1YASA

Hydroxynitrile lyase complexed with histidine
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
256
structure length
256
Chain Sequence
AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHKLQLTKTKEIAEILQEVADTYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (lyase/peptide)
molecule keywords HYDROXYNITRILE LYASE
publication title Mechanism of cyanogenesis: the crystal structure of hydroxynitrile lyase from Hevea brasiliensis.
pubmed doi rcsb
source organism Hevea brasiliensis
total genus 93
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 1996-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1yasA00
1DX6A 2PVSA 2VA9A 1EB8A 1CUBA 4J0DA 4KACA 5EHNA 2XUAA 1VA4A 2YH2A 4FMPA 2Z8ZA 4Y2JA 5FP0A 1CUHA 5AOCA 1K5PA 3WJ2A 2JGJA 4E15A 1VLQA 1UFOA 1QIFA 4DMFA 4MQMA 1XROA 3ICWA 2CB9A 4G8DA 5K3DA 4KRYA 2AJ8A 4AZ0A 4G1FA 3FSGA 1UXOA 5CBKA 4D9JA 1TQHA 1EK1A 1LNSA 3OM8A 3WK9A 3DJYA 4P93A 5E4JA 3ZPXA 4OB6A 2HRQA 2OAEA 1ODTC 3DKRA 5E2IA 1ETHA 1CUIA 4KE6A 1IUPA 4MXDA 4INZA 5CMLA 3HXKA 3D59A 4BVKA 4RPCA 4X94A 1EHYA 1HKHA 2XUGA 5DYYA 1AUOA 4B80A 2GZSA 1WB4A 3NOXA 3X3HA 5LZ8A 2O2IA 1NU8A 2XUDA 3BJRA 2FJPA 4Q3OA 5HCUA 1HQDA 3TGLA 1USWA 3WMRA 3ICVA 3WWOA 2DHCA 2QS9A 3STVA 1BEZA 3V1MA 1W1IA 4AZ3A 1YCDA 2XI4A 3VDXA 5JAOA 3TJMA 2Z5GA 1A8UA 1SCKA 1R88A 1HL7A 4XJVA 1U2EA 4NMWA 4U2CA 3HI4A 1CUDA 2CZQA 3FLBA 4Q3KA 4OPMA 4ZV9A 3STXA 2Z3ZA 2QJRA 3IBTA 3I2HA 4S0XA 3R41A 1W52X 2JGEA 4KYVA 1CR6A 1MNAA 4V2IA 5I8PA 3G8YA 3F98A 3W04A 2AJLI 2B9VA 4DNFA 5C81A 2C4HA 2WU3A 1XRNA 4LHEA 4M0MA 4WJLA 4H7HA 5HFNA 4Y2RA 4C4XA 1AURA 1QFSA 4U2GA 3KD2A 1X2BA 5FPPA 5F4ZA 2JGIA 3DKKA 3WZLA 5A2GA 3EBLA 3EQ9A 2XMZA 1TAHA 1JFRA 4C4YA 4H0CA 2OGTA 2WIKA 5ALYA 5ESRA 2Z8XA 3H2JA 1RWQA 4BAGA 1B41A 2FUKA 5AIAA 2XQFA 4K5QA 1K63A 3H19A 1IVYA 4BATA 1EX9A 4QWMA 4F60A 5JZSA 4ETWA 1QZ3A 5FXMA 4UPDA 1XRPA 7YASA 1WOMA 5AKKA 1WHTA 1E8MA 1JMKC 1Q84A 1ZJ4A 5EHXA 1QIHA 1R3DA 2HA0A 2WG0A 3ED1A 3ANSA 5AK4A 3CXUA 3H1BA 2XUQA 3STWA 1B6GA 1RP1A 3SC2A 1SCIA 4FLEA 5ALEA 3QPCA 2DHEA 3QYJA 1MX1A 4XIIA 5T4HA 1GQSA 1E5TA 1YS2X 3WKCA 3E4DA 1ZD5A 3ZI7A 4AB1A 2HRRA 4X6YA 2HA3A 2ZYRA 2OCLA 4Y2TA 2J4FA 4J0KA 1OCEA 3C6XA 4G8BA 5HQ3A 4NS4A 2WUFA 3I6ZA 4UHBA 2ROQA 3PF9A 4Y2YA 1CUAA 1Y7IA 3AFIA 1MAHA 3FCYA 2WJ6A 4U2BA 3I1YA 3SK0A 3O9MA 2HHAA 1LPNA 1AZWA 3OOSA 2DCMA 2W22A 2ZJ7A 2NW6A 1XQVA 1UT6A 4PSCA 1DT5A 3VVMA 1QIJA 3M81A 3WIBA 4QDTA 5AKGA 1ZD3A 2V97A 3PICA 1Z68A 4E14A 2HA6A 4OYYA 3FYTA 2V98A 1JI3A 2DQYA 3HACA 3VISA 1DQZA 1MT3A 1HBJA 3STUA 1VA5A 1ZD4A 4UFNA 3GROA 1TCCA 1CUWA 3BDIA 3QBJA 2BGRA 5CT6A 4QLAA 3I2GA 4FKBA 5CXXA 1EDEA 4KRXA 1IZ7A 3RK4A 1TCBA 3R3UA 3WWCA 3ESDA 4C88A 5HKAA 1XZEA 1E89A 1ZICA 2XUJA 2C7BA 4H35A 5AKZA 4BRZA 2OCGA 3K2IA 1XRRA 3WKEA 3WL7A 3VJKA 2C0PA 4BCBA 3C6ZA 3FCXA 5SYMA 3FYUB 4H7KA 2QT9A 5FV4A 3FWHA 5IH7A 4ZXFA 4UHEA 1LPAB 2UZ0A 5JAHA 3A2LA 2RGUA 4W1PA 4OYLA 1XLVA 3W9BA 1CIJA 3T4UA 5A6VA 1R9MA 4Y2UA 3JYHA 1FFAA 2RHWA 2QXUA 1UKAA 5HQ3B 4GLBA 4PSUA 2GBIA 4K2AA 3ZLTA 2ACEA 3WL5A 1EVQA 1CUSA 2D5LA 3G7NA 3IDAA 3FLEA 5K3CA 2BCEA 1XZDA 4RE5A 3EQ7A 3HZOA 4H7FA 5LYYA 5D3ZA 3V1KA 3G9TA 5CTAA 4Y2PA 2BAGA 3ZLUA 3C5WP 2B20A 1JJBA 1KU6A 1EB9A 5HF9A 3LLCA 3DL4A 2PSEA 1LZLA 3ZLVA 1E8DA 2OQVA 4KE8A 4I3FA 5EIEA 2CEKA 4CIAA 3N2ZB 5CT9A 1U8EA 3WI7A 3DOHA 3H2KA 4BZZA 4L3WA 4RE6A 4FNMA 4IQ4A 1MPXA 2C0QA 1P0IA 1QIIA 2XUKA 1DWPA 4BBZA 1R50A 1EDDA 1AX9A 1WB5A 4J0IA 5K3BA 1AGYA 5KWIA 1LPMA 1C7JA 4HXFB 2Q0XA 4JUIA 2ACKA 4EA6A 1P0PA 1M33A 2RIPA 2XB6A 3CCBA 3WYDA 1QFMA 5AM1A 2XE4A 4ITVA 1IUNA 4X97A 3AIMA 1XKTA 1WB6A 2HFKA 4BCCA 5EHZA 1JJIA 2P8SA 3RARA 5EHQA 5T4EA 4X90A 2XQKA 3AZQA 3GZJA 1CUFA 1MTZA 4F0JA 2Y6VA 1CLEA 4AN0A 3C6YA 4BB0A 3C8HA 4PSDA 5DWDA 5JD5A 5K5EA 1W76A 3WK4A 5AI8A 4L72A 1F6WA 1A7UA 5EFZA 3D5EA 2XQGA 3QZUA 2EDCA 4CCWA 1KEZA 2XQJA 3WKAA 3AJAA 5C8VA 3HJUA 5AP9A 4GW3A 2PKYX 5DNUA 4KAJA 1ACJA 5AI6A 4O08A 2XUFA 5ALHA 3NWOA 4HAIA 1FFEA 1K6EA 2VJDA 2PM8A 3B5EA 3AZPA 3WIOA 3STTA 2PX6A 1BCSA 3G0BA 3WK6A 5HK9A 2RHTA 3IB3A 3M82A 3AIOA 3I2IA 5KWJA 1CRLA 1DU4A 4P9NA 1ORVA 4HZGA 3AINA 4MYSA 2JGLA 2V9ZA 4IH1A 5CURA 2ZYHA 2VF2A 1DQYA 4PQEA 2WSLA 5A7FA 2O2GA 5DLPA 3FLAA 3IA2A 3IUJA 1MJ5A 2H7YA 2C58A 2VSQA 3H18A 1GPKA 2HA4A 1O6GA 5A71A 4LIPD 1YASA 4KAAA 4B0PA 4UFPA 3MGAA 4QZVA 3U0VA 2JGMA 2H9YA 5LZ4A 3ANTA 4K6GA 1O6FA 4BDTA 5DTIA 2XDWA 2CJPA 1CUEA 1R4ZA 1TRHA 1FFCA 1WM1A 4P08A 2QKYA 5CT5A 5AKIA 5CRIA 3WLAA 1MO2A 1NU6A 4H7JA 1ZGBA 1X2EA 3K9BA 5AI4A 3VJMA 1JJFA 1EVEA 1H22A 3I28A 4PF1A 4QDOA 3QMWA 2XUPA 1FSSA 5HZGA 2B4KA 4FHZA 4UHDA 1LGYA 5AK5A 5E4YA 3W9UA 4AQDA 1YAJA 4FFVA 2DFPA 1N5MA 3L1JA 4W9RA 3R3WA 2YASA 3TRDA 4DMHA 1CUZA 4BYMA 3RLIA 3RM3A 2WG2A 2QJWA 1H23A 3R0VA 4ZREA 3FVRA 3H2GA 5C8ZA 5LZ2A 1PJAA 2HM7A 3I2KA 3DEAA 4CCYA 5LZ9A 3V9AA 1UK6A 2WUEA 5JIBA 1XZIA 2GYWA 1XZFA 1ORWA 5LKAA 1GKKA 2H1IA 1SC9A 2WFLA 5ALRA 3R3XA 1EH5A 1YB6A 3PUIA 4DNPA 1EK2A 4CI9A 4EY6A 2OGSA 4JYPA 1THGA 2WIDA 2XMBA 5HK8A 3SWWA 4YK7A 2WHQA 1MU0A 4N5IX 4RGYA 5JARA 4X91A 4YX9A 3K6KA 3D2BA 1U4NA 2I3DA 5AM5A 4BE4A 4B7ZA 4F5ZA 2HA2A 4UBOA 1CFJA 