4HGNA

Crystal structure of 2-keto-3-deoxyoctulosonate 8-phosphate phosphohydrolase from bacteroides thetaiotaomicron
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
165
structure length
165
Chain Sequence
STINYDLSRIKALAFDVDGVLSSTTVPLHPSGEPMRTVNIKDGYAIQLAVKKGLHIAIITGGRTEAVRIRFAALGVKDLYMGSAVKIHDYRNFRDKYGLSDDEILYMGDDVPDIEVMRECGLPCCPKDAVPEVKSVAKYISYADGGRGCGRDVVEQVLKAHGKWM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 2-keto-3-deoxy-D-manno-octulosonate 8-phosphate phosphohydro
publication title Structural Basis for the Divergence of Substrate Specificity and Biological Function within HAD Phosphatases in Lipopolysaccharide and Sialic Acid Biosynthesis.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
total genus 62
structure length 165
sequence length 165
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.45: 3-deoxy-manno-octulosonate-8-phosphatase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4hgnA00
1S8OA 2FUEA 2WF9A 4I9GA 2OYCA 2I7DA 5AI9A 2G09A 3OCXA 3WKAA 2R8EA 2B30A 2FDRA 5AKYA 2HI0A 5AW7A 1JUDA 3U7EB 2ODAA 4UM7A 3ZWKA 2IOFK 1L8LA 2YMQA 2HF7A 2W43A 2CFTA 3AR2A 4XE5A 2WFAA 4BX2A 3NAMA 4ZEXA 2HHLA 2P69A 3MMZA 3SHQA 1O08A 4OFZA 2ZOSA 3U26A 1RLOA 4Y2PA 2WM8A 4EENA 2I33A 3WGUA 3E81A 1AQ6A 3PCTA 1WVIA 3PGVA 5AK4A 4BNDB 5ALSA 1XPJA 2ZBGA 5ALXA 2C88A 2G08A 2VKQA 3UMGA 4UASA 2HOQA 5A3QA 3KD3A 3QU4A 5AM5A 3WK8A 4Y2VA 4YCNA 3BA6A 3IB6A 4NWIA 5AW4A 3W5AA 4CE6A 3F9RA 3NRJA 3E84A 3WK7A 2R8YA 1TE2A 5ALMA 4KX5A 4Y2JA 3OCZA 1IWOA 2FPSA 3EPRA 3M9LA 3ZW7A 4YGYA 4Y2QA 1TA0A 5JJBA 3WK4A 3I28A 3NIWA 1ZS9A 1YS9A 4Y2YA 5AW1A 4NFLA 4C4RA 3SF0A 3E8MA 2AUTA 3FVVA 3L8EA 1RQNA 4BYGA 4BNDA 3D6JA 5ALJA 1EK2A 4C4SA 2EARA 4DW8A 2QLTA 5AI6A 3ET5A 5AHXA 1RC8A 3UM9A 2ZBEA 2CFRA 4UM5A 4UMFA 1Z4PX 2YMMA 1L7NA 5ALNA 2JGAA 3A1DA 2YFYA 3RFUA 3NALA 4CNQA 4FE3A 3N1UA 2ZBFA 1U2TA 1ZOLA 3B9BA 4UMEA 4DWOA 4JDPA 4HGOA 1QYIA 4KNWA 2YJ3A 2AH5A 3N07A 3L8HA 3U19A 4HGRA 3WK9A 4KNVA 4OHFA 2ZXEA 2B8JA 2Q5EA 3QXGA 2DQSA 1CR6A 3QGMA 1U7PA 4RETA 2YBDA 3PDWA 1EK1A 1NRWA 2BDEA 3ET4A 5AK5A 1L8OA 3ZX5A 4YIHA 5AM2A 1ZD5A 2HO4A 3HYCA 5AIAA 2NO4A 3W5DA 3AR9A 4Y2XA 2C8KA 1ZD2P 1Z4JA 3OCYA 1CQZA 4XOUA 4QJBA 3NASA 4BEVA 4EELA 3SKYA 1K1EA 1SWVA 1Z4NA 2WF5A 4FYPA 5ALEA 3IJ5A 3QU5A 4NAVA 1S2OA 5AKXA 3OCUA 5AVQA 3U7GA 5AKGA 1RMYA 1O03A 4E88A 2OBBA 2C8LA 2RAVA 3R09A 4JB3A 4ZEVA 1J8DA 2R8XA 2QYHA 4GIBA 2P9JA 3ONNA 5AVXA 3OCVA 2CN1A 5AM4A 4HGPA 1N9KA 4H1WA 5ALFA 1RDFA 4DCCA 3L1VA 1MH9A 3L7YA 5AI8A 4HGNA 2NYVA 4FFDA 3J7TA 2RARA 4UW9A 3OPXA 5AESA 3R4CA 3FPBA 4O8CA 2EATA 5AK3A 1Z4QA 2FPXA 2IA5A 4J2TA 5ALIA 3B9RA 4EX7A 3ED5A 1TJ4A 5ALPA 3HLTA 5AVYA 5AK6A 2GHQA 2HX1A 3FM9A 1NF2A 4BEWA 4YCLA 3E58A 1RMTA 4NABA 3ZVMA 4UAVA 1Q91A 1U02A 5AKZA 3P96A 2FUCA 3B8EA 4BKMA 4KYTA 3A1EA 3EF0A 4HGQA 1LTQA 3OTQA 5ALOA 5AVTA 3I6BA 3FZQA 1VJRA 2PKEA 2W4MA 5AKJA 3I1YA 3SD7A 4UU1A 2I54A 5AW6A 3W5BA 3MN1A 4L57A 1SU4A 3N28A 4J03A 1NNLA 1RKQA 3AR3A 3IRUA 1KYTA 1QQ7A 3L8GA 3QLEA 3QU7A 2G1AA 4Y2TA 1XVIA 1L7PA 5IT0A 4EX6A 2Q4TA 4EZEA 5AM0A 1XP5A 3CNHA 5ALGA 4Y2SA 2YY6A 5AVWA 3AR8A 5ALUA 2PQ0A 1U2SA 3ZI4A 1WPGA 2B0CA 2P11A 4GXTA 2D2VA 1ZD4A 1Z5GA 1RQLA 2JARA 4KN8A 3AR6A 3ZUPA 5E0OA 1T9ZA 3DNPA 2RBKA 3NUQA 5ALRA 2FPRA 2GFHA 4ZEWA 3ZWDA 1YMQA 1Y8AA 2IOFA 1J97A 4CF4A 4PNHA 5AVVA 4MUMA 4UU0A 4UMDA 5IT4A 5AW8A 5FP0A 3WKCA 1ZD3A 5AKKA 1N8NA 5A3SA 3QUTA 3TLMA 3QUCA 5ALHA 2B1RA 3FPSA 1L7MA 1ZRNA 1Z4MA 2HF2A 2Q4RA 2G06A 2YN4A 3A1CA 5AIBA 4Y2RA 1F5SA 1Z4IA 1RPZA 4KX3A 3KDPA 3WK5A 2I55A 2I34A 2O9JA 1FEZA 2WF6A 3KZXA 2YJ4A 3I76A 1ZRMA 3N8GA 2G80A 1Z4OA 2R8ZA 2HEGA 2AGVA 4G63A 3S6JA 2AMYA 1YV9A 2G07A 4BX0A 1QQ5A 2B8EA 5A3RA 4L6AA 2BY4A 3W5CA 4Y3UA 3L5KA 5AI4A 3QUBA 3CZ4A 2G0AA 1PW5A 1YDFA 4NV0A 2YJ6A 2I6XA 3ZU6A 3QNMA 2ZBDA 5ALQA 4L6CA 2JAWA 5AVSA 2MSNA 5ALZA 5AI0A 2FI1A 4YH1A 3ZVLA 3SLRA 3SMVA 3ZTWA 5AKHA 3VAYA 3BWVA 2YJ5A 1TJ3A 2YMLA 5AVUA 5ALYA 4BBJA 4BX3A 1Z4LA 3WKDA 1YJ5A 2GMWA 2RB5A 2O2XA 3KOOA 5AW5A 1LVHA 1RKVA 1RLMA 4DFDA 4G9BA 3GYGA 2FPUA 3QU9A 1VFPA 3WKEA 3ZX4A 4YIKA 3MPOA 2B1QA 1Z4KA 3WKBA 3EF1A 5AKEA 3U13A 1RRCA 1RLTA 3NANA 2OM6A 5ALVA 4CF3A 1X42A 4HYTA 2WF8A 2B82A 2BDUA 5IS2A 5ALLA 3DV9A 1YNSA 4Y2UA 3N5KA 1U7OA 3AR5A 4HAIA 5AKIA 3FGOA 4AP9A 1QH9A 3ZVNA 4RESA 3A3YA 2PR7A 4OD0A 1SWWA 4OCZA 3WGVA 2JAOA 5AM3A 1WR8A 3KBBA 5ALWA 5AM1A 2GHTA 1L7OA 3U7HB 3M1YA 3ESRA 2OA0A 2HDOA 5AKLA 5AVRA 2IOHA 3L1UA 2FEAA 3UMBA 4EEKA 4AS2A 2ZG6A 3L0BA 1Z88A 3QUQA 3OCWA 3SKXA 3QU2A 1RMQA 4UMVA 4UATA 2IYEA 2EAUA 2WF7A 1ZJJA 4F72A 2JAUA 3ESQA 4XQ0A 2MU1A 2WHEA 1T5SA 1WZCA 5AVZA 4QQFA 2P27A 5ALKA 4IG4A 1L6RA 2X4DA 4MWOA 4UAUA 3MC1A 4B6JA 4C4TA 3AR7A 1VJ5A 1QQ6A 2W11A 4I9FA 2NO5A 3R9KA 3U7FB 1Z5UA 1T5TA 2HCFA 4XPZA 3DAOA 4IFTA 5AICA 4CF5A 3L0YA 5AW0A 2YMPA 2C9MA 2HSZA 3AR4A 5AI5A 2GO7A 4F71A 3QYPA 3UMCA 2CFSA 4YCMA 2FPWA 3KC2A 5ALDA 3WK6A 4AS3A 3L0CA 2C4NA 5ALTA 5T41A 5AW9A 1Q92A 3ZTYA 3K1ZA 3PGLA 5AW3A 5AW2A 3QX7A 4UARA 1RKUA 3DDHA 3L8FA 3RF6A 3EWIA 1TJ5A
chains in the Genus database with same CATH superfamily
