3CRNA

Crystal structure of response regulator receiver domain protein (chey-like) from methanospirillum hungatei jf-1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
129
structure length
128
Chain Sequence
LKRILIVDDDTAILDSTKQILEFEGYEVEIAATAGEGLAKIENEFFNLALFIKLPDMEGTELLEKAHKLRPGMKKIMVTGYASLENSVFSLNAGADAYIMKPVNPRDLLEKIKEKLDEQEKEGHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of response regulator receiver domain protein (CheY-like) from Methanospirillum hungatei JF-1.
rcsb
source organism Methanospirillum hungatei jf-1
molecule tags Signaling protein
molecule keywords Response regulator receiver domain protein, CheY-like
total genus 47
structure length 128
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3crnA00
1YMUA 4PEVA 4FB4A 1EWKA 2PL1A 5KC8A 3LUAA 1YVUA 4MS1A 2LPMA 2JBAA 3K9CA 3HUTA 4MR9B 1ZDMA 2JRLA 5HKOA 4RK0A 4O5AA 4OBBA 2E4XA 4YS6A 2J48A 1KMIY 8ABPA 2P4UA 1J56A 3CU5A 4XARA 4Z9AA 1MVOA 3OQNA 4RS3A 1TMYA 2JVJA 1UDRA 5GQSA 1XHEA 3N0RA 2R48A 3IP5A 1B00A 4D6XA 3N8IA 5C5CA 2FXIA 3Q7SA 2PUBA 1A04A 5DGCA 4XLTA 2NZUG 2R47A 3IDOA 1DCMA 3OQMA 3HJFA 1LJUA 2JBAB 4RXTA 5F64A 2FW0A 4EVRA 4RXUA 3F7NA 3KLNA 6CHYA 5DTEA 4RY9A 4KV7A 4RZSA 3RH0A 3LUJA 2PLNA 3O2QB 3MYYA 3QLUA 4KNYA 4KK3A 1PUXA 4QYWA 3DZDA 3KTOA 4MQFB 3T6KA 3I09A 4YV7A 1QQBA 3GV0A 2RJNA 1PNTA 2PAFA 2AYZA 4Z4EA 1DBWA 5JS1A 2CD7A 2NT4A 4NICA 3NNNA 3H75A 4CBVA 1AB5A 3H5LA 1W25A 3N0WA 1DCKA 1GUDA 4E7OA 3CFYA 4RK6A 2FSPA 4OG2A 1CYEA 3LUKA 5B3JA 2PUGA 1FFGA 2IPAB 3EODA 5IC5A 2FQYA 4TMYA 4ZPJA 2PJUA 3JVDA 1NATA 4G0XA 1OXKB 4MR7B 4TN5A 2WRZA 4MQFA 1MIHA 5TE9A 1LK0A 5E3JA 3LKVA 2QSJA 1S8NA 1NXWA 2FMHA 3NHZA 1YS7A 2R4QA 5TPWB 2VK2A 1Z2DA 3JVIA 1USGA 1EWVA 1USIA 2OENG 2RGYA 3IP6A 3CG0A 3VNAA 3OLXA 5CNIA 4H60A 3R0JA 2FN9A 1NXVA 4RWEA 2CHFA 4D74A 5KQLA 1ZGZA 1SRRA 3T95A 1F51E 4M88A 3TMYA 4EVSA 3DBIA 2RJOA 4F8JA 2LIVA 1E6KA 3G85A 2WMYA 4WZZA 4KPYA 1NXPA 3IPCA 2HPHA 2QVCA 2FTKE 2QW1A 3HV2A 4Z4HA 5FBHA 3EULA 3KS9A 4LRQA 2FKAA 1C4WA 4WXEA 3E61A 1L5ZA 1YTUA 2WB4A 2LUOA 1D4ZA 3QLVA 5HM6A 2E4WA 4MQEA 1USKA 5FWXB 2L18A 1M2EA 4ZMRA 3I5AA 5BR1A 1APBA 1JX6A 1Z17A 3CTPA 4KRFA 4TLMB 4PE5B 4NQRA 2ID7A 3ROTA 3BRSA 1P8AA 1NY5A 3B2NA 3KCNA 4HNRA 1D2AA 3TO5A 3BILA 1DC8A 3A10A 2MSLA 4JB0A 1RPJA 4LDAA 4O1IA 2IPLA 4WT7A 5TPZD 4RU1A 3RQIA 3URMA 4YWHA 3MM4A 3HEBA 2P9HA 5T3YA 1VPWA 1QQAA 5KQMA 4OLBA 4W5NA 3OLVA 1NXSA 4S05A 1CHNA 1QO0A 3NBMA 5IUKC 4RKQA 3HXMA 3CS3A 2VUHB 4RV5A 2JCGA 3MMNA 4MRMA 3LTEA 5IX8A 5EWJB 5KWSA 4Z9BA 1ZH4A 5DLEA 3H6GA 1BDHA 2LBPA 1KRWA 3JPYA 1NXXA 3QK7A 2W42A 2E4VA 4D6YA 2NUBA 5DKFA 3TD9A 3H5IA 2QV0A 1A2OA 5KQPA 1RNLA 1D5WA 3OQOA 1BDIA 1U0SY 4ETMA 1H9CA 5EWLA 3H5VA 4KQCA 3NNSA 1EAYA 4XASA 4XAQA 2PE5A 3C3MA 5KI6A 2MYNA 2R25B 3H5TA 1VRVA 5CNMA 5B3JC 2FN8A 2ID9A 1Z26A 3CKMA 4YCSA 1RZRA 4JB2A 3SNKA 4NV3A 5TQ2A 2E4ZA 4S04A 4IF4A 3EQ2A 1ABEA 1ZGGA 2MYUA 3JTEA 1BAPA 3C3WA 3SY8A 4F11A 4YRZA 3SQNA 3HVRA 1FQWA 1P6UA 2H3HA 3KKEA 3GYBA 1BA2A 2QVGA 3D02A 4KVFA 2LP4Y 4QPJC 3Q7TA 3CZCA 4RDCA 1GUBA 3ROFA 2GI4A 3BRQA 1BDJA 4Y9TA 3C97A 1JHZA 1DP4A 1Z25A 5KQGA 2PUCA 1ISSA 5EWMA 1R8JA 3A3KA 4G0PA 4MAAA 4MR8B 1ZITA 3HCWA 1NXOA 3HDVA 4GNRA 5TPZA 4EYQA 2L19A 3N75A 3KHTA 3Q9SA 4N41A 3W9SA 4EYOA 1W9HA 3F73A 3N53A 4N76A 2FLKA 3NNDA 4RXMA 3JPWA 1YIOA 4IRXA 1DBQA 1ZAYA 1QMPA 4LE2A 1JLKA 2A9OA 3MIZA 5TQ0B 2FEKA 5PNTA 4EVQA 1K68A 4NCAA 3GRCA 2ZWMA 3LUFA 3IPAA 4QYMA 1PHRA 4W5QA 3F6CA 5KC9A 3GL9A 4YR7A 2CHEA 1U8TA 2MSWA 4DADA 3GBVA 4Z4FA 4KQ9A 1MB0A 3EGCA 3OO0A 3CG4A 4L85A 2DRIA 1FFSA 1F4VA 2XDYA 3DGFC 1URPA 4G0OA 3GT7A 1DRKA 4E7PA 4MRMB 4Z4GA 2MYTA 1SXIA 3ILHA 3CLKA 4IILA 5HSGA 3LUCA 2AYXA 3LMKA 3MF4A 2A9PA 1JYEA 3HZHA 4F3TA 2QU7A 5BQ3A 1KGSA 1M5TA 1P2FA 1Z12A 3FDFA 3RVOA 2M98A 4LDZA 3BREA 1LBHA 1VLZA 5ED4A 4JASB 4RSMA 3O2JA 4NCBA 1GCAA 2GWRA 1PNRA 2E4UA 3C6QA 1XWWA 1Z15A 1VKRA 2QZJA 3EAFA 3HUUA 4FE4A 3KYIB 1Z16A 3T8YA 4RK5A 5ABPA 1QP7A 1KRXA 4RY0A 3C3KA 4W5RA 3EJWA 4H3KB 4JA2A 3P9YA 3MQ4A 5FBKA 3LKBA 3OLZA 2FQWA 3K4HA 3LUHA 4H3HB 3RVMA 5BRJA 1PEYA 1JL3A 1CEYA 4RK1A 5CNKA 2PUEA 2IDMA 1DG9A 2N9UA 5D2CA 4YGXB 3RVNA 5DCLA 1MAVA 2FLWA 4P98A 3UKJA 1U2PA 9ABPA 1I3CA 4KFCA 3DGEC 3QEMA 2BGGA 2GBPA 1TJYA 2FEPA 1A0OA 4ML3A 2NT3A 3G1WA 1DC7A 2IPMA 3NHMA 4OTZA 3HS3A 4O1HA 2HQOA 3FFXA 7ABPA 1ISRA 3TX6A 4Z4CA 1GLGA 4MS3B 4F12A 3SG0A 1YK1A 3CNBA 4LZLA 3RVQA 2WWVD 4W5OA 4EYGA 3OMXA 4PZ0A 2A9RA 1L5YA 2HQBA 4ZYLA 3OMWA 4G0QA 2PMCA 3D8UA 4N0QA 2V0NA 1TVMA 4PYRA 1EFAA 3O1JC 1GCGA 1JH9A 2QR3A 3HSYA 4EYKA 4MS4B 2PUFA 3FGZA 3LFTA 3LUGA 4YP9A 1SXGA 5FWYB 4Z0NA 2IOYA 4OATA 5GOTA 4L4UA 4YO7A 2PL9A 2HQRA 3CZ5A 5EWMB 5BRAA 2F8TA 1ABFA 2JVKA 1FFWA 3O75A 5JNTA 4Q6BA 1AB6A 3Q41A 1WETA 1DZ3A 4MYRA 4Z4IA 3FFWA 4KREA 4W5TA 4MR7A 1MB3A 3A0UA 3I45A 4RK4A 1YK0A 1QPZA 3OM1A 4XXHA 3IP7A 3KSMA 2JVIA 1E2BA 2A9QA 1DRJA 4MS1B 5IUJC 1NTRA 3HK2A 1DBPA 3M9XA 4B09A 1LBIA 1XHFA 3O2SB 3KG2A 4DQDA 5JNVA 4DN6A 4WXMA 4WWHA 2WJAA 1Y1LA 4KMRA 3H6HA 4XFKA 4F06A 3IP9A 3O1HB 3O74A 4HNQA 3RVSA 2FVYA 4ZMSA 1BVHA 1M2FA 1YS6A 4WUTA 1RXEA 3JY6A 2RDMA 1TLFA 4G0ZA 3UUGA 5JNRA 5IBQA 2FEWB 1SXHA 