The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
62
|
sequence length |
165
|
structure length |
165
|
Chain Sequence |
b'STINYDLSRIKALAFDVDGVLSSTTVPLHPSGEPMRTVNIKDGYAIQLAVKKGLHIAIITGGRTEAVRIRFAALGVKDLYMGSAVKIHDYRNFRDKYGLSDDEILYMGDDVPDIEVMRECGLPCCPKDAVPEVKSVAKYISYADGGRGCGRDVVEQVLKAHGKWM'
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule keywords |
2-keto-3-deoxy-D-manno-octulosonate 8-phosphate phosphohydro
|
| molecule tags |
Hydrolase
|
| source organism |
Bacteroides thetaiotaomicron
|
| publication title |
Structural Basis for the Divergence of Substrate Specificity and Biological Function within HAD Phosphatases in Lipopolysaccharide and Sialic Acid Biosynthesis.
pubmed doi rcsb |
| total genus |
62
|
| structure length |
165
|
| sequence length |
165
|
| chains with identical sequence |
B, C, D
|
| ec nomenclature |
ec
3.1.3.45: 3-deoxy-manno-octulosonate-8-phosphatase. |
| pdb deposition date | 2012-10-08 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF08282 | Hydrolase_3 | haloacid dehalogenase-like hydrolase |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | HAD superfamily/HAD-like |