4CT0A 1QIEA 1YS7A 4P7FA 4C87A 2VXOA 3IDZA 5AI9A 5LWHA 1L2TA 4K86A 2X77A 3OWOA 2WU4A 4UTOA 4FS8A 4UHHA 3LFTA 4KGVA 4QGSA 1I5RA 3PE3A 3D6TB 1U2ZA 1BD4A 4CKBB 1U0BB 2XNDD 5TSDA 2GYYA 5K6AC 1WZIA 3ZWKA 4QX6A 2GRJA 3ESBA 2XBMA 1KI4A 1TCBA 4CG3A 1IUNA 3D2LA 2O8FA 4B3HA 3BA1A 3T4UA 4R51A 1HOTA 1IEXA 5AWFC 2Y67A 4QQ8A 3F8WA 4NMLA 4CEJB 1GTVA 2Z9DA 3M82A 3NONA 2JH9A 4UE6A 1MQSA 3PX2A 4D7AA 4POOA 1J33A 2ZRKA 1RBZA 3ITDA 3SF8B 5TS2A 3W7AA 2ZROA 4N8SA 3I9V1 3LNTA 4YT8A 4IR7A 1OXBB 4WK4B 2AE1A 3OOSA 3Q3VA 4IS3A 4Z54A 5BN4B 4YRJA 5JQGB 3AL3A 4BAUA 1V7ZA 4YCAA 2QM0A 1UC5B 3LWNA 5AM5A 1DP4A 2RCYA 3O1JC 3O5AA 3T41A 4G0OA 4O1IA 4AKSA 3ZHCA 5TQ0A 4AX4A 3TLCA 2XXJA 3IPAA 2JAHA 4F2GA 4NBKA 1J5EB 2WRZA 3EH1A 2QWXA 3FYTA 1VHQA 1ECFA 5L51A 5A4AA 2NPIA 5B1EA 1SOAA 1V8ZA 4Q01A 1EVQA 3U7JA 2WTXA 1W5AA 4IRXA 1DADA 1CJUC 2ZPUA 4NH4A 4DMLA 5G0UA 4Z9AA 1U3VA 1C7JA 3PNOA 2JK1A 2R00A 1FDUA 4HSEA 5ARDA 2E6KA 4BMSA 3PCXA 4IQGA 1UQUA 3ZY4A 4Y2YA 1E3LA 3L7OA 2FSHA 2VPYA 5JVDA 2E5LB 1LRLA 3H0EA 3F6EX 2C2ZA 4FHZA 2XB8A 2PMDA 4HEQA 3DYBA 3OIYA 5K0LA 3FJ1A 5M29A 3KQQA 3GIDA 1DX6A 4JT9A 1L7VC 3IAS6 4QQKA 3ZWCA 4CCWA 5CDUA 3RC1A 2WSSD 3ELUA 4AURA 2AI3A 2BMDA 3NG1A 3NKFA 1U81A 4OMFG 4HT3B 1W6RA 5AHXA 3ACDA 2R6GA 3L41A 1ZK4A 2BKXA 2QIOA 4II3A 2IZ1A 1E1MA 3ME5A 4HN9A 3KZVA 1T0BA 2OESA 1NPDA 3HSYA 1GFIA 1JEQA 3QHQA 2IWHA 3OZAA 5ICGA 2DLCX 5CVUA 2PGNA 1EVZA 1V39A 4FYJA 4IWNA 2VHJA 4CNQA 1FS4A 1NN5A 1JWLA 2WM9B 1C2TA 4GLLA 4F3NA 4IKPA 1KI7A 1PKXA 4GPEA 4KMSA 3TOZA 4ENRA 2BMWA 2FH5B 3DXYA 3WGNA 3WGQA 4CIAA 1UEXC 3HO1A 2EQ5A 1AKTA 1QYIA 2OFXA 3OFSA 4JYMA 1ZITA 4L5BA 3RHZA 3KYDB 3JD4A 4MV1A 5HFJA 5L3ZA 1GPMA 4Y2GA 4D46A 4QJIA 4MW6A 2PGDA 5JNWA 1HTBA 3JRWA 5LKAA 5JNSA 4I50A 4RSMA 5DTRA 1T25A 1CWUA 1HZZA 2AFHE 4D43A 3ZLJA 1XWWA 1HYQA 3BQNB 4QGGA 3T99A 2QF7A 3HDHA 1QV6A 4GRDA 4FP9A 1OKKA 2BDEA 1G38A 1SVLA 3R3YA 2FRXA 2NU6B 2PWYA 3ENKA 4AU1A 1JQ3A 4YIHA 4CLOB 2LZ0A 1KKUA 3O4IA 1FJHA 3A2LA 2MJLA 3CT4A 3T7DA 5JS7A 3RIHA 3VR4A 4V0MA 3JYQA 1AM4D 1BU5A 3MS2A 1SA0B 2YNMD 2GNOA 3GJRA 3BDVA 1X38A 2GBLA 2VJBA 5T4HA 1Z2OX 2C5BA 3JZAA 4NNJA 2HFKA 1PP4A 4NNPA 3GC6A 1IBCA 1GRCA 3OF5A 4PX2A 3U4GA 2VPIA 4XD7A 1OHHD 2EG9A 3VH2A 4K6GA 3VR3D 2G9ZA 5KTMA 4FYPA 3ZV6A 2PUGA 4NATA 4BQNA 1IH8A 3GQBA 5FV7A 3P0IA 2XUZA 3LZDA 4G56A 4DMMA 2YCBA 5EE3A 4L8LA 2WU0A 2IGBA 3U3KA 2HUPA 1OE0A 1PUXA 2H2GA 5FJJA 2WYUA 3R6TA 3H04A 4E88A 2XXBA 1HYGA 3LPCA 1V5GA 4FXPA 4OFXA 5FBVB 3T1TA 3ZHXA 3IPRA 2DC1A 1JT2A 1GPYA 2AMJA 3B13B 2B99A 1A95A 1Y6QA 3IAM6 3NBUA 4GIBA 3UWDA 4C0XA 5JOQA 3ONNA 1JDVA 3DMFA 4PV7A 1M2VA 1U2PA 3DE5X 2YFHA 3W9YA 4DT1A 1TEHA 2XLCA 4DNOA 1YIAA 3HA7A 1G3UA 1O94A 2NAPA 3C3XA 3E3MA 3UEOA 1QV9A 4UNPA 4BQOA 3CO5A 4E3ZA 4LZLA 1E18A 3K6RA 3SHOA 4RXUA 3KQMA 3L7YA 5DW3A 3V1UA 4E2FA 3JVVA 1NC3A 3KKEA 4JLVA 5SV2A 3WO1A 4DM4A 1X7WB 4BP9A 1PFWA 4UPDA 5KTSA 4KXXA 1G7CA 5AUOB 2QYSA 2IDJA 3B1JA 1RYNA 4H3SA 2F9FA 1EVEA 9GPBA 3HVIA 1XZQA 3C8UA 2X6QA 3HKDA 1POWA 1BMFA 2JKVA 1OIVA 4QFBA 2EBHX 4CF6A 1IQPA 1YFJA 4TT3D 1R4MA 2P9GA 3CISA 4HOYA 5IYZF 4JXZA 1FC0A 2RHWA 3BGOS 3QVWA 5A4DA 1CY8A 1IAVA 2PKQP 3DVAB 4I6GA 4ARBA 3TE6A 3AU9A 3LAWA 3H19A 1ZGCA 3FM9A 1KL7A 2V7QA 5KNDD 3USZA 4UU8A 5J4VA 3IERA 1E4EB 3SZUA 3HCFA 4REQB 4MK4A 3UTCA 4OGFA 2R85A 4RK7A 2VI5A 5L4LA 5LFAA 3GLGE 4ZFNA 2UZIR 3PNSA 4TXHA 1UWVA 5G4KB 1GPWB 2C98A 2AJBA 1E2QA 4L22A 1WXIA 1WHSA 4INPA 2D0IA 3UG7A 1FYXA 2PMCA 2H4WA 3CTMA 2HN9A 4LW8A 1LF0A 1QHIA 3QELA 2ZTVA 5HZKA 4I1UA 4NEGA 3FYUA 3G0IA 2PRSA 4DLBA 2PUEA 1UPBA 2ZJ8A 3C3DA 4Z9FA 2VSFA 4KO8A 3SIPA 4IZOA 3TNYA 2OC4A 5I8ZA 3O3CA 4BLVA 2CSUA 3G2OA 5L40A 3W5BA 3IE1A 5FT9A 3ZE0B 1S01A 3K32A 1G8PA 1WQ4A 4YPFA 4HVAA 4IP0A 3HKEB 2PGXA 1MOZA 4D9JA 1L4BA 1SG0A 3GK3A 1EYZA 2D1RA 4IJVA 4ZRNA 2JRLA 3SG0A 4C2UA 4DY4A 4ZCLA 3WNDA 3JAKA 5I3ZA 2DRIA 1XTZA 1KI6B 1G66A 3UOAB 3EXFB 1KFBB 4MMZB 4N0DA 3FZYA 4X1IA 1JEDA 2DHEA 1Y5IA 1NTOA 1AF7A 3NVAA 1OAAA 3D4BA 2FWBA 1P91A 5KEIA 2VT7A 5D2CA 5EVJA 3DE0X 3V9AA 4LJ8A 1A9RA 1WD7A 4MRAA 3RM3A 5JYDA 4DCJA 1UBMS 2DFNA 4KXUA 4GMDA 4Z9BA 2V6GA 2XB9A 3ER9A 1R0SA 1XU7A 2PMBA 5T6BA 4D41A 3V8RA 5L4SA 5LP6B 4Y0AA 2QRVA 3GO4A 3NHPA 3KR0A 1A2OA 1JYFA 3DYVA 3QFTA 2R86A 2OVBA 3KTFA 5ELLA 1DX9A 3HGTA 4LJ5A 1GAQA 1P39A 3DP9A 2ZWAA 2Z04A 1W93A 1T9HA 2GVDC 5E95A 2BLLA 1MRNA 4JI6B 2QQ5A 4X6LA 4YT2A 4HAUA 1N8TA 5FPSA 4Q1EA 2PS0A 4B82A 3ASUA 2R60A 3THXB 3ZJUA 2RHLA 4X1YA 2Z5FA 4PR0A 4RNCA 3X43A 1PBTA 1UZMA 3SLGA 1UKZA 1HNNA 2VF7A 3AV0B 3BQ9A 4DLYA 1C8LA 3NWBA 4GVPA 1V45E 3SQNA 2OHOA 3HU3A 5COBA 3QPAA 3ZUGA 4Q5IA 1K3UB 3RWMB 3ND6A 5LIPA 4HTFA 1MUUA 1ZHHA 4N8EA 1LCIA 3R7SA 4C0WA 4X61A 2O3JA 2OSVA 1YJ8A 3EZXA 3PHIA 1L4MA 4NK5A 3BH7A 1JJFA 4TWIA 3O31A 4EDFA 2I34A 2NXNA 1OBVA 2YRWA 4D0SA 4ALLA 4EB0A 1ZRHA 4DOMA 3R3HA 5CNMA 5E38A 1LX6A 4IDPA 1FX0A 3P0JA 5A4MS 1QIHA 1V1MA 4EG4A 1MEOA 2HEGA 5TMDA 3KTAA 1WY7A 3BZBA 3K92A 3I73A 1EDEA 5IUNC 1N5JA 5IYZA 3CRMA 4JKIA 1Q16A 1JHUA 2PKCA 2VK4A 4MVCA 4EHIA 2VA9A 3TIVA 4S35A 4Z3KA 3EC1A 3GROA 4NZ9A 2REQA 5LOVA 2FCRA 2ZRIA 3O8OA 4GP6A 2CMFA 1IZ9A 4HQKA 4RV5A 1DBSA 4TSFA 5FOQA 1Y8RB 2H07A 4D3YA 4Z1MD 3DE4X 2RJOA 3CINA 5CFZA 1PW5A 4HDKA 4PTZA 3IPXA 8ADHA 3LLCA 2AC2A 3C3CA 3ZU6A 1VHLA 4FBGA 