5K3AA 4B81A 4B0OA 4ZI5A 4ROTA 2H7CA 1OXMA 2QOEA 4B82A 1GGVA 4GDMA 1IMJA 1TIBA 5BWBA 1CVLA 5DTJA 5JZ9A 2XUHA 4Y7DA 5AKLA 1VE7A 3LIIA 4Q34A 1JKMA 1A8SA 4MEBA 4PO3X 5ALFA 1FFBA 4QA9A 2HA7A 2W6CX 4XX1A 2JGKA 2WUGA 3B12A 3VXKA 5K3EA 4X85A 4U2FA 2OCIA 2HU5A 2GYVA 2JBWA 2PPLA 4BZWA 2HDWA 1LPSA 4DSZA 1BS9A 3C70A 1K4YA 2WG1A 2EDAA 4CCYB 1ZD2P 4H18A 4AMYA 2R8BA 5LKRA 4C01A 4W1RA 1CEXA 5AM0A 3NGMA 4JH0A 3HSSA 5JAPA 1A8QA 2OQIA 2VTVA 2ZSIA 4G4JA 2WFLB 4WDRA 4GI1A 4WDQA 5DNVA 5BV7A 1QO7A 3BF8A 1QTRA 3D0KA 5DJ5A 4TVKA 3D3NA 3D7RA 2R11A 1DT3A 1SOMA 1E66A 1G4HA 1R9NA 3W06A 5JD4A 1D07A 1P0QA 4W1QA 3D2AA 4Y2QA 2ZYIA 4X6XA 1DX4A 4BDSA 4K6KA 1E3QA 1UK7A 4HXEB 1F0PA 1BRTA 4AN1A 2WIGA 4DIUA 1XZGA 1L7RA 3HABA 2XMQA 3AZOA 1XZCA 4FFWA 5HKBA 1KU0A 1MAAA 3PUHA 1DWQA 1NX9A 2I03A 1RYYA 5T4BA 3W2TA 5E4TA 5LZ5A 1H2WA 2AXEA 5IKXA 3H2HA 2IIVA 2O7VA 2PSJA 2Y2UA 3ESBA 5JATA 2WQZA 2PSFA 2QZPA 3O0DA 4N5HX 1G66A 1W4LA 1TKRA 5HF6A 5AH0A 3D2CA 1VXRA 5ALOA 5FPQA 3O4IA 1VXOA 3I2FA 5I9IA 3ESCA 1J1IA 5ALQA 3G0GA 2H7XA 4NVRA 1HDEA 4OU5A 4DNOA 3LCRA 3H17A 4AMZA 4UBNA 3BF7A 2G4LA 4UBMA 5CT4A 4X00A 2QM0A 5SYNA 4J03A 1GPLA 2E3JA 4KE9A 1QIEA 3A70A 1VJ5A 4B83A 2PU5A 2RI6A 3S8YA 2DSNA 1YSCA 2WUDA 3DDUA 1PFQA 1T2NA 3PE6A 3BIWA 2D0DA 3DD5A 1CUUA 4LXIA 1DINA 4X3CA 1BN6A 5FDFA 4OSEA 5HFAA 3HC7A 4BC1A 3S2ZA 4Q1VA 5I7UA 2QUAA 3CN7A 4UBIA 2VAXA 3EQ8A 5ALWA 1EDBA 1Q0RA 1YR2A 3SX4A 3DNMA 2QXTA 3I6MA 1J07A 4EY8A 2PL5A 1XZBA 2WHPA 1GQRA 1GKLA 2VAVA 5EIAA 1DTEA 4U2EA 3O95A 3I6YA 5D6OA 5ALDA 5CT8A 3DYIA 1LPOA 3QM1A 3R3YA 1WCYA 4J0CA 4BE9A 6YASA 2RAUA 3OPMA 3TEJA 2XUIA 4DMCA 5ALSA 4FLFA 1CUCA 2HADA 4E46A 1XQWA 1JT2A 3STYA 4F21A 5AKHA 2ES4A 3LP5A 3MUOA 4A5SA 5A7GA 3UUFA 1XZJA 4W63A 4DLNA 2QVBA 1ZIYA 1UK8A 3DOIA 2OXEA 2RONA 1W75A 3WZMA 4DTCA 2JEYA 2ONCA 2DQZA 3R40A 5AK6A 4AO8A 1AMNA 3DLTA 4X6UA 4EHBA 4QDUA 1JMYA 3IURA 1VZ3A 2FX5A 3GBSA 5AI0A 2PSHA 3WK5A 1CUVA 4EY5A 3OG9A 1HLGA 1XRMA 1XLWA 3H2IA 3H04A 4H77A 3VVLA 4ARAA 3BE8A 4OUKX 3WK7A 1W6RA 3F9CA 1QONA 4HS9A 1GPNA 1TCAA 4IO0A 3E3AA 1J06A 1BROA 5FKJA 3WQHA 3DS8A 2GZRA 4A16A 4N8EA 1JU4A 1Y37A 3WWEA 4CIBA 3NUZA 2VJBA 3MUNA 3F67A 1QGED 1QIMA 5JZBA 4UHHA 4J3JA 4KE7A 3PFCA 2XMSA 4Y2SA 3WA6A 1VKHA 2AJCA 4H7EA 4GWLA 2QMQA 4QE3A 3G0CA 4EZIA 2WHPB 1L7AA 1UKCA 1XZMA 3JW8A 2Y6UA 2DR0A 4LYDA 5HF5A 2GBCA 4GECA 2VATA 3WL6A 4GBGA 5ALPA 3C6BA 2HU8A 3F97A 1L7QA 3HLKA 5ALXA 4GXNA 1H2ZA 3G02A 1ZOIA 3L1HA 5DYTA 3KOOA 5ALTA 2WTMA 3KDAA 4QWWA 4DM7A 1ZJ5A 5ALGA 2OGZA 4CG1A 2ECFA 4BVJA 5AM3A 4DMKA 5IVIA 4MYDA 4BVLA 2VJCA 1FJ2A 4KJXA 5AI9A 4EY7A 3FNBA 3C5VA 4TPKA 3O4JA 1WPRA 3GELA 2G5PA 5JAUA 2BKLA 2PUJA 2ZVDA 5ALUA 1XZHA 4Y2VA 4B9AA 4E11A 5LZ7A 1CV2A 4KR0A 1G42A 1YAHA 3L1IA 1H2XA 3DCNA 4EBBA 1XLUA 2HA5A 2QTBA 5BOVA 5JALA 2X76A 4OB8A 1SFRA 5ALJA 4AO7A 1UOQA 4J0HA 2VJAA 3KWFA 4EUSA 2QR5A 2FJ0A 3QH4A 1H2YA 2C5GA 4UHFA 4Q82A 4QDZA 3A6ZA 4UUQA 2WM2A 5JD6A 1CPYA 5DYWA 4OD0A 4G8CA 4WFKA 4CG3A 4WCVA 1K8QA 3A2MA 1ZI6A 4LYEA 2OPHA 2G5TA 3R3ZA 4C6HA 4EB0A 1EINA 3UMJA 3Q0TA 4IH9A 1C4XA 2OG1A 4W1SA 1YA4A 4H7IA 1XKLA 1ACLA 4RNCA 1PV1A 4JEIA 2OAGA 3OURA 3LS2A 1A88A 5JYCA 1E8NA 4WFIA 4FTWA 4X92A 3DQZA 4B85A 4BP9A 3IUNA 5AKYA 1TK3A 3AIKA 2GBFA 3V48A 1QE3A 2Z3WA 3CN9A 3HEAA 4CG2A 2EEPA 4BC0A 4WFJA 4K6HA 1YB7A 5FUMA 2B61A 2WIJA 3FYUC 4DNQA 3ILSA 4ZV7A 1Q83A 3IIIA 4NZZA 5JASA 1UOOA 3QPAA 1BN7A 5CW2A 5IVHA 4IHAA 3ESAA 3GUUA 5CXUA 4IH4A 1MX5A 3C45A 4QNNA 2ZJ6A 3BIXA 2O2HA 4XWGA 5AOAA 3LIPA 3GA7A 3H0CA 4DGQA 2XMCA 5ALVA 3C87A 4Z49A 1QLWA 2C5FA 3FSGD 1DWOA 3PF8A 4UHCA 5HF8A 2WFZA 4C89A 1FFDA 4FLMA 1Y7HA 5FOQA 1XZLA 2XQIA 2YYSA 3BL8A 3WKBA 4EY4A 3BJMA 2BUBA 4YASA 1X70A 5AICA 4G5XA 2J3QA 3D4LA 4B84A 4MJ3A 3F96A 3IUMA 5AIBA 4Q05A 1OILA 1N5RA 4G9GA 2OCKA 4Y9SA 1WPXA 2XLCA 4PW0A 1GZ7A 2JIDA 2WIFA 4UBJA 2WTNA 4BCDA 3I1IA 3VKFA 1XFDA 2J4CA 1QIDA 1XRQA 5ISMA 4J0JA 4JYMA 4FDMA 2X8BA 4L0CA 4ZGBA 5AM4A 1U65A 1G5FA 4X95A 2WKWA 2XUOA 1XRLA 3O9VA 3PI6A 2HU7A 2JGFA 4PV7A 3FBWA 1QOZA 5AOBA 4UBKA 2BFNA 1N1MA 2AJDA 2BJHA 4HVTA 3HYSA 1ZGCA 3WA7A 4XVCA 1R1DA 4ARBA 3FYUA 5D3KA 3CCCA 2GYUA 5AM2A 3QMMA 3M3DA 4DSAA 1AQLA 2CMFA 3M83A 2QRUA 3V1LA 2GBGA 1GXSA 1P0MA 2WILA 4OB7A 4MEAA 4ZRDA 1XZAA 1VOTA 1CUXA 5JADA 1LPBB 4FBMA 3GFFA 3MVEA 4X7BA 5ALKA 5EIHA 3EIOA 5KBYA 1C7IA 5J3JA 2PUHA 4BAZA 4HXGA 4JNCA 3I2JA 5CH3A 1BE0A 3JWEA 3QVMA 3E1GA 1XQXA 4GHWA 1UOPA 1F8UA 2O7RA 4LKOA 2ZJFA 1VZ2A 2Y2VA 4YPVA 5CH8A 3BXPA 3FAKA 3UUEA 1I6WA 5KREA 3N0TA 3QITA 1UK9A 5C7YA 2X5XA 2WJ4A 2ORYA 2VQ6A 3EF3A 4N8DA 1BU8A 3U1TA 5AO9A 3DL7A 3WJ1A 1EXWA 4BRSA 4I4CA 5EI5A 5ALZA 1UKBA 1CQZA 2PBLA 2I3ZA 3G9UA 4G9EA 4KAFA 1F0NA 2CUTA 4P92A 1SCQA 4J0GA 1EI9A 1ZI8A 3RKSA 1ODSA 4CFSA 2BGNA 3ZWQA 1QIGA 1ODCA 4B9EA 4I19A 4MQLA 1QTIA 2QUBA 3KSRA 1BCRA 4L9AA 4GEGA 3W05A 2HL6A 2HFJA 3V1NA 5YASA 5AHXA 5AKEA 3FOBA 4FWBA 5JANA 3KXPA 4DYHA 3G0DA 1S8OA 3PFBA 3DYVA 4OU4A 3WYNA 4U2DA 2XMGA 5A62A 5LIPA 5K3FA 2XT0A 4M0EA 2HIHA 2I78A 1LBSA 2IITA 4BTLA 2ZYSA 1ISPA 4QEKA 3G0IA 5AKXA 4MWSA 3BDVA 3B3QA 4HTAA 3P2MA 3OC0A 4B6GA 1QO9A 1CQWA 2IX9A 2BUAA 3IVMA 2YXPX 4X93A 4A23A 4BAUA 4AO6A 