1E6MA 3I42A 5JNUA 4Z99A 5JNSA 2IPNA 4MQEB 4MLCA 4RKRA 3QLUC 5FWXA 2H0AA 3QEMB 4MPTA 4HNSA 2I6FA 5C5EA 5EWLB 1Z18A 1JYFA 1PEAA 3H1FA 1JF8A 3QELB 3QLTA 2GKGA 2IKSA 3H1GA 5CNJA 3RVJA 3DLBA 3GA5A 4YLEA 5I4CA 3BBLA 4JOQA 3S99A 1D1QA 5T7BA 1C0EA 3FMVA 4EUKA 3M6MD 5IUNC 1ZH2A 1QNLA 4N03A 1QP0A 1OXBB 3SAJA 1RZRD 4KK4A 3CHYA 3JS5A 4N47A 1QP4A 1YMVA 2FMFA 1ZN2A 2JK1A 3GWGA 1T34A 1U2QA 4IGAA 3N6VA 2KYRA 3OLWA 3H5WA 5EWJA 3EQZA 2L17A 1JDNA 3QX8A 1D1PA 2VUIB 3RVPA 1QKKA 3KLOA 3KYJB 2CWDA 4JP1A 4MLDA 1K66A 5TQJA 2HJ9A 4UHKA 4ZJPA 4LX8A 1FSPA 3RVKA 2MYPA 5JS2A 6ABPA 1ZY2A 4MR8A 2O20A 3QELA 3L6UA 3FFTA 5JNWA 3L49A 2M1ZA 4PICA 3ILYA 4EY3A 3MA0A 1E6LA 1JWLA 1JDPA 3RVRA 3T38A 5IEJA 3O1IC 3HDGA 2FMIA 3VNBA 3RVLA 4RY8A 2X7XA 1ZHHA 1ZESA 4G0YA 2WY2D 4MS4A 1HEYA 4N0PA 4Q6WA 5IULC 3OO1A 4QICA 2PKXA 3N0XA 4G0MA 5FWYA 1EHCA 3EDCA 2YHAA 3QEKA 4JAVC 2L2QA 3F6PA 2Q5CA 5TQ0A 5HQJA 4OLAA 2PUAA 3HO1A 3E3MA 3LUDA 4FE7A 1Z13A 4IMJB 5TQ2B 2GX6A 2MSKA 3OLYA 5IEBA 3UK0A 3QLVC 3HM9A 1JFTA 1U04A 2WJWA 2OQRA 4MS3A 3H5OA 3M9WA 3A0RB 4IMIB 4TLLB 4MGEA 3CRNA 2B4AA 4G86A 1RXIA 4LE1A 2PUDA 3H1EA 3LOPA 4HYEA 3DLHA 1DJMA 3KJXA 3Q7RA 1JBEA 4G97A 5TPWA 2JB9A 3OM0A 2E4YA 3SM9A 2F8SA 4MR9A 3O21A 2YHBA 3Q15C 4RK7A 2NZVG 4UHJA 1JFSA 5CHYA 1IIBA 2ZAYA 2QXYA 3TB6A 2VYCA 4ETNA 2B1JA 1ZVVA 4KZKA 2FQXA 4ETIA 1NXTA 3QX9A 1DCFA 4Q7EA 1EWTA 1TM2A 1LJLA 2HSGA 1SD5A 4EGSA 1JFVA 1Z2EA 1P6QA 4GPAA 4P1ZA 2FMKA 2IYNA 1M5UA 4LE0A 2TMYA 1QO0D 3GBPA
chains in the Genus database with same CATH superfamily
1B42A 4AIIA 1N5MA 1F0PA 2QY9A 3EXHA 2PLFA 4K40A 1GA6A 2G06A 4MS1A 1B6SA 4PPYA 4Q9AA 3R75A 3VNRA 5K0CA 2JLYA 1V47A 3FOZA 1Y5LA 2W70A 1OLXA 1IN5A 1Y3DE 2QTVB 1HSZA 3VR4H 2D0DA 4L4YA 4A2QA 4CM4B 1OA0A 2QPLA 2Z4RA 4YRCA 5HF6A 4DIEA 2QMQA 5BWMA 4BUCA 3M2TA 4ERXA 2J59A 3LVQE 1NDQA 2IYFA 3Q8MA 3UJ8A 4JVNA 2OCBA 2VI5A 3GCDA 2R48A 6Q21A 1NX9A 1WMAA 4BMSA 3GEHA 2NUTB 3K2IA 4G0NA 1JI0A 2QMZA 1PR0A 1T8WA 2WKRA 3K35A 3UHFA 3FB4A 4DLAA 2VH2A 5K8IA 1D07A 4YCLA 1UQTA 2GGSA 1I9CA 3L7NA 4B3XA 3OJWA 4CL8A 5EJ4A 1WD5A 1UJBA 4BLSA 5J2UA 1GVHA 1LJUA 2CZGA 2EFEB 1L7NA 2O1SA 2QD4A 2XTJA 3B7PA 3M0EA 3QHQA 1ZKMA 1P2SA 1P7CA 4Q4JB 4D8WA 4LDPA 1T0UA 4UPDA 5JIBA 1DE0A 3VZBA 4CF3A 5K3EA 3BEDA 4LVCA 2G40A 1TMKA 5CDGA 1H8ED 4MQ5A 4D4GA 1AGNA 2WTMA 3FN4A 4YRKA 3QFHA 4JVSB 2I7VA 1PD1A 4NFYA 2BF7A 4KYVA 2B9VA 3I1FA 4DFDA 1XVIA 3FAZA 5GGYA 3SXPA 3JD2A 4CLHA 2B9EA 2D1TA 3OOJA 3N3BC 2QTNA 1RJDA 3KDSE 3L6DA 4H0FA 4Q00A 3CRMA 4KGVA 4Z0TA 5DBHX 1I3LA 3G17A 1I01A 2C31A 3DZKA 1U9ZA 2Y66A 3UTDA 4OFZA 1W9MA 3DWIA 4Y2SA 4IR7A 4JJIA 1S7CA 3SJAA 2PH7A 3GEIA 4UU8A 3GA7A 1NW3A 4B8WA 1IWBB 3I2YX 3S40A 4LOAA 5BUZA 3JALA 2HQSA 3KVYA 3P9QA 4IDDA 2RI0A 3KEOA 1YSCA 2XE7A 3C5WP 2O8CA 3R5TA 2VOEA 1KH2A 3AJ8A 4AQYB 3C45A 1X8JA 3RIXA 3BMOB 4G0UA 2H2WA 5K8VA 2A4MA 3DZJA 4I6EA 1AF4A 1ZN7A 2Z2YA 5LCXA 4TUYB 3AEKB 5AI6A 4ZU3A 5FYDA 5ICEA 1M10A 2LD4A 4MYDA 2CE2X 1W6RA 4NVRA 5LOVF 4FHDA 2EKDA 1U99A 1YT5A 1DNPA 1I80A 3O6VA 3T95A 3PUVA 4C05A 1NMXA 1AG9A 1C3XA 3NYQA 3VA7A 4L3OA 2W48A 1K86A 1KP2A 1XCPA 3C4QA 4ZI7A 3FMFA 4KZPA 4OH7A 2HO5A 1UMCA 3C4JA 3DVLA 1FUIA 1P7YA 3EWSA 3PJGA 1YTUA 3EAGA 3BK2A 1QE5A 1N2GA 3OECA 4JS0A 4YJ3A 5FWXB 3MD9A 4RYLA 4ZOCA 3V9PA 2Q9AA 4NYIR 1K7YA 3AYXB 4JIMA 4EQZA 3RLIA 4EB6B 1XTIA 3FDJA 5DHAA 4PE5B 4KYTA 1CETA 1X13A 2AKAB 1L7BA 4EJ2A 4L0CA 4MWZA 3EVNA 4J2HA 4MPJA 2ZJ8A 5IXYA 1O2DA 5GAJA 5TPZD 2CDCA 1Z8HA 4GYWA 2Z1DA 4UOZA 2D74A 1BEUB 3BXHA 1UJCA 3CVXA 3AOEC 4Z8XA 4RQUA 1P4RA 2CBXA 4BO6A 1TEVA 4M0CA 3AZOA 3DAHA 3N59A 3OLVA 4FYHA 3ID6C 1E2HA 3EPLA 1IHYA 2VTEA 4DUPA 1OC2A 4DMRA 2B69A 4NCKA 2BEUA 4MUMA 4Q12A 3T35A 1NU8A 4O4JA 2JIDA 2A7QA 4RELA 1AN9A 1SCAA 1KRWA 3OOEA 2YVKA 4FLFA 3LKDA 4FSXA 3KVRA 1KE1A 4HJRA 3JQBA 4Q9JA 4XKJA 1LUAA 3VR2A 4DGSA 2WKQA 4UAJA 4WX2B 5DGXA 2VPPA 3AR2A 4XQEA 1B8VA 3VPGA 1UPUA 1ZRMA 2BCGY 1NNSA 3GNLA 1V1RB 4LCBA 4Q9IA 3JQEA 5KTPA 1MJHA 2BEUB 2PGAA 2H85A 3TI7A 1Q0HA 3UO8B 5A2GA 3WLFA 3TOXA 3H5TA 1A5TA 2ZI7A 4RCYA 1V39A 4OFXA 3W5VA 5KCZA 3K20A 1DWPA 2Q0QA 5B3KA 1AX9A 3B5IA 5JVDB 3WLOA 3ICEA 3EQ6A 2NSYA 3PXBA 3Q9UA 4WKGA 3GIWA 5K3FB 2P2CA 2KM1A 1IHXA 3BE6A 2P3LA 1PFUA 3GCZA 3WK6A 2AMVA 4F4UA 2P68A 1LD3A 1R8SA 3AFIA 3DZIA 4QBTA 5AM5A 4NAHA 3DQZA 3U1TA 2I91A 3TR6A 1K98A 3A4NA 4ZOBA 4E6PA 1XNHA 1Y7LA 2AXEA 1P1JA 2HIGA 5A0TA 2LP4Y 3IMEA 3IE2A 1IJFA 5AK5A 4CV1A 2G04A 1BDJA 3J7TA 2FN7A 2VF7A 1CR2A 3QVVA 4B3HA 1P74A 3NTVA 4W8GA 4BV8A 3JAWB 2JIBA 4MR8B 4X63A 5A4AA 3ITEA 2C4TA 4MYCA 2VATA 3ZLBA 4HUQB 3RAGA 5TMPA 1QTQA 1D2GA 4QTZA 2I3DA 2P9EA 5FI1B 5EE1A 3WLNA 1WUHS 3ZYZA 4HQOA 1BQ3A 3NFRA 1Z6QA 2IEYA 4ABTA 2F1OA 1M6WA 4NYIQ 1Z3CA 4CF5A 5JJ5A 4ZTZB 1V8BA 5IW8A 1R4AA 4EVQA 4NCAA 2ZSKA 4YPFA 4MVJP 3TQRA 4OHCA 4NYJR 3IPAA 4QYMA 4UD6A 3HZZA 1MMFB 3MAGA 1NU6A 3ABRB 4D9CA 3LC7O 5BUCA 1Q74A 3OY7A 4D8YA 5CG2A 2W93A 1YCDA 4RSGA 4DADA 2VHCA 1GGKA 4W8OA 2F43B 1Z0ZA 2GCOB 2YIMA 3PUYA 4FOPA 4REQA 4G63A 4F4IA 1PDOA 3HYLA 1RADA 3DGFC 3F3MA 2DQZA 4O6VA 3HR4A 2QQFA 4L74A 4D45A 4E7PA 1OY1A 2DBZA 3CVOA 3VC7A 4QOEA 4GKKB 2E85A 4RPJA 4JKOA 1Z4MA 2O0JA 3QWHA 5I9TA 1VSQA 1FDIA 