4JBLA 4LHXA 4LGYA 2P75A 4PM4A 2P65A 3GT3A 1C0LA 4RZUA 2XODA 4WQMA 2PAFA 1J1UA 2XCIA 1YUNA 1FYEA 1YFZA 1C0EA 2JZNA 2YDXA 4NF2A 3LIIA 2A4MA 2OCIA 4LOLA 1E9AA 5LBUA 3BTUA 3DV0A 1FDWA 3M81A 4KTTE 4IAOA 4U7PB 3DUFA 3LFHA 2H16A 2OPHA 2VYNA 4RK4A 2JKYA 4RIGA 2GN4A 4KH0A 4PAGA 1OT3A 1TYBE 2PLFA 4BMOB 3CEMA 3RYIB 2GHIA 4GS5A 2OG1A 4Y6QA 3CUVA 3LSYA 2Q5QA 3FNGA 2B3DA 4IMJB 4JBHA 4O4HF 5EIXA 3TW4A 1NZDA 2IKSA 3G7UA 1J7JA 1M66A 3DMTA 4GMXA 4OJQA 2PNJA 3T1QA 5CDFE 1UQTA 2H5JA 4LZWA 4P7KA 1U11A 1WE2A 4DIFA 1QR2A 3CO0S 3URMA 3V4VB 1IZYA 3U39A 1HA3A 3NHRA 5B37A 5I9TA 4TQAA 1FUEA 1VRWA 1YZ3A 2G04A 4QNRA 4FNAA 1O57A 3WGKA 2JA1A 4J90A 2GNPA 2PYZA 3VU1A 5I01A 3SEFA 1QAOA 2NV2B 2OM6A 3X2EA 3P19A 3EQ8A 1WETA 4BLPA 4R71A 2CNKA 3AZPA 3N76A 2HQOA 3C7AA 1DDOA 1E3DA 3AC0A 2AIRA 5KKNB 5KWIA 5DKFA 5GIPE 1USKA 5LD2C 5ALLA 2GN2A 3PDCA 5K5EA 3R5SA 3PTAA 5AOVA 4UBJA 4S24A 8LDHA 2XCOA 3RJMA 4CV0A 4F9TA 3JVEA 4OI2A 1EIZA 3D6NB 3AJRA 4EHDA 1VMAA 5CAEB 4OH7A 5BV2P 2CWWA 2EP8A 3HYTA 3MILA 3LU1A 3PU6A 4IDDA 1WR8A 1E0SA 3IO5A 4RZIA 5CLHA 2IYLD 4MIYA 5EFOA 2OFOA 4CKZA 1NF9A 1N6LA 5DEOA 2A9PA 3G68A 3SQXA 3FDZB 1LA2A 3TNLA 1FP4B 2QY6A 3RQIA 2J87A 1XJQA 4KN9S 3BK1A 3C3YA 2V0NA 4OV6B 1SELA 3K05A 4F8EA 3CGWA 1SKMA 4ZI7B 1ZL2A 3K9WA 2VDKB 2VJQA 2WP8J 1NVEA 1NASA 3D59A 3UGTA 1TAHA 3N2EA 4FN4A 4JK3A 5A2GA 3U6BA 2P6UA 4XIFA 5DX1A 5LMUB 2G4LA 5ARBA 1E3SA 3INNA 1RMQA 1MX3A 2RJNA 3LLSA 1WBJB 3NUGA 4F5DA 3ND8A 4ZHQF 5J5CA 3PPXA 2HR1A 3NHWA 3KJHA 2A57A 2C9BA 1GFWA 1DKNA 3BRSA 4MWBA 4PBRA 3UAYA 3GEEA 4HLCA 1PVVA 1OH6A 3OM1A 2X14A 3EBOA 4BMPB 2Q2OA 4WCDA 3RSCA 1X1RA 4A7PA 1TF5A 5KJ1A 4HDRB 2CLMB 1F1BA 2YZ7A 3R8FA 3VDRA 1RPAA 2W2LD 3BHNA 4PQYA 4TM8A 3ZJYA 3KKQA 2B20A 5FR2A 3R3JA 1T15A 3QY0A 3EZLA 3M7IA 5I7FA 5K8TA 2A7QA 4NONA 4CI0B 1G20E 1B4DA 4KQFA 4MLDA 3U0VA 4EUNA 2BGLA 3WV4A 2GD1O 2ECQA 4U1RA 1PI3A 1N1EA 4JAVC 2GEVA 5EIAA 2OFFA 4YJDA 1A9QA 2P3OA 3COPA 4MARA 4ZGWA 1ZAYA 1W5BA 5D00A 1IG0A 1CQPA 2GGSA 1HT0A 3I6QA 5C3UA 4F71A 4OM8A 4MINA 2HKIA 4F04A 2OXIA 4M87A 1Z8FA 3USES 3I37X 1QB7A 3NDIA 5C1PA 2R8RA 4XRRA 4KFTA 2G8NA 3IP8A 2EP7A 4RK6A 5DW0A 4C4OA 4ZK6A 2PO7A 3PUIA 4MPDA 8MHTA 3WK6A 1SU8A 4B3MB 1CDZA 2R48A 3HS3A 2VDVE 4EEXA 4I55F 5ALTA 4BWGA 5IKMA 1P2FA 5CHYA 3O1LA 4YQZA 3IHWA 4ZI5A 5BOSB 4FSHA 4L5YA 1Q92A 1MV8A 3WICA 3JVDA 2RHMA 4QXPA 2Q41A 1NJSA 2P9TA 4YAIA 5KYKA 2FPIA 3OAAA 1YASA 2B2CA 4DXHA 3WP1B 5C35A 4M54A 1TJ5A 2QS9A 5G2OA 1LNSA 1K4MA 5FTKA 2WF9A 2NADA 4IIJB 4YP9A 4DWJA 1SR8A 1SC6A 1P5HA 2CZQA 1O97C 4LSGA 3OTGA 3IOEA 2ODAA 3AHJA 2CNOA 4CTKA 3GPBA 4EKGA 2YMQA 1BIFA 1ZI9A 3G1TA 4NIMA 3WDLA 4AVYA 4ZYVA 3JU3A 2CL6X 1P2GA 1UM9A 4WLFA 2RK3A 4U9UA 2C1ZA 3AR2A 3OTIA 4UE3S 4ZEXA 3DHVA 2QZ4A 2FN4A 5GJBA 4HH1A 5TPWB 4QUAA 2ACVA 5AOAA 4MB0A 4RVCA 2P6NA 2MR6A 5A9TA 1ZN9A 1XAGA 3C4JA 3N9IA 2WM8A 3TIXB 4URVR 4EPXA 4NCAA 1FRFS 2CCGA 1N57A 4KIFA 4W1QA 5DZSA 5HDBB 3ZZ1A 4IYJA 5HW0A 1I7DA 2H00A 3GT7A 2HHAA 4D1YA 4MS4A 4I9NA 5KINB 3KFXA 4NJEA 1EFPB 4YXWA 2ADOA 4V1CI 3WG9A 1B8PA 2R8PA 3R41A 2NXJA 4UNNA 2XCTB 1RBMA 1DKLA 4M8KA 1YBHA 2II6A 3AM5A 3E1KA 3K5WA 1XNQB 2ZM6B 2WICA 1SC1A 3CX3A 2HLNA 4B3DA 4B17A 1N2CE 9ABPA 2IYRA 3BB3A 3BERA 3L3BA 3OPYA 1I94B 1GU1A 1DEKA 2PPVA 1Y9AA 1P2DA 2LPMA 4XIYA 1M73E 4ZVMA 4Q3OA 1L5NA 1OKKD 2OSBA 2C2MA 3MRVA 4JI7B 4TMXA 1QZ3A 4DKJA 1M1XB 4UEOA 4UNIA 1F3OA 3AKYA 1MEJA 4Y2JA 5FBQB 1NG9A 1SBYA 1LPSA 2WWFA 2B6HA 2NUBA 3EPRA 3KYIB 3GN2A 2DPHA 4LE0A 4ZVKA 3VR4D 3OX2A 5J58A 4AJPA 1QRRA 3RK0A 1G9SA 2I62A 1KO7A 4Q82A 4BASA 4RTKA 5JDIA 3NIWA 4FDTA 1J4AA 4LXUA 1U99A 4MKZA 1SUDA 1U28C 1X86B 1YI8A 5EOVA 5KYUA 5KKCA 3IHLA 1LJ8A 2IV2X 1C4WA 5C9ZA 1AUXA 4I5GA 4XD7D 2W83A 1VMEA 4M8IA 3FWYA 2OYRA 4C4SA 2OHHA 1B15A 2PMEA 3AETA 3EAQA 4GKJB 3PUVA 1VBFA 3H3JA 2XITA 3DOOA 4LDAA 3WGYA 2OHIA 5DV9A 1DKRA 1XJWA 3HCRA 2ZS7A 3O2NA 3THYB 5IVHA 4DRYA 1QF6A 2XF2A 2YMMA 4H7PA 1E3WB 2JGDB 3MOIA 5DI9A 1II0A 1OW3B 4I4IA 3TLBA 3TLYA 3GZNB 3R7LA 4BFXA 2HA0A 3ONVA 4M1WA 5A06A 4A2PA 3HABA 3STWA 1DO2A 3GP5A 5LMZA 4NBTA 3R5XA 4IKEA 4KLCA 1K7CA 1O94D 2E0IA 2BHRA 1P0PA 3W5HA 3EMBA 4N40A 4G84A 5CFQA 5JBNA 1Z5OA 3LKDA 3IEKA 5JPCA 5IASA 2C7OA 1IY8A 1HG1A 1QK4A 1MMFB 1M5UA 4HAVA 5H3CA 1ZJZA 4D0NA 4AMBA 4Q4LA 2FAXA 5AD1A 1Y1TA 1ZGAA 2Q1XA 1UODA 1HDZA 2AQKA 3ANLA 4RMNA 4R7GA 2QTGA 5F7JA 1W36D 3WL4A 1M72A 2PA3A 3PXGA 3BSWA 3WLTA 1VLMA 1BMFD 4WKNA 1CVLA 1KAQA 1QTIA 1G21A 2A88A 1NSYA 3IUPA 1P2TA 4MVJF 1R8QA 1UP7A 2EGHA 1JDNA 2AN9A 2IEDA 2HO4A 2RHTA 2CKMA 3P0FA 4FBLA 3ZGXA 4L73A 1ECPA 2FPGB 1ZI6A 2BT4A 2HSEA 2WNIA 5IRCD 1R9JA 2V7QD 4YACA 2WWTA 1DMSA 5KZMB 4C1NA 1YFKA 3DO6A 3INTA 4C4YA 4Z0TA 2DYKA 2ZYUX 1US8B 2AL7A 3NYRA 1THTA 2A0XA 2C4KA 3O92A 2G70A 2ZUBA 5CG1A 5DBOA 4IDCA 1K1EA 3R7NA 1I4LD 2VL7A 4LNAA 4B33A 1Z4NA 4KYUA 4P4NA 3R7FA 2Q3HA 4KN6A 3ZOZA 4F3YA 4BVGA 4NAVA 3MTGA 1Q7EA 3FPFA 3PFIA 2RHRA 1TUEA 4HAWA 3OZIA 4RS3A 3FE2A 2SNIE 1T43A 3JQ8A 4LQCA 1BFDA 1XA3A 1RRFA 1BRTA 1ZK2A 1ETHA 2X13A 2HV9A 5I4KA 1KH1A 1FY2A 2QZSA 1VYVA 5BNFA 2PWAA 4F4FA 4TMWA 1FRNA 3K30A 2A0YA 5JNLA 5AM4A 5JROA 4D79A 1X19A 4L8WB 2N42A 5C2JB 3WLPA 7MHTA 3ZNPA 3K1AB 2ZZKA 4CBVA 1U2DA 2PL9A 1ZNXA 