3CRNA

Crystal structure of response regulator receiver domain protein (chey-like) from methanospirillum hungatei jf-1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
129
structure length
128
Chain Sequence
LKRILIVDDDTAILDSTKQILEFEGYEVEIAATAGEGLAKIENEFFNLALFIKLPDMEGTELLEKAHKLRPGMKKIMVTGYASLENSVFSLNAGADAYIMKPVNPRDLLEKIKEKLDEQEKEGHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of response regulator receiver domain protein (CheY-like) from Methanospirillum hungatei JF-1.
rcsb
source organism Methanospirillum hungatei jf-1
molecule tags Signaling protein
molecule keywords Response regulator receiver domain protein, CheY-like
total genus 47
structure length 128
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3crnA00
1NXWA 5CNKA 5DTEA 4N76A 1QO0D 2CD7A 3GT7A 5BRAA 2FEWB 2IDMA 1ZH2A 2LIVA 8ABPA 1YVUA 3NNNA 4W5NA 2A9OA 4MR9B 4S05A 1YMVA 5ED4A 4HNQA 4RKRA 3N8IA 5BQ3A 3CKMA 3O2QB 4MPTA 2LUOA 2FKAA 3DZDA 4MQEB 2QVGA 3M6MD 5TPWA 1JFVA 1NXVA 5GQSA 4KMRA 4KRFA 4ZYLA 4N41A 4TMYA 2F8SA 4OTZA 4MLDA 4E7OA 2JK1A 1ZGZA 2JBAB 3I09A 3LKBA 5BRJA 5JNSA 1RZRD 4Y9TA 4F8JA 4WWHA 5JS2A 3RVRA 1LJLA 4Z4EA 4IMIB 4KNYA 3HZHA 4Z4GA 5FWYB 3EODA 2L18A 3CS3A 2MSLA 1DP4A 1JX6A 3MYYA 4GNRA 1YK0A 4D6XA 2VYCA 3JVDA 3BBLA 2V0NA 1Z17A 1NXPA 2E4VA 2HQOA 5F64A 1QQBA 1E6KA 4YP9A 5JNTA 4JB0A 3RVJA 3HDGA 4LX8A 1ZHHA 2H0AA 4JOQA 4MR8B 5TQ0B 3HDVA 2WJAA 1NTRA 3O2SB 4Q6WA 4HYEA 1QP7A 4Z4CA 4RY8A 3OQMA 3HS3A 4JA2A 4Q6BA 5JNWA 4JASB 4EYOA 3IPAA 1DBWA 1NXSA 3H1GA 2PL1A 2O20A 2OENG 4WUTA 1QKKA 1JHZA 1JYFA 4OATA 3HVRA 3HJFA 5TE9A 4Z4FA 4QYWA 1QP4A 3EQZA 3I42A 1TM2A 4MR9A 2JB9A 5EWJA 1GCAA 3OMXA 3ILHA 1EHCA 1Z16A 2GWRA 4N0QA 1Z12A 4RS3A 3N0RA 3NHZA 4W5QA 1A2OA 3O2JA 3OM1A 4IILA 1HEYA 3QK7A 2Q5CA 2PUAA 3DLHA 1DG9A 2R25B 4MS1B 4LDAA 3T6KA 1LJUA 2FN8A 4G0OA 3DGFC 4Q7EA 4H3KB 1JDPA 2JCGA 3HV2A 4RSMA 