3BWEA 3D6FA 5F7OA 3CT4A 2BR3A 3JAKB 4QTYA 4B87A 4IFEA 1JWAB 3D8BA 4YRIA 3DC2A 5HS4A 3HYSA 3PA8A 4FSDA 5IKMA 1OXXK 2QU8A 3RVOA 4BMYA 4DDMA 2H8KA 1FNSA 4NPAA 2Z58A 2QBYB 1YRLA 4G2TA 3CVYA 4UBLA 2B2XA 1KFJB 2J3MA 2JAWA 4RS4A 4NMHA 4HAXA 1OREA 2JEOA 4RA9B 4KQJA 4MPRA 1SFRA 4OI1A 421PA 5HM8A 3HXQA 4KQGA 2E7ZA 1YCGA 2YZNA 3ZR4B 4ISBA 5EGSA 1DWOA 1W6UA 3MMPA 1QDLB 4BX0A 1PGOA 1SCQA 2GQ0A 2QY6A 1RYEA 4HDOB 4ZVOA 1YONA 4N0DA 3TB6A 4BZQA 5K8LA 4IDNA 4C76A 1L3BA 4B6OA 2ZYSA 3J81k 4FS8A 2B36A 2CF6A 2YV3A 4CM6A 1IDN1 1RWMA 5BT9A 1K97A 1QGUA 4LVNA 4TVBA 3REQB 3CVWA 4FYKA 1AA6A 1GL3A 1NVTA 3EXFA 4P98A 4HDCA 3UAYA 4L5IA 1JQLB 3JU3A 3LC0A 3ZWKA 2WAMA 1QS0B 4OREX 3PFGA 4Q3OA 3RS2A 4BKPA 1VLQA 2O2CA 1TJYA 4BAZA 1SOAA 2Y2VA 3C5HA 3OOSA 2LXNA 3IT1A 4N0MA 3RTAA 2JGLA 4OHPA 1FW8A 2ADMA 4RHCA 4V1CB 1LDYA 1JT2A 1RZ3A 2QMEA 1K4YA 3KZVA 2NNWB 4M38A 4DZRA 3ETNA 4A91A 1N7IA 1JFFA 4RJTA 4EPRA 3B8HA 1R8XA 3KTAB 5JO0A 2IYYA 3OAAA 1OFUX 1BJTA 3IEPA 1NDUA 5C4IA 2IYSA 2I4MA 2E55A 3ETGA 2HQBA 3RC1A 1PVOA 3Q9NA 4MVJM 5EE3A 5GVSA 2FX2A 1RJWA 1K5HA 4C5AA 3DC7A 1GPAA 2FY8A 4FEYA 5FX2A 5CX4A 3CUTA 1Z68A 4YI5A 3TEJA 1E5TA 1MO3A 4FW9A 1C7RA 1WHSA 3CH4B 3JYLA 4JJKA 5HILA 3IQHX 3K6SB 1CJTC 1DDGA 1T3LA 2D1FA 3R9XA 3HA7A 3I64A 3RHTA 2P2GA 2FFRA 1UK6A 4OATA 1MO2A 3PLRA 2O8VA 2I2DA 2WD7A 5JBQA 4MIOA 3ML1A 3R6WA 2O1WA 4PYQA 1RCUA 5AI0A 1JR2A 1YZYA 3UG7A 3VR5A 1XALA 3C14C 4E22A 3K70D 3Q1LA 1AKEA 1TC1A 2C54A 1Q95A 3LC2O 2C4WA 3QVLA 4KO2S 3I45A 2P8SA 2OD2A 1NBWB 1Z35A 1TOAA 4IPTA 1MNAA 4OUDA 4BO9A 3ER9A 4E13A 2PO7A 4KQHA 3QKSA 4E3WA 1ZM3A 3COJA 3KVOA 2LDBA 5JJBA 2GZ2A 1UZLA 2G63A 1EYZA 1TI7A 2GRAA 2RCNA 1Z56C 2VDWA 2C0CA 4BJ5A 4S2UA 2Q5OA 4WXMA 3PXGA 3SEQA 4YP1A 4BMOB 2R8RA 2HPVA 3AMVA 3H9QA 4WBNB 3ZKAA 3EGDA 1IRIA 1FRFS 4Y1GA 1PX0A 3OZTA 5I9MA 1XI2A 2I1LA 1BVHA 3BB4A 4PVDA 2Y77A 2H65A 3EVGA 4AICA 1RXEA 4OGFA 3D0QA 3DAGA 3VYRB 4R8KA 1ZHFA 3O83A 4KNVA 5T67A 5JNRA 2SKCA 3QY0A 2FPIB 4HVTA 1SXHA 4DYHA 5IYZA 2GBGA 1WX1A 1L5FA 2RFLA 1KZYC 2GVNA 1N3YA 1NUAA 2ZTLA 4QOJA 4Q01A 1HDIA 4G36A 5BWCA 3PDIB 4YIKA 3KUUA 2B4KA 4Z3DA 4ZCLA 1V8FA 4EHNA 4TWJA 3U4CA 2C2YA 1S8AA 3HJGA 4MUFA 3ZCPA 5FI5A 3RT1A 2JCVA 3FPGA 3EXHC 1SVMA 4DQKA 1QHYA 2V03A 1EM8A 1R5NA 1SPXA 1ZWLA 4KFSA 2ZZNA 2WHPA 2ABWA 3RSOA 2O52A 4B6JA 3C24A 5THXA 3CMMA 4N47A 4EY4A 3FWPA 1K8ZB 1TAHA 2JK1A 3P96A 3KPVA 3IVCA 1ODTC 1ZRSA 5LOVB 2JW5A 2COKA 2L17A 1FJXA 1D1PA 3GFVA 4LWPA 2XCLA 1GWNA 3TR0A 4DJAA 3EWNA 1JDBC 3QLJA 4NFLA 1OR8A 3A7DA 4UHKA 5FPYA 1JSCA 3BCHA 4BLWA 5JQGB 2JLBA 2QX8A 4N5IX 1M75A 4MR8A 2B4QA 5IH3A 1NV9A 4GYYA 3TW8A 4BZWA 2SKEA 1OFIA 3GHYA 3ZCRA 3LDUA 3L49A 3LG2A 3RU9A 2R85A 2ZVPX 4FLMA 5H80A 2UXBB 2P11A 3RS5A 3QU9A 3UTCA 4JI4B 1DEAA 2QPAA 1FSGA 3DAYA 4TMKA 1CG6A 2BYTA 4FZ3A 2VJOA 3ADDA 4FC7A 4YJKA 5JQGA 4BQQA 2A84A 1BXGA 1UEJA 4CIBA 3O26A 3LBYA 5E1OA 1ZHHA 4MS4A 4B74A 5KTRA 1JSRA 4XRRA 5DRTA 3ZCXA 1QVVA 4ER5A 1EHCA 3K2QA 4MUJA 3CT6A 4KR6A 3RT7A 2PH5A 1CJVC 3OZBA 4R2JA 4HN4B 5TS2A 4FE7A 5FOXA 4IRUB 5FBZA 4C2TA 7MHTA 5GJWC 3ZGNA 1KL7A 1ES9A 1IBLB 2R1UA 1JLMA 3AJRA 4FR2A 4TKZA 2AI2A 4K6FA 5KUTA 2IZ7A 4DZZA 1WNTA 4JGBA 1HYGA 1E64A 4ENUA 3QV1A 1I7QB 3QOWA 5FR2A 2JGRA 5DHPA 3DEFA 3EVFA 3F6EX 4J7XA 3LOPA 4JELA 4AZ3B 4EH1A 3ZE9A 1RZUA 3VTZA 1UBHS 5KNBD 1BE1A 4IIJA 3S7TA 1UPAA 3PEUA 3RT9A 3HDHA 4WESA 5LKAA 1AHNA 1YBFA 1YQQA 3NTOA 4TLDA 2PGJA 4UHJA 2R60A 2G7ZA 2C92A 2UUOA 5I3CA 3GP8A 1IULA 2VJNA 2VHTA 1II9A 3BH0A 5F5XA 3A1DA 3D6UA 4ZAXA 3B52X 1TM2A 2JZOA 4C04A 1RHUA 1NVVR 2OBBA 2GR9A 2JFXA 4CM9D 5JAZA 1ATIA 4KJXA 4LE0A 3I6BA 2BM8A 1PT7A 2TMYA 1I10A 1ADCA 3ESZA 3LVBA 1NY6A 2QL9A 5HHTA 5CM8B 3LUAA 3G8AA 2Z98A 2FMXA 3HWWA 4FMCB 2YY6A 4MK4A 5DTQA 2JBAA 3B13B 1GQFA 1EBUA 1MB4A 5HJEA 4X8LA 4LHZA 4YP5A 1XZDA 1ZN9A 4R2KA 3BMCA 3WNZA 1M2JA 5K20A 4FMDF 5HGJA 5FPHA 1OZHA 3JRXA 3H9CA 1IOLA 4NR0A 3WIOA 4X8OA 4DMCA 5IM4A 2BFCB 2PXCA 2HRQA 1XHEA 5BOVA 1T8UA 2OV6A 1G9SA 4CMEC 5JMOA 3N6RA 3O95A 2Z6UA 4KR0A 4J0DA 3E8SA 3I6IA 1XKLA 3W78A 3VU9A 4KR3A 2W4MA 2FXIA 2QN6A 2X9GA 5T6BA 1JDZA 3GFGA 4I50A 5BMVB 5TIIA 3DBHB 3LZCA 3SSNA 2G4LA 2NZUG 1KJZA 2BY4A 2MTBA 2Q8PA 4EEKA 4FIZA 3H19A 2ZRLA 5ALLA 5AW7A 1E1DA 5EXEA 2AR0A 2RKBA 4JUDX 1J07A 4HKTA 5HZHA 3TAHA 2JGNA 4DTIA 1P2BA 1XNJA 3AG5A 4UCFA 4WBNA 4CF7A 3O2QB 5J40A 5BQFA 3KJIA 1ILEA 2QGZA 1W5SA 1XVAA 3G2OA 2VJPA 2XMDA 4FGUA 4WGFA 2VSYA 1XNGA 2F00A 5JH7A 4PINA 3OPXA 1T29A 2WA2A 3BXOA 1JFLA 2FCRA 3PUIA 3UPDA 2O8FB 5JADA 1G0OA 2IF2A 1Y6ZA 3H5LA 4YXWD 3EZ9A 5A7GA 4F9FA 8ADHA 4U7WA 3BE5A 4Q3BA 1C1DB 1V2GA 3UQZA 4PV7A 5EIAA 1XJQA 4F71A 1KVUA 3DHNA 2PUGA 4C3VA 4ENQA 1QH1A 3EDRA 2DPLA 4S3MA 4QT0A 1C3OB 1WOYA 5IC5A 5NLLA 3HA3A 3PNVA 3WK5A 4TN5A 4LIPD 4BO0A 2QP4A 2JZCA 2J3JA 1E2LA 1KDPA 5JVDA 4EO4A 2C82A 1SAYA 3HGTA 2BFOA 4HDRA 1YS7A 1FFXA 4JLJA 2JFYA 4JC0A 4UTXA 1IL0A 3DZBA 4FYIA 4G9BA 3HFRA 4FMCF 4GGOA 3U62A 5CFZA 3SE0A 1JU9A 1VA4A 3R0JA 1K6MA 3HBNA 3PSHA 1HKHA 5F98A 4JLUA 2EX4A 1JZTA 3IUSA 2PV7A 1DFIA 3RNLA 3TMYA 4EB6A 2YQZA 8ATCA 2J3LA 4NZPA 2QNRA 3D54D 2LIVA 2FUG1 3I9OA 2WMYA 5FBQB 3NCTA 1N1EA 1AMUA 2HT1A 1T9GR 2ZPUA 3HWX1 2V6IA 2NX2A 