1YASA

Hydroxynitrile lyase complexed with histidine
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
256
structure length
256
Chain Sequence
AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHKLQLTKTKEIAEILQEVADTYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of cyanogenesis: the crystal structure of hydroxynitrile lyase from Hevea brasiliensis.
pubmed doi rcsb
source organism Hevea brasiliensis
molecule tags Complex (lyase/peptide)
molecule keywords HYDROXYNITRILE LYASE
total genus 93
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 1996-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1yasA00
2Y6VA 4B6GA 4MJ3A 5JD4A 3N0TA 4DNQA 2ORYA 4OYYA 3R40A 4OSEA 5ALRA 2VAXA 1SCIA 1AZWA 1AMNA 2D0DA 4ZV7A 4NS4A 3FAKA 1H22A 4YX9A 3FYUA 3F97A 3IURA 5ALNA 5A7HA 2AJDA 2VT6A 4CCYB 1VZ2A 2XUIA 1VJ5A 2FJ0A 2QT9A 4J0GA 1HKHA 5K3CA 3C5WP 4WY5A 3D2BA 1UKCA 4K5QA 1TIBA 4W1QA 5ALDA 3AJAA 5AKJA 3SWWA 4HXGA 3VXKA 1FFEA 2XI4A 4U2BA 3WA7A 1EINA 5IH7A 1R1DA 3STVA 3WZMA 1RP1A 5DYTA 4LHEA 2WHRA 1UFOA 4X95A 1VA5A 3C6XA 2VATA 1E5TA 4MYSA 4DGQA 5HFNA 4UFNA 1HPLA 4ZI5A 5LLSA 3WWCA 3MGAA 4NVRA 1BROA 1CRLA 1ODSA 2QXTA 2WJ3A 3NUZA 5CW2A 2Y6UA 3M82A 3DJYA 3NGMA 1L7RA 4UBJA 1BU8A 3G0IA 3TGLA 2HDWA 3O9MA 2HRRA 4IH1A 1XLWA 5BWCA 5ALKA 1XROA 3I2JA 3QM1A 1E3QA 4L9AA 3WJ1A 3GBSA 3WK4A 5AKGA 2V96A 4KJXA 4X94A 5AI6A 3T4UA 4BZZA 1QIEA 5KWIA 1R50A 3WK5A 3QPDA 2RAUA 2DHCA 1LBSA 3VJMA 1MT3A 3IBTA 3OM8A 3H1AA 1H2ZA 2WJ6A 2C0PA 4OUKX 1XQVA 5AKEA 2R8BA 4BAGA 3FYUB 3H19A 4RGYA 1ISPA 2OG1A 2PSEA 4XJVA 1XRPA 1ETHA 4G9GA 3R3UA 4MEAA 4ROTA 5FRDA 4L0CA 3KDAA 5EHZA 2BFNA 2GBFA 2WUFA 3WKAA 1TQHA 2OGSA 2BAGA 1QJ4A 3BE8A 3WK6A 3FCYA 3K9BA 3V1MA 1EVEA 3D2AA 3OC0A 4CG1A 5LZ5A 4B80A 5K3DA 1CLEA 1XZCA 1YR2A 1N5MA 4UBMA 3H2IA 1XZGA 1E66A 1GPLA 4DSAA 3B3QA 3I2KA 2XMGA 3I6ZA 4DSZA 4QWMA 3U1TA 3BXPA 3ILSA 1P0QA 1Y7IA 2HA4A 3WIBA 1BRTA 5EHXA 2HA6A 4K2AA 4P92A 1ZOIA 2JGFA 3QPCA 4N5IX 1DQZA 5JASA 4J0DA 3V1KA 1CUYA 2LIPA 4H7FA 1LZLA 2VJBA 2W6CX 3EQ9A 4PNZA 1YA8A 4GEGA 5HF6A 2ZYHA 3DLTA 4QDOA 3BL8A 4H0CA 1ODCA 4UHDA 1CR6A 1XZBA 3VJKA 4UBKA 2WIFA 5HK8A 4B7ZA 4C89A 5DTJA 4QZVA 3W2TA 3MUOA 1QIFA 4J3JA 2RHTA 2Z3ZA 1F0PA 3UUEA 3T52A 4Y2VA 1T2NA 3H0CA 5E4YA 3FSGD 1CUUA 4H18A 1WPRA 2WFLB 1EXWA 4Y2YA 1CUWA 1O6GA 2W22A 4KEAA 5CH3A 2BUAA 2WFMA 2C58A 3PE6A 5C81A 1XKLA 1CVLA 5AKZA 5LZ9A 4ZV9A 5CXXA 4BTVA 5FDFA 1ZIYA 1U8EA 1D07A 1DWQA 3AIKA 1AGYA 1WHSA 1A8QA 3X3HA 1Y7HA 5HQ3B 3DL7A 2GBGA 1WCYA 4HRXA 3O95A 2JEYA 3F67A 1A8SA 4AN1A 5LZ4A 4X00A 4DNOA 3LP5A 3PUHA 1CUCA 1UXOA 4J0JA 4EY4A 1JJIA 1SC9A 5CTAA 3VKFA 4JEIA 5AI0A 2OCIA 3WL7A 2AXEA 3KOOA 3A2LA 4QLAA 4UHHA 5LIPA 3W06A 1UWCA 3WL5A 3E3AA 4Y7DA 4UHEA 5FKJA 1XFDA 2G63A 3OURA 3OPMA 1MAAA 3V48A 3KWFA 1QIDA 3ESAA 5JARA 3STXA 1GXSA 4Q3KA 4Y2RA 5CH8A 1CUBA 1PJAA 5EIAA 3D0KA 5ALPA 1CUAA 2AJ8A 2ZJFA 2HADA 4BVJA 4U2EA 3WWOA 4WJLA 2XUQA 1N1MA 2ZYRA 4UPDA 3WL6A 4X91A 2QM0A 2BUBA 1N5RA 2HA3A 1M33A 1VE6A 4RPCA 2ES4A 3BJRA 1MAHA 4FFVA 5AIBA 1XRRA 1ZGBA 3GELA 4A16A 1MX5A 5FXMA 4AMYA 4PSDA 2XQGA 3OOSA 3N2ZB 5ALIA 4AMZA 3AUKA 4FHZA 4X7BA 4UFPA 5AJHA 2DR0A 1ACJA 3G9XA 1GT6A 3KWJA 4IH9A 2CKMA 1XZDA 3AILA 5A62A 3L1JA 5DNVA 4UHBA 2OAGA 3F96A 3I28A 2CUTA 2WFZA 2GYWA 2QJWA 1LPOA 3WIOA 3WKBA 1LPAB 2XMBA 5AK5A 1DINA 2WIJA 4P08A 4BCBA 1CUIA 1CUHA 1K4YA 1MN6A 1E89A 2HIHA 1W75A 2HU7A 5SYMA 2XQIA 4WCVA 4G8DA 2XB6A 4AN0A 1MX9A 4BDSA 4FWBA 4YASA 4UBLA 3H2KA 6YASA 3G7NA 3G9TA 4RE6A 1LPSA 1YB6A 4ZWNA 3A6ZA 1P0IA 4Q1VA 5ALYA 2JGKA 2XUKA 5JZ9A 1VKHA 2XMRA 1THGA 4EBBA 4EA6A 4PW0A 5AM5A 3BJMA 5ISMA 4LKOA 1SCQA 1GKLA 3ICWA 1IVYA 4BB0A 4EY6A 5SYNA 3C6YA 2WQZA 2XQKA 5I7UA 4KE9A 2DQYA 1VLQA 3CCBA 2H1IA 4KE8A 3I1YA 4BCDA 1SCKA 5EFZA 3HLKA 2VJCA 3O9VA 2QUBA 3ESDA 4QDTA 2XUDA 2JGJA 7YASA 4BC1A 5JZBA 5ALTA 2WU3A 4G8BA 5JADA 1XQWA 1ACLA 1UK9A 3D3NA 1DX6A 3VDXA 1JMKC 3QH4A 1QO7A 1B41A 1DU4A 1SFRA 3NWOA 1CUZA 4BZWA 3M81A 5AM0A 4UUQA 5IVDA 2Z5GA 1MNQA 4I19A 4B82A 2PSJA 3MVEA 1P0MA 4LXHA 5JAHA 3WQHA 3IDAA 3R3XA 1LGYA 5K3AA 1WPXA 1E8MA 1ZJ5A 3PUIA 2BJHA 1CQWA 5CBKA 3H17A 5AKYA 4H7IA 5HKAA 3FOBA 3ANTA 3G02A 4Q3LA 4X93A 4Q34A 3ZLTA 5JD6A 5K5EA 2PUJA 5AI9A 1YSCA 3LLCA 1C7JA 3KXPA 1W6RA 3C43A 2VTVA 4AO8A 3D59A 2Z8XA 3STWA 2RHWA 2OCGA 1R3DA 1MTZA 5C8ZA 1MJ5A 4C4XA 5EHQA 5K3BA 1THTA 4N5HX 4DMHA 4Y2SA 3GZJA 1BEZA 4IO0A 5KBYA 3E0XA 1Z68A 4UBOA 4K6KA 2CEKA 4OU5A 5AIAA 3F8SA 3K2IA 4PSUA 5ALSA 1UK6A 3BIWA 3D5EA 3RM3A 2CMFA 2UZ0A 2ZYSA 3O4IA 1XLVA 3DDUA 3HJUA 4CI9A 4MQMA 2I03A 2H9YA 5A6VA 5HKBA 5FOQA 2BGRA 3W05A 3I6YA 4BC0A 5FPPA 2ACEA 3QZUA 2V9ZA 1G4HA 1TK3A 2JF0A 2QMQA 2ZJ6A 4WDRA 2Y1KA 2JGEA 3L1HA 4W9RA 5C8XA 4J0KA 4BRSA 1DQYA 1XZEA 1FFBA 2JGMA 4OYLA 2WG0A 4X3CA 2GYVA 4QWWA 5HF9A 4PQEA 4N8SA 4JYPA 4WY8A 2VJAA 1ZICA 1DWOA 2Z8ZA 3DNMA 3F9CA 4BVKA 5K3EA 4BYMA 2QJRA 4L72A 4N8EA 1JMYA 2Z3WA 4AB1A 1Q0ZA 3B5EA 4Y2JA 3FNBA 3CCCA 4JNCA 2HA5A 1H2XA 5IVKA 5D6OA 3DOIA 3WK8A 3YASA 4ARBA 5T4EA 4PO3X 5AM2A 4G4JA 1R9MA 3Q0TA 1XLUA 1BE0A 4H7JA 1TRHA 1QO9A 5C8VA 1KU6A 3WKDA 1YAHA 2OCLA 5ALJA 3D7RA 1JT2A 2X8BA 2XDWA 1AC5A 5A71A 