3PRKE 1W1UA 4G1BA 5CNKA 1S3GA 3ACBA 3VO8A 3WRXA 1I6LA 1JLRA 3KO8A 3MN1A 3P96A 3F74A 3NOQA 1MIHA 2NXNA 3U7QB 3IBCA 4M1OA 2IRWA 4KPYA 3RVSA 2IH5A 3L1KA 1MFZA 1IB6A 2VPIA 2OCGA 3GAFA 2FK7A 5D84A 1N6PA 5J4LA 1HYBA 3RG2A 5D8DA 3RWMB 2DETA 4ME6A 1KSGA 5CXXA 4UTRA 4QG3A 1U2SA 1SPBS 2OHJA 3LBFA 1JAXA 5DYGA 3R5HA 4AG6A 1Z4PX 5GJWC 1FL9A 5FB3A 4ABYA 1WE2A 3L6UA 4GKAA 4EKGA 1PFGA 1NDHA 1MIOA 5CK5A 3TRKA 2ZZNA 2R7NA 2PCJA 2X15A 3ZYZA 3QEBZ 2O8EA 1GARA 3O74A 2ZAYA 2XHZA 2CDNA 1G60A 4Q3AA 4YAKA 3L84A 3LKZA 1YNSA 3WGGA 3WRYA 3W6PA 4XYMA 2F67A 5ALZA 4PIMA 3RPEA 4ESVA 4XM0A 4R0MA 2PS1A 1BHJA 2G0AA 3LX6A 4O8CA 4TMWA 4WASA 3ZWPA 1SUSA 2IYQA 4QODA 3QI2A 2CLSA 3VR5A 2M1XA 4XIYA 4ZOAA 4EG8A 4TXHA 2GZHA 2JFVA 2NZXA 3SDZA 4TT3D 2A67A 4TVOA 4LRYA 2WG1A 1PFWA 2QI9C 2ZJFA 2E5LB 2BGGA 1MZVA 1XJCA 1ES9A 3A1DA 2FRDA 1W35A 3V8EA 4E0BA 2CNOA 3IVMA 3MGAA 1FNDA 1Z8HA 3MAAC 4BYGA 3HXOA 4O4IF 2C8KA 3EW7A 5U4XA 2VTBA 2GZ1A 1XQWA 2Z2KA 3OEYA 3TQHA 1LV7A 4F5EA 4QGHA 2Y2VA 1QCCA 3AM4A 5DCLA 1SIWA 5GIOE 1YDGA 1OGIA 4YC7A 3SBEA 5FTNA 2XB8A 1G4HA 3U2QA 5FADA 4Q4CA 4DB2A 1I3NA 4PRLA 1IUKA 4KN9S 1KZ7B 4CCAA 3FWYA 2DMRA 3M5CA 5HUJA 3V00A 1FJXA 1M0TA 3ESDA 3N7AA 2JCVA 2JRLA 4DV5B 3O2QB 3OT4A 4EKDA 3JWHA 4PG4A 4ZYTA 5EHXA 2Q0QA 4CKWB 2ZTSA 1SOWA 4LMPA 1PWYE 5ALLA 3VDXA 4E31A 2IDZA 2N0SA 5D51S 2ECKA 5C1BA 3MAGA 2XCLA 3KT0A 2G1UA 4FZVA 4MRSA 4LZLA 2OV4A 5B6PA 1RXWA 3PGXA 1OT3A 1X7ZB 4MEAA 4XJXA 3DEIA 4YTEA 3EXEB 1ZKDA 2WVJA 5BYBA 4BUJA 2A57A 2WMNB 6LDHA 3QHAA 1AQUA 2D8MA 3PT9A 4XWAA 4AQDA 3FMIA 3LUBA 3SGLA 2NU6A 4PYMA 1T1GA 4BEBA 1SG6A 4D9CA 4UQOA 3I12A 2W6ID 3STXA 3BMOA 1YFLA 4JI6B 5HKBA 4CMBA 4LY9A 4ESEA 3L7JA 1V8FA 3KLPX 1YHNA 3K70D 4XSGA 3SJAA 2A0FA 1G21E 2H1WA 4LDPA 1J97A 1NNLA 4MUGA 1QDUA 5DTQA 4KQ2A 4M9QA 5CDSA 5EWJA 2PS9A 1ZA1A 3BRWA 3HUEA 4JGIA 4DYHA 4ZXFA 3WMRA 2JLWA 3KVNA 3X43A 2VPTA 3V6LA 1IEWA 2G3YA 1Z12A 4R1NA 1DGQA 4AVYA 3ND7A 2VKQA 2D3WA 2ZJ1A 1K5GA 2X22A 1G9TA 4JL8A 5L3QB 2VTBB 1NW4A 4H16A 1VBMA 5C53B 4YYEA 1UMKA 1J00A 3P4XA 5EC8A 2QLTA 1V1RA 5C31A 4HX9A 4EBBA 5HIMA 4YS6A 3O5AA 4LFBB 5K0TA 4HEA1 2DQKA 1R4MB 3MS2A 3FJOA 4M8SA 4OXKA 5T7BA 5I6DA 4MARA 4KYUA 1TEZA 2IEBA 1ZCFA 1P7WA 1V9CA 3OPXA 1RAIA 2ZJYA 2GN6A 3DNPA 3ACDA 3L6DA 1LWOA 3AP2A 4LC1A 5E38A 1E4VA 3N8IA 1PEAA 2CXQA 3GLIE 5EHQA 3PE6A 2JCBA 2EZTA 4GR9A 2PO7A 1BXZA 2R4QA 1JEYB 4HWOA 1B6RA 4RD0A 3HKCA 4BRZA 3UPDA 4Q7MB 5H5JA 3CS3A 1V9SA 4TN5A 2FR8C 4UHJA 4Q7QA 3QBVA 4KWTA 5FA6A 3W2IA 3T3EA 1Z4MA 2IJGX 3JYQA 3QU4A 1TQ4A 4LMRA 3U9LA 3OZCA 5B4TA 3AQ4A 4XD2A 1TZKA 3A3OA 3KWMA 4KBGA 2PUBA 1RWMA 2EXXA 1HG0A 2J9FB 4CKEA 4Q1AA 3NBMA 1EM6A 2X3YA 3LNCA 4WZBB 2VSXA 3HCCA 1CJUC 2VI5A 1TZCA 2FMXA 1WLYA 1FP2A 2YN4A 1AKRA 4DY6A 6NULA 1CQWA 2R84A 4KXLA 2JLYA 1XJ5A 1YZ3A 3CVXA 3VPGA 5HIAA 1RC0A 5IKEA 4MW7A 4LRQA 1LFAA 1XPJA 1DCTA 4RC9A 3N0XA 3DT8A 1W36C 1DO2A 1KY3A 3ZHSA 3KQLA 3C5VA 5FHQA 2AD5A 1UP6A 2HU7A 1VPEA 4MDYA 5CT8A 3VFDA 4YCSA 1BN7A 1Z6TA 1TUEA 2R0QC 4JI1B 3W2FA 3HYSA 5FYQA 1B8VA 1K1EA 2UYGA 3QFFA 5DLPA 1CT9A 3L0CA 4IOLA 3FOEC 3WSWA 1HFEL 3NAGA 3AXTA 5ERYA 1GGJA 1ANKA 1V1RB 4JBIA 5M7EA 2PGJA 2GHRA 1JG6A 3CUEF 5A4DA 3OC6A 3HGTA 5B3AA 2Y99A 2P6UA 4RHCA 4Z0HO 5JNVA 4NCAA 2WSIA 3A1UA 3KKLA 3FE2A 3A3NA 3QF4A 2EFGA 2GO1A 3HR4A 3VTZA 1Z83A 4CM8A 1E9BA 4PFJA 2EWMA 2QG9A 2H0RA 3ESAA 4XE5A 4G5RA 1EESA 1A98A 2DLDA 2LPMA 5HDQA 5TVGA 3A6LA 1FTYA 1N2GA 5K0JA 2AXEA 2AFHE 4ER6A 3CUWA 2HXYA 3TO5A 2WFMA 1ECPA 1Z82A 1GPKA 1CJTC 1FFXA 