1YASA

Hydroxynitrile lyase complexed with histidine
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
256
structure length
256
Chain Sequence
b'AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHKLQLTKTKEIAEILQEVADTYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYDROXYNITRILE LYASE
molecule tags Complex (lyase/peptide)
source organism Hevea brasiliensis
publication title Mechanism of cyanogenesis: the crystal structure of hydroxynitrile lyase from Hevea brasiliensis.
pubmed doi rcsb
total genus 93
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 1996-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1yasA00
4RNCA 4BBZA 1GPLA 3T4UA 1EXWA 4H77A 2HU5A 2XUPA 4F21A 3DQZA 3DEAA 4UFOA 1SCQA 3WIBA 1LPNA 2C4HA 3GUUA 2OAGA 3H2JA 3U0VA 5JASA 2BKLA 4WY5A 2QUAA 4BCCA 3QMWA 2VAXA 1EDDA 1WM1A 2QRUA 3KSRA 2X76A 4G8CA 1ODSA 1F0NA 5CURA 4C87A 3FBWA 2WUEA 4G8BA 2VT6A 4Y2QA 1JU3A 5EIEA 1IVYA 2PSFA 4N8DA 1EK1A 1R88A 4OPMA 2HL6A 4KAFA 3H2IA 1HPLA 2WIKA 3FLBA 1ORVA 5SYMA 4MXDA 5ALWA 2WJ6A 5ESRA 4E46A 2Q0XA 3BF7A 4U2CA 1OXMA 4HRYA 4KEAA 5FV4A 2QJWA 3FCYA 3VISA 3TJMA 3WWDA 1HQDA 4MQLA 2XMGA 4BVKA 4PSUA 1EI9A 3D4LA 5AI5A 4Z49A 4QA9A 4CG3A 2O2HA 2PSJA 2ZYHA 2HDWA 4QDOA 5IVKA 3FLAA 1QIMA 3G9TA 5ALVA 2XT0A 4DNOA 5AI6A 1GGVA 1EB9A 3HJUA 2XQIA 4B84A 5LZ5A 1XRNA 2RI6A 3IUMA 4HZGA 1N8SA 4C88A 1TQHA 1MX1A 3QITA 2ACEA 3I2KA 2WFLA 4X6UA 1PV1A 3O4JA 4UHEA 4RE5A 5AM5A 3C87A 2WUDA 5T4FA 1YR2A 2CKMA 3F98A 2FUKA 3VVLA 4AN0A 4Y2YA 5I9IA 1F0PA 1Q0RA 3PDCA 1ZI8A 4K6GA 3WL7A 2ZYIA 4EZIA 5CT8A 4WFJA 3R0VA 1ZIXA 2XLCA 5CT4A 3VDXA 4BVJA 4HXFB 1N5MA 4EY7A 1ZJ5A 5JAPA 4WY8A 5AJHA 2PVSA 4AO8A 5ALEA 4JUIA 4TGLA 2WQZA 4P9NA 5I8PA 1CUCA 4H18A 1JI3A 2I78A 4BAGA 3STVA 1QIKA 2OGTA 4J0IA 4EHBA 2VJBA 1UKBA 3ZLTA 1UK7A 2RHTA 2HFKA 4QDUA 4CI9A 4YPVA 3GBSA 3X3HA 5AO9A 4OUKX 1JMYA 1XZCA 2VT7A 4FOLA 2CMFA 5AKGA 1K5PA 3BE8A 2QXTA 2IIVA 4B9EA 3QYJA 2XQFA 4L3WA 3CCCA 2C0QA 4BE4A 1EDEA 4I3FA 1QIFA 3BXPA 1JJIA 4Q3KA 3W2TA 5K3DA 2XMBA 4KJXA 1KU0A 5AOBA 1AKNA 3U1TA 3C6ZA 1VOTA 5FUMA 5AHXA 3I2IA 3I6MA 4OB8A 4WFKA 2OCIA 4J0HA 1OCEA 3FNBA 3ICWA 1GQSA 1QONA 2XMDA 5KBYA 2EDAA 1IUNA 5AKKA 2HHAA 2V98A 1QIHA 1A7UA 2BUBA 3TGLA 5CT9A 1DWQA 3T52A 4PF1A 4ARAA 3WLAA 4FWBA 1BN7A 1T2NA 4QDXA 5DNWA 5AOCA 1W1IA 2YH2A 1QLWA 4IQ4A 4YK7A 1GKLA 3DKKA 5T4EA 3I6ZA 1LZLA 1GT6A 1CEXA 3KD2A 5JYCA 4DSZA 1UKCA 2XDWA 4BP9A 4EA6A 3R3ZA 3C5VA 4NMWA 4XJVA 1W6RA 2VSQA 4E15A 4MEBA 1EX9A 3C5WP 1LPAB 2DFPA 4MJ3A 5E4TA 4B6GA 1SC9A 2IX9A 3BF8A 3IB3A 1WB5A 1QFMA 1YA4A 1XQYA 3UMJA 4B85A 2XUKA 5AOAA 5JADA 3CCBA 3GROA 5K3FA 1AQLA 2B61A 3O9MA 4ROTA 3DL7A 1G4HA 1W52X 2WFLB 5IKXA 1J2EA 1EK2A 1CRLA 5JZSA 2JGLA 2FJPA 1NU6A 1ZGCA 5ALPA 3JW8A 1LPOA 4U2FA 1BRTA 3I1YA 4M0MA 3D59A 4QZVA 4EY6A 2Z3ZA 5ALZA 2ROQA 3AJAA 1YAHA 1SOMA 3DLTA 3RLIA 1CUFA 2HRQA 4X85A 5ALHA 3G9ZA 4ZGBA 1AUOA 4RPCA 4PSDA 1ACLA 3NGMA 3PUIA 4KACA 1Q84A 4X90A 1MNAA 4F0JA 5AI8A 4AQDA 5JZBA 2CJPA 1UOQA 2HA5A 3A2LA 2O7VA 1Q83A 4UUQA 4Q34A 4FHZA 4AMZA 4XIIA 4BB0A 2VQ6A 4TPKA 3V1KA 3FYUA 4OB6A 2WHRA 5ALNA 5K3AA 3YASA 5EHQA 1LPPA 5ALUA 4FLFA 4H0CA 4DIUA 5A6VA 2XUOA 5AK3A 2OLEA 3PE6A 1R3DA 1ZD4A 5A62A 1VKHA 1BE0A 3STWA 4Q82A 2GBCA 5EHZA 4BC0A 2ZSHA 2ZJ6A 3BDIA 3BIWA 3OTQA 3C6BA 1DT5A 4H35A 5CT6A 4W1RA 1THTA 1ETHA 3V1NA 3STYA 1BS9A 2JGMA 1XZKA 3ESAA 1XQVA 3WK6A 2VJDA 2WIDA 1R9NA 4ZREA 1XRQA 2QR5A 2OCLA 1FFEA 2HA6A 5FRDA 3WWEA 1ZGBA 5LZ2A 4X7BA 3KWFA 5E2IA 4MWSA 2B9VA 3STUA 1QFSA 3AFIA 1VZ3A 3KDAA 1UKAA 5JAUA 5ALJA 3DL4A 1MU0A 4AX4A 1A8UA 1L7AA 1T4MA 3F67A 1CFJA 1ISPA 1XZHA 5AKXA 1RWQA 4QDTA 4S0XA 4AB1A 1UK8A 2LIPA 5CRIA 4HXGA 1H22A 2AJCA 5JAHA 1USWA 1LLFA 3R3YA 2OCGA 3DJYA 1ODCA 3BDVA 1JT2A 2V96A 2OGZA 1BCRA 4LHEA 3CXUA 1TAHA 1QO7A 4TVKA 1CUAA 4X95A 1UOPA 5LLSA 5JAOA 5JARA 3AZQA 2RONA 3AIKA 1BU8A 1CUEA 5ALQA 1K6EA 1BCSA 3DYIA 3I1IA 4G4JA 4BYMA 1CUGA 3R3XA 5AM1A 4G9EA 2HA3A 2BAGA 2WTNA 1XRPA 5AI9A 1QTIA 4B82A 4EY8A 4CG1A 5ALOA 5FKJA 2OG1A 5D6OA 4BC1A 4DMHA 3WK7A 2B4KA 3WKEA 4X91A 3P2MA 5D3KA 3BJMA 1DTEA 2C58A 1OILA 7YASA 5AKZA 2WTMA 4B0OA 3EF3A 3FYUB 1P0QA 4Y2RA 4E11A 4ZV9A 3H17A 1BROA 1J07A 1W75A 4HS9A 4XWGA 3UUFA 1RP1A 5HKBA 1D07A 3D0KA 1ZICA 2WG1A 3OPMA 5KWJA 1WB4A 5JD4A 4QEKA 1BEEA 3OOSA 3VKFA 3FVRA 4LXHA 4HAIA 5ALGA 1XRMA 3M82A 5IVIA 5EGNA 5ALIA 1UFOA 4PNZA 4UHCA 1XLUA 2GBGA 4IH1A 2WIJA 1CLEA 1R9MA 3C43A 1TK3A 4AZ3A 3KWJA 4LYDA 3BL8A 2Y2UA 4BRZA 4K5QA 1CQWA 2HA4A 4C89A 4W9RA 2AJ8A 2V9ZA 4C4YA 1QIEA 3EIOA 3RKSA 3WZLA 5E4YA 4GW3A 4WDRA 2GZSA 3QPCA 5HF5A 1YAJA 2EDCA 3E1GA 1MN6A 4PSCA 1XKLA 2XMSA 1VXOA 4X94A 4Y2PA 5K3FB 4N8SA 3G0GA 1XQXA 2PPLA 3D7RA 2QJRA 4J7AA 1ZIYA 1SCIA 3ANSA 3B5EA 5AKLA 3I2HA 4IHAA 1AC5A 4CCYA 3BJRA 3K6KA 2JF0A 1TIBA 3IURA 2QM0A 2IITA 3ICVA 1S8OA 2J4CA 2XMQA 1FFCA 4UPDA 4OYLA 4P92A 3G0CA 3R3UA 3I2JA 1ZI9A 3ZLVA 1QE3A 3FLEA 4LYEA 3LIPA 3SC2A 1XZAA 5A7HA 1CUJA 1NU8A 3O4HA 1U8EA 2PSDA 1FJ2A 1E8DA 4LIPD 2WHPA 4Y2TA 1IUOA 2Y1KA 4Q05A 2C5FA 3DD5A 1WOMA 3K9BA 1E89A 4AXBA 3O0DA 4FFVA 5F4ZA 5BOVA 5DNVA 1UXOA 5LYYA 5ALTA 4LKOA 2XQJA 1JMKC 3W06A 4MQMA 2JEYA 3MUOA 2WIGA 