2PT9A 5EJ6A 1KZ7B 1K8RA 4Q4AA 2P9ZA 3RUEA 1BCSB 4PZ9A 3UXEA 3MF4A 3D3WA 1JG7A 4QG7A 3KOWA 3K2IA 2OV4A 5DGDA 5FBRB 5IVKA 2B61A 5SY6A 3VHQA 1EFUA 4TZKA 3D1JA 1KDYA 1GOTA 1NRXA 5AK3A 3L82B 4OAQA 4PYIA 1XAHA 3PDUA 3ROEA 2AYYA 2KBFA 2VATA 4OAPA 4UUQA 4KBYA 4CLRA 2BRUC 3ND9A 3RSLA 4MV0A 4CQMB 2BHLA 5KNLA 1W9HA 4KFUA 2FZWA 4US1R 1U0JA 5A3VA 3TRJA 4KV7A 1GLVA 1EGHA 1NU8A 2JJ2D 2LDBA 1N2SA 3HU5A 3PJEA 2BBWA 1AB6A 3NC4A 4UXHA 4ROSA 2IW1A 1I4EB 1CEEA 1NG1A 2BHSA 4TQGA 4CYMA 4ZMSA 1DKOA 3ZHYA 4LWPA 1JG6A 3HKBB 4O29A 1CS0A 2AF4C 2D1SA 2OZEA 3PGMA 4DMKA 1V95A 3NRCA 1HNXB 4C5BA 4GI3A 2AR0A 4TYMA 3RHSA 3AILA 2IGTA 3ITKA 2VQFB 3VPGA 1GGNA 3UPDA 1EB8A 3H6GA 1K7FB 3FUCA 1NWCA 3DOUA 2ZWPA 2AFIB 2ZATA 3KPWA 3MJFA 3PEUA 4M89A 4V1CB 4HGQA 1MNQA 4X8LA 3ES9A 2JA2A 3DAHA 4PZZA 5EZYF 4YMVA 1YAHA 3Q3IA 4PHGA 3VPFA 1T5BA 4LJYA 4DVJA 4H16A 2ZREA 2W4MA 2Z2ZA 4RY8A 5JANA 5JRDS 3T1HB 2YNMC 3OKFA 3EFBA 3T3GA 4Q15A 5GY7A 5KMGA 3E9NA 4JOSA 5JO0A 4F6CA 1FUKA 4GMGA 1JZTA 2VOEA 1KI3A 221PA 1QQ7A 3L8GA 1A9XA 4MMXB 1E1NA 2REBA 1SKUA 4EZBA 1L5SA 4HPXB 2YWGA 5TLSA 3CR7A 1OFGA 1TNDA 1QNLA 1N32B 1J56A 4WLUA 4F4UA 1BE8A 2QGFA 1L5ZA 4UBOA 4XKJA 1RI1A 2W2OA 4Q1AA 4NBWA 3VVCA 2FK8A 1ECBA 1W48A 4EHNA 4K2HA 5IWAB 4TSRA 2EFJA 2QEQA 4QYIB 3UY4A 2NTYC 3TVYA 3LX5A 1GR1A 4M76B 4CETA 1U2SA 3KAQA 3O73A 3PLRA 4TSFD 5K3DA 3ZIDA 1ZEMA 2PS1A 3GVIA 5CVDA 5LMCA 3A11A 3EODA 3DHWC 1TJPB 2HWXA 1ZD4A 4ZK2A 5E4YA 3W0LB 5BR7A 2PLWA 5BWBA 5EA2A 3LVRE 3OPVA 2XAAA 4ALNA 1RKXA 5EQTA 2JLWA 1HKHA 3DR5A 2QSJA 3HP1A 1T1IA 2QD2A 3DNPA 3WRWA 5KYNA 1ULHA 2PZGA 3BUSA 3H9BA 2H51A 1HETA 5CT9A 2FUG6 4IIDA 1W0JA 5FUVA 1BKSB 2G6BA 1GZSA 2Q5IA 2YOFA 2DBQA 4FT4A 1BEUB 4HX9A 5FA8A 1S0UA 1D03A 1Y8AA 3W04A 4CF4A 3O8QA 2FKAA 3AW8A 3K20A 4YRDA 3T0GA 3DW3X 5B3AA 3EIEA 4OATA 2VYND 3OJXA 2QAGB 4H4CA 1YB5A 2JJ8A 1WXEA 1N6IA 4LYJA 4EJ6A 3RVPA 4W9RA 4XWTA 1JFFA 4ZT5A 1JR3E 2UYHA 1H0HA 4V0RA 3BWEA 4MGYR 2GZ1A 3P26A 5L6LB 4EFKA 4FGSA 5TJ9A 1TZJA 3LQQA 3RU7A 1UK6A 2H18A 2JJMA 3QQ5A 4KMOA 5CNJA 1GL9B 3MB5A 4QTXA 3ZE6A 3WRYA 3ILHA 4ZCQA 4W5NA 1ZEJA 3AJEA 1ISRA 1PJBA 2QRUA 3FI0A 3NHKA 4GP9A 3D8NA 4IJ5A 1NE7A 1SB8A 1Z4IA 3BF7A 4I08A 4ZEOA 1P7PA 4S0XA 2RK4A 3KPVA 4EA6A 4LISA 1SVSA 3TUJC 3RIXA 2RHCA 1FEZA 1ORTA 4L75A 3QEKA 4BATA 1KWGA 2D8MA 5EIOA 4IIXA 4DLSA 4R3WA 5H3HA 2IHKA 5C1BA 1EI9A 4QXMA 4YRFA 4E4TA 3GGJA 4WK6A 5ENZA 4DB4A 2RGRA 2QIPA 4CKXA 1V4VA 1K5HA 4ID3A 4M4SA 2IIQA 4CMEC 1C30A 2PXHA 4JXJA 3IQHX 4BN0A 1K9VF 2V8OA 4UOQA 1PJCA 4WVFA 5ICEA 4JLUA 5SZKB 4HEA6 1NDQA 3PXUA 2J6BA 3FTDA 2G71A 5EGNA 4UCWA 1U2GC 3TYXA 3BIXA 5IM5A 4RQBA 2CL0X 3AHFA 3LX6A 1WMDA 2DLDA 4Z2YA 1SZJG 1PJRA 3O7MA 4ZOLB 5ALQA 3BL8A 3GP3A 4YP5A 3WWYA 3X1JA 5EZYA 3DD5A 1L7RA 3DR3A 2GFQA 1GGFA 4S2UA 5ALZA 5HQ3B 1H0SA 3S8YA 4GZLA 1Y33E 1XOIA 3LUCA 4CM8A 2VH1A 1MR3F 4ALJA 2QVCA 4RGVA 1J2UA 5ECGC 4BO3A 1H1DA 3SX0A 3UJCA 2BPOA 4RJLA 2YJ5A 4WN9B 3LO5A 5J59A 4BJ3A 5CUQA 3WJAA 3OQVA 1SCUA 1UAGA 1VGVA 1KTVA 2GMWA 2QW0X 2O2XA 1T2UA 3TMYA 1YB1A 3I4LA 3SSNA 4CIYA 3H1FA 3CEHA 1OFUA 5KVAA 5A6SB 4F1JA 4MUXA 1U4SA 1D0VA 3GYGA 4L5CA 1FTGA 1VFPA 4PLCA 4BQIA 1KI2A 1I4WA 1XL1A 4XM2A 4ZAYA 3CU5A 2CVQA 3A4VA 1KBZA 2WLTA 2Y2VA 1QP4A 3IBFA 1K8XB 4QEDA 4K9RA 3GLUA 3IXLA 2JZCA 4HDAA 4CF3A 4ND2A 3L40A 2O6HA 1FYDA 4DV0B 3AF0A 4I4TB 4URUR 1MGPA 3NR2A 3OQHA 5EUMA 3PQDA 2F67A 5BVGA 2I2CA 4UAJA 5JYBA 1J42A 4ZT2A 3A4YA 5EP2A 3R7WA 4M21A 2WYWA 5DOVA 4AZ3A 4AM8A 4MW4A 4RD4A 1PGJA 1Y7TA 4YDHB 1KBOA 5DM1A 3ZK9A 1P6XA 1P31A 2FSVA 2VNJA 4HJXA 4MJXA 3AI1A 3JVIA 3ZCSA 4HAZA 2IXGA 2J3DA 2W00A 3RHFA 2KLBA 2OWEA 3ERCA 4J1SA 1YS6A 5AM1A 3AI2A 1BXRB 1WTAA 3PA8A 4QJ5A 3RIGA 1W35A 4D92A 4GBMA 1S3SA 4F85A 1Z13A 3BX1A 1VIYA 2Q5JA 3HCDA 1KIAA 5CT8A 3TR5A 1VECA 2BM0A 1LQTA 1LBHA 2CLHB 3VTKA 2WUFA 2UU9B 5L6MB 2CXOA 2ERXA 1CULC 2GCIA 2ROQA 3BG5A 3GELA 4KR2A 2ID4A 5A4FS 2ZI7A 1DBQA 1Y4UA 4WK0B 3TAHA 1T9BA 3MRXA 3RLFA 2I3AA 3WGHA 4N3BA 2ZULA 1CZRA 3JZMA 4GOLD 5LBTA 5CW2A 2HJRA 4QT0A 2JAXA 1ZQ9A 3WWPA 4JP2A 5JFOA 3EZYA 4UCFA 4DEYA 1MJFA 4F72A 2VQDA 5B58C 3H11B 1LKZA 1P5JA 4R2JA 1G98A 1Q1BA 2IEIA 2GK4A 1LTKA 5F2EA 1BE0A 1OCEA 3DEAA 3PB3A 4QVKA 1Y81A 4MUIA 2Q1SA 2EW8A 1YL7A 1RQPA 1QIMA 3G7NA 1BX0A 2QN3A 1H23A 3I9KA 4LC9A 1NLYA 1XXLA 4ZDIA 4RF4A 4RTSA 3OMWA 1LY1A 4PN7A 2JGKA 1I6WA 4ILKA 4Y9SA 2XGGA 2VF5X 2XI4A 4QBGB 4LF7B 4GYKA 2RGWA 3QHPA 4BDTA 4F2DA 1Q19A 4YXWD 4BNZA 3KJGA 5K4HA 3IXQA 3GLSA 4ZVNA 3KUUA 2Q6OA 1ZP6A 2C5HA 1GDDA 2ISQA 3R76A 3ZI7A 4HQFA 1E7WA 1LWNA 5GGYA 5HX7A 1IZ8A 2OGUA 1OREA 1KQ3A 2WM3A 3BZWA 4L72A 4ZO9A 2P1ZA 3FFXA 4QC2A 5BVHA 1ABEA 1UF9A 2NXWA 2WUVA 4P5PA 4A0FA 4G25A 2I71A 4RZSA 4O3FA 4BMXA 4CMIB 3WHLA 1O9GA 3FUTA 5JSZB 1SC4A 3I2JA 2Z9CA 4NESA 3PR2B 1RJDA 4YC7A 1HV8A 1HQDA 2KE5A 3PVSA 5E4JA 4BQRA 4BP8A 2OHXA 2JDIA 1SQGA 3JXEA 1RPJA 4FFVA 4P4SB 1DPGA 3AL0C 1IBKB 4ESOA 4NVRA 4FR0A 1XMSA 3CWZA 5AW3A 2C3OA 4IUDS 5BSTA 3PQ3A 2ZSDA 3NT5A 1XZBA 1T2CA 2VQEB 4XGQA 2A78A 4I1IA 3EWIA 3LXMA 2FOLA 4W5JA 4XUCA 5ULLA 2HWKA 2IYFA 2BTOA 3FWKA 5DYWA 1ADBA 1ZMRA 2A0FA 2MR5A 3CPJB 5TGZA 3RARA 4AY4A 3GPCA 2F3TA 1KJYA 1T29A 1YZNA 3T9DA 3BCSA 3DC7A 5FI3A 1NQTA 2F3QA 