3HRHA 3FVTA 3BWXA 1WHSA 3A2NA 4FOLA 4FNGA 3WWPA 4HRXA 1MNQA 1CUYA 5AI5A 5IVKA 1THTA 3OTQA 2WFMA 5DNWA 1ZI9A 2WU4A 3G9ZA 5FRDA 3H1AA 1N8SA 4UFOA 2ZSHA 3KWJA 3O4GA 5ALNA 2CKMA 4Y2XA 4H7DA 3YASA 1MX9A 1YA8A 1UZAA 3AUKA 2VT7A 4WY5A 5LLSA 4TGLA 1T4MA 2J3DA 2OLEA 5A7HA 1MN6A 3VJLA 4OCZA 4LXGA 1LLFA 4M0FA 4AX4A 1JU3A 2XMDA 4G4GA 4N8SA 2WLSA 2K2QB 2V96A 1XQYA 2JEZA 4AXBA 1HPLA 2XMRA 1ZIXA 1LBTA 3IULA 4MWTA 2PSDA 1CUJA 3C43A 3WK8A 5ALIA 5D7BA 3WL8A 2PU7A 2VEOA 1VE6A 2AJBA 4HRYA 5AKJA 4X71A 1LPPA 4Q3LA 5K3FB 1GT6A 2Y1KA 1LZKA 3AILA 1Q0ZA 4J7AA 5CH5A 5FLKA 4KEAA 4LXHA 5IVDA 3R3VA 5T4FA 4QDXA 5AK3A 3QPDA 4WY8A 2DHDA 3PDCA 4PNZA 3C8DA 1QJ4A 3IUQA 3T52A 1XZKA 3O4HA 1UWCA 2CBGA 1J2EA 3F8SA 2XLBA 2JF0A 4ZWNA 5ALMA 2LIPA 5EGNA 2VT6A 4FBLA 5BWCA 4UBLA 4C87A 5ALLA 5AJHA 1CUGA 1IZ8A 1IUOA 4BTVA 1QIKA 3G9XA 3WWDA 5LP1A 4QLOA 3E0XA 3WKDA 1YS1X 4C4ZA 3QMVA 1EA5A 5C8XA 3ZV7A 1BEEA 5H3HA 2WHRA 4G4IA 3Q8WA 2WJ3A 2G63A 4BP8A 1AC5A 2BUCA 1AKNA
chains in the Genus database with same CATH superfamily
4YAUA 1NI4B 2FWMX 4R01A 1PR0A 4LRTB 4K7JA 4MUXA 4E03A 4J0DA 3HU5A 8ADHA 2XUAA 1JLRA 4ZRMA 4CMEC 3NAZA 4D1YA 3K6SA 3F49S 3MGCA 2HC9A 1Q95A 2ZE5A 1GOTA 1KH2A 4BX9A 5HKOA 3N70A 4BGDA 2OBBA 2PKCA 2Q5JA 4PR0A 5AOCA 4YHHB 1I7SB 2Q5OA 1VPEA 5AVUA 2F59A 1N9GB 3IT1A 1NP6A 5TGTA 1HORA 3V4LA 4PX9A 4EO4A 5AW1A 2P0YA 1NVVQ 3QLUC 4FVTA 3Q3EA 3REQA 1Y33E 3EJ6A 3PXAA 1CQIB 4H3SA 4DIBA 2BW0A 2XAAA 1L8QA 1W4CA 2QI9C 3D3QA 1ZMTA 4G8DA 3ZXUB 2AJ8A 4N6NA 1FUUA 2QP9X 5BSUA 1CRZA 4AZ0A 5LWQA 1D6SA 4ZARA 2F1OA 4QU5A 3HWX1 4B6FA 5HHTA 4FCTA 2OGUA 2IIQA 1XXHA 3COPA 2GEDA 3D8BA 4P82A 1CIPA 4UC0A 1O6ZA 1MB4A 1YO6A 3PUVA 1T9HA 4HH1A 5I3CA 4DLLA 1Y9JA 5LQDA 1UBGA 2J41A 3WK9A 3DJYA 2AXPA 4QAQA 2QRMA 1SBYA 4KDFA 4DA7A 3DMTA 3FOFC 2E21A 2OAEA 3KQVA 1ODTC 3R74A 3T1QA 4A10A 4C0HA 1RHJA 4LMPA 1ETHA 1YIOA 4LYHA 3KYIB 3PDHA 3RADC 1FRQA 3AHEA 4JUDX 2G0AA 2V1XA 3AFMA 4HBZA 1XMOB 2Q1SA 5KTKA 3S4YA 5DOZA 4W5OA 2FFBA 2OOKA 2ZSEA 1T9AA 1C3XA 4GPAA 1GAEO 4BNHA 2GN9A 1EFDN 1OZAA 2O3RA 1D1TA 3J7AC 4IRUB 4J1QA 5BMVF 3EOBI 1I3KA 2GZSA 1QOPB 2PA3A 2X5JO 3Q11A 1KE1A 3X3HA 3N2NA 4XSGA 1BWSA 1PGJA 1G7CA 3BRCA 3MK31 1L4KA 4JUBA 4HZUB 3SGLA 4CQJA 3CVUA 3R7NA 1YI0A 1RTKA 1KNQA 4CLRB 2FJPA 2DFNA 2Z56A 3EXIA 4LVUA 1JX6A 4C1BA 1NAIA 4IVRA 5GV7A 5B6JA 2IS4A 2NMVA 1QKKA 3TGLA 4ZAFA 1FP4B 3DE1X 2XXJA 2AE1A 3WMRA 2YYAA 4QASA 1DOZA 3OZVA 3ICVA 4JSYA 2LKCA 4MRAA 4ENPA 4ER7A 3P9SA 3ECAA 4R1MA 4X84A 2DFKB 1U0LA 3THXB 3RC9A 5FIUA 3ZV6A 3E7WA 4A1FA 2J09A 1JMVA 3D1JA 5KNCD 3USZA 2QS9A 5KQGA 2WWWA 3ABSB 1CJBA 1J8MF 3WO1A 1N0WA 5KNDD 3WYEA 3RTAA 1AGPA 1BEZA 3I01M 2NPIA 1AIPA 2H2HA 5BQ3A 4UVEA 4A8HA 4I14A 4FEYA 4TXNA 1AVTA 5J2UB 3S2YA 1EWKA 4POAA 2VCYA 4HQOA 3RF7A 1QFJA 3KEMA 5KYUB 3U5TA 2IHKA 1EXNA 1AV6A 5L7TA 3E48A 2OYSA 1ZS9A 2C29D 1MC1A 2G3YA 1LA2A 5JEEA 5M2QA 2XGMA 2OBMA 4LBYA 4M6WB 1ZKMA 3EF0A 3TJMA 2NO5A 3IXLA 1XQ1A 1NF9A 3L4BC 1OYOA 4M8KA 4QPDA 4NPAA 3A6JA 1FW6A 3SHTA 1PL7A 3F6RA 4DVJA 2WC1A 1QH9A 1R88A 3VOBA 1QFZA 2P2ZA 1HL7A 1XNGA 1VI2A 3B1VA 1OGJA 3BAFA 4R1UA 5EE1A 4ZAGA 4R3UC 4KFCA 2GTHA 4XJVA 3EIHA 5REQA 4MQ6A 1ZOSA 5DF1A 4MV8A 1FX1A 4QXQA 3MWGA 3IR6A 2IQ5A 3A4NA 2FUCA 3ICOA 1M1NB 5HBRA 1BA3A 4CDGA 3IP5A 5AVVA 3P9QA 1RXWA 1JT9A 3STXA 2W8BB 3BB3A 1VHJA 4E13A 2QJRA 3IBTA 1PT9A 2WJYA 2YWXA 4HKTA 5JO9A 3R41A 2X23A 2JGEA 5LXTB 3PXGA 1C9KA 4OO3A 3Q72A 2HR1A 4MQEA 3QLVA 1X1CA 4K8RB 3VKWA 3F98A 2X13A 3EXHB 3ITEA 1JTVA 3WYBA 3ZWVA 5K8TA 1P6UA 2BKEA 2QM7A 2B9VA 2WRZA 1WVIA 4YJ3F 3V00A 4YGYA 5TR9A 2C4HA 1F2TA 2BFMA 3HNOA 3JQ8A 4FYKA 2Z2YA 5T64A 3TSYA 4BQQA 1JZTA 5HFNA 1U5AA 4C4XA 1H9CA 3M34A 2NUAA 4PAOA 5EAIA 1AURA 4L5IA 4P33A 3NT5A 2CT8A 2VWHA 3KJQA 3OZRA 1EU1A 1G8SA 3AFNA 1NWCA 5FPPA 4XJSA 5EKUA 5U4XA 2GQ0A 4IXMA 3LX8A 4IX9A 4X45A 3GLKA 3PGMA 4QOFA 2QJOA 2AUMA 3VHLB 3GQBA 2J3MA 3GUZA 4IJKA 4HGPA 3FDFA 2O1WA 4JITA 2DTEA 4KZKA 2VPWA 3FPLA 4HDKA 4P7GA 1HYBA 2DYKA 2DULA 2A9QA 3THWA 1U80A 1EX6A 1UM8A 2WIKA 3DEZA 3FN4A 3G6WA 1B8NA 3T4PA 5ALYA 4ARUA 2Q7XA 1U8YA 1G21E 4Z86A 2Z8XA 4O1MA 3ER6A 3L7JA 2DUWA 2BFOA 2ADFA 4MV0A 4TKLA 1B41A 4R40A 4BWFB 2A30A 2ECOA 4BFTA 2HYIC 3FSEA 3PUJA 4ENTA 1E2PA 2YC4C 3FHLA 2QX6A 4FS8A 3UYKA 3CF0A 5I9BA 1OB5A 3GFOA 1UFVA 2GKOA 4G9BA 4LNUB 1GA4A 2X4IA 2PYIA 3KXKA 1YBVA 1K63A 4MICA 4UKDA 4O5OA 3MTAA 5CA0A 5C4GB 4BATA 2R751 3A9VA 1J21A 1EX9A 1JR3A 3BMXA 3I5UA 4QWMA 5B3LA 2G36A 1Z12A 2YWEA 4F72A 1N75A 8ATCA 5JMOA 5JZSA 3DPIA 2TECE 3OJLA 3TTTA 3ZHCA 5FXMA 1IHXA 1VLJA 1SHTX 2J5KA 3VR0A 1R4MB 7YASA 3WGTA 1ZY2A 4YRSA 2BC9A 1US8B 5AKKA 2PX0A 1J0EA 3B60A 4EM6A 1E2NA 1E8MA 2GSDA 2R6JA 2NAPA 2IYAA 3KV3O 3RFVA 4MPJA 3TLCA 3K15A 2PUFA 3CB4A 3L06A 4NV0A 1ESCA 4IWNA 3SVLA 1ZJ4A 2B0CA 2BSXA 2J9RA 1IQ0A 3ZW9A 1N78A 3WGVA 3F71A 3M6VA 3ZXIA 1C9YA 4BXOA 5KYNA 3GW8A 4N5NA 3A9WA 1NUTA 4M1YA 4R8KA 3ETJA 2WBLC 3H1TA 4DHWA 4G0UA 4K9QA 4CEIA 1MQSA 3IQXA 5EOVA 3A4YA 3C3CA 2VAPA 4ZQEA 2B35A 3HMKA 3LZCA 4BMDA 4E3WA 3VMFA 5EIXA 3BWCA 3H1BA 2XUQA 3OFND 4JCCA 1YQGA 3TAUA 2WYWA 6PFKA 3STWA 4ZTUB 3R9WA 2ZIGA 4MDYA 1HFKA 2O3JA 3QOFA 2VPPA 3SC4A 3SP1A 1U7PA 