4F60A 2GYUA 2C5GA 1L7RA 3HSSA 3WWOA 1LGYA 1A88A 4GWLA 4J0JA 1YS2X 4J0DA 5JALA 2HIHA 2DSNA 3HLKA 2VJCA 3WZMA 3AZPA 1WPRA 5DNUA 1XRLA 4EUSA 2ECFA 5C8ZA 2DQZA 1N5RA 1YB6A 2W6CX 3WWCA 3GA7A 4QE3A 5LZ8A 2PL5A 5HK8A 1XZLA 2Z5GA 1DQZA 2VATA 4DGQA 2XUIA 1Y37A 1EDBA 3AUKA 1P0MA 5ALYA 3G0BA 2RAUA 3C70A 2YASA 3NUZA 2QT9A 3WA6A 2H9YA 4IH9A 3NWOA 1HBJA 1R50A 4K6KA 5KREA 2JGKA 3AZOA 5DTIA 3H2GA 5K3EA 2ORYA 4E14A 4NZZA 5JIBA 2PKYX 4J0KA 4OCZA 3K2IA 5FDFA 2X5XA 1AGYA 5CH5A 5DJ5A 2AJBA 1YA8A 4UBLA 3H18A 2QTBA 3MGAA 4L72A 4X92A 4KAJA 1MO2A 2Z8XA 1TRHA 2EEPA 1AZWA 3W9UA 2AJDA 3DOHA 3KOOA 5JD6A 1DQYA 1XZFA 4EY5A 3VJKA 3GZJA 3H2HA 2G5TA 1H2WA 4HXEB 4DMFA 5LP1A 1DU4A 4IO0A 2Z8ZA 6YASA 3EQ8A 5BWBA 4C4ZA 5EHXA 1DX4A 5AKYA 3LS2A 2V97A 1UOOA 3QH4A 4W63A 4I19A 3EQ9A 1ZJ4A 1BN6A 3DYVA 4OD0A 5ALLA 1SCKA 4H7IA 4GDMA 1VJ5A 2K2QB 3R40A 4UBKA 3WWPA 3FSGA 5D7BA 1RYYA 3W9BA 1QTRA 3HZOA 2OXEA 3W05A 1ZI6A 3WKDA 4O08A 3MVEA 1JJFA 1A8QA 3HRHA 2VAVA 4Q3OA 4KRXA 1XFDA 1LZKA 1G66A 1Y7HA 1WHTA 3MUNA 3QMVA 3LIIA 1H2XA 4M0EA 2ONCA 4QNNA 1ZD3A 1Y7IA 3QPDA 4UBMA 2QKYA 2WG2A 1NX9A 4JNCA 4CG2A 5HFNA 5C8VA 2BGRA 1WCYA 3IDAA 2GBIA 1IMJA 4N8EA 3S8YA 5DWDA 4NVRA 4ARBA 5CBKA 2VJAA 4DNFA 1WPXA 1E3QA 1THGA 4YX9A 5JZ9A 3AINA 3STTA 3FYUC 1LBTA 4G4IA 2WFMA 5HQ3B 5HF9A 4AMYA 3FOBA 1XZEA 2J3QA 2WG0A 1J1IA 2XMRA 1MAAA 3CN9A 4MYDA 1H23A 4OYYA 3M83A 4UBJA 5CMLA 4GHWA 1ODTC 3EBLA 5AICA 5EIHA 5BV7A 3NOXA 1XRRA 1QGED 2Y6VA 5IVDA 3L1IA 4PQEA 2O2IA 1CVLA 2P8SA 1G5FA 4P93A 4WJLA 4FBLA 5C7YA 1GPNA 4Y2JA 3HABA 4UHDA 4PV7A 4F5ZA 5T4HA 1EH5A 1ACJA 3GFFA 4MEAA 1FFBA 3QM1A 4V2IA 4XX1A 5LIPA 5DYTA 4EBBA 3HACA 2XUFA 3E0XA 1GZ7A 1CUUA 1DWPA 2H1IA 4HVTA 3WL6A 3ILSA 3UUEA 2ZYRA 2XUGA 1VE7A 2D0DA 1F8UA 2I3DA 2Z3WA 3O95A 5EIAA 5AI4A 3VJLA 2XQKA 4KAAA 4OU5A 2VA9A 1EINA 1O6FA 2RGUA 3V1LA 4G9GA 4UHFA 5HFAA 4KRYA 5AH0A 1H2ZA 1O6GA 2HU8A 2HA2A 1XQWA 5A71A 3WKCA 1CV2A 2WKWA 3G0IA 2WILA 2XQGA 4G4GA 2CB9A 5ALKA 4XVCA 3F97A 1VE6A 3CN7A 1LBSA 2QUBA 2PUJA 4OU4A 4DMCA 2HFJA 1WHSA 1XZBA 3OURA 5ALMA 3IBTA 2WSLA 3E4DA 4HTAA 4W1PA 3PFCA 5CT5A 4JEIA 1VA4A 4ZWNA 2WU3A 3TRDA 1KEZA 3IIIA 2WUGA 1HKHA 5ALRA 1CUHA 3M81A 5KWIA 2JBWA 5HZGA 2I3ZA 2XUQA 2VF2A 5A7GA 3C45A 3DKRA 3N0TA 4FNGA 1LPMA 1UWCA 4UFNA 4FLMA 4A5SA 1XZMA 4LXIA 2JGJA 1E66A 1QJ4A 4H7JA 5FOQA 2XE4A 5JANA 2WJ3A 1B6GA 5A2GA 3LP5A 2E3JA 4X6XA 5DTJA 5AKJA 2DCMA 1XLVA 2O2GA 4H7EA 4M0FA 2Y2VA 3ESDA 3ZI7A 1GKKA 3FCXA 3G9UA 3C8HA 4BE9A 4B83A 2I03A 5AM0A 4BTLA 3S2ZA 1XROA 4JYPA 5AIAA 4GI1A 5FXMA 4X71A 2ZJ7A 1Z68A 5DYWA 3LLCA 1EA5A 3WK4A 3AIMA 4J3JA 3V9AA 5J3JA 1UZAA 3I6YA 5YASA 4BATA 4YASA 1FFDA 4U2DA 5EFZA 1CUXA 4CIBA 2AXEA 2DQYA 2ZSIA 2ZVDA 4BCDA 4DNPA 1CUVA 3OG9A 5T4BA 3DOIA 1K8QA 4D9JA 1N1MA 3F9CA 3FYTA 2XUDA 1PJAA 4A16A 5FP0A 2DHDA 3HXKA 3DCNA 4H7FA 3A6ZA 3O4IA 4FMPA 1B41A 4J0GA 1E8MA 1TCCA 2W22A 2OPHA 2XUAA 3STXA 3E3AA 2H7CA 4ITVA 3WK8A 1U65A 5LZ9A 4MYSA 2R11A 3A70A 3I2GA 3IUQA 5DYYA 4BZZA 3W04A 3WJ2A 3AIOA 5JD5A 4B80A 1Q0ZA 4FNMA 4BAZA 1CIJA 3OM8A 1CUBA 4JYMA 4CFSA 5BWCA 1IUPA 3ZPXA 2D5LA 1XZDA 5AM4A 3OC0A 1J06A 1XZIA 4DYHA 3IUJA 3H04A 2HA7A 4DM7A 1DX6A 1AURA 4LXGA 2CUTA 3PUHA 4N5IX 2OQIA 1CUSA 2FX5A 4L0CA 3BIXA 3V1MA 3D2CA 5HK9A 1EVEA 3ANTA 5I7UA 4JH0A 1E5TA 2PU7A 5LKRA 4I4CA 4Q3LA 3WK9A 3SX4A 2J3DA 3DS8A 4NS4A 1M33A 3VXKA 5HQ3A 4KE9A 1JKMA 2ES4A 3IA2A 4BRSA 5AI0A 4AO7A 3WK5A 4FLEA 3TEJA 1AMNA 5E4JA 2XB6A 5AKIA 5CH3A 1CPYA 1XZJA 3RM3A 3FSGD 1C7JA 3C6YA 3V48A 3WL8A 3PICA 5K5EA 2HRRA 4FTWA 1YS1X 2XI4A 3H1AA 4H7KA 5CTAA 4MWTA 3L1JA 3FWHA 5AM3A 1SFRA 2PSEA 4AO6A 4G8DA 3IVMA 4AN1A 3G02A 5FPPA 3WYNA 1JFRA 2GYVA 1XLWA 3GELA 2R8BA 3I2FA 1YASA 1JJBA 1ORWA 3JWEA 4WDQA 2X8BA 1U2EA 2PSHA 4EB0A 4C4XA 1MNQA 2QZPA 4PW0A 4FDMA 3HI4A 4UBNA 5AK4A 4U2EA 4G5XA 4W1QA 1ZD2P 3R3VA 1IZ8A 1WB6A 3N2ZB 3QVMA 4BAUA 3D5EA 4CIAA 1U4NA 2CZQA 2O7RA 5AK5A 3WMRA 4A23A 4KR0A 5K3CA 4H7DA 5EI5A 1QIDA 4X00A 3RK4A 3RARA 1W76A 3SK0A 4QWMA 4Q1VA 1IZ7A 4CCWA 4BCBA 1MT3A 3DDUA 2QXUA 5IH7A 4Y2VA 2GZRA 1CUWA 3IUNA 4GEGA 5CXXA 1DWOA 4Y7DA 4QLAA 4QLOA 5LZ7A 1X2EA 5H3HA 1CUZA 5LKAA 2WU4A 4X97A 1CUIA 3H0CA 1CQZA 2J4FA 2PU5A 3C8DA 2UZ0A 1VZ2A 5C81A 2OCKA 1MTZA 2PM8A 2CBGA 4AZ0A 1R4ZA 3G9XA 2BFNA 3I28A 4KE6A 2BCEA 4IH4A 3VJMA 1P0IA 1L7QA 1XZGA 4GBGA 2C7BA 2ACKA 4J0CA 4ZRDA 3WYDA 1UK9A 4K2AA 4DSAA 1F6WA 4DTCA 3B12A 3ZV7A 2YXPX 4DMKA 4U2GA 5ALSA 3VVMA 2XUJA 2GYWA 5JATA 3L1HA 3ESBA 3H19A 4B9AA 1G42A 2DHCA 4GXNA 1XKTA 2QMQA 1EHYA 3QPAA 2QS9A 2WIFA 3R41A 4UBOA 3QBJA 1YB7A 5AP9A 1E8NA 1QO9A 4X6YA 4GECA 3WQHA 3F96A 4UBIA 2HM7A 1GPKA 4H7HA 4BP8A 1GXSA 1PFQA 3G8YA 4B0PA 2XMCA 1HLGA 2HA0A 2PBLA 5D3ZA 1QIIA 2WHPB 1UK6A 3PF8A 1LPBB 2DR0A 1DT3A 3O4GA 2G4LA 3O9VA 5FPQA 5HF8A 3FAKA 4K6HA 5K3BA 4BVLA 3H1BA 1C4XA 2QOEA 5IVHA 3ED1A 1H2YA 1K63A 4FFWA 1FFAA 2VTVA 3B3QA 1CUYA 4Y9SA 1QIGA 1X70A 4QDZA 2RHWA 3QMMA 2DHEA 3ZLUA 2NW6A 2HADA 2BJHA 4CCYB 5C8XA 1HDEA 2BGNA 4DLNA 3HYSA 5HKAA 3SWWA 4UFPA 5SYNA 2JGEA 4X93A 3JYHA 2JGIA 1MJ5A 4OSEA 4BZWA 2WUFA 5HF6A 3WA7A 3BWXA 2XUHA 4B81A 3WIOA 4Y2SA 1P0PA 2H7YA 4INZA 2AJLI 1TCBA 1VXRA 1LNSA 4KE7A 4W1SA 5CXUA 1CUDA 