5AK6A 2R11A 2ACKA 1NX9A 1PFQA 4B9EA 5DYYA 2EDCA 1JU4A 2WILA 4ARAA 4E14A 4MEBA 2C4HA 2O2GA 1JI3A 4C4ZA 4X85A 1DT3A 4KYVA 4DYHA 2Y2UA 2OQVA 2VA9A 3O0DA 4M0FA 3RLIA 5DYWA 3DYIA 1FSSA 2IITA 1LLFA 4EHBA 4QDZA 3CN9A 2WHQA 5LKRA 1EA5A 1L7QA 5EI5A 5EGNA 1L7AA 2XMSA 4Q3OA 1X2EA 2FUKA 4UHCA 4Y2XA 5DLPA 4CIAA 5FPQA 4TPKA 3S2ZA 1TCAA 5KWJA 3C45A 4G4GA 2WSLA 3IIIA 1ZI9A 5ALLA 3VVMA 1ZD4A 4NZZA 2PM8A 1UKAA 2H7CA 4E15A 1IMJA 3C6ZA 5FLKA 4H7DA 3CN7A 4BP9A 4XVCA 3KD2A 4DTCA 3WYNA 3G0BA 2PU7A 2ZJ7A 1OILA 2QXUA 2JGLA 2OQIA 3HYSA 3RKSA 4LXGA 2PPLA 4DIUA 2XQFA 4A23A 3HXKA 5ALWA 2WG2A 2WM2A 2O2IA 5LKAA 2XMDA 3IUQA 2O7RA 4G9EA 4BAZA 5IVHA 2HU8A 2IIVA 3PDCA 1LBTA 5HF8A 4KRYA 4HXEB 4MXDA 4X71A 5D7BA 5EIEA 1MNAA 3QMMA 3ESBA 1IUNA 4B85A 2WTMA 4X6YA 4C4YA 4OCZA 2WTNA 2G5PA 2WHPB 5AOAA 4J03A 2BCEA 2YXPX 4I3FA 3IULA 4INZA 3STYA 1FFDA 1GPNA 5E4JA 1ZD2P 4RE5A 1QIMA 5HFAA 1JKMA 1QTRA 4GHWA 4J0CA 3QMWA 2OCKA 5AM1A 4JYMA 1JFRA 1AKNA 2HL6A 3I2GA 1WHTA 2PVSA 2WKWA 4CIBA 5CURA 2WJ4A 5C7YA 3V1NA 2XUOA 3R41A 2XMCA 3Q8WA 2OPHA 1ZD5A 1B6GA 4OD0A 4CCWA 1HDEA 4W63A 2B4KA 3AFIA 5JALA 5JZSA 5I8PA 4Y2QA 1BN6A 3F98A 1DT5A 4QDXA 2DCMA 1XZJA 4E46A 4NMWA 3ZLUA 3G0DA 5JANA 5JD5A 3OG9A 3PF9A 2VQ6A 4MWSA 1IZ8A 3JW8A 3D4LA 5AP9A 4CFSA 5AI5A 1CUJA 3C5VA 3M3DA 4DMKA 3SK0A 4GI1A 2RONA 4H7EA 5LYYA 3ZI7A 5AHXA 2HRQA 3AIOA 4DMCA 3V9AA 4KE7A 4FLFA 3AIMA 1MPXA 1AUOA 5DNUA 1J06A 2QUAA 4HS9A 3AZPA 4V2IA 4W1PA 2JGIA 2V97A 2K2QB 4GWLA 3JWEA 3D2CA 3PF8A 1OXMA 4MQLA 3DQZA 3C6BA 4KRXA 1UOPA 3HZOA 2PUHA 4AZ0A 1QIJA 3I2IA 1U4NA 1RYYA 1R9NA 3LIPA 2DFPA 4N8DA 1XZHA 1YB7A 1XKTA 1I6WA 1LPBB 5LP1A 2WIGA 4FOLA 3HABA 4G1FA 4FNGA 4AXBA 5CRIA 2VT7A 1DTEA 1ZI8A 1XZKA 4DLNA 4C6HA 5BWBA 2HA2A 2AJLI 1R4ZA 2GBIA 1GQSA 3ICVA 4B84A 5ALXA 4HRYA 3QMVA 1HBJA 2RGUA 3UMJA 5JAPA 3FWHA 4KAFA 4ZREA 1K6EA 1JJFA 4XWGA 4CCYA 5CT9A 5D3KA 1XZMA 3E4DA 1AURA 1Y37A 5CT8A 4FLEA 4H7KA 1EI9A 1QGED 1XQXA 2B61A 4A5SA 1VA4A 3TEJA 1LPNA 4X97A 1IZ7A 5AM4A 2I3DA 3WLAA 4U2FA 4YK7A 1N8SA 1W76A 2XMZA 3QYJA 3R3ZA 1F0NA 4U2GA 2GBCA 3DL4A 2XUFA 5IKXA 4KAJA 4X6XA 2O7VA 3E1GA 2CJPA 1U65A 1O6FA 3STUA 2OAEA 4AQDA 4OPMA 4ZGBA 3L1IA 4QDUA 4FKBA 3SX4A 1VXRA 4B0OA 3BF7A 3DD5A 1MU0A 1W1IA 1CUGA 4FMPA 5H3HA 1A8UA 3BIXA 2J4CA 4Y2TA 1QOZA 1G5FA 2JIDA 2DHEA 1CUXA 1EVQA 5ALGA 4BAUA 1QIKA 5K3FA 5IVIA 2I3ZA 4LYEA 3FYTA 4C88A 2PSFA 4WDQA 2XUAA 5AI8A 1QE3A 1EK1A 3ANSA 4RNCA 2GZRA 3LIIA 3H04A 5F4ZA 4BTLA 5E2IA 4HVTA 3H2HA 4GW3A 4E11A 3GROA 4GECA 2E3JA 2HFJA 2EEPA 1QZ3A 1KEZA 3EBLA 5JIBA 3EF3A 4J0IA 3W9BA 3HI4A 2X76A 4FLMA 3K6KA 5ESRA 4EY8A 4ZRDA 3S8YA 4AZ3A 1VZ3A 5A7FA 3IB3A 4BE9A 2WFLA 3VJLA 3O4HA 4CG2A 5CT5A 1UZAA 2QR5A 3DCNA 2C5GA 4C01A 3H18A 5ALEA 1XZFA 1QLWA 2QOEA 1C7IA 5I9IA 5LZ2A 2OXEA 3PICA 1EK2A 4QEKA 2V98A 3FLBA 4X6UA 1VOTA 1CUEA 4OU4A 1ZIXA 4LXIA 2XE4A 1BS9A 5EIHA 4B0PA 4U2DA 1WB6A 5T4HA 1E8NA 1CUFA 3FCXA 4YPVA 4F60A 3G9ZA 4TVKA 2OGTA 4QNNA 4FBMA 3G8YA 1EDEA 1QTIA 1DWPA 5LZ7A 1QIGA 1YCDA 1S8OA 1XRQA 2OGZA 3MUNA 4EUSA 5YASA 3PI6A 3IA2A 2I78A 3QPAA 4XX1A 5K3FB 1W52X 2AJCA 3ZV7A 1LPMA 2ZYIA 3R0VA 1JU3A 4MWTA 4EY7A 4XIIA 3BWXA 1QIIA 3M83A 1GZ7A 2WHPA 3O4GA 2XT0A 1BCSA 5AH0A 1C4XA 2PX6A 1XRLA 1FFAA 1ZJ4A 1X2BA 2NW6A 1K8QA 1XZAA 4WFIA 4QA9A 5HCUA 2PU5A 4ETWA 1VXOA 1NU6A 4MYDA 5JYCA 3G0CA 2CB9A 2YYSA 3P2MA 2QTBA 5HQ3A 2C0QA 3IVMA 3EIOA 2HHAA 4GLBA 4F5ZA 1EHYA 3WMRA 1IUOA 5EHNA 2WLSA 4O08A 2GZSA 1GGVA 1P0PA 1AX9A 3UUFA 3W04A 2EDAA 2WG1A 1CUSA 3WL8A 5AOBA 1UK8A 5AO9A 1PV1A 1G42A 1QONA 3VVLA 5BOVA 4J7AA 4BBZA 2CZQA 1DX4A 3STTA 3DYVA 2QZPA 1MX1A 4Q05A 2H7YA 1OCEA 4K6GA 1LNSA 5HZGA 2PL5A 1YAJA 5ALZA 5CXUA 3QBJA 4QLOA 4Y2PA 1CQZA 4JUIA 2XQJA 1WOMA 5AM3A 3OTQA 1YA4A 1H2WA 1UKBA 1XRMA 3I2FA 3HSSA 3BDIA 2XMQA 3QITA 2WIKA 4G5XA 3ESCA 4AX4A 1H2YA 4KAAA 4AO7A 1EB8A 1TKRA 2FX5A 2HA0A 2XLBA 2YASA 5JAUA 4Z49A 3LS2A 4QE3A 4HAIA 3EQ7A 3FLEA 3IUMA 1TCCA 1QIHA 1CEXA 2IX9A 4K6HA 5AKIA 3BF8A 5A7GA 5FV4A 1USWA 2PSDA 5ALVA 4D9JA 3I2HA 3KSRA 1E8DA 3DS8A 5HK9A 4KE6A 4J0HA 3GA7A 4BDTA 2VJDA 3C87A 1CPYA 1ODTC 1EB9A 4GDMA 4UBIA 1EDBA 2Q0XA 2HU5A 1VE7A 4WFKA 2B20A 2VEOA 3DKKA 1AQLA 3AINA 3HEAA 3HACA 5JATA 1JJBA 3AZOA 3QVMA 1WM1A 3FSGA 4W1RA 3G0GA 4WFJA 4W1SA 5CT4A 5AICA 2AJBA 4FBLA 4HZGA 3B12A 2J4FA 1GQRA 3LCRA 1LZKA 4GBGA 2PKYX 3DOHA 2WU4A 1CV2A 4OB8A 2ZSHA 3GFFA 3HRHA 4H7HA 1F8UA 2ROQA 1XQYA 2DSNA 2ZVDA 3JYHA 1YASA 4B81A 5J3JA 4AO6A 5AI4A 5CT6A 1LPPA 1FFCA 1NU8A 4KACA 4LYDA 1IUPA 2XUHA 4CG3A 1XRNA 1UOQA 2ONCA 5AKLA 2C7BA 4F21A 1CUVA 3I6MA 1WB5A 1EX9A 1F6WA 5AK3A 2BKLA 2RIPA 1CFJA 4UHFA 5FP0A 4H35A 5ALMA 4UBNA 4TGLA 3I1IA 1H23A 4B9AA 5DJ5A 3WA6A 1A88A 5AKKA 4UFOA 2B9VA 4OB6A 3G9UA 4DM7A 2XUJA 4IHAA 2G5TA 2GYUA 2WUDA 3SC2A 2QKYA 2JEZA 3DEAA 2VSQA 3U0VA 4HTAA 5AK4A 2VF2A 1GPKA 3PFBA 3WK7A 4H77A 1ZI6A 4BE4A 2G4LA 1MO2A 2HA7A 2HM7A 2ECFA 5BV7A 4LIPD 1XZLA 4L3WA 2HFKA 5D3ZA 2D5LA 4X92A 4M0MA 4G8CA 2FJPA 1BN7A 3A2NA 3WK9A 1YS2X 1TCBA 5DNWA 1XZIA 4PV7A 3ZLVA 1QFMA 2C5FA 4FNMA 2QS9A 4GXNA 4C87A 3WJ2A 2QVBA 5CMLA 3GUUA 2WIDA 4Y2UA 2CBGA 4JH0A 1A7UA 3FLAA 4Y9SA 1J1IA 3BDVA 2X5XA 4BCCA 4Q82A 4DNPA 1K63A 3ZPXA 