2IYPA 1B6GA 2R68A 4K81B 4UJ5A 4UUAA 4YAOA 5DNWA 3WK7A 3WLTA 1ESNA 3E61A 1OWLA 3VTAA 1EIWA 4LC9A 4AECA 5ALJA 5KSPA 1KAMA 1NJ8A 2ZRNA 1ZBQA 4P7BA 2ZUCA 3JZMA 5FLKA 3GQBB 4AG3A 1M2WA 5FL7A 4C5BA 5I9LA 2PUVA 4DARA 1RYZA 2EGHA 3CZ9A 4LRWA 4KR9A 4NQRA 3C3YA 1QHHA 4XVHA 4C0SA 3L7LA 4QGSA 2IUFA 5C32A 2TMGA 4RVFA 1I1QB 1Z39A 3JZFA 1NE7A 2ODAA 1VHTA 2YJ6A 1SKYE 2GHRA 1A8HA 2VA9A 5EZSA 2QROA 2POCA 1FTGA 3DBLB 4MA0A 1DAPA 1R1DA 2DQYA 5FXMA 4B5LA 1DLJA 4L5BA 3CLRC 2P2DA 4MVJH 1UWVA 2BMAA 1E92A 1Q15A 1YU6A 2P9BA 1NXSA 3TMKA 4DLXA 4P58A 5L3VA 1L5VA 4Z3OA 5I51A 2DVMA 3RADC 1VB3A 3H8WA 2RGNA 3UAWA 1T2VA 3HDQA 2R8EA 5M2QA 4P7GA 5KWSA 1TKBA 3KZXA 4MW6A 4IH9A 2B5OA 2W42A 4L2IA 4QHSA 3VNQA 7REQB 3ZXXA 4FGKA 2OWDA 3PR2B 3LP5A 1XJWA 2EHJA 1EA5A 5JEDA 1Z4PX 1AZTA 1OI2A 5LJLA 4KXUA 2WIDA 1G3MA 4NMMA 4QREA 1WPQA 2WG1A 4GMXA 2AN3A 1ECPA 2QRPA 3HVJA 2IHVA 4A15A 3HY6A 2C00A 3ZDXB 1VRVA 2CMDA 3KR0A 2O8NA 3VH3A 1Q1BA 2NG1A 3BK7A 4MYSA 2XVYA 4X64B 3CKMA 1WQ3A 4EHHA 1I2MA 3CSDA 2GN1A 4MXDA 1H1LA 3ETEA 1F8GA 2YW9A 3L4KA 1CF4A 1NNI1 2AGVA 2IRWA 2ODWA 3INGA 3L4EA 1MJ5A 1QKIA 3O5AA 2F1JA 3COSA 4UKDA 1I30A 2Y4OA 4FFBA 3PHBE 5EJMA 4O2AA 4HYTA 4UMFA 3ZV3A 2GPNA 4J0FA 2QZSA 2H7YA 3OIWA 4V38A 1GKIA 2GO7A 5IXJA 3IAXA 3D6AA 3LPMA 4ENSA 5EQFA 1BXKA 3UMBA 5CP8A 4YONB 4I2NA 1CE8A 4KR7A 1FMTA 4KIGA 1W73A 1EB8A 1KDTA 4WFQA 1RKXA 4N5MA 5KQGA 2R4TA 2PUCA 1Y3IA 4BNWA 2ZVDA 3HHEA 4GLFA 2QTZA 4JJEA 1ZJYA 4IQ4A 1Y34E 4QAJA 2A8YA 2CF5A 2GA8A 3WGIA 3C39A 2Q7XA 4BWVA 2IIBA 2ZQYA 3HCNA 3KKKA 4LMPA 4MSUA 1R0LA 4N41A 2BMFA 2I1WA 4DUGA 3SYMA 2WUGA 5AIBA 4EI7A 4L78A 1GAXA 2M6LA 2OHHA 1ZNYA 4D02A 1QTNA 4PLZA 2XZDA 1M8JA 3JV7A 2GOYA 3OC6A 4CIXA 3TIGA 2AZMA 4IDBA 1LF0A 2J6BA 3H04A 3ESYA 2YRFA 3K0FA 4LHSA 3V4VB 4D0GA 1MRNA 5AM4A 1FMCA 1P0IA 2ZITA 2I4NA 4GZ6A 1CRQA 4B3MB 3G68A 1YQTA 2Q1TA 1YGPA 1P5ZB 3SOZA 2MSWA 1X7HA 3TLZA 1FP7A 4PF1A 1KKLA 1BJKA 4EUHA 2XCSB 1R4NA 4OQMA 2WHQA 4YRRA 1JR3A 1JG4A 4AI6A 1AM4D 2JL1A 4HUQA 1K0FA 3LYUA 4II2A 1I24A 2ZSIA 3IBYA 4PO3X 4W99A 4DW8A 3VR6A 1R50A 3WBJA 3EB9A 1RLJA 2V54A 1G8KA 1ZINA 1HRKA 4FCVA 5LU9A 3I9NA 2BHLA 2P6UA 2V7QD 3DEZA 2XB4A 4IFTA 4O2LA 2FF7A 4Q05A 1C3VA 3ZG6A 1CBUA 1YZFA 4E21A 3KLPX 1JYEA 4N9WA 1R4NB 4NCXA 2QU7A 1UKEA 4EW6A 1E18A 1FVFA 1HR0B 1P9NA 1ENYA 1MB9A 3UGJA 2D1YA 1NLUA 2ZRPA 4E2FA 4DA4A 3MWLA 3E3AA 4TSFD 2Q50A 3AF4A 3DDZX 3FYCA 4BLOA 1LV8A 3FYUA 1OAKA 2Q3MA 1MU0A 1GPMA 4NCBA 1BCRB 1JTFA 1TM4E 3LFHA 5LA6A 4CKWA 1C9JA 4PN3A 3T5GA 2J1LA 4M87A 4I14A 4IOKA 3OQIA 2G17A 3LE8A 3EJWA 4RTPA 3AEZA 4JU8A 2EW8A 3MINA 1U7TA 2OHIA 3EIFA 3JQFC 3OE5A 3WA6A 1JLLB 4JN6B 2B20A 1M5RA 5K8TA 4P7JA 5A05A 1Z5ZA 4GKAA 2VL7A 4DPMA 2YY7A 3OZFA 1JL3A 3ACDA 1SULA 3P94A 3N39C 4QECA 4RK1A 4WZBB 2AEFA 5AK3A 2IV7A 5JSUA 3OZRA 1TVKB 3MJVA 3VR4D 2I7DA 4JJFA 1TE2A 3T1OA 4OXRA 1XL1A 4C4RA 1RP7A 4JUBA 5CTJA 4JL5A 2VKQA 2DETA 3P2KA 4KFCA 4PCAA 3V1UA 3ZX5A 1II8B 5IH7A 3PC4A 3UXEA 5FTLA 2DQ4A 1O0CA 4KQEA 1N8SA 1VGQA 2YDXA 3NYIA 3PNBA 3I28A 4XA8A 3NIBA 2IPMA 1DAMA 3M6AA 4E12A 1G18A 3DFFA 4XSGA 2HQOA 5JAQA 5IBCA 4IJUA 5AM3A 1WZEA 3DLHA 2GWHA 4X6LA 1E0AA 5H4HA 2FE1A 3ZXSA 4E4TA 4GOKA 4C4YA 4KQMA 1NJGA 4PHFA 2ZPAA 3M9LA 4F92B 3VUFA 4HCJA 4ZXFA 3GLUA 5EVCA 2G9VA 2A9RA 2X9LA 1QTIA 4WAUA 3G9ZA 3T99A 5CCBA 2QX4A 4RNCA 1IFXA 2WQZA 3ORSA 4PG7A 4JZYA 4V0ME 5CAEB 4Z7OB 3HACA 1PW7A 1U90A 1A82A 2CFIA 4KO4S 1Y1PA 4PZAA 5JYCA 3QVJA 1QQ7A 1WR8A 3ASZA 1C50A 1T15A 2VPQA 1P7WA 4GT1A 3AM3A 3RGGA 1R0WA 1X19A 1RM0A 2IEDA 1G7TA 2ZSHA 2I4LA 1IN8A 3A9RA 1XRJA 3PV0A 4FC6A 4QU9A 3S2ZA 3DCNA 1QZZA 1I0ZA 2PS9A 1U2RA 3K5WA 4I5EA 5EWMB 1YVPA 3S1SA 4N3GA 3M5DA 1VFNA 4O4HF 1GFSA 2SICE 3I23A 3B60A 2CV1A 2C0PA 1DZ3A 3WYGA 1GVNB 4IDHA 1I2CA 4R7GA 1JR3E 4G23A 4W5TA 1E2EA 4B44A 2V8OA 4D5GA 2EU8A 1BKSB 2VSFA 1EB9A 1SH7A 4TUYA 1EBBA 4ZARA 1WB4A 4C7OA 1ONPA 2VJCA 2PMBA 3B7GA 4WL0A 1N0IA 1Q2XA 1V11A 2DJ5A 4EUFA 4JNCA 1C7EA 1GA4A 4D9GA 2J32A 2EGGA 3EGOA 2FZGA 3M9XA 2O7QA 1WUIS 4ZREA 1QCDA 5IN5A 3SICE 3V32A 4F4CA 5INTA 2IIQA 2JEYA 3KT3A 3KB1A 2JLXA 2WD7B 2Z3WA 2RHMA 4IVQA 1MC8A 4BBAA 1XZMA 4QAQA 4C7OB 4D3YA 4ER0A 2BSXA 4P4SA 2JFUA 2V7GA 1VM6A 2RDMA 4C3UA 2UAGA 3WJAA 5CXUA 2B83A 4JBXA 2GFIA 4V0QA 5ILGA 4LHYA 1L3CA 4P3KA 3TPCA 3LWNA 2FRDA 2PKQP 3NH6A 4BMVA 3FCOA 3UIEA 4FQ7A 4MQEB 3TXYA 4LPSA 3UFBA 1EHYA 5DASA 4FFPA 3UWOA 1UODA 4FYVA 2QJOA 4JR0A 3WLKX 4CKEB 5K9ZA 4C2AA 2P4EA 5KJFA 1Z0FA 3PK0A 3DLBA 4XSVA 3H1GA 2OXIA 4L5AA 1OCEA 1BE8A 1QFYA 4HG2A 3ROPA 1TYEB 4II3A 4V2UA 1H1TA 2JRCA 4FONA 4GVXA 4AP5A 5IWCA 5JFGA 1KMMA 3G0IA 1RWOA 1TIBA 3CBQA 1INLA 3E9MA 4HYYA 3DJFA 1UDAA 3KOYA 4R71A 1DEXA 5D3QA 3NANA 1U2QA 3M6XA 5KBYA 2KYRA 1EGMB 5LFAA 1Q50A 1GPKA 2HF9A 1JDNA 3T15A 2O48X 4Z4QA 4E09A 3DV0B 5B37A 4Z1OA 3GT0A 3CY6A 4X0EA 4ZJPA 2YVQA 1Q3TA 1OFTA 1RYDA 1O6BA 2XYQA 4KR2A 3JASA 2ZXUA 3KQLA 4EPVA 4D9HA 3IUYA 1A9RA 3GFSA 3UHJA 2UUAB 4TKVA 2QUJA 3QELA 3OTHA 3EC7A 3ETDA 1IQRA 5CJ2A 1YDHA 3E9NA 1XSEA 4I50B 1Q3KA 1Q91A 1EFRA 3AV3A 3A4IA 1ZD9A 3MA0A 5FUXA 1M2GA 1EGAA 2GRJA 3O90A 3F4LA 3SLKA 4OH1A 1GPUA 3Q0EA 4Z1MD 3K0FB 2WK1A 1V5GA 2I7TA 1ACLA 1MO4A 4EY7A 1JAHA 1L8OA 