5LZ4A 3A2NA 1YCDA 4UHBA 2G63A 5A7FA 1BEZA 4Y2UA 3QZUA 2PX6A 1A8SA 2OAEA 1MX5A 2CEKA 4X3CA 3ZWQA 2OGSA 4J03A 2HU7A 3Q8WA 4ETWA 1QZ3A 4C6HA 3LCRA 2FJ0A 4N5HX 1LPSA 1AX9A 3AILA 1ZD5A 5HCUA 2QVBA 1YSCA 4KE8A 4U2BA 3WI7A 1CR6A 1QIJA 4RE6A 3Q0TA 4HRXA 3D2BA 1DINA 1R1DA 2XMZA 2ZJFA 2ZYSA 3EQ7A 5AKEA 2Y6UA 2OQVA 3G0DA 5DLPA 3ESCA 2BUCA 1C7IA 5ALDA 5ALFA 4GLBA 3G7NA 4WCVA 4G1FA 1VLQA 4UHHA 1K4YA 1EB8A 2VEOA 3R3WA 1W4LA 5ALXA 4BDTA 3A2MA 4ZI5A 1MAHA 1JU4A 2G5PA 3WL5A 4KYVA 3F8SA 4EY4A 4FKBA 5CH8A 4L9AA 4QWWA 4RGYA 5ISMA 2H7XA 4ZXFA 2XLBA 3WKAA 4DNQA 4B7ZA 4P08A 5FLKA 3C6XA 3HEAA 3H2KA 4OB7A 2B20A 4ZV7A 1I6WA 2JEZA 1QOZA 1FSSA 1VA5A 2C0PA 1KU6A 1UT6A 3IULA 1HL7A 3PF9A 5EHNA 2RIPA 4C01A 2YYSA 3HC7A 2WLSA 3FVTA 1MPXA 1X2BA 3DNMA 4BDSA 1ZOIA 3PI6A 5CW2A 3WJ1A 4PO3X 2GBFA 5AIBA 2JIDA 3WKBA 4Y2XA 3D2AA 2WJ4A 3D3NA 5AK6A 2WHQA 5AKHA 5AM2A 1EVQA 2BUAA 1MX9A 2JGFA 2WFZA 3M3DA 4WFIA 1TCAA 3KXPA 2WM2A 3PFBA 4BTVA 4FBMA 1TKRA 1GQRA 2PUHA
chains in the Genus database with same CATH superfamily
1J0CA 4R9SA 1SC3A 1JB9A 1XHLA 1AS3A 4RZIA 5JJKA 4IDGA 4YO8A 3BXGA 4L85A 4DCMA 4UQLA 4TL8A 1L8QA 1XD2B 4KNWA 4LTNA 1XAHA 1SUWA 3TBKA 4F21A 1E32A 3O73A 4YRSA 5B1YA 4FE7A 5I8ZA 1KK3A 1RI2A 3LF2A 3M8KA 3OHSX 4FZJA 5FOWA 1X87A 3ZZ1A 4JJZA 2XOKD 1ZOOA 2GM9A 1LTHR 5MGBA 1Z56C 2QGFA 3LWNA 1B74A 4P83A 2C4HA 5IUNC 3ZJUA 4R98A 2INGX 3QV1A 5FTMA 4FQ8A 4JJEA 1Z6AA 1ZXXA 2X86A 1CB0A 4B6RA 1ZZEA 1UADA 5GP1A 3FTCA 3AK4A 1GUZA 2QD2A 1DIGA 2VNAA 3DMNA 3QHAA 5B3KA 3IODA 3STHA 4R68A 1L4EA 2JCBA 3QX9A 5KQRA 2ZBGA 4YFVA 3JARA 4ZAGA 2WJPA 5DYGA 5F7ZA 5CURA 2YFYA 2HIMA 2X9NA 3PS9A 5AJZA 4LX8A 3DKVA 4MW0A 2NWQA 4MJ7A 4MR9B 4EB6A 3CVVA 4ZQFA 1QP4A 2FDCA 2VNSA 1O57A 2AVDA 2FFRA 3H9EO 3Q7PA 4YUVA 3Q5DA 1HGXA 4QTUB 4B71A 2JANA 1GEEA 3IAFA 4UDOA 1Z4QA 2J6HA 2UVDA 4L22A 1WTAA 3TB6A 1C0PA 4OPMA 1EE2A 1KKUA 2HL6A 1A04A 3EIWA 4NXNB 3DEHA 1U2TA 5BN3B 2OZPA 3F6YA 3PFFA 3FLBA 3OF2A 1Z2PX 3RR2A 3LDUA 5BVHB 4IINA 1ORVA 2PRYA 4B3XA 4DJ5X 6CHYA 1ZBQA 4FJ1A 2X58A 1VHQA 1N4AA 3WTCA 4MVYA 3T1OA 5H8WA 1YZNA 5ALWA 3T94A 4L28A 1G2PA 1TT7A 2XGOA 3QG1A 3CGGA 2AG6A 4FIZA 5JAIA 3NWJA 1BH2A 1HR0B 3RRJA 1R5BA 1XXHA 2QRLA 5HIAA 4W4TA 2HK9A 1N33B 1QYRA 1F3OA 4P84A 1U5AA 1F2TA 1LI4A 4Y1FA 4ZT6A 1W88B 2WE7A 3PB3A 3CZPA 5DGCA 5L3SA 3IQDB 1GN8A 4BFWA 2PGNA 2CHGA 2ZETA 1V45E 4I50F 1TYDE 5L7TA 3L6RA 3ETCA 2OHIA 4MW1A 3V1UA 3QA9A 3FUCA 1DZ3A 4WLUA 5A1TA 1U81A 4KDRA 3G2MA 1ODIA 2YVQA 3C3CA 2QQFA 3KUDA 3G8AA 4N47A 2V3WA 3UXYA 5H59A 5IT9A 2QTCA 1D4ZA 2H29A 2JCSA 3COPA 4EPYA 1T1RA 1KE2A 3DA8A 5AXCA 3DMDA 2C31A 3VPHA 1ZQ1A 3B53X 1EHIA 4G1EB 4MHSA 1GFZA 1M54A 1TGYA 3H11B 4QICA 1I6KA 2YJZA 4EJSC 1YIDA 5AI5A 3PUXA 4PGAA 4QA9A 2VQDA 4UNSA 5FWDA 5A3QA 5KCZA 1NMZA 4M89A 4YT5A 3T34A 5K01A 4RIFA 4JR0A 5IVKA 3AESB 4KCGA 4ENPA 4HS4A 4JYCA 2ZK7A 4TWBA 2CDNA 5ALVA 4HGYA 2XT0A 4DWVA 5D5QA 3QHQA 2WSSA 4E6EA 3LFUA 1XFAA 2V0CA 3HXPA 2C4MA 1Y9AA 4NJOA 3RU9A 3HJUA 1JWAB 1SUBA 1Z6GA 5B4VA 5CIWA 5J43A 4B84A 5JMTA 1E2BA 1C3XA 4OX9Y 3ICQB 1LX6A 1AQIA 1XRNA 2O7NA 2RI6A 3I9JA 3CNOA 2HHJA 3O84A 4RA9A 5I9SA 2AR0A 3D4IA 3WMXA 5CLQA 3LQ1A 3X2SA 1LD3A 1N8SA 3LKVA 4HZGA 3RIXA 4C88A 4EF6A 4W5RA 1Z08A 1MX1A 3K8YA 2QTWB 3MEQA 1L5OA 3GA0A 1L3BA 3I2KA 4V03A 1TKCA 2ZKLA 1SKUA 4NQRA 1KEEA 4PYJA 1FJGB 4X6UA 2W6NA 3SS8A 2G70A 4Q4AB 1NFFA 2FR8A 3WP1B 4M60A 2JH9A 4PZAA 3E2MA 1NW3A 3BWBA 5DHQA 1AXEA 2MWMA 1E61A 4OOEA 3T3HA 4GS5A 3DO5A 2HWUA 3F98A 1FQOA 3VVLA 5I3CA 4Y2YA 4EI9A 1F0PA 5F76A 4LX0A 1C3EA 3WL4A 2ZYIA 3F74A 2M9MA 2CDRA 4PC3A 4EZIA 1EU1A 3OBBA 1W48A 5CT8A 4D9GA 2WJAA 2D74A 5TF0A 4WFJA 4EHHA 4TT3A 2XLCA 1J1ZA 5K0SA 4NEGA 4ZU6X 2QBYA 1VLZA 3T1HB 3D3WB 2REBA 1GG2A 4JXKA 1SEVA 2BDEA 2XSZD 2JGRA 2J59A 2H3HA 2NZ2A 4G26A 3LBAA 2ISSD 3GCGA 4OXNA 1HKUA 1YVRA 1KQOA 1RKQA 1ZJ5A 2XNSA 3QE4A 1TFRA 2PUVA 1L5MA 4IQ8A 5AJHA 5DGXA 1CY4A 3WV4A 4C6SA 3RU2A 1CDDA 1JXQA 3PQ6A 1AK2A 1J99A 3VPGA 5IJ9B 1JECA 3FHTA 3KYIB 1KOGA 1XKQA 1UJBA 2O0JA 4I1UA 3GDGA 1XIVA 4EMBA 4J7UA 3WAJA 1OH8A 4LHSA 1S7CA 4M7OA 4D4IA 3JXEA 2YJNA 1N75A 1DJNA 4N0DA 1T26A 1B15A 5ECWA 2WQZA 3W5AA 4GG1A 4I4LA 3COSA 3I0MA 1GAEO 4UPEA 4XFDA 2NYAA 3LPLA 2J08A 1JI3A 3FF4A 1RYEA 3PGVA 2CK3A 3W77A 1ECJA 1G98A 1CZHA 1B43A 1G64A 1LRLA 1OFUA 2CE7A 2G17A 2OQRA 2RKWA 2SCUA 1CDEA 3P0FA 4R31A 4J0IA 4YJFB 4EHBA 3M3HA 5ED4A 3R9XB 2HHCA 1EP9A 2JZCA 2Q4RA 1UK7A 2DH5A 2RHTA 3JRWA 3K8QA 4G1CA 4JT4A 3AHDA 4PLGA 3VI4B 5BN4A 1F7VA 1CNEA 1BVHA 3I04A 5IJ0A 4CI9A 4YPVA 2OSVA 4GZMA 2HJWA 4UMVA 4JI4B 4ZO7A 2Q99A 3JALB 4TS4A 5AO9A 5EJMA 3PLRA 1AJEA 1L4FA 1U02A 3CINA 5BQ3A 4HDNA 4KXYA 4BUCA 2VT7A 3KD3A 4HH1A 1E9VA 5LM3A 2B2CA 3AV0B 3VU9B 3BE8A 1QCYA 1Q0HA 2GCNA 3R5SA 1F9AA 1PN3A 1ZO8A 2V7EA 2H17A 2R6R1 1NZDA 1O54A 3QYJA 5GJCA 5H4HA 2XQFA 5CCDA 2DPMA 4L3WA 4BUZA 2C0QA 3F47A 2VFAA 1EZZA 1LF0A 3FWNA 1U94A 4PZDA 4BJHB 4EG3A 4KPEC 3KETA 4BGDA 4LFBB 2G83A 1IBMB 1R5JA 1RWWA 3PPYA 3PZBA 1JA9A 3HKEB 1U9CA 1AIPA 2O23A 1Z6PA 2XB4A 4BHTA 2JGNA 4TX1A 5SYAA 3GG9A 4ZDWA 4ND5A 4JLNA 1NJSA 4K1LA 3MJTA 3BD9A 4RESA 4HAWA 1KI3A 4HHEA 3H5LA 3GF4A 4X24A 5F9HA 5E6UA 3KQWA 1YTUA 