3CRNA

Crystal structure of response regulator receiver domain protein (chey-like) from methanospirillum hungatei jf-1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
129
structure length
128
Chain Sequence
LKRILIVDDDTAILDSTKQILEFEGYEVEIAATAGEGLAKIENEFFNLALFIKLPDMEGTELLEKAHKLRPGMKKIMVTGYASLENSVFSLNAGADAYIMKPVNPRDLLEKIKEKLDEQEKEGHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response regulator receiver domain protein, CheY-like
publication title Crystal structure of response regulator receiver domain protein (CheY-like) from Methanospirillum hungatei JF-1.
rcsb
source organism Methanospirillum hungatei jf-1
molecule tags Signaling protein
total genus 47
structure length 128
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3crnA00
1I3CA 3OQNA 2MYPA 1M5UA 5TPZA 4YV7A 4LE2A 1RPJA 3QEMB 3TMYA 2PLNA 4KPYA 4O5AA 3TB6A 1MB3A 3T6KA 2HJ9A 1CEYA 3QX8A 1D1PA 1YMUA 2CWDA 1P6QA 2IOYA 1JX6A 1DP4A 4ETMA 4W5NA 2X7XA 4RKQA 3ILHA 2W42A 4KK3A 4RY9A 3EQZA 1C4WA 3HUUA 4P1ZA 1J56A 1ISSA 3HZHA 5KWSA 4Y9TA 1JWLA 1E6LA 4E7OA 4RS3A 4ZMRA 1QQBA 2E4XA 4G0QA 1KRWA 4DADA 1QO0A 2L18A 5C5CA 3I45A 3RVLA 5KQPA 2FKAA 4RK0A 2FMIA 5TPWA 3UK0A 1SXHA 3EODA 4EYOA 2E4UA 3MMNA 3N8IA 1M2FA 5I4CA 2QZJA 1A0OA 1LBIA 3LFTA 5B3JA 2NZVG 1JFSA 2WJAA 6CHYA 1Z12A 3RQIA 2QV0A 4NICA 3LMKA 3T8YA 2IPAB 5KQMA 3MYYA 1D4ZA 2PUAA 3RVPA 1Z2DA 4UHKA 3LOPA 1USIA 2HPHA 2A9QA 1NTRA 4LDZA 4IRXA 2NT4A 5EWLA 3DGFC 3EGCA 3HDGA 1AB6A 1ZGGA 4NCAA 4LZLA 3DGEC 5DLEA 1D1QA 2PAFA 1TMYA 3HVRA 3OQOA 2FVYA 1PUXA 1F51E 3IP7A 4PZ0A 1SD5A 5KC8A 4N03A 5JNSA 4EYQA 4S05A 5CNKA 5B3JC 2LBPA 1JL3A 1ZESA 3LUAA 4MQEB 3P9YA 1TVMA 4N76A 1CHNA 4JAVC 1YK0A 2HQOA 2PUFA 4YWHA 1VLZA 2E4WA 3KG2A 3QK7A 4RY0A 1ZAYA 4MLDA 1ABFA 5E3JA 2RDMA 5FWYA 2MYNA 3KS9A 1YS6A 3RVNA 5HQJA 5F64A 4XARA 1EWVA 4G0YA 3A0UA 1URPA 1EWKA 4JASB 1PNTA 1MVOA 2L19A 4MR7B 4RXTA 2I6FA 1E2BA 4HNQA 3FFTA 1NXWA 3HDVA 3M6MD 1GLGA 3OLWA 2IPNA 1P2FA 1DCFA 3KLNA 1BDJA 1RZRA 3O1IC 4IILA 4XAQA 4YCSA 2ZWMA 2PE5A 4GNRA 3FDFA 2PKXA 4ML3A 1S8NA 3L6UA 3H5LA 1A2OA 3OO1A 1QP4A 2AYZA 3QELB 4P98A 2FQXA 1U2PA 1QNLA 4G0ZA 1M5TA 3SNKA 1MAVA 1PEAA 3JPWA 4XLTA 4JP1A 3Q7TA 2YHBA 2QU7A 3SQNA 2HQRA 3OLVA 3JVIA 3SY8A 1EAYA 4RU1A 2GKGA 3QEKA 6ABPA 4RDCA 5ABPA 5JS2A 4H3KB 4XFKA 8ABPA 3LUGA 2R48A 2PUCA 4Q6WA 1OXKB 3EULA 5JNWA 3RH0A 1ZVVA 1FQWA 4TLMB 3TO5A 4F8JA 3GWGA 4D74A 5FWXB 4KK4A 4MR9B 1P8AA 5KQGA 3KYJB 3HM9A 1L5YA 3RVMA 1JF8A 3QX9A 4UHJA 4ETIA 4WXMA 2MSKA 4MS3B 3H75A 4Z0NA 1JYFA 1ZH4A 3CRNA 4MS4B 3CZ5A 4MQFB 4ZPJA 3ROFA 2F8TA 3KYIB 3IPAA 3RVOA 2WWVD 2WB4A 4HYEA 3FFXA 4N47A 1RNLA 3OLYA 2FMHA 2PMCA 4G0MA 4EYKA 5JNUA 2QVCA 3O74A 4PEVA 5C5EA 3QLUA 3C97A 3HEBA 4KQCA 1Z15A 1DG9A 5EWMB 3HSYA 3E61A 3IP9A 5TQ0B 4H3HB 5EWJB 1FFSA 2JRLA 5CNJA 1ZGZA 3OO0A 3KHTA 3MA0A 3O2SB 3BRQA 4WWHA 3TD9A 3BREA 1WETA 1LBHA 3HUTA 1USGA 4G97A 4FB4A 5TPZD 1ZY2A 3KLOA 4MR8A 4PICA 5ED4A 1YTUA 1JYEA 1QP7A 1P6UA 5JS1A 4FE4A 3HXMA 2L2QA 2B1JA 4KVFA 2HQBA 2AYXA 3QLUC 4RK4A 3OM1A 5FBHA 5T3YA 1DRKA 3Q7RA 4EVSA 2CD7A 2JVJA 5IUNC 2FQWA 3EDCA 4KREA 1M2EA 1TM2A 1Z17A 4QYWA 4RXUA 2JB9A 2VUHB 1AB5A 4N0PA 3A10A 4GPAA 2FEKA 5HSGA 5TQJA 1GUDA 4NV3A 3F7NA 3QLVA 4IF4A 2PL1A 3LKBA 1E6KA 2PL9A 3FFWA 2M1ZA 4W5TA 4KNYA 1BAPA 2O20A 5FWXA 3UUGA 1BVHA 3Q9SA 2RGYA 2N9UA 3SM9A 4MRMA 5TQ2B 2NT3A 5KI6A 3S99A 1D5WA 2J48A 4PYRA 2PUEA 1D2AA 2FSPA 4MQFA 2FMKA 4MS4A 4IGAA 1Z13A 4G86A 4YGXB 3VNBA 4YP9A 2QR3A 3JS5A 4O1HA 1IIBA 4QICA 3FMVA 3H1FA 2IDMA 3GYBA 3QEMA 2XDYA 4RK1A 1Z2EA 3QLVC 3MF4A 4MLCA 2A9RA 3FGZA 3GT7A 4MS1B 3A0RB 2IPLA 3H1GA 4LE1A 4ZYLA 5TQ0A 1LJLA 4IMIB 4RV5A 2JVKA 3H6GA 1W9HA 3CLKA 3T38A 5TE9A 4Q7EA 2V0NA 3I09A 2JBAB 3IP5A 4JA2A 2H0AA 5BQ3A 2FN8A 5CHYA 4YR7A 1TJYA 5JNTA 2LUOA 5IBQA 3O1HB 5DTEA 4H60A 1KMIY 2FMFA 1MIHA 1JBEA 3CHYA 3O1JC 2WRZA 5JNRA 3O75A 3KSMA 4OTZA 3IDOA 4EUKA 5IEJA 1DJMA 1XHEA 2P4UA 4G0XA 3I42A 1RXEA 3L49A 2PUDA 3OLZA 3N0RA 3OQMA 1PEYA 3W9SA 4MPTA 3LUJA 4NCBA 2VK2A 3HS3A 1HEYA 1ISRA 1YK1A 5JNVA 1U2QA 2FLKA 1U8TA 2JK1A 3IPCA 3SAJA 1RZRD 3D8UA 4F11A 2MYUA 1XHFA 2DRIA 5TPWB 2R4QA 5GQSA 3EJWA 5BR1A 3GL9A 1EHCA 3LUKA 4B09A 4EVQA 4KZKA 1DCKA 4JB0A 4Z99A 1SXGA 1NXTA 2F8SA 3Q41A 2NZUG 4RWEA 5DGCA 3HV2A 3MIZA 4ETNA 3UKJA 3HJFA 4RK5A 1VKRA 1LK0A 4W5RA 3K4HA 3N6VA 4MQEA 1BA2A 2Q5CA 1L5ZA 2IPMA 3MM4A 1APBA 3N75A 3KJXA 4RZSA 1JDPA 3T95A 2IKSA 3LKVA 2E4YA 1ZITA 3OLXA 2GX6A 3ROTA 4MAAA 5EWLB 1DBQA 1ZHHA 1H9CA 2ZAYA 3NNSA 1SXIA 4RK7A 3OM0A 2B4AA 1SRRA 2FTKE 4TN5A 5HKOA 1KRXA 3M9WA 2OQRA 3C6QA 2YHAA 3G85A 4YLEA 4E7PA 4W5OA 3DLHA 4M88A 1GCGA 4MR7A 3F6PA 4L85A 1JDNA 1RXIA 1VRVA 3CG0A 3RVJA 3H5TA 2FN9A 2H3HA 3GV0A 1NXXA 5CNIA 1FFWA 1NXVA 1PHRA 1Z25A 3OMWA 3Q15C 3R0JA 4WUTA 5IULC 3A3KA 3F73A 2PUBA 1NATA 1GUBA 4HNRA 3HO1A 2P9HA 2FQYA 3VNAA 2WMYA 3NBMA 1NXOA 1YMVA 2QW1A 4KFCA 3JTEA 2ID9A 3RVSA 3QELA 5FWYB 4W5QA 4QYMA 1ZDMA 5IX8A 4WZZA 1FSPA 5T7BA 4DQDA 1VPWA 1MB0A 1DBWA 1NXPA 1Y1LA 3C3WA 5HM6A 4Z4EA 1A04A 1R8JA 3C3KA 4EGSA 2R47A 2NUBA 4YO7A 2QSJA 3LUCA 4WT7A 5D2CA 1QMPA 2VYCA 1YIOA 2FEPA 1T34A 3O2JA 4LX8A 4JOQA 4Z4FA 1QO0D 2BGGA 3F6CA 2MYTA 2ID7A 