1WD7A 4PZLA 1GITA 1PQWA 2QX6A 4QG7A 2OZVA 3LLMA 2DTDA 4Z9FA 1G64A 1OZGA 3QKRB 3OEHD 1VBKA 5CGQB 4BBZA 3R9KA 4KAFA 1U02A 4YUAA 1TUBB 1DMSA 3QEKA 5M5BA 4FNMA 2J5XA 2ERYA 1A50B 2IODA 2YWEA 2XUFA 1TAQA 5TQ0A 4B6SA 1V71A 2PUAA 1U8ZA 4FD2A 3GCXA 1ARZA 1A3CA 1HURA 2FP4B 1GSAA 1J7JA 1XD8A 1XBTA 2BC9A 2D54A 3A14A 3F8WA 4KSBA 2Q3CA 3R3UA 1T5BA 5DNEA 3TIXB 4JV5B 2C2OA 1GU1A 1HYBA 2HXSA 4MVJE 2QHXA 1PNOA 1USWA 4D98A 4S0ZA 3IVGA 4XB2A 3LH5A 3AQ4A 3CRNA 2V7VA 4H7PA 2G9NA 4QGFA 3H1EA 5CK4A 3G5LA 3ZZ1A 1EMDA 2RHOA 3RTBA 4FVTA 4G97A 1KJYA 1CUFA 4WUVA 2BTQB 2Q3BA 3HI6A 4J7CA 4G07A 4URXR 3T7RA 2AF4C 3T5BA 1RWNA 1ODFA 3WO1A 1M2KA 4EVIA 1VKOA 2D13A 3DR5A 4HMQA 4KZKA 5EG5A 5EIBD 5H16A 5J2TA 3W1WA 1S2OA 2YZMA 4IW3B 3TLGB 4G9EA 2C61A 4H35A 4N1AA 4IDFA 1ESZA 5IJWA 1H5NA 5CM2Z 1TD9A 3L1UA 3OPYB 1Z4QA 3QVTA 5ARDA 3DMTC 4EW2A 1QZTA 2IZOA 3O31A 4GICA 3GD5A 3VYTB 4Q39A 3SFVA 4V0OA 1VZ2A 2ZB8A 4IF6A 1DC3A 1Q0PA 3HC7A 1OSNA 1XXHE 4MEJA 1T36A 3KE9A 1ZDMA 2PH3A 4WESB 5F7JA 3T1NA 4ER6A 3ZYCA 3TJRA 1IJEA 3OTIA 1EJ2A 3AY6A 2XUHA 4KXMA 3CU5A 1E1QA 4TTRA 1RPNA 2UZ0A 1JPUA 5K45A 3VAAA 3OQNA 1UUFA 1X1RA 3OX1A 5DWVA 1RRFA 4LJ7A 4NF2A 4PGHA 3T1QA 1GT91 4YVFA 3EEBA 3UY4A 3DWFA 5BORA 1YDMA 2AT1A 4OA8A 3USZA 2Z8YA 3R7AA 2YZ2A 4C2UA 1PL8A 4C20A 4M36A 3I62A 1VJGA 3HQ4O 1QOPB 3MWDB 2ZI4A 4XLTA 5C7OO 3THRA 5EWJB 4EAAA 3HI4A 1XLWA 5BNZA 1Q14A 1Q1GA 4ZC8A 2X8LA 1XZHA 2JBAB 4OF4A 1G7CA 4C4ZA 5M04A 4J0JA 4OSOA 4UBOA 3IQWA 3EDYA 4W5JA 2QN8A 4QYWA 2W37A 4BP3A 3PEVA 3GAFA 4HATA 3VRHA 4MVCA 2OWEA 4B8YA 4AN4A 1NLFA 3QOYA 1G1MA 1JNYA 1DOAA 1SXJB 4XJXA 2WD9A 3KQTA 3QI2A 4KAXA 5KSWB 1ENPA 2WVAA 1PBTA 4NQZA 3T7CA 2CMFA 5HUHA 4DIFA 2Q4EA 2CC2A 1B16A 2HGZA 4KU4A 4YJ3F 2IV3A 4AT1A 4RTQA 1HDYA 3QX7A 4BO2A 4QYIA 4RK6A 3ETHA 4CM1A 2FP3A 5T6MA 3UWDA 1G41A 2P75A 2PRZA 3KSUA 4RTOA 4KSCA 3W77A 1OC4A 4MROA 1W29A 1LPBB 3EY4A 4PFSA 1YUMA 4V2IA 1BGWA 1A9QA 2VS1A 1MAHA 1MW9X 5CBPB 4P32A 1WP4A 1THMA 5F76A 2IXDA 1JFFB 3Q10A 4M76B 4URZR 2CCGA 4RVUA 4B45A 4BZZA 3P20A 2R4QA 4UQLA 4ZWNA 1JFRA 1Z2DA 3U4IA 4JJGA 4EO7A 1PFQA 3T0IA 2COUA 4H4DA 1IOVA 1WVIA 3EG9B 1XEWX 3IP6A 4K1LA 3CG0A 3CXRA 3NAMA 1ISHA 2IYLD 5FFNA 5AVXA 3C5VA 1XMOB 1QZ3A 1F4LA 1U1GA 2BFDA 2C20A 1CE8B 1F51E 1IB0A 4AF8A 5BSWA 1NM5A 3ZV4A 5AHWA 2VZLA 4N4AA 1Q22A 2WFAA 2Z3VA 2WINI 4YPVA 1Y80A 1U2GA 1ZIOA 2FTKE 4LDRA 4JYAB 4J03A 4S1VA 4ODIA 1XTSA 3KS9A 4OHKA 3PXDA 4H1HA 1R4MA 4OQEA 3HEMA 4WXEA 1L5ZA 1WEKA 4NIMA 2W2OA 1SO8A 1GAWA 4CI9A 5B6IA 5KVSA 2JH3A 2PHZA 3LHIA 1ZMOA 3I5AA 4DR5B 4DQVA 2QXUA 1EVJA 1JX6A 2PKCA 4KWHA 1MUUA 5HWSA 5HJ7A 2QTCA 5CDYA 3V6LA 1UM9B 5FJIA 4C1NA 5IVIA 4E1AA 3OZVA 4P92A 3PQ6A 1X7ZA 4MJ7A 4RTNA 4MHSA 3EEQA 3T9FA 2IPLA 1CUVA 1TK9A 1TYBE 1DG1G 4RPLA 4KX5A 4KYIB 5JDCC 4I81A 4YWHA 2P91A 4RZUA 2WSIA 1H42A 4FEEA 3CWQA 2OP1A 4AG5A 4LYDA 5JECA 3BMXA 1CR4A 1MEJA 3IAHA 3WRVA 5JHGB 2QRQA 3RF7A 4F38A 1M1NA 2HJRA 1AMNA 3B6JA 5JD4A 2Y1XA 4IUYA 3DZGA 2XVMA 4ENPA 4WZAA 3SSAA 1GGEA 1UMBB 2D3WA 1MH1A 2JCGA 3K9BA 3Q4GA 3QWFA 5CFQA 1A77A 1OLSB 1ZOLA 2HWUA 4K9DA 4UULA 3V42A 1VCIA 2WJ3A 4P3XA 4CTJA 2R7MA 2ZJZA 3AF5A 5KWJA 5LZ9A 3R0ZA 4KWCA 4RD4A 4F45A 2QN9A 1WIWA 5AKHA 1VE6A 4B83A 2NTVA 5JROA 1XTJA 1QSGA 2ZAGA 2ZBRA 2OBFA 2DTEA 2IEZA 1A98A 4GUDA 3TKAA 3ZC3A 4E08A 1CHDA 4M98A 1IB6A 2PJRA 1V8PA 3IBTA 2RH8A 2KLBA 3P27A 1EK1A 2WUDA 3C3MA 1W96A 4FNOA 3T4UA 3SVLA 1M2OB 1RFLA 2WWYA 1KO8A 3LXMA 4PG8A 3TLMA 3ZGOA 5DFAA 2VA8A 2AWOA 1HH4A 4CL0A 4FFNA 1QXSA 4EFNA 4OXYA 3VR4A 1ZGAA 4YPOA 1KVSA 1QIKA 1TRKA 2V65A 5AW9A 3ANSA 3T34A 5JANA 3C2QA 4PSAA 4C0WA 1ISPA 3ZCQA 2WUFA 3SYNA 1BCSA 3RK1A 5EJ6A 4FM9A 1U80A 5A04A 2RAVA 2E49A 2XUQA 2ZLBA 4MZXA 4MNTA 2EJUA 3IEKA 3ZQJA 3VHRA 3T3HA 2OO5C 4D1YA 1KSJA 2JIQA 3ROFA 4OA5A 4ZOAA 4ZEOA 2PN1A 3RS8A 2ZETA 3E5RA 2VPYA 4YUZA 3T1TA 1SJ9A 4DA9A 3ZI7A 1CYDA 1MAAA 1R8JA 4CIYA 1KRHA 1V6SA 1U65A 4Q7QA 1RKQA 2VUUA 3HDVA 4O8ZA 4GNRA 2ZRKA 4QHYA 4NK4A 1JEAA 4QPCA 1SBZA 3K8ZA 1T1IA 2V6BA 3IVAA 4WA7A 4AM8A 3AFHA 5D00A 4Y7CA 4RUKA 3W2HA 3ZNOA 1E9AA 4QFDA 4DAEA 4K0KB 3NTQA 1ZBDA 2AZDA 5CR9A 1SNYA 4N6GA 2X22A 2HGSA 3CKKA 2GYWA 2YHUA 2C4HA 3A32A 5DV9A 2GVDC 2Q7DA 4CMEA 4FYXA 3RUHA 4BB5A 4I9FA 3OFNA 3P45A 4MVJI 2ZWMA 3WDLA 3DS8A 2V6MA 5JYDA 2HV9A 1LS1A 3GL9A 1JEJA 1PJ2A 1Y3BE 3COPA 3I6MA 3AUKA 2CHEA 4LYYA 3W7BA 4MCAA 3WB1A 2YYAA 4R2LA 3OETA 5CURA 3GP5A 5BSHA 4IIJF 4I55B 4Y7DA 2CYAA 1DBSA 1GTJ1 3DLAA 3OO0A 3FTNA 3R1IA 5C8ZA 4KXWA 1FFSA 1G5PA 4UE2A 4BKQA 3D4IA 1AT1A 1OFUA 3OOYA 4HQFA 4LSWA 2B4RO 5EUMA 5KNCD 1NYQA 1BU8A 2NPIA 2RHDA 1Z4LA 5F2KA 3BORA 2RHGB 3N5KA 821PA 4HLCA 1HQKA 4NJOA 3H17A 2O14A 1YTLA 2CYBA 1O6GA 1TUIA 3L4SO 2CN1A 4PLWA 4RAOA 4BASA 4QRDA 4JI7B 1YZTA 2XOXA 4BQRA 1JJFA 5BYKA 2WQ6A 2CMGA 3M7IA 2QJRA 4XQCA 5L6MB 3UF0A 2R97A 3ABQB 4C88A 4YLGA 4AJEA 4PQFA 1XT6A 3IO5A 3WHLA 2DUJA 1R9MA 3FCYA 2DWCA 5DGHA 1IM5A 1TW3A 5BWLA 1CRWG 5GJBA 3OJ0A 1DJPA 2EYQA 3VSAA 3CZPA 3KSZO 1P1BA 1RI2A 1ND5A 4X61A 4MRVA 3C6QA 4JLBA 2C8JA 4UJ3A 3RYFA 1JHDA 3RFTA 4DAOA 5LN1A 2VHUA 1AC5A 2VJBA 1GKYA 3W7AA 3EMDA 4L02A 5JC8A 1DKOA 1QK4A 5DOVA 4G1BA 1NASA 4CLDA 3EEOA 1F3OA 1HLPA 2I2CA 3LP6A 3QF7A 