1I9CA 4HZGA 1UOOA 5DCWA 1AN9A 4KMOA 4DMUB 1KS2A 3TRIA 1X7XA 1E92A 2ORVA 3OHMA 2W11A 3BMNB 1U2DC 2P9FA 2BH9A 3H11A 5GV7A 1Z5NA 4XASA 2REBA 2R1TA 4L2IA 3BC1A 3COPA 2HBZA 4X1IB 2O8BB 2VF5X 2Y3IA 3GRUA 3HS3A 1OZGA 4PO9A 2WHPB 4UHKA 4BNIA 2OPHA 5AOAA 2QJFA 3KAJA 4TMFA 3M0EA 5AKKA 1T15A 1PJLA 1E9DA 2RHRA 2XKAA 5EQDA 3WK8A 1KVRA 2OL4A 1XVUA 3LFHA 1V7CA 1JR3A 2PSDA 3WBJA 2QN6A 5AVVA 4BJ5A 1PE0A 2C2ZA 1UPUA 1GCAA 1R15A 2CC2A 2GF9A 3DT6A 3MB5A 2WEKA 1ZUNB 4HSGA 4Q1DA 5LFAA 1OH6A 1X3LA 1UPXA 2NO7A 2VSYA 2H8KA 1DAHA 3KKQA 4M53A 4W6QA 1JJFA 4MPRA 4C4SA 4NBVA 2QRGA 3WFIA 4BNKA 1QKKA 1RHJA 2HBYA 3MTIA 3ORQA 3N5CA 2ONJA 3ADOA 4AF8A 1QZZA 2D1TA 4I08A 4D02A 1OXUA 5IC6A 3S7ZA 4C2TA 5KSZA 4DABA 4YRIA 2Z56A 5DI3B 2CWWA 3LY9A 2XZLA 4G3XA 3RRFA 1EDDA 2XDAA 3D2CA 4NYJR 2VHYA 2H7VA 1EQ2A 1LJLA 3DDNA 3O82A 1CJKC 4OQPA 4BVEA 2H4XA 3U7IA 4DSNA 2GYWA 4ZVTA 1PO7A 1S0UA 3G68A 4G4IA 1FBTA 2E4WA 3ITDA 4WFQA 1QPZA 2I1VB 1KEUA 1FC0A 1GPLA 1W88A 2XNHA 2IIPA 2F43A 4URWR 4Y9TA 2VYNA 2PMCA 3ZGZA 3WGVA 3EAGA 3DXYA 1CQZA 1JIVA 2VPPA 2FWRA 2GF2A 4XWYA 3CU5A 3OLZA 3L7DA 2XMRA 4QUHA 3FETA 3OE7A 2KBFA 2CWDA 1NF8A 3EEYA 3GJQA 2GVZC 1A96A 1XFDA 5HJ5A 1VKZA 3EE6A 2ZE6A 2OSVA 1K0UA 1LDGA 2R85A 2PXXA 2YHIA 3FLMA 1SZJG 3PIRA 1N6NA 2WHEA 2ONCA 3N2GA 3SN6A 3SQMA 3T9EA 3VM6A 4F9TA 8ADHA 1L1RA 4YDQA 5JLJA 5KINB 1F1JA 1TUIA 4J6FA 3VR6D 1M1YE 3P9KA 2GEFA 2VHZA 3EC2A 5DT9A 4E4YA 4LDQA 3U3OA 2EKBA 4B3CA 5BR4A 2QRHA 4I1VA 5A9SB 1GQSA 1XEWX 4R6XA 1XMOB 5SYNA 1QOPB 1LBEA 2Q6KA 3BCRA 4NFHA 2CHEA 4DCJA 2OOKA 2QXUA 3OZXA 3ND5A 4HN4B 4KPEC 4CV2A 4TM7A 1P9LA 3ZCUA 4Z4QA 5AO9A 1KRHA 4O4LF 4KJXA 5DNCA 2IS6A 3PDCA 4CT5A 1DIAA 2IHZA 3HQ4O 4CN9A 2VHQA 2RHMA 5IASA 2VXOA 1IEVA 3I9MA 2IZ1A 2ZRPA 1EA5A 3EPKA 5KX5F 2YX1A 3HCRA 4HEQA 1YK1A 5CDUA 3OU7A 3JD3A 3H5WA 1C9DB 2I6FA 2XNDD 1XFAA 5TC4A 3F9CA 3X1ZA 4L6AA 2XGMA 4AFNA 4DUZB 2XR1A 3MMXA 3VYSB 5I7UA 5CVVA 1XKTA 2XDWA 1J2YA 1ZKMA 2GI4A 4K5QA 1X13A 1Z8NA 2QN3A 4LRSB 3QEKA 4D8VA 4KGZA 2X40A 1LLQA 2K7FA 1B1CA 3LDFA 4M0PA 1A4RA 2YWHA 4GH5A 1MABB 1Z7EA 2WUDA 3I2JA 4RV4A 3CLTD 4WZAA 2C42A 1KO7A 4CTMA 1V8ZA 2HLDD 2VPWA 4ZT2A 4LF4B 2Q2VA 2C5SA 3AKDA 4QDZA 3D3NA 1O96B 3OESA 2WUWE 2C2WA 3QPCA 5F2KA 2YFQA 2JGIA 2AC7A 4NAHA 3USES 1G38A 3WLLA 3K96A 3KB6A 4RKYA 3S4YA 4FT2A 4MQUA 5A7FA 4WHMA 1TVKA 2GLXA 1ZM2A 3C2QA 3EDYA 2HSGA 4RJ2A 3NNNA 4MQBA 3DCJA 4ZQEA 4C7MA 1MVOA 1TEVA 2H2HA 2VAVA 3PGLA 2QMHA 2AFVA 2W98A 1OD6A 1KBQA 3GH3A 3NLLA 4AG5A 3W4KA 2KLBA 4QSHA 4X61A 5EE5B 3SSAA 5C5CA 1N5JA 3AKYA 3KNZA 4X63A 2I4IA 4RXMA 1RKVA 2HQ1A 3KYDA 2BFFB 1BMFD 4JLOA 3SYNA 4TVSA 2UZ3A 4M37A 4W5JA 3LOPA 4FOTA 3R0XA 2CN1A 1J2UA 4EF6A 1Q7EA 2QUIA 2YC4C 1B6TA 1UR5A 2R47A 3E35A 4MV7A 4FW9A 2EWVA 1Z0AA 4BBZA 3FY4A 3WO0A 1OU4A 3R3ZA 5KVQA 2XMZA 5LU9A 3H16A 5JY1A 4NXMB 2QE7A 3F6CA 2ATCA 4JBXA 5F7ZA 1Q0LA 4D97A 2AF4C 4WBSA 1K5HA 1LF0A 3JQ9A 4HUQB 5I8WA 1F7UA 5HOEA 1Y9DA 2VBFA 2H4HA 5F7XA 3PIIA 5K3FA 5EJFA 5HUHA 2D0OB 3N0RA 1T5DX 2HO4A 4P7GA 2REQA 4UDXX 5IW8A 5LDHA 4DXAA 4PBTA 3MM4A 4MUBA 5B2ZA 3QVGB 4ALJA 221PA 2RBGA 2I1WA 1CJSA 5ENDA 1TYDE 5F35A 4XIFA 5KPDA 5E8RA 1CUIA 3VISA 4RA9A 2TMKA 2NXJA 2NV0A 1V11A 4UXHA 2EYQA 2HIAA 2I80A 2BISA 5J1TB 3X44A 3H7AA 3A4TA 4UUMA 5EIAA 2WKPA 3C43A 4CMIB 5IJWA 1N5OX 1MAUA 5B3KA 4U2BA 1O1YA 3H19A 1D2RA 3A25A 4PY2A 2HIMA 1QFJA 3H6GA 4IEFB 1UBCA 5EUQB 5BSEA 2WIDA 5C8YB 4H2DA 2F9LA 3NIBA 5H4GA 4ZPXA 5A3QA 5EKXA 4JS0A 1Z2PX 2ZI7A 3RS8A 1DT3A 4PYNA 4I3FA 1CXZA 4CF6A 