4KQ9A 2E4VA 4G0OA 3IP6A 3JY6A 3EAFA 4MR9A 4EVRA 1JFVA 3O21A 3RVQA 1B00A 3NNDA 4RK6A 2WY2D 3E3MA 1JLKA 1QKKA 4MS3A 3LTEA 3Q7SA 2JCGA 4YRZA 4Z9AA 3HCWA 2VUIB 2QXYA 1DC8A 4LDAA 2R25B 1Z26A 1ZN2A 3LUFA 4FE7A 2PJUA 1EWTA 1DRJA 3K9CA 4KRFA 3OMXA 2M98A 4IMJB 2CHFA 3DLBA 2FLWA 3G1WA 1BDIA 3CFYA 2KYRA 1Z18A 3N0WA 5EWMA 5BRJA 2TMYA 3URMA 3N0XA 5KC9A 3H1EA 3ILYA 7ABPA 1E6MA 3KKEA 4TMYA 2GI4A 5CNMA 5EWJA 2FW0A 5IEBA 3H6HA 9ABPA 3EQ2A 4L4UA 1QPZA 4Z4GA 4JB2A 4PE5B 1DCMA 3N53A 5DKFA 3RVKA 2JVIA 2RJOA 3LUDA 3CS3A 3O2QB 1TLFA 5GOTA 4Z4CA 3LUHA 4OATA 2RJNA 2L17A 5IC5A 1YVUA 3BRSA 1JH9A 3H5OA 1QQAA 5IUKC 1BDHA 1JHZA 2A9PA 3NHMA 5BRAA 2E4ZA 4Z4IA 1EFAA 1CYEA 1NXSA 3H5WA 4Z9BA 2GWRA 1DBPA 1U0SY 3CKMA 4N41A 1OXBB 5IUJC 1ZH2A 3QLTA 2IYNA 3NNNA 4MGEA 5PNTA 3KCNA 3M9XA 3NHZA 3GA5A 3D02A 2LP4Y 3GBVA 2HSGA 1KGSA 4OLBA 1C0EA 3RVRA 4ZMSA 3CU5A 3CZCA 3HK2A 2FEWB 2QVGA 3JPYA 1GCAA 3KTOA 4F12A 2WJWA 3DBIA 4MR8B 3SG0A 4NQRA 4RY8A 3DZDA 4XASA 1LJUA 1DC7A 5TQ2A 3BILA 4F06A 3H5VA 4XXHA 2LIVA 3CTPA 3GBPA 4MYRA 4F3TA 2OENG 1K68A 1FFGA 1XWWA 2MSWA 3I5AA 4ZJPA 5FBKA 2LPMA 4N0QA 4YS6A 1NY5A 2GBPA 1USKA 1DZ3A 3CG4A 1ABEA 4EYGA 4HNSA 2A9OA 1Z16A 4CBVA 1PNRA 2PUGA 1W25A 1YS7A 3B2NA 4RKRA 3CNBA 1U04A 1K66A 5KQLA 4MS1A 1QP0A 4O1IA 4G0PA 3TX6A 4RXMA 4D6YA 4KMRA 4MRMB 4OG2A 4EY3A 3JVDA 3H5IA 4TLLB 1UDRA 4WXEA 3MQ4A 2MSLA 5DCLA 3GRCA 1F4VA 4OLAA 4RSMA 3C3MA 4LRQA 4QPJC 2CHEA 4D6XA 3BBLA 2FXIA 1JFTA 4KV7A 4LE0A 4OBBA 2JBAA 4DN6A 4S04A 4Z4HA 4Q6BA
chains in the Genus database with same CATH superfamily
1I3CA 2FR1A 2XYQA 1G0OA 3DKVA 4XYMA 4EQ6B 3MRTA 4GVXA 1KK1A 1NRJB 3EQ9A 4KPYA 3OZDA 5CH3A 3UMRA 1Y7IA 2GZMA 2IGTA 4RTSA 5JJCA 1WXHA 4IO0A 1CEYA 4RA6B 1ZXBA 1GQOA 3U5TA 1KZ1A 2V4MA 5BN4B 3X1KA 1YQTA 3UWOA 4EW1A 4JWTA 5HFAA 1WU7A 2XB9A 3C8ZA 4YASA 4GI2A 4UOZA 1NNEA 1RLJA 4LPSA 4I2NA 1AX9A 3Q8WA 1H6CA 4ZAFA 4GQAA 3JYOA 4AF6A 1ODIA 4MSUA 4CI9A 1YL5A 2OLKA 2ZQYA 3L8GA 5AW0A 3HUUA 1K8XB 1A9XA 2RHLA 1TTQB 1K9VF 4DLWA 3VR4D 1QQBA 4KUGA 2Y2UA 3IOBA 4BAGA 4WBNA 4RCYA 2PMFA 2VG8A 4KIUA 5FPQA 1JXOA 2OXIA 3NUZA 2XEDA 4OV6B 2DFKB 2Q6TA 3CRVA 5IHPA 1LA2A 1JEQA 3SCZA 2DETA 2HF8A 1IJKA 4LWZA 5FLYA 3W8DA 4EKIA 3WHPA 5ELXA 3EXG2 2R8XA 1DFGA 3EY9A 3KPUA 2X0NA 1YZHA 4FGWA 2JASA 4Y9DA 4CL3A 1E3LA 1DQRA 2I87A 4JLKA 4LOJA 2Y0PA 4LOKA 3SVTA 2F43B 1S2LA 2ODWA 1N6LA 3SMQA 2I3DA 1AHHA 3FWHA 5JSKA 3S8YA 2BP7A 1Z2DA 3NVDA 4REMA 3MBKA 4L5JA 2P3QA 3LXUX 1NTRA 2RHRA 1W2WB 2Q5OA 3GC6A 4IRXA 4J0QA 4V0OA 1Z7BA 3P2KA 4FGUA 1NW3A 2F62A 2H59A 1I7DA 1NYLA 3RR2A 1NYTA 4NPHA 2ZYWX 5DLEA 2AEEA 4DUZB 1TYCA 3PNKA 1Z0AA 1TIBA 1QG6A 3Q98A 2O19A 1WKCA 2AR7A 2NSLA 4NYMQ 1EXVA 5ADUS 5D5HA 3N8KA 4PGHA 3DMNA 2QMUA 3IDZA 1ISHA 3PC2A 4E5UA 5C7LO 4E5KA 3C7TA 2VH5R 4GPZA 1ORRA 1OYYA 1THTA 4IJVA 3UXEA 1E5DA 1U2DC 4J0FA 3JD4A 1SOAA 1NM5A 1UPTA 3N87A 3VC7A 3H16A 5L7WA 1XA0A 1P1HA 4AKIA 1ORHA 1H9BA 2QNRA 4TS4A 5K3AA 2Q46A 4N0DA 2JCXA 3IBSA 1ZU4A 1Z7WA 4OOEA 4XH9B 4ZVMA 4ESHA 3L8HA 4UU1A 1V41E 5AI6A 5HCNA 3T1OA 1Q5PA 1YFKA 1YS6A 4U2DA 3DAPA 5IVDA 4IZOA 3GZTB 5LXTA 4CF7A 1Z0ZA 1S9HA 5GIPE 1JR2A 1EWKA 2VQFB 3I8SA 2ZJ3A 3ZGNA 2CYAA 1L5SA 4KGDA 2VJNA 3HA5A 3B20A 4EO4A 5ESWA 4CM8A 5CM8B 4YX9A 4QWWA 1IXYA 1IU9A 2QMZA 2CLCX 2ATCA 4ZYYA 1KYTA 1BDJA 1XMPA 2CNKA 2HCFA 3C39A 4MI6A 2WFAA 2ZWMA 2UZIR 2IRWA 5BSRA 1S8NA 1KEEA 3BEDA 3KJFA 1M1UA 1JA9A 3H5LA 4LHEA 4MP8A 4BIIA 4XB1A 1H0HA 1U1GA 1ZU5A 5DNEA 3ZLUA 1CUUA 3P2MA 2WF5A 3D8RA 1T8UA 4JGIA 4BPBA 2Z6UA 3TIGA 2CE2X 4QQ8A 5E9WA 4D43A 3LZ6A 4DBVO 1QQTA 2AIRA 2YXPX 3CXUA 3QXHA 4MI9A 3HGMA 4KXVA 5ILGA 4DVJA 4GL2A 2HQRA 4QGGA 4R16A 1H2XA 2IWRA 2VDQB 2YYSA 1H85A 4QPNA 4II3A 3GLHA 2VDRB 3SZMA 3R5JA 4HDKB 4WBSA 1XDUA 1C9KA 3W2FA 4XCVA 3K6SB 1G98A 1Y1PA 2H1CA 3PUJA 2G4LA 4QTTB 1T4BA 5UKDA 1DWQA 1ZNZA 1Z6PA 3BS4A 5DGIA 5AK4A 3ZWAA 1YE8A 4J7UA 2P9GA 4LZPA 2JPDA 5LBIA 2HF9A 2PWYA 4K6OA 3T5CA 3QOWA 1NHWA 1YS2X 4M0DA 1AHIA 2AUNA 4C4XA 4MYTA 2MSKA 2YMLA 1SCQA 4Q48A 4Q82A 4RJIA 1K8RA 1GZ6A 5SYAA 1KDPA 3GNLA 2FZCA 4M8IA 3QQ5A 4ID9A 4A0GA 4UM9D 1C9MA 1RT9A 3KYIB 4MW9A 4HYEA 5ARDA 3HA7A 3ZGLA 2AG1A 3KEGA 5LQDA 1IZ9A 1RNLA 4RD3A 3E70C 1NRWA 2FOIA 5BSGA 1ODLA 1NF2A 2VHYA 4MQUA 2JFUA 5KOYA 3QLUA 3KOXA 3GELA 1UPCA 3JRNA 2CGEA 3N2YA 3C97A 2JIMA 4KFUA 1E3JA 2ADMA 2P1ZA 2I3GA 3IVXA 1DQYA 3PRYA 5D3MA 5K3BA 4HEJA 1DMRA 3UMSA 4P3PA 5BR7A 3NOQA 4H3HB 2GPBA 4CLDA 2RD2A 3B1FA 1YR8A 3S1AA 3W2EA 1PJZA 2J0VA 3HR4A 3L0DA 3OQ6A 4UTRA 1Y3HA 5FL3A 2ORWA 1SEPA 1YDEA 3O2SB 1ZOSA 3DWFA 4IY1A 3BDIA 1Q77A 4JJEA 3U62A 4BO3A 4TXHA 3CW8X 4C05A 2FLVA 5ALRA 3MGKA 4JB8A 1DJPA 4C3ZA 4A15A 3ICWA 3WIOA 3WIDA 3ZJ4A 2Q50A 3OM1A 5IJXA 3A9WA 4BLRA 4ZVSA 1R0XA 2EBFX 3D4NA 2GERA 2RIPA 3THYB 1LF5A 3D6AA 4FFOA 1VIMA 4RXUA 5CIYA 3ERCA 4TWAA 2GJSA 2HRBA 1NU6A 4UE2A 1Q7TA 4DM7A 5CA1F 1TYAE 1XZHA 3T1YB 2FEKA 1D1SA 1QR2A 3G89A 5DIZA 4MJXA 3EEYA 1GUDA 1OLXB 2RAFA 4ZV7A 4HDKA 3K6SA 4IV8A 4DGSA 1GNSA 1PGPA 3AY6A 1E6KA 4IP0A 3CJTA 4ZC1A 3R7SA 2OHHA 2M9MA 4F60A 1BQ3A 3FDXA 3VR4H 1GPDG 1SKYB 4QBFA 4KXYA 3BIFA 4ZOLA 4GZMA 1Y81A 1ZSNA 3RRJA 3GIWA 1TW2A 1OHHA 1SHJA 4KL8S 4RIGA 3BB1A 3LOUA 4Q3KA 5KOIA 