4NWIA 4OYLA 4XX0B 3HB7A 4IEFB 3VQTA 4JYCA 5IJZA 1E79D 1RQLA 2G70A 4DDWA 4GM4A 1ZSVA 1NQOA 4NHOA 4OLJA 3QH4A 2QJFA 4GR4A 3H2YA 1YZHA 3C48A 3D3WB 2B7LA 4GS5A 5BWOA 4AKGA 2ZUFA 4V0MA 2RK4A 4KXYA 1CUZA 1RMTA 4CW7A 5HZKA 1V16A 4MKFA 5KWVA 1BCRA 2W43A 1WG8A 3ZHQA 5ENVA 2FEPA 1A0OA 4NU0A 4E30A 3ERCA 2CXQA 4HMPA 9GPBA 3MWYW 5ISMA 3RYHB 4GPTA 1T9ZA 4Z0HO 1DC7A 1QBGA 2P4SA 2CFOA 1GFZA 2Y6VA 1W5EA 1TEXA 3OP4A 4LZAA 3TX2A 1GCIA 4JY7A 3PIRA 1MQSA 1JQJC 3HBJA 3IA7A 1Y1TA 3N8GA 4MWTA 1ISRA 2GYVA 1PSDA 5ERXA 1SHLA 3SG0A 1V26A 3ZOKA 1UPBA 5ELLA 4IUCS 2IXGA 1U8UA 1C9YA 3F4BA 4X6UA 3TH5A 3NHYA 5BR8B 1V1RA 4PNPA 1FXSA 5H81A 1QRRA 4M9QA 3TOZA 4CVNA 4HRXA 4NULA 1JE1A 2MSDB 4XCXA 1UMKA 3LYAA 1CPYA 2CVZA 2INGX 3DT8A 3DTVA 4WKPA 3ZWBA 1HYHA 4HVLA 5ALVA 5BN3B 1A9YA 2DLDA 1A4XA 1X42A 3HB5X 3L1JA 4ESHA 4BCDA 4JQZA 4D56A 2MWMA 3EBLA 3IXLA 4ZRDA 5IXSA 4I8DA 3WKDA 1QE3A 4FD3A 2Z4SA 2FZLA 4FFWA 3OEHA 2A3NA 1SG6A 4GDMA 5I3ZA 1QCYA 5ER6A 2GN9A 3BWBA 4AUKA 2H4HA 2H5EA 1EFLA 2J3IA 5B7GA 4HDNA 1LQUA 2G1JA 1WM1A 2JHGA 3JQRA 5DHUA 4B32A 1ZC4A 1ABFA 1D09A 1NL3A 5T5QA 5JNTA 2OD9A 5DYNA 1NLMA 3VX4A 1T9AA 1ZO8A 1S4MA 4R1OA 1CJBA 3BXFA 4G4JA 1PP4A 1NQUA 2BBTA 3MWFA 3Q1KA 1N8NA 3JATA 3SIXA 1GCOA 4E5PA 2WABA 3EOAI 3KSDO 4G67A 5CB8A 3G49A 1BH2A 2VF4X 4H9GA 1PK9A 2B0CA 2BDEA 3TQCA 5BSTA 1KYTA 3M2PA 2E6KA 3WDSA 3SXJA 3KG2A 1I94B 1QMGA 1W8IA 1NGSA 4AL4A 2W00A 4W7IA 1J33A 1O97D 3AI1A 5D5PA 3CLRD 2B6NA 4I9GA 4RIIA 3Q2IA 3T61A 1SA0A 1IEVA 4TROA 2Q29A 4UVHA 1KU6A 5H5JA 3W5DA 5IK2A 2Z9BA 1UMDA 2QX9A 3HJHA 4GX2A 1J8DA 4JSYA 1K3FA 1GPLA 1U7XA 1AQIA 2G88A 3IP8A 4MUBA 2X5XA 5ICMA 1K5DA 1WXHA 4R3NA 3AF0A 4LTMA 1LBQA 3GAMA 2PWYA 5HYVA 2FDCA 4MPTA 4B8ZA 4M0MA 2X7JA 3W5HA 1TTTA 3GRZA 3WMXA 4ADSG 3A6PC 3CRW1 4AY4A 2RGNC 2EZ9A 1E4EA 4O4HA 1NOIA 2W8BA 3M6MD 3CQ9A 3P71T 4GAEA 1QP0A 2FB9A 3JAKA 5A9SB 3EYAA 1JHXA 2FMFA 4UVDA 3IQIX 3VNUA 2XYRA 4MX8A 4OGLA 3JQAD 2XRFA 3PIDA 2XKAA 3UXMA 1E61A 2FCAA 4BNDB 4GD3Q 2F8LA 2EWWA 4YFYA 1QKKA 3FTEA 1LPMA 3GJXC 3HJTA 1LK5A 2W8BB 4DXAA 3PF9A 3ZWQA 5AVZA 5JS2A 4EG0A 1T9CA 4B80A 5IKEA 2PFGA 5KZMB 1N6KA 1U0EA 1Z5PA 3V4SA 4QOGA 1PV4A 1XZQA 3I01M 2CYCA 4EJSB 4XQ0A 221PA 4FWBA 4P3YA 1FQKA 1FNBA 2P35A 4UW9A 3C3CA 3VYWA 2DB3A 5CXXA 3SQMA 4DA6A 5CDFA 3BMNB 2CD9A 2B8EA 2Q45A 1N2CE 4BLQA 1HNNA 2HWKA 3GPCA 3ITNA 1VC2A 4QATA 5J5VA 2FWIA 1RACA 2HJHA 3DBRA 3AL2A 3FR7A 1W47A 1LI4A 3IT3A 3K9LA 2XWQA 2CY0A 2NZYA 3OO1A 4N0PA 4QWWA 1QIFA 4ZO4A 5SZIA 2ET6A 4TS9A 1OKKA 1TO6A 2GJ9A 3MW8A 4DKJA 1PWHA 1EI9A 3GH1A 3IODA 5LQCA 3MIIA 3QXGA 1YRHA 4R69A 4L27A 4U4AA 3N2KB 4B85A 9ATCA 1T24A 1L5OA 4UEQA 5KS2A 4MUYA 1H65A 2IUSA 1DTSA 1X1AA 1ST3A 2BGUA 3ZDEA 4QTXA 3FVTA 2J6HA 2DGDA 2YH2A 4BP9A 3J80A 1XXHA 2B4AA 1S2MA 1OHHD 1QYCA 2GN2A 2JEZA 3H6KA 1TYAE 3O7WA 3CEAA 4IX9A 4RPHA 5AM1A 3ZE1B 4DHEA 5FWNA 1T2EA 4XWTA 1OXSC 4TZTA 4K7JA 1G4HA 1YCHA 3P5SA 2W98A 4RV4A 1YZUA 5AHOA 2WTUA 4ZQEA 1ICIA 4BNMA 4ZVKA 2WTBA 4P33A 4AZ0A 2ZAYA 4MWGA 1K1EA 2DWQA 1L7AA 3BK1A 3I0ZA 1DPFA 3LGAA 3QX9A 1RAAA 5LBTA 3AESB 4CM8A 2O7NA 4GU5A 2M1XA 2BWJA 4JEIA 2VQSA 4ZQGA 2EJCA 4PZDA 4DY4A 4S1PA 4ZGWA 5ES4B 2AF3C 4FKZA 2VDMB 3Q5DA 4GPAA 3DKKA 4Z53A 1YB6A 5LXTB 4Y1RA 3FRIA 4AX4A 3VJRA 2IE8A 1GAJA 2YL2A 1JE0A 4K6OA 2XUAA 2OFXA 1SQ6A 4U0JA 4TUYF 3GN1A 1YVUA 2O5EA 1ZIXA 2VJQA 2Z5GA 2AR7A 2OO3A 2VT2A 4KO3S 1B15A 4O5AA 1XXLA 2HJVA 4FQ8A 4P84A 2BRUC 3PGKA 2N47A 2P4UA 1P7ZA 3VR5H 3ZJ4A 4D25A 1KDZA 2HA6A 4BJHB 4NHEA 5BYBA 3HFJA 4CLRB 3CA8A 2Q2VA 4D6XA 1G59A 3EXEA 1Z88A 3TDMA 5HJ2A 1DKLA 1K63A 1T6YA 2MSEB 3E3NA 5DTMA 1MDBA 1FBTA 2DP4E 2WKWA 5EC8A 2R47A 3KFVA 3U39A 4EG3A 3OPMA 4PSKA 4S2EA 3K0EA 2UYOA 1DCMA 1QGDA 1CJSA 3DEHA 1CERA 4K8OA 1N5KA 4TSKA 3PWZA 2RHLA 2B5WA 1TM3E 2G4CA 2FPIA 3F7MA 1ETHA 1PUXA 3CWCA 1QLJA 4JVLA 3T6KA 1WQ1R 3MHPA 4L8YA 1QYVA 1ESMA 3PXXA 1EP2B 1L4EA 5AHRA 3QF4B 2PMEA 4BMXA 1RRGA 4DMHA 3CRRA 5J58A 3G2PA 2H92A 1J25A 1PJCA 1GYRA 3CZ4A 4ZZ2A 4J7UA 1FJGB 1D6MA 3FCCA 1ZVJA 4XB6B 3DE1X 1L7VC 4K5QA 3WX0A 3QPWA 4GECA 2OQIA 4XWWA 1I7LA 1N2BA 2E5WA 1W0KA 1R37A 5SYMA 3HCPA 5WRFA 2QP9X 1P2GA 4IZOA 3D0KA 4NMLA 1JQ5A 4EHDA 1SELA 3M49A 1EAMA 1SCKA 2X3FA 1BIFA 2AQ8A 2FK7A 3EOZA 3HRKA 3X1ZA 3WAKA 4BNYA 1WNFA 1VKHA 4EHKA 2ZBEA 3BMQA 4YP0A 4ZDWA 3AONB 1RRMA 3R6TA 4ZEWA 5E9AA 2JHPA 3KUCA 1PSWA 1CQIA 2GN0A 3PSAA 5D1HA 4I1PA 1L4FA 2AFRA 4L8LA 3UMMA 1N0WA 4UREA 2ZSAA 3QMVA 3JRNA 1TXGA 4CCAA 4DF3A 1UPXA 3EMKA 4BYGA 1SUPA 3PNPA 3EISA 1GAQA 1BXGB 3I9V6 2YUTA 1B41A 4F8JA 3O8DA 2HUNA 3BDVA 4M6WB 4ZCPA 4LXTA 1BDMA 2F1IA 1VJTA 2PM8A 5KHOC 2XZTA 3E48A 2ZKLA 3FDZA 2AQKA 5DNAA 1RQGA 1U2SA 3ONFA 4CIVA 2GN6A 1Y8RA 2WFLB 3QW2A 5IM5A 4WFJA 3RRMA 4GMDA 3HCCA 3S70A 1CY7A 2PT7A 3FFBA 3V4LA 1O0BA 2G82A 1ULUA 3MCAA 1T4CB 1ID8A 3KLBA 4MKRA 2Y27A 2P5UA 3GGDA 1QHIA 3HCOA 4OI2A 2XE8A 4ZQIA 3BILA 2QQ5A 1YULA 2ECKA 1KDOA 3K16A 4XGRA 1ZQ1A 1EFHA 3BEOA 4XD7D 2C5LA 3DKVA 3URMA 3VV3A 2VF8A 3GJYA 1J24A 3UJHA 2IW3A 5B30A 4WCDA 1HDZA 2C8KA 4UU7A 3L3BA 1NR5A 2D0OB 2EQBA 3CUKA 3WDMA 5BNTA 3UGQA 1QQAA 4QJ4A 1HYQA 1LRJA 3CJQA 3D2BA 4IEEA 1MQ8B 5EHGA 1B43A 2FFHA 4S05A 2P3SA 1NF2A 4WZBE 1DJOA 4FX2A 