1GL3A 1WAMA 4YACA 1N8KA 5F1OA 4FKMA 1IOZA 3G5AA 4CKWB 5JTUA 4JLMA 4UUNA 2Q2VA 4BLRA 1QHNA 2DHEA 1NJ8A 3DA8A 1MX1A 2KBFA 1SBZA 2X3FA 1HT3A 3V2HA 3PIDA 1W4ZA 2VHZA 1BWPA 1NKVA 4PXSA 3BXEA 3VBCA 1RR6A 4C5AA 1SUCA 3ABRB 3Q85A 1IN7A 3AY3A 1GNSA 1ISSA 1PVDA 2RCNA 2VDKB 3U4CA 1VDZA 1IU9A 1YV9A 3RVPA 1QYDA 2HRRA 2IYQA 3DMRA 4Q03A 3EMVA 3ZYZA 4ZYUA 1BIFA 1TQ2A 4JJ4A 2W71A 4PHHA 1PAUA 4K40A 2QE6A 5NLLA 4E32A 5C46F 4X6YA 1YJBA 1N2JA 2ECQA 5IAGA 2G1UA 4Q7JB 4Y2TA 2I33A 3R7FA 4O3MA 1XPJA 3I0NA 4UEQA 5LBUA 3A05A 3RSFA 1P9WA 3U3DA 4DGSA 5LN1A 2I7DA 3C6XA 2PANA 4G8BA 4FUQA 1JQEA 1VHLA 1WY7A 4NFHA 3W5VA 3O38A 1Z2PX 1NG9A 1XWIA 2O2JA 1LK5A 3B7GA 3QIVA 3RG2A 3RODA 2OQRA 2GPNA 2WSYB 4BUZA 5JOQA 5LQKA 4RHXA 2WUFA 2VI5A 3I6ZA 3IERA 4QFDA 2A5LA 2YN4A 3PF9A 1VP3A 1U0TA 4XYBA 1M76A 4DWJA 2N3ZA 1CUAA 3IYLW 4NCKA 2ZROA 3WIUA 1Y7IA 5C80A 1ZOLA 3OT5A 4FSXA 4MRVA 1V6AA 1JG2A 2QNBA 4YFYA 4WBNF 2WJ6A 3QOYA 5MN4A 3NBYC 1G5RA 2D4AA 5B4VA 2EW8A 1L9XA 3WSVA 3RI3A 2YOHA 1LPNA 1L5OA 3QNUA 1T5DX 1AZWA 1NDUA 4NE7A 5AVZA 4LSGA 2Q8NA 4J8PA 1G2OA 1DBIA 5FI0B 3HO8A 3SXUB 4B79A 1XQVA 5GWXA 5HJ5A 3BCSA 1B8PA 1UT6A 2JLYA 1NC3A 1Z8DA 1DT5A 3RYIB 3VVMA 1QIJA 1M2VA 4JBGA 1PNRA 2RKOA 5SY4A 2EHJA 2H92A 1VBNA 1HOTA 5G4KB 4CDNA 2IHVA 2IYOA 2P9FA 2JFGA 1W87A 4G65A 4PRLA 3DAOA 3WLSA 4D9NA 3HB4X 4ZA2A 2HHJA 3ZU2A 5B7PA 4BY9E 3RDPA 1NONA 3AEXA 2J6CA 2UUAB 4RTRA 5CUQA 2A84A 1G21B 1IJEA 2VS1A 3PPWA 2H00A 4FB5A 3UPUA 3L7KA 1QCZA 4DMLA 2DQYA 3K30A 5J58A 2CDNA 3EUEA 1K0UA 4NFLA 2OZVA 2DQKA 3WNVA 3ZDBA 3LDAA 3VISA 1XKXA 2GT1A 3PC8C 1SG0A 4FFMA 2Q1TA 4AJOA 2FUG6 2HBZA 4L4SA 3STUA 4LFBB 1WBJB 4K03A 2CYAA 3ENZA 4QSMA 1VL8A 4XYGA 4GOJA 3KHSA 3KPYA 1PGNA 1NSFA 3OECA 3NWJA 2NSLA 3R9IA 4R0NA 3CUEF 1JEQB 3VO1A 3GROA 3T7DA 1J0AA 1M1YE 1TCCA 1CUWA 3HY3A 2C5LA 1P2GA 3QBJA 3C6QA 3TPFA 3NUQA 2B30A 4HX5A 2BGRA 5CT6A 4ZALA 4C4SA 3PV0A 4EG0A 2Y1FA 5TS3A 3DE0X 2GI4A 5DHFA 3I2GA 1DAKA 4EPWA 2E55A 4OHWA 4FW8A 2E87A 3EBPA 4NRDA 4GWKA 3S2GA 3S27A 3SIPA 3W5CA 1EDEA 3RUDA 1IZ7A 3RK4A 3WX0A 3A37A 3WWCA 2PV0A 1T34A 1O9GA 4LVOA 2IH4A 3MLAA 4HFRA 1AA9A 2WVHA 1JG7A 3WP0A 5E6SB 2VSFA 2GLUA 1JAIA 3N5KA 4G0YA 1TPYA 1E89A 1VC2A 3MCUA 4HUQA 3ZOKA 4C07A 2E49A 1G7TA 3BFVA 3I32A 1XI2A 4IL5A 2OO7A 4H35A 3HKDB 3EY9A 3DO6A 5B2ZA 2Q07A 1TCUA 3EE6A 1EVYA 1JJ7A 2XVZA 2YV2A 5KSYA 1IY0A 2TSYB 3SJAA 5JJ5A 2XCRB 4YT5A 4D96A 2IXBA 3VZPA 3FCXA 3K5WA 1QG0A 1ZMOA 4FM9A 1T3LA 3FYUB 1WIWA 3HU3A 1U5CA 3K05A 4D9FA 5FV4A 5A3QA 2CNWA 4RA9B 1O96B 1CEEA 3KJIA 4LV6A 4UHEA 2GPBA 1SVNA 1VL2A 2L18A 3PKZA 3TM5A 1KH1A 1SBQA 1XCLA 2XCQA 1S0UA 2UZ0A 1BMTA 1QGUA 1M66A 5A4DA 4ARCA 1HZJA 3DCJA 3ZG6A 3ZU4A 1Z4KA 5FOXA 4URFA 1U2DC 3W6OA 3A2LA 2ABWA 1MPTA 1FRZA 2PZGA 2R1TB 2RIRA 5K6TA 2RGUA 2XXAB 2NNLD 1T5HX 3DEFA 4W1PA 1ZGGA 2XJ4A 2BGKA 2YV3A 3AEKA 2F3RA 3MTQA 1K97A 4BQNA 1QQAA 3HKBB 2EWMA 4QGSA 4PYLA 3AOEA 2WV9A 4Y2UA 5TQ0B 1WX1A 2ZRQA 3WR5A 3ICEA 4R8SA 3TR0A 4RTKA 1CJVC 4ZDJA 3MCTA 1UKAA 1WMBA 1E94E 3PNSA 3EARA 3EHEA 1IM8A 2AYYA 3QTBA 4ZHQF 4CKCB 4IY1A 2NPOA 5IT0A 5K8LA 1O5TA 4YRDA 1BDIA 2VTDA 4MP3A 2XEDA 1EVQA 1PR1A 4IUBS 5ULLA 4EFDA 3HP1A 1TO2E 5KQPA 1Q1GA 3G7NA 4I3GA 1PQWA 3FLEA 3PWTA 4U3JB 5K3CA 1L4LA 1NQUA 1E60A 1FE8A 1TK9A 3SLRA 1O5IA 4C2TA 1EDZA 5EMHA 1A9QA 1QK4A 1XZDA 3FZQA 2A35A 5EYPA 2RH4A 2WM9B 4LA4A 1NJ1A 4MDEA 1OUMA 4B6OA 2V1UA 5CA1A 3V1KA 1JHZA 5CTAA 3RH0A 5GZ3A 3P9IA 3T3GA 3AM4A 3V7UA 3UWPA 3KJHA 4Y2PA 3C39A 4QBFA 2ZAGA 4WGGA 3PJGA 3THYB 5KKNB 3NDPA 4XX0B 3S1LA 4J7UA 4Q1CA 2PDAA 3B8EA 2ETVA 1HRDA 2B20A 3DBRA 4M8IA 1QH8A 2ZBQA 3GDFA 4FHDA 3H9BA 4D56A 1K3UB 3AEUB 1KU6A 5B5SA 4UTNA 1EB9A 1SUIA 5FTNA 1W9HA 3KE8A 5HF9A 1YT5A 3N7TA 5KIAA 1BDHA 1VMIA 2I3GA 2A92A 4OGKA 4AF7A 2Q3EA 2WR8A 2G9VA 4DC1A 2ZOSA 4BVGA 2FW6A 5M7EA 1R15A 1LZLA 3FPCA 3PNLA 4IUYA 2BZSA 3H5RA 2OQVA 2RE8A 1QUEA 4E09A 2OK8A 1EGVB 1NMEA 1ZLXA 5CB4F 5IANA 4HLNA 3EPLA 3ZGNA 4BWVA 1B0AA 3T06B 1WMAA 3CUWA 3OD5A 2CEKA 3V8BA 2H5LA 4PC7A 1I7DA 4LY0A 4ESHA 1OBVA 1XEXB 3DLHA 3WI7A 5L3RA 5DCUA 2C31A 2Z2JA 2VRWA 3B82A 3F73A 5LVAA 4KXWA 2ZI6A 3RREA 4FNMA 3HYCA 3ZE1B 4DREA 1EFPA 1SCUA 4V0KA 1JHVA 5L45A 3GEBA 2Q49A 3KFLA 4L7VA 3RAPR 4CNQA 2C0QA 3HS3A 2AOUA 3TQIA 1PT5A 4Z1OA 4HGYA 4G0NA 3ROXA 2HLPA 4YCCA 4OXXA 4N65A 1C7EA 3LW8A 2JDID 1PZXA 3P9XA 5J43A 1M1YB 1SHUX 3IT0A 1PKEA 2E1PA 3N86A 5EERA 5ESWA 2IWRA 5K3BA 3W8FA 4C22A 4N7RA 2ACKA 2FN4A 4EA6A 3HM2A 4CV3A 1M33A 2RIPA 1UBEA 3P2JA 1A8IA 1Y8RA 4M1SA 4UU7A 4ND8B 1QFMA 1YB2A 3L7BA 3EZ9A 4AKHA 1JWAB 2YHIB 4RCVA 5IKMA 2H2FA 1NLMA 4P86A 5IT4A 4H6VA 1GQOA 1VB5A 2YJGA 4DC0A 2X7HA 3AIMA 3QX7A 5IARA 3U62A 4DCNA 4EMUA 3PXEA 1EPUA 1IDN1 1JJIA 5H70A 2P8SA 3BE5A 4IDDA 1VG9B 3GFPA 4FOTA 4I66A 5FEUA 1JKJB 4HN4B 4TTIA 4JL8A 3ONNA 4IKPA 3IQEA 4D4GA 4MDFA 2PRKA 1CUFA 1UQTA 2AYZA 2B4TO 1WG8A 2PGIA 2QM8A 1P31A 2WD7A 4JGGA 4WMLA 4EEZA 4EIWA 1JWBB 1TJ3A 4F0JA 5A4FS 3GNLA 1KYZA 3E27A 1A69A 2Z58A 2ZM5A 4ENWA 3FMFA 3PQEA 4FGKA 1X8XA 4FKZA 1JA1A 2WDPA 4QA9A 5DWDA 4XWWA 1YBAA 3S6JA 2Z0MA 3IBSA 4YP5A 4B6EA 2ZUUA 1EUDA 2FZLA 3GYBA 1J09A 3MJFA 1UJBA 2EF1A 1LJLA 3UQZA 1TKBA 4OBBA 2HH9A 3ZCUA 