2XLCA 4FFWA 5LZ8A 3WWEA 2BGNA 2DQZA 1Q83A 2PSHA 4FDMA 1YS1X 3DKRA 4EB0A 3IUNA 3WZLA 5AOCA 4EY5A 5ALQA 1WB4A 4HXFB 5CH5A 1EDDA 5A2GA 5FUMA 3WI7A 2J3QA 3A70A 1Q0RA 4DMFA 5DWDA 4ZXFA 3EQ8A 2XUPA 4FTWA 3ZWQA 1BCRA 4PF1A 3C70A 3FVRA 3R3VA 1GKKA 1J2EA 3H2GA 4DNFA 3HC7A 4BATA 1QFSA 3C8DA 5HF5A 3VISA 3NOXA 5T4FA 4U2CA 1R88A 4X90A 3FVTA 1SOMA 1ZD3A 2RI6A 2OLEA 1K5PA 4M0EA 3TRDA 2DHDA 3W9UA 4BVLA 4PSCA 4ITVA 4BP8A 1ORVA 1G66A 1TAHA 3WKCA 2J3DA 2VAVA 1HL7A 1BEEA 2WUGA 3WYDA 3WKEA 3H2JA 1HQDA 2P8SA 1UT6A 4B83A 1RWQA 1W4LA 1ORWA 1FJ2A 4G4IA 1U2EA 4F0JA 3TJMA 3AZQA 5T4BA 5ALUA 2YH2A 3R3YA 4P9NA 4I4CA 3RARA 5E4TA 1HLGA 3IUJA 1KU0A 2Y2VA 4IQ4A 3ED1A 3FYUC 2H7XA 5DTIA 2JBWA 2QRUA 1ZGCA 3RK4A 1UK7A 1J07A 3FBWA 4IH4A 5KREA 1T4MA 3PFCA 3A2MA 4KR0A 2WUEA 5ALOA 1CIJA 4BRZA 1UOOA 2ZSIA 3C8HA 2BUCA 4S0XA 4EZIA 3O4JA 4P93A 5AKXA 1Q84A 3V1LA 2XUGA 5AKHA 2PBLA 5ALHA 5ALFA 3WWDA 2O2HA 3H1BA 3R3WA 3CXUA 1EH5A 3WWPA 1CUDA 5JAOA 1X70A 4OB7A
chains in the Genus database with same CATH superfamily
3VBEA 4LOIA 2VNKA 3GMDA 4M86A 1ULTA 1XXHB 2W43A 1K66A 2RDMA 4O1HA 4B6GA 1UJBA 2D1TA 4G5QA 5A3JA 3N0TA 5JD4A 3IOMA 2ORYA 1YKGA 4DEVA 1N5KA 5JS6A 1FC0A 2V9CA 4OYYA 1AD2A 3R40A 3T3NA 4B32A 4CKEB 3ZQKA 3ASUA 4KGZA 1FVXA 2PRYA 1AMNA 1YOVB 2Z6QA 2O8BA 4WHMA 1G8GA 1P2DA 2Q50A 3BL5A 3N07A 1YIDA 3MT8A 3O7MA 2OXIA 5A1JA 1UBHS 3WIUA 1UADA 1O9GA 2EZUA 2Q4EA 3NNSA 6LDHA 1ESCA 4ZXPA 4YX9A 1C1XB 4QUGA 2GDJA 4I1PA 1J23A 1YJ8A 3IURA 5GONA 1II8A 1H1TA 5ALNA 4DLKA 2DEUA 2AJDA 2OZLA 4XGQA 1U8XX 1K86A 1DAIA 1XD2A 2PPVA 3MWGA 5FCDA 1EM8B 4LJKA 1NVUQ 3K09A 4TLCA 2ADFA 3ZS8A 5CEFA 1Y6JA 4C4TA 2NTJA 3VO8A 1GNTA 3CZ9A 3H1PA 4L95C 4HUTA 2R4UA 3N9IA 4QBKA 4RADA 5KTTA 3UW1A 4EG6A 1M34A 2VRWA 3OAAA 1BAPA 7REQA 3UV6A 3U80A 1KAHA 5IABA 4HKTA 4BQIA 3KLMX 4W5HA 1JWAB 2XVYA 3TRIA 2JBAA 3NHRA 2WKRA 3ELUA 4LZJA 4OQFA 2FVYA 2XAUA 4YJGB 5AKJA 2OSBA 3HPRA 2Q6KA 4Q4LA 3OZSA 2IDZA 5JC1A 2GAJA 2FZEA 2CJYA 3OOYA 2XI4A 2AWNA 1RC0A 1M1YA 2AN9A 4Z7JA 3CLVA 1UC4B 1ZLYA 3LK7A 1NUQA 1SVOA 3NTUA 3FNGA 4MW1A 4D82A 4DCOA 3DOJA 1LK5A 3KYBA 1YE3A 3RYHB 1N6PA 5AXBA 4D9FA 3KSAC 3U7RA 1M2WA 3TXYA 3EZ9A 3SFZA 3DDCA 2JH9A 3V2UA 1QYVA 4G0PA 1Q7EA 3VDMA 2CNWD 4CFYA 2H1VA 2HGZA 1N5OX 4BJ1A 1E62A 3C6XA 4EFNA 3IAM6 3TMKA 2P6UA 3EWSA 2WZQA 4RJTA 4MYSA 1Z6XA 4NE2A 1HC7A 4KL8S 3WBFA 4LX8A 2HMTA 3LRTA 1LCIA 2B25A 4O59O 1JFTA 5LB2A 1HPLA 1O6ZA 3P9ZA 4ZI5A 5LLSA 1SG9A 1D9ZA 3D9QX 2IS4A 2HSGA 1GGHA 3PNQA 2QNIA 2QXTA 1CRLA 4BWYA 1KVRA 2H9IA 5CW2A 2NG1A 4L74A 1V45E 2XITA 1JAHA 2MT9A 3H4VA 4Q1CA 4QXMA 1GV0A 1SHZA 3HRKA 3MAGA 4CLHA 1BU8A 4C14A 5JUWA 2C78A 1FLAA 3G59A 1DBIA 3OIUA 4JR0A 2J9FB 3O9MA 1Y8RA 2FCAA 3PWKA 1FK8A 1ZK1A 2ZB4A 1XLWA 4FOOA 4RY2A 1SQGA 3JVDA 4NCXA 4E1AA 4ZK2A 4MLPA 3EPHA 1PTJA 2FMXA 3FFTA 2P0EA 2QX9A 3SHTA 3UXHA 2ZQZA 3E9MA 4HYTA 1IIBA 5BYAA 2BTOA 3G5AA 4LEIA 2VO1A 4RVOA 3WOVA 4L9AA 5TLSA 1YJXA 3VFDA 1IN1A 1OFIA 3WJ1A 4MW6A 1GG2A 3JVVA 3WK4A 1WNTA 4MMYB 2E85A 4P4TA 4ESOA 1HDOA 1R6XA 3WGZA 4PYIA 4B3JA 4FEEA 3CR8A 3RSCA 3QI2A 4NE9A 3O8NA 2X6QA 4KXYA 2A9OA 1MT0A 3E0QA 3GG9A 3IJRA 3RVOA 2RAUA 3BK2A 1SA0A 4NYMQ 3VH4A 5G3ZA 1KMHB 4XOUA 1ZAKA 1GN9A 3LX4A 4LMPA 4BL5A 4C0BA 3OQNA 1JDZA 2DHCA 2W2OA 5DWQA 3FA2A 4YRJA 3ADBA 2NO7A 1ODKA 1M2HA 1J7JA 5TS2A 4P0PB 2RJ3A 4M0UA 4BJ5A 3IEIA 2K7FA 2FZ4A 4Q1EA 1XNHA 3Q15C 1KAEA 3WRXA 1WUKS 4OUKX 1XQVA 3GEMA 1D7OA 4EVIA 3L7JA 1GGMA 4ITRC 3VU9A 1HFJA 2VDOB 3FYUB 2VYVD 3H19A 1LNQA 1J20A 4B6EA 2IV3A 4B6PA 1P31A 2NU7B 1GEGA 3QY9A 4RFSB 1E3TA 1HOTA 4NDNE 4GPEA 4NABA 4UNPA 4QARA 3UYKA 4CHTA 1ISPA 1J21A 2QJTA 4XJVA 3BG5A 1DL5A 1OZHA 1R4MB 3F0TA 5H68A 4C2BA 1P60A 1UBNA 4Y6PA 3DZJA 1Q1AA 2FSHA 4ESHA 4ANFA 3QW2A 1W581 2IEBA 1J2UA 2P30A 4OSPA 2ZWMA 4I6EA 1Q7TA 3C5HA 2XGSA 4L0CA 5BVGB 5DN6D 4IIYA 3HXPA 5J4HA 1LY1A 4G5YA 4PU0A 3EARA 1CIVA 3R7WA 3UJ8A 1Q2XA 2QD4A 2GLTA 5BUSA 4FE3A 2P4SA 3QLUC 2WUFA 1IY0A 2NU6B 5HYVA 4HGNA 4TKLA 4LXYA 3GJ3A 1FSGA 3GH1A 1PHPA 2C57A 1EVZA 1QYXA 1XL1A 2OGSA 3WYEA 1XF1A 4BEVA 3NAQA 5FIUA 1PL8A 4NS1A 2OK8A 2H17A 3D3KA 3FCYA 2RFLA 3D2AA 3IVRA 2IYEA 4JJ8A 4RVUA 5GV8A 4F2HA 2V74B 1KQGA 3VJRA 2VS1A 1Y7LA 2ZYDA 4UMVA 2NTEA 3EEQA 4BZQA 5JY1A 3ZD7A 4RK6A 5HIJA 3WSVA 4LRXA 2ERCA 2QRQA 1CTQA 3OF3A 1YQGA 3B20A 2WJHA 2JZCA 1ZW6A 2X0IA 5FLEX 1NPTO 1LBQA 1C9EA 2QB5A 1RTTA 1N2XA 3PA6A 4P7BA 1XZGA 5E1DA 4DSAA 3ELWA 1OFUA 2CHQA 3I2KA 4DSZA 1FMLA 3DXXA 1V4NA 3ILSA 3JWIA 1KR5A 3MSCA 4KO8A 2HCFA 2HA4A 2QLMA 4CUKA 3DBIA 3PEFA 3K32A 1R2QA 3N87A 1RDFA 2HA6A 4YBRA 5EHXA 3WL4A 1DBVO 1R8YA 4O4JA 3K1AB 4UM5A 2UYQA 4D8TA 1VPVA 3CLSD 4Q7KA 5LUAA 1ZOIA 4RGBA 5A0FA 3VO9A 3JD2A 5I5EA 2XYGA 2C9OA 4J0DA 3RTGA 2GVNA 3N8HA 4H7FA 5K0TA 4AQ7A 2IXEA 1LZLA 2WWXA 3EG5A 1TTTA 3AU8A 2C96A 4CMKA 2W6CX 3EQ9A 5DCUA 2IODA 1LSUA 1NBWB 2X8WA 1K7YA 4PNZA 2R8XA 5IFKA 1RYDA 4W9NC 1Z4MA 1RM5A 4XCQA 3U1BA 1DZIA 1YCGA 4CUJA 5CEJA 3S70A 1EBFA 3PGKA 4B7AA 4QBIA 1QK5A 2LE0A 1L5HB 1LTQA 2YRFA 2Z5FA 3ILXA 1JLLB 5B4UA 3D6VA 4H0CA 9GPBA 1KTIA 1I7QB 2BGLA 4XIFA 3ZW9A 4ZTUB 1EUZA 5HS4A 4DZTA 1FRQA 1GLGA 5IFLA 1YVPA 4Q9LA 1ZVVA 2WIFA 5HK8A 4IRXA 1WMDA 1NKSA 