4FNGA 4IUCS 1DUIA 5D00A 1HF3A 3FMIA 3L7KA 1MJHA 2OBMA 2X9QA 5C8ZA 1NIJA 1OI4A 2FSPA 1X3SA 5HF6A 4GOKA 4HH1A 2M6KA 4N9QA 4INZA 1LH0A 4O4JB 2QR3A 3JS5A 3IX7A 4IVNA 2ERCA 4RV9A 3PNVA 3UMFA 3WOHA 4QDTA 5FPPA 2EFCB 1QFXA 4URHA 4D0SA 5JAOA 2Z2XA 1M33A 3GYBA 2RGCA 3SIPA 5LOVA 4IIUA 1R6XA 3MWEB 4ZAZA 3UPUA 2BBOA 2ORED 4YRKA 1K6EA 4XSVA 4G25A 5LVAA 3IT2A 1KP2A 3I34X 5KIAA 5CH8A 4FD2A 2OM6A 3VZSA 1O96B 3DCYA 3G1TA 3KTFA 1JHRA 1SCBA 3VR3A 4PU0A 1WSBA 2VDJA 3D43A 3OUUA 1GN9A 1HDRA 4OB7A 4RV5A 4ESOA 5HNKA 2JFBA 2PX5A 1VBFA 2Y3IA 5F2OA 3CR7A 1UPFA 2P2YA 2O57A 1IZ8A 1QWOA 2J5RA 1P2TA 2TRSB 3IXMA 3OSZA 3ZXSA 2OHGA 5DTEA 3H9EO 3I39X 1XZFA 1C30B 4X65B 3PUWA 5I4IA 2IHJA 4KPFC 1GG8A 4MWSA 1YRWA 1NNUA 2QRVB 2YCLA 4KVGA 3UJBA 1CJKC 2C3YA 4R0MA 2VF2A 5GZ1A 1RXEA 4HH3C 4EB8A 2XHEA 3IKJA 2D5BA 4G6ZA 1KFBB 1F7VA 2HFJA 4CKZA 3THYA 2W0SA 1ECLA 5A0FA 1PEYA 4ABYA 2XLBA 5GONB 2W2LA 4UHEA 5DK6A 2C97A 4PG6A 2GS9A 2YS7A 3KUUA 4IJMA 2AB0A 3FOEC 5E9JA 1IXZA 1RWXA 5B36A 3ONDA 3VJKA 2YN0A 1RLUA 2QTAA 3G1UA 3OX4A 1DV2A 3NR2A 4KWIA 4WINA 5BYJA 4Z4QA 2R4QA 3JASB 3UXYA 3K7EA 4ZODA 3WY9A 5LKAA 5ADWA 1KL7A 4EJSC 3CNOA 1U9JA 4GGOA 2PX6A 3Q41A 2UVPA 5IAJA 3T99A 4EDHA 4N12A 5EIEA 3HV2A 1IDOA 3GRPA 3NHUA 1Z5PA 3PDUA 1G20B 2SICE 5IJAA 1DUVG 3OZ7A 2QGZA 3CSUA 1VL8A 4C7OA 2HU2A 1J8FA 4L4RA 1FP2A 5CGZA 5FDFA 2GTIA 5F1KA 2VXCA 2C7BA 1S2MA 1WOMA 1K4YA 3IOYA 1TF7A 2X41A 4FNMA 2CDAA 2JAWA 3OE7D 3UCEA 4B3JA 3PQ7A 9LDBA 3BE8A 4ZQIA 2XMRA 1O2DA 3VH3A 2HMYB 3OD1A 4JFRA 4PZPA 5HE8A 3JR7A 4MAAA 2CVZA 5EWLB 2ERXA 5KDLA 4AJIA 4NU0A 5B3AA 1VGQA 3PT9A 4YQEA 3HY3A 1H9CA 2D8MA 1D7AA 4J7AA 2B4AA 2JCBA 5DNCA 4HQKA 5LQNA 4U7DA 2EWVA 1RM4A 3CEMA 2Y68A 3G9ZA 4FOSA 5EN4A 5K6TA 3I4LA 2GZAA 1L1FA 3FMGA 1U31A 1GAJA 1DU4A 3IDAA 3KQSA 4LBZA 1NXXA 5CNIA 5G3ZA 2QRZA 3BH0A 3OPMA 2OECA 4FFRA 3KZNA 4ZI3A 4OBXA 1RWPA 3GRVA 4KXQA 3R7WB 2WMYA 3RYIB 3NBMA 3V1MA 2D1SA 1C30A 4EL5A 5EJAA 2C7OA 1NVVQ 1KC1A 4PQFA 3QELA 3BXPA 2VP6A 2C4WA 4WKBA 5F1YA 5KTPA 3Q40A 1RU3A 4ALLA 3AI3A 2IU4A 2YFYA 3WGZA 2CXHA 2B7LA 1MT0A 1XZEA 5GONA 3WBJA 2W9XA 1TEXA 1YZYA 1TKCA 1YR1A 2GH1A 2CD9A 3A4LA 1YCDA 1C3VA 2OBFA 2GN4A 3GGGA 3CGWA 2DBRA 4PM4A 1AT1A 5TMPA 1Y6FA 1X8LA 1W6UA 5DULA 1N6IA 2QXUA 5D2CA 1CY2A 2Q7XA 1LPPA 3TLJA 1PWHA 2E9SA 4ENSA 3BKWA 3G7SA 3B3JA 2IWHA 1D4OA 3EZ9A 1UBJS 3K15A 3JASA 4QBKA 3TIFA 2D74A 2DWOA 2FX5A 2K87A 3BL5A 3ORRA 4EVRA 4L8WB 2X2PA 1UJ6A 2Y0CA 5AXBA 4RK6A 1SD2A 4RD1A 3ZV6A 2UXBB 3HR7A 1XXLA 4KAFA 3AUKA 2A57A 2DHDA 3SXJA 2YQ4A 4NECA 2O8NA 5CW1A 1JWBB 4MLZA 1JIQA 4AJNA 2H1IA 1H0KA 1RC0A 2PUHA 4OUKX 2GEJA 3UW3A 3EVZA 3VPSA 3UG7A 5JOQA 3FAZA 2NYUA 4BX0A 4EUSA 2F90A 3MRVA 4XRGA 4HZIA 3B9QA 3DDOA 3JD0A 3M2PA 1IQUA 1X1AA 1EUQA 3M6IA 4HQNA 4E32A 2QTCA 4LNAA 1J7KA 2PZGA 2CDRA 2FPPB 1NKSA 2YNMD 5IDVA 3RAFC 4NEGA 2C4NA 3RG2A 1DHTA 1QIMA 2RGNC 1OXSC 4X20A 1CUCA 1ADBA 1OHHD 1X7WB 3IAHA 1WXDA 4I4TB 3ZTWA 1JJIA 1L6RA 1ZD3A 2YY7A 3R6WA 3ZE1B 2IYXA 3T4XA 1NDHA 4AO6A 2II6A 2A30A 1KEWA 4L4UA 2J9FB 1QS0A 1T2DA 2Y1LA 3TS1A 3U4QB 1B42A 1IWPB 3KB6A 1LW7A 1YDFA 2VPWA 2P0AA 4KFSA 1JFLA 5DYTA 8ATCA 2VO1A 4FFNA 3ZW7A 2RJNA 1YR7A 2P5UA 1J06A 4TSRA 4ZVUA 4QECA 3TLYA 1G8KA 2I4TA 3PEEA 3Q5EA 4IQGA 4N5NA 2F48A 3LL4A 1YZUA 4M6WB 5HOEA 1KZ7B 4B7ZA 4RCVA 2G1JA 2ATEA 1XPUA 3V3KA 4LJLA 3CKMA 4K7JA 3VR3D 4EHJA 5J1SB 1O9BA 1B8PA 4MGEA 3R3UA 1J7JA 1V95A 5KX5B 2NSHA 4GICA 4FE3A 3OIYA 5IBRA 5JSUA 2P7IA 3B3GA 2HDHA 2JHCA 3GGDA 1DIHA 4RJJA 2GM4A 2D4AA 2IYOA 4EWLA 3QUBA 3VBEA 1ENOA 4PVCA 3AF0A 3O8OA 3E9YA 1Q1NA 5AHOA 3WHLA 4WXHA 3ZY6A 3JQDA 2Z6QA 1PGQA 5F12A 1WUHS 1ZZEA 3KB8A 5FOXA 2WI8A 3MJTA 1GPBA 1F2TA 3HJHA 4EB6B 4ZJYA 4AYTA 1D2MA 1VSBA 3EUWA 3KLPX 3SHFA 1K8QA 3TBHA 2YVLA 4XXHA 3ELBA 2A1TS 2CLMB 4YAGA 4UVHA 2ZE6A 3PFHA 4JENA 1KI9A 3G2KA 3O4HA 1SBNE 2AXNA 1XWWA 3BA6A 2X8AA 4X8OA 5ALXA 1CDDA 3GCZA 1WCXA 2W2LD 3P9CA 3W2HA 1T8PA 2AJCA 4P7KA 3KKLA 4QUGA 1C9EA 1SZDA 3ESQA 5LBTA 1MR3F 2Z8XA 2XW6A 1W25A 4P3YA 4RKRA 4B43A 4F92B 2FPPA 3KHKA 1V4VA 3WWOA 2C7PA 5FTWA 1ACLA 4PSKA 4C3UA 2JGKA 1AO3A 1X7WA 2VPXA 3PWTA 1IY2A 3Q0EA 1BHO1 3WGYA 2QX8A 1V5WA 4IDCA 2DPMA 2WWWA 1OFVA 1PIWA 3BCUA 3KX2A 2ZBQA 1QHHB 1ULAA 1D4AA 3R76A 4IGFA 3PK0A 3TLGB 1WX1A 1L9XA 1RD4A 4DQVA 5BNWA 1O57A 3D64A 3I4CA 4PAWA 4LGVA 4GZ3A 4W63A 4TLBA 3VPCA 3STVA 2G5CA 1NNLA 3G5TA 4RD6A 4YV7A 2JNWA 4Q1FA 4JI3B 3PHLA 2FR0A 3W5IA 1QLHA 2O3SA 4BQEA 2OE2A 1ZVJA 1Y1TA 4LBYA 4CFZA 1IPFA 1VKOA 2ZBVA 2GZ3A 3L7NA 4MA5A 3EHDA 3PA8A 3WFIA 5JS8A 3SE0A 2VDUE 4NYJQ 2JL1A 521PA 4U9IS 1SK8A 3WGUA 2XZOA 2R85A 2X9VA 3PG5A 3C3JA 1GT91 1ISSA 2H5JA 3GY0A 4O33A 4RANA 3L41A 3MJHA 4AY3A 3NJ8A 4A6EA 2MOKA 4D3XA 1L4FA 4G0QA 3BMCB 4OMFG 2Y71A 1ECJA 1Q0SA 1QO0A 4GPTA 3I45A 4JELA 4R2LA 4IHQA 3MTAA 1R15A 5KTYA 5DLQC 2AT1A 4WL0A 5HE9A 4MDYA 2B7CA 3HCFA 1NBMA 2J09A 4N6OA 4ESVA 2YIDA 3AO0B 3VU1A 3ETEA 3GGSA 4H6XA 4PQGA 4EB6A 4M0KA 2OT3B 7REQB 4CKCB 1Z0DA 1MAUA 2OV2A 3P71T 3ZX4A 3QE9Y 1MTOA 5AJWA 1R4AA 3EMKA 4NAHA 6CHYA 1T0BA 1NUQA 2ZJ1A 3FTDA 5FHRA 1PR1A 3EF0A 3OZTA 2ZQZA 3DB1A 1WULS 2ECFA 4BKMA 3JQ9C 1H2AS 1C2YA 5BV2P 4B9EA 1UK8A 2JIRA 4C22A 5JARA 3NBXX 2VDWA 1AB6A 