2PO5A 2ZM6B 2QTGA 3UICA 3QVSA 5J2TA 1ZN8A 2ZCVA 1RCFA 2JFQA 2IOFA 3CURA 4CT4B 1P9LA 1O6BA 3BL5A 1NI5A 1Z12A 1XMJA 3BXXA 4DC0A 3C6ZA 1HYGA 3M5PA 3OQIB 3BA1A 4REOA 3H6KA 5FUMA 4AY6A 2FEXA 1B8VA 3OFNA 5DLQC 3I9V1 2P6UA 3U49A 2RARA 1HE2A 3DAFA 1E6WA 1QGAA 4OB8A 3VSEA 1SCUA 1GTL1 1JALA 1HG1A 2JIMA 521PA 3WHPA 4HNAA 4S1TA 3USZA 4N7MA 2HMVA 4RVDA 5JFOA 2FMHA 1XA3A 3BRCA 2H4YA 2WTAA 4QXOA 2ZE7A 4HJXA 4IICA 1SBQA 1I24A 2JHGA 4KWHA 2B1QA 4LXQA 3ZV4A 3AOEA 3B6JA 4UZSA 5IW8A 3WP0A 1QHFA 4IVRA 1ARZA 2W43A 1QIHA 1DLIA 1Y3HA 2HSWA 3O31A 3TXAA 4KR6A 1UF9A 3QOYA 3OZRA 4OGKA 3VV3A 4YAWA 5KJ1A 3W5BA 2XE8A 2C2KA 2CSUA 2O1WA 3IXQA 4GOXA 1QZZA 3E7WA 3MAGA 3Q8XB 4QDXA 3FFTA 5AOCA 1W1IA 5FO1A 4EA7A 2RAPA 4R8MA 4CKBB 2IHUA 3B8EA 4OBEA 4MS4A 3W5SA 1U8CB 3UJNA 1THMA 2SCUB 421PA 3C3XA 2VPPA 3KPWA 2TMGA 5JYCA 3CRMA 3DG9A 5LQUA 2XDWA 5D3QA 4GX5A 4JWTA 4RSHA 3TQCA 1OYVA 5K0JA 3D81A 4LV8B 4RSRA 1A0OA 2CXUA 2FPWA 3KK0A 4PXYA 3CC8A 2ZWMA 3NANA 1QS0A 3VR3A 3ZV6A 3MBOA 5HQJA 4K0KB 2WWTA 4EPXA 4NY1A 3OI7A 4ZCMA 5JJIA 3OO1A 1W6RA 1JLLA 1KZYC 3JQBA 3VMFA 4BLVA 4YR9A 5A4IS 5KQMA 4GVPA 1TTQB 2D59A 4Q7LA 3RSSA 1WLSA 3LCVB 5L9AA 1Y0BA 1O5IA 3K2EA 1EX9A 1SB9A 1X8JA 3RT9A 5E8JA 1BHQ1 1XYGA 4BWFB 4R2KA 1SC9A 5DWVA 1KVUA 3DSRA 3I6IA 2IYVA 1SUIA 1UC4B 1WB5A 3CEHA 3TCXB 2P6MA 1FNSA 1QFMA 1K7YA 3WNVA 3CWCA 4UOEA 4TVBA 3E9ZA 1BE8A 3VOSA 2IEYA 1IM8A 1AE1A 1INLA 1X80B 4IIUA 2EP5A 2FV8A 4Q16A 3R3HA 1T36A 4WK0B 4EF4A 5IEJA 2XAAA 2ZSKA 3MTDA 2QPLA 3U26A 1P1RA 3JQDA 2HEGA 1GRCA 4ROTA 3EUFA 4YUWA 1NIJA 3HP1A 4QU8A 2HLDA 3RU7A 4FFPA 2YX1A 3GEEA 4DZTA 1TFUA 1W52X 2WFLB 1AMOA 4F4CA 1JDSA 3QPWA 3KWLA 5AW4A 4YRKA 1G3IA 3GLKA 3ZX4A 3BEDA 3WGQA 1F5NA 2CF5A 1ZGCA 1T8YA 3DZCA 3RASA 1A1VA 2BI8A 4U2FA 5CM8B 2VJYA 2GPJA 2Y4OA 1I13A 1G3MA 5IDVA 3ZHYA 3I1YA 1EYZA 3RJZA 4CKCB 3OIUA 4KQHA 5FI0B 2XCUA 2G08A 3D59A 3IP9A 4QUBA 4R83A 2DFDA 4AY5A 3LXMA 5BSEA 4P4UA 1TLFA 2CUNA 3AOGA 3CYFA 1UKZA 4KIFA 4KB5A 4L51A 4MCHA 3ZBQA 3GHHA 4YTEA 3RCBA 1YAHA 2ZB2A 4IPTA 2BRUA 2X1HA 2YFHA 5HG0A 2C9OA 1SZDA 4E5MA 1BXKA 2VK4A 3D7NA 3THOA 2VH5R 1CUFA 2VZ0A 3DMTC 5ADVA 1KFCB 3G9ZA 3GK3A 4L95C 4TTAA 4L78A 5FLEX 3VDRA 3TR6A 3TTWA 2CJWB 2ZS9A 3A1FA 2VF4X 3AF3A 1KZHA 1KQ3A 2WOOA 3D0RA 1ORIA 3PP8A 3IP6A 1H94A 4EOGA 2NUPB 1EK6A 1Y1KE 4U6QA 5LWQA 1YBHA 2WJHA 1PX0A 3HY3A 5B1DA 4JJKA 4BQOA 3CPJB 3PHLA 1HOTA 1V16A 5FWYA 1IC6A 4B44A 3DB1A 1H1LB 5DHRA 5L3SB 2ESRA 5C34B 2E21A 2HA5A 4UEWA 4BECA 3I30X 3NP7A 5AW3A 1JSRA 2FUG1 1LC0A 3ACDA 3PUVA 1DS6A 2PA3A 1NSFA 3QEMB 1EP1B 4ZOBA 3SDBA 4MX8A 2X23A 2WWVD 1JEDA 4UUQA 2H2DA 3ZJ5A 4K0RA 2A14A 2RAVA 3EAFA 4AECA 3MGCA 4BB0A 1YB4A 2VQ6A 3G13A 1EE1A 2WRZA 3QVGB 4LZAA 4YCJA 3PXUA 3OIDA 4IDAA 3T38A 4B7AA 1YULA 3QK7A 3FYUA 1YU9A 4A0QA 4YNBA 5TGTA 3W3AH 3ZWDA 3RRNA 3V32A 1RAGA 2OD2A 3TLGB 8OHMA 3GV0A 2F9FA 1V9CA 3TLCA 1CS0A 5KWSA 1NP7A 3EVGA 5ALUA 5EIBD 2O2CA 3ZW7A 4IYRA 3EUAA 5AK3A 3QNWA 3DZIA 1YJXA 4LZNA 4Q7EA 2L69A 3PE6A 4KTVE 4OLHA 4YGXB 3HCNA 5P8WA 1GZ3A 3GJ4A 4BO7A 2RGCA 4K28A 5JQGA 4DIEA 4JT8A 4YT4A 4BFZA 2PX3A 2WSIA 4XQGA 1PWYE 3BXHA 4FDTA 4NJEB 1MABA 2GBCA 4GRAA 5EHZA 3H5NA 1H0KA 4AF8A 3TQHA 3LY7A 1CR0A 2NVBA 4K46A 5TEWA 5GOZA 1DT5A 1T9CA 1P5ZB 1U0JA 1DO0A 1QR6A 1YC5A 1Z5GA 1XMPA 2P4HX 1T5IA 4DCUA 1G20E 1O8CA 1XPJA 1VMIA 2GJSA 1DIBA 2VUTA 4PLPA 1BS9A 2JGMA 4WZAA 3SQNA 4LTDA 3SLRA 3V1NA 1AO3A 1YNOA 3OLQA 1J7KA 1KAQA 4HEA1 5KTKA 1JXMA 5FWXB 1XKXA 1Z2CA 3DBOB 3FMOB 3PHGA 2WIDA 4ER7A 2OHXA 2R6ZA 1AK9A 3DPIA 1R9NA 3EZ9A 3M4YA 4MB6A 4ZREA 5C3UA 1E2PA 3AVYA 3E61A 1N2IA 1ZD9A 1X1CA 3CR3C 2FN8A 3K2BA 3E53A 4MV8A 1M3SA 1T4GA 2V9PA 2VBFA 3E05A 3KZOA 1Z6ZA 4GPZA 3WWEA 3TJRA 1KY4A 4GC9A 2RC6A 5KSZA 1X1TA 1GQQA 2B98A 2B9VA 3FFAA 2Y9MB 1MC8A 4GUDA 2YBEA 3QVLA 4KLCA 3N53A 4TQGA 4BB6A 1BSVA 4BEVA 1FEZA 2OILA 3RRBA 3KQVA 2F3SA 3FTDA 2VXYA 4Q1EA 3KDAA 3ZIUA 5JAUA 1EFRD 1CHNA 4RD0A 4UTXA 1DIAA 3DL4A 4XYEA 3FMIA 4BWVA 3ZBUA 2YWDA 4CMEA 1BCRB 4Q21A 5CA1B 3H1GA 1Q22A 4Q47A 1L7AA 1XL1A 1IFXA 5LC1A 3WWZA 4Y6LA 1MT0A 4NARA 4DAEA 3ISJA 3HNOA 3FFBA 1JJ7A 1XZHA 3QNMA 4CM8A 2CJFA 5F7XA 2F4VB 3CZAA 2PL3A 3PNOA 4EWLA 5JSZA 2JL1A 4FPXA 1Y3DE 4KKVA 1F5SA 1BKDR 1Z25A 3SX2A 3TLBA 1G0OA 3OCWA 3TSAA 4I3HA 1TM1E 5JNLA 3MTAA 4O4IA 1NW4A 2XA1A 3HQ4O 1Q21A 1UK8A 2LIPA 4C14A 4HXGA 1G8KA 4XGNA 2QBYB 2I3BA 4J2HA 5JAHA 3TPZA 1USWA 1XCPA 3EVFA 1QP0A 4LJ9A 3KAQA 3OEHA 3QE9Y 1B26A 3DJYA 4ITRC 3V3TA 4DRZA 2OPBA 1ODCA 4P0QB 3JSXA 3N86A 4AJOA 3BDVA 1IXYA 1JT2A 3E35A 2ZUWA 3ZDYB 3ZK8A 1Z7YA 1BCRA 4KQCA 3U3KA 4ECAA 2MSCB 4X1YA 3S7ZA 3T7KA 1EAMA 1JG3A 3CXUA 3Q7QA 3MT7A 1KWGA 2A94A 1B4DA 4WT7A 1Q50A 4ZVKA 2X40A 1CY2A 4WK6A 1EFAA 3RYFB 4C0BA 4I7EA 4X95A 4HNSA 2X2EA 1BDJA 1BO6A 1LX7A 4WOJA 4FWTA 2HYDA 4X1IB 1E96A 1R0XA 1I94B 3VYVA 2OV3A 1C9EA 5K0BA 1FX1A 1DVRA 1PSZA 4KO1S 3VC1A 4JI8B 3KAKA 3NNNA 3WTBA 1XP5A 4AVYA 4CDRA 5C1IA 2OYSA 3AIKA 1CUEA 3M5DA 4G1UC 1K6EA 1BCSA 1KETA 1MIOB 2HUNA 1ZH6A 2NZYA 3CIFA 1A9PA 3CKYA 3DYIA 2PRZA 3DDSA 4ER0A 4BOYA 2NQ8A 4LBWA 3RRYA 2ZSAA 5E7MA 2H07A 3URMA 3F3SA 4U00A 4ZOLA 5JYBA 1JEEA 3A0RB 4BYMA 1RLOA 3T3NA 2BZGA 5A9TA 3PD7A 3EJ6A 