2HSGA 3Q15C 4N0PA 5KQLA 4G0XA 1SXHA 5FWYA 3LMKA 1Y1LA 4RY0A 1ZH4A 4TN5A 4N47A 3HK2A 5FWXA 1A04A 3QEMA 3SAJA 1Z2DA 3W9SA 3QLUC 2CHFA 1DCFA 3ILYA 2PL9A 3LTEA 4KQCA 2ZWMA 2DRIA 5EWMA 4MR7B 5KC9A 2WWVD 5IC5A 4PZ0A 3LUKA 3LUHA 3OO0A 4NICA 3CU5A 1URPA 3FGZA 1PNTA 5TPZD 2IPNA 6CHYA 2ID9A 3A0UA 4YLEA 4EUKA 5JNVA 2FVYA 4RV5A 1PUXA 1JFSA 5CHYA 3HCWA 1BDHA 4MR7A 3OLWA 5B3JA 1C0EA 2WB4A 3H1EA 4Z99A 3MMNA 2LPMA 3O1IC 4O5AA 2PAFA 1F51E 4JAVC 5FBHA 4LDZA 4EYGA 1ZITA 3C3KA 1VLZA 4YGXB 2AYZA 2NZUG 3KSMA 2FMFA 5BR1A 4D74A 1CYEA 4W5RA 5ABPA 1TMYA 1VPWA 3QLUA 3VNAA 3MF4A 4MGEA 2GKGA 4EVSA 3RVMA 1Z18A 1QQAA 4IRXA 3K9CA 3N0WA 5TQ2A 2FQYA 1T34A 2FW0A 2FLWA 4RK6A 5B3JC 2MYUA 3HEBA 1Z26A 3N0XA 3GWGA 3IDOA 3NBMA 5HM6A 1DBPA 3H5VA 5DGCA 4YS6A 1JBEA 1DZ3A 2JVIA 3MM4A 4WT7A 3LUAA 1FQWA 5C5EA 4HNRA 2BGGA 3F7NA 1JDNA 5IEJA 4YCSA 1GUDA 2LP4Y 4YWHA 1FSPA 3M9WA 2QVCA 1GLGA 4DN6A 6ABPA 3QEKA 4ML3A 2WMYA 3JPWA 3C3MA 1DC7A 4CBVA 4RK4A 1SXGA 2RJNA 1XHFA 4H60A 1W9HA 1EFAA 1KMIY 1FFWA 1U2PA 4G0YA 3SNKA 3KYIB 3L6UA 3GV0A 1Z13A 4RK7A 1WETA 1ZAYA 1AB5A 1S8NA 1EWTA 3O21A 3F73A 2PUBA 4G86A 5CNMA 3LOPA 2X7XA 3MA0A 1PEAA 1M2EA 1USGA 2IPLA 2QW1A 4RWEA 3URMA 5T7BA 1P2FA 3EDCA 1USKA 1EWKA 4LE0A 3KCNA 4N03A 4UHJA 1NXTA 3P9YA 1ZESA 2MYNA 1SXIA 2QZJA 3NNSA 2NZVG 3LFTA 3RQIA 1B00A 1Z15A 3KKEA 4ETMA 1FFGA 3TMYA 1D2AA 1U8TA 3LUDA 5EWJB 4DADA 1RPJA 2E4WA 4UHKA 1LBIA 3I45A 1ISRA 5KWSA 2FQXA 3O74A 1D1PA 4HNSA 2PMCA 3CZCA 3Q9SA 2PKXA 4YRZA 4ZMSA 4KZKA 2PUEA 2J48A 2FSPA 1MAVA 3QELA 5JS1A 4QICA 1JF8A 3CRNA 5IUKC 4O1HA 1XHEA 3KG2A 1W25A 4EVRA 1PHRA 2JVJA 1PEYA 3H6GA 2HQRA 4OBBA 3R0JA 2IPAB 1ABEA 4E7PA 4FE7A 4EY3A 5IULC 5IEBA 3H5OA 4MR8A 3CZ5A 1DRJA 1NY5A 1E6LA 3G85A 5IUJC 3F6CA 1ZN2A 3KTOA 4MS4B 1D1QA 1U2QA 1MB3A 1U0SY 4RKQA 2OQRA 4KPYA 5IX8A 2PJUA 4WXMA 1YS6A 3NHMA 4Z9BA 3UKJA 2E4UA 4LZLA 3LUJA 5D2CA 4KK3A 2IPMA 