4DABA 3HXQA 1PIWA 2ZUUA 5AW7A 1Y7LA 5KO2A 4LS3A 1WEHA 3MJEA 1HFWA 4R2HA 5E8JA 9LDBA 2ZTSA 1MX1A 1DPFA 2GJ4A 2ZDHA 2NTVA 1ZD8A 1XXHA 1N2BA 3G2KA 4QVIA 3LLUA 1GSAA 3EEBA 1D4OA 5FWYB 3AM1A 1MO4A 4BX2A 4KIUA 2IYTA 1A4IA 2LCIA 2LIPA 2P6OA 4QPCA 2CXHA 4UEQA 4J9UE 1X87A 3C41J 1QYDA 1O9HA 4ZCRA 5E7MA 3GJTA 3FFBA 5KDOA 1SOMA 2B7LA 4Y2PA 3Q15C 3TOSA 1DRUA 4HDNB 2I9KA 5CX1A 2NU9B 1HSZA 3B6MA 4KAJA 3TFQA 3WYNA 4BGIA 3CPEA 5CB4A 1MRSA 1XRMA 3BWBA 3VR6H 4MP6A 1XMJA 2ZITA 6GPBA 1TKCA 4BNNA 3DT8A 2DTEA 3FMGA 4F6LA 2YWXA 3G2JA 1CJTC 2W5UA 2Z2JA 2FN3A 1EQUA 2A9JA 1W52X 2BFFA 2J7KA 1O2DA 2WK1A 4MMYB 2ZSEA 2HC9A 3IB6A 3RU9A 4BE7B 6Q21A 4YJHA 3MLBA 5EJMA 5TC4A 4G9EA 4CFSA 2BUCA 2VTBA 4D4MA 2ZIZA 3LT5A 4RVOA 2ZW9A 1MT3A 2W2TA 1FPMA 5J3JA 1YDMA 4B8ZA 2QENA 3AIMA 3ADBA 1PL0A 5ALMA 3N7TA 1VPDA 4L1KA 1FU8A 2ECFA 5ADVA 4JUBA 1EFCA 2XWBF 3BMOB 5DO9A 3RASA 2DR0A 3U17A 1F1JA 4JVLA 1NN1A 1DEOA 1Q95A 3EW7A 3V97A 4ER0A 4JDUA 4N3GA 1HE8B 3JWGA 3TPZA 3I5XA 2WJYA 1EA7A 4MUBA 5BY2A 2J6HA 2NU7B 2P2YA 5JAQA 4MUGA 1MF7A 5HILA 1U5BA 3TQTA 3ZBUA 1LX7A 2BMJA 2BFDB 4DV6B 2PXCA 3JQQA 4BNDA 2CW5A 4DVGA 4GP7A 1M2NA 5EHNA 4S0ZA 1X2BA 1TU3A 2JLYA 1T0PA 1UMCB 1ZIYA 2FB9A 3UQZA 5J9FA 2EZUA 4EABA 4NK4A 4EUEA 1U0OC 4JFRA 3TTTA 1KDRA 1U04A 2BGNA 1Y5LA 4Y67A 3IVCA 2X7JA 3RV3A 3DKIA 1JLLB 1I2AA 1WDTA 2QDKA 3DCNA 2YIVX 4UNSA 2UVPA 3L7JA 1VHDA 1PS0A 2XJ4A 4ANFA 4DC9A 4EL5A 4HMOA 4N3CA 4KV9A 1ZMOA 3T5TA 3OLZA 4B9EA 2FG7C 2UYQA 1U2TA 1X7YA 2E5FA 3AHGA 3B36A 3R6DA 3D6UA 4MQEB 3WXMA 4RZQA 4AO7A 1BDIA 4UC0A 1BX1A 3HJGA 2L2QA 3QE2A 5HF5A 1FW6A 1FL9A 1G4UR 5FTWA 3WWEA 5EHZA 4HGOA 4OIMA 3DLCA 4C04A 5LXTB 5F5LA 4MS1A 2MSCB 2YJ3A 4HDMB 2XOKD 2X8JA 3ESXA 4RF3A 4RLFA 4TLBA 1EFAA 4LF9B 1EXMA 2C2HA 3D31A 2OFWA 5ILOA 2YZNA 3RAEC 1M67A 2BZ0A 3D6MA 3MCUA 2OAQ1 1J8MF 2LW7A 4LHYA 4BS9A 4HC4A 5JG7A 1IJBA 3TLXA 5JD6A 1HLFA 2ZRNA 4R98A 1U9CA 1EK1A 1VKNA 3F9CA 2PSHA 3UWPA 2PGOA 2VBGA 3R8XA 3SM9A 1LEHA 1RD4A 4JVSB 3LGSA 4M38A 3V8EA 4B47A 4FZJA 4AMZA 3B51X 1ES9A 1RBYA 1WXXA 1PT9A 4HNHA 4TMKA 3AU8A 1BXZA 2IU0A 4FQ8A 4C6HA 2XOXA 1MAHA 4HQ0A 1QMPA 2GA9A 2JIDA 4EYQA 3FIJA 4PC6A 2C94A 2WJZB 3IBYA 4D3ZA 2PUVA 1DQNA 4HD8A 1HZZC 1ML3A 2PTHA 3EZNA 3I8OA 3LY8A 3QE4A 4MV9A 2OQVA 3W1WA 4BMZA 5JMWA 1QE3A 2JGNA 1S2MA 4HH3C 2EC5A 4BEVA 3FOCA 3SSOA 3SOPA 4RPCA 4G5GA 4TL7A 1XPRA 4IQ0A 4Z4FA 3DOCA 4NHOA 3FNRA 3B1YA 1NXVA 1SNYA 3IJ5A 3EZFA 3PHCA 4WNAA 2Z6UA 4H1WA 1PQYA 4UM9B 1KFEB 3KAJA 3P0RA 1A4XA 3FWZA 2KLHA 5CFMA 4PNZA 2ZWVA 5C51B 3A0UA 4XCQA 5TE9A 2P41A 2GBLC 3ETLA 3DVQX 3OZVA 4RXTA 4DQXA 1GN9A 3EUWA 5LQJA 3QBJA 1DFHA 3TEJA 3EGXB 4A8HA 3O82A 4X00A 4LKOA 1QHYA 2Z5GA 1T8RA 1I3OA 3CIOA 3UAWA 1GL7A 1X39A 1SBIA 2Q2NA 3DWEX 2Q3LA 2P5YA 2ANBA 2OFPA 4DCCA 1P0IA 3LUJA 1GZ6A 2HRZA 5AI8A 4HGNA 4D6XA 2E4XA 1XVLA 4MVJD 2FFHA 2GRAA 2HQ1A 2B21A 3A9VA 4J7XA 4UW9A 3UATA 4MRPA 4KXWA 3ZWMA 7REQB 3H7IA 5FADA 4N01A 3EIXA 2O2ZA 5EZ5A 1L4LA 1GXSB 1MO5A 1W75A 2PPLA 5F77A 4DIBA 4XEHA 4Z1OA 4PBSA 1R4NB 2VSOA 5FWAA 1JFRA 5EXXA 1P3JA 1P1RA 4J2TA 3FRIA 1O94C 5LYJF 3OX4A 1U63A 2R1ZA 1SC9A 3NAQA 4FS3A 5DNWA 1QMGA 3DBRB 3DDSA 4UUNA 4XR9A 5JWHA 2NUPA 2QNIA 3E5HA 5B36A 1M0WA 3C6MA 2GHQA 2HLPA 2XDQB 3K9NA 2BP7A 4X3CA 1GTL1 2Z58A 3Q72A 4YVFA 4XDGA 5FUQA 5GVSA 1RMTA 5IHPA 4KE8A 3KVOA 1GRQA 3HBAA 3HUFA 1G2QA 4LZZA 1WBDA 1W36C 4FGKA 1OXTA 4EG8A 4EMTA 3K16A 1BMQA 2D06A 1ODTC 3P96A 4LHEA 1DRJA 1JQ5A 2NQ8A 2XVMA 4CMBA 4TYPA 2XKKA 1AUQA 3EF0A 3PWSA 4FN5A 5LR6A 1J20A 1KGSA 3LA8A 1XG5A 1U1DA 3CWQA 2Y76A 4BFTA 2K7ZA 4ARIA 3G8DA 4PR3A 3ZGVA 1TCUA 2GASA 1MIOA 2O20A 3M89A 4UD6A 5FBZA 4MOWA 3SD7A 1JI3A 3IDAA 4KDEA 3SIRA 3UK6A 1OOEA 5BQPA 3W34A 3W78A 4Z7QB 1KTIA 3FETA 4ALIA 1P2SA 5LIRA 4QBFA 5COAA 1FFAA 2VP4A 4K9DA 2XA2A 4N3NA 3KEOA 3FYSA 3G6KA 3ANNA 5IABA 4JASB 3EGDA 1AMNA 1Z38A 4JLDA 2ZJAA 3WYEA 4H0NA 5KTOA 5LBIA 3ZKWB 4BO2A 3U44B 1IVYA 4YP6A 2XRMA 1FPQA 3A6HA 3FYUC 4L74A 4IDHA 4WBNB 4G0VA 2XNHA 1JIIA 4NKRA 1U7HA 4QE3A 3KLOA 4PTYA 4EUHA 3WA7A 4ND4A 4GXRA 1CQJB 4TMFA 5KVSA 1KE2A 2O0MA 2ORWA 2W6OA 1JHVA 1UKVY 2ICAA 2WM2A 3OO1A 4TVBA 4U7TB 3S1AB 4QLBA 2F1RA 3NHAA 4G5FA 3ZEAA 2DUWA 4OHYA 1ZJ4A 3IP1A 2D13A 3ADCA 2FLKA 1PK8A 5C18A 4KN8A 1GRVA 3K15A 2LKCA 2IUYA 3KIPA 3FRJA 2XMRA 4B43A 4G3XA 5FNVB 4K6CA 3DNFA 4DILA 3HZZA 4BFLA 3E7FA 1YMQA 4UFOA 5DDIP 2FKNA 3TL3A 1QXSA 3QY9A 1U1FA 2JI4A 2JF0A 4R8MA 4KO3S 4TSKA 1JLRA 4BTEA 3GP8A 1NXSA 3VBEA 2R47A 1EP1B 1RQ2A 2VNIA 3FNBA 1I30A 4RIEA 2C4MA 5B55A 2WT9A 1VG8A 2OG2A 4IOJA 5F3DA 3L8CA 1M5TA 4WY5A 2OP0A 4ZT7A 5KDDA 5LZ8A 4DKXA 3ROQA 4QU0A 3SIXA 3M2TA 4OXYA 4L8FA 1R5JA 2DWCA 4A92A 4RW0A 2V3WA 2XNCA 3FPSA 1JR6A 5BWMA 1ESCA 4G41A 4OB8A 1KK1A 1ST2A 2BR3A 1SRQA 4MH0R 3A1CA 2JASA 1HDRA 4EECA 2Z56A 3GXOA 1SRRA 3BE6A 3O1IC 4E5UA 1WM1A 1RPZA 2UYCA 3SHTA 1KVTA 3C14C 3G1WA 3MG9A 5HIIA 1VGRA 2JFBA 3WK5A 4DPLA 2C5EA 3KSDO 1NW5A 1JGTA 4PSDA 3WDMA 3PUYA 4OHCA 3B5EA 4QTZA 1ZVVA 4BAGA 3ENQA 3DXZA 1CUIA 1Z4OA 4C0KA 5LYJA 4PGGA 1E3QA 3WA6A 2B83A 2I4RA 3BJMA 3DHEA 4Y6PA 3HNOA 4G8BA 4KK3A 4DRZA 3NUZA 1JIQA 5D3QA 3LT0A 3IIKA 2VJNA 1D2NA 5BV0A 2D0PB 3CZ4A 4YX9A 3AVWA 1I80A 3RSOA 1DAIA 2PN1A 3D7KA 4J1QA 1KYZA 