4WLNA 3EFHA 1W5EA 2UUCB 3B6ZA 4L9WA 1XTTA 5TMPA 1P1JA 1PW5A 1RWWA 1ZGJA 2X5NA 3FWKA 1E1QA 4HQ0A 5EFZA 4TTQA 3SJUA 3QKWA 2JAXA 4S1VA 5F2OA 5H4GA 4YP6A 1PTJA 4J75A 4ID9A 3GMIA 4K9DA 3LLMA 5E9AA 2PWBA 2X77A 1GGMA 2R47A 3ET5A 4MAFA 4QU9A 4RGVA 4QOGA 1JPVA 5KX5A 1PSDA 3QU7A 3SPXA 5FPSA 3WKAA 2UYGA 5AP9A 1N8TA 3NEPX 4RF3A 2NXWA 4N7BA 1Y9EA 4GBED 5FTWA 1TLLA 2BM9A 3F5MA 3PZRA 1E3EA 1QLHA 1U3GA 4MWGA 3TLKA 1N9KA 5FUXA 1AO0A 2P9HA 1CRQA 3BSYA 4PG6A 3ZXYA 1NW8A 4RC9A 1TTQB 1KYQA 3K6RA 4BWGA 1FFEA 4DJFC 3WGIA 1ENZA 2BHLA 1K6EA 3B5EA 2PM8A 2F1IA 4JWTA 2P9EA 4AJHA 3I58A 1E92A 3TNYA 4HL6A 3SFTA 3QHAA 3OE7A 4O4HF 1N5DA 1BCSA 3AU9A 2KI5A 2ZR9A 3ENVA 3GB9A 2RHTA 1IVSA 4F9GA 1OI2A 3ZJTA 1SQSA 4JJ7A 1MB9A 5CXQA 3M82A 4HVAA 2V5UA 4XCVA 2J5QA 4D0GA 1YMUA 2IYLD 5L4NA 1JKFA 2O07A 4NF2A 5IMBA 4P9NA 5K1ZA 1M5UA 1U0FA 4LPKA 3N3AC 3S7TA 3DE6X 3WB0A 1Y5LA 1OAKA 3A04A 1A8PA 4P34A 4HZGA 2FN7A 1QHHB 3OBBA 3IEIA 4HP8A 4M8LA 4QAJA 1E2FA 1KI3A 5E7JA 4EAQA 3DKPA 2EQ5A 2V9ZA 1V1MA 4L73A 1R0KA 4BV8A 1C9NA 4N47A 5E6RB 1MJHA 4LQCA 1BEUB 2G25A 2X0DA 3VVCA 4CG0A 4E1VA 1M6EX 2VF2A 5COBA 4IMIB 4PQEA 4PGHA 3ZQ4A 3EASA 6ADHA 2WSLA 1PG5A 5JJIA 1AGNA 2O2GA 4RVUA 5D3MB 5DLPA 2A9KA 3IA2A 1NXPA 3NT2A 5E0KB 5DE3A 3W5DA 4G0MA 4RY9A 5TF4A 2PEYA 5BN1A 1TIPA 2PQ6A 1J70A 2BBWA 4YCBA 3ZCVA 3RS0A 2FR8C 1VSUA 2BZ1A 2RHCA 5GOZA 4F9TA 5JISA 1P2VA 1UZMA 2HA4A 2QW8A 1W2HA 4EKIA 1DFIA 3K0SA 5ICEA 4DLWA 4TS1A 2FSPA 2OHJA 2AZDA 5EJ8A 4PLTA 2AHRA 4GOND 2AR7A 4RVGA 5E95A 4KXFB 5IEJA 7MHTA 4D3SA 1TADA 2ONKA 1UP7A 5T41A 1D5WA 4H4DA 2JFYA 2VDMB 4WESA 1P72A 1BW9A 1TZKA 5J1TB 4RVDA 4JUAA 4JQOA 4MW1A 1CUEA 2BGLA 5JHHB 1JYEA 1C8KA 2FSUA 1M2OB 5AXDA 4D74A 1Y1LA 4L5JA 4YMSA 3TQSA 3HE3A 1DIAA 3F5SA 4I4LA 4TV8F 1V4BA 4XVQA 3G2KA 1LQTA 4AY6A 4IBOA 3S81A 4EYKA 2C7RA 4DV0B 3L8DA 3B48A 5AI4A 3EXFB 1OPXA 2ZB2A 3AVUA 2R65A 4CMBA 1CR2A 3VJMA 3QWAA 2QVXX 1EVEA 1H22A 4P83A 2RGWA 1OBOA 4HFMA 4MH0R 2NTEA 3FRJA 4MW5A 4URWR 5B64A 3WNBA 3K9HA 2NUTB 1KJZA 1T5BA 4G4SP 4J16C 1ZR2A 4KBYA 4QJIA 1UUFA 1V25A 3T5MA 3DM5A 5KDOA 1KEPA 3UMSA 2CZGA 3AY6A 2JFHA 1AKNA 2Y1LA 3KDPA 3F90A 2JD1A 2B4KA 4FHZA 3A9UA 5K8UA 2AMYA 1EX7A 2ZJ1A 1MX3A 2DM6A 5K9ZA 4BX0A 1LBIA 2RAFA 4Q3NA 2B8TA 4W5RA 2JI4A 1YOBA 4QOIA 2P2CA 4KNYA 3ZS9A 5KEIA 1EG7A 2W90A 3P19A 4C08A 1DB3A 2ZDGA 1W5TA 4J1NA 4QG3A 2J9YB 1O9BA 1VJCA 3ESZA 4NY1A 2ZJOA 1CRWG 3R3WA 5HOQA 5ECYA 4HT3B 3TRDA 4DMHA 1CFZA 3D3WB 5KTRA 5JH7B 4BEBA 1QGDA 2HGZA 1IWOA 2GEUA 1T2UA 4XOIA 2EFGA 3GRPA 2CNNA 4OHOA 3B2NA 1F14A 4KZPA 3VZSA 5AESA 5DM4A 1H23A 3M1LA 3K9NA 3I6QA 3PL1A 4PSAA 3RD5A 5LYJF 1FQJA 3A4IA 4WCDA 3SFVA 4IDGA 3G2QA 5C8ZA 2IE8A 1S89A 1OB2A 2XQVA 3G17A 3LF2A 3RGWS 4JT2A 5TT0A 3QNMA 5CDFA 3IUBA 4O25A 4IAOA 3MHPA 1RXUA 4K9LA 3U7EB 4PZZA 4BFXA 4CCYA 5LZ9A 4EYOA 2BT4A 4EP1A 4FE4A 1PZGA 3VR2A 4WZAA 1ODJA 4F4FA 3BZBA 5JIBA 4URXR 1KYVA 4IYJA 2O3TA 2EVWX 2D0PB 3Q9NA 4H3VA 1F12A 3IMFA 5EN4A 9GPBA 1TM1E 4JJKA 3CW8X 4OATA 6LDHA 3I92A 3PEFA 4TS4A 3IPRA 3CX7A 2WZDA 1ZXLA 2HTFA 4HQRA 5AW0A 5FAXA 4Z4EA 1SEPA 4TN1A 5EP2A 3QEMB 4RMHA 2O5RA 3IRVA 4XD7D 1QQTA 5KOHB 1EBFA 1LV8A 1AF4A 3LV8A 1AB6A 1E3WA 1F2VA 3GF4A 1K88A 1Z6TA 4H4EA 4KDCA 1A4IA 2VYVD 4BZPA 2WFLA 3D6JA 1T9ZA 4H08A 1EFAA 4CMEA 2YICA 3OC6A 1UWLA 3GRUA 4MJ7A 2J59A 4RVOA 3VH2A 4ZAWA 2W9XA 1J24A 2QBYA 1EH5A 4LWPA 1VE3A 4OBWA 1YB6A 4E2FA 3K0EA 2DC1A 2QIOA 3AWIA 3FYCA 4YP1A 1TJ4A 3GMSA 3ISTA 2ZZNA 3AKDA 4NJEB 4CRWB 2NSDA 3VPCA 4PG8A 2C2OA 3F74A 3O0TA 1M8JA 4HAOA 4OI0A 1RXYA 3E5RA 4EY6A 2GBLA 5HJEA 4FS3A 3X2SA 1KBZA 1MB3A 3FBTA 4JYPA 4L4RA 2XNSA 1J22A 1IIBA 2ZSKA 3D0OA 4UTPA 1AXEA 1EZ1A 3AMVA 1L1EA 4HG2A 1EUCA 1AKQA 2WIDA 4X3OA 2Z1DA 1QVZA 3BGDA 2IYVA 5I7RA 2ACWA 3SG0A 3E23A 1Y9DA 3DBIA 1XMJA 3AU8A 4J3NA 2J32A 1KVQA 3EIFA 4M53A 1V5GA 3K2QA 3ZBPA 3PBKA 4P5EA 1TPZA 3PX7A 1HY3A 3TX2A 4YX9A 2A9OA 3T9EA 1NRXA 4UVIA 2EW2A 2HRCA 2JIRA 3D1VA 3D2BA 5AM5A 1NVVR 1Q12A 4UBOA 3OPVA 4M36A 4C7OA 4KRFA 3OTHA 3UWKA 3WGQA 2IVZA 4JVMA 5K3AA 4KP7A 4BKUA 2HDOA 1G4UR 1G55A 2A3RA 1KS9A 1R6BX 4EFNA 5LFAA 1FJHA 3OQ1A 2Q4RA 2D2VA 4ROTA 3Q8MA 5JXWA 1O94D 1OXMA 4TUYF 1MMFB 4PVCA 4BO0A 2W6JD 3NC4A 4X1IA 3KUKA 1GILA 3TX6A 1GR1A 2H17A 2IYZA 2HREA 2OFPA 3LUBA 5AVXA 2O7SA 2MOKA 1E18A 2WWGA 3GXOA 3LPCA 3OEHD 1NR7A 1UXIA 3IELA 1CEQA 4W5HA 1UKZA 3KV1A 1M2NA 4PCLA 1KI1A 1FMCA 4YA6A 4GQAA 1JEJA 2KMLA 3DWGA 3G68A 1KVTA 3E6AA 1BXGA 1CQXA 1ENOA 1GU7A 4ZVVA 3PTZA 2KW5A 3LJKA 4MQBA 1X7YA 3H3XA 4E4RA 1EVJA 3K2BA 1O54A 5JZ9A 4Q4AB 4Y7DA 1G2PA 4DIEA 3MW8A 2HSGA 4BVAA 1M34E 4B43A 4L2IB 5EJ6A 3EVAA 3SE0A 3DXXA 2QK4A 2ZATA 4WXEA 5U4QA 1R8SA 1JKMA 1KJJA 2C2KA 1GSAA 3I23A 2XX3A 4BIMA 2FEXA 3VNQA 2G5CA 2YRXA 3U9TA 2X1HA 2D2IA 3IUYA 4XVHA 1ZIOA 1E9RA 4I1RA 2EX1A 2ZUDA 1KMHA 3AYXB 2HA7A 1GG9A 3LPMA 1TI7A 3B9RA 5UKDA 2W2OA 2ZE8A 4M54A 3KYBA 3B12A 1ZNQO 1VPWA 3GT3A 2A9RA 4RIFA 5K3EA 4U2FA 4TOIA 2FDCA 3PC4A 1PR9A 3PWZA 1U31A 1XU4A 2ZRCA 3W8DA 1BC5A 1Y6GA 4EKEA 5BYKA 3VPGA 1XNJA 2AOVA 4GSYA 1S3GA 1LPSA 4N12A 1H2RS 4JK3A 1OW3B 1QO0D 3RC2A 1TAQA 1BX1A 2H59A 1NQAO 5EJFA 1ZD2P 2QTVB 2I87A 3JWJA 3CZ5A 4BNWA 1KJ9A 1W0JD 5KNBD 