1GQFA 4CT5A 2DKFA 1AKRA 3L77A 3IUYA 3M3DA 3RVBA 5A9RA 1SNYA 4BB5A 4C0HA 1D1QA 2FZ4A 3KLMX 5BVHB 5MN4A 2UZ0A 3GEPA 2R1VB 4QXPA 1WHTA 5LP1A 3NGLA 3TLGA 4K6KA 2FDXA 1QHHA 3M81A 2ZU0C 4BLUA 4EYGA 2H9YA 4MVYA 3LUAA 4NFYA 3RHSA 1MJGA 1CUXA 2VNSA 3ZVNA 4BMXA 4ZZ1A 1DBSA 2FUKA 4CMEC 1AGNA 4M0UA 2C0PA 3CZQA 3E8XA 4KBGA 2WIFA 3V4LA 1YKSA 3QXCA 4IBOA 2AFIA 2ZP1A 2V7XA 4QSHA 1ZAYA 1AXGA 3L8FA 4RQTA 1RLIA 3DFIA 4B75A 2DQ4A 1PS9A 2YASA 1D2EA 1PHPA 5IAKA 4J3NA 4G0YA 5AM3A 4C4AA 2UXCB 3MS2A 5EZQA 4BV2A 2DQKA 3GIDA 3RAPR 2NG1A 3QWIA 4KLNA 5TDHA 5AK3A 1L3BA 5ALEA 3FFTA 3K70B 2CHUA 2XGSA 1PD1A 5EJ5A 1HZZC 4HQFA 2XRYA 3IV6A 1MZVA 1TFUA 5F9MA 1Y7HA 4X7RA 2I7XA 3FSRA 3MPOA 4NNPA 1T5OA 3RC3A 3SEZA 5JBNA 4X7BA 1GPAA 3AG6A 1BE1A 3NQ41 4I1YA 5DNDA 2BH2A 1K6JA 4LXHA 2JLUA 5FB3A 4RFSB 3E4CA 2IY7A 3PVCA 4W9RA 2N47A 3O83A 1QNLA 3WBBA 1JB1A 1PZGA 2C5LA 2HI0A 2JARA 2FPKA 3DMHA 4O2BB 1CIVA 4HH4A 5C34B 4EKDA 2DFTA 5AQ1A 5KOJB 1NWCA 1GG5A 2PH5A 2WT4A 3T7CA 2EG9A 4CDRA 1EJ6A 4DCTA 1XTJA 3KSZO 4GUDA 2VQ3A 4OHCA 3JVIA 1FP4B 4CDMA 1C9YA 4B3IA 2OB2A 4GM1A 1U3FA 1KH2A 3HN6A 2WW8A 3HPQA 1LU9A 3R40A 4N6NA 1SUIA 3FVTA 4D4GA 4OAQA 5K3SA 3G2PA 3V6LA 9LDTA 1OPRA 4L3WA 1IB6A 4CG0A 3BICA 3E53A 1OBHA 4UFPA 3LY5A 4KK4A 4MW4A 5BVHA 4G56A 3QYAA 2R1VA 5C8DA 2ZJBA 2NXJA 4D7AA 1K3UB 1RAEA 1WZ2A 2QPLA 3E0XA 2WK1A 4X61A 4MS3B 4WSOA 1EX7A 2DBQA 2F59A 4BP9A 1VP9A 1GRVA 1W46A 3E7WA 3BMOB 3LH5A 1A9TA 1QP8A 1X80B 4HJRA 4WADA 4BL5A 3FOWA 1AQIA 1XDWA 4YJ3F 2OMEA 3B12A 3ZDYB 2DJIA 4ZIRB 2MHCA 5EA2A 3Q3IA 4QARA 3HVJA 2Q9BA 4HLQB 3CSSA 3U9TA 4L50A 3PYMA 2FGJA 5CT4A 1E9AA 3FPGA 2D2VA 1GPWB 3HPRA 4KR9A 2Q1XA 1SVKA 3P5SA 4JBNA 2O3QA 3TFWA 1UJ5A 1RXUA 3U44A 2Y66A 2PZMA 4QOHA 2CXXA 3O82A 3UT0A 7MHTA 1QOQB 1ZGZA 2E85A 4C0BA 2XD4A 1K5PA 1I9CA 2PIAA 1FF9A 2X76A 2W6CX 3NV7A 3FMPB 3TNYA 5BQFA 3RFCA 1WETA 1LBHA 1W85A 3WLFA 7AT1A 1MO4A 3KWMA 4Z7OB 2GF9A 1HL3A 1IE3A 2R8BA 2AVDA 3A6EA 3IE1A 1JYEA 4L27A 5A71A 1HDYA 1RS0A 5A5GA 4C87A 1MKYA 4YEDA 1UDAA 2KX7A 4ZYWA 4EG5A 4R1SA 1M2VB 1EP9A 1IHYA 1PDVA 1MJFA 4IIDA 2FW9A 3KB1A 5CPBA 4YIKA 1KJ8A 4XI9A 2Z1MA 1XTUA 1ISMA 1B3RA 5ALOA 1XZLA 2X9NA 4ZANA 1IOLA 1PFGA 3CURA 3GRAA 4X54A 3TE6A 3EPRA 2XOEA 4PIMA 5AK0A 1RMYA 2HHLA 4C06A 2Z5LA 3DOOA 4KNYA 4MITA 2V7VA 4DE5A 1RHUA 3I9LA 1IPEA 1I9GA 5CVEA 5IM5A 4ZZIA 1GTL1 1WPQA 2EBHX 2IZOA 3AVQA 5C80A 1O5TA 1SUPA 1V3TA 1MQ9A 1ZWKA 2XEXA 2EIXA 2OLEA 4IXWA 1WCIA 2O7NA 2ZBUA 4EHDA 2RE8A 2VWPA 2ZWAA 1Z83A 3UWDA 3USZA 2W4QA 3TW4A 3L40A 1D5WA 2KJQA 3EXIA 4QELA 5AW3A 3BVPA 1NQUA 3HJNA 3MEQA 2FEOA 4YAUA 3WL8A 3CLRC 4OXIA 5GPBA 2C7QA 5JCZA 4G0NA 3CUWA 3LC1O 3GJZA 3P20A 3GP5A 4CG2A 2L69A 4E2YA 4LQLA 4FWTA 1I2BA 2YY6A 3BHNA 1OC4A 3IJPA 1P7YA 2PGAA 5FCDA 3X2SA 4QZVA 1P1BA 3KAPA 1NOIA 3TL2A 4R8RA 3T9AA 1UKCA 4FR5A 1ZFNA 1ELOA 4CIWA 3ZW8A 1M3SA 1U8UA 1QJCA 1LSJA 1GNTA 1GG9A 1CE8B 2JVKA 1D7OA 4JIGA 1GR0A 4YY3B 4R5HA 5CB0A 4AUMA 3E03A 4NZ9A 2EZTA 3RU2A 1CRZA 3DV0B 4K6FA 4XIIA 4YYZA 2GA8A 3AQIA 4MUIA 1N8NA 3B1KA 3IS3A 4JLAA 4M0FA 1E9FA 1EUCA 1JG7A 3P45A 3KSUA 3KB2A 3LDUA 1MIHA 2D5IA 3CHYA 3GYGA 4FLFA 5IT4A 3IT0A 4K6CA 2RBGA 1TJ5A 2VKTA 1Q11A 4TKMA 1OH7A 3CJQA 1M2VA 3HU3A 3P0RA 5IFLA 4WLOA 1UDCA 5M2QA 1FQJA 3EGVA 4WTOA 4D80A 1RRCA 2V6IA 3PWZA 4K2AA 4F4DA 2VK2A 2ENUA 3K9HA 1RWMA 4BNDB 1AS3A 2JFVA 1PAUA 1U81A 1YQEA 2CDCA 3LQRA 3MTDA 4LZJA 4FDTA 5DP1A 3UB2A 1GADO 2DKOA 1G1MA 2IYWA 4GR9A 1NW5A 2Y92A 4X1KA 4DMHA 2IH2A 3STXA 1J0AA 2CMDA 3NTUA 5EEGA 5I9TA 4BO0A 4Z99A 4LSWA 4Q47A 5HZMA 5AOVA 3CX8A 4RWEA 2JLSA 5EZ5A 2XI4A 5DT9A 1VC2A 4XYLA 1N2BA 3N5KA 2FB9A 4GPEA 4QVIA 1GTZA 4N3AA 2XBLA 4WZBB 13PKA 4HPXB 1L5ZA 1X77A 4OQNA 1Q1ZA 2CZCA 5C1OA 1M5RA 4XIYA 2A7XA 3GD5A 2CUKA 2NU6A 4NI5A 3IB6A 1RM0A 2O7SA 1KI1A 2HIAA 2OORA 2XY4A 3B9RA 1Z4NA 3C45A 3OOYA 5CYPA 3ROTA 4M55A 4QNMA 4EBBA 5BW8A 2VT3A 2XRZA 1V47A 2WB2A 2QSZA 4UBLA 1GGNA 5GJBA 1JILA 1L5OA 2I7DA 4H0NA 3WKEA 1EZ1A 2OG2A 5JZVA 2WABA 1Q20A 4RZQA 1ZKDA 3GB9A 3NTXA 4HWKA 1LDBA 1CE8A 1JAIA 4WK2B 3SJAA 2FV8A 2I2XB 1U0JA 1E1YA 2VSOA 4TL8A 4DBLE 5IKOA 1KS2A 3UHPA 3F8WA 3T3MB 2X19A 3DOJA 3DZBA 3DV0A 1YJBA 2J33A 4KR0A 3ZTTA 3TZKA 2DSTA 1LW6E 1Q1GA 4R7GA 4LJ8A 2O2XA 3SBXA 5E1MA 2P9HA 2EBUA 1JDVA 4RD4A 4AY4A 3N8NA 3QEAZ 3RS4A 3VNAA 3VPFA 2HXSA 1YA6A 4Q4JA 3GN2A 2PANA 4G5QA 3C87A 1SXJB 5FNVB 3J80A 1JIJA 3GO4A 1WKVA 4D42A 3EA0A 3GLRA 1YULA 1RM5A 2GHRA 2CEAA 3K5WA 5THQA 5LU9A 2YWXA 1VPWA 3ZGZA 3ITNA 3OZWA 2WKRA 1AN9A 1W76A 2VF5X 1XRJA 1XVLA 1N0HA 5J2UB 4F71A 1ZUIA 2ZFUA 4RPJA 5EINA 2NUBA 5F5XA 1OLOA 3R6DA 1EFRA 3TVTA 1SRQA 3BTVA 3HCOA 4NXMB 2ZRDA 3MT9A 3L92A 4PY2A 2HMUA 5CX1A 1F1JA 3NPMA 4BUJA 4Z4FA 3LF2A 3SC2A 1SVNA 3PXAA 5KSPA 4ALKA 4KQ9A 1BGWA 5JQGA 4AY2A 2I8CA 1G2IA 1OWLA 1YHNA 4FOOA 3T34A 1L7OA 5IARA 1WKBA 4OP2A 4K8RB 4R9RA 3EYAA 1JQ3A 5IYZA 2RC5A 1PU2A 1J21A 3CNHA 1JLKA 2R8PA 3IIKA 4K87A 4M21A 3HYTA 5EG5A 5REQB 4B4UA 4CIXA 3QITA 5J4HA 2GD6A 2XDQB 3D7NA 1OGJA 1J09A 1YBAA 2QG4A 4HNTA 1DC8A 2HTFA 1QLWA 4HCJA 4D99A 3I8XA 4UDOA 3RCBA 1T6NA 3IPYA 1PTKA 3OZIA 5HTKA 1U3TA 3SLGA 1RXWA 2WM8A 2XB4A 3STWA 2CHFA 4DXHA 1P75A 5JD5A 3DLBA 3DT8A 1JZQA 2RKBA 2QRQA 