4IIBA 3S5UA 3MJEA 4WECA 4FSHA 1FF9A 3COPA 1YIOA 5I9BA 1R0SA 3DE0X 2V6GA 3PJEA 5A4DA 2G1PA 1PT5A 3MUOA 5KYVA 3L4SO 4ZFNA 1G2IA 1VPWA 3ND9A 3L7CA 1ODJA 1YRYE 4IZ6A 3UUEA 2FPPA 3VR6A 4DV6B 5IN5A 3BFJA 4Q47A 2W11A 4N6OA 4RQTA 1XEXB 5H83A 2CVHA 1POXA 2FP4A 4HJXA 3SBEA 5E4YA 3FSGD 3A28A 4P84A 3SYRA 4GRIA 2O8BB 1WPRA 4EGQA 4TKUB 4G3XA 4C76A 1XSEA 3PEWA 4E33A 3KJNA 1RHUA 1A2KC 1G41A 3LZDA 4KEAA 1PT8A 2ZBUA 4L3VA 2P2GA 3W8FA 2VJMA 4DJJA 4MP3A 4UUNA 5KJEA 1QO0D 4DIEA 3TW6A 2B4TO 3LYAA 3M6XA 1KZHA 2P35A 3ZIAD 5KUTA 4MO2A 3ZKWB 5KTRA 1CFZA 3QQPA 5ESDA 4CEIA 1P6XA 2KBFA 3ACBA 3MFYA 3I5MA 4YUAA 2ZDGA 3IV9A 1RP7A 4O2AB 5COBA 5SICE 3VR4D 5LQSA 2XDQB 4AU1A 1E3DA 3T41A 4ZV9A 3ILYA 4OQDA 5HBGA 1Z29A 3AOEA 2PQ2A 4FX5A 4E5YA 3FZYA 1S3IA 2H4HA 5IMSA 2ZIGA 2ZWOA 2BHNA 3EFHA 1T3GA 3C4VA 4M1QA 1GZSA 1KS2A 1U8EA 2OOSA 4J0FA 4CIYA 3E9NA 1D07A 2E82A 4JYCA 4PYRA 5EJAA 4B2IA 1A4IA 4G23A 1MTOA 2YBDA 1D2GA 3A04A 5JS2A 1FUKA 4XVUA 1GZDA 2WHEA 3X3HA 3PYMA 4PYNA 3DL0A 1Y7HA 5HQ3B 1VG0B 2V8OA 2XPCA 2AC7A 4PGFA 1GLVA 1NMXA 1Z0DA 2ZROA 4XB2A 2X0EA 1WCYA 4HRXA 4EGJA 5DZSA 4YCMA 1OLUB 3L82B 5E6SA 5BVGA 1HYBA 1T8PA 4QOHA 1T0UA 3RWBA 2X4GA 1TVKB 4PYJA 1NWHA 1Z33A 2BEKA 3DBVO 3HY6A 3QKSA 4PZEA 3EVFA 3U4CA 4DNOA 1P0FA 1T0PA 4KQXA 3CSUA 4MWZA 3KJGA 4IX1A 4B4VA 5ITWA 1YBHA 3SDZA 1DMRA 2VIIA 3DFIA 5E3HA 2O7QA 3IXLA 4BX2A 1G5QA 1SC9A 3JSXA 3EXFB 4MKIA 5CTAA 3WMGA 3QELA 3ZH2A 1MH9A 2EBWA 3IHWA 3U17A 3WNZA 3ZDQA 1UEIA 4CMJA 2FOXA 1IYZA 2KM1A 4DRXA 2MYTA 1B1CA 3P2JA 4DA8A 2VRNA 4PVDA 4P4GA 3A37A 3NAMA 4I9GA 4P81A 2C5AA 2DQSA 3HFRA 2CL7X 4L8VA 1Y33E 4D99A 5MDHA 4V3CA 3MOSA 4JEUA 1QF9A 1G20B 5J58A 2AMLA 2GXQA 2OP0A 4MWCA 3PRJA 4UEJA 4BNXA 2R5NA 3R74A 3CRW1 1NQOA 4R2MA 1H1LB 2FQXA 1L5LA 3SLRA 1FFXB 3WL5A 3LDAA 1L5HA 1XELA 3MPUA 4XLLA 3KXIA 2WJIA 1W36B 2G63A 4ZT4A 1AT1A 1DEKA 2H2GA 1R0YA 4BGIA 3PT5A 3OURA 3PRHA 4XRRA 3TIGA 4QIHA 4TQUS 6NULA 2ACWA 3R77A 1T10A 4C21A 3INRA 4LJ9A 2CBZA 1KVUA 1RZUA 3STXA 3K0SA 3ZZUA 2O57A 2GPTA 1GNQA 2PS3A 2HUPA 2BZSA 3VNSA 3EAFA 1E92A 4O0LA 1NW5A 2B83A 3T1NA 2MINB 5KB3A 4HQ0A 1OFUX 2BOVA 3JQAD 2GLXA 2O48X 2NYVA 4DA6A 1XAGA 2NPIA 3BFVA 5ALPA 1WETA 4TMTA 3T7AA 3WGOA 5ESXA 1EQ2A 2HADA 2LV8A 2O2JA 3KZMA 2P41A 3M6IA 4LYFA 3U3ZA 3D4NA 3WWOA 4E03A 3IE1A 1L4MA 3U7GA 1N1MA 2XH8A 3WL6A 5LP6B 3B2EA 1ULSA 3QE9Y 2JCGA 3KOUA 4E3WA 3QVXA 5JCOC 4J2OA 1T5LA 2H3EA 4AN4A 4LY0A 1M33A 5C35A 5J4LA 4YI3A 1NSFA 2C2HA 3ANNA 4RPCA 2I33A 2ES4A 1QYIA 4OVKA 1MAHA 1YKSA 1SCUB 3WAJA 2YC2C 2IHBA 1PTKA 3F3SA 5CCDA 2J3JA 1B93A 2QORA 3FIUA 5A0TA 1N2EA 1Z39A 4ZZ2A 2F1HA 2GPWA 4YCCA 1D1TA 3H6HA 5ICFA 1MX5A 1A7KA 4JBWA 1AE1A 4A16A 4CF7A 2OORA 4AJPA 2HQ1A 3O3MB 3ZE7A 2R7KA 2XQGA 3F6RA 1P8AA 4A9AA 3OOSA 1ECPA 2FV8A 4NESA 1O97C 1X1QA 2UAGA 2FEPA 3AR2A 3NYWA 2F9LA 4YRZA 2CLIB 4FSXA 4UFPA 4YAUA 4CN9A 2ZQ5A 1LEHA 3A9RA 3G2PA 2BMWA 2PGIA 5AJHA 4LE2A 1H2FA 3UENA 4EYQA 4EZEA 3GZ4A 4IH9A 4LMAA 3HCBA 1Z8FA 3LGSA 3V00A 3R8XA 4B6SA 3HK2A 4B09A 4EYSA 3DKIA 1FFYA 3EIXA 3QV2A 4G01B 4GQAA 3ZXXA 4JBXA 3K1TA 4OYHA 5ECDA 2CXOA 3I9V6 3L1JA 4XFDA 5A62A 5K4HA 4AKIA 3KJHA 1TPYA 2O59A 1N75A 1QVWA 4UHBA 2JFXA 1ZJZA 3MTAA 1NJGA 3I28A 1YR3A 1V5GA 2CUTA 3SS8A 2GYWA 1SQFA 3DHVA 3L4EA 3UY4A 3WKBA 4ZN6A 3HKEA 2HIMA 3MUFA 1U7UA 2NSDA 1FVOA 3MAJA 2JG3A 1N8TA 3K05A 5J5CA 3QA9A 4FILA 3AIIA 1W29A 1P5ZB 1I7NA 3RTEA 4ID9A 3RK0A 4ZZ1A 1M2FA 4KUEA 1YQEA 1DINA 4KR6A 1Z6ZA 1U7DA 4CF4A 1K4YA 3BE6A 1K98A 4NECA 2HNBA 3NC1C 1ISFA 5DI3A 3R7FA 1NRXA 2HIHA 3CZ5A 1EVIA 3TZ6A 3WISA 4BJHB 4WBNF 1C3VA 3OWOA 2WWRA 3RAPR 4CCSA 3O3CA 4OFXA 2OYCA 2F00A 2JD0A 3PQEA 1CC1S 2XQIA 2OCXA 4DR6B 2QE7D 5F7XA 2BFEB 2IW1A 5BN4B 3UQZA 4ERNA 4ZZIA 1NZJA 2ZSEA 3NB0A 4YVFA 2PKEA 2HZ7A 5GQSA 2ZJ5A 2LCQA 3WGUA 5DFAA 3EGDA 2G4VA 1M6WA 4US2R 4BDSA 1UMCB 1R5JA 3D4BA 5EJGA 4JI4B 2DTDA 1Q22A 3AM4A 1A50B 1TT7A 4I3HA 4Q6WA 1JIIA 2N1BA 2YW2A 4M1SA 4JLVA 5LNK6 1IN6A 4ZVKA 4KPEC 4IV5A 1QG0A 1FNSA 3M5WA 4BO2A 1TO6A 4S1VA 5BQPA 4CR7A 1VKHA 1BJRE 3GJ7A 2AR7A 3HDJA 3HWSA 1THGA 3K70B 4PW0A 3L8ZA 3RVPA 4D5GA 5AM5A 2G76A 4IXTA 4NZ9A 1CCWA 2AQ8A 2C07A 2IXDA 3AUFA 4BN5A 4LKOA 5B1SA 1SCQA 3BH6A 2ZYAA 1IVYA 4HLQB 4BB0A 1TE2A 5SYNA 3IBCA 2YVLA 1EJ0A 3DBRB 3FVVA 2ZTUA 1S3FA 3C6YA 4RV5A 2ZU0C 3GHHA 5IHXA 1ILEA 4UEQA 1I2DA 4Z7NB 2QD1A 4RK5A 2BKVA 3CCBA 2H1IA 1OW3B 1WP9A 2MSWA 2QT1A 3C3XA 4KE8A 1F3OA 5LFAA 2BFEA 4MUBA 1PL6A 1WRBA 3PPIA 1E96A 4BCDA 3BGWA 1FIUA 2PS0A 1ORRA 3NRJA 4EEXA 3WBKA 1Y3CE 4Q3DA 2XWPA 2VN8A 1DQRA 3ND6A 3ZTYA 5JT1A 5DLDA 3N2GA 5AUPB 5ENVA 4TV8F 3UTCA 1OLSB 1W1UA 3CWCA 1T0IA 3TR0A 3FVQA 1GPMA 4C3ZA 5JZBA 3LBIA 3SSNA 5KZMB 5ALTA 3FKSD 2V7BA 4RXMA 5EPOA 1ACLA 4NBKA 5DASA 4B46A 3FMOB 1MKYA 1AXEA 3ZZNA 3JTEA 1WA5A 1XTRA 3AKYA 3QH4A 1DADA 5LU8A 4HAXA 2I9KA 5TRTA 1CR4A 4M7WA 4GI7A 1Q1BA 1EZZA 2VSOA 3HCCA 1PZFA 4GOMD 5TJ9A 1DU4A 3SOPA 2F7SA 1CUZA 5J9FA 1AS2A 1Q57A 1Z62A 1VMAA 1PJ2A 3O1LA 3L6DA 5IW8A 5GZ6A 5A9RA 4XYGA 1XCJA 4CLDA 4PHCA 3OZBA 4FYYA 2XGGA 4FONA 3NLLA 3R5SA 4K9PA 3SHVA 4EW2A 4RL4A 2KW5A 4II7A 4TQ9A 1ZS9A 4BNDB 3FPSA 4OQ4A 3EZ2A 2V6MA 4CFZA 1B3BA 3H8SA 2FA9A 1T2EA 1TADA 