1L5WA 2ZE7A 3ZV4A 1SBHA 3MD9A 4D3XA 4B35A 3C4VA 3CUKA 2GOYA 1GARA 5JHHB 2BFEB 2KPOA 5EJ7A 5F9HA 1S2LA 1XUOA 2PT5A 3F8SA 3OSUA 3CW9A 3NWJA 4HO1X 4U7DA 5EZQA 2ZKLA 2FRVA 1PR9A 2KYRA 3UMFA 4ZC1A 4A6DA 3CVOA 2O3TA 3QMPA 1L6IA 4PYQA 5FEMA 3RTBA 4UTNA 5JAZA 4BWFB 1UKAA 3JSAA 3LCJA 1AHPA 1NATA 1CYEA 3ZVLA 1ISJA 4YCCA 4OKSA 4S1OA 3PJFA 1PZHA 3HWWA 1NIJA 2XKBA 1ABFA 2BFCA 4HRAA 4NCIA 4RD3A 1WDKA 3DBLA 1H8ED 2HA4A 3CCBA 2C5FA 3RB8A 2IS4A 2YWJA 1XMVA 1B6RA 1OJ7A 2QW1A 3VKUA 2ODBA 3D1LA 2OLKA 1X3SA 2GM5A 4L9WA 3L7LA 2ERYA 2PWBA 1DAGA 4P0TA 3UG6A 1ONOA 2OHGA 1DB3A 4ACBA 1Y6ZA 1BCRA 2QTLA 1UPXA 3M3PA 4EG1A 4ZO6A 1UZUA 4QQNA 3PHHA 1SXPA 2E49A 3ENNA 5T3YA 2AFHB 3C5EA 4UHJA 2HWWA 4FYVA 3K96A 2B94A 5EC8A 1KKLA 4Y2HA 5B12A 2QBYA 3FTFA 2DR3A 1R6TA 4W8OA 4D8VA 4A5SA 4AWAA 2N3ZA 4GHWA 1SB9A 5F1OA 3JQGB 5JJCA 4B6RA 4IOMA 1CQXA 1AQLA 1MQAA 2H54A 4KIWA 2HY7A 2D1YA 4BVBA 3ZVNA 3DKVA 2QX4A 2E18A 4DA7A 2O1XA 4QDKA 3WFIA 4WFKA 4LJ7A 3UFXA 2BUBA 1Q20A 2Q07A 2QZJA 1RQGA 3C8HA 3ED1A 4WA8A 4PXAA 4GX0A 2R68A 1PJSA 4LRSB 3UK0A 5KSOA 1QKKA 4H77A 1EHCA 4G0QA 2RAFA 2JFZA 1TOAA 621PA 5HCNA 3OIVA 3LRPA 1KMHB 2WT4A 1LDNA 1W96A 4TUYF 3M4YA 4A82A 1TAUA 4F4CA 3SAJA 2PXAA 1NQAO 1WCXA 2REOA 4RYLA 1MZVA 5DI3A 2X5NA 1G7TA 2CB9A 5F2NA 1FFBA 1F60A 4LGMA 4LHZA 3SFVA 5LQRA 5K0BA 4QUBA 4EYEA 3EVEA 2WJGA 3VJKA 3QPUA 4O4IB 5AJZA 6REQB 2JLVA 2BTQA 1P7CA 2E4VA 5TR9A 1GY8A 2EXXA 1BG6A 2GCOA 1AS2A 1GSHA 2MU1A 3IE2A 4GQAA 4QPDA 4XQ0A 1X8LA 1P81A 2C96A 2PMFA 3E9RA 3FIUA 3LF1A 3W3AA 4RFSA 3SXUB 4JR2A 3TL6A 4E21A 3OLYA 5K09A 3ZLBA 5KBYA 1EZ1A 2RGUA 2UYYA 2FRDC 4I9FA 3VYWA 4QD3A 2GBPA 3IEMA 3BHMA 4G24A 2O7RA 1GTZA 3KWJA 1A2QA 1MOSA 4R1SA 2ODQA 1QAQA 2Q3CA 4KGDA 1P33A 4Q9NA 4WPGA 3PX7A 1UANA 5KI6A 2WVGA 3Q3GE 2YHIA 5AI5A 2WHPA 4TYQA 2Q4OA 2VYVA 2ZYIA 3L6RA 1J8FA 5FOWA 1MX9A 3D8UA 3IAHA 3L0IB 1VL0A 3PUJA 5FOXA 4TOIA 1XZKA 4F56A 2EF1A 1I2MA 2FEMA 1QUFA 4RWZA 1Y8QA 3MS4A 1UMBB 3L02A 1RBQA 4F97A 5MFPA 1QCCA 1WB9A 3LX4A 4DCSA 1QDEA 3STUA 3NETA 4IEFB 2HM7A 3QA9A 4WZAA 5E9QA 4NYMQ 3QP9A 1JIJA 2RB4A 3V4LA 3FOBA 3VSEA 5LD2B 3GLRA 5LKRA 3KQNA 3VV2A 3TAUA 3GIWA 4HN4B 4P4LA 2FW8A 5IDVA 3PICA 4XYLA 3JPYA 5SZIA 2QVZX 2ONYA 4C4AA 3GLGB 2V54A 3DEJA 3RF6A 5IZCA 3LDUA 3OOJA 2FPKA 3NHJA 4E51A 1X8KA 2F48A 4RH3A 3ZXSA 3WKAA 3ELDA 1DKMA 1NI4A 4WW0A 3FJOA 5ADWA 5J4LA 4MYTA 4H3VA 3EG9A 4MUNA 3M2PA 4MWGA 3BGWA 2RAUA 2J67A 5JMPA 3R77A 3D8HA 3BE5A 4TMYA 1JMYA 2C2KA 1LSJA 5KB3A 3JSXA 1DNPA 5LJLA 1ZR4A 3R0JA 5A9SB 1NM5C 1MT0A 3I9OA 2IHVA 2SCUA 3DZDA 3JR3A 1T4GA 2J3QA 1RIFA 1LLCA 2WVJA 3CRQA 1OV6A 4LBWA 4R1NA 3SHQA 4KR3A 3KQSA 4NEHB 1EX9A 4AYXA 1HDGO 4OP2A 1XK7A 3E61A 1ULBA 2QRPA 2Q0SA 3PCTA 4FKMA 4LTNA 4ROTA 4H7EA 2XB6A 2C99A 1XPJA 1BWRA 2QQ0A 2ZBGA 4YTEA 1TPZA 1OLOA 1CUHA 2G08A 2NZWA 3DDOA 2DFTA 2GXSA 5CTAA 3FKJA 2HOQA 2AHOA 4QUDA 1YBMA 2QVBA 3NAZA 1PDVA 1IL0A 2XVAA 3KXDA 4I81A 4N0EA 3A4LA 2NVUB 1XA4A 4L02A 5DTJA 3LW7A 2BCGY 1FVHA 4B6PA 3TCKA 4WGFA 4C6SA 1E6LA 2EX0A 2A5GA 4GD3Q 1ULZA 3GGGA 3OI7A 5EPEA 3NPMA 4R6XA 4DLAA 2YRFA 2FWMX 3AOEA 4UEJA 4B87A 5F3WB 4ETMA 4TUYA 4CLXA 2EJBA 2WFZA 2CLLB 2H4XA 2X8WA 5B6PA 1XZLA 2FQYA 1RWMA 2YIMA 1OV4A 3KLPX 4FOLA 2A84A 1FQWA 4X9XA 3ZW7A 4NXMB 2XHEA 3TXXA 1TD1A 2VDJA 4FYMA 1BE6A 5C80A 4GOJA 1NVVQ 3IB3A 1NKSA 4BGVA 4Q21A 1A72A 4WMLA 4N3AA 5A05A 3QPBA 2H2DA 3EVCA 4B6FA 4XD2A 3O2SB 2V7GA 1PK7A 2PH3A 2Q5LA 3LOUA 3M34A 3G0HA 1COWA 2M98A 1VZ2A 4K6FA 2AXQA 3ZI0A 4CMKA 1D9XA 3QHAA 3PITA 4EY7A 1Z7EA 3WNQA 4RTNA 4PSUA 1KPHA 1LBIA 3PXBA 4M7RA 1LSSA 4C0HA 1G8SA 3CG0A 3Q6MA 4LNUA 3UW1A 5K03A 3B5JA 3WISA 4WSOA 5K3EA 3I5YA 2XVYA 4LV5B 4EPTA 4G4IA 5CDTA 3IIIA 1Z6XA 3SYKA 1ZH4A 3AY3A 5JDIC 2F17A 5FYDA 3W9BA 1ZHOA 1L7NA 3AEQB 3V1NA 4XWWA 3ND7A 1CJSA 3X1DA 4Y1EA 3QUAA 3E8SA 3NI2A 4OA8A 4OSOA 4YJFA 1CV2A 2CDRA 4IFBA 5D7BA 4MVJE 4CMAA 2PUCA 3WQQA 1Q6YA 3BXOA 1Q2UA 2Z8YA 3FX2A 3G0CA 2Y6VA 3B9BA 4GOKA 1HDIA 1EVIA 1GGJA 1VKOA 2EEPA 2VDWB 4IDNA 1Z33A 3CN7A 4MR8A 3GUHA 1YE3A 1CB0A 3BRCA 1M8KA 5INTA 1I2DA 1P1KA 1GGHA 1QIDA 2Y0EA 3M6XA 3K6KA 4M0PA 4KE6A 4NBLA 3FTPA 4BN4A 3TS1A 4KNVA 1D6NA 3IKMB 3R6GA 1TTQB 4EY3A 5JXJA 4YCJA 5C7LO 1L7DA 2Q5EA 3B1ZA 4QICA 3NEAA 3INRA 5HUQA 3CKYA 2DQSA 1BHSA 3DOFA 1F8XA 2EJCA 4N6OA 2JEOA 3E22B 1YHZA 1WXQA 5B1YA 1E4VA 3P4UA 2Q9CA 2G8LA 4MWCA 1XQ9A 3L77A 3L7AA 4M0CA 1MZPA 4Y18A 4MROA 3E9YA 4N0QA 5HRCA 2VUTA 1ZESA 3HEBA 2B0JA 2BEVA 4XVUA 3E2MA 1EU1A 2BBSA 3TQCA 2JHPA 1XVAA 3ANTA 1E2LA 3K4PA 5IC4A 5B7NA 2RJ3A 1S8FA 5K4GA 4CDMA 3L6EA 4ND5A 4B3SB 3KUCA 5AJTA 2O1WA 2FUKA 3N53A 4M22A 5FD8A 2C9YA 3HP4A 1ID8A 1WL8A 1C3VA 4H1TA 2ZJ7A 3BE8A 2VWQA 5ALEA 3WLNA 2BL4A 2P4SA 3G0DA 4OK6A 1BROA 4FNGA 3I83A 4IUBS 5CW1A 1LF5A 1CW2B 1P6UA 1RHJA 3RFXA 4KO4S 3U61B 1CEYA 1OB5A 3NGMA 2Q2WA 3N59A 2NZVG 1XEXB 2ZR8A 5KYTA 2A0UA 4DXAA 1LI5A 1NMSA 2ZCJA 1B93A 2IDKA 4ZP1A 4JB3A 1ZSVA 1I01A 2UZ1A 2OAGA 5E7QA 2MYTA 4JYPA 5D6NA 2IPXA 3RSZA 3QX8A 4EVRA 5JNVA 1K4KA 1C3XA 4OJNA 4MJLA 3KQLA 1TO6A 2OK7A 4WXRA 4EJSA 3FOFC 4KIJA 4BL5A 1N5IA 3DA8A 1Y37A 2RE8A 5DMXA 1WMEA 5JCZA 4O2AB 4TZTA 4K9SA 1RDFA 1DCKA 2BBOA 3CZAA 2ATEA 1R0LA 3DTVD 4KPUB 4KWCA 4R0VA 2WLSA 1TFUA 3DEYX 