2R11A 2DUNA 3N0WA 1F6DA 3PKZA 4LYJA 3ZDCA 5C9ZA 3N0XA 3O0DA 3VM6A 2ZETA 3H1EA 4II2A 2JFXA 1RPZA 2HWUA 3NVAA 5HZKA 1GKKA 3WGHA 5JY6A 5FOUA 4AJJA 3I6BA 2C2WA 3QENA 1MQ8B 2IYTA 1J4AA 4NONA 2RHMA 121PA 2BGRA 1EFCA 5GOTA 2CC2A 1XLUA 3RQSA 3M6XA 4AO7A 3I6MA 3IVRA 5HQ3B 2XVYA 1F6WA 1O94A 2V7BA 4G4JA 4H4CA 1SXJA 3I1JA 4QVGA 4DF3A 1I7QB 4UHFA 1RYYA 2E1RA 1JE0A 1CQZA 2VF7A 1YQUA 3OIVA 4OGGA 2IU6A 2B8JA 1NXSA 3H5WA 1HE3A 1K8YB 1TTPB 4B2IA 1UPAA 4TMZA 2WFZA 4CQMB 3NDBB 3O38A 3AIOA 2BMDA 2V7UA 4BVBA 2FETA 1W49A 4XWTA 3IUBA 5KJ6A 2A59A 3HN7A 4D57A 1F0PA 4JXKA 1J0XO 2OSBA 2XOXA 1BMTA 3DVSX 1FYFA 1O95C 1BRTA 4D9GA 4MVJI 3T94A 1V8OA 4V39A 3NCTA 3O8LA 1JPUA 1SIBE 1DO8A 1RDFA 3LVBA 5KNDA 2XA2A 4XPZA 3SSMA 2IF2A 3LBNA 3I9JA 1U2TA 4LECA 1SIWA 3QUCA 2Y1XA 1P5RA 1B3BA 2FSUA 3GXBA 3ZOZA 3EBOA 2XDQA 4F3TA 1TM4E 2BR4A 2ZBDA 4XYBA 4FEGA 5EYPA 3MUOA 5EQTA 4DR2B 5B7GA 4B6GA 4N18A 1BG6A 1AK1A 1XEAA 4MWZA 2GESA 3C6BA 2CL5A 4RHUA 2OZEA 5JDCA 3DD1A 1FX0A 3LBAA 4EFLA 1KQFA 3WYDA 4YPVA 2E1PA 4U8GA 4F7WA 2G83A 4ROTA 2PWAA 3II6X 3N0TA 2ZUCA 1XVVA 5FPHA 3BBPA 4MS1A 4EA7A 1UM9A 4O1IA 3TX6A 2W2TA 2ALJA 2JEYA 3PC8A 4LTNA 3H1AA 4QOGA 3TIXB 3O95A 3O8QB 2PGIA 4JR0A 2GA9A 4GM4A 2M6LA 5I7OA 2WDPA 4M1OA 3KT6A 1HR0B 1EWQA 1QR6A 4HB0A 1NQTA 4KV7A 2QGFA 4KB5A 4EHKA 4FYYA 2VSYA 1SKYE 1V71A 4IF6A 3FJOA 4K9PA 3B8EA 3AI2A 4RZUA 2YS6A 2DQSA 1XLTC 3PEWA 2W90A 4Q3OA 4ONEA 5TT1A 2EEZA 1M6NA 3BB3A 3P0FA 1WD7A 5TJ9A 4YALA 4FGJA 3T3NA 1JGTA 1AZLA 2ONZA 3DP9A 3G2IA 4YT4A 3HEAA 4I50F 4I1RA 4K3UA 4Q7JB 4ZARA 3DTNA 3NHRA 1IFXA 4A9AA 5CDYA 4IX1A 3PPVA 2NOAA 2V59A 4OLFA 4CQNA 1XZDA 1XVTA 3LBIA 2IHVA 1X38A 1H0RA 1QDEA 4DDHA 4NBRA 2PGDA 4P1ZA 4OYRA 3W1EA 1PE0A 3OQHA 4KGZA 4Q3EA 2J3HA 2XAAA 4K3VA 2UYOA 3WB9A 2VP5A 4F1KA 1GAWA 3A9VA 2D5CA 5KQPA 4MLPA 1YB4A 2VPPA 3FUTA 3UFXB 2ZTMA 3VC2A 4ZO8A 1RYNA 1G5PA 3AETB 5JXJA 3PNYA 1FFAA 2FPLA 1U90A 1FP7A 1OI3A 2AH5A 2RGEA 1W52X 3FYUC 3ZDQA 1I4OA 4LI0A 2GYVA 2Y67A 5IDQA 1S2NA 1A0OA 2ZB4A 7YASA 5EHXA 3S2ZA 1Z4KA 3WA6A 5LQJA 4CHGA 2ZWPA 2C7GA 3L0SA 4JVSB 1ONOA 1RKBA 1M54A 1XMJA 4WEOA 4F8YA 3NP9A 3TXAA 3T9DA 1QPBA 3QPCA 3RRFA 3GN1A 4B3SB 4BNFA 5LQCA 1UDBA 3RBAA 2I6UA 2PG3A 4AQYB 1EFRD 4YROA 4TROA 2CSUA 3O31A 1L5RA 1CB0A 4PLYA 2J1LA 3WAKA 5KEIA 1EDEA 2R6AA 3AHJA 5D8DA 1N5MA 2WSLA 3QUAA 2F3PA 4UTZA 3E82A 4MV8A 2ZYSA 4RHXA 4NYMR 4KQJA 4P36A 2VNKA 1C1HA 3T52A 4ALMA 2P2ZA 4MO9A 5EIAA 3ZE9A 2JLQA 5B7NA 3C16C 4H1HA 4K9SA 3H2YA 4DTCA 2V4UA 3ASVA 4MPPA 3QFCA 1ZSVA 2X13A 4TKUB 1YUMA 2PH1A 3NGMA 4BQPA 3HDHA 4XPIB 4EF5A 3R9WA 4JAVC 3D0RA 3G6WA 1WBDA 1CEEA 1NW9B 2J8ZA 1SBYA 3C1TA 1CRLA 1JU9A 3OTGA 2ZUDA 2Y6UA 4HDQB 1G21B 2DUMA 1KAEA 3VHRA 2DP4E 4A1FA 5KOHB 5ELLA 1OILA 2C82A 4DLZA 1EFUA 2NSJA 2QAIA 1RKXA 3CJRA 4P7FA 1G20E 4BTEA 3OOHA 3VKFA 4MHTA 3AVTA 4R9VA 4BEBA 2IYLD 3VNUA 3TBKA 3IBGA 3DOUA 1ZRMA 4ARIA 2ANBA 4Y98A 3HV0A 5DK4A 4LYAA 4TSFA 4ZU1X 2I6FA 1JNYA 5EXEA 2B2XA 4ZN6A 2PLFA 3SIXA 2HB6A 3OLWA 2VC2B 4ZCTA 4EYEA 4CZ2A 3FA2A 2Y0DA 4H15A 5LJIA 1ORVA 2H1FA 3PIDA 4CIAA 1OZ0A 4Y6GB 4AUKA 3OPNA 5DW0A 1TA9A 4FYKA 2AG8A 3AB7A 3T5GA 4B3GA 2PLWA 4ML3A 3AETA 2J4FA 3ZU3A 4D4KA 3N1UA 4M36A 5IG2A 1O94D 3UJ6A 3I9OA 1SXJD 4P4TA 3ZXYA 5AVUA 1XCLA 2CMHA 1TCCA 4XCQA 3SIWA 2OWEA 1DKRA 1ODFA 1L8LA 4HDSB 5AJHA 1L5KA 2GF2A 4BQNA 4XLTA 4EK9A 3ND6A 1E7YA 1X8KA 3PWKA 5F7JA 2CJYA 4A82A 3CH6A 1IMOA 4I6EA 3QU2A 4G81A 2P9FA 2C0CA 2UUPA 4BVKA 4UE3S 2ZULA 3EMVA 4FYXA 2Z8YM 3DBVO 4YRTA 5EGNA 4E5PA 3H42B 2PN1A 4TLMB 3R3JA 3V8RA 4ARAA 3VDNB 2PY6A 1N8KA 1NQVA 1QH9A 3K0AB 2FMXA 4BS9A 5KNDD 3NTQA 2H4WA 3NVMB 1GRQA 4RLHA 4W99A 2VJCA 3C7CB 4R1TA 4QWMA 4DPLA 1QH8A 2BSQA 3G8DA 2X0IA 3OKPA 1DKUA 2VFAA 1HFKA 3PX2A 4P9NA 4RF3A 5K0LA 3DL4A 4ZTZB 2IHUA 2QTTA 3F98A 1AK2A 4MKIA 4PX9A 3V1YA 2ECKA 4EENA 4LJ6A 4M7OA 3VZQA 1DELA 2WB4A 4RH0A 3NHFA 3ZNOA 2IK8A 2VRNA 2XMZA 4URVR 2ZBGA 4YI5A 1G21A 1QMGA 4PHGA 3UIEA 3EEQA 1QSGA 5E0OA 3TQHA 1W581 4M83A 2G77B 3IBFA 4WN9B 5E3HA 1BMFD 1K7FB 1VFNA 4G0UA 3VC1A 2NLOA 5AICA 1ZW1A 4KZPA 4WACA 4IIJF 3RJZA 3ZNQA 2QE7A 2PX4A 2ZW9A 3E61A 2QW0X 2HRRA 3QVJA 4UASA 2NO4A 5KAMA 5CT8A 1K7CA 1G42A 1QC5B 1ZK4A 2C2MA 5E3IA 5FUQA 2Z4SA 2JRLA 2R65A 1K06A 4OFXA 5CT6A 3OWHA 2RIRA 1P7VA 3B1WA 4QEZA 5TVKA 4PNPA 2H08A 2BAGA 3OZBA 3REGA 2IS2A 2RG7A 3HUTA 1H93A 4V1CA 3K9WA 1LPAB 1B74A 2CJXA 3VX3A 2GRUA 2O5EA 1SCKA 3HUEA 1KK2A 4GMKA 3VYVA 1SB8A 1DBRA 3Q11A 2PCJA 5I3ZA 1O89A 1QP7A 4KXFB 1V8DA 3GPIA 2BFCB 4KVFA 1T5DX 2BHTA 3HHEA 1V7CA 2QD3A 3Q7RA 4MV9A 4RMIA 2IIVA 3U3MA 3CIFA 4BN0A 2DHQA 3LX5A 1M2EA 4Q34A 2YUTA 2I29A 3EZNA 3H13A 1AB5A 1JG1A 5FLEX 2C2HA 1QRSA 1JDJA 1TF2A 3S5JA 4BAUA 1HDOA 3GDFA 3QIVA 2Y99A 1Q57A 4MUYA 2P6RA 2GZ2A 2O6HA 3H8SA 1M1YB 2PS9A 1Z56C 1ZD1A 2KLBA 1J42A 1EGQA 1Y9DA 1BAPA 2CXTA 4IS2A 1RMTA 4ACBA 4ENQA 4A92A 1SCAA 3K0AA 1B8NA 1VHQA 1KI6A 3HCNA 3GEBA 2N9UA 4WA7A 5CLQA 5EMKA 4URZR 2ZREA 1KDTA 5DWDA 2BBSA 3PICA 1GZHB 1TK3A 5E6SA 2GM3A 3A4IA 3AFHA 4KODA 4XA8A 2JJ8A 3L8EA 4B4DA 1ZCZA 3IBCA 1TM7E 1AOXA 4ZICA 1RWOA 3HCEA 5J4VA 1VE5A 1NBME 3ZPXA 4Q00A 1P44A 2WD8A 3NAZA 3V8PA 1FNNA 3RO7A 2NAFA 4RK1A 3QF4B 1N2EA 3ZZUA 1F2UA 5KCZA 