3M6VA 1XLTA 4LXHA 4IOMA 1SBZA 4DB4A 4MB2A 1RPAA 5J1TB 4NY1A 5JAHA 1E60A 1BE8A 5FTNA 1SUEA 5LQUA 4L5BA 4EKIA 1RQ2A 821PA 2O1WA 1LGYA 1DCFA 3KZOA 1N9ZA 3ZD8A 1P4RA 1WPXA 2DPGA 5F98A 2P9ZA 3L46A 5E6SB 3RWMB 4CJXA 1NQVA 2AFIE 5IG2A 1COZA 4ALNA 3CW2A 3VRHA 5A9SA 5BUZA 4M60A 4Q9KA 1P6UA 4IDPA 4S3MA 2BJHA 3PHCA 3OEHD 3FB4A 3LT4A 1FJHA 1XJ5A 4I50B 4S0ZA 2J5KA 3NKLA 3BX1A 1BMDA 4XDHA 5LR6A 3H17A 1I13A 4A8TA 3QIVA 4AROA 5LQJA 4Q3AA 4D8WA 3EHEA 1KRWA 3ISVA 1UC9A 2FPKA 4YXWD 5HKAA 2IP2A 1I10A 2J9YB 4TUYB 1UPXA 5B30A 1TFUA 2BFPA 3QOXA 3SXJA 4FYVA 4Q3LA 3QLVC 2I1QA 4X93A 3TTWA 1JYFA 1Z4OA 2C9CA 3H1GA 4Q34A 5G41A 5JFTA 2YJZA 1QRAA 3EJWA 4FS8A 3AEQB 4IQFA 3KO8A 4JLWA 5DNAA 3GUCA 1Z2OX 2CNOA 3B53X 1ESZA 5D85A 1DC6A 1E6KA 1OIXA 3MLBA 4YRPA 3X2EA 2PUJA 1KY4A 5JSUA 1NUTA 2OBLA 2X8JA 3E35A 1C7JA 1AHIA 1W6RA 2LCFA 3BAFA 2QTRA 3LM8A 2C2GA 2OLKA 2VLIA 3L1VA 1FYWA 1O77A 2W0SA 1QP0A 3SHOA 2WT9A 1HFWA 2VTVA 1YOBA 3D5TA 5J2TF 4MRMB 1JA1A 3DZKA 3D59A 2Q7DA 1L5FA 2RGXA 2G04A 3FNFA 1NLYA 3M0EA 3WVNA 2VRCA 5IM4A 3V3KA 1PR1A 2A86A 1F3LA 3GU3A 1ZXLA 3L0YA 4V0QA 3DC7A 1H8HD 3G5TA 2RB4A 1XVVA 2C29D 3D2LA 2WTXA 3E2PA 3LG2A 3NIBA 4NEGA 4TN5A 4AD8A 2XBUA 3ELYA 3WHPA 4AICA 2WJPA 5HUHA 2CWDA 3HP7A 4LGMA 4DWVA 4POOA 1E7WA 1A9YA 2HAEA 3SXUA 2R79A 5IDQA 3ZGYA 1FW6A 3WV5A 5KNBA 1J1UA 1EAYA 1NLMA 1SVSA 6Q21A 4K6KA 2CEKA 3U5ZB 4Q00A 4OFZA 5IUNC 2E6KA 3W7BA 1YRAA 2FWIA 3F2VA 4NBRA 4X5OA 1U11A 2Q5CA 3VO2A 3Q6MA 2ZAGA 3BIWA 3BK7A 1MDBA 2RHOA 4KXVA 2Z2KA 4PX3A 3DP9A 3HYLA 1APBA 1AQYA 1KGSA 2FLVA 1GFZA 2QTNA 3QKRB 3HVIA 1E5DA 4LI3X 4EG1A 3EXIB 1ZUNA 1N7JA 2BKXA 2UVPA 3UKJA 3A6EA 5B1HA 4EB8A 4RTSA 4CIDA 2C3MA 1XDUA 1X80A 3QTLA 3DBHB 3HQ4O 4FZVA 3KVRA 3SX0A 1RPZA 1GAXA 3M1YA 1PYDA 3QRWA 4WOPA 5CLLA 1QCYA 2RH8A 3HR4A 5M5BA 1I4OA 2PZBA 4TLDA 1O8BA 3S1AB 4WK4B 1EE2A 7AT1A 4DQLA 1I14A 4YC7A 1SU7A 4B73A 4E30A 3O73A 2FY8A 5FPPA 5CHYA 3GZNB 4ZODA 1QHNA 3CH7A 2Z6UA 3ITDA 2E4UA 3V1TC 1ZCJA 4A82A 1A9QA 3EYAA 2JLVA 1WVMA 1X19A 2JF0A 2CC2A 3L0SA 4UCXA 1OXXK 3T7KA 2ZJ6A 4KFUA 3NS7A 5FULA 4N0EA 3X44A 2Y1KA 4EJSC 1QP8A 1EKXA 2Q5HA 2X1MA 4DEXA 1KDTA 3G7UA 5LA6A 1RKBA 4U02A 4KX3A 3RS2A 1Z0AA 4IF6A 4F4FA 3U39A 2XA9A 3P97A 1NQTA 3QPVA 4MITA 2KLBA 5FBHA 2H4FA 3TPFA 4BRSA 2W6QA 1XZEA 2OHVA 3I30X 4IIDA 3IGFA 3VNBA 4LNUA 1YUMA 2WW8A 4IWYA 4OYLA 1SOVA 2Q07A 1P9LA 2E37A 2GN2A 3TOVA 2DE0X 1ONNA 1EJBA 2GYVA 2LNDA 3FPFA 3GMTA 5EZQA 1A8IA 4A36A 3IIEA 3M6AA 4TN1A 4D3DA 4ZQBA 4Q4CA 1YJBA 1PNVA 1Z0ZA 5LQAA 1GAQA 4K6CA 3GRCA 4RVDA 1C7FA 3DSRA 4ZO9A 1YU9A 4CDNA 3TM4A 5G0TA 5F1YA 2VP9A 5CX4A 2VJAA 1ZICA 2O0JA 4LRWA 1DWOA 3R44A 2IXBA 2ZOSA 3BMNA 3WMXA 3X2SA 3T5AA 3RS8A 1SXJC 1H4VB 2MMGA 2IHYA 2Y9PB 5C7LO 1DUSA 2QJRA 4L72A 4GC5A 1JMYA 2G77B 3PL5A 1G5PA 1GPBA 1QGUA 2D2VA 1DKMA 1DI0A 5EKDA 2CMKA 4KIWA 4WA8A 4ZAYA 3DULA 1I7DA 5F35A 4AB1A 4LF5B 1T5BA 2G4CA 1JZTA 2WK1A 1SHTX 3PHHA 4QU9A 1JG6A 4Y2JA 1QE5A 4V0RA 1Q50A 1PT9A 4DYDA 3GFQA 2WABA 3SQLA 5LNK1 2FFQA 1FMJA 4RHXA 5DN6A 1LSOA 2GPYA 4XIJA 3JVEA 2JFFA 4DILA 4M0KA 1INLA 2BF7A 2P4UA 4PANA 5FOTA 2VZ8A 3JTMA 5T64A 4RTOA 4YV2A 4AURA 3NDJA 2P9QA 1VHDA 3YASA 1DAHA 4EYEA 4E12A 2HYDA 3DDWA 1N2HA 2A88A 1VL5A 5T4EA 5B36A 3DT9A 3TG8A 1BVRA 4LDNA 3EGXB 3MS7A 3ZGLA 3C6MA 1H6CA 3D64A 2BEWA 4OKSA 2I4IA 1XLUA 4UOQA 5BSFA 2FQYA 3B78A 4KIUA 2F3SA 2X9GA 5M7EA 4NFLA 5EE3A 3ZDCA 2G7MC 3LGAA 4OEHA 2C7GA 3HFGA 1TRHA 2HD4A 4PS0A 4ZEMA 4R6XA 2F1JA 4B1FA 2JASA 2UYOA 1JG7A 2ZR9A 1C1DA 2A4KA 3KOXA 5AVKA 1RI3A 2I2BA 4E2ZA 1E1RD 2OCLA 3HKDA 1T8RA 1JHMA 4ZAZA 3EFBA 3CEAA 3LCUA 4I9NA 4A0GA 1BD4A 1XI2A 2I2XB 3CUTA 4JL6A 4JUFA 1VL0A 2W2QA 5AK6A 2P62A 5F7JA 3DQQA 1CX9B 2R11A 1DTSA 3G2JA 4OXNA 1C0PA 4IQ0A 3SVZA 2I55A 1KBOA 4Y2HA 5KNDH 4LQCA 1BKDR 4IKPA 5A9TA 5L7TA 1MO4A 1BHO1 2WILA 3WFIA 4DQVA 2BT4A 4MVYA 3A3OA 4ARAA 1OLSA 2PS9A 3ULKA 2C9BA 2DVMA 5JSKA 3RRYA 4E14A 2J7PD 2Z4TA 3EIWA 3LP6A 4MEBA 4QGGA 2C4HA 4CCAA 1QQBA 1PEKE 3DP7A 1NR1A 3PGMA 4X85A 1Z7BA 1DT3A 5KO2A 4FYXA 3OKAA 3E3MA 3KQVA 5IJ9A 3L84A 3VKHA 3B13B 2C2OA 1RWWA 4N6GA 5I9TA 1J1ZA 1MMFB 1M9NA 4FKMA 4OMFG 3CXRA 1H0HA 3BM5A 4O2AF 3ETCA 3KXKA 4EJMA 1U3UA 3IQIX 4OHMA 4TTRA 4HNVA 3TI7A 1Z35A 1ULUA 2ONYA 2IPOA 3AF5A 2O5EA 4R8MA 2IITA 2YV5A 4GH5A 4RSMA 4QFMA 1DXHA 2H1SA 2GJ4A 2IYUA 3HRIA 3D6TB 2AKAB 3QNMA 3TNDA 2FW9A 4RHCA 4U3JA 2NXEA 5AW1A 2AK2A 2JI8A 1ARZA 1H05A 1VPLA 2L18A 3CVOA 3CZMA 1I0IA 2QLNA 3VPDA 4OQLA 3W1EA 1F7VA 4N18A 3NHMA 4FBGA 3OJOA 2B3DA 2C5EA 4XWAA 3HA3A 1GU1A 3LUBA 1VJDA 2CDCA 3V7WA 5TY0A 2CMDA 4IY1A 1L7AA 2XMSA 4TM7A 2PXAA 4UVHA 3WLOA 5EE0A 3E15A 4EJ0A 1WXWA 1X2EA 3OPQA 5ARDA 5U4XA 5KYGA 1OWOA 4H3KB 1EFPB 1VJTA 4B48A 1P5RA 1DG1G 1TCAA 3U0BA 3NHSA 1SO8A 1ZCFA 4P5DA 3E2MA 3P0JA 4MV7A 1UOEA 4PY2A 2LDXA 3LT1A 4J6EA 3AR3A 4MICA 2WSLA 3UGJA 1U0HC 2CVOA 1PP4A 1HSOA 2C95A 1E4EA 4R1TA 2C4VA 1SVKA 3ZH9B 4TZKA 2Q1YA 5DBGA 2PY6A 1Q21A 4RPJA 2FPPB 1Q3HA 2PM8A 1UKAA 1NBME 2JPDA 3SZRA 1S8AA 3ABQB 1Z7WA 3LCCA 3F5MA 3NM6B 1U3VA 4IDAA 4OBEA 3W7AA 4EYKA 3HXOA 1DV1A 2Q1SA 1MV8A 4HCJA 1D7AA 1DG9A 1UWKA 2ILVA 2O07A 3I76A 1O6CA 3KE9A 3TSWA 1L8AA 4X1IB 2R6DA 2HO5A 2PD6A 