4DREA 5IXSA 3AEKA 4QGGA 2B8TA 1VSTA 1ORRA 2I2BA 3G7UA 3RVDA 3EFHA 2CD9A 1YS9A 2QXYA 4M9ZA 1EGMB 5I7HA 3NAMA 1OPRA 4G84A 4ZRMA 1H1DA 2PLAA 5JBNA 1QWOA 1J8MF 2VA8A 2OV8A 1ZJ6A 2OD2A 2XECA 3QHPA 4P3PA 2DLCX 1DBWA 5EVCA 2BN4A 3I3SR 4RV9A 2FHPA 1LZKA 2PZBA 1G7TA 3PC3A 3AB3A 5DB4A 3S81A 4MTCA 1SKMA 4RQAA 1C4OA 4HMOA 4X1KB 2IWHA 4XA8A 5CEEA 1RLUA 4H6PA 3AGPA 4Q9LA 3Q6NA 5REQB 3PUKA 2HL6A 1QV9A 4MIYA 4E51A 1GM5A 1O9HA 4KIFA 2IS2A 5K0NA 4RD3A 3WL5A 2BCGY 4XFDA 1P2VA 3V8BA 4U2EA 4M1TA 1U0OC 2QQ0A 2HJGA 3EUEA 3NGXA 5FOTA 1J09A 2NVUA 3GOQA 3N8NA 1C0LA 1WJGA 3B36A 4B71A 2JS7A 5BQXA 1BIFA 1IK4A 3TINA 4IICA 5KQMA 4BWFB 4DC9A 3VR6H 3EK2A 3KB1A 1ZMBA 2P5SA 3NRBA 2AFIB 3UJCA 2HA5A 2NLOA 3RYIA 3WLJA 3PHIA 4U3JA 4HDRA 4D3ZA 1F14A 5K0LA 1K4KA 1J1ZA 3NJ4A 3O8LA 4NBNA 1TNDA 2HUPA 3ABIA 4W1QA 1AGNA 1HT1E 3HACA 2EG9A 1V16A 1OV4A 3L8ZA 4MMZB 3UHPA 2BTQA 4G86A 4JUCA 1YOVA 4EY3A 1Z28A 3HYCA 1W5EA 2V0GA 2VYFA 1QDEA 1N0HA 2YJGA 3QJYA 4BZQA 1QFMA 2J6HA 1UC4B 1XTBA 3KJNA 4JSTA 5LP6C 1JB9A 3FVQA 1XCOA 1JHZA 2R8OA 2ZI6A 4W1SA 1KHHA 1OBVA 3JD2A 1G20E 4K8OA 2FVYA 4AP9A 1D5WA 4DG9A 1XTIA 2FMKA 3DZIA 3L01A 5L95A 3G79A 4QNNA 3RVBA 4YRMA 1KOGA 2ZWVA 3QUQA 5A2GA 1PNTA 1T2FA 4QYIB 4RK6A 4UE6A 3I3OA 4HTAA 5B57C 3JAWA 5U4QA 1WKCA 1CQPA 2DBYA 3I37X 2PKWA 2QX6A 2OO3A 1T0IA 4MICA 1O97D 2XNDA 1QHSA 1U02A 2AHRA 3LQ4A 2YHAA 3IOEA 1HPLA 4ARIA 3A4NA 3BD8A 1CUAA 1I14A 3F1KA 3QUBA 3RYFA 5BW8A 4ZQIA 3ZU4A 2ZVDA 3EHDA 1TAGA 3AERB 4FMDF 4N6OA 4TLMB 3CSSA 4UBOA 4YN3A 5B3LA 3ZDFA 4H18A 1LQ2A 2C3YA 4EB6B 2A33A 1C0EA 3RUPA 4RVOA 1L0BA 4HNSA 3M4XA 5JROA 3OVMA 1R0ZA 1A04A 1C8VB 1ZK3A 3IEPA 3AEZA 3BF8A 2P2GA 4YXFA 3L4SO 3AVVA 4FR2A 3UJHA 3WL8A 1A71A 4KC0A 1PS8A 2AMLA 3U4AA 2PQ0A 4ZMSA 3DMFA 1NV9A 2GD1O 9MHTA 4OUDB 1QIFA 2PLWA 4D1YA 1CUFA 3E3NA 4GBJA 4JEHA 2IV3A 3EVTA 5GOTA 3RHSA 2GSWA 4AUMA 3IMEA 2G9ZA 5AVWA 4NCBA 2FLWA 3NCTA 4ZTBA 1JU4A 5B7QA 3HBAA 2FW7A 3V1YA 4AQYB 1FJHA 1EWVA 4R6WA 3L0YA 4R8SA 1I33A 4ZU1X 2ZSIA 4HP8A 1XZIA 1ZLXA 3D5TA 2GNOA 4QA9A 4QYTA 5FFNA 4Z0PA 1JWAB 1ZINA 2P2SA 4Q7LA 2F8MA 4U3JB 3I76A 1PQYA 2DPLA 3W5BA 1O58A 2JG3A 2I99A 3RFUA 1SZPA 2AMYA 4TVKA 3ZCVA 3C3AA 3FDIA 2UYCA 3A0RB 3OMXA 1XDZA 1T6XA 2I3ZA 4EAQA 4Q7EA 3PX7A 3EOAI 2PL3A 4HDMA 4NDNE 1L9KA 1OC2A 1H0HA 2VIIA 1DQYA 1J25A 3IELA 4LECA 3ILXA 5AW9A 5IFKA 2FGJA 1V7PC 3A3PA 4TSFD 3BK7A 5HK9A 3NW9A 1FNBA 1PJ8A 1UKBA 5HG0A 1HE4A 4RAQA 2PV0A 4UNSA 1SELA 1U0EA 2V4UA 1W36B 2X0NA 1C29B 1GU1A 3X1YA 1YRYE 2PS3A 3OTQA 2Q45A 1GRNA 1YA8A 5BSWA 2RG1A 3RB8A 1EZ4A 2B2NA 2JEYA 2VK8A 4OL0A 4Q3DA 5ITSA 5B5SA 5F3RA 4ZK2A 3ETHA 5JI2E 4NH0A 3MT9A 1E1CA 3AYXB 4P3NA 5EHZA 3GIWA 3RYHA 1V2HE 1Z74A 1UZMA 4RZ2A 4ZMRA 1RXSA 4QPNA 4XVQA 1CBUA 1ILEA 4M4SA 3NOVA 3BB1A 4U5QA 4U7JA 3TQTA 2IDMA 5CB4B 4CYMA 2F3PA 5LD2C 5GQSA 4DV0B 1SCUA 3D6NB 3D8HA 1CUBA 2QA5A 3Q98A 4P98A 5HVNA 4EJSC 1EE1A 1QQ5A 1TE2A 3W7BA 4E13A 1GLNA 1ESNA 1IIBA 3FZEA 5MF6A 1KEKA 2HSWA 2B2CA 4G4JA 3VHRA 3LG2A 2WR8A 1Q6ZA 1EE2A 3LBYA 4OQLA 3T7KA 3ZX4A 4ALMA 1WUHS 3TDKA 5AVRA 1TO2E 4DIBA 1DV1A 4V24A 2NPIA 3SKYA 5JXJA 3KWFA 4BVFA 3BHJA 3HDHA 3LNTA 3NJ8A 5EQJB 5EUBA 1VSUA 2BHSA 1YAJA 3AOEC 4NS4A 1NVKA 3SZGA 1X9GA 5A9RA 5CBPA 2FOLA 3NVDA 4HMQA 4WAUA 2PR7A 4D4JA 2BMWA 2XMPA 1ZK1A 1EK2A 2PBFA 3GRYA 1E69A 3GD5A 2J6IA 1N9GA 1EFCA 3EXG1 3CR7A 1NHGA 3DBVO 3ENQA 2QYHA 4JQOA 4MV1A 3U39A 2R3SA 3C3XA 3QGMA 3WX0A 5JNRA 1I4TD 1M2VA 1Q1QA 2ORWA 4P08A 1L5SA 1NF9A 3KQMA 2BMJA 1J21A 2MINA 3FYUA 4JI4B 4MV5A 