5AOAA 1FRZA 1CJVC 4RDXA 3PE4A 3NW9A 4H0CA 3CUUA 4JI7B 2WJ6A 1AXRA 3O3NB 4B7CA 4B74A 1VJDA 1L8AA 5BYBA 1QC5A 2Z57A 2FFRA 4O02B 3I37X 1M6VB 1RYMA 4NRDA 4NX2A 4JX9A 1RPNA 2J9XB 1PSWA 4I8DA 1ZIYA 4DQKA 3UH1A 4JA2A 1SUBA 2EU8A 4IIVA 4IQ0A 5BQ3A 5E38A 1SWVA 5BW6B 1YJCA 2OCDA 1G16A 1EAMA 1SPXA 3TLKA 4HB3A 3A6JA 3ZV3A 1F4PA 1G6Q1 1OR8A 5KVAA 4QFMA 2Q0XA 3PJDA 1F6BA 2CHGA 2F00A 1PV2A 2WTNA 3WSVA 4CI0B 2J5QA 3LLCA 2AQ8A 3LQFA 4MMYB 2XIJA 4OMDA 4OTZA 1QRUA 1ESZA 2QD2A 2VBIA 1XHEA 5H8WA 1R9JA 2FP3A 4NHOA 4WKOA 1G8JA 1Q0RA 1NMZA 2GK4A 2OMKA 3AFIA 3M1YA 4OUDB 4X3OA 2NSYA 4D41A 1Y4SA 4YCJA 1DEOA 4TSFD 1VPEA 2KMLA 2QJTA 4H1VA 5JE8A 4LIPD 4CV0A 2IU3A 1HEYA 2PGLA 3MTQA 2XCSB 4QJBA 1DWOA 3DR3A 3DKPA 2AC2A 2LR0A 2VUTA 1M1YA 2QROA 3I9V1 1DG1G 1K86A 4PFSA 1F60A 4YRFA 3OUZA 1XHFA 3GFRA 5E6UA 2O4CA 4MVJE 4NJEB 6AT1A 5E1OA 3B78A 3E9RA 3QPWA 5MGNA 1C1DB 1ZD9A 1NXTA 5EESA 3CEAA 3TD2A 4QJ3A 5A4AA 1Q0LA 1OXXK 5L7YA 1B6GA 3SVZA 5L4SA 1V2HE 4AU1A 4CM1A 3BE6A 1P0IA 2NQ2C 1NG1A 3FNBA 4R81A 2IELA 2G63A 4XYGA 1APBA 4BBAA 1VDMA 3AR8A 4W9NC 2W70A 2Z8ZA 2WSMA 4RZSA 1Q2XA 1SA0B 4B3MB 1UDXA 2AWOA 2H4XA 4EDFA 5ALLA 1GNVA 1DAMA 3WBKA 3WKCA 3G85A 5H4GA 4M76B 2ZROA 4DMRA 3BJZA 3PRHA 5KNDH 5KTOA 1M6VA 3KZMA 3RBZA 3RVJA 4MUBA 3QBEA 5ITSA 4WVFA 2H3HA 5ESDA 3OSUA 1OWMA 1UQUA 3IUQA 4WUTA 4OX9B 2B36A 3K9LA 2JGDB 2YDYA 3FF1A 4JHXA 3M49A 1OBVA 2RH9B 5FFNA 5SICE 3CX6A 2ZRAA 2CBGA 2B5WA 1M7GA 3PSHA 2GGSA 1FZQA 1YCFA 4EHBA 4U9HS 1NXOA 4WLUA 3UOWA 1YMVA 1NVVR 1WY5A 1J2UA 1J0CA 3EMDA 3S27A 3HNPA 4QRHA 4ERNA 2X1VA 3CUVA 3IILA 5IT5A 4DQDA 1M1XB 2NQ8A 2QE7D 4D3YA 3D4IA 4DARA 4DV0B 1VMDA 2I1LA 3M1IA 4YO7A 5FNZA 5I5GA 4DM3A 3MHTA 4MUXA 5E7IA 3OLQA 4KWEA 3VTFA 5ICEA 3EFOB 2VSXA 1LPOA 3WDMA 3ZJTA 1M8GA 3BJEA 2IKQA 4MQBA 2C29D 4RYLA 4OQFA 3ZNNA 1CJBA 4JUDX 3GCWA 2NO5A 4JP3A 4Z0TA 3KKPA 4F9TA 5K8UA 3UAGA 2V4ZA 2CJPA 3E3AA 1OX6A 2Z3VA 1ODCA 3RT9A 1Z5WA 2B1IA 3W4IA 1QF9A 1XC7A 1Y8AA 3CYFA 3E3MA 4MGIR 4IDEA 3A4YA 4OBWA 3JTMA 2R6GA 1XA3A 4KWTA 4TT8A 1X19A 2FPOA 4LG1A 1C7EA 2VUIB 1U5BB 4MJ7A 4YMHA 1N6HA 2Q8NA 1IXKA 2FWPA 4WOJA 3K1YA 5DB4A 2VJYA 3GH1A 1OUMA 1SA0A 1PD0A 2Z6AA 2B78A 3WTCA 2NIPA 1KMNA 3FUUA 5G4KB 2C4KA 2WMOB 4IFIA 4WMLA 3ZZ0A 2HK6A 3I2KA 1ECPA 3NAGA 4Y2VA 4J75A 5A06A 2XKBA 4TTRA 2I54A 2REOA 4R2HA 1MDFA 3ZWNA 4JI6B 3PXDA 4DREA 3OQPA 4DRZA 1TT5B 3KNZA 2XV1A 3BQ9A 1HL7A 3EBLA 1Y1SA 1BXRA 2D5LA 1JSLA 5ERXA 3I0ZA 5AKGA 4CKBB 5EJGA 2CXUA 3NCHA 4AN1A 4DVGA 2F2TA 4BX2A 1GTSA 4WGFA 1KZGB 4ASUA 1HYEA 3KC2A 5A9SB 4JLJA 4LHXA 4YAFA 4ZYVA 3LUHA 4ZYUA 5DM0A 4AKTA 1GGMA 2LIPA 1FPQA 2XGMA 4JJFA 2VP3A 3S4YA 2IHNA 4JJKA 3H5OA 1PYGA 2GASA 2Q6KA 3MFQA 3TNLA 5L3SA 2Z5FA 1C50A 1DLJA 1FTGA 3GLIB 3V7WA 5CB4B 4DV6B 4M37A 3FOCA 5ICCA 5F3RA 4LXIA 3TQFA 3EPJA 1RWNA 2WIDA 3L6CA 4EABA 2QVZX 4BV8A 3RSCA 4Q1BA 2PH3A 4RS4A 5KJCA 3FPHA 3VH4A 4C0SA 2BEWA 3E9MA 4DOMA 2HL6A 4D25A 2Q0SA 1XRMA 3LC0A 3JPYA 3JWHA 5BXYA 4R69A 1XV5A 1TUBA 1KFCB 2NPFA 4ER0A 5B1YA 3OF5A 1MW9X 5TEWA 1KQOA 4BMNA 1JZSA 2B4QA 2OGSA 3AXSA 3BILA 2RB4A 3FPBA 3RS0A 4PSVA 1YL6A 1LNSA 1Z6YA 4CF4A 3E35A 4D1YA 4ENPA 3CTPA 5F3WB 1V39A 2RK3A 2UZ1A 4Y30A 2EF0A 2R6HA 2FEXA 1SULA 4P6VF 1JI3A 4RFVA 4YP0A 1CUWA 1GXSB 2EKZA 3HGQA 1U5BA 3ND5A 1I6WA 1E2HA 1T5TA 3G0CA 3LUBA 1Z5UA 2ACEA 3E9CA 1Y7TA 1XEWX 4YAWA 3UBTA 1Y8ZA 3GUHA 2WIJA 5K3FB 1FBNA 2OQVA 2RBKA 3AUJB 4WCDA 2WYWA 4YPFA 1OFTA 3I58A 1UIMA 3PNOA 5CJ2A 5JQWA 3EDRA 1E4VA 1IRXA 2GETA 3ON5A 3NRCA 2ZCUA 4FR0A 1R37A 4YRNA 2FP4B 2OO5A 4YDRA 3PDIA 3QHAA 2VQ6A 3X2FA 4ETWA 2KI5A 3LFHA 4CKBA 2H18A 1XZPA 2FXIA 4G9EA 2VHCA 1Z2NX 1AQUA 1EGMB 4OQZA 4PG4A 4QJIA 3RASA 1J90A 1E5VA 1CLEA 2BE7A 3OZUA 3A9UA 4S04A 5A9SA 1XRSB 4HRVA 2X5NA 4JYMA 2JCYA 2QYSA 2WIKA 3BOSA 3C8DA 3O3MB 3W9BA 5L53A 3GRUA 3I01A 1OROA 3QV1A 4K9NA 4KYVA 4TVKA 3FHLA 4W1RA 4GSKA 2OXTA 5DHTA 1ZVQA 3GFFA 3SSNA 1R27A 2XYVA 4EUNA 3IQXA 1SVLA 4BJ3A 4ERXA 1NKTA 1D2HA 1P6QA 2RGXA 4LNUA 2PMKA 4BFWA 2V7WA 4F2PA 5BYKA 4YIHA 3JWIA 4O29A 1Y82A 4KK3A 3JCZA 5KKCA 2DHEA 2YOFA 4RY9A 1L1RA 3PQ5A 4FEEA 1QYIA 2JCSA 5KWSA 1CU1A 5EHZA 1UZUA 5F7XA 2BZ0A 1L5GB 2ZIWB 3DJFA 4UMVA 1R6BX 1ONBA 4J43A 2BFWA 3NBYC 2FCAA 1AD2A 4MVJG 1T9GS 2HEIA 3L6EA 4RK0A 4A0FA 4BMPB 1X1DA 2CNWD 1SKAA 5DLPA 4WZAB 4L8VA 1RC1A 1W36C 2Q0HA 1FQKA 1DXQA 3AU9A 1M2FA 2PT5A 4H7IA 2WDZA 4O63O 4ENUA 4DLPA 1VKJA 3UGQA 3AF5A 4XDHA 2NZVG 4A8HA 3KQLA 1L5VA 4FCCA 2QPOA 1SCNE 2GD0A 4CLRB 3IJEB 1EHYA 4F3NA 4US2R 2BCGY 4XUCA 5DNWA 2UUCB 3AJ9A 2FVXA 4UMEA 4CTKA 4WA8A 5BY2A 1P77A 1Y3AA 2PZAA 2XB6A 1DIBA 3L6BA 3R44A 1K6IA 4LDZA 4UHKA 3PE6A 1FRVA 4Z0PA 4WQMA 1F06A 2PCLA 5DP2A 5KQRA 1YHYA 1IHXA 1MJGM 3DEHA 3HDGA 3VAAA 2NVWA 3ZE7A 4N0MA 4CCSA 4Y6SA 1P9RA 5JJIA 3O3CA 3ZW9A 2NZ8A 1XD2B 4L5AA 4UZFA 2B4YA 3TDKA 3UYLA 4DAOA 4EKNB 4F4CA 1ZKMA 3JVVA 5LMCA 1LTQA 3IAM6 1QZUA 4N03A 5JPIA 5JNSA 2MSCB 1PZXA 2HNAA 4GPBA 4MVJM 5FBZA 4MQEB 3W6NA 4LFAB 1KNQA 2Q5HA 4GOLD 2O2EA 2A67A 1XMXA 3RAGA 5IM4A 3FTNA 4HP8A 2J4CA 5DHPA 2DUUA 3TH5A 4MGKR 3ETGA 4E07A 4BEWA 5L7TA 1KVUA 2BTOA 1F38A 5EIOA 4B84A 2BFAA 2N0SA 2C98A 3KS9A 3QVOA 1ZH0A 3NT5A 4XARA 3BXEA 4WZBE 2EW8A 2ODTX 1S7GA 