4OSOA 4CF6A 2EOAA 2ODPA 4HEJA 2PU7A 3K20A 3ORYA 2F9MA 4HPXB 4IILA 1OILA 2GCNA 2QXUA 2X77A 1RYZA 2FWJA 5DYIA 1I6MA 3N58A 3KWMA 1QAOA 3DAGA 3DR5A 3MCVA 1C8BA 1M0SA 1VRWA 4R71A 1US8B 2WVHA 4OP3A 3RKSA 2EEZA 2WHYA 1QB7A 5G1OA 3Q3EA 2ISSD 3VV2A 5CBPA 3VYRB 1YUBA 3GH3A 4A23A 4DXAA 2XBMA 1II0A 4C7XA 5AVXA 1FDTA 2YICA 1QZTA 2E6UX 3DONA 2D2IA 2YL2A 4BASA 2AUNA 2AN3A 3ACDA 2QVXX 2R8ZA 3OZ7A 2XMDA 3MEQA 1T1JA 2P1DA 2GT1A 1SUDA 2RCYA 2JANA 4WN3A 5EKXA 2X4IA 5E2BA 3HGMA 2B82A 4PYMA 4DJFC 4YMVA 5J2TB 3UFXB 1OGIA 3AEUA 2HI0A 3WB0A 2NVUA 1GHTA 3OEYA 3S1LA 1ZNQO 2WB4A 3BUSA 3GAZA 4RL6A 4TL7A 1TMOA 3QQ5A 5KVQA 2KQUA 2XB2A 5HF8A 1RAGA 3UB4A 3AU9A 4MW5A 3ZE8A 3U7QB 3DFMA 4MXDA 5AJXA 5CM9C 5IC6A 1D5CA 2PT7A 4Z9BA 4NZPA 4AJNA 3QMMA 1RRKA 2B5OA 1B6SA 3NHZA 2IZ5A 1TGVA 4QFBA 4DKXA 5JCPA 4KR2A 2HK7A 4R0NA 4MHTA 4CM7A 1P5HA 5L3SA 2X13A 4N7RA 1AK1A 3AETA 4G5HA 1YVDA 4M1KA 3PENA 4DDVA 4MV5A 3VC2A 4TXLA 3DYBA 4KWCA 4X6YA 2WTNA 3CURA 4LJ8A 2Z95A 2G5PA 3AESA 3EVZA 4M6WA 4LJ6A 1VFNA 3F78A 2XTZA 3GI1A 3S29A 5EJ4A 5AXCA 1MIOB 2CBXA 3BIOA 3IULA 2HK9A 4LE0A 3U3DA 4F4CA 1PEAA 3TSAA 1N6HA 1FFDA 1YVRA 2AYYA 2C9MA 1EWQA 1N0IA 1NW3A 2Z58A 1YB1A 4DA7A 4O4LB 4GMDA 3OUTA 4IJWA 1KE2A 3AF3A 1KOGA 1I1OA 2O1XA 3CKMA 1U7ZA 4OKNA 1L4EA 4OOFA 4HG2A 3RV4A 4RHTA 2QUHA 5D3QA 4HXYA 4NNPA 3C7DB 2HOQA 2GM5A 2JK0A 2JIMA 3C39A 2DY0A 1G3RA 1PFVA 1W85A 3CKKA 1DJOA 1YS6A 4AJ4A 5C8YB 1RJFA 2OCKA 3JVIA 2B1RA 4JYMA 4TKMA 1WMFA 2GF0A 4YUWA 2HL6A 1VKNA 5AW8A 2B8NA 3VKUA 3WHKA 3Q12A 5CURA 3GLGA 4KGXA 1HTTA 3DZCA 4KR3A 3A14A 2VTBA 4W5JA 1JQDA 3A4LA 2IFTA 2WJ4A 3AUTA 4FJ0A 2NZ2A 1V8FA 1BXRB 2HWYA 1YZFA 1MHPA 4LE1A 3GK3A 4AP6A 2H06A 2OPHA 5KKNB 1ZD5A 1IQPA 1JQKA 3A0UA 1ZW1A 4OD0A 2D06A 2B8WA 4ATNA 4CCWA 3WY9A 5L3RA 2OMKA 5KSPA 4O0MA 1BE6A 3IBSA 1I24A 2K7ZA 3N0VA 5JZSA 4GMFA 4CG0A 1GR1A 2QK4A 3EGOA 3TBKA 2EW1A 1Y0BA 1NF8A 1J5XA 3HKCB 1KC3A 4LJ7A 5I8PA 2MSDB 1KYIA 2GJSA 4UNSA 3TRKA 3A9TA 1TQ6A 1QH8A 2AW5A 3F98A 4IEEA 3SJAA 1JDVA 4IINA 1TYEB 1DHTA 4NQRA 3CU5A 3IAXA 4HGQA 4WJZA 1PWEA 4N0PA 2QV7A 3G9QA 3M5DA 4Y1EA 1L1FA 5BR1A 4IGKA 1TFRA 2F17A 3BXOA 4KK4A 2QRPA 1GG5A 3DE3X 3WRWA 4P54A 4J07A 4QYIA 5DMXA 4DIKA 4RENA 1XZJA 3S81A 2VHUA 3T5DA 2FZ5A 4X1KB 4L5YA 1E6MA 2G7ZA 2BI7A 3OG9A 3CSDA 3UWPA 5CD9A 4MVJI 3LY5A 3AR5A 3SQMA 2VSXA 2QTTA 3RJ5A 4D6XA 1AF7A 4MWSA 1KBQA 4TMWA 3H9CA 3Q0IA 4L5AA 4DARA 5IXYA 5CFRA 1E1NA 2DBVO 4TT3A 1VYUA 3F5SA 3JW8A 2P6MA 2QDKA 1H8ED 3P9QA 4NDAA 5AP9A 5AI5A 1CUJA 2P2DA 3N76A 2C4WA 2LWIA 3QU9A 5JJIA 4J90A 1PWZA 2O5CA 3HKDB 3MJCA 2XQVA 2NVBA 3PGVA 1QV6A 2QN1A 4JU9A 5CPBA 3BHJA 1A97A 3OE1A 4BVEA 4YAIA 1C7ZA 2MHCA 4GI1A 5ECWA 2WQ6A 1KF0A 5E9WA 3ZI7A 4AAYA 1D1QA 3GL9A 3T1QA 3QVSA 4UTNA 4EAAA 3MJRA 2DLCX 2IUSA 3MN1A 4DMCA 1U1IA 2DMRA 3AIMA 1LQ2A 1AUOA 1CY6A 5CVJA 1RPNA 3ELBA 4XSVA 3PDIB 3GA0A 4Z9YA 3AHCA 1EG7A 3V8RA 4QLBA 7MDHA 2ZBDA 1TU4A 2CVFA 2QUAA 1VI5A 4GKVA 1M6EX 5EVCA 5FJJA 3DUWA 2WF7A 4R68A 1JS1X 4V2IA 4W1PA 3L4JA 2K2QB 3PLAE 4IFBA 1XTBA 5CD1A 4F6LA 4HLUA 3JWEA 1M34B 4FZ3A 2YYZA 4MQLA 1U04A 5AJVB 3DAYA 3E6AA 3L92A 4FSDA 4XAQA 3S8MA 3KKZA 4DOMA 3I5YA 4LFBB 5GINE 2PYDA 4L4SA 3TTUA 4O3FA 4Q7JB 3VYWA 2VH5R 1E0DA 3DQZA 2ZIVB 4X54A 3JR3A 1E2LA 3AJEA 2GPSA 5BMOA 3L7OA 2PLRA 2H5JA 2PWAA 3HZOA 1NVEA 3FJOA 4PSVA 3ZK8A 3EPLA 1S3GA 2FTKE 3G2LA 1G55A 3I2IA 5AD1A 1IB0A 2WD7B 2WDZA 521PA 1LX7A 2A7XA 1W4CA 1RYYA 4MR9A 3JR7A 3MTEA 5FUWA 3SZMA 1WMEA 3LIPA 1FDUA 1I1QB 2G1KA 2J46A 2P6NA 3D8SA 4IV8A 4N8DA 3WGQA 3DOUA 5KYTA 5HM8A 4NYMR 3QU2A 2W4QA 4NENB 3U6BA 4KGVA 2PXXA 1EWTA 4OGKA 3N6RA 4FNGA 1NW8A 2IXFA 2EIXA 3HN2A 1NVXQ 5IDYA 4IIJF 3TD6A 4GKAA 3H2YA 1PL7A 3CA8A 2R84A 4EENA 1PYOA 3VSDA 3AVWA 3AL0C 5F64A 1D03A 4CEHB 4KP7A 3QUTA 2A9PA 1Y9DA 4K9QA 5ECGC 1GA6A 2OV2A 3TWOA 4P3PA 2O9JA 1W48A 1LQUA 3GLIB 2GKGA 2O2DA 1HYQA 1D2RA 4RGVA 2FR8C 2XF8A 1NSTA 3PD1A 1B42A 1W2WB 5F3WB 4XGKA 5ALXA 1L4GA 4C0KA 3HBLA 3QMVA 1HDYA 1DIBA 1HBJA 3AY6A 1B6TA 3JRWA 3PC8C 4KOEC 3ZVRA 2W2PA 1QJCA 2CYAA 1MO3A 2FWRA 3UMJA 4INPA 1KAOA 2OVBA 1Z45A 2ADOA 2ZJ4A 1HEUA 2PGJA 3LUKA 5HGXA 1RYHA 2UUCB 1K6EA 2AZTA 1KH3A 1RW4A 4ZCRA 1ZKDA 3AVTA 4HSGA 3MJVA 5CT9A 4D0LB 3U4AA 2XKKA 5JO0A 3A0RB 3U48A 5DNCA 1PT6A 1UUFA 3RTBA 4OQQA 1YBVA 8ABPA 5CT8A 4P2GA 2C5HA 1U7HA 1G18A 2G17A 5JU6A 3PFFA 1BFUA 1EI9A 1RCUA 4N41A 3WGJA 4YDRA 1B8VA 1HE1C 1RKQA 2BFDA 2OHHA 3LYUA 4XM0A 1VA4A 3TEJA 1FW8A 1UPUA 3LA8A 2KHZA 4EHAA 2PL1A 3TGWA 3BTUA 4J0EA 1B7GO 3K0AB 2YS7A 2JJ8A 2YWHA 5D00A 1L5RA 3QUAA 2GF2A 1G60A 2PO7A 2A67A 1MOPA 1D6NA 4G9BA 4RVHA 2W48A 2GOYA 4QRDA 4BHTA 1DELA 3IMCA 2NMVA 3GPDG 4U2FA 2NO6A 1N6NA 1N8SA 6CHYA 4EKEA 4MPPA 3A6HA 1GZ5A 2WTBA 4QOEA 3MJSA 4KXNA 3BWEA 5BSEA 1JX6A 4OXXA 3GDOA 4Y30A 3VPXA 3WDLA 2GBCA 5B3JA 1KJIA 3BXZA 1KP3A 2DKNA 3DL4A 3ZZ0A 1OI3A 4DR7B 4J4BA 4KZPA 4LJYA 1Z4QA 1S9HA 1OROA 1YL7A 2O7VA 4X6XA 2DUNA 3DOOA 4WOCA 3ZW7A 4EF4A 1LA2A 1OV4A 1Z18A 5JBIA 2I4LA 3WZ2A 3CPJB 2PKQO 2XTJA 3AM5A 3B70A 2C5LA 3NWBA 4MW2A 5ELMA 1GQFA 2X1HA 2I65A 3FMPB 1U4OA 3HU3A 3W78A 1QHEA 2ZVJA 3AI1A 2DFLA 3L0DA 4FK8A 4CM8A 3HADA 4ZGBA 3USCS 4HEA1 4Y6QA 4F2DA 3PNSA 2FSVC 