4JXKA 3SF8A 4CFYA 4WZBE 3CHYA 3F6RA 3D7KA 3WBFA 1AKWA 2CEKA 3WOHA 3A31A 4M7WA 4EFNA 1WUYA 4EFLA 4FGKA 5ITWA 3O38A 3GFFA 1GTZA 2EHJA 1XYVA 2CXPA 3OZ7A 5L6LB 3HVKA 1FTNA 3D3EA 5CR9A 2J48A 2XGSA 3JYLA 3FVVA 2CLLB 2O06A 5B1EA 2E5FA 2OR3A 1CJCA 4QTZA 4RL6A 3RD5A 3B20A 3IVGA 3STWA 2JAQA 3R40A 4UXIA 2CVOA 4QUDA 4TX1A 5F5LA 2Y0DA 4YYZA 1JEDA 3CVYA 4QAJA 4YMUA 5JE8A 3JU3A 1QK4A 3R3XA 2FK8A 1MJGM 2Q5FA 1JEOA 3PUVA 1I80A 1NW9B 2NTEA 3LC7O 1Y4ZA 4BJ1A 2F4NA 2Z43A 2QJWA 4IGAA 3AQIA 4XFJA 3RVMA 3W1EA 3K0FB 5JNLA 2Q4BA 4K9NA 4YP9A 4D4LA 3NUGA 2J5BA 1CNFA 1JHUA 3UCEA 4EPRA 2ZJ5A 1T26A 4DYVA 4N0DA 3D8UA 1WPXA 2VJPA 4PG5A 5JXWA 2WW8A 2EL7A 2C2BA 5HKAA 4KE7A 4KTVE 5BPHA 1PS9A 1RWWA 3ELBA 2BFEB 2BKXA 3IHKA 4DILA 2ZBFA 3MHPA 3RS5A 4EBFA 3EXHA 3H5VA 4C7VA 4KJZA 3GVHA 1Q3TA 1T5IA 4I9GA 4GLLA 3R5TA 5DM70 3ZW7A 4GQBA 1C3XA 2PZFA 3OEHD 3KUXA 5HIJA 2KB0A 1EEXB 1LPAB 3NKFA 4FSXA 3TFQA 5CFQA 3S40A 2W4IA 1OXKB 3G13A 4OMFG 4A8JA 3S2IA 5JH7B 1H9CA 1ZH0A 4QQFA 2PX2A 4WA8A 3MRVA 2JLSA 3IDSA 5EWMB 4HTFB 4FR0A 4KXYA 5EIBC 1PK8A 3ZHOA 4DLTA 5TARA 5I9BA 5BSTA 2FF5A 2QROA 5C8DA 3V4RA 4QWWA 3GJXC 3WZLA 1NUPA 4WK4B 1WO8A 4PBRA 2E4XA 5E2BA 1UCFA 4I55B 4CTJA 1DWOA 1SCQA 1BVUA 3G85A 4LJ7A 3TOCA 2HJVA 3OZVA 1Z56C 1YAHA 1KI9A 1YC5A 2W2LA 2ZI5A 4OJQA 4GKVA 4M86A 5JNWA 2Z2JA 4Z4HA 1KDVA 1IAVA 3I45A 2PFSA 3A7EA 2MINB 3FYUB 1ODJA 4XUEA 4AT1A 5JALA 2CT8A 1KRWA 3O1IC 1OREA 1E0DA 5EPOA 3Q8MA 2QLBA 3TIIA 1XNGA 1X6VA 5AR1A 1O95A 2X0FA 1KH2A 3C1AA 1F2TB 1MORA 2SECE 3ZIAD 4AKSA 3L8MA 3AG6A 2V5VA 2VR1A 4UCWA 5FUWA 5H3CA 4QTYA 4CGZA 4IRXA 3V8VA 1LEHA 2J3KA 2ZTMA 1VMIA 3QK7A 3R7DA 3TZEA 1JIIA 1QYVA 1ABFA 2OV1A 2YWRA 5TIIA 5L3SB 4MV3A 2B78A 3DVAA 3QYPA 4UNNA 2J9ZB 4Y6GB 5KWVA 2ORED 4MLCA 4P0QB 1EGHA 3V8MA 2VRCD 4RX1A 1SCIA 2CUTA 3FYSA 2JDID 4GM1A 1ORWA 1NQAO 6REQA 4MVWA 4CETA 4D9JA 1L5VA 1JLSA 4W7SA 2AG1A 3B1KA 1XTVA 4B84A 4F4FA 5CITA 1N5RA 1JXAA 4HQOA 1UK9A 2QTTA 2O2ZA 3KOMA 3MWLA 4BE4A 1TTPB 3B51X 2WUEA 4KIUA 4Q16A 1RRCA 3TM4A 5DNYB 4MGYR 4Q00A 1M34B 3OQMA 1UFKA 1E4OA 4HN9A 1CYEA 4W1RA 2AN5A 1T4DA 2KS6A 3N5KA 4JVOA 4LTDA 3VVCA 1MRZA 1FU8A 1LBQA 4YAJA 3WB0A 3DC2A 2B99A 5SYAA 5TV2A 4D9IA 5L3ZA 4OYYA 4JYCA 3UW3A 1HEUA 1XF1A 3GGOA 1DQPA 1VMDA 1NI4B 1FRZA 3O9VA 3QE2A 4UVDA 5EXSA 5H3LA 1QQBA 1PVOA 2NIPA 4EYEA 5LQAA 1G8YA 3LBAA 3MUFA 1EP3B 4HNAB 5FD8A 4F9EA 1E1DA 2Q5HA 4GRAA 2MSKA 3ROXA 3MS4A 1DC8A 1ZH6A 2CY0A 4HYQA 1NXXA 1YGPA 1BA2A 2JVJA 3C5CA 3ZDEA 3CRVA 5BQOA 3TZLA 4O4IA 3VR4A 4HXEB 3R3JA 5K03A 1XLUA 3B85A 1N2XA 3KQPA 3FSGA 3REQA 4DMFA 1KORA 4JDUA 5AVYA 1KO5A 1R6XA 2WM3A 2XTZA 3KQHA 2CHUA 3U56A 4KACA 1SXHA 4QICA 3VR5D 1KP3A 4UMFA 1PU2A 4CLHA 4CQNA 3BJRA 3DYIA 4P33A 4RW0A 4B7ZA 4ZOLA 2Q3MA 2A3RA 1OXBB 3IEMA 4G0UA 5H4HA 3LECA 3RC2A 2CJFA 2H5JA 3JQ7A 4AWAA 3AC0A 4YRPA 5I9LA 4YACA 5HPYB 1IOWA 2PZAA 3IDZA 4AZ3A 3BJEA 3IAUA 1UKZA 4MPDA 1ORIA 3TUZC 5FWNA 4PWYA 1T2VA 2IYYA 3VDMA 3AJAA 3DT9A 1N2IA 4YMVA 5L51A 1U63A 4XJVA 1EWTA 1WDLA 5AUNB 4NZZA 3LF1A 5DBEX 3PUJA 4EK9A 1GUDA 1MV5A 3W05A 1E98A 3TLXA 1QVRA 3V7UA 4ZVRA 1LPOA 3VMMA 3G23A 3DYVA 2DR3A 1E4EB 4UU1A 3QH4A 3R44A 4I1YA 4BJ3A 4ZZIA 1JDTA 2Z3VA 1NFRA 4QECA 5BR1A 2O4CA 1LNQA 2KE5A 4UU0A 1Y6JA 2ZBDA 5LB4A 3ZNOA 1U0RA 3V5NA 2FEAA 2RGNA 2GBIA 2Y67A 2BPOA 1O9BA 2HOQA 2G77B 2Q41A 3KR0A 3EA5A 2DHCA 2IXGA 2VO1A 3R0QA 4Y6RA 1HNXB 5H81A 2ASVA 9ATCA 3O31A 4M38A 2QNRA 4O2BB 4Q02A 3D2AA 3SQNA 1SBNE 4YJKA 3MOIA 3BICA 2AQIA 2EARA 1XOIA 2RE8A 5CW1A 3W4IA 