2H57A 2B83A 4I0WB 4TOIA 3C2QA 4CM4A 2IDJA 1EGAA 3EUFA 4ESEA 2ATXA 3AJEA 4EJ6A 2IE0A 1B43A 2BF4A 4RKEA 4W1QA 4KACA 4YCDA 3K1AA 1ZD2P 3A2KA 4ASUD 1TO6A 3CLVA 1JAXA 4ZVRA 2BZSA 3ZK9A 4A7PA 4C03A 1P7ZA 3H3FA 5JSQA 3WZMA 3QVGB 1NM5C 3BX1A 3L6UA 3OO1A 4GRAA 3NM6B 3G23A 1KO7A 3RIXA 3X1XA 4X45A 3R09A 1HSOA 4CIDA 3M33A 3ISJA 3TKYA 2F1KA 2OFFA 3PR3A 4CLRA 5DI3B 3THXA 3ZHSA 1JE1A 4ZAXA 2JI8A 2QS9A 3OTWA 4LISA 4RU1A 2BRUC 1X15A 2OESA 1SXJE 2PRSA 3VR6D 5KYGA 1OH6A 4XFKA 1GSHA 1XXHB 3LG2A 3EULA 3IAAA 3TRFA 4UXIA 1MX5A 4HMOA 4DA6A 5C1BA 1S4MA 4P83A 1OWNA 3F96A 1ZC3A 3A6PC 4V2UA 4OHZA 3DQZA 3LPAA 2WD9A 1CLUA 1LQUA 3QV2A 1ADFA 3F9IA 3GZ4A 4ZD6A 5E4YA 3VYWA 1I13A 4E2ZA 2JJMA 3WYFA 1B0ZA 3HRHA 3VSBA 3Q3EA 1W75A 4Z51A 4EJ2A 3H75A 3ZKWB 2CLIB 2VP2A 4FX2A 3K96A 4WRRA 3IURA 3T7EA 3HLYA 3KR1A 3C7KA 4O2LA 1LLUA 4P0PB 1L5QA 2WQZA 3IPAA 3WJ1A 1HT2E 2FAXA 2J3MA 3CM0A 2YJNA 1K97A 1NMSA 3LQ1A 3COVA 5CPFA 1PFKA 4I4IA 4EX7A 5FV4A 3V9PA 1JHDA 2OZKA 2R6CA 3FD8A 4RZ3A 3AOEA 3HVUA 1NG9A 4F6RB 3HDYA 3MWDB 3SQDA 3T0FA 2P40A 3OHMA 2BSXA 4DBLC 4KQCA 4MQ4A 4Z5XA 1H4SA 4TZ0A 1Y48E 2ZTVA 4ZT2A 1TC1A 1VB5A 2QR5A 4MV4A 5AJYA 1T8RA 3PJGA 4Q19A 2CLLB 4IICA 1UFKA 3KT0A 3M6LA 4JMLA 2PIDA 1UQRA 2IZ1A 4Y1GA 4G8JA 3D7SA 1AZWA 2QTNA 3DE1X 5I8ZA 3VMMA 1DAHA 4E2FA 4E94A 4FEAA 4JV5B 2VK8A 1SVWA 3BRCA 4CODB 3THSA 1ZM7A 1ZY2A 2O5VA 3QVGA 3ET4A 3KLOA 4RGBA 3H2SA 3U3XA 4YCLA 1PR4A 1CJTC 4L9RA 4CV2A 3QXJA 5AVOA 5IU6A 3MBOA 2GK6A 4LXXA 4OI1A 3F49S 4FE4A 2Z9BA 4FTWA 4ZDKA 2AYXA 3QLUC 3NBFA 4LTDA 2VAPA 3B6ZA 4ZV9A 1RWWA 3CMCO 3TJZA 5DI3A 1Q21A 3H83A 2WJZB 1KAHA 5EZYF 4ARVA 1H4VB 1W47A 1W0KA 2JF0A 4OHKA 4BFUA 1AV6A 4UCFA 5DYIA 5TY0A 3QLVA 2WICA 3BCHA 4UHHA 4EM6A 2YMPA 3G7NA 4RBNA 1XXHA 4GE3A 4ZAWA 3B6EA 4G5RA 3VGPA 3HFJA 4V0QA 2VI5A 1KBZA 1Z37A 2YWFA 1JR3A 1HTWA 3DOIA 4OYLA 1FZTA 1BJTA 1YJQA 2O2IA 3IV9A 3LCJA 3BHJA 4GMFA 2BCJQ 3USCS 1CNMA 1CDZA 1JJ7A 3I9NA 3OIDA 4MCIA 2AQHA 4URYR 2Y1WA 5MF6A 5AVSA 5LMNB 2NT3A 2EX4A 1DAEA 2RKWA 3OFNA 4R68A 5DHUA 5E2AA 1DDIA 5A1TA 2CLDX 3OBIA 2YXDA 3ZKWA 4AY5A 4MKGA 1HRKA 5JO0A 1SHTX 3MJ4A 5IHXA 3LCRA 4MIEA 4YP9A 3FCCA 1N5JA 2QZSA 1ZJ5A 5H3LA 4C6RA 4L9AA 4OXKA 1IIBA 3W8FA 4RADA 2N1BA 3B1XA 3DTVB 3IEKA 4V0MA 4D4IA 1B0AA 1PNQA 3SXUB 5LN1A 1WSAA 4OKNA 2YMMA 3QEMA 3RS8A 3AUXA 1C3XA 4QDZA 1Y6QA 4Y2XA 3SYKA 4C4YA 4JJIA 5B1HA 4CN8A 3E9NA 5JAZA 3NBKA 1BCRA 3NHWA 4WLEA 4ZK6A 1RRPA 2GILA 4HAVA 2ID8A 1INLA 3V1UA 1A8IA 1RBMA 3G0OA 4ZYLA 3ZDAA 2B94A 4FXPA 2BE9A 3WMRA 3KPJA 4LZAA 1P2VA 4Q7EA 2JBAB 1V4NA 3RIGA 3UKOA 3VVMA 4GOXA 1IJBA 1C41A 5F7ZA 3WK4A 4EZEA 4RF5A 2FXVA 3QJGA 1JEAA 3QF7A 4FMCB 1OBFO 3D2LA 3V32A 3AJ8A 5FYQA 2NTJA 2Q2QA 5LA6B 2F55A 4YPOA 3KELA 2WRZA 4KGXA 4QRIA 3WISA 4ZVPA 4ARUA 2R0QC 1IDN1 5IEJA 2PO7A 2DFPA 5TC4A 2I9KA 2C9BA 4OKSA 2PUDA 1P5ZB 1SJ9A 2EJBA 4JJ4A 4EIWA 3DZJA 5ECWA 1E1RA 4BVLA 2Q3FA 5CD1A 1P7CA 3T3GA 2M2IA 3L1KA 3L7IA 4IQFA 4RTRA 2WWYA 3QNUA 4M0LA 2C3OA 1KO8A 3DUWA 4J0GA 4RD0A 1XNQB 1U2QA 3SZLA 1NPDA 1UEXC 1QH1A 3K20A 2FPRA 4LVUA 1UXGA 3BWBA 2QX7A 1UH5A 4XIFA 3DV2A 3TBFA 3IE2A 1L7VC 2VSNA 5C4MA 2DRIA 3ZLTA 4MI1A 3WK9A 2XH8A 3AFOA 3HYSA 4DXAA 1ZRNA 2CLEB 2C77A 1Y5LA 2D2EA 2MR6A 2VA9A 4MK4A 1NAHA 4F5WA 2HJHA 4XGKA 5DGCA 2CCJA 3G82C 2W2PA 2V9CA 4TYNA 3CVUA 1P18A 1P62B 1AKWA 1UBSB 3B1ZA 1NR7A 3B7GA 2BOVA 3B51X 3V5NA 4DMLA 2DPHA 4BE7B 4EG6A 1ZQ9A 3FPFA 1BJRE 5JH7A 1PR3A 3T3EA 1ZXXA 2WOOA 2HSDA 3MM4A 5JYBA 4ZTBA 4RIFA 5KYUA 3UVEA 1LTKA 5J43A 4CIYA 4JA0A 3ESDA 3IPRA 1UL1X 4C9BA 4K6GA 1FFYA 1TMGE 1DAKA 1PUJA 3HWWA 3FWYA 1RE1A 2Z9CA 2YXBA 3LKVA 1CQXA 3OETA 4UAVA 2GXAA 3L93A 2P41A 3GMIA 4KWCA 3PDWA 5DCWA 3TKLA 3VR6H 5H81A 4C21A 1XI2A 1ZEMA 3W9UA 2WAXA 3GH3A 3L2OB 3EOBI 4XKJA 2POQX 3F7OA 3DLHA 1QF7A 3AM1A 3GLTA 3BMQB 1GCGA 4DR6B 3CR8A 4L85A 4FGLA 5A04A 3I76A 3LX8A 1NASA 1SKBA 2FWRA 3KQTA 4GSYA 4K81B 3DXYA 5TARA 5I7RA 2DHRA 5AJZA 4H7DA 3RROA 1I32A 3EPKA 1GUBA 3ZIDA 2EW2A 1CD5A 1QPGA 4TTPA 1T9CA 2P27A 4N5IX 2WD7B 1Z5VA 1GY8A 2ICAA 3PQFA 5TMDA 2YR0A 3BFXA 1OREA 2GR9A 3AEKA 2JAQA 2UKDA 6Q21A 2PTHA 4V0NA 4KR7A 1FS4A 4W5QA 1J2JA 1SHZA 2A5LA 2JGAA 4M0CA 4G5SA 1XZAA 3EC7A 1Y1LA 3M82A 3G17A 3GDWA 4EITA 5CCXA 1Y4ZA 4Z4EA 1RHQA 1XIVA 4I55B 5AUQA 3D3KA 4J0EA 3C3KA 3TNJA 4DW8A 1G21E 2V58A 4R8MA 4DC1A 1KMHA 4D2IA 2A5GA 3BJRA 1YIOA 1EE1A 4PC1A 2IY9A 1U65A 2TMGA 4RJ2A 4UHCA 4N3NA 4BQQA 4EELA 2YJ4A 2WNHA 5AW8A 1KBQA 2ZYVX 4NZPA 3RJMA 2BFFB 5FBVB 4DIUA 3ZZNA 3H2KA 4ZI7F 2DWPA 2LVBA 5BN1A 1RVV1 1WB4A 1CS0B 2CFTA 3FY4A 2C9ZA 1MCZA 2WY2D 3LDFA 2HWWA 1BDMA 4QUDA 3IV7A 1XB2A 4PZCA 3SI7A 2BGJA 2WZDA 4QQKA 3VOSA 3GU3A 5BOSB 1EA7A 3OX3A 3PFKA 3IALA 2IXBA 2VZLA 4Q1DA 5TSDA 5AXAA 4DCMA 4G1UC 1W0KD 1XO1A 2BFDA 1Y5IA 2IBMA 2JLRA 3FNHA 1R0RE 1SVIA 4KVAA 4MB0A 2PGXA 1YZ3A 3L7DA 2PMWB 3G0DA 3U4GA 5B1SA 4HZUB 3WWCA 4ZFNA 1E2EA 4RM3A 1EGVB 2CNDA 1JR3D 1VFPA 2DGDA 2OYSA 3EWIA 3MUEA 2R4TA 4S2UA 1JTFA 3RFXA 3VNRA 1QGED 4G9BA 4UPEA 4QM7A 1ND5A 5KWVA 2QBYB 1KE2A 2D1YA 4Y2QA 4AZTA 2KPOA 1EDZA 3OFND 4F4JA 5TGDA 3NT4A 2W93A 4B3CA 1Z2PX 4KAAA 4F72A 1THZA 4X7PA 1Z7GA 1NBOA 4QULA 2QHXA 4PS0A 1ATZA 3EIWA 5FR1A 3ICEA 3ASZA 1CY1A 4MEAA 