3N0RA 1NJGA 1UWLA 3AESA 2OO5A 3CEMA 1M67A 3BL6A 5TMPA 3SFTA 1JHXA 5FOTA 4MKZA 4KLZA 4B82A 4EY8A 2QTVB 2H1OA 1J9ZA 4Q5IA 3T7RA 1SBCA 4B34A 1DRJA 1P0FA 2E4VA 3D6FA 4ZDIA 3N70A 1XJCA 3S3TA 3V97A 3LC1O 1KOJA 4I4NA 3QX8A 4Y30A 2I1WA 4RCYA 5B6IA 1QM5A 3BIJA 1EMDA 3FE2A 3GAMA 1R4AA 4LXTA 1IU9A 1HSZA 1G7TA 3DJFA 1II8B 3LPNA 4NS1A 3ZEIA 3DLHA 5TDHA 5M2QA 3AR6A 1VC2A 4NMLA 4RHEA 2H51A 1K7XB 3PRKE 3TW8B 4RTLA 3IIKA 3D7KA 4MVXA 1NJ5A 5KYWA 1Z9BA 1VPEA 4DLKA 2A67A 3QA3E 2C42A 4MRMB 1QHGA 1IXSB 4PAQA 2O8BB 4B0OA 4JVMA 2AXNA 2R00A 4JGBA 1PDWA 3B7PA 3FNGA 1O0SA 3LC2O 4MARA 2J3EA 4LJKA 4A3SA 1Q11A 4U5QA 3OH8A 1P0QA 4QYIB 2WT4A 4PPGA 2VH1A 4N5MA 1J24A 3L92A 2FZVA 2A6PA 2C07A 2X19A 4RZ2A 4YFYA 1JSLA 3D7LA 3FH0A 1EJBA 2ZYAA 2J0QA 1EXMA 4IHJB 1FFHA 4BLUA 1D07A 3D0KA 1TC1A 3ETDA 4MUIA 3PGLA 4HMOA 5HKBA 1FU4A 3PGJA 1Z45A 2ZUBA 5L4LA 2D2XA 1N1DA 2WG1A 4IYJA 2FW8A 1Y8QA 3OPMA 3QI2A 2D1YA 1CJTC 1WB4A 2RK3A 5DHPA 5JD4A 5KWJA 3AKZA 1T5OA 4C6TA 3LY9A 1V39A 1L8LA 2ZSDA 1Q7BA 4DS3A 1VL8A 1M6WA 2H4FA 3KSZO 1HE8B 3KZXA 3TW4A 2ZZMA 1D1PA 4I1RA 4S1VA 1PWEA 3I92A 4OF4A 1IN7A 5C31A 4RKYA 4XSHA 3RUEA 2ZAOA 4MPRA 5AJYA 1EUQA 4CR7A 3O92A 4UU0A 4D26A 4TOIA 1LLCA 3MYYA 3NEJA 4L8GA 3UAZA 4AY3A 4UTOA 1GA4A 4ZQCB 5IVIA 4NESA 4F9GA 3ES9A 2CD7A 4JJFA 1UFOA 1JFFA 3T0GA 4UHCA 3GGDA 3QYPA 4Y2HA 2GBGA 4C29A 3WLJA 1OBCA 2WIJA 2PIDA 3DXYA 3OT5A 4BP1A 1CLEA 1R9MA 2CNDA 4ZI3A 1JAZA 1EGHA 1YRWA 2YYYA 4TQUS 3ZV3A 2Q1SA 4RF5A 4QPPA 3F1LA 1E2IA 3B3AA 3BL8A 3GLIB 2ACWA 2B6NA 3R0IA 3RB8A 3ROGA 2AQHA 4BRZA 4DVGA 4R6XA 5B36A 2ZXUA 1MENA 4N76A 1EDZA 4OKNA 2EQBA 2B4RO 2KBFA 1XTTA 4C0XA 3TIVA 1R6UA 2V9ZA 2X1LA 3CZRA 4UXJA 3RKSA 1HNZB 4DYDA 3NHSA 1N1GA 1RXIA 2WPNA 3RTBA 4AP6A 3MJRA 4DLBA 2VTDA 3MJ4A 3JCZA 3KJIA 3BJEA 4PZLA 1AKMA 5BPHA 1NVEA 1ETUA 1X86B 1RBZA 4RJLA 1YAJA 5HF5A 1L5HA 3WRYA 1CVRA 4E7PA 4ENTA 5M34A 5HXAA 121PA 1O08A 2QU7A 3DEZA 4PSCA 2PWYA 4MRVA 3I61A 5IAOA 1CZRA 3H5IA 2BM8A 1XKLA 1WABA 2A30A 2QD3A 2QN1A 3TW6A 4EUKA 1SK9A 5CLIA 3TX6A 2IBMA 2G0NA 1TIPA 1X1RA 1XQXA 3HJHA 1VIDA 4RZ3A 2QJRA 4DA9A 3QLTA 4J4HA 5KB3A 2PUEA 1KI2A 4OQ4A 5CDHA 3HI6A 4RKEA 3ANSA 4OQLA 4WUVA 1G291 5EJ4A 4L5AA 3A8TA 1D8AA 5CGQB 1R6TA 4W5QA 1U28C 3N3AC 4G85A 4RZXA 3DWIA 2ZBPA 3AO0B 3N2KB 3DVAA 3PDIA 1AKEA 4G65A 2NUTA 3H5VA 3KTAB 5TE9A 4EW6A 2VBCA 3E6AA 4WWHA 3S1AB 2D7DA 1U8TA 1KFJB 1RXCA 2E9SA 1UFQA 2OMEA 2J4CA 2XMQA 3CRNA 1FFCA 1NDQA 1WVMA 1VHWA 1Z15A 3AY3A 3C1UA 4I4TB 5F73A 1AK1A 2REQB 3CV3A 2YHAA 1BFDA 1T9KA 3G0CA 1WXEA 3R3UA 1C1DB 1RXUA 2Y77A 3UJ9A 2JAQA 4R2MA 4EX7A 1ZDMA 4YHBA 2GFQA 3TLKA 4QJ3A 3ZWYA 1YL5A 1E77A 1KMHA 4ZOLF 1JMVA 2QN7A 2VJNA 5HPYB 2C59A 1QH1B 1V1MA 4D3DA 1F8FA 4XH9B 3LO5A 4YAKA 3KUXA 1L4HA 2CDCA 2QLNA 1GYPA 3QMPA 4GX1A 3LD9A 3AX6A 1NU8A 3FF1A 3O4HA 4UZEA 3G8BA 4NR0A 5TX7A 3OCZA 2R4TA 1FJ2A 2X0NA 2BFEA 3A4VA 2WHPA 3OU2A 1IUOA 1DV1A 2JJYA 4KMMA 1PT7A 1GSIA 2C77A 2C5FA 3I9LA 4ZGWA 2VQ3A 1JA1A 3PVSA 3Q9SA 4INPA 4AXBA 4CEJA 5I6DA 3VZDA 1WDWB 3ONFA 5LYYA 3PQDA 3BJIC 4LKOA 5BXQC 3H6HA 5CNJA 1KK0A 2DVMA 4YMGA 1EVZA 3RU3A 2A0YA 5BYKA 5JYDA 4Z9AA 1Y3BE 5COAA 2JEYA 3B1ZA 2CSXA 3E03A 1MZVA 1BRMA 3I39X 4NBSA 5DLYA 3K15A 2WIGA 2PV0A 4H7PA 4QPJC 5DBHX 1BVUA 2LV8A 4F60A 3JAWA 3MLAA 2O48X 2XD4A 4FW9A 2H18A 5DYIA 3FZYA 4EHFA 1WNTA 3RBVA 4RLSA 1NI4A 2FHPA 1FS5A 3WRWA 4M1ZA 2JASA 1NULA 3DBLA 4G81A 2Q5HA 3EF1A 3DFZA 3IV6A 3LX6A 4NF2A 4MWGA 1X0VA 1RDFA 5I7SA 4M9XA 4PSAA 4FEEA 1PJLA 1F20A 1GDTA 2CHVA 3T7CA 1PJ2A 1R4NB 2H92A 2VJCA 2AOTA 3HLKA 1KI9A 2BKEA 3TDMA 3WZMA 3KS9A 2AN9A 1WPRA 3EGOA 3G5AA 3D6MA 3SE0A 3O03A 1H69A 1XRLA 1PUXA 3L7LA 4BO1A 4EUSA 1U1EA 2DQZA 3C4QA 1X7ZB 2YHIA 1K66A 4Y6QA 1CE8A 4D9CA 1E3MA 4NV0A 4XUEA 1FVHA 1N5RA 1BNCA 1Q20A 4QVKA 2Z5VA 4P6VF 3QPVA 3KKQA 3RKUA 5TPZA 4QQNA 1W5AA 4QE3A 1W96A 2KLBA 2XDQB 5LZ8A 2GO7A 4AMGA 2Z5GA 1KQPA 2O5VA 4K3VA 4Y0NA 5T5QA 1BOOA 4W7IA 3LBYA 1POWA 4HDRA 3D3EA 1EFVB 1JIKA 1PNTA 1M1YA 4NV3A 5CK4A 2WV9A 1Z7BA 3B3GA 4WKCA 2B4AA 1QKKA 1XRSB 1SU6A 4J6FA 1M8PA 1PL7A 2W9XA 2DF8A 2ZI4A 4XUGB 1MJGA 5JO0A 1RD4A 3FPJA 3VR6H 3IX7A 2YASA 3NUZA 1KJ9A 1XR3A 3WA6A 1RWVA 3NWOA 4BX9A 1NQVA 3T1YB 4IDDA 2VTBB 3IVGA 2JLZA 2A1UA 5F3WB 3AHCA 3V4ZA 1NMYA 3AU9A 1R50A 3CX6A 3MLBA 1FFSA 1Z4MA 3VHLB 5CXQA 2GX6A 2OZLB 1JPNA 1I6LA 1KZ7B 2JGKA 3K0FB 3OZVA 4LJ7A 3W9SA 3FWPA 4FFDA 1U5BB 3H2GA 3SJBA 2AS0A 5BYJA 1P2VA 4R8KA 3F49S 5K3EA 2ORYA 1XYYA 1U7PA 4HP8A 2PKYX 4HSEA 3KJNA 4OCZA 3QFHA 2PX0A 7MHTA 4F9TA 1OXKB 1GPWB 3TE6A 1WHTB 4CQJA 1MH9A 1DFIA 2OHJA 2FG7C 1TM3E 4C7VA 5EZSA 4XRGA 4GBMA 5BV2P 4UMFA 3L8GA 1EGVB 1YL7A 4OUDB 4O5AA 5EVJA 1YA8A 3PEFA 4D57A 2ZJAA 1FTQA 2Y1OA 3D4OA 2QTBA 2AEJA 3LT1A 1NW8A 2MR6A 1Z0KA 3M2PA 4DN6A 3ABZA 2N46A 4URXR 2NX2A 1MBZA 1SXIA 3W5HA 4B5LA 3G2KA 3MELA 3VHXA 1YVPA 1C14A 4OAQA 3H5WA 4EQ6A 1GPBA 1TRHA 5CX4A 4OA5A 3W9UA 3E7FA 1KXJA 2PTGA 2YY6A 3HUDA 4IVPA 3WQSB 7GPBA 1T6XA 3VU8A 1TVCA 1RYNA 2EEZA 2IU3A 2VOEA 4U7DA 4FGKA 3S8MA 3LECA 3RRMA 2OV2A 4PHFA 4BYGA 1FLDA 4RQAA 5DIFA 4FM9A 4CV0A 4IKEA 1NE7A 3CLUC 2FPSA 2WF9A 4JC8A 5DTMA 4AYXA 1I1NA 1HTBA 2QVXX 3EGDB 4R3UC 4WNAB 3DCIA 3TVTA 3ZNQA 