4NK5A 2JVIA 1E6UA 1JKIA 1NW4A 4IIEA 4KWIA 4V0ME 3K6SB 1TZKA 5IKEA 3S2EA 3RJMA 1TYDE 1F0KA 2DUJA 1F9AA 3C3PA 4N12A 4B4DA 5JI3E 1CUGA 4PNPA 1UBEA 5IJ0A 4QAJA 4IJKA 1N3YA 1EIZA 3BIXA 3EDMA 4XD7A 3ADDA 2PUDA 1YC5A 1Y8RB 1CVIA 2VTEA 1KIMA 1RYFA 4K8OA 4TLBA 4NCJA 2B8EA 4TTSA 2ODNA 3OEWA 4DCSA 4O4IF 3K8OE 4WT7A 3DMYA 5CA0B 3DBOB 4YJ3A 5ALGA 1IM2A 3E27A 4JKOA 3V2GA 1QIKA 5K3FA 2AG1A 5IVIA 3RUPA 1O8CA 3G85A 1OC2A 3PCXA 721PA 4V0SA 3NNNA 3J7AC 1AQ6A 4MR9B 3IAEA 3UHFA 2ZBGA 4PLWA 3VSAA 4OHVA 5AI8A 1T0JB 1O97D 2BM9A 4XX0A 4DRYA 1F8XA 1EK1A 3DCYA 3Q3VA 2ZK7A 4RNCA 5A06A 2X5KO 3T15A 2IKQA 1X8LA 2QD5A 4Q3BA 4KVZA 2ZI9A 1UM9B 4OF4A 2GGSA 3TYXA 3ZD9A 1JHDA 4JUCA 5JDCA 4GW3A 3A7EA 4D6YA 5I8WA 1OT5A 2CMGA 1XCGB 1RAIA 2XNDA 3EEYA 3H1FA 4NR0A 3GA5A 5DSZA 3F9RA 3RRFA 3W5JA 5IAOA 3LVQE 1PZXA 2C31A 4YAGA 5MFPA 1LWOA 2EEPA 3OA2A 3QFFA 4EVSA 4RV4A 2PV0A 5LOVB 2JAUA 2X15A 3H83A 4Q4DA 3AXTA 3EF3A 1CEQA 4J0IA 4IXDA 1EFKA 3WMEA 3V7NA 4F4UA 3I9KA 1NW9B 4LOJA 5DM70 3WV4A 1KI1A 1O95A 2VC2B 3PEEA 3UM9A 5ESRA 4RD4A 4TQGA 5AVVA 1DPGA 3ENQA 2D5AA 3PFIA 4YP9A 3A31A 3RRJA 4WESA 3Q5EA 1K9VF 5A7FA 2C83A 9MHTA 4WLFA 4Y6RA 2EJWA 1A5ZA 2WKQA 4OMDA 1FVFA 2WFLA 2XVMA 5ITZB 2O0HA 2QM3A 1L7XA 2AD5A 4Z7OB 1J2RA 2JS7A 1NKVA 3VJLA 3SIPA 1VSVA 5A5GA 4MUHA 4RH3A 2CHFA 1M74A 2N3ZA 1T2VA 2QL9A 2VZEA 3GCDA 1ZXXA 2P2LA 4RMGA 1NP7A 1RMTA 2F1RA 5EZSA 4LTNA 4ER3A 2QR5A 4GPD1 4UE6A 1V5FA 1AV7A 1I4TD 3H18A 3MD9A 1KDZA 4MV9A 2FPOA 2UYGA 2PTHA 3PQ3A 3GJZA 4NU0A 4MI6A 5HDBB 3GLHA 2JEOA 4YYEA 1PV4A 3IP5A 1FQJA 2ZRBA 3KYDB 4J9UE 4RCZA 3KWLA 3TQOA 1J22A 5KQLA 3COSA 1T2CA 1T8WA 3B7GA 3JCZA 5TE9A 4P7FA 1LF0A 5TX7A 3TBFA 4B6RA 1E2DA 1W5SA 3BRQA 3IOBA 4WINA 2WWVD 2OXEA 4GWKA 1C50A 1OX4A 1ZNZA 3D4IA 3FVWA 4ZTBA 1AOXA 2FSGA 2V98A 2ZYVX 5T8KA 1E1QA 5BNIA 2CHUA 3RB8A 1VOTA 1CUEA 4OU4A 3TUIC 2ZS8A 5FORA 4XQEA 4DABA 4LXIA 4KO4S 3TJRA 1BS9A 4HDNB 3W3ZB 3IQZA 5FEMA 3QX3A 3PYXA 1WB6A 4MRRA 1YZLA 4BBAA 5T4HA 3SMQA 3Q3GE 2WJAA 4TKZA 1J9EA 2YUIA 2JL1A 1KOJA 1Z74A 2HK8A 2RI1A 2VJKA 4PGAA 5EESA 3ADCA 4XPIB 1KJWA 1OI2A 2EFDB 4BPBA 2OK7A 3G9ZA 4TVKA 1S2OA 1KRHA 3T4PA 4FBMA 4F2PA 3SJZA 4OY3A 3QWHA 1GVHA 5GM1A 1C0LA 2W93A 3I0MA 2M6RA 1E7RA 2ZI3A 3T94A 3H3XA 1DRWA 2BBOA 3CQ9A 4FFNA 4LS3A 5L3VA 1H0SA 4HMOA 5I4CA 5C4GB 1DWUA 3IC5A 3DXYA 4RA6B 2PN1A 2GARA 2C84A 2GBLC 4BLQA 2X0RA 2XX3A 3AEYA 1QIGA 1G3MA 1E7YA 3VR6D 3GLGE 4P2BA 1CT9A 2GHTA 2NO9A 4CKYA 2ZCVA 4BKOA 5LBTA 5JOQA 2OGZA 4R3UC 4MKHA 1XCPA 2ALJA 2MSKA 2NU7A 3HWWA 4Q02A 3PQ7A 5YASA 4EUSA 5IDWA 5KPJA 5CCXA 2YN4A 2I78A 3I6IA 4HNUA 2J59A 2AJCA 1L5VA 1QLJA 1SNYA 4I2NA 5JTUA 1POWA 3TLZA 5IUKC 3VR4H 4ACBA 2ZRDA 5CEEA 1TZBA 3F3YA 1QP4A 3R0VA 4EY7A 1VG9B 4OHRA 3GBPA 1GQOA 2ZULA 5EXSA 2QIOA 3CLRD 4FD3A 1PG0A 4GSKA 5E7JA 1FYVA 1A4RA 1Y5RA 1JIVA 4WERA 5EE5B 3VKVA 3K9CA 2PV7A 1OVGA 3NBXX 4UMDA 3F6EX 3PXDA 3M4NA 1U81A 3CNLA 4M9CA 3V8QA 2HYIC 4D4MA 5LYJA 5JPIA 4FHEA 4XCXA 3WMFA 1XRLA 5IC5A 2EGHA 2VNHA 4R3NA 3RYIB 2KS6A 5KQMA 3BMOA 4AJOA 1AM4D 3ADOA 3O4VA 1I0LA 1USGA 4CMHA 2TECE 1SQ5A 1KAQA 1SXPA 4LF7B 1ITZA 2NW6A 2VRCD 5DCWA 4EHKA 4Y0NA 3SX2A 5AUOB 1FRZA 1GQQA 1YFKA 2PRSA 3K35A 3LHSA 4AY5A 4F5EA 4TTPA 5C2JB 1SXHA 2MWMA 3OHSX 2B4QA 3K70C 3AP3A 1VXOA 3UXMA 3OQMA 1BKYA 2BR5A 4AJJA 1K7CA 4KDEA 3IAAA 3ZCXA 4KSBA 4QSHA 3RG8A 4LYHA 2AZMA 3VH3A 3F4BA 2FWNA 1KQ3A 2WIBA 5E9AA 4ZRMA 1FYXA 3PC8A 4BBPA 2PYIA 5JISA 1XNJA 1OYYA 3CY6A 5K8LA 4Y0AA 1SRRA 5IS2A 1JBKA 2E48A 2P7HA 3M6UA 4RIEA 1KOLA 1I4DD 1XCMA 3EIQA 1UBUS 2VYFA 2P5YA 3S27A 2VPXA 2XZOA 2IYAA 1ECFA 1LFDB 2QX6A 1ZJ6A 2NO1A 4LBYA 4YHHB 4KLRA 2GCIA 2EJBA 1V8PA 1ZSNA 4F5ZA 3TOXA 3BSFA 2PS1A 1ZSVA 3I8SA 3K4PA 1V43A 3CIFA 2GTHA 1DAGA 5TJHA 2I2FA 2VP0A 3KKLA 3ZEIA 2REXB 4AM8A 5LD2C 2VDUE 1KYYA 2QLJA 1T35A 3NEYA 3VOBA 1TK2A 4GYJA 5A1TA 5AW7A 3JZDA 5I9LA 2DAPA 1GNPA 2G1UA 1CUSA 1G2QA 1NIJA 5FUQA 1FE8A 3F7TA 4U9HS 3ZD6A 1KJ8A 1UK8A 3R7WB 1PV1A 2JD2A 1G42A 1RWBA 3O26A 1GILA 4HFMA 4L4UA 1GYRA 4RCYA 4C4PA 4RM2A 2QZJA 4GMKA 1U99A 3A6DA 4J7AA 4Z2AA 3RVKA 4AF7A 4WMLA 1DX4A 2MR6A 1UP6A 1OR8A 3DYVA 3STTA 1K08A 4C08A 3UN1A 2H7YA 3R3SA 2K2WA 3GBVA 1LNSA 3B5IA 4G65A 3JU3A 4JC8A 8GPBA 1YAJA 2WICA 3PTZA 2BLNA 1QZXA 5JZOA 1E1MA 4FGLA 3R09A 1WSWA 2GKOA 4WW0A 1NTOA 2YDXA 2DKFA 2AEMA 1W0KA 4PYKA 3QBJA 3FYCA 3P71T 4GR4A 5GGXA 1FUIA 3C4QA 1DG3A 3BRCA 4MR8B 1FB5A 3TLJA 3CEMA 2Z5LA 4RVFA 3ICEA 2XE7A 5PGMA 2EKZA 3WYCA 2OFXA 4HF7A 4F7DA 2UXBB 5GIOE 2G1JA 5TQ2A 3INGA 3U19A 5BQ5A 2PIDA 5AM3A 3OTQA 5T7BA 3PPVA 3UWOA 1KWKA 5C4MA 1PR5A 3LX6A 5CFLA 4NMXB 1XRMA 3BDIA 2G9ZA 1WWKA 2XMQA 1PHRA 3MD0A 5G1PA 3ER9A 1ZN7A 3F49S 2HDOA 3HBMA 3K09C 5E1OA 3IMFA 2FLWA 3DOFA 3ROQA 1YQDA 3QITA 4BLWA 5KQGA 4KBYA 2G09A 2WIKA 1BVUA 2FF5A 4B3DA 4BNZA 4YCLA 2XRZA 4AX4A 2KE5A 4KAAA 5HMLA 4HTFA 3CW9A 1EB8A 3GLKA 3L4BC 3QLTA 1IHXA 4A15A 4HQRA 3JYOA 4YPOA 2XCIA 2E5FA 4YPFA 3A9VA 4S35A 2WYIA 3GMSA 1PG5A 3O93A 4NYJQ 1GL3A 5HRAA 5K0SA 5BWLA 4ALLA 1LTHR 4C0AC 4GXTA 1GA1A 4RHYA 1TCCA 4RO0A 5TMEA 3TL2A 1QIHA 4EY3A 3P20A 1YBMA 2GF9A 4QUIA 3UUWA 4UUOA 2DPYA 5MN4A 3WLLA 1U94A 5JFOA 1B73A 3EASA 4OMCA 5KYXB 4DV5B 1XMOB 