1QNLA 2VK2A 2MSKA 4ETIA 3GBVA 1P6QA 1DRKA 3SQNA 4G0ZA 4F12A 5C5CA 5TPWB 1YK1A 1BDIA 4W5OA 2CHEA 2PUCA 4QYMA 1PNRA 1YIOA 2FEKA 1TLFA 4ETNA 5IUNC 1BAPA 4MAAA 1JLKA 4FB4A 3IPCA 5TQJA 5DCLA 2XDYA 5CNIA 2A9PA 3KYJB 3TD9A 2E4XA 2R4QA 2PUDA 1L5YA 3MIZA 4RDCA 5PNTA 3SG0A 3H1FA 5KQMA 1DC8A 3HXMA 1EAYA 3L49A 1E6MA 3BRQA 1XWWA 3B2NA 5TQ2B 4KQ9A 1H9CA 5GOTA 1R8JA 4EGSA 5KC8A 3I5AA 1CEYA 3LKVA 2R48A 4ZMRA 4RXUA 1MVOA 5JNRA 1F4VA 3H5LA 3Q41A 3HUTA 2WY2D 1VKRA 3OM0A 1RNLA 4MYRA 3RH0A 1QPZA 1QMPA 4MS4A 1ZDMA 2RJOA 3T8YA 2NT4A 3IP9A 4EVQA 3OLXA 5JNUA 2WJWA 1NATA 2JRLA 2YHAA 1JYEA 1KGSA 1M5UA 3GA5A 3H5IA 3H6HA 3IP5A 4KV7A 4XFKA 1RXEA 4RXTA 5TPZA 1ZY2A 4OLAA 1LK0A 3A10A 4KFCA 1YTUA 4PE5B 4LRQA 2QR3A 2IKSA 1ABFA 3O1HB 2H3HA 4MRMB 3O75A 1P6UA 4PYRA 3ROFA 4Z4HA 3A0RB 2YHBA 5EWLA 2A9QA 3T38A 3F6PA 3QELB 4NQRA 2FMIA 4LE2A 3OLVA 2QSJA 2CWDA 3OMWA 3RVPA 3BILA 1BDJA 1MIHA 4MS3B 1ZVVA 3EJWA 3H5WA 2R47A 3BRSA 2FMKA 3QEMB 1FFSA 1JH9A 1OXKB 3KLNA 3VNBA 3CG4A 4L4UA 1VRVA 1LBHA 1USIA 1TJYA 4XASA 3G1WA 4KREA 4D6YA 4ZJPA 2FEPA 2FTKE 5FBKA 2PUGA 1DJMA 2M1ZA 3BREA 2GX6A 3DBIA 4RK1A 4PEVA 4G97A 3HSYA 2IYNA 3S99A 3UUGA 3CFYA 3CHYA 3RVLA 3KJXA 1U04A 2PE5A 2NUBA 3FFXA 1EWVA 3T95A 1MB0A 2ID7A 4RK0A 7ABPA 1DCKA 2L2QA 2JBAA 2MSWA 2RGYA 3JS5A 4H3HB 2W42A 3HUUA 3KS9A 4XARA 2PUFA 4TLLB 1D4ZA 3C6QA 2E4ZA 3FFTA 3N75A 4LE1A 2A9RA 3CG0A 3OLZA 2P4UA 3M9XA 1DBQA 2FN9A 1RXIA 3OQNA 1C4WA 2B4AA 1OXBB 4G0MA 3FMVA 1D5WA 2VUIB 3OO1A 1ZGGA 3SY8A 3EQ2A 2P9HA 4JB2A 4XAQA 4L85A 4FE4A 3FFWA 3H75A 1YMUA 3JTEA 2FQWA 2WRZA 4PICA 1JWLA 3H5TA 3KLOA 3KHTA 2KYRA 1BA2A 3LUGA 3RVOA 4NCBA 4MLCA 4RXMA 3GRCA 3MQ4A 4YV7A 3RVKA 3LUCA 4MS3A 4RU1A 1KRWA 3UK0A 3FDFA 1J56A 5CNJA 1QO0A 3JPYA 1M5TA 5HQJA 3HO1A 2L19A 2JVKA 4XXHA 2QU7A 3QX9A 4NCAA 1SRRA 3GYBA 4F06A 1KRXA 3QLVA 4O1IA 3TO5A 5HSGA 1L5ZA 4EYKA 1K66A 2TMYA 3CNBA 4GPAA 1K68A 2FLKA 