4QXQA 3BXXA 1QIFA 4CV1A 3C87A 1F38A 3MJCA 3OP4A 4JJ7A 4M46A 1F4VA 3RBAA 5T6MA 1NIPA 4B4WA 1BTOA 2LCFA 3EVGA 4P1ZA 4O8CA 2EQBA 1UC4B 1XVVA 1FTWA 5DOZA 1CUYA 5ERGB 3RABA 3ZWNA 4KWTA 4E11A 5ALIA 3VH1A 5FL3A 4FLFA 3KT3A 3VU9B 1U2DC 4IGIA 1QHEA 3CNNA 1TMKA 3KUXA 4QDTA 3AVUA 4XTCS 1SGWA 3HY4A 1YUMA 4QO7A 3WNZA 4BNKA 5DYNA 4TKLA 1NF2A 3F5FA 3KEQA 4IHJF 3E58A 1KS9A 4GRIA 3U4QA 3PHGA 3EZ2A 3DLIA 4YRSA 1G19A 4JLPA 1TF2A 4NE9A 2D0DA 3U37A 4BO6A 3OQMA 3ZNOA 5K0GA 3RVKA 1FOEB 3PUXA 4JA2A 4KQEA 4FYYA 4W7SA 2AMVA 3HR8A 3EIWA 4TV9F 3LBYA 3OTQA 5ALOA 1G20B 3UENA 3FZGA 3FZQA 4JC5A 4KUGA 4EPYA 1N6HA 1DOAA 5DNDA 4BVLA 2J0UA 5AKJA 2MT9A 5L7WA 3EXIA 4A0GA 3MN1A 3IEVA 1PJ8A 5AR1A 4CM1A 1NFQA 1HH4A 3QV1A 2NSYA 3EFOA 5DASA 3BIOA 1YI0A 4QFDA 2QTBA 4D8UA 1QPZA 1EBBA 3JARB 4RSRA 1QK3A 3TUIC 3WSWA 2GAFA 4RIFA 5B4VA 3T9FA 4IVNA 2CXSA 1MORA 3CHYA 3HRHA 3MWDA 2Q4TA 3H5OA 4PCUA 4XIJA 4BJ1A 1U0GA 3U3DA 2H4JA 1XP5A 1MRZA 1T5OA 1S8NA 4E15A 2XBLA 2HCTA 3VOSA 1KDOA 2H06A 4AJLA 5AVWA 1QNFA 1UJ2A 1JTFA 2G72A 2DFPA 3F5SA 4K0KB 1UUFA 1W1UA 3ND5A 1EVLA 3VXKA 1UBCA 5LU8A 4LXXA 3HJTA 4M6WA 2CNNA 1QM5A 2J5XA 2GLXA 4PIVA 3RRJA 1U1GA 1F4LA 4RTPA 3UC9A 4UE2A 4HQOA 2CVFA 1PRYA 1GUFA 2GPSA 3REQB 2AOUA 2V03A 1KYXA 5E0OA 5KIAA 1VJDA 3E5MA 4MUJA 1SU7A 2YWFA 4YN3A 1G8GA 3CRW1 1F2UB 4HFMA 3T7IA 2RBKA 3PFBA 1W7AA 1NLFA 3UMVA 2AZ4A 3OM0A 1UKBA 3NHBA 1GU7A 5F23A 5L3QB 4P38A 4YDSA 3G0BA 3IFSA 4I7EA 2FSSA 4WZBB 1VJ0A 2PT6A 3MBIA 4L3WA 3NM4A 2BGRA 1WDWB 4IEIA 2QE6A 1O95A 3QITA 1T6XA 1Z45A 2I4IA 4B7CA 3SR0A 2WSMA 4BRSA 1TAGA 3T7SA 5A1TA 2PUDA 1TQ2A 3TW0A 3AL2A 4INAA 4OJMX 4UVDA 4IS2A 4Q4JA 2DM6A 3UV3A 2GKSA 3SXJA 1Z28A 2LKDA 2YR0A 3F2VA 1CE8A 3N6RA 1UPFA 3KO8A 2G7ZA 4TLAA 3TOCA 3MMNA 2PH5A 1M6WA 2OC9A 4C7JA 1E1CA 1JNXX 3EIFA 4B2YA 3MNFA 1H2XA 3GVCA 5ENDA 4ZVPA 5JY1A 1OXSC 3TFOA 4KTVE 2E5WA 1V71A 3DWGA 3ICPA 2BV3A 2WJ4A 1E5XA 3VC2A 5JW6A 1JFVA 4WKCA 1IJFA 3U3ZA 1N2CB 1EFVA 1WS6A 2ZJZA 4TTVA 4X94A 4ZYXA 2H6EA 3CX7A 1FSFA 4JXXA 3FOAA 3EJ6A 3FVRA 3RYCA 1HQCA 4HNQA 1FS5A 3I6MA 1CQIB 2EJVA 2QV7A 2Y93A 2ZIVB 4P80A 1II8A 1BKDR 4AY2A 3L1JA 3K6JA 1PS8A 2A1IA 3DDCA 3DZJA 3RS4A 3WRYC 4DSZA 1ZCAA 3HXPA 4C0SA 3HEAA 4FGWA 3ISVA 4HNSA 2WJHA 4XARA 3GI1A 5DSTA 1DUIA 1JAIA 1V7CA 5K3FA 5AI4A 2XUAA 1DCMA 2GQ0A 3N3BC 4IHJA 4A8TA 4B80A 5BMVB 1OY1A 2FOXA 1UMKA 2G0AA 2WD7A 2UDPA 2YS6A 4MLZA 4RY0A 5MGBA 1U0NA 3NWEA 1HE3A 2B4YA 3VI4B 4PQEA 1ITZA 5AJWA 5ITWA 3AB8A 2ZBDA 2BTEA 2UXBB 3ZKAA 4HJRA 4X7MA 4QVGA 1SVWA 4TV9A 2YWEA 3QNUA 3ASVA 4KR9A 1H2YA 4WK2B 6NULA 4XX1A 4M1QA 1QFSA 1QBGA 3NTQA 1ZVJA 4YPVA 1A50B 3WL8A 3B20A 4IIFA 2OBFA 3C7CB 2PL1A 4JT2A 1C3OA 3HM2A 4W5QA 2ZAMA 2PM8A 4HADA 2BEUB 4TKZA 2IYZA 2POQX 1GPBA 2VRWA 4F1KA 2W6NA 2G5GX 5ALYA 1Y0BA 3EMVA 1F4PA 2ZRDA 2AQ8A 1HQYE 3W3AD 1YR8A 4WJLA 1FQKA 2ZANA 5JD4A 1ABBA 4AZ0B 1B0AA 3AKCA 4D97A 2BFBA 5H80A 4H08A 4JX8A 5HCUA 2H8GA 3I2YX 4OX9B 2DR2A 1XN4A 3MPOA 3LD9A 4RY2A 4B3JA 1W49A 3CLSC 4MPJA 4HLDA 1NY6A 3E4CA 4MVJP 2FU5C 3CS3A 4BX8A 2WV7A 5BN5B 2UXDB 5H4GA 2V65A 3LVBA 3PFGA 4JSTA 2DPGA 2VYVD 4J2HA 4O4LB 3FVQA 3H16A 4OA5A 3WLIA 1DXOA 3EXG1 4GM4A 3D4IA 3PL5A 3BKXA 4OYRA 2IPOA 2ODTX 4MA0A 3EVTA 4H7FA 1XPUA 3H2IA 4QTUB 4HS9A 3CSDA 1PVOA 1BQEA 1ZD1A 4YASA 4LY0A 3E0XA 1Z0SA 4OYYA 2A3NA 4N5NA 7AT1A 1AQNA 1AGYA 4UDXX 4JJZA 5BSEA 5M5BA 3D1VA 2Q3BA 1U7TA 2CHUA 1YZLA 4TKVA 1NVDA 3NT2A 4XPIA 4BO1A 1QP7A 4NHEA 1JAHA 3IEXA 1K5GA 1O8BA 2ODPA 4IDAA 2HDOA 1W88A 1VG0B 1WPRA 1KARA 2I9PA 1QG6A 4YROA 5EXPA 5J40A 1SK9A 4O8ZA 1ANKA 2O2CA 3ZWYA 2CT8A 3ZJTA 2AVDA 2JEYA 1Z74A 4JHXA 2Q5OA 2C8JA 3BM5A 1Q77A 2CD9A 1IJEA 2UKDA 3LPMA 4AS2A 4AI6A 3BMQA 3KLBA 2FPOA 2BR4A 1PTKA 2FSVC 3QU2A 2R11A 4KSCA 1H85A 5CIWA 5TXGA 1M0TA 1XCBA 1TYAE 3V2UA 3JRXA 3F46A 4NOJA 4DR7B 5B57C 3FB4A 5FDFA 2GN9A 1T1JA 4RK1A 4MUYA 1C1XA 1M2OA 1MC4A 1I7LA 3BH0A 4U2CA 3L0OA 3PI6A 4RCVA 2C3YA 2Z08A 1KIMA 2D62A 1FNSA 1SH7A 2F3UA 3QYJA 4YAOA 2JJ1A 3PRHA 2CLOB 3A9RA 4E5PA 4H35A 3GJSA 4QYMA 4HV4A 3MS7A 5KYYB 5ALKA 4O3MA 2BFNA 3QBEA 1L6RA 3B6IA 4DSUA 5IDYA 4B6JA 4DPKA 2G40A 3JAMA 2IV7A 4PWYA 5EZ6B 4PHTA 1VRVA 3VPSA 2ERCA 1S7CA 2QXYA 2PGAA 5IF9A 3LECA 1AURA 3U7QA 3IQEA 3ZE2B 3MT0A 4CF5A 3P0HA 1UBTS 4RFVA 1EUDB 1YS4A 2PZ8A 4EGCB 1OTXA 3I9NA 1Z7GA 3C98A 4QGAA 2LV8A 5AW0A 3TMKA 1H6AA 4JJKA 4G23A 2IYYA 4OHWA 4CQLB 3AVXA 1X1DA 1TQHA 2B2XA 3GWGA 1PFKA 2GB4A 2HF8A 2X6RA 4WUTA 5C52B 3GFBA 4DJ5X 4E13A 5AO9A 1E7MA 3L0CA 1Q21A 4P58A 2XWJI 3N2GB 4G5OA 5A5DA 4OBBA 1NLUA 2I6QA 4ESHA 2HMTA 2ZWIA 3LOQA 2GYVA 4KFRA 2H1LA 4PYRA 4JJ4A 3GD5A 4E2ZA 2O5EA 1JQKA 4JI3B 2BBTA 2PS3A 4ARSA 1TECE 4KUHA 4RD2A 4XFJA 4ECEA 4F4IA 5GZ3A 1TIPA 3CCFA 3DULA 3PQ8A 2PWPA 4MO2A 4Q0MA 3TOXA 2PVCA 2A5YB 3C3PA 1JEAA 4DLUA 3HY3A 5F78A 4KWHA 3TNJA 4CF7A 3R9XA 1V16A 4ZREA 3V4RA 2AMLA 4B4KA 1PUJA 1MB3A 3NORA 5KNBD 3ZYZA 3KPYA 1DQZA 1COWD 1ULSA 1FQOA 2JGEA 3BB1A 4N5HX 2WB2A 1XCLA 1T6ZA 4H15A 2HIMA 2WB4A 3MWGA 5EWJA 3B2QA 1Z3IX 4Z4CA 2O05A 1KU6A 3HCNA 3LA6A 1R0BA 3PRYA 4IXNA 3SICE 3H9GA 3F4LA 2A2ZA 1TM3E 4B7XA 3F3MA 3ZCVA 1FMLA 4K3UA 5SY9A 3PJGA 1Y3AA 2WFAA 3FPEA 3HTXA 3IDSA 1SZDA 4K40A 2HHLA 3UN1A 4J0HA 4Q12A 4U6QA 1QF9A 1V9LA 