2E87A 3OAAA 1P80A 1YCFA 3GWGA 2F2TA 4XQEA 4C0WA 4DA8A 1GPUA 1N3IA 2ZDQA 1CIJA 2JBHA 4YJFA 2IXFA 2QN8A 3S29A 4FB5A 1DTWB 4JP1A 4NK4A 5KTRA 3KPVA 4Q9NA 1QANA 1XALA 3AL3A 5HK8A 1TAHA 3O6VA 3A1VA 3LE8A 1HFJA 1WPQA 4M8NE 1E2DA 4NMHA 3VOAA 3FTDA 4C3OB 4RF4A 3CCBA 1ZA2A 4ER3A 1Z0FA 3K9CA 4EMSA 1BXGA 4TTJA 5KWJA 1JEQA 1ZH4A 2BR5A 1Z6ZA 3ZOKA 5KB3A 2IE0A 5FOSA 1I6KA 1WCIA 1UC8A 4XGNA 2HJSA 3KKNA 2NO0A 1XZQA 4P86A 2IZ6A 4OJMX 2CV1A 5C81A 1SZDA 5ALGA 4O6VA 1XQ9A 2A5LA 4G1EB 1CW2B 1XK7A 4Y2TA 5DYWA 3GLHE 3ISJA 1D9XA 1JA1A 1E7WA 3BE4A 1HL3A 3HU5A 4IG9A 4JASB 3ZWWA 4K6KA 4ZVVA 4L5BA 4D44A 2A9KA 3BIJA 4EI7A 4UEWA 2XXAB 2MCFA 4C0KA 2J46A 5FUQA 1WDKA 3ZDRA 1CRPA 1ZGAA 2XZTA 1KC3A 1JBEA 1FYFA 1KFCB 1N2CA 3K8QA 2DKOA 3TUJC 4AYTA 1XP5A 4NJMB 3QZUA 4KXQA 4U2KA 2WUVA 5LA6A 1OXSC 2WB4A 1A9SA 4HNGA 4LWZA 2VH2A 4N5MA 4R8RA 1COWD 3HUTA 3R76A 2N1MA 3VSDA 3RKUA 5HJ7A 4I36A 4Q39A 1Y80A 4GI2A 3SQOA 5FORA 1F1BA 4YRQA 1VI6A 1YS1X 5AJHA 1RHMA 5EPUA 3TOSA 2REXB 1KPGA 4YMIA 1F4PA 2NUAA 3O75A 1YJ8A 1NVVR 4JLSA 5F12A 3LLUA 2PX4A 3A10A 5JDIA 3HEAA 2F62A 4KQXA 2GESA 3T7DA 5BRAA 2Q5EA 2XBLA 3CMMA 3AINA 4H3HB 5EP1A 5L7WA 5LMUB 1YVRA 3IB3A 4I9FA 3QWIA 4JLWA 4YAIA 3TLKA 3BD7A 3CZAA 2H63A 3EUAA 3G0DA 4YIHA 1JE1A 4BO2A 2BBTA 2B83A 3GT0A 5ANRB 3ESXA 3U4DA 3U9TA 2EKQA 1SCNE 2PE5A 1D2MA 3SFZA 2XUHA 2GS9A 2E9SA 1GLGA 3RRJA 5F21A 1NKVA 3RVLA 1H05A 1QWSA 2PR2A 3NBFA 1JDZA 4PFKA 3OQJA 5JEEA 1XPOA 1T4BA 4P22A 4TS9A 1KI8A 4WV3A 3KR1A 1F0PA 1MX9A 1Z25A 1HV8A 3O8DA 5AVOA 5DTIA 2O1SA 4BRSA 1Q0HA 3MSXA 1QGOA 5K7SA 1ECGA 1GZ3A 1A2KC 3STUA 1I4OA 1NG1A 3B78A 5ED4A 4AZ3B 4PPFA 3GWZA 4FM9A 1EDZA 2QN1A 3O1HB 3Q7QA 1FW6A 2QI9F 5JS8A 4QPJC 3FZQA 1UINA 1HY3A 4TPKA 3UK0A 1N5KA 4RH0A 3M6WA 5CM2Z 2JI6A 3TCXB 1T9HA 5DRYA 5J4YA 4Z86A 1DU4A 2C7VA 1JB1A 2BGKA 2D5CA 4MQ6A 4FJ2A 4RPHA 3FOZA 5JYBA 4TMVA 3IQHX 4QJBA 5E7MA 3I52A 3NHLA 4EHLA 4GR4A 1EP9A 1WF3A 1KEPA 2NAFA 2VQSA 2C82A 3N2IA 1FFDA 2W2NA 2GN8A 3HJUA 4FYHA 1NUHA 1OLXB 1ULUA 1S2DA 2EFYA 4KXUA 3PQ5A 4XQCA 3BFXA 3V4VB 3WWZA 1FFYA 1QQ6A 3WGYA 4KEAA 4GI7A 4LNUA 4BV9A 1Y89A 2PLNA 3CA8A 3VDNB 2KPOA 5M5BA 2Z8YA 3ICEA 2DAPA 5G0SA 1KI6A 4GGOA 1J9EA 1FP1D 2I2XB 1ZGBA 4GE3A 2LNDA 3P19A 2Z95A 4IXDA 3SVTA 4NJEB 2C2YA 2C58A 3WP0A 2BDUA 2Q46A 5BSUA 1TMYA 2LP4Y 2V54A 2PZEA 3RUFA 4R1TA 4KX5A 4QKQA 3T41A 1AZTA 2EQ5A 1AY0A 1WW2A 2IY7A 2XQVA 4YRRA 3UFXA 3CSDA 3T1NA 4EKEA 4GMDA 4BECA 4D46A 1JA0A 1GAJA 1WY7A 3FB1A 1NTOA 5HRAA 1B0UA 4W82A 1CS0A 3DTVA 2F64A 3C3PA 2F55A 1AHNA 1I2AA 2ONZA 3H99A 1CUCA 2FZ5A 3EIUA 3L7KA 5HKOA 4X20B 2BM1A 1NW6A 5CDTA 3C3MA 3ELUA 3B89A 2ID7A 4QWMA 5ALIA 1D6JA 3GNSA 3RM3A 4L75A 1UADA 1OWMA 3KBOA 2XXAA 2Y1KA 1PR5A 1R4NB 2XB9A 4RA9B 3VO1A 2A9FA 5ALMA 1Q0TA 2DLNA 2PK3A 1BJTA 2HCBA 4OAOA 1QUEA 5AK4A 2QPOA 1MDFA 2W9XA 4OGWA 1VGRA 3UKJA 1YF3A 1FIUA 1V35A 3G5UA 1ZS9A 2OCXA 3FTNA 4P82A 4WGFA 4DRZA 4OHWA 3ZKAA 4CT4B 1YHYA 1RQXA 2RAUA 4LQLA 4H9GA 4XVHA 4A27A 3G0GA 1AGYA 3HYTA 1L8LA 5LNK1 1RE1A 3G2MA 2JGJA 3COWA 4FE3A 1FX0B 4G09A 3WO1A 4CIAA 3IILA 5JFTA 4Y67A 1RMTA 4EVIA 5ABPA 3CY6A 2OMKA 1HT0A 3AF2A 1S3IA 1OA1A 3FUUA 4C9BA 1XCJA 2AQ8A 2XE4A 5LCXA 1U2ZA 4G81A 1ZNXA 5AW4A 3PGA1 3F7TA 5JW6A 3D3WA 4UOEA 1M54A 2Q5JA 2PH5A 1LTQA 3H9QA 3NRJA 1IJBA 3E4DA 1HQKA 4BMOB 1UEIA 3I58A 3KAPA 5G3ZA 4WFIA 5LOVB 5ESWA 2FY8A 2OWDA 2YYAA 4M2LA 3S70A 4B34A 2ZUVA 1T29A 1NVBA 1O0SA 2XQIA 3CLSC 1LPMA 3DBIA 4YRKA 4B8WA 2PS0A 1ND5A 3KC2A 4MS4A 3UMMA 2YQZA 4L78A 1SXJE 2QVLA 2V7GA 