1WRBA 3RT7A 3JAWB 2IY7A 3V2GA 4C20A 3AH8A 4N3CA 4XWYA 4ZZIA 4U7DA 4R0MA 1XPRA 2F43B 4ZOCA 5I9TA 2G5GX 3RB8A 1RWKA 3ZI4A 2AF3C 3AI1A 4YP7A 3MUFA 3Q3GE 4JR1A 4MK4A 4A6XA 5KOJB 5JAPA 5GONA 1PX2A 4Q01A 1A8QA 3ZQ6A 4ECAA 4UPEA 3ITNA 4LDJA 1X1SA 5F3WB 2NVUA 4EEXA 5EESA 3NBFA 3NHPA 1DBRA 3P4YA 3U5ZB 3SF0A 1X9HA 3DBOB 4N7MA 1C0IA 1S1CA 2PRYA 4MYRA 1LRKA 4QBTA 1G20E 1AQYA 4MW7A 3TSAA 1XHLA 2D8MA 3VNUA 1CU1A 2C03A 3TLBA 2V5AA 3BF8A 2QAIA 4IJWA 3G8AA 1MKYA 1Q57A 2QD3A 4M60A 4D44A 2HMAA 2P9YA 2OG2A 5G3ZA 5FYDA 2EX4A 4B73A 5HIAA 4EB3A 1TA4A 3X1WA 3X1MA 4BMSA 1KQGA 3EWSA 1DT3A 5A4JA 3VGPA 3A6DA 1SOMA 1E66A 1G4HA 1R9NA 4FEEA 1NF2A 2GCOB 5BN3B 1DBWA 1NN5A 4MS4A 2G7MC 3M70A 3G7SA 3NP9A 1B43A 4JBYA 1KJIA 3PHIA 1DRUA 4M8NE 3DMDA 2RB5A 3LCUA 4COOA 2FMTA 2VDJA 2QRHA 4KL8S 4L8FA 1RYZA 4PNPA 5ITZA 4BQPA 4EHAA 4DQVA 1U3CA 2GDZA 5FTLA 2FEKA 4X6XA 2WJAA 2WUWE 1PNOA 1HA3A 5CNIA 2W4QA 3H3FA 4K6KA 4XGIA 1UK7A 3DTTA 3LHIA 1NBAA 2MSDB 3OF5A 4UCXA 4BLUA 1UP4A 1ZIDA 4C05A 4F1WA 1AN0A 3GMTA 5JAIA 3OAAD 1V5WA 3EODA 1X3SA 4F8EA 2E4AA 1W73A 1YQWA 3C1TA 3A9TA 3UT0A 2X19A 4US2R 4DKJA 4PC6A 2ZT6A 1WU7A 2DY0A 5KS2A 4DIUA 1G8HA 2HSZA 3R7LA 1FW8A 2R6DA 1L7RA 3EDYA 3AF5A 1SVWA 4LXTA 1GLGA 4NL4H 4MUFA 3L0IB 2X2FA 2CGEA 1CD5A 2IDMA 1MP0A 3ONFA 2D74A 3JQBC 2Y0PA 3PHLA 4HWPA 4EARA 1FRNA 1ZG3A 1LTHR 2C3YA 1MAAA 3GLSA 5KAMA 3PUHA 1GHTA 1NX9A 2VJPA 2I03A 4TRRA 5I4BA 4Q4CA 5LR6A 1RMTA 1NULA 2GZMA 1QX4A 5E4TA 2WSMA 3GPIA 4P3XA 2GEKA 4RVFA 5LZ5A 5IKXA 1NQVA 2IIVA 2Y2UA 4DDMA 3T7RA 1UKVY 4GWGA 3BREA 4QQKA 2G06A 2C8LA 5KKCA 5HBGA 1ORRA 2R44A 3T9DA 2WQZA 2FMFA 3O93A 1RAAA 1UPTA 2CFIA 1CZOA 3AY0A 3KKNA 3O0DA 4M9QA 4N5HX 4A0SA 1G66A 4GLOA 2P6RA 2VHVA 4YDSA 1BSVA 1XTZA 2GDJA 4IO1A 1V0JA 1RXEA 5AH0A 4P58A 3D2CA 3M9LA 3W4IA 2FW1A 1M34B 4LEIA 3B36A 3JYOA 2QEQA 2VVTA 4D02A 1Z7YA 1I14A 4X60A 2X4LA 5GAJA 1FVHA 3I2FA 1D6NA 2ASVA 1XRJA 2FG6C 2OTCA 2ZI9A 3LRXA 4L16A 4KQ2A 1RABA 4MAAA 4Z2AA 3G0GA 2H7XA 4OU5A 1HDEA 4HUTA 2YUTA 3H17A 3TIIA 4IDFA 3Q12A 5B1EA 3PA8A 2DQ4A 4B45A 5DM70 3ORHA 4HLUA 3OIVA 3BF7A 1RLIA 2PGOA 1IOWA 2G4LA 2VPXA 1TVMA 3BRWA 3HBNA 2BWJA 1M6NA 4M7OA 1PS0A 1CB0A 2CLEB 3R2JA 4PHCA 4Q6BA 5DH9A 5BSTA 1VYUA 5SYNA 4KE9A 3UATA 4YCMA 3KLBA 3L7NA 3JYQA 2GVZC 2X7XA 4G6ZA 1Y5IA 1PVVA 1T36B 3INNA 4HLCA 4B83A 4DLSA 2PU5A 4ZPXA 3NHWA 3OEYA 2DSNA 1Z4QA 2Y9MB 3K32A 3QE4A 5AW7A 2W7TA 1N7HA 1KRWA 4HNSA 5JMPA 2HRZA 2D0DA 5A4MS 2O8FB 2CLFB 3GZNA 4LPSA 5AW4A 1D0VA 4LXIA 1CQPA 2OT3B 4PRZA 1AKWA 1GQYA 1H6BA 1Q11A 2WVJA 3DO5A 4DAOA 2ONZA 3G89A 1BN6A 3CURA 3SHFA 5FDFA 5HFAA 3IFSA 3HC7A 5M04A 3SDSA 3S2ZA 3CJRA 5H16A 1QRAA 1Z18A 2FSSA 4OHMA 1SZJG 4B74A 4HGRA 4TYWA 3UMGA 1CJCA 5BUSA 4ZV4A 5BSVA 1ULHA 5DM60 3CN7A 4DBVO 1ZVQA 1G20B 4JR0A 3TEFA 3S1SA 1I3NA 1DSSG 2HMTA 1PR5A 3EQ8A 5ALWA 1SZDA 5F5NA 1L7DA 1ISMA 1P80A 1QXSA 2I7XA 4IMRA 3URKA 4EMBA 1AF7A 2EYQA 4GFDA 1UQRA 1DOAA 3WJAA 3KTDA 1HSOA 4I50F 4LF4B 4QYIA 1MRSA 2OC4A 4QECA 2I7CA 1HC7A 1REQA 2C9YA 1NVDA 2EKDA 3HR7A 4KIUA 1IG3A 2Q8PA 3W9YA 5DIZA 5BRJA 4EGFA 1X87A 1DPFA 2MYNA 1O8CA 3I6MA 2IV7A 2P5UA 1N6OA 2X6QA 2GK4A 2CFOA 1U1DA 2OM2A 2IW1A 3CTMA 1EXMA 2LPMA 2PL5A 3EG9A 4OM7A 4PHFA 3QVUA 1JB9A 1Q1ZA 3F9IA 4EY8A 1V26A 4MX8A 7ADHA 4JI3B 3ZDYB 4MVJA 4I4TB 1GQRA 4O3FA 2VAVA 3D2LA 1DTEA 2AKAB 1C1DA 1DP4A 4H27A 5TQVA 1T2AA 1YQXA 4WX2B 4JU8A 5KTSA 3SBEA 4Z4IA 1VI6A 3I6YA 4H9GA 4MA4A 5IDWA 3ZHOA 3PLNA 1Y34E 1P1KA 3EZ2A 3OTGA 3IVAA 1Z63A 4J0CA 1SVKA 3ZEIA 2QX7A 4CJXA 2F8LA 5JCOC 5IBPA 2RAUA 5CJ2A 3U44A 4RTOA 3QVKA 5CA0F 1JF8A 1HDOA 1T4GA 2PUTA 1QQBA 1ZK4A 2WFAA 4OJYA 2D4HA 2AN5A 4IIFA 4AQYB 3SEFA 2JJMA 3K70D 1OAOC 2ZBFA 5J9FA 2Q3LA 2FE4A 1UBSB 2J3KA 2GBPA 3I34X 1XQWA 3I9MA 3PR2B 4US0R 3UM9A 1Q2UA 1KDPA 2PBRA 5DGTA 3H1EA 2REBA 3UXHA 2Z8YM 2P75A 1XAHA 5AKHA 2ES4A 3LP5A 4QBHA 5AVRA 3OOWA 3KUCA 3I9LA 4QTYA 8AT1A 2A59A 3KM0A 4FYHA 3VR1A 1Y8QA 4V24A 3ZHUA 5KYVA 1CY0A 3UUFA 4GIBA 1NI4A 3IAEA 4F85A 4I6GA 4AULA 5KQMA 2Q3CA 4H17A 1ONBA 2H2AA 3LCMA 4C0SA 3L6UA 4YJ2A 3RHTA 3ZWPA 4F45A 2R7MA 3TUJC 5K4AA 3S40A 1V7ZA 1ID1A 5I7HA 5LDDC 5CIYA 1XIVA 2YINC 4OL9A 2JEYA 4HEJA 2Z9BA 3CPSA 3IDOA 1PS8A 2F9LA 2ANCA 2JPDA 2GF9A 2RBGA 4LMRA 4HNAB 4AY3A 4EHBA 4PYRA 4JEUA 3FNFA 1VZ3A 4RLHA 4XUGB 5AI0A 2R7LA 3U61B 1FZTA 2GARA 3QQPA 4DCMA 2PSHA 1K8XB 4IPTA 4YRBA 2FLVA 2CVHA 1GYPA 5EWLB 2IXEA 3NAGA 1HLGA 1M7BA 2VP3A 3DZHA 1H0HA 4MOWA 2HU2A 1L7BA 1TF2A 1Y3IA 1LS6A 3A1UA 4C30A 1E2MA 3H04A 4PN7A 3TZQA 4FR2A 2O23A 2DR3A 2VC2B 2QORA 3UWDA 1SUDA 3Q2IA 1E9DA 1Q1QA 1U8FO 3ND5A 2VF4X 1QONA 4GOXA 4HS9A 1HT2E 3I2YX 2PVPA 1UDAA 2H08A 2IY9A 2QZSA 2PN1A 3COWA 3UXYA 3PFKA 3TUZC 3ABQB 1YBFA 1J06A 4PZCA 1BROA 4N39A 1M2EA 1FP1D 1T2DA 3DTYA 2VDOB 4XE5A 4FMCF 4CHGA 1ZIPA 4A16A 2GZRA 2RGAA 1Q3TA 5A03A 2EL7A 3BH0A 5CFLA 3FSRA 2XWJI 4NAUA 3QXHA 1XXLA 5BW4A 3NUZA 3D1LA 3QKRB 3Q88A 1F7VA 3DDOA 3FDZB 2H1LA 3B3JA 4MS3B 3F67A 1QIMA 1XEAA 2Y4OA 1LY1A 4FD2A 2W4IA 4YQEA 5JZBA 3SM9A 1N33B 3VPDA 4YRTA 1QU3A 3DGEC 3K94A 4HCJA 2HUNA 3WOVA 2L17A 3GHHA 3DV0B 4QPJC 3TECE 4D57A 4HJXA 3RYTC 4D46A 2J8ZA 4YV1A 5EVCA 3RFFA 3LWNA 5BMVB 2DHQA 3FUVA 2WHPB 