1RFGE 5F51A 5A6VA 1ZJ6A 2BCEA 2VBFA 2B21A 3I2KA 3IUMA 4R2HA 1M66A 4RKFA 5CT4A 5EPEA 3KOZA 1BD4A 4Y6OA 2EEPA 5CRIA 3IKJA 3H6GA 3U0BA 1CZUA 2Z5LA 5EEGA 1N36B 2WF7A 4L0QA 3G8YA 1LSUA 2J5RA 4D6YA 2O54A 2NVUA 3DM5A 3E84A 2W2XA 3AZPA 4HGNA 1A2OA 2J7PD 4BDTA 1BE6A 2PX4A 3VYUB 3QUAA 1H8EA 1PNVA 3A9UA 3LP8A 5BSUA 1T3HA 2J9RA 5H3LA 1YZLA 2YR0A 2MYNA 1KI1A 1VSTA 3KOWA 5LP6B 3A1WA 2QDXA 2ZS7A 2ODPA 3A11A 3GD7A 2VPIA 4Z54A 1GD1O 3SLGA 4O4LA 1C7ZA 4YCSA 4X7MA 4IGEA 5EKDA 4EGAA 1Z82A 3RYFB 4F2HA 4LZWA 1OLSA 5D1NA 1YNSA 4XFJA 3FZGA 3H18A 3KYDB 2E4ZA 3NOOA 2VHQA 3RWMB 2ISSD 3SQLA 3KAPA 1XMXA 1ABEA 5DOZA 1IG0A 4YMVA 1H6BA 2EDCA 1H2FA 1AXEA 2JJ8A 3IIEA 4HDSA 4P5PA 4F11A 5EMKA 4BGDA 4IVRA 3HVRA 4XIYA 3CNEA 2KJQA 2RB4A 3OSZA 2VAWA 3CISA 4MWEA 2CKDA 2DHCA 1E5DA 2GK6A 1JTVA 2HCBA 1PZMA 2Y2UA 3A4MA 3TIFA 5U9CA 1LPOA 3IHLA 1DP4A 2ZIVB 3RG2A 2ZTMA 1R74A 2F48A 3VC1A 5ILQA 2QL6A 4GXQA 3V8VA 5KVCA 2GK3A 1NXOA 1I3MA 1J5XA 1KJIA 1ZM9A 4FZRA 3TZBA 3ES9A 4GBMA 4ZYZA 1Q83A 3FYSA 3AESA 3NHSA 4CM8B 4C6SA 1YR6A 2WIAA 4ND2A 2PANA 2ZJYA 2IH4A 1KAGA 4HQNA 5GJCA 3GLFE 5TQ0B 3QUCA 2II6A 2NZ2A 4N6OA 5PNTA 5BN3A 1OGYA 1S3GA 1WE2A 3LUFA 2A5LA 3ED1A 5BNFA 4PS0A 4AG6A 1OTHA 1P1KA 4GWGA 5EERA 1VHDA 3TTWA 4ARSA 4AZSA 1ESDA 1ODKA 3FWZA 1K7SN 2XPCA 4NBKA 2IJGX 2P9YA 2V5UA 2Z2KA 2ZXFA 3PQ5A 4Q16A 4PWYA 4UDYX 2V45A 1MB0A 2G76A 4L85A 1GLNA 4YWJA 5E0OA 1E3QA 3RUPA 4M0KA 4F93B 3GOHA 1U9CA 4L6AA 4MLZA 4YDSA 4C6RA 3ORRA 4WASA 4G84A 4RBNA 2JLZA 2HRBA 1KFCB 3RUIA 1CR6A 1L1EA 2ZJ6A 1VL8A 4XOIA 3O3CA 5J2TF 5MN6A 1MDFA 2XGJA 5GONF 4BU1A 3MGKA 2WPDD 4ZQCB 1SB8A 3KXKA 4ZCRA 4FUQA 1RYFA 4D9NA 1KVQA 3OKPA 1U5AA 4ND7A 5AW0A 1QRAA 4MKHA 4M86A 3UOWA 3R41A 2REQB 5C37A 3BREA 3HKBA 3Q3EA 3R2JA 4NOLA 1NFFA 1SXJD 2NU8B 1REQA 5KNDA 4B9AA 1NNUA 1DU4A 1VECA 3FSJX 2IXTA 4OU5A 4DILA 4QSHA 1TADA 2H4YA 3TRKA 1T5DX 2E4UA 1Z15A 2GEJA 2XD9A 3FCXA 2R7KA 1ZICA 4JBIA 3RTGA 5AK0A 3TMAA 3KBBA 1U8XX 3R3JA 1IPEA 1T9HA 4EYEA 2BFMA 3CLUC 1KZ6A 2HK6A 4P7FA 1M34A 1A5SB 2HH9A 4IO1A 1I1NA 1P17A 2YW2A 4O0LA 1SIBE 1D03A 3GPBA 1FPMA 1CD5A 1JG3A 1TGVA 1OVGA 4PQGA 1YU9A 4H3HB 4WBNF 2FZ4A 1NC3A 5GINE 4GP9A 3OI7A 2XOEA 1LNSA 5D2CA 3AOGA 3SJCA 3T41A 3Q8KA 1HRDA 3PQ3A 4G0VA 5EGNA 1YVEI 1UK8A 4F3YA 2HRDA 1NBIA 1H0RA 3DGEC 5G4KA 1XVUA 3HKEB 1J2EA 1EXWA 5E2AA 4CTMA 1J8YF 4FGLA 4GYJA 1TCUA 2LRHA 3PL5A 3VZDA 1N1DA 4LZPA 3CURA 3NHWA 1RLUA 1P19A 4QBIA 3EQ7A 1U2ZA 3G2MA 4YRQA 3TLAA 4EZEA 4I5GA 5ALHA 2H11A 2H3EA 2Y9MB 4G89A 1I2ZA 5A9SA 4BIMA 4F12A 2H07A 2CHGA 2FSGA 5DGIA 1YK1A 1AUOA 4LZLA 1XCGB 3RVQA 1SK8A 1XX6A 3UA3A 3CH7A 2VP5A 3DDUA 1E2KA 3HCEA 4RF4A 2P0AA 3WK4A 1RDFA 4V1CI 3AR9A 2PS1A 4FNGA 4KITB 1QU2A 3CPJB 3SYKA 1BG6A 1A71A 1QYWA 1QH0A 4FE3A 5IAJA 3ZWWA 3WLIA 1YAJA 4CETA 2YWGA 2W6JD 4G0QA 2PMCA 3CNHA 1KY4A 4U2EA 3HYNA 4NS4A 1ZL0A 5IP5A 1RQ2A 1IVNA 3JSAA 4D3ZA 2BI8A 1UXKA 2MIIA 1Y4ZA 1IZYA 1P73A 1JH9A 4HADA 1HK7A 5F2NA 2ZWVA 1FXUA 4MS4B 3LFTA 4R6WA 1HT3A 1WCXA 4MQ4A 1DOHA 4OB7A 1YA4A 2J07A 3T5CA 2B1GA 2O2YA 4FK8A 2A1TS 2ZUDA 1CUXA 1K6IA 1VBNA 3PNQA 4HZGA 4CN9A 3UPTA 1N6PA 1Z62A 2UXDB 1NJ1A 2GJ8A 3R5SA 3U3ZA 2C3MA 4RX1A 3DNPA 4YAEA 4GL2A 4OQNA 4ZD6A 4MAFA 3HP7A 3A0UA 3ZHUA 3C4VA 3EG9A 4BNGA 2I80A 3D6VA 3M1AA 4ZCIA 4AXXA 2C1EA 4MQMA 4YROA 1Q84A 2ADFA 4GWLA 4HEA1 4HTFA 1QJ4A 1NTRA 3P2JA 4B0OA 2BZGA 1GTG1 1KYZA 2AZXA 3W1VA 4MARA 2WUWE 1U0JA 3EOBI 3NALA 3QOXA 3IP9A 4YMHA 2XDWA 4J9UE 3GHHA 2FPLA 3PC3A 4WJKB 1QRSA 1GRVA 3IFSA 5KNDD 1VA5A 3X1WA 1YS6A 4EL5A 3WGVA 3H5NA 4QUJA 1PJ8A 2X5OA 3QV2A 4FWIB 8AT1A 2EJTA 4M9RA 1C9MA 5AHXA 2JFGA 2FGJA 3RRFA 2JFWA 2W2KA 3W3ZB 4NYMQ 3OQ6A 3UBMA 4DA8A 5B1IA 1Q92A 2CHUA 3RTDA 2IEIA 1UJMA 3D1JA 1SCDA 3A6EA 4ZRNA 2OYRA 1E5LA 3AWIA 1IQUA 3AUJB 3AVUA 3H05A 1KO4A 2OOSA 3E05A 5DTJA 3AY3A 5A5FA 3FLAA 1L1RA 2BMEA 3BSWA 2QUZA 3D7RA 4Z2YA 2GM5A 1GUZA 4JXXA 5CNJA 5DH9A 3Q8WA 2XRZA 4OHWA 3L0DA 3M34A 3AU8A 1E7WA 3L8DA 3F9IA 4HNTA 4A8HA 3FMVA 1NBOA 4F6RB 4URHA 5CXQA 4URWR 2FZVA 2LGJA 1VG9B 3B12A 5LL6P 4EA9A 2OCPA 1KWKA 3R7BA 3QZUA 4DCOA 1IXYA 5DLPA 2B1IA 1AQUA 3PR1A 4HUJA 1F17A 2GEBA 4QA9A 4EY5A 5BV0A 4GHWA 3F96A 4NY1A 4DLZA 3VU9B 1QO9A 2C5SA 2WJZB 4WK0B 5CDUA 4TYMA 5TQJA 4HTAA 5EP1A 5ADVA 5ICCA 2O3QA 5KOHA 3LRTA 2O20A 1DQYA 1NUSA 3K0KA 1N1GA 2VP6A 4HAOA 5HEKA 3F5QA 1XQVA 2IHYA 4IEIA 1QYRA 3VMFA 1LSOA 2GAFA 2QTWB 4J1SA 3L40A 2WAAA 4EEZA 2PX0A 3EG5A 3QU2A 2P9ZA 5B57C 5AJXA 2PFSA 2Y6UA 4Q9KA 2PAAA 3MTJA 2PMWB 1OLOA 1HL7A 3CWZA 2BEVB 3MS4A 2HRRA 2PX3A 1Y42X 3UMRA 4RY8A 1N4AA 2FPKA 1E3WB 1H0KA 3EEYA 1MH9A 2HPAA 3DL4A 3GLSA 4KXQA 2EBHX 3DO8A 4Q6WA 5C9ZA 3MJDA 1PI3A 4HZUB 5F2OA 4BMCA 1EUZA 1E7MA 1JG2A 1R16A 2J67A 2D3TA 1P4HA 2UKDA 1CUWA 2FXVA 2XF2A 4DV4B 2X1VA 3DTNA 5IC6A 4AU1A 4ZEVA 2ZRBA 1X1TA 5AVJA 5IT0A 2GX6A 2ZB7A 4Q15A 1S0UA 2UZ4A 5LB2A 3HM9A 1ZIDA 4DLTA 3ONDA 4LJRA 2VYVD 2NZWA 4KUEA 1G6HA 4LTNA 3OZIA 4OD0A 5AH0A 3M9WA 1Y9JA 3LU1A 3X2FA 5FUWA 2GM4A 3V4FA 1RXYA 4M0UA 1ZN8A 1LZKA 2OY0A 1U0NA 1JBEA 1F6BA 2VH5R 3G3EA 4FHGA 2ZIAA 1PWXA 3TCNA 1FFXB 3K1YA 3PDWA 4TOIA 1EFTA 3Q15C 2CXRA 4WKNA 4OBWA 4BNTA 1ETUA 4IIGA 4JUAA 3UGTA 3G5MA 2DKNA 5EPUA 3UV7A 4AJ1A 