4AFNA 3OEED 3KKLA 3ME5A 1OV6A 2CUZA 2V54A 3OQPA 4KX5A 4B3TB 4LF5B 3K73O 3WYGA 3DOCA 4HDOB 1U7UA 3ZU3A 2HW8A 3K6RA 1GZHB 2GDZA 4GKAA 4YV1A 4BE7B 1KKMA 1Z8NA 2JCVA 3VR0A 4OYHA 3W8DA 4LY6A 3FUUA 1UOOA 3DTYA 4CIXA 2CNKA 4HDSA 2A84A 4L4XA 4UHJA 2Z0MA 4B3IA 5IT4A 4I19A 1X6VA 3DE0X 3ILXA 3P71T 3HXMA 1WY7A 1TNDA 4QSHA 3UCEA 2IZ1A 1ESEA 1BN6A 1E62A 1TU4A 3DYVA 4TVOA 1R3UA 1BDBA 4GR4A 5ALLA 1J2RA 1N2OA 3GPCA 4O2LA 3KR2A 5F78A 5I5EA 3LT5A 4DARA 1FP7A 3B1VA 3Q41A 3L7IA 4OOFA 2QVYX 3QEJA 1Q91A 1C1YA 4Z1MA 1A97A 2BY4A 2OLJA 3W5DA 1ZJZA 2W37A 1EHCA 3R40A 3WHLA 2QR2A 4E3ZA 3HZHA 2R79A 5EJGA 5TLSA 1SXPA 4RH1A 1QTRA 2DUJA 3M2TA 3PNBA 3HCWA 3SIRA 1QQBA 4MQFA 5AVVA 2NPFA 5ES4B 2WSMA 1I01A 1ZI6A 4UEOA 2IV7A 1A8IA 4FFNA 4HAZA 2VZLA 3T9BA 2W0SA 1JJFA 3A1CA 2YOFA 3HMQA 1A8QA 2PMWB 2Z2XA 3OICA 4N6GA 4RHCA 2VAVA 5EZ5A 4DRYA 2CBZA 7REQB 4IMPA 1KAEA 3MAJA 3L82B 2NVWA 4NDZA 5JECA 4RTKA 1LZKA 4ZPXA 5D1HA 2VRBA 1AKUA 1G66A 4OBWA 5BN5B 3SQLA 3E18A 3T7SA 2RGNA 3BREA 5IDQA 1DG9A 4BIMA 1NN0A 1WHTA 1LTKA 3QMVA 2BHNA 2CEAA 1WW2A 4G23A 4OQNA 4O3MA 3A6DA 1WMDA 2J0UB 1KWKA 1N5KA 1SG6A 1I3OA 1E3JA 4DHWA 5CX1B 2HMSA 3AFOA 2HUPA 4MGYR 2NVUA 1NX9A 2WG2A 1NVXQ 1YB1A 3AYXB 2XDYA 1DOAA 2V6JA 3F5FA 4JNCA 1LB1B 5HFNA 1WMBA 1ZFNA 2QAJA 4RF2A 1OWNA 2I80A 1JR3D 2P7HA 1XI2A 3LZ6A 4QBGB 1S96A 1WCWA 2I6QA 1NW7A 2ZBVA 3K30A 1R6BX 3LAWA 3LHIA 4OXQA 1Y7LA 1S89A 2Q1YA 3KJEA 3K9HA 4N8EA 4YJDA 4MMXB 3VQTA 4ICIA 3LYLA 4IMJB 4O59O 2DY0A 1ZR4A 2BGWA 2NTJA 1M8JA 4ARBA 4Z4QA 5DB4A 1L8OA 1PR4A 3I09A 1F06A 2E6KA 4YQYA 1LWOA 1KYVA 2EGGA 1XVTA 2J9RA 1WPXA 2HWWA 4YX9A 1KZGB 4LJ5A 3SHOA 4ZU3A 1LBTA 3STTA 4G4IA 1OMOA 3MJDA 2QROA 3O7MA 2V7QD 3PGA1 1XZEA 1CR1A 5HRAA 2QUIA 1XEXB 2C7VA 3QTLA 2Z30A 4DR3B 5CYPA 5JVDA 1NV8A 5FAXA 2YXBA 4RL6A 2F9LA 3T1VA 2VDQB 3L7YA 5EQTA 2B4TO 1ISRA 1C8KA 1RI4A 3O8RA 4OYYA 2IOHA 1H4QA 3EBLA 4Y3UA 3EWSA 2AX4A 4O4HF 4EKYA 3Q9NA 1XRRA 3BMNA 1JBEA 1Q0LA 1Y5NA 1Z7GA 1R0ZA 1UODA 3L1IA 3U9TA 1SVNA 4DMUB 2BSQA 3K05A 3I5YA 3OEEA 4L2IA 1CQJA 2AFRA 1NG1A 3DOFA 2QE7A 2B8NA 4X3OA 3UAOA 2UUBB 1FBNA 3M6WA 3VKUA 3B9QA 3Q3EA 2FTKE 2PKQO 3HKCA 4U6NA 3MGKA 2HI0A 3UWKA 1EQ2A 1M8GA 2Q3JA 4IEEA 1TUBB 1N0WA 1L1FA 4ZHSA 4TTIA 3K31A 1B16A 2J9GA 2UZ1B 4G67A 3VTZA 1A9OA 3GD7A 4XX0A 2B0JA 4HR7A 1N0IA 1QNLA 4MUJA 4X8MA 5CFOA 5DP2A 1W5BA 1JR4A 1BQEA 3EGXB 4G9BA 2IV2X 2P9BA 3E81A 5A3SA 1QKIA 5K8CA 4XCQA 4F5ZA 5T4HA 2DFVA 4MA4A 1FLVA 1JG4A 4E5YA 1D5WA 1XMSA 1ACJA 4OHUA 1QHHB 4LHYA 2RJ3A 4MEAA 1FFBA 6PFKA 2BFBB 3QM1A 1MW8X 1EFKA 1LK0A 5CLLA 1UBKS 4LJYA 4MAFA 4FGWA 5T3YA 1S02A 4HX5A 5LQKA 1R9GA 1TJ4A 1URPA 2XUFA 5IH3A 3W7VA 1UL1X 3EPKA 1OROA 3BD7A 4I81A 5L3RA 3SHTA 4JV5B 3CZ4A 1KZ4A 2GXUA 1ZL2A 3ET4A 3P7MA 3WL6A 4MJXA 4OL0A 3EFOA 3HA5A 3CLUD 3UUEA 2OHFA 1X7WB 1ZIPA 1XU7A 4XDHA 4YAFA 4Y2GA 4K6FA 2Z3WA 1SHUX 2Y1FA 3QGMA 1L9XA 5EIAA 4KR9A 3I5MA 3ZNPA 2WWYA 3PHIA 3SJCA 2GA9A 3LCCA 4BX2A 1RQRA 3B5IA 2CV0A 5K4GA 1BMFA 2WTUA 3R5JA 4DIMA 1PWXA 1LLUA 1V0JA 2AZTA 1FXUA 2HKIA 2I4NA 1H4TA 4OU5A 3WLLA 3ZCRA 3HVRA 1G3QA 1UKEA 2VA9A 1LI5A 3IR7A 4UAUA 5HE8A 4E5VA 5BV1A 4B3HA 4KQKA 5JSKA 4WW0A 4JODA 2JLUA 1S2LA 3UHFA 2PKCA 3WMWA 4G9GA 4I4TA 1TPZA 3CG4A 3MT0A 1R8QA 4KODA 1I2ZA 5FUVA 1KYIA 5L4NA 4QXRA 5F1KA 3HVUA 3QBTA 4I1YA 3VJRA 3U3RA 3ZG6A 1H2ZA 4ZI7A 1LVUA 2HU8A 3SYNA 3GJZA 3H8WA 3U7IA 2JLVA 3E4CA 2RCNA 4FD2A 2WKWA 3CX3A 4N7JA 1GCGA 1C5KA 1NRWA 3G0IA 5TVGA 3RAGA 1PJQA 1QFYA 4ECEA 4KQFA 2HH9A 1NL3A 2NT4A 3RUDA 3GN1A 3TI7A 2XQGA 4F5EA 1C2YA 4OKIA 5K0GA 3ESXA 2M32A 2CB9A 1VYHA 3REQA 3HE3A 4HH3C 3PJGA 5LA6A 3UMRA 2FI1A 3INRA 4HAYA 3C48A 1M5RA 3N2LA 4OXKA 3CN7A 1RAEA 3GJ3A 1LBSA 2PJDA 5EXTA 2WLTA 5IT5A 3IILA 3JWJA 4LMPA 5C8YF 1M0EA 3HDTA 4KYUA 4JI7B 1O1YA 4WKOA 2C96A 3D5TA 3L8DA 2HFJA 2ZAMA 2OG2A 1WHSA 2PZLA 1H4SA 2EFCB 3LUHA 2Y71A 2ZWVA 1PD0A 5LDDC 3IHTA 2VXBA 3T3MB 4KJZA 2XA9A 4LDNA 1KFKB 5IZCA 3PQ3A 3BIOA 4EDFA 2ZIXA 5EHIA 5D85A 3CBGA 2JD0A 2HJSA 2ALJA 2WSLA 3E4DA 1QAQA 2GBPA 1G8GA 4PTLA 3I8XA 4FFOA 4W1PA 2VK8A 2BEVB 4PG4A 4DCGA 4D0SA 4P4LA 5CT5A 3IOMA 1FRNA 3TBHA 3HJCA 5IKMA 4O2AF 4OHZA 2XHEA 4RTNA 3A6JA 3GH3A 1VA4A 4R81A 1J5XA 2RSLA 3W90A 1Y42X 2WU3A 4AG3A 3IOEA 5JNSA 2ZSUA 1TM7E 5HGXA 3IBGA 3BB1A 3LUFA 4WVFA 3C41J 2ZSEA 3IIMA 4QHYA 2FFAA 5ALRA 2C99A 4JA2A 2C3YA 2DKNA 3NHAA 4NK5A 2PMEA 2BGTA 4BVHA 5KWIA 2JBWA 3UT6A 4G86A 5HUQA 2WUVA 1HZZA 2OHGA 1N3YA 1ULAA 1IN6A 1BA2A 4G36A 5DT9A 2CD9A 4L5BA 4PTZA 2QNBA 3V4VB 5KJEA 3C7DB 1HK7A 2JFXA 3TUZC 5JC1A 5A7GA 3K1TA 3N0TA 4WA8A 3LKDA 4QUJA 2QTLA 2IX3A 2B34A 4I6GA 4PNEA 1ZITA 1HQKA 1TO1E 1HLFA 1Z6TA 2R7MA 4G56A 4LMBA 3ZHRA 4E30A 4OHFA 1S2NA 5JNVA 4ZP1A 2O8NA 3EE6A 3ZW8A 5HDBB 1Y33E 2ORWA 3MILA 1NF8A 4ZVMA 2HHLA 3M1AA 1JAYA 2QSJA 2JGJA 3CUSA 2ORIA 4J4TA 4LXIA 3T5PA 1AUVA 5TQJA 4E1VA 4MV5A 4EH1A 1NQXA 5FOQA 3IDSA 2OZVA 3MJVA 4XGRA 4BN0A 4NHOA 4MHTA 1B6GA 1PHPA 1XDDA 3EXEA 3X1DA 4TL7A 1IONA 4YBZA 2E3JA 4LDQA 4DDHA 4KZKA 3FDXA 4X6XA 2B5OA 2B5WA 9LDBA 2EW1A 4DBLE 1H2AS 2I55A 3Q9LA 2HBYA 4HWSA 1V1RA 3BCUA 2XDQA 5DTJA 1JG7A 5J5AA 3TCKA 1RC8A 3OZCA 4MQ6A 1K8XB 3PTZA 3SC4A 3G8DA 4YI5A 3F5SA 4FHGA 1SVMA 