4FD2A 1E9DA 2GCGA 2IEYA 1RRPA 1YAJA 4PHFA 2VF4X 3SVZA 1A5TA 4DZTA 3KS9A 2B6NA 3FR8A 5FUWA 2ZIUB 4GI1A 5DM60 2GF0A 5BRAA 5JECA 5GGXA 2O4UX 1IBLB 3UPUA 2VLIA 4TL9A 2OBNA 3S2FA 1G2OA 3H1AA 3OLVA 4KLNA 1DUVG 5EWMB 2F8LA 2Y99A 1IHXA 2ZRJA 4ARZA 4RJTA 5B4TA 1XKTA 1X1TA 5FWNA 4JJFA 1IXYA 1NQ5A 1TTTA 4BLSA 3NRJA 4HZIA 4MULA 2G5TA 4YQEA 2Q45A 1G4HA 4H6WA 5FWXA 4M53A 4B4DA 1UKYA 5D3MA 4D98A 3QLJA 1SFRA 3ABOB 3L0PA 4DA8A 2O50A 5I9IA 1Y48E 1LK7A 4HH4A 2C95A 1Q57A 1I8TA 1RYEA 2CXQA 2OV6A 1J2JA 3WSVA 3ROPA 3ZS8A 1VPVA 1FFXB 1M74A 3UOWA 5J2TA 1NUAA 1N0IA 1RIIA 2GBFA 2RDMA 1U3TA 4PINA 3WWDA 5IKXA 2PXXA 3TJMA 2ENUA 1TGYA 3I2GA 5C1IA 3RC2A 3GG2A 3R40A 1S1CA 1CR4A 1KP3A 4HNAB 4LJ9A 1J1IA 1QIGA 1UK9A 1KRHA 2QR3A 1XCPA 3D6JA 1NQXA 4OPMA 1CF2O 3GA0A 4OQXA 3KQUA 4B3RB 2V6IA 3JCZA 4ZXPA 4DW8A 1WSWA 2BKUA 4HDSA 4OJTA 2XMZA 2RIRA 3SP1A 5IJZA 1RZRA 3X1WA 4MYSA 2ZRAA 3DEIA 5HK9A 1RWBA 3EZ7A 4J4TA 1EUCB 1O6BA 5B2FA 4Q34A 3VHLB 3PE6A 4G1CA 4F4DA 4DV4B 4OX9Y 3L79A 4PLHA 4EB8A 3VDQA 4KUEA 2ZXFA 2XGOA 3T0FA 1Q17A 2HJSA 3FFTA 5IBRA 3ZQ6A 4PWZA 4CTMA 3A06A 1RI5A 4P0PB 3NX4A 4BB0A 1S9DA 1SIWA 2PKWA 3A26A 1HURA 3PJDA 4U00A 4G1FA 1AG9A 2OHVA 5JALA 3VPBA 4LRYA 3BCHA 3D2BA 1FDOA 1LV7A 1LWOA 2I4MA 3KHSA 4FD3A 4L4YA 3F7TA 4Z8XA 2NV6A 3ZU2A 4ASUD 2OY0A 2VF2A 3BL5A 3CA8A 3ZCUA 4KN5A 5P8WA 1B6TA 3FFWA 1PX2A 4BXOB 2EKQA 1GTRA 1L9KA 3UXYA 1XZDA 2EFYA 2I3GA 5CIQA 4LYAA 4M9ZA 1AD2A 4US2R 4XWGA 2O8FB 1E5VA 1QK5A 2DULA 3QA3E 4OJYA 5DJ5A 2D7CA 2ORIA 4MITA 3VNAA 4BWYA 4X95A 4LJAA 1E7YA 3L4BA 4MCAA 1AHIA 2AD1A 3BHJA 1JBEA 3ICOA 4L3VA 2HT1A 1E64A 3W5DA 4XCXA 1ZM4A 4EKIA 4Y2XA 1N6RA 2QD4A 5DWQA 4XOUA 3BSFA 3K4QA 4OBEA 4P9NA 4RK0A 2MIIA 4JLKA 3CX6A 4E1VA 4JUDX 3SKYA 2QAIA 1NUUA 4DHEA 2WF5A 3SYTA 3C3AA 5IP5A 2OHJA 1PHPA 5EMHA 4PSVA 3ZGNA 2H5IA 1IM8A 1M34A 4NMWA 3JQ6A 2MINA 1JAXA 5TQ0B 4GVLA 4QTTB 4DV7B 3EGEA 1CQWA 3Q98A 4G8JA 1BFUA 2PD6A 3JQRA 3MD0A 4J07A 4IDFA 4K6KA 4WH0A 5HM6A 5AOBA 5EMJA 1F6DA 4JP5A 3QX3A 2QPTA 3BWMA 4TWJA 1VCHA 1VPEA 3H0KA 3BDAA 4ZEVA 2OBMA 1S8AA 2QYHA 4PE5B 4XH9B 4F2WA 4QTYA 1G5HA 2D4AA 1O4VA 2LVBA 5IJAA 1XTRA 1JDBC 2NUTA 1WUTA 1O8CA 1WU7A 2Z4SA 2OAP1 4HGPA 8OHMA 1FJGB 3KOZA 2PD4A 1XE3A 4J1TA 4RKWA 1R0WA 1SKBA 1CX9B 1TK3A 5I9SA 2CSXA 4IXTA 1JG3A 2MSKA 3QVSA 5LM3A 2NSLA 3MLEA 1EFLA 3CH6A 3E9MA 2MDTA 2BH2A 5LC1A 2D2XA 3GLHA 3K7EA 5CLIA 3AXTA 2K2QB 4QOJA 1L5KA 2O3RA 4WY2A 4YRQA 1Z0IA 3OE4A 5HE8A 2WHRA 4B6QA 1KJWA 1QQAA 1JHPA 1E2UA 1I32A 4G67A 2GN8A 2YZ2A 3LDGA 1R8JA 1U0HC 4CIWA 1U3CA 4CMJA 1XTQA 3VPAA 1MJ5A 2GZSA 1W581 3G8CA 1N5LA 1A76A 3U4DA 4AD8A 3BXFA 2QOEA 3DH0A 3OIDA 3PRKE 3ZC3A 2CMDA 4Y6LA 2HBZA 4AZWA 4M9QA 1PGOA 3KU4A 4WRRA 1V1RA 3EAGA 3ZY3A 1YULA 2GEDA 4IJWA 5IM4A 2ZZMA 1BX3A 2BM1A 2X9VA 5F98A 2BM8A 5C3MA 1AKEA 1RI4A 2IHBA 2RH4A 4JELA 1QC5A 4KXQA 3HCWA 4X1OA 2VRNA 3RLIA 4EF5A 4J0EA 3M1LA 3WIUA 1FTNA 1O95D 1UC9A 5J2UF 3LHDA 3H1BA 5B7QA 4J0QA 2QMOA 3DDNA 3A1EA 2FW9A 3IVXA 3DVLA 3EGWA 1OGYA 4OUKX 1K6EA 5K0FA 3CUTA 1Y1LA 3PQ2A 1Q3TA 4RPKA 4P2GA 5CG2A 3O47A 2FUNB 2VEDA 4C1BA 5F1PA 4PBTA 2QW8A 1Z83A 3JV7A 4WCFA 1CUJA 3BD6A 3VV3A 3DQZA 1QIIA 2RBGA 3PEYA 1YZGA 1NNLA 3F6PA 4Z9XA 3NZEA 5AUQA 1KSGA 4UTXA 5IF3A 1CJCA 2ET6A 3WOVA 4A0HA 1GADO 4PG8A 4G81A 5AJVB 4UCXA 3IKLA 2C00A 5K6TA 5C1OA 1G8HA 1I4OA 4BUJA 2CMKA 1GCOA 4JMLA 3PS9A 4RV4A 4EX6A 1DRVA 2DKFA 2HRDA 1GT6A 3HA3A 3HGQA 2ZUSA 1ESZA 3W6NA 2Q21A 2V97A 3KWLA 2OBLA 1X14A 3Q0TA 1Y6FA 4KQWA 3U5ZB 1JKMA 2FZLA 2GZRA 2HPHA 2VFAA 2XE4A 4HGYA 3BMNA 2ZI9A 4Y0NA 4E5MA 1B7GO 2R1TA 1EA5A 1V26A 5CH3A 1EEHA 3VYRB 2PE5A 5JAHA 2IU3A 5EG5A 3VPCA 3U9LA 2W22A 4AF6A 3X3HA 3MA0A 1WB5A 1E9FA 1LTHR 3VFDA 1RAGA 3HZHA 1KQNA 1J2EA 3H1PA 5I8WA 2ZUEA 1DLJA 4R05A 2QL9A 5EXDA 1EJ2A 4Q3EA 2XYHA 1IJKA 1N3LA 3WQSB 1Y8ZA 1FFHA 1QGUA 2J5BA 4AWXA 3BCUA 1KOFA 1W19A 2HBRA 1M2VB 2CUKA 2IOFA 3P94A 2EJWA 4JU8A 4MQBA 4WINA 5EE1A 3W1EA 2VA8A 4DT1B 1FCJA 1YE5A 4EOGA 4MKGA 2X0DA 5CLLA 3TGLA 5LL6P 4HBGA 2J0SA 5JCJA 3BSSA 1C0IA 4HDOB 5CK5A 2C7QA 4XSGA 5HF9A 3ZY5A 1VPTA 1XKLA 4RWEA 2OCPA 5A3SA 2VJLA 4BAZA 4CM8B 1CNMA 4L6IA 2AE2A 3ZWQA 1NVBA 2YQ5A 4FOSA 1YU9A 4RVFA 2J9FA 1WXWA 2F55A 2DUJA 1EWRA 1N6NA 1X1CA 2BF4A 2WAYA 3DJYA 2GTPA 4JHLA 4PZPA 4QBIA 4R9NA 1IY9A 2CB0A 2Q3JA 4MDHA 3VJLA 4EVSA 2AYZA 3AF1A 1U1EA 3TTUA 1W36B 2H1CA 1CUVA 2AKAB 3HKDB 5AIBA 1PJ4A 3HHPA 4FI3F 3NBKA 5HDQA 1LW6E 5GOTA 2VDRB 1NBEA 5JPIA 1PDWA 1RC0A 3AINA 2WUWE 4DCMA 1RJ9A 1JLHA 1IU9A 2EKDA 2IYQA 3DOJA 2VDNB 3JQFC 2H85A 4ZZ2A 4WZAE 1JAZA 2O9JA 2J09A 3SEZA 2CFCA 1UL1X 5CFRA 2YJ4A 4PVCA 1FF9A 3ZDZB 4RQUA 1HC7A 1O89A 3GVPA 5AMXA 3WJ7A 3LYHA 3DP7A 3TX2A 1JEJA 2AMYA 4FVTA 1QQ5A 3GT4A 1KO1A 2R79A 2RONA 1FMTA 2FSUA 3A1VA 3MEQA 3VUEA 3JATA 3GCXA 4DDKA 4G0UA 1WHSB 1K66A 4KIGA 3EQ2A 1VSVA 1K89A 3FYUB 3S29A 2AOWA 1E60A 2CNWD 2VNAA 3GPIA 2FZGA 3LBAA 4CPDA 2ORVA 1KEKA 5DYIA 1KY2A 1TVKA 3HJAA 3TIFA 1RZUA 3CUSA 1IOLA 1OLXA 3VHXB 3FI9A 1ZUHA 2GT1A 1TM5E 4KE7A 4KDRA 4RHXA 2IP2A 1ATZA 4MUKA 4PW0A 3X1YA 2OHFA 3LM8A 3CLUD 1KI1A 3WGZA 4FFSA 3GDHA 5BWCA 2G9QA 1PR6A 4DMHA 5AFSA 3JAKB 2IZ6A 4TTJA 2QY9A 3E15A 1VDMA 2DF8A 3W6OA 2VH2A 4Z7OB 4A3SA 3QWAA 3BL6A 3FNFA 3L84A