1AU9A 3F98A 3TOSA 4I0WB 3VFDA 2VJMB 3WHIA 3K96A 1GYPA 2PMFA 1K7FB 1H0HA 3SI7A 3WNQA 4ZV9A 3C5CA 1WUKS 1P6QA 3OFJA 5KVQA 1SOMA 3IKMB 1LS6A 3OKAA 4HXFB 2A4KA 3VI3B 1P4AA 4X84A 5EMLA 1G3UA 3BTVA 1N78A 1RC8A 1PL0A 4FB4A 2FJPA 3VR0A 3FF1A 5JPDA 2UVDA 1D8TA 2QN2A 1OZAA 4JR1A 2I1VB 3Q2OA 2OC4A 3ZE0B 2NO5A 4TKMA 2FMTA 2PGIA 2R6CA 3E4DA 1K08A 4TXJA 1RQ7A 3KQYA 2POQX 4K1XA 4PC1A 3IESA 1QK5A 3FOBA 2JGIA 2ORED 2X58A 2VBIA 2QDKA 3GRVA 5C5CA 8OHMA 4OOFA 2HV8A 4H17A 3QU5A 1PJZA 4INJA 4WCVA 3AF6A 3PXAA 5F7XA 3E9YA 4E33A 1GNPA 4D4MA 3P9NA 2G5PA 6AT1A 1QX4A 1W88A 1CUUA 5F64A 1B4DA 2BGNA 3B78A 4IYRA 1XTRA 1PV2A 4AMYA 1VPVA 2DH5A 1K0UA 4N7MA 4QNMA 1MT0A 3D8NA 1UP4A 1L5RA 1LTHR 2DMRA 2OQVA 3F8TA 4YNBA 3R74A 3NYRA 3GV0A 2DLNA 2ZWPA 1A7UA 4QQFA 1FDTA 2W6ID 5KVVA 3STUA 2EVWX 1K6EA 4B33A 3AI2A 4HF7A 4B6RA 1Q7RA 2A0KA 4DWOA 4RLHA 1QG0A 4IUDS 1Q5PA 1V6CA 1ZOPA 3ND9A 3G5TA 2PX5A 1C14A 3IB3A 3A6DA 1E3LA 2JAHA 3BIJA 3OPYI 2VYQA 3DD1A 3G7NA 4RJ2A 2ZJFA 3C6YA 4WNIA 4M0PA 2ZJ3A 3WFJA 4G8JA 1ORHA 4PRZA 4KODA 3AR8A 3SF0A 3COVA 3RV4A 4YCCA 2V3VA 2EX1A 4KFTA 4MRSA 2WEKA 1GEGA 4ZT6A 1EM6A 3GGCA 2XEXA 5JJKA 5ALXA 2DSTA 4WQMA 3DPUA 3AILA 2CLFB 3F97A 1XKXA 2HA7A 1FL9A 3HSKA 3TPZA 2AS0A 1VHLA 3R9WA 4NKRA 3UATA 2I78A 2XB9A 3PFBA 4ZO7A 3C6BA 4BHTA 2W83A 2JKYA 2YUIA 3PWSA 5IJ9A 3C5EA 1E60A 3AB3A 4TV9A 2YS7A 4ZCTA 4LWQA 4QJIA 5C35A 2G07A 1XGKA 4Q82A 1GR0A 1JIJA 3BWXA 4BGIA 1WJGA 2Y4NA 4XWAA 1Z38A 3BB1A 4CGYA 3RBVA 4Q4HA 4RGVA 4ALKA 5FBHA 3PEYA 3EVTA 3S2GA 5LLDA 5FDFA 2X23A 3TAXA 4BQPA 1Y4DE 2ZRMA 1D7OA 3AX6A 3DBOB 3ELDA 1CQWA 4BB6A 4DV5B 3WV4A 4CEHB 2YYSA 1RJ9A 1CEQA 1HLDA 2CLLB 2R1ZA 4AYWA 5BW5A 3T0GA 1LDBA 4KE8A 5BYJA 4R2MA 2OXEA 1KAOA 5DYGA 5E1MA 4KQKA 1Z4IA 4XTRA 4NG4A 1J90A 3O93A 1W48A 4M9UA 2ZP1A 1N3LA 3OMLA 4WT7A 3RQIA 1KHHA 1XNRB 1AF7A 4HH1A 3HA2A 5BMOA 2FSVC 1V3VA 2OMKA 4M6WA 2OKCA 2H1LA 2G4VA 3MM4A 2ZRDA 3THWB 4U6SA 2BI4A 4LZZA 4Q48A 4TMFA 5JLAA 4DEVA 4IS2A 4BRZA 1SCUA 4QOSA 1D6JA 3HDTA 4UNSA 4UNNA 3NLLA 5HIJA 2O6HA 3WRYC 4PCLA 1SUSA 4C1BA 1CHNA 1XRLA 2AX4A 2IUEA 4BMNA 4CMIA 5J2TB 5AHKA 2XD4A 3MCVA 5C7IO 1UBRS 1MOPA 4DC0A 4MWDA 2JLRA 2VC2B 2PGLA 1VYHA 3EFOA 1RRPA 2GCPA 2XTNA 3W04A 2OK8A 1E1NA 3JVVA 1OIWA 4MGIR 1LV7A 1V37A 3LRXA 2ZE8A 3V1YA 1BDHA 2Z5VA 3WKAA 1UC8A 1BA3A 3ADKA 3MZ0A 3PX3A 4HDAA 4LX0A 1PGJA 4HAVA 1PDWA 2ZUSA 3GROA 5KTYA 2UZIR 1SURA 4GE0A 5CEEA 1S1CA 5BSEA 1ORIA 5L53A 5NULA 5L9AA 1G3QA 5LSAA 2OLEA 1V1JA 4COOA 3ANYB 1FS5A 1Z2AA 2GCNA 3HKBB 4GEKA 4XASA 1NW7A 3N2YA 4H59A 4XOUA 4OHZA 3D7LA 2C95A 3EF1A 4K0RA 2JGKA 4C43A 3EFHA 5JW6A 3EFBA 1J5PA 1GDHA 1OHHA 3CUSA 5AJZA 4KN9S 3T7TA 3L7MA 4JLKA 1UADA 2ZI9A 4BVLA 3EXG2 3ZLUA 5TQ2A 2PSFA 4AJPA 4QVIA 4KIUA 3LI2A 3WQRA 4CMHA 2VWPA 2NMVA 4X9XA 4LF8B 3NOQA 4MKXA 2P27A 4CEJB 1SY7A 1G6OA 3KEFA 2H3HA 4D4KA 3AVXA 1IOWA 1E7RA 1TU4A 3EIWA 1UXJA 1PEKE 4GPBA 2Q28A 4IINA 3HV0A 1S2DA 4GZLA 2CXNA 4OUKX 5GONA 3ELBA 3Q7TA 4MV0A 3MXOA 4ZTUB 2GI4A 4L8GA 3UEOA 5JRJA 1ZM7A 2Z09A 4JFRA 4HWOA 5DGTA 5LQRA 2I3AA 1DWUA 4CQLB 2HNAA 4DPKA 1WY5A 4G3XA 4KWEA 5AXCA 2HTFA 4YCDA 2A5JA 2L42A 3F71A 2GUWA 3AP1A 3DUFB 4UUOA 3PG5A 1GIAA 1PF7E 2KE5A 4M55A 2AOVA 3E53A 3SIWA 4QBFA 1E6WA 3L7CA 3RUFA 3UUEA 3NNDA 4DNFA 1A1VA 1I4DD 1XYVA 4IRXA 4MGHA 3CX8A 4XH9B 1O94C 1W19A 3U26A 4OKIA 4FMDB 3VSDA 1Z33A 1BJRE 4F9GA 2XTZA 2EFGA 4RTMA 4ZKDA 4N12A 1ITZA 4CZ2A 2VSXA 1E1CB 1EXMA 4RQBA 4XEHA 2XUGA 4M8KA 2JHAA 1CRPA 3LV8A 1I5OA 2P6PA 4AC9A 2WYHA 3HPRA 3IAFA 1I4LD 1SVUA 2V74B 3N2EA 3PP8A 5JRDS 1KI4A 2E21A 4C4XA 4ES6A 3LW7A 1F8UA 1Y1RA 3AB8A 3NIWA 4BFYA 3L0YA 3DYBA 3P9KA 4BJ3A 3A2KA 1URPA 1IOZA 1E77A 1P4JA 4BE9A 3A05A 3L1HA 2W2PA 1DKMA 4PC7A 1A69A 3OIVA 5T8KA 1SKQA 3CINA 1DIAA 4DJ5X 4WJLA 2IV2X 1XPOA 1KEEB 1E62A 3NJRA 5CUQA 5F3WB 3B53X 3I3OA 4KQ1A 3ZNNA 1TA4A 1V5WA 2R8ZA 1X94A 4KUGA 4YJ3B 2FPXA 3KSRA 5EIHA 3FDFA 2YTZA 2KSQA 1B14A 4GQAA 1I4EB 4FR5A 3KXDA 4M1EA 4TQGA 4YT8A 5L3SA 3X1DA 1B8PA 2CNOA 1PZEA 2XB6A 4PPQA 4A92A 3FUXA 1E1KA 1E4VA 2PT9A 1XG5A 4D46A 5KVAA 4DEYA 3QQ5A 5J59A 4YMUA 2P6OA 4M4SA 1GZ5A 1EVLA 3WLEA 1Y4SA 2D1QA 1IH8A 4KQIA 4MV6A 4Q4JA 1QP7A 3A2NA 1EUCA 2A86A 2EW2A 2HFKA 3K1JA 4IDEA 1QUFA 4CDRA 3WIEA 2P1ZA 3KJHA 4MWOA 4DLWA 3ZWNA 4QG3A 1I7DA 2ECQA 1Q57A 2J5KA 2DHEA 2R3SA 3MK31 4P4GA 3OLZA 1O87A 4RY2A 3EUFA 2W4IA 3NBYC 3UV3A 1ZUHA 3FYDA 4HRAA 3PKZA 4LY9A 1D2MA 1YCFA 5EUBA 3C6XA 4IXDA 3GRKA 4J4BA 1R5BA 3IYLW 5FPSA 4DQXA 4LHWA 3VUEA 5B1SA 1CEYA 4P31A 1CUCA 1AA9A 3ZCTA 2N9UA 3RVNA 2G83A 2J3QA 4MYTA 1MAVA 1JAYA 5DCLA 3TRJA 1R0CA 3EZYA 1L5HA 2AMYA 2JF0A 2AK3A 2BGGA 1N2CB 1QHEA 3FSGA 4PBSA 2FSHA 2GBPA 4UDOA 5HCNA 3UJBA 4BE4A 1U5BB 4JDPA 5K0TA 4TTTS 5CD9A 3ZVRA 1QKJA 1OYVA 2ZATA 5EZYB 2O8BB 4JBHA 3GO4A 3EW9A 4LKRA 3FFXA 1W5TA 3AIKA 2XJ4A 3QJ5A 4NCJA 4U9IS 3W5AA 1I32A 1V45E 1BRMA 4WOKA 4GMHA 3TTUA 4C4TA 1G8FA 4JVOA 2WD8A 4RDHA 1A1SA 2XLBA 2FFBA 3SHWA 3VHXA 1H5QA 4YY3B 2H2IA 4O25A 4Q7MB 2IS6A 1NP6A 5AW6A 1NVAA 3BZUA 4XVCA 3AKDA 5HFNA 1P7VA 3KKPA 1DKRA 4J0EA 1VYUA 2VTBA 3GC6A 1TFRA 3K05A 4NZZA 4L3WA 3UXYA 4U9HS 5JZVA 1ECBA 2IFTA 2WVHA 3OOWA 5BY2A 1EDZA 1NZDA 3R3XA 5IMSA 3MLEA 1I2BA 3BGOS 2FEMA