4C3VA 3BF8A 4H2DA 3IV7A 1KYZA 2O8FA 2IPNA 1YUNA 1QPZA 5ALVA 2IYSA 4WKGA 4BPRA 3WWYA 1KTVA 2YFHA 3EFOA 4O2LA 5LOVF 2VP3A 3INTA 2NLOA 4N4AA 2I8LA 4W5OA 2F55A 5CCEA 2AG8A 5TF0A 4XOIA 4ZHQB 3P26A 5FFMA 3UMRA 4BDTA 2Q3HA 4Q1AA 2QZSA 3WO1A 2AZDA 2VJDA 5ICSA 1XKXA 1CPYA 1EGMB 1LU9A 2ZM6B 1UZNA 4LF9B 4P86A 5REQB 2ONJA 4CPDA 4FDAA 5DO9A 3KQNA 1EDBA 2AOWA 4H0NA 3OD5A 1QH8B 3VR4A 3AVXA 2R00A 1EDZA 2OCYC 3W3AA 4O6VA 2PEYA 4J49A 1PL0A 1ST3A 3S68A 1E3JA 2AE1A 2RHGB 2G9QA 3N2KB 3OCVA 4JHLA 4OL0A 5DBHX 1U0TA 1EGQA 2W2VA 3OQJA 1LS1A 3OQ6A 1XO1A 3GJ0A 3G2NA 3FD8A 3NO4A 4YRTA 3SJCA 4DBZA 5JBNA 3DQPA 2YZMA 3FSGA 4W1RA 1WJGA 1YB2A 4W1SA 4KV7A 1YDHA 1XMSA 3DZ8A 3RFVA 2AJBA 2CLFB 3TNFA 2PR2A 1DE0A 3FF1A 1UF9A 4FINA 4G84A 4X1KA 5FF9A 3UATA 3EZYA 1RC8A 3FMFA 1K8XB 4H27A 4X64B 2E18A 1NXTA 4BXOB 2QYOA 3BGIA 2BSXA 1KMQA 2D8MA 2SKCA 1W47A 2WU4A 4OB8A 1OFHA 5D3MB 3VV3A 2OZLB 1FNNA 1X1RA 3PPXA 2H7VA 3RS5A 4J2TA 1OXVA 4GT1A 2DSNA 5K6AA 1R6UA 3NBMA 1YFLA 1H3NA 4YALA 1KSGA 3ZE9A 2P5SA 2BSAA 5J3JA 4MI3A 4HNTA 3QKSB 1R10A 1Y5NA 2YXEA 3M34A 1T4BA 1NV8A 4C5BA 3UFBA 4HDSA 1X9IA 5AI4A 2EZ9A 1OC4A 3AT1A 3DTNA 3VI3B 1FFCA 4JLJA 2B5WA 4KACA 2TSYB 4XDZA 4HPWA 7ADHA 3ZUGA 3M2PA 1L4KA 5EIFA 5EPUA 4BWVA 4L7QA 2XUZA 2J09A 2VJOA 3QUCA 4DUGD 2JFWA 2ECQA 3HUEA 2BRUC 3WLMA 2VDWB 1YF3A 1UOQA 5JSYA 5AKLA 2P91A 4JSYA 5EMMA 2VK8A 4KQ1A 3EXEB 2JHFA 4M88A 4PQFA 3DPSA 2YIVX 3OTIA 4PRZA 4F21A 5LQKA 2FMHA 2I6GA 2R6HA 4CVNA 1WB5A 1EX9A 2HWUA 2E4ZA 4FZJA 4GX2A 4OM8A 2RIPA 1CFJA 3TPZA 4Z99A 1GAWA 4EUNA 3TZKA 3RTCA 2XMPA 5BUQA 5LWHA 1E3MA 3LRPA 4P4SB 3P1JA 2GZ2A 2Q8QA 2DERA 4UHFA 5FP0A 1VGQA 2Y77A 4CMCA 4YECA 4E31A 1C9JA 2QW0X 4HBZA 1YHNA 4IOJA 2IE0A 2AF3C 1CY4A 4N76A 2HQBA 1JF8A 4B9AA 4I1UA 2XVZA 5DJ5A 2CXRA 1V1MA 1YVEI 2ZSFA 3EW7A 3JQPA 3O91A 2JCXA 2XIJA 3DPIA 3Q7QA 2HWXA 4L6AA 3VH1A 4E7OA 3BGOS 5JXIA 1MJGM 4L8GA 4NJOA 4IXNA 3IBFA 1CZLA 1L0BA 3VR0A 5EIWA 2AH5A 3BTVA 3EODA 1SXJB 3KU4A 3G9UA 3URMA 4W5TA 4FOSA 4L8FA 5DNEA 4D92A 4DM7A 5BW8A 4IHAA 1O96A 1PR0A 2UDPA 1GFWA 2G5TA 1STOA 2VI5A 2YINC 2DHQA 5CIYA 2H1RA 1QNFA 3EIEA 2ZTMA 3VR5H 1NW7A 2BGKA 1A9SA 4XWTA 4ZHQA 2PFGA 5AW3A 5L53A 2JEZA 1LI7A 1E2JA 5GWXA 4B2YA 1X7GA 5FLXA 3BT7A 2NACA 2TMGA 3KCNA 2BF4A 4X20A 4HTAA 2RGDA 2CLLB 3QUQA 3G82C 1R27A 4JOCA 3OY2A 5K7SA 3MLAA 3UJ7A 2A6PA 3NOOA 4WWHA 3DLHA 5T6MA 3O2JA 1QF7A 4DMGA 2LW7A 2GZ1A 3KIPA 5I9SA 3CMCO 2FQ1A 3A1NA 1SIUA 1AMOA 4L4YA 4LAFA 2F8SA 4O5OA 2HM7A 4MJLA 3WFZA 1HSZA 1G38A 3HJTA 4M1TA 4RDIA 4PLPA 5DBEX 4LOAA 3QKWA 1NJ5A 3U7HB 4TWRA 1XZLA 2GZMA 4Z1MA 3ZY6A 5J4VA 1FP7A 2GXUA 4UUPA 3W6UA 4HUQB 3LBFA 3HUDA 3Q98A 4G8CA 4JDPA 1EE1A 1UP4A 1TOAA 2OCBA 3AVOA 3NWEA 2DCUA 2FUG1 4JT9A 5C34B 2FJUA 3ENNA 4U7JA 4DCVA 1YS2X 3BKXA 3C97A 1YKFA 2PJRA 2O06A 4HAOA 1FU4A 4KSYA 3GVIA 4FNMA 2ODQA 3JD3A 1BDIA 2XGMA 4XM1A 2NQ2C 1NNI1 3WOHA 1SAYA 2FGKA 4DA0A 4L8YA 1D04A 5G0WA 4P58A 3RAJA 1VL1A 2YJGA 2WIDA 3WYAA 4JH0A 5HOQA 1S1CA 1S2GA 2MINA 3TUZC 1A7UA 3LY7A 4Y9SA 1J1IA 4I46A 3R7DA 5DISB 1TQ2A 4LQDA 3B38A 2WEKA 1K5DA 1PGOA 1LLCA 1UZMA 3OZUA 1R0XA 3DFFA 1ICIA 3CRRA 5L7WA 4RY0A 2N75A 3N3AC 3V4SA 3FKJA 3ETEA 1SURA 2IK8A 2VK4A 4Z4HA 2CV0A 1N2ZA 3L6BA 3MWKA 5LZ8A 3MYYA 2VT3A 3WWEA 1D4AA 4I4IA 4BN4A 5EJ8A 1X0XA 2LIVA 4R8LA 5JS1A 2GD2A 2NP6A 2DWUA 3OEED 1RI5A 2GKSA 5JAIA 2L19A 2DQZA 3SXUB 1ECJA 3KG2A 3N2NA 1MW9X 1R12A 3F9IA 1H6DA 1BC5A 3E9QA 1PJBA 4FDMA 3RYCB 3N74A 2ZR7A 4O1MA 3WZLA 1OYWA 4DCJA 2UU9B 1CF4A 2Y1LA 4LYGA 1XVTA 3GRFA 2P9TA 1TPZA 2XT6A 2BKAA 2GK4A 2D1SA 2IHJA 2JJ1D 1E1CB 1KEVA 3HDHA 5FTMA 2HRZA 1P61B 1GGEA 3ON5A 1SN7A 5CLIA 4EL5A 1BTOA 1T3SA 2PMFA 1JKXA 5JWHA 4OBBA 5C7IO 5JDCC 4IWXA 3C1OA 1QHYA 1L5WA 2QSZA 2QX7A 2I34A 1LJUA 3WI7A 4LHSA 4CKEA 2BWJA 4EDHA 4ZDJA 3A70A 3O31A 3W4KA 4Z7QB 5JR3A 4D9NA 5K2OA 5IULC 1F0YA 1YQUA 4DMFA 5DWDA 2XHZA 4UD2A 1GDDA 3FSEA 1FSZA 1JR3D 2OBXA 4XUCA 2QAGB 3N2YA 5BY2A 3B1FA 3P4XA 4FJ2A 4LRQA 4ZAWA 1PR9A 3RS4A 2FRVA 5EG5A 2SECE 3P9YA 3ZKAA 3ZWQA 4QOFA 4FQ5A 1ULZA 3R3VA 4BFLA 1UBKS 1VKOA 2FE1A 4DNFA 1AQIA 1EP3B 2EGGA 3ILVA 4MWGA 1QFSA 4LJSA 3C8DA 1HR0B 3AVVA 5HF5A 3JQ7A 3ZU5A 3NOXA 3RKUA 3VZBA 2H1LA 1KFCB 1OXTA 3IODA 3IP9A 1QHHA 3SGLA 1FTQA 3KJIA 3FVTA 2PZLA 1SC4A 1SOMA 5HEKA 3RJTA 2YS6A 3IDSA 3CNNA 3PR3A 3R2JA 4ISBA 2I91A 1QRUA 1EVYA 3L40A 3A58B 2QL7A 2YWRA 3TRDA 4LX0A 3CVJA 3W9UA 1NPDA 1OT3A 2R6GA 2C9YA 3EZ6A 1R66A 4NH0A 1IZ0A 3KR0A 1VGVA 4V1CI 3KZCA 4E51A 4BP8A 1ZRSA 2I6SA 2Q3BA 4ITVA 3ROMA 3OC6A 2JZNA 4TZTA 2Q3JA 3RBAA 3PPYA 4EHIA 4FNOA 2R8RA 1TAHA 1C0EA 3UH1A 3WKCA 1E5XA 2R62A 4UTVA 1RYBA 1S2LA 2QRLA 5J47A 1VRCA 3S2YA 3K2BA 3UKDA 2Y0BA 3IBGA 2AYXA 5ADUS 2UUBB 2ORIA 5C52B 1HL7A 2FX3A 3OKPA 2WUGA 3R3JA 4OTZA 3WYDA 2ZUTA 1OTXA 1XE3A 2BM0A 5E2AA 2REQB 1Y4SA 2INGX 1RRMA 4OHBA 1UT6A 2CDNA 4B83A 2WP0A 2Q3LA 1RWQA 1LRKA 1W4LA 2ZI7A 1ORWA 3QWIA 4MCHA 1KI6B 4GD3Q 5JSHA 1O0CA 4NPHA 1MJNA 4LPSA 3PHBE 1D0VA 4B43A 4WCFB 1QHHB 4DC9A 3THSA 1DUIA 3ZIUA 3UK0A 4YHBA 3BTOA 3CZQA 5IYZB 4R9UC 2YH2A 4Q9HA 3ND5A 3OLVA 2R7NA 3JQ9C 5JCXA 4DTIA 3B52X 4IHJF 3DMDA 1VL2A 3GJ8A 4XWWA 1U02A 4KQ2A 2G80A 4JELA 1HLGA 4ZOEA 1RNLA