4QX6A 1XLVA 1G20A 2ZCUA 2ZRGA 1PV4A 4H7EA 3T5CA 3VZPA 3LUDA 1N9ZA 3D6NB 4KFUA 5LOVB 2BMEA 1PR9A 3GAAA 2QENA 1EUDB 1UXHA 3KVVA 5DHTA 4PS0A 1FFWA 2DECA 3EXHA 4CVNA 1WIWA 2I03A 3RVRA 4B35A 3HKEA 4B83A 4NICA 3FUXA 2GSWA 3QKSA 5AM0A 1Z63A 2HYIC 5KTYA 1EFVA 1NMQA 1RQXA 5ECDA 2JVIA 3KKEA 4GKVA 1E3IA 1YKSA 1NBME 1TA0A 2A33A 3F7TA 4PR0A 3UWSA 1LDBA 1QZUA 2VDLB 3P5BA 3PA6A 3S2ZA 2P9YA 4KI0A 1XROA 2OCXA 2O5EA 3T3OA 3KHKA 4XEHA 5LU9A 1NA5A 4GI1A 5FXMA 4C1NA 4JAVC 3WDLA 4C4OA 2ZJ7A 1CS4C 2V6GA 4U0JA 4WAUA 4RK1A 3R0ZA 4DG8A 1U1GA 3TR5A 4E32A 5HZKA 3QUAA 3ZVNA 3UAXA 3T35A 3TI9A 3B1JA 2TSYB 1Q57A 1A2KC 4KXWA 2XODA 5LA6F 4BVGA 4EG1A 1EA5A 1JWLA 1E5LA 1FU7A 1FJXA 1HUQA 3AIMA 4FFMA 2P6RA 1WE2A 3WO0A 4H6PA 4J3JA 4IOMA 5J3JA 1UZAA 1XCGB 2C61A 1IRXA 5YASA 3DCJA 5I7HA 3A31A 3IQZA 3ITKA 2PHZA 2I34A 4TKUB 3OOEA 4LDAA 3SXUA 4PC7A 4DG5A 1VJ1A 4HLNA 3HFJA 1BMFD 3SBEA 3SYTA 1JEYB 4A4DA 5K8IA 2ZPUA 1GU0A 1FFDA 4U2DA 1NRIA 1V48A 2F62A 4QBKA 2NTEA 1P45A 4FR0A 4JOQA 3U3ZA 4TZ6A 4Z4EA 2CMHA 3Q1LA 1ADBA 3HN6A 4DJJA 1Y3CE 2F00A 1NVBA 1OBFO 3DOEA 3OE4A 2WPDA 3UH1A 3OIGA 2A86A 1Q0UA 3KSMA 4HL6A 3DEJA 3HS3A 1TI7A 4FSHA 5BURA 4KN9S 2AT1A 3D8NA 1K0FA 3GFBA 1E7MA 3DO6A 4GI3A 2ZVDA 1JR2A 2OV8A 1F38A 5D5HA 1SCAA 1N3LA 1XAJA 2Z9CA 3PENA 4NKRA 4B4VA 1VG8A 4D3SA 4IJWA 1E2JA 2O52A 2O05A 4XD7A 1KP2A 4B4UA 4BFTA 3DTVA 3TZCA 4A2WA 3K5HA 3KTAA 1SCBA 10MHA 1X1EA 3EC2A 5GONA 3WLOA 3OC6A 1J00A 4HWGA 5TQVA 3MXTA 2NG1A 4YDQA 3P4XA 4REQA 4Y1GA 2YBDA 1ZNWA 4IOJA 3TSCA 2EZUA 3W5JA 4Z4FA 2F4NA 4WBNB 2ZYWX 2D4HA 4P2BA 4ZEMA 4DCNA 4ZO9A 1HZJA 4KPUA 1F7UA 3LOPA 2KB0A 3S2EA 4W5OA 2R8RA 5FJIA 1M6YA 5JSFA 3LL4A 1OLOA 1TCCA 2MTBA 1H66A 1WTCA 2OPHA 3STXA 3GRKA 1L4LA 1EX1A 1LEHA 1A7AA 3MXOA 3NIDB 2VBIA 3CNBA 5K9ZA 3OPQA 1TQ4A 4NL4H 2IOFK 3MWJA 4WIAA 4KFRA 3VH3A 1VL1A 2IYTA 3WK8A 3X0DA 3FRHA 3RVNA 3VNBA 1IVNA 2QZZA 5C5DA 2OD7A 4RIGA 1AF7A 1I7NA 2EWMA 2OWDA 3R1IA 2VQFB 3L0BA 3H2YA 3DVAB 3PDIB 2JLXA 1E1DA 4XAQA 3TR0A 4BJ3A 1M1XB 2F43A 5C3MA 2A9PA 5JDIC 5GVRA 2Q5OA 2O8FA 3NOOA 2VDRB 2VCYA 1CJVC 1K4KA 1ZVQA 2G9RA 3H4IA 1EJ6A 2ZIUB 4QFMA 3W04A 4FGJA 2O8DA 3AIOA 2YV4A 4IJKA 5JD5A 3KKPA 3OT1A 5C46F 2CHEA 2LVBA 2MSWA 2CLFB 4Y9UA 2QSYA 3OM8A 3PRYA 4Z4IA 3CB2A 4I14A 3DTNA 1F4VA 1OE0A 2QE6A 3R7WA 4E51A 5B55A 2DLNA 1KK1A 3FR8A 3K9GA 4GR5A 4ILEA 4JYMA 5KSWB 3KQQA 2W2VA 1IUPA 1YVUA 5D5PA 3VKVA 2IH2A 5JCXA 4QGFA 1VCIA 2QUKA 1GDHA 3MG9A 1OAOC 3KBBA 4QARA 4Q03A 3WL3A 4AUMA 1XZDA 1GZSA 4YXWA 1SD1A 4GPTA 1T0PA 1V5FA 4J1SA 3U13A 2ILVA 1IK4A 1B2LA 1KYXA 1XELA 4YDSA 1UDCA 3TOCA 4AM8A 3L06A 1EDOA 3ZCXA 3WYFA 1AUQA 3OQBA 2BI7A 1IHYA 5K0LA 1DX6A 3LJKA 3OTWA 1SHJA 2EIXA 5JCOA 2RHJA 3OP4A 2J9YB 3RS3A 3K0KA 4DQVA 2XVZA 1AXGA 1WU8A 3PUHA 2H2GA 2MSLA 1CUSA 2OQIA 3DAYA 1UJ2A 4JROA 4L0CA 5HILA 3RRXA 4D9NA 4ZK6A 5C4MA 3P52A 3FW1A 4O29A 2LW7A 2HY7A 1SG9A 5CHEA 1PSWA 4F2HA 1FRQA 1Y89A 2W0MA 1EVEA 4J6EA 4TMKA 3TIFA 3ONWA 3NV9A 4KHZA 1I1OA 2HDHA 2PGDA 1LRKA 4YROA 4JH0A 3RSGA 1I2BA 2KYRA 3B6EA 3UK6A 3HCAA 3IH5A 3SC6A 3ZDEA 4YRJA 4LQ4A 3OCXA 4JB8A 5LKRA 4I4CA 3ZXUB 3WK9A 2JI4A 4C5AA 1FW8A 4DLYA 3SX4A 4A15A 3ZDCA 1JEAA 1HRDA 2J3DA 3U7FB 3VH2A 1R8XA 1M33A 1V11A 2P90A 4LZOA 3A4TA 4P5DA 3VOAA 4EELA 4RLQA 1QANA 5AVOA 3DC7A 3C3PA 3H75A 3FJ1A 3F1KA 4J91A 4LJLA 1R10A 4OHRA 1T3LA 2Y3IA 1P31A 1KH2A 3NTUA 1ATZA 4JBIA 3TW8A 1L7BA 4PFJA 4ZCRA 3AVVA 5F2KA 3L4JA 1Z22A 4ANFA 3CU5A 4HNHA 4FLEA 4QQKA 4E21A 5CFZA 5E4JA 1XPUA 3LPAA 1UMKA 1SQ5A 4I0WB 1C9DB 4TLBA 4N3AA 4E3WA 5I7VA 1CPYA 4BFXA 2VP5A 4CTOA 1WA5A 3FSGD 1C7JA 2GLXA 1YQDA 3D31A 4G4SP 4YP7A 3U81A 4CPDA 1E0JA 3KYDB 5JS8A 1O95C 1H3FA 2QPAA 3DOJA 2EHJA 3TLJA 1JYEA 1BVRA 4L6CA 3R5HA 4LSMA 3K9CA 2CMDA 3GGGA 4J8PA 2YWEA 4TQ9A 2VZEA 2I8CA 4LHWA 1VCMA 4WLOA 4E88A 1YS1X 3N5KA 3E27A 1Q7GA 1Z5NA 1T5SA 2VLIA 2XECA 4MDEA 3H1AA 1HEYA 4LA4A 5DM70 3QBVA 5J58A 4ESOA 4YP9A 1AGRA 1E9EA 1SM4A 1VKRA 2XA2A 2EYQA 4KX3A 4MKRA 3ZWOA 3ZHTA 4DR2B 3CGWA 4P7JA 4RKRA 1H2EA 3UK1A 2PSEA 3R75A 4LJAA 2O8EB 4PQFA 3VR4D 3WSWA 1A9SA 1HFWA 2V7BA 1H2HA 3MB5A 3PHCA 1KEVA 4G5GA 3J81A 1W2GA 4M4SA 5AW5A 5ICCA 4I55B 4QNMA 3CLTC 1E1RD 2PGAA 1SXJB 3S44A 1WUKS 4NDNE 5T8KC 4QJ4A 3BK2A 4JDUA 1PK8A 1PLKA 1SGWA 3ANLA 2XW6A 4GI5A 1VSVA 4N0QA 4URZR 3WDKA 2HNKA 2G9ZA 4EB8A 3UMVA 1L4UA 1U2ZA 3QLJA 1T36B 4KSYA 1IN8A 4OFBA 4YAOA 2QD4A 3EGDA 3LRPA 1JJBA 5EEHA 4B4KA 1BKSB 2Q45A 1U2EA 2ZB8A 3L43A 5AVSA 3S81A 1YC2A 3IO5A 3QVKA 1I3KA 2ZATA 1MNQA 3CSUA 4JP3A 1T0UA 3PWTA 4HQLA 4PEVA 2HBQA 2QZPA 4AU1A 1G41A 4A36A 3JWIA 4M0LA 4M9ZA 3BRWA 3HI4A 3P2IA 4K6CA 4O4IB 3PIIA 4U2EA 1R12A 2WINI 4G5XA 3UGTA 1DKQA 4CF4A 4EG0A 4RHFA 4HDKA 1B2RA 2W2NA 2Q4TA 3R3VA 1IZ8A 1V9LA 2DUWA 4IIBA 3TF5A 4E6PA 1CXZA 4JLBA 1EKXA 3RVDA 3V2GA 2Z5FA 4BV2A 2AUNA 3D8HA 3UATA 2C2HA 5KS2A 1TA9A 2O7RA 4YY3B 4K26A 5AHKA 4JIMA 2TMKA 2RGBA 1DOHA 4A23A 2UV8A 5C5IA 1KAHA 2J5KA 1QLHA 4RD2A 4DMMA 3OKPA 5K3CA 4XRRA 4KUHA 5EI5A 3QUBA 4X00A 1P2BA 1UFVA 3NPMA 4KV7A 2OFXA 4CTMA 3AEKB 3F4KA 3MLEA 2QG9A 5K09A 4F4HA 1W76A 1RFGE 3L4KA 2R2GA 4IFEA 2ON6A 4PIVA 1EFUA 1DARA 1ZD8A 5AHRA 4CCWA 4K3UA 5CDFA 4WINA 2XWJI 4BCBA 1V71A 