1GA1A 3W04A 1FNNA 1A8PA 4L4XA 5AW2A 1QX3A 5CCXA 3M6LA 2DPXA 4NENB 1XMPA 1DL5A 5BVGB 3SPXA 2AK2A 1UBTS 5EWMA 2O8FB 1SUIA 2OOSA 3CZQA 3K1AB 3L6BA 4IIJB 1IPEA 4BMXA 3DLBA 1QH8A 3VUEA 2I2DA 1M1UA 1KTVA 2DE0X 2VHCA 4IDQA 4LXHA 5KTPA 4KR0A 4KLRA 5AHWA 5DW3A 5C8VA 1EXVA 3EJ6A 5D85A 4IMJB 3D8SA 3B5JA 4POOA 2IIBA 3LQ1A 4N5NA 3DBLA 1FFSA 1VCNA 1KIAA 4RPCA 5CYFA 3ZE9A 3GBPA 4WBNA 3BIWA 4DLSA 3W5VA 1CUJA 1P62B 4LXTA 4Y1FA 2Q7XA 3FDXA 2CB0A 3JVUA 2AOXA 3NTRA 1LPNA 3AY3A 3V8NA 4QYMA 4DGQA 2XVYA 1TJPB 1W88B 1VOTA 3WSTA 3EMDA 2OHVA 2HZBA 1AH2A 2I4RA 2WM2A 3ANLA 3AR2A 3VDRA 3ZZNA 4B8ZA 3ORYA 5EFOA 3GEHA 5KNBH 1B73A 3LM8A 5EE0A 5EKUA 2QBYB 2QNIA 4GMKA 1Q2XA 2EATA 3NEPX 3X0DA 1DIGA 1P7ZA 2IXDA 4J4TA 3E2IA 1SUCA 1JHVA 1Q12A 5LU8A 1G8HA 5CB4F 1OV6A 1BD4A 3DMGA 4TLAA 1JJAA 1FF9A 4HQKA 1T4GA 5DSTA 5AW6A 2JD0A 4UCQA 7ADHA 1MG5A 2QGFA 4KW7A 5BN3B 1WPGA 4OHRA 5KOIA 1RYDA 4J43A 3WLKX 4EMBA 3LC0A 2BELA 2ZIGA 2FPPB 3I09A 4ZV7A 2ZAGA 4MAAA 1DJQA 1NW8A 1P73A 3QUAA 3M6AA 2Y6UA 4OL9A 4UBLA 3ZCRA 4Q3OA 5DEOA 1UBNA 3TMYA 4F3NA 5B64A 4L0MA 3ZEAA 2D2FA 5J2TA 3USZA 3CMCO 4HAYA 1IZ0A 3V4FA 4QXPA 3DEJA 1CR4A 3HNOA 3M34A 2CDRA 3PSAA 2EFEB 3ROTA 1M7GA 4DLVA 1J20A 2PYIA 2IV2X 3BSWA 3DB1A 3DG9A 3STHA 4A36A 2YV5A 2PZJA 1RLJA 1SIOA 2XWQA 4AK9A 2Y1DA 5BMVF 3PDUA 1LW6E 4WUTA 3GV0A 2ZWOA 4NPHA 2E4AA 4NENA 5KNLA 4AJ4A 3RTAA 1M6VB 3WGLA 2IOHA 3AHFA 3H2ZA 3WV4A 3KTAB 4MRMA 4BNZA 4K9PA 1SIUA 4CLXA 3L04A 4QU8A 3UO8B 4TYYA 1NUSA 5A1TA 4ZP1A 5BN5B 1Q1AA 3QTBA 5HRCA 3W5DA 3VBCA 2E89A 3PK0A 4YJDA 1A9QA 3Q2KA 2FZLA 4KK4A 3A1CA 3C3KA 3KQVA 3BJZA 5LYJF 1DAKA 3ODPA 1SOMA 2PV7A 1F60A 3MTQA 3PR2B 5AKZA 1G41A 4Z7NB 3G5AA 2QAIA 4B43A 3TGWA 4RBNA 1JEEA 2XT6A 3WMXA 5H59A 5BXYA 1RT9A 2R1VB 2J59A 4WZZA 2O19A 5B3JA 1R74A 2ZSEA 8OHMA 5LN1A 3RYCA 2PRZA 3LCVB 2Z58A 1IATA 4EFDA 4CPDA 5JH7F 1JUDA 2B61A 1V5EA 1NYRA 3F6BX 1LA2A 2VP3A 3G2OA 2QR3A 2XWPA 3OP1A 1HFKA 3W3AA 3BJIC 4FJ1A 5EIBD 3D6AA 3SSMA 1QQTA 2CFSA 1UDRA 3N6RA 4YJHB 1Y9JA 4W63A 4LXYA 2QY9A 1BE1A 3JZAA 2I03A 1RWPA 1OX6A 3M89A 4II2A 4PGFA 4U0JA 5FI1B 1BX1A 3OT5A 3R9WA 3TTTA 3CLUC 2X14A 3LUCA 4BNTA 2D8AA 1RI4A 3RFXA 4KR6A 4H15A 1Q3KA 1RNLA 1YZTA 3HBLA 4Q4HA 2A1UB 4QLAA 1H69A 5ICGA 3FLAA 4KQCA 2VPQA 3ORHA 2ETXA 4KPGA 1HE1C 3HDJA 4PZZA 2UYHA 5KTYA 1M8JA 5I7WA 3R7WA 2D00A 4IFEA 5I5GA 4ARVA 1EIWA 4MVXA 5KYYA 3KQWA 4QOGA 2AOWA 4PZPA 4BNDA 3KU4A 1BDHA 2P3LA 4Q4AA 1RWOA 3OCJA 4LF8B 2BGJA 3QXXA 5JADA 1VGQA 4CDRA 3Q2IA 3L4KA 5JVDA 4F4JA 2VRWA 3O73A 1E4EA 4X3PA 1XCGB 5COBA 5HE9A 3RJMA 5HOQA 5AVXA 2D7DA 1I6WA 4DTCA 2IYNA 4DCVA 3L7MA 4BKOA 5INTA 2IZOA 2ZPUA 2ZSUA 3X2SA 1STOA 1JECA 3ON5A 3KSUA 3FCXA 4BL5A 1M72A 4LQDA 5KQLA 3IP1A 1NZJA 1NRIA 3L41A 5BVGA 1LGYA 1KK3A 3Q8LA 4LOLA 1QRDA 1RABA 2J30A 2PVPA 3F5SA 4KQMA 4RZSA 4XR4A 4DN6A 3DF7A 1U0FA 2FWIA 3R6TA 5JISA 1QIIA 3OP4A 3DZHA 3SK0A 3UATA 1ZG3A 4Y30A 1NI4A 5CDFA 3FPEA 3OIUA 4ND7A 3S2EA 2RGBA 1TA0A 3TG8A 3E3AA 1M1NA 1A3CA 4FCWA 5ARBA 1BRTA 2PAFA 4N7MA 3NP9A 4A10A 2P3SA 3PDHA 1H0KA 3HN6A 4ENWA 3TSCA 4DVGA 2WVAA 4O2BA 4JN6B 5EHIA 2W6JD 4RTQA 2OO5A 3HXKA 4JBNA 3PLRA 3OUTA 4D25A 3K5HA 2IU4A 2PX8A 4KAFA 3L4JA 3G8CA 2CXTA 3TOXA 3D4BA 4ETWA 4PC7A 1NDUA 2ZXUA 1E6LA 3UPUA 2YYYA 3CYFA 2GERA 4UMVA 1C7EA 4ZQBA 1EQUA 2WJAA 1U3FA 1Z6AA 5SZJA 3ZU2A 3GAZA 5BNZA 4MQFB 3U0VA 2AHOA 1ZD8A 1ZRMA 3LHDA 4RSHA 4TMTA 4OI1A 3PLAE 1N33B 5BV8A 1BW9B 2WJ4A 4M1MA 5EFZA 1G64A 1ZGJA 3L46A 3ES9A 3EYAA 1Y1TA 3TDNA 3CRQA 1TM1E 1K89A 1DPGA 2Z6QA 