3V4OA 3U4DA 1UPBA 2R25B 5LPNA 2WAYA 4HZUA 4II3A 3JR3A 3RC7A 3JW8A 2Y6UA 3GJ8A 4OEHA 5CLLA 2C4TA 1J9EA 1A4RA 2DR0A 2B82A 2HN9A 2PX4A 2QYTA 2XR1A 3CVJA 1U0NA 1MHTA 2NSYA 5HF5A 1JHXA 3QWFA 4D4KA 5IG2A 3K8QA 4IIJB 1FP4A 1HK7A 1MVNA 3WL6A 1VRVA 2DMRA 4ZQGA 4Z9AA 3EXG2 2WYUA 4CCSA 4D6YA 3OCZA 3C6BA 5BOSB 3RROA 1SHJA 3THXA 3F97A 3OM0A 4URHA 2E4XA 4CF7A 3NHMA 3DXZA 1MJFA 2AMVA 2P65A 3HNPA 4G24A 4DCJA 1AMUA 3NHKA 3EULA 4GXNA 1V1RB 2J45A 1NHWA 3FHCB 4JMPA 4R9UC 2QDKA 3IESA 1FFWA 4PO1A 4NABA 4N1AA 2O8DA 5DV9A 4CF6A 3HFSA 5EJ2A 2GPAA 5ALTA 5THXA 3TRJA 4BRUA 4H1WA 1WKBA 4II7A 5L8VA 4MR8A 3LECA 5SY9A 4DSTA 2W83A 3AFOA 3NFRA 1KWKA 1EFTA 2CB0A 3E9QA 4CLEA 5ES3A 2VT2A 2O6LA 1BWQA 5FQNA 3OHMA 1KR2A 1PWZA 5BQ5A 3WQSB 4DMKA 3EXEB 3MTBA 4Q0MA 3VR3D 2A7QA 4RMGA 1IY2A 5EUBA 4D6PA 1S9DA 1ZONA 2WINI 3H5WA 4I3HA 4TZ0A 2RDMA 4KJXA 1O7JA 3HM9A 2HV8A 3K09C 2W0SA 4ARIA 1HE1C 4A8TA 2GK6A 5B36A 3HXTA 1RQRA 4HADA 2OORC 4FHFA 3G8CA 4US1R 2G5PA 4G5QA 5A0VA 3PR1A 1H69A 4DCTA 2BKLA 3T3HA 1I94B 4AJIA 4G67A 3AKYA 1KYTA 3K5HA 5ALUA 2BISA 5LLTA 2V7XA 4O4IA 1PT7A 4F4UA 4AJ9A 3U56A 2IS2A 1N1GA 1NNLA 1UPUA 1KIFA 1T8UA 2NYVA 2W8BA 3IBGA 3LQ2A 4P81A 1QHGA 1K06A 3LT0A 4QVKA 4TMXA 4IWXA 1DX9A 4RQAA 5CB8A 2ZTSA 5LQCA 3PK0A 3UMMA 1CV2A 1GV1A 1HFWA 1SG6A 3W6PA 3UOWA 3TLYA 1N2GA 4YRZA 3NIBA 1GGEA 2PWZA 5LXTA 4GBJA 2IYYA 3A58B 4R4JA 3Q3IA 1XLUA 4UXHA 2PKRA 2HA5A 2FQQA 4LS3A 3ZGOA 3V55A 3F7TA 3PP8A 1QBGA 4MUIA 1L8AA 2QTBA 5BOVA 4NWIA 1BX0A 1RZVA 3ETCA 4OB8A 4OXRA 3UIEA 3WLMA 2Q1WA 3N59A 1Y3CE 3PFGA 4KWEA 4YJ3B 2XYRA 4KNVA 4L4XA 5ALJA 5FNZA 4CL3A 5K3SA 1KBQA 1Y8AA 1QQ7A 4DQDA 1TLTA 4YBZA 3U1BA 1U4OA 4NS1A 1PUIA 3IEMA 2IQIA 1C3JA 3SBOA 3KWFA 3K0AA 3ZC3A 4EUSA 1F0YA 2H0RA 3QH4A 5IT9A 4UHFA 2OZEA 4QRHA 4B4WA 4FEAA 1G64A 4CIWA 2YXEA 3GUHA 4QDZA 5KNDH 2HJHA 1QWOA 1KI8A 1VE9A 4UM9D 4F2DA 4UAVA 3CZ9A 3TPCA 4G8CA 4CG3A 2ERXA 2P4QA 2B3DA 4O33A 5H9VA 3P5BA 4OKIA 3PEUA 4WCVA 1K8QA 4IXNA 3JQAD 3B3FA 4YQZA 3D8HA 4LYEA 3LA8A 2A14A 3KYJB 1KJQA 4QUDA 4CF4A 2GCIA 2P4EA 4C6HA 3RUCA 3BZWA 1EINA 3GAFA 1JLSA 3GG9A 2C92A 3CLHA 2UZ4A 3AKEA 2AQIA 1QGZA 4KQEA 4N3BA 5AXCA 4P53A 4ALMA 4NCXA 3BKXA 1KFEB 2J87A 3IXQA 4ABTA 1VCMA 5FCDA 1AS2A 2H0AA 4IH9A 3U7QB 3HR4A 1IXZA 1B73A 3R75A 5CA1F 1T15A 2VNKA 4H7IA 1XKLA 1ACLA 1HYGA 2B83A 1AK1A 1QHIA 3W2HA 5DTQA 3AUSA 3UJ9A 1RHQA 5BW8A 4QQ8A 4UQLA 1V8ZA 3HP7A 3DHNA 1A88A 1QPBA 2GUWA 3BK7A 3KOWA 4IIUA 4U7JA 4QLBA 4LNUA 2HXYA 2ONYA 3BFPA 3VZBA 3A1TA 3WAKA 4WFIA 2P2DA 3FETA 4S1NA 4YAIA 5FI5A 3EWIA 4DABA 3JRNA 1L3CA 1IIRA 4QPNA 5DRYA 5B1HA 3GAMA 4C29A 5LJIA 3SEQA 4Y1EA 1P9OA 3TQRA 4CTJA 2WUVA 3T7TA 1O6BA 1PQPA 4BP9A 4DUYB 1SXIA 2G4CA 4FFLA 5AKYA 5KKAA 3N5CA 3VHXB 3HCPA 2GBFA 2AG1A 3I5AA 4PHGA 1US8A 1KY5A 4UAUA 1L1FA 1BGVA 5L95A 1K8YB 1WXFA 2Z3WA 3EIQA 3HU1A 2TYSB 3CN9A 3MOSA 1PE0A 3QF4B 4IEFB 3RVLA 3E9YA 3W78A 3HLTA 4BFSA 1Z7GA 3QLTA 4YP9A 4AJPA 3D7KA 4XM2A 5CM9C 2IZ1A 4IX1A 4WFJA 3WMXA 2PLAA 3GUYA 3KOMA 2EKZA 3K9WA 4A36A 1TU4A 1V3TA 1YL5A 2JCGA 2B61A 3DKIA 3WBKA 5JDIA 3FTCA 1IXSB 2VXBA 4FE3A 4C43A 1Z2DA 3GVPA 1Z4LA 2CL0X 4KN9S 2YZKA 1XDZA 4OXIA 4BLTA 4DQLA 3QPAA 4BKMA 5CW2A 1TKCA 4YT8A 6NULA 1P2DA 2GAOA 3GUUA 1DKMA 1MG0A 2V6IA 3KO8A 3GPBA 3HYRA 3IUEA 4IH4A 3VPAA 5CXUA 1VYVA 1MX5A 2VNSA 4V1CB 2A5DA 2WKSA 4LDQA 4X44A 1DTSA 1W1WA 3EAQA 3GRFA 3LIPA 4CIYA 1Q0SA 2QZJA 4YROA 4HAVA 3SZUA 3H0CA 3KSDO 4BLOA 2GO1A 1MV8A 3GT7A 4BN0A 3T6KA 1HKUA 2XD4A 3SM3A 3TRKA 5F7OA 1TEZA 1WJGA 2C5FA 4P3YA 5FWYB 4D4LA 3BJIC 4QEZA 3O75A 1DWOA 1OWMA 3FWNA 4TX1A 4WY2A 4KQ1A 3B6MA 3D6UA 5TV2A 4C89A 5BPFA 1T8RA 3OQIA 4O0LA 3E7PA 1ZNZA 3MHTA 3I9V1 5FWNA 2OEPA 2ZVQX 3EXAA 3UMFA 1S96A 2XWBF 4EQZA 1CEYA 4W8OA 1G6KA 2WIBA 1DAHA 4KPUA 4HDCA 3FLMA 4NENB 1SD5A 1W2GA 3GN2A 3BQMB 1J25A 2GNAA 5LQRA 2OHIA 1KY4A 3EPKA 3WKBA 1GAXA 1MIOB 4UXIA 1GGHA 3PLRA 4TMWA 1L7MA 4TV9B 5FOUA 4QYMA 5D00A 1CG6A 3W5BA 1Q0TA 1X70A 1ST2A 2PYZA 1XELA 3TQHA 4G5XA 2WAOA 2VLBA 3HJFA 1E99A 1YHZA 3NALA 4U5XA 2J3QA 3BICA 3UJ8A 4EUFA 3ZUPA 4LSMA 4WBNB 2W0MA 4MJ3A 4GKKB 1NP3A 1T6NA 4FT4A 3WDMA 5JW6A 1ESNA 3O8RA 2LXNA 3PNMA 4RU1A 2GJ9A 1N4DA 3WC4A 4ZKDA 1Z2OX 2BGUA 1OILA 1G8YA 2CFTA 3G13A 1WPXA 3DQQA 3P8ZA 4U6SA 1O4WA 3MCZA 5I7OA 2XF8A 3OTIA 4DV3B 4CQNA 4PZEA 2B1JA 5DHAA 1I32A 1YRLA 2MTBA 4PW0A 2YNMC 5HCNA 1NJ6A 1YB4A 1DKLA 2REQA 1QLJA 3DFUA 4NMHA 5E4FA 3S2UA 3VDNB 4DG5A 2JIDA 8LDHA 4QVIA 5BPHA 4PLGA 1G41A 4R7GA 4A0FA 5K0ZA 5KX5F 3PYXA 2WTNA 1EIZA 2GD2A 3OP1A 5G4KA 4HI0E 2Q41A 3I1IA 2O8EB 3JQ7B 2UUPA 2ZYTX 4TVSA 3C15C 1NJGA 4Z9BA 3VNBA 3QBTA 3HV0A 2PL9A 2OCBA 3UKDA 3W5JA 2GJKA 2NIPA 3OF3A 1IXKA 4MUEA 3EGOA 4EFLA 3N6VA 1C2TA 1QIDA 1ZH2A 3KQMA 2IBTA 4Q02A 2Q6TA 4YCLA 5ISMA 5I5EA 4UPVA 3S55A 5L3QB 1L7OA 4FDMA 5F5XA 1EXDA 2G28A 3ZQUA 5HRUA 1GZVA 2JEOA 4BBJA 3KXIA 3NTUA 1ODIA 2PG3A 3PNVA 5LQJA 4J7XA 1H4SA 4TTJA 4Y6PA 4IUDS 4I08A 3WL4A 4E12A 2R96A 1U65A 4ZT6A 1XAJA 1XWWA 4YRKA 3OLVA 1CX9B 1QP0A 4W5TA 3ZGYA 2OD9A 3O8OB 4JJGA 3M6UA 3OQJA 4G5YA 4KX3A 2FGJA 4TQ9A 3E3NA 2CLHB 1Y1QA 4E6EA 4P4NA 1WEKA 4NU8X 3COVA 3O9VA 1ES9A 3A28A 2HU7A 3RLFA 2HLDA 3W5IA 1AOXA 2JGFA 4GOMD 