1SCUB 1NUHA 4A26A 3CWZA 1H2WA 5JSYA 1YVUA 3DW3X 4RPKA 5JD3A 3D3WA 1UJ2A 3ETJA 4MIOA 1ZR2A 1KYVA 2VNHA 2IBSA 1TO1E 4MGHA 1N7IA 5FO0A 2FG6C 4BRUA 4CEHB 1T3TA 1QNFA 3QQPA 3C6ZA 3V2HA 2QRMA 1M2OB 5DZSA 3P2JA 1OXBB 3EZ6A 4I55A 3AR4A 4NV0A 4TMKA 1X9IA 4G5GA 2EFJA 3TPZA 3R5HA 3ZN2A 5EJ7A 2XQFA 3KIPA 3T7AA 1C7ZA 2VIIA 2NXNA 5AW4A 4RUKA 1BEEA 4DHWA 1NQXA 1WUIS 4CTMA 1QK5A 4MDHA 2BFFA 4OHFA 4LVCA 3R3SA 4UARA 4ZEOA 5HX7A 3MTGA 1TD9A 5DCYA 5IZ4A 4OK5A 1KVQA 1I3NA 4Q4CA 4TVOA 5JSFA 1ZH8A 5LZ4A 5F98A 3G0HA 1PJBA 5DWVA 2DEUA 2CV2A 3NWOA 1DEAA 4KAXA 4EW3A 5JXWA 1KJZA 2O8CA 1VCHA 3DVLA 1W1IA 3E1SA 4UCWA 1ZJYA 1EG2A 3O5AA 1FUIA 1O03A 1RW4A 3QPBA 3T61A 2GBPA 3OQ1A 1Z8FA 4YRQA 3ORYA 1JA0A 1L8XA 1N5DA 5LQKA 2RGAA 4BKOA 3HN2A 1Y9ZA 1HE8B 3EC1A 2ZRMA 3L1VA 4Q18A 4HWTA 3D31A 1YDGA 4NNJA 3QUSA 1Z82A 3N74A 4ZA2A 4XVQA 3FYDA 3S7ZA 4LVNA 3I92A 5EHQA 4C3VA 4FFSA 1R74A 4J90A 2QBYA 1HDXA 2JEOA 4LY3A 3LSTA 1V35A 3DMFA 3LWZA 5DVZA 1XZ8A 2Q21A 1RYDA 3B52X 5DNVA 3U2QA 5ALVA 3GPLA 1M1YE 3OOJA 3ONNA 4OI4A 2REQB 4YDHB 1EVIA 3IPXA 4TV9F 3E2MA 1KYWA 1SCUA 4ZHQF 2PM8A 4J1QA 4DQUA 2V8OA 4AN0A 1XMOB 1ZI8A 2FHSA 1NBIA 5JAHA 4LZWA 1FFCA 3C4VA 3I2YX 4QDKA 3K16A 4KO8A 3CMMA 4M9UA 5SZKB 3QX8A 4BP8A 4C30A 1QYWA 2HLDA 4HNUA 2X7XA 1M2OA 2WTUA 1L4UA 2BHNA 1X86B 2Z04A 3HP4A 3CWCA 4TTTS 4XQ0A 3K9BA 4CCYB 2ZUEA 4NG4A 1I4LD 4ZREA 3DR5A 4BLWA 5KYYA 2IF0A 2D1TA 2LWIA 3ZU4A 1EDOA 3E15A 4KQFA 2CFIA 5ALDA 5TPWA 1XK6A 3I04A 2XKJE 1P1IA 3O90A 5IABA 3SC3A 1N0VC 1VQ1A 1VIAA 5IVIA 3N8IA 1E4OA 2P4QA 4LFCB 3MJRA 4FSDA 1VJ0A 3OPXA 4GVPA 4POOA 3QIAA 4Q9JA 3RUEA 2WTAA 3TCKA 1VLJA 2QRUA 4P2GA 1YS1X 3T8YA 4JBIA 5H16A 4DSTA 2YRWA 3BHIA 2I03A 4BMYA 3RVPA 2RHBA 4EY7A 1USIA 3EDOA 2NT4A 1ZLYA 2OBNA 4DRYA 3CR3C 3EZYA 3IMFA 4J0CA 4UFNA 3RU9A 2WUFA 3UC9A 1JMKC 1N7JA 2PAFA 4YMUA 2J3EA 5CYGA 1UKAA 3WICA 1PUXA 3EARA 4P08A 1BVUA 4BRWA 1IWOA 2R8RA 3GPDG 1E5XA 4BTVA 3QNWA 2OCYC 1S2DA 1U1EA 4TWBA 1E2NA 4POAA 3GFPA 4F45A 1HDGO 5ENVA 2G5TA 5HKKD 4WOCA 5EJIA 1AMUA 2PUFA 1ORDA 4C07A 4YWHA 5LP6B 5LUBA 2PSSA 4QYSA 4RY0A 1AGPA 1KKMA 3LFUA 4K9KA 1DKQA 1X7GA 3JQFA 1LQ2A 4BDSA 2V45A 4S0XA 4BXOA 1T1JA 2A1UB 3WQBA 5T41A 4ZZ0A 1J49A 1NTOA 5FWYA 3RVNA 5L45A 5HQJA 4N5MA 2FPIB 4CEJB 3H4IA 3M1AA 2FCRA 4KDCA 2P91A 2L19A 3K0CA 4MR7B 1SU8A 4N1AA 4P84A 2OOSA 1IM2A 3DFZA 4JVOA 1TT7A 3C3EA 4FZRA 2VZEA 4QOIA 4C0KA 4CCYA 1CETA 4KDRA 3ZI0A 4R1LA 1JN0A 3EEIA 2P9JA 4J4HA 4Q4HA 1DBIA 4B2YA 1J5XA 4TWIA 4LS3A 3A7DA 3VV3A 1Y9AA 3T3PB 2V0CA 4L75A 1LDMA 1MAAA 4Y1RB 1TFRA 1EH5A 1R5JA 1DFHA 1Z3IX 1KYYA 3DOEA 1Q91A 3KYCB 4G3XA 5LC1A 1A2OA 4CW7A 1Q15A 3EUAA 4IDQA 5T6MA 2Q2NA 5CVDA 2R6FA 1WXGA 4NCJA 4IQ8A 5LZ5A 1AUOA 1D6SA 4G0ZA 3HYCA 1THGA 2IXAA 3U0VA 4GGPA 4M0EA 4LSMA 1CERA 1Q0UA 4FW8A 1E79A 1FRQA 4BUCA 1DGQA 2Y0EA 1XCBA 3K1TA 6NULA 3DL0A 6GPBA 1Z8NA 1PF7E 2BBWA 3F47A 2H31A 4G85A 3COJA 4RDCA 1JLMA 3USES 1XTVA 4MV5A 3R7LA 2ZZKA 3BJMA 4DLKA 2JJ2A 4P31A 4DA0A 2EQAA 1G8FA 4OIMA 1IQPA 4YJ2B 4R2MA 1CK4A 4F8JA 1UT5A 2QAJA 3RWOA 3GK3A 1YL7A 1JUDA 3BFJA 3MCUA 4X24A 5U4QA 3TSAA 2C42A 5HP4A 1NQWA 5J1TB 3B53X 4N48A 1FBTA 2O6LA 1RXCA 3M5WA 4Y3UA 1HSZA 4A5SA 5F23A 1BKDR 1DOAA 4ZCRA 3CN7A 5B1EA 1LK7A 1TVEA 3N8HA 3SVLA 2V3CC 3NIGB 1J25A 1KO1A 1Z0FA 2FGKA 2N75A 3TRJA 2ZIAA 3WO0A 1Q83A 3PFCA 3KZXA 1QYDA 4AJHA 4G1EB 3V1LA 2WVAA 4G1BA 5I01A 1ZS9A 1HRDA 2AXEA 3GCDA 2ZSEA 4G0MA 5BSUA 3TR6A 1FTYA 2WA1A 3IR7A 3KVVA 1T8SA 3NBQA 2CFOA 1XEXB 4W82A 4TX1A 2VN8A 3ZBUA 1YC5A 2W2QA 4NEQA 4F86A 4U1RA 2VJPA 3WB1A 2ZSIA 3FG9A 2Y9MB 1NAIA 2IP1A 3VSCA 1DO0A 4OFBA 1MNQA 3JQQA 4BJ5A 4CEJA 1AJEA 4UEWA 2GRAA 1MAWA 2OPBA 2Q41A 3H6KA 3N2KA 1QYRA 1E0KA 3RTDA 2A92A 1X8XA 2EWMA 4PBTA 2PS0A 3IVCA 5CBPB 1QDLB 2XSZA 3TD9A 4LNHA 4H3VA 4RMJA 1W1UA 1Q7CA 3U7IA 3WS7A 2Z1NA 3VJRA 2G8NA 4Y1RA 5JJ5A 2WG2A 1GPYA 1MPXA 1I4EB 4L08A 2DECA 2OXEA 3KYCA 1QHYA 2OV1A 4PZZA 2I7VA 3CEHA 3P26A 1P45A 3OQBA 4QDJA 5DX8A 1KYQA 2BKEA 2CVHA 2WC1A 4XDYA 4U39A 2XNCA 3U56A 2HLDD 1D9XA 1KI7A 2FZKA 4Q24A 7MDHA 3IBTA 1Z17A 5LL6P 3PFGA 5ER9A 2ACKA 2DMRA 3G59A 3LWBA 3Q6NA 2MT9A 3SX0A 3HGTA 3MYRA 1UAYA 2HLPA 3QEOA 1EBUA 4IV5A 3T0IA 2Q5QA 3ABZA 1OY1A 5TQJA 4ZCMA 4LF9B 4NCKA 1PJ2A 2OP0A 3COYA 4O4LA 3K70C 1RJDA 2P2NA 4GMDA 3GLIE 2W71A 5EKUA 2I2BA 2I67A 3AHHA 1MOQA 3GGJA 3MCVA 4FCVA 4REQB 2B5VA 5D51S 4YT2A 2P3SA 1K4KA 1XZQA 2LNDA 4B4WA 3A7EA 1XWFA 2P7HA 2ZG6A 3E8MA 4I6JA 5K2OA 2FPGA 2QE6A 1AV7A 3GFSA 4AJ1A 1WUKS 1PKEA 3DMGA 1D2AA 1R2QA 1WMAA 5CK4A 1Z13A 1JH8A 3MG9A 3M0EA 3BDVA 4D02A 2B82A 3AV3A 2H2AA 3C5WP 3UPDA 4YK7A 5MN6A 2KHZA 4L73A 4XE5A 2C5HA 3ZGXA 5JCOC 5DU2A 1IMJA 3QZUA 4Q1VA 4DFDA 2AHRA 1FMJA 4JEMA 3WRYA 4B3HA 5KYNA 1I0IA 1QXSA 3D3EA 1CUAA 1UBGA 2HYDA 3OU6A 2IJGX 4OQLA 3AERB 2BMEA 1XTZA 16PKA 3DKIA 5LQMA 2PS1A 3OP1A 5JRDS 1LJLA 3WNDA 1ILWA 3JQBC 4IJ5A 4ZI5A 2O48X 4YUZA 1JFFB 3TLEA 4WXRA 4BQRA 1P0CA 2WJ4A 3JQ7B 5K9ZA 3OJEA 4IYRA 1EPUA 3MJDA 1TJYA 3A9SA 5D5PA 3WL3A 1J22A 1HG0A 2GXQA 3ETDA 4OHPA 4D97A 8GPBA 1HPLA 4P32A 4BFYA 6PFKA 4R05A 3KU1A 2WIBA 4C4RA 2VHUA 1BIFA 2NU8B 4X5OA 4D9EA 1N33B 3LVFO 3AHFA 1CUDA 2R3SA 2UUAB 3KV1A 2VHZA 1HNWB 2NW6A 2OZLB 3FCSB 4DGQA