3OZAA 3IQIX 3RYHB 3CR8A 2HCFA 4OB8A 4E70A 4RHTA 3EJWA 4JFRA 1WNTA 4Z0NA 3RBZA 1TQHA 3UY4A 1BCSB 4I50A 4K26A 2Z4TA 4KCGA 3V42A 2JHFA 1PT7A 1PT8A 2Q07A 1SHUX 4AN1A 3IXMA 1NMEA 1RZ3A 4FWBA 1YB6A 4OLJA 5GGXA 3FMOB 4M76B 1RJEA 4ZRNA 1G8GA 3RI3A 2E37A 4IUDS 4KZPA 5TEVA 4BMPB 4DDKA 4UTNA 1PQ4A 3D7MA 3W3AH 5BQFA 1TDJA 1AXGA 3ICOA 1F0KA 4XX0B 3MRTA 5JY6A 5KWIA 1OIVA 1V1MA 4UTOA 5B53A 4V0RA 4E2FA 1EUCB 2BTQB 2PD3A 1Z2OX 3DL0A 5MFZA 1R10A 1Q7RA 1DQSA 3V2GA 2O7RA 1EZZA 3F98A 1O5OA 1UT6A 4PGHA 5FQOA 5HE8A 2B1GA 2JLCA 2QW8A 1I3MA 3EPLA 3WYEA 2FZWA 3QEJA 4COKA 3LPNA 1BCRA 4FBGA 3B3GA 1IOLA 2H2IA 1BOOA 1SEVA 1KVSA 1QZUA 3DOFA 2YRFA 3ICWA 4V0SA 3SMQA 3SYKA 1UKYA 2OD7A 2WLTA 2Y0BA 1VJGA 3LV8A 3T1OA 4EDHA 1P91A 3R7BA 4ZAWA 2GN4A 2EFJA 4W7IA 1S2NA 2A9OA 4AZ0A 4WERA 3UAVA 5CXUA 4DV3B 1XT6A 3RUIA 2NO4A 3AFNA 2W90A 1UEXC 1YZFA 5BQPA 3VGPA 5AVQA 1NSYA 4FDVA 2IYRA 3EZ7A 5M34A 1PEKE 1W0CA 2P1ZA 2ZAOA 3DC7A 4JJ6A 1JVNA 4RTNA 2IYLD 4YRCA 5IEJA 2O14A 2L0XA 3WHLA 2LCIA 2P9EA 3AXSA 1Y9EA 1ESDA 3GCWA 4OY3A 3JQBC 2VL7A 2LVBA 4JB2A 2BAGA 5EXTA 4URXR 3I9V1 1VPTA 2BTOA 1YMVA 3W8EA 2FPGB 1RQNA 5ER6A 5EOVA 2WZBA 2HDHA 2QTVA 4EB6A 3F9RA 3TBKA 2I3GA 2NNLD 1GQFA 4FNGA 1HQDA 4CU2A 1MO2A 1G7SA 1DDIA 2JJ2A 4LSWA 3DFUA 4TTSA 2HEIA 5KKCA 2F59A 2BFBA 2GKSA 1KS9A 2L82A 3R09A 4FN4A 2EBHX 3AUYA 1SXGA 4CMAA 4EPWA 3LMKA 2I55A 3C41J 2HQSA 1CDEA 1V71A 4P3YA 3Q8KA 1EWKA 2Y92A 4ZTZB 2CUZA 4E1BA 3HTXA 4ZO6A 5BN4B 2QM0A 1ZHFA 2EJTA 1L1EA 1UQUA 3BKWA 4ZAXA 5JAMA 1QF9A 2X41A 2P6OA 1GRVA 1X70A 3I83A 3DWIA 2I33A 3H9CA 3CWQA 1PJ2A 3KZMA 3CJTA 4DUGD 2ZYIA 3BS4A 4R31A 4PSCA 4LF9B 2O7QA 2PH1A 3H4VA 4YRSA 5D6NA 1KERA 3AI7A 5FOWA 2FRDC 1C9NA 1U80A 1U99A 3GJ8A 3ZTTA 5D5PA 1GR0A 2KSQA 3DKPA 3WGUA 1GUZA 4ND1A 4U1RA 3EEFA 1KWKA 1XYYA 4TWRA 4V3CA 1AKVA 5BT8A 3WJ2A 2N47A 2VDQB 5ELMA 4DSZA 2EU8A 2WMOB 3FBTA 4ZHQF 3U7RA 1QC5B 4PQFA 5IFLA 4JLMA 4A0FA 1LY1A 1RAFA 5TQJA 4LJYA 5DM1A 2F3TA 2H1HA 3I05A 1BNCA 3QVMA 3ZZUA 1DLIA 3O21A 5F33A 5FPQA 2YFKA 1TW3A 3K4HA 1A72A 3S28A 4UD2A 3AHCA 2QN2A 5H80A 3GNLA 3BTSA 4NS1A 1Q0RA 2JGAA 1MJFA 3DL2A 2YBEA 1VL1A 3A70A 2M6KA 1NN5A 2VHXA 3CRNA 1HEIA 1CDOA 2JH8A 3D4IA 4TL7A 1P2UA 3REOA 4EHHA 5CVTA 1PFKA 1KI4A 2PMFA 1PQPA 3VYTB 3GT3A 4RFSB 1CK4A 4QATA 2ISCA 4F8JA 1EHYA 4P53A 4QXOA 2AZTA 2P0EA 1GRQA 3HP7A 3H0CA 4JOCA 4C0XA 5K01A 5KYWB 4XOUA 3OJEA 2VLIA 4AMBA 3H8JA 1KKUA 5C0OE 1XVVA 1GV1A 2J3JA 1Z4KA 2F9FA 1KJYA 2QUZA 5AJUA 1KOLA 3UN1A 1JKJA 1OUMA 2PRSA 3ESBA 3PNYA 3OPVA 1C3OA 4BQNA 5E1DA 2CSUA 4EECA 4DTIA 3VR2A 5IT5A 2JNWA 3AT1A 1RWVA 1FSFA 2H2DA 4QXMA 1GYQA 1Z3CA 3L0OA 1ENZA 5CA0A 3RFTA 4GL4A 3T0IA 4X7BA 5LVAA 1NQXA 3B9QA 2AIRA 3GLSA 4HG2A 2RHGB 1IDOA 3KV3O 1W75A 4TL8A 1B4DA 1YBMA 3QLUA 4PC1A 3NNDA 4EW1A 2FPIA 3F71A 2BEWB 4U7HA 4KTTE 4XQ9A 3OCYA 4ECAA 4I4TB 1FB5A 4DIUA 3NHBA 3HHEA 3JAWB 1GTJ1 2XYRA 2JKVA 3SEQA 3M2TA 3PRJA 4LG1A 3II6X 4WNCA 3AUSA 2QPLA 4K6MA 3WL4A 4EUKA 1P0IA 5JJBA 5K8IA 4FVTA 1HDZA 3OTWA 4IF6A 4YJ3B 3SZUA 4EL5A 1KY2A 2I3BA 1YB2A 3O9MA 1CETA 2CF6A 4L16A 4KSBA 5HZMA 1TM5E 2BRUC 2WWFA 3EHEA 5IH3A 5C7YA 1XRPA 1FUKA 3SF8B 4Z7OB 2NSJA 2X8LA 4R8LA 3QYJA 3SFVA 3C6MA 1E1RA 2JIZD 5FFFA 3OKFA 2P9YA 2OB1A 4YCAA 4QAQA 5HW0A 2JI9A 1V3VA 1XZMA 2V6BA 2JJ1D 3OZWA 2XF2A 4HVTA 4M7OA 3HCOA 4UKDA 1BSVA 5JPIA 1L5LA 4INJA 2QRUA 3Q1LA 4UUAA 3WA6A 5AK6A 1BRMA 1XVAA 4KFCA 4CMEA 5IABA 2AQKA 1U3GA 4FEGA 4HDNA 4J8PA 2ADOA 1JR4A 3DDSA 4N12A 1M76A 3LF2A 2GGSA 2HU5A 4FINA 2HF9A 2IGTA 3FPCA 