4DXHA 3KETA 1QYIA 3QX9A 5LL6P 2YZ2A 4QICA 3RVDA 5JXGA 5KSZA 2YXNA 2A0FA 1OV4A 2C5HA 4TKUB 5E6SA 5AOBA 4UBKA 4NULA 4CT5A 2BFNA 4DV2B 4HPJB 4EMSA 2H1FA 2QMEA 4HVTA 4JA0A 5H7XA 4QT4A 1KEVA 4KYTA 4LXXA 3UK7A 2C83A 4DLYA 4F11A 4DN6A 3LSTA 3IEUA 5AJTA 1SU7A 3UK1A 2ZB8A 3WA7A 1EE1A 3PNOA 1MO5A 1S2MA 3CZMA 1KMMA 1C2YA 2D5CA 3EDCA 1R1DA 2DECA 1IBRA 4RCZA 1G4AE 3FYUA 4U00A 2F1JA 4LC1A 1O96A 1YFLA 2F4VB 2VK1A 5CU7A 3SBDA 2W6PA 4RD1A 4YJKA 2FEPA 3NNNA 3DZGA 2GZHA 2ODTX 4XYEA 3FB1A 3VO9A 4RDXA 1TQ4A 4Y8VA 2QL6A 3SVZA 3GJQA 4J4BA 2FTKE 1P2FA 3M83A 3IQWA 2R1TA 5I7VA 1P0MA 3E3OA 2IEYA 2WILA 4MEAA 2ZT8A 4ZRDA 3T5TA 2XXAA 1H94A 3DC7A 2CEAA 2OV2A 4RENA 5HS6A 1ZJ6A 4FW9A 2VJMA 1M10A 2Y0BA 4GM4A 2IHYA 1HLDA 3CBQA 4F6RB 1NXSA 1UJ4A 2CXRA 1Z82A 3CNBA 3EIOA 4UM7A 4P38A 3O8CA 1KQ3A 1NUHA 1KAHA 3ZDRA 3U1VA 4L08A 4ZHQB 1PFWA 1PNTA 3I2JA 2XY4A 2JW5A 5AVOA 1RYHA 4S1WA 4LBZA 4G0QA 3RWOA 1MH1A 2AEJA 2VLIA 4OHYA 1M2JA 4XIGS 1XQXA 3M4JA 3OOJA 4R8VA 4Y0NA 1VSVA 1KYYA 4GAEA 3JSAA 2RGCA 1KAMA 4N0MA 3FUXA 2O7RA 3BOSA 1X42A 4LKOA 4PXYA 4S35A 5CNJA 4ZO7A 1VZ2A 3WJ7A 1A9ZA 2X0NA 2IPOA 3DHYA 5DLDA 3AKZA 5CH8A 1B0PA 4WN9A 1S6YA 2J0UB 2LW7A 1XKQA 5BP7A 1NA5A 3OJEA 3RIMA 3RRXA 4GM1A 5BURA 1ICIA 4X62B 3GLFE 2PUDA 4LKRA 3A1DA 3NANA 2IU0A 2FZWA 3KYCA 5IT5A 5A9TA 4QJ3A 2VUUA 5EMJA 4B6QA 4CKYA 2O7NA 4CE6A 4IMPA 3DDWA 2YWDA 2EWWA 1JR3D 1SUEA 2C4UA 2FKNA 2X5XA 1T0PA 1SN7A 2YUIA 4ITUA 5FWDA 2MJLA 2VQ6A 1OZ0A 2Q4EA 4N8DA 3B1KA 1SB9A 3BHMA 3IJ5A 5FR2A 2AR0A 3FOZA 3LGXA 2GRJA 4D3YA 3JQ6A 3C1AA 1S2OA 2DCUA 3WJ1A 1WSDA 2TRSB 3Q2KA 4WZZA 4WFQA 2FOIA 3CX4A 5FA6A 4RKEA 1DAPA 2PHZA 3PLAE 2I3ZA 4FGLA 2WF8A 4KTTE 2QG4A 1JL3A 1X7WB 1E7RA 5CB4B 1XNRB 3HCEA 4Q1FA 3BD9A 2ID7A 4JGIA 4PAQA 1PEKE 1R5NA 2HD4A 1YRHA 3CIOA 2XYPA 2VH1A 3H4TA 4CFYA 5CXSA 4ZTBA 2ZQZA 2NXEA 3WGOA 1LI5A 3UG6A 3VU9A 5DB4A 4NBKA 1SA0B 5B7QA 2FMUA 3HFRA 1ODCA 5EA2A 2BFEA 4G56A 4RF5A 3RYHB 3EH2A 1LLCA 4YAKA 2AW3A 1U0RA 2QR3A 3DTVB 1QTIA 1T3HA 1BG6A 1BCRA 3KSRA 4OLBA 3KQUA 4DYVA 2HWUA 3F46A 4AXXA 2OV6A 1RMQA 5IC6A 2QP3A 2NQ8A 4NZYA 5AKEA 4GSKA 4ZD6A 3ROGA 3FOEC 4AZTA 4FWBA 3HL0A 4UARA 1NJSA 3CKKA 1M1YA 1W34A 4UUOA 2IYEA 1T6BY 2AIRA 1BH2A 2MSLA 2RCYA 3DE2X 3FNRA 3P0RA 1EK6A 1R4NB 2HBYA 1U6IA 1XJ5A 2ZU6A 4R1PA 4X1YA 3GFGA 5BN5B 2IV2X 3W1VA 5EJ5A 5HZMA 3ILYA 2QPLA 2DP4E 2G07A 2ZI5A 4ASUA 4JBLA 5ADUS 2PT7A 2AS0A 2VPQA 2XMGA 3QRWA 3RV4A 1PJRA 3TPZA 4I1OA 8MHTA 4KPEC 1ORTA 2YHIA 4EBBA 3VZQA 5I45A 1LBSA 3JQ9C 1N6RA 2QUZA 4RYDA 4YYZA 1TCVA 1ISPA 1UBUS 1KDOA 4JBWA 3UJDA 4L1KA 2NO1A 5CFOA 5IWCA 3B3QA 1GSIA 2FWRA 3K31A 4HTAA 4IR7A 3HA3A 1JKJA 1JTFA 3HY6A 3RQIA 5FORA 3ITKA 3NASA 4MKXA 3LWZA 2X9VA 1J8VA 4KJZA 2BUAA 4CFSA 3O8QA 5BRAA 2A3NA 3PIIA 4RJIA 5K05A 2VXCA 5JXIA 5G3YA 4CGZA 1VLHA 1P5ZB 3DAYA 3PXXA 2SCUB 1D8AA 4L0QA 1YE3A 3HRHA 1OFGA 3CH5A 1TNDA 1OLUB 1AQ6A 3GH3A 3CA8A 3FPKA 1BVRA 4JQSA 3DOOA 3X1YA 2OLJA 2ZZKA 3GYGA 5BV2P 1K4KA 4FOLA 1JEYB 1XZ8A 2F8MA 2CJFA 3RS7A 3OE5A 5IUJC 5FAKA 3WWPA 3RFUA 3IIJA 3F4BA 1G6HA 1OA1A 1T25A 1V3UA 2ZSFA 1P33A 1VM6A 4QUIA 1DAIA 1V7CA 1THTA 3CV3A 4KGDA 4RHYA 5CX4A 2HLNA 3IR5A 1MJGA 2Q5CA 3T1VA 1W93A 3OQ6A 2AX3A 3H1AA 1NTRA 1DJQA 2QSUA 3OQVA 3DULA 2B3TA 1N8SA 3LDFA 3CVXA 1NL3A 4DLZA 2BJWA 3EA0A 3KWJA 3OZUA 2PAFA 1N2IA 3HG7A 3QSGA 2BGWA 3HO6A 3OKFA 4FE7A 1BFDA 1GUDA 1FTQA 2YXDA 1DLJA 2VYQA 3GR6A 2HF9A 1SHKA 3DR3A 2ODAA 3FCCA 3L43A 2V7WA 5TPWB 1N0IA 3ZDEA 2OUIA 2CKMA 2UZ1A 4P2GA 2GZAA 3DOEA 3EN0A 3LDGA 4NU0A 5G1OA 5LDGA 1LJ8A 1MX9A 5C5DA 3GLHA 2MMCA 3EZ7A 2XZPA 3EUWA 3GV0A 2V8OA 4JI2B 4ZVLA 1AK2A 1DARA 2JJ1A 3K4QA 3OCXA 2EBFX 5DHUA 2BMDA 4BO3A 2PUBA 2ZBDA 4G85A 3JQBA 1CZKA 1GIAA 2IOFA 1UEIA 4H3HB 3GLFB 2NO9A 4WY5A 1TF7A 5CYGA 5LLSA 2PQ2A 1T4MA 2YJ6A 2C9BA 3EVBA 1YCGA 1JN0A 3BFKA 2DXIA 4FFBB 3CR7A 1AHHA 3ZUGA 3E5HA 1DG1G 3ED5A 5A7HA 4F7DA 2A5YB 4TWIA 4I9HA 3BWBA 3OFJA 4LJAA 1MN6A 1GUYA 3SHOA 4WKCA 4A27A 3QFSA 4JKIA 4BO9A 2B4AA 4UNNA 4TT8A 1C7RA 3ZKWB 1T9KA 4BLPA 4XIFA 2R1ZA 1KZHA 5BR1A 4ESVA 3JATB 2CE7A 2X0KA 3JVUA 1JE0A 2F67A 4HDRA 4AX4A 4EA7A 3EUFA 3EDRA 1QKIA 4G4GA 2D5IA 1C5KA 4LV8B 4PAGA 2ZRIA 3DBLA 3OT1B 3W2IA 5JJCA 3K70B 2XZLA 2II6A 1XQYA 4PBTA 4MW9A 2PS9A 5JVDA 2DBYA 3P26A 1GKUB 2A1IA 2EP8A 1N6LA 3OLYA 2H6EA 4M22A 4NKRA 2G08A 1B8VA 3EXHC 4MWTA 3DZIA 2BTQB 1O5OA 2RHJA 4URYR 1OXTA 3BXFA 5D3MA 3L8ZA 2SBTA 2PSDA 2IEIA 1E1CB 1L7XA 2DH5A 2ECPA 2XV1A 3DVLA 3T8YA 1TQDA 1PJ8A 1TZ2A 1KQFA 1W36B 2CNWD 4MIYA 3T7SA 1EFUA 1R8YA 1V3VA 2VP6A 2PU7A 2YXLA 4GP9A 3WL8A 4D4IA 1TX4B 3KHUA 3TUIC 1L6IA 2QSYA 3DGFC 3BMCA 4LTMA 4B8YA 4F3RA 1VE6A 1A82A 3F47A 5GONF 3R5TA 4TROA 1K7YA 1OZGA 4YMVA 4OAQA 3NBUA 2DG2A 5K3FB 3N2YA 5DW0A 3CZCA 2Q45A 3OZFA 3P45A 3OI7A 1Z0UA 2M98A 5JUWA 5IAOA 2CJXA 1OMOA 3HEMA 4LK2A 2HHHB 4M0LA 3H99A 2C2ZA 3AILA 1Q0ZA 2EAUA 2E18A 2QGFA 3BFXA 3K8OE 2FWNA 4MMXB 4V0ME 2I22A 4IJ5A 4BQIA 5EJMA 3RHZA 3UJNA 1RSZA 1MAUA 1PFVA 2YHSA 3H2YA 3PT5A 3R3VA 5ILQA 3A1FA 1BKYA 2HSEA 4W6QA 4KO8A 3E9ZA 3TH5A 4B48A 4R31A 5AK3A 2QRVB 3CY6A 4TV8B 2GLXA 3IDQA 1ZC3A 3GN1A 1G60A 3CNNA 3R6TA 2Q50A 2IPNA 2RGBA 1YQ9A 1DMSA 3BULA 4WUVA 4A8JB 5BWNA