1UINA 1XHFA 3TOVA 4QGHA 4NYJQ 1DBIA 2VTBA 5DXJA 3KELA 4Y2VA 3CEJA 3A6HA 4WFQA 4P35A 4ALMA 2HSEA 2WNHA 3FDZA 2P9HA 4RJJA 5CHYA 3NHLA 3VNQA 1Z83A 3T3EA 4RQUA 1LVHA 1SCJA 3HUTA 4UXHA 5CXXA 3WR5A 1DBVO 1KO7A 2JJ1A 3M6VA 4OMUA 3FSRA 4FDAA 1CY7A 5I7AA 3T3DA 5CA0B 5H3HA 3EEFA 4MYCA 2YQ4A 3BQ9A 3ZK9A 2Y9PB 3OJEA 3LCMA 4BRUA 5LQMA 2W6IA 1XEAA 4ZOQI 3H87A 3QE2A 4WZZA 3B1FA 1JAXA 3IB6A 2PU5A 2VJMB 3QFCA 5TQ2A 4NZOA 1KSJA 2OZLA 3ENKA 4R2LA 1EG2A 1VZ2A 3AEUB 4P3OA 4B8WA 4RBNA 3DOUA 4O4HB 4U7JA 1IJBA 4A1FA 3VC2A 4KRFA 4B8ZA 1N0UA 3NC0C 1NXSA 2YJ5A 3ZJ4A 1KC1A 4U2KA 4BMNA 5L3VA 4BNGA 4TKVB 4K8RB 1MO4A 1QHXA 2I5PO 3F4LA 2R6JA 3G9XA 3I9FA 4BFCA 3BB4A 2BFNA 4BNLA 1CS0B 1V7PC 4KE6A 1DHRA 4MB0A 2PJRA 1ABEA 3H0EA 3D2LA 1S2IA 4IH4A 4NI5A 2C2GA 1L7QA 3NATA 1B14A 1XZGA 4GBGA 3G3EA 3LL7A 3LQFA 2VC2B 1Y6JA 1UK9A 1FNMA 5EIFA 1PNOA 3DR3A 4NHEA 1NASA 3CR8A 4DTCA 4KAXA 5TQ0A 1SPXA 3SXPA 4F8YA 1VPDA 1FDVA 2GHIA 5H3LA 5GZ1A 5BUSA 3E3OA 1LDMA 1WVGA 3EWAA 1ZVVA 2PANA 1IQ0A 2XUJA 1ADYA 2QI9C 3K53A 2FUG6 5KAPA 3ESBA 3H19A 2G1JA 2QGNA 2X3FA 1A4IA 5KYYB 3VU9A 1DZIA 3SHVA 1V47A 4KL8S 4A0FA 4MLPA 1JR6A 2YXEA 3G2OA 1XN1A 4LJ8A 4EYGA 4A6EA 3HA2A 4CLRA 2IZ6A 3ET5A 3GLGE 4D4KA 1Y4DE 4I9UA 2QMQA 2RBGA 3U7JA 1NPDA 4DREA 5JAPA 1EHYA 4BNNA 1PFKA 2C04A 1RIIA 2BMWA 1GZVA 3GVCA 4CM4B 4HUQB 1ONOA 3JQ7A 4NOLA 5LB2A 4A7PA 1J70A 4P3NA 1EGAA 2FSFA 1N2CB 2GF9A 2AEEA 1R5NA 1SVSA 1TEXA 3L1VA 1HT2E 1TJYA 4JCOA 4Y7CA 3S0JA 4N82A 3IUEA 1CFZA 1X74A 1YB7A 4RQBA 3EZLA 2E4YA 3WIUA 1P4GA 2XNDD 5G0TA 3K09C 4X6YA 3DUFB 3T41A 3ZY2A 4Y98A 1NPTO 2IHJA 2QUZA 5KI6A 5G53C 3M5CA 2JIZA 4HQOA 5U9CA 1GPKA 2O2JA 3JAWB 1J25A 4H7HA 4MIYA 2AOWA 4AN4A 3HO8A 1IB0A 1FB5A 1NUSA 8AT1A 2W2OA 4EPRA 1ADCA 5AVUA 2Q2OA 3BJZA 1ABFA 2JKYA 3A14A 2B1RA 3AQ4A 3IELA 3QE3A 3BXEA 4U8GA 4JIGA 1H4VB 3O8LA 4P22A 4R2IA 1I9GA 5AVRA 2Q29A 3GJRA 2DWCA 2QPOA 4MW7A 3I45A 3U40A 1M6HA 1OFGA 1O94A 3B13B 4YAGA 1TT5A 2F1HA 1BA3A 1KEWA 1BHJA 2XE7A 3KVOA 1L5VA 4XPIB 1HWYA 1OIVA 2PL1A 2Z4TA 1O87A 3PF8A 4HQ0A 5D86A 5SICE 4UPVA 1ZK0A 1KA9H 4KQEA 4QUIA 5GM2A 1DT3A 3TQRA 5HKKA 5GONB 1XSEA 1T9ZA 1Y80A 2P3QA 5C1BA 2QUHA 5KNDH 5FBKA 3HTXA 1RBYA 2H4ZA 4RZSA 4MGZR 1QH1A 1V1MB 2QQEA 3D3KA 2IZ5A 3NVMB 3UN1A 1V8DA 2PH5A 1ZM4A 2Q07A 3HPRA 4YJ2F 3CT6A 1C4XA 3G2QA 5J4HA 3UMYA 1ZJYA 3I52A 4BQFA 3R6WA 4DLZA 1WW8A 1RRVA 2W90A 1AMUA 1NJ2A 1J23A 1H2YA 2DUNA 3OJOA 4FFWA 2FOLA 1T3SA 3UPDA 2AN4A 5FTLA 1CY6A 2V1XA 1JYSA 3JQ6A 1Z36A 3QLVC 4HDSB 1SKAA 3NKVA 5EP1A 5EZ6B 1CUYA 4UVDA 5G41A 5K1ZA 3UPTA 2VNJA 4ZVNA 1ILWA 1FP2A 3F3MA 3JWPA 2UYYA 3OKFA 4R1SA 2C9DA 1V9SA 2NW6A 3L04A 4KIGA 4PYMA 4R1TA 4AJ4A 4RTRA 4V24A 5LQDA 4MIEA 1KR2A 3ZCVA 1JFLA 3SIWA 1NXOA 3T9CA 1TZ2A 2YHSA 1Y6ZA 2ZTMA 3DZFA 1GPAA 3L3BA 4JL5A 4RA9B 1I80A 4EO7A 5EGSA 4AF6A 1G2QA 4CCSA 2C1EA 2LDXA 4QFDA 3HB4X 3SWWA 4FD3A 3KCNA 3GX1A 3OLYA 5SYNA 1EWQA 4DFDA 1OWLA 1OT3A 4JY7A 4YRPA 2Q4DA 4TMWA 3KLOA 3X1MA 5IBCA 2VJPA 2I2WA 1GDDA 3OJXA 2I2CA 4I36A 4YS6A 1CVIA 2QG4A 1KO1A 3IMEA 4WTOA 4LDZA 5LSAA 3TLZA 2HMUA 2GEFA 3Q12A 1MOPA 3VYWA 5DCLA 4RDIA 3ETLA 1YBAA 2IXAA 1KARA 3EZXA 4TL6A 5HJEA 1TUEA 3IEMA 4INZA 4AMBA 1RXEA 2BD0A 2AJLI 2XITA 3UIEA 3SY8A 1MDFA 5F1PA 4BO9A 3NR2A 1LNSA 4R16A 4N5NA 4LSGA 2FMXA 2QNIA 1YACA 4RENA 3I9KA 3EPJA 3VKHA 4B75A 2BN4A 4C0WA 1QF9A 2Q5IA 3LUJA 2G63A 2CZGA 1D1SA 2GXQA 3HV0A 3Q7RA 3B60A 2W48A 1RNLA 2RIRA 1Y8RA 4Y2UA 2JFGA 2OAEA 3HBFA 1MX5A 3KZMA 5BSGA 1QMGA 3LGXA 2V3CC 2PRKA 2Y1EA 3KOZA 4OHKA 3RNOA 3OETA 3KXDA 1RRPA 4MS4B 5B2ZA 3H2BA 1V1RB 1POXA 2NU6B 4Q9HA 4AROA 2ZI9A 4N39A 4X20B 4N7RA 2I2BA 2HF2A 3CWZA 1AX9A 3NM5A 1SQGA 3AILA 4R7TA 5JJBA 4Z1OA 1E4OA 3VBEA 4DQKA 4R0VA 2FRVA 1RJ9B 3KB2A 2A1UB 4POAA 1AKYA 4Z8XA 2H2WA 1V3TA 2QM7A 3UENA 4CR8A 1TKAA 1Y6RA 1NBAA 3O75A 5JRZA 3WI7A 1YSCA 2EW8A 1CLUA 1TM4E 4GMFA 1WO8A 4HN9A 4U2BA 1B42A 2XRYA 5LJIA 3MMSA 3Q0TA 1USUA 1FRFS 1U2DC 1Y34E 3D2BA 4FYVA 3SMQA 4AQ7A 5KYYA 2P27A 1COZA 1DMSA 1LWNA 4DLXA 1PYOA 1XMIA 3WICA 1YJ5A 2ZYSA 4X3PA 5JSUA 3NBZC 3IGFA 1GNRA 2QZJA 4LZJA 3KQNA 2IBSA 2Y6UA 5KKAA 4RVFA 4BKRA 4HH4A 3Q87B 4Q9LA 1R6AA 5IAKA 1L5ZA 1G1AA 3FXAA 3MNFA 2ADOA 4HNAB 4TS3A 3ESCA 1BXGA 1C7IA 2BUCA 5EUQB 5F12A 3LCUA 3O3MB 4ZCQA 3PEWA 2AX3A 3OFVA 4YUXA 5EHGA 1P19A 4I9HA 4D3XA 1XN4A 3E5MA 3TFQA 2UYCA 3LM8A 1U0TA 2H9AA 2QZSA 3L8CA 4AUKA 4J1NA 1EFRA 4EL5A 5CFPA 2FOIA 1K4YA 2IDZA 1X42A 3PRJA 3WLTA 4NE9A 1YKFA 3MSXA 3ZHSA 1C4WA 2VEOA 2J3LA 4DIKA 1KO5A 3FNIA 3KEGA 4ZOCA 4CQMD 4OX9B 4INAA 1BHSA 2R85A 5ALXA 2LCIA 4MUEA 2BEKA 2WWGA 4RK0A 1MAHA 1VI6A 5ES3A 4C2AA 4D8XA 1H9CA 3FRJA 4L8WB 4PYQA 3C6MA 3GMSA 4CIDA 1Z47A 2DKFA 4KYVA 5E6SB 2D7CA 4DHEA 2IOYA 2AFHE 5AMXA 2F48A 1JTEA 5IN4A 1P2DA 3BCRA 3U44B 4LYAA 3B1XA 5CH8A 1GL9B 2B78A 3HUEA 2O59A 2CFSA 3N75A 4MVJG 3IDFA 2I4TA 2ZRQA 1FNNA 5JAZA 2GZAA 3AB7A 1OT5A 3OUTA 3FCSB 1PAUA 5IU6A 4ZYTA 2DFLA 4C4SA 5H5JA 4YMVA 5I7WA 1FDOA 1ISGA 4AL4A 2B2XA 4IWXA 1A50B 2FY8A 3FD8A 4WZ6A 5IMBA 4GOLD 3CSSA 4B7ZA 3OEWA 1Y5RA 4P08A 5FLKA 2NTVA 3C6XA 2Q49A 1IM2A 1N5IA 2P6NA 1JJVA 3MD9A 4OB7A 4U6SA 3DL2A 3P2OA 3P9SA 3SQOA 1FSSA 2OE2A 1VA5A 2BFCA 5TMDA 5J4VA