1A1SA 4DDWA 1NQ5A 2GZRA 5JO0A 4JYPA 1YDFA 1YIAA 1ZISA 4LRUA 3L8GA 4A23A 2C07A 1IBSA 2Q3FA 3LXMA 2ODTX 4FPXA 4JLAA 4UM8B 1Q20A 3TE6A 3OEHA 3AY0A 2NTNA 2PJDA 2UZ1A 4IFTA 4KGVA 1H2ZA 2XVAA 3QWAA 2FEKA 4TYPA 1QO7A 1N7HA 4NPCA 1OH8A 2X9QA 3R6WA 4GU5A 1W0KD 2BHTA 2QR2A 3EXHB 3HH8A 2RFLA 1GFSA 3TTUA 1XZJA 3ER9A 4WN9B 1WHTA 3SOZA 2FP3A 4HVLA 3M5DA 1DBQA 1K8XB 1B2LA 1IG3A 1NBEA 1OI2A 1M2KA 2WG0A 4GLBA 4NYIQ 5DP1A 4WLFA 3DTVD 1GA6A 3R3YA 4I4LA 4L4SA 3ZC3A 4DE5A 3MEQA 5DFAA 4PAGA 4AAYA 1U8UA 2ZSFA 5SZIA 1V43A 2OORC 3AV0B 3CZMA 3OA2A 4ZQGA 1THTA 2EJVA 2FYTA 2M32A 3DZ8A 3R23A 4G24A 1XG5A 1WXDA 4OX9B 1VE5A 3HP4A 3UKDA 3MGBA 4EGQA 5DZSA 1G8PA 3K2IA 4WXPA 3UA3A 3C1UA 3LYHA 3MYYA 1RRFA 1D0SA 3IT2A 4AICA 1J90A 2RKOA 3GDGA 1VXOA 4IVRA 5IMBA 4ED9A 4BMZA 4G07A 3RVJA 1L4UA 1LRJA 3K1AA 1R8JA 1TKCA 4WY8A 1O3YA 1QCYA 2AZDA 1QVZA 2XWSA 3VNQA 5KVVA 2IC5A 3DYBA 3TNDA 1E5XA 1B41A 1UH5A 3MWKA 1BDBA 5B58T 3QEAZ 4LAFA 1C8LA 2HR1A 2X0IA 4CL2A 1BFDA 1WG8A 1E3EA 3JQGA 3PPVA 1RYEA 4XYEA 4RPKA 2VH1A 1VB5A 1NNI1 2Y93A 1SXJA 4LPSA 2P27A 1SOAA 5A4FS 1DJOA 3BWBA 4MP8A 3KLNA 3FSRA 1M0WA 4KO3S 3Q9UA 4GZ6A 4L5IA 3N8DA 4TSRA 4BV3A 4XIGS 1Y7HA 3B1VA 3C6BA 1T2AA 3DBHB 1CRWG 4FFPA 2JZOA 2B8JA 5T6BA 2O5CA 2BEJA 4RVDA 1P6QA 1N2BA 1V8OA 4D4KA 3ZGLA 1OMOA 3HKDA 4BUCA 5FAKA 4NQZA 4CL8A 1MQ9A 3WADA 1RJ9A 2WYVA 2WJ6A 5C32A 5L3VA 2ERCA 3P52A 2FG7C 5DYIA 1WB4A 1XDSA 2VYQA 4KRYA 3UV6A 1FUIA 4YMHA 2DG2A 5T4BA 3FVWA 3BL8A 3HXTA 3AGQA 4X91A 5FCDA 3P9CA 4AUNA 5JNTA 4DV7B 2O8EB 3U80A 3LHIA 3JAKB 2V65A 4MR7A 5F73A 4I4IA 3ZV6A 3E0XA 3PFBA 4UBNA 4P58A 3D0RA 2FG5A 3ZWQA 2AI2A 3H1FA 2C97A 2W2KA 4B3DA 2O52A 5BSKA 5ICMA 3MOGA 1F2UB 2FSGA 3TBFA 1RU3A 3WK6A 4REQB 3SLRA 5L9AA 4B3GA 2ONYA 4PS1A 3OPMA 4X64B 1EWRA 4YRDA 4F9GA 4A0HA 5JNSA 1NJ5A 2G9QA 2JF0A 2V7UA 3LYUA 3QIAA 1N25A 4PTLA 1NKSA 5BQ3A 2VP2A 4KRFA 1U0NA 3EBOA 4ZJZA 5AM3A 1IU9A 1JKXA 4YRAA 5IUJC 2XMSA 2GUWA 2VCHA 4MCJA 4TV9A 3AKEA 1JMVA 2WKWA 3ANNA 5BR8B 1DEAA 4YASA 5KC8A 4BNLA 3LZDA 3RAPR 2JFFA 1MOPA 3GJ5A 4MZXA 4RXUA 3I1JA 5EIHA 3SIXA 1AMUA 2CXRA 1HC7A 1ZCBA 1OWOA 2VHJA 4S2UA 3ZHUA 4TTTS 4DLLA 5ADVA 2ADFA 3ET5A 5J47A 4BMVA 3EZNA 2GRUA 2IZ7A 1PL6A 3I9V6 2GNAA 3NI2A 3QELB 1XAGA 2JATA 5FNVB 1ABEA 1ZK4A 3TNFA 4BNJA 1GVNB 1U7OA 2IUTA 1XQYA 3VC1A 2QYTA 4D57A 1KAHA 1OFGA 1ZR2A 2XUFA 1Y81A 2Q8QA 3BGVA 2BEUA 2WC1A 4KDEA 4GLOA 3WISA 4Q47A 4DQ0A 4XCVA 1ORTA 2C03A 1Y8QB 5TQ0B 3S2SA 4LXXA 5DCYA 1L4KA 1HX7A 4DIEA 1PFYA 2CJWB 1XU4A 1HDYA 2D2XA 2E3JA 1YVDA 5CPBA 1S1MA 1X1BA 3SJ7A 4ZI7F 4DT1A 3Q72A 4KGXA 1GPYA 5JZVA 3W5AA 3MCWA 1PK9A 1JZQA 3SHOA 3SG0A 1MTZA 4R68A 4R1UA 1YVUA 4KPUB 4FU0A 3IUJA 2XE6A 3B82A 3EZ9A 2V55B 2CE7A 2NT3A 1BG6A 4EPYA 5LM3A 3UJ7A 1GPAA 4U2GA 1N3LA 1RRPA 5L40A 1EBUA 2CNWA 4V2UA 4NBKA 4NKRA 2G25A 5FHRA 1EFVB 2QTGA 3FI0A 4BQPA 3UEOA 3IOYA 3WMFA 4GKKB 2BMVA 1WY5A 4QDXA 2D7JA 1W2HA 4JLNA 4P83A 4EVRA 3NM6B 4H0CA 4GPIB 1UM8A 5CA1F 1NU8A 1ESMA 3D59A 3I2GA 3OIYA 1IZ9A 4JLKA 2CE2X 4ZXPA 1DBRA 3E7PA 1KU6A 3X1KA 5LA6F 2RC5A 5A3RA 5EEHA 5J58A 3ZR4B 3CF2A 2BYTA 2RI1A 2W22A 1GD1O 2NT4A 1P74A 1ZGGA 2VAPA 4XGKA 1LLUA 1H8ED 4QYXA 2BL4A 2R96A 3HRHA 4ASUD 4NBUA 2Z0MA 2JIMA 2QMEA 2RAVA 4IKOA 2B5OA 1NZDA 1XTUA 3DFMA 4NU6A 5SZKB 3VH4A 1PR0A 3ESZA 5K9ZA 3LQ2A 2QM3A 3K72B 5IJ0B 2ZRBA 4LJ5A 3K9LA 3AOGA 3WICA 3I01A 4S0XA 5C35A 2QSJA 1VECA 3K16A 1JNXX 3E5HA 5B58C 5IK2A 4PRYA 3N1UA 3DF9A 4CNQA 1EVIA 1PAUA 1TJNA 1SU6A 4F86A 2PAAA 3AM3A 4KNVA 2QL7A 4R7TA 1ND6A 3DMDA