2QXYA 3CLKA 1QP0A 4MQEA 3RVSA 4DQDA 3RVQA 1TVMA 3JY6A 3GL9A 4P1ZA 1GUBA 4Z9AA 4Z4IA 4RK5A 4KVFA 4RY9A 1APBA 2VUHB 4QPJC 2MYPA 1UDRA 4F11A 4W5TA 1A0OA 1DCMA 3OLYA 5HKOA 2MYTA 5DKFA 5EWMB 1E2BA 1NXOA 3N6VA 4G0PA 3C3WA 3OQOA 3DLBA 2HPHA 2IOYA 3E3MA 1P8AA 4KK4A 4YO7A 3ROTA 2L17A 1ISSA 1GCGA 2LBPA 4MQFA 4EYQA 4WXEA 3NNDA 2FMHA 1Z2EA 3RVNA 2RDMA 3D8UA 3A3KA 2FXIA 2N9UA 3LUFA 3O1JC 4OG2A 3GBPA 3QLTA 4OLBA 9ABPA 4TLMB 3Q7RA 2GBPA 5EWLB 1IIBA 3Q7SA 1JFTA 3IP6A 5KQPA 2GI4A 4XLTA 3TX6A 5I4CA 2HJ9A 4MRMA 3C97A 1BVHA 3Q7TA 1I3CA 1AB6A 3E61A 3QX8A 4ZPJA 3N53A 3DGEC 3EULA 4RZSA 3K4HA 4IMJB 4B09A 2QV0A 4JP1A 2F8TA 2B1JA 4F3TA 4G0QA 5DLEA 4IGAA 2AYXA 4M88A 4P98A 5T3YA 2E4YA 1M2FA 2M98A 4S04A 5KI6A 4YR7A 3QLVC 3TB6A 3EAFA 3JVIA 5FWXB 2NT3A 4MQFB 2HQBA 4NV3A 3SM9A 3IP7A 1RZRA 1YS7A 4WZZA 4Z0NA 3HM9A 5TQ0A 2PLNA 2I6FA 3EGCA 5IBQA 3D02A 4IF4A 4MS1A 5E3JA 1CHNA 1NXXA 1SD5A 1Z25A 5KQGA 2ZAYA 1JL3A 3CTPA
chains in the Genus database with same CATH superfamily
1IN7A 4TT3A 2DU8A 1OU4A 2XF2A 1YHYA 3ZIAA 5JJBA 5KHAA 4OIFA 3J81k 3IT0A 2QJRA 2YVKA 2COUA 1J0BA 2JFZA 2DKOA 4OYYA 5DGIA 3TW0A 4TVSA 3K2BA 4QOEA 1N32B 5JD4A 5C8DA 4A36A 4RKRA 2BH2A 2JI7A 3HVUA 2LUOA 1BSVA 4II3A 1WDTA 1J9GA 2FOXA 4UFOA 3IGFA 4LYFA 5LJIA 1SU6A 3R24A 4PLZA 4TMYA 2F8SA 3QBTA 1M7HA 1AKYA 5LYYA 1OZGA 5FYDA 2P40A 4AZ0B 4FEEA 4LHSA 3LC2O 3K1AA 2R6HA 2H57A 3GO4A 4DR6B 4NYJQ 3WLTA 3U09A 5JBNA 2QJWA 3Q98A 2I3ZA 1MEEA 1Y89A 3PD7A 2ESRA 3WRYC 4YCCA 3H13A 5FWYB 2MWMA 3PJDA 4NK4A 3L3BA 1GUFA 1FUEA 4XW2A 1R4MB 2W4MA 1KYVA 2BGTA 3NJ4A 2W2QA 1W96A 5HFJA 1T0PA 3BULA 1SR8A 4LPSA 1VPLA 4ZD6A 1KVUA 4IHQA 3T5GA 2R6R1 4E12A 1T24A 4EY4A 3AM3A 4L72A 1SBYA 1ZW6A 4GPEA 1QE3A 3GCXA 3ZWWA 4PPYA 1Q1AA 4MR8B 1ZONA 2VBIA 1DAHA 1CJCA 3FOWA 3HB7A 1DKQA 3PF8A 3ZS9A 1XNJA 4BO0A 3O7WA 2YFHA 1TJ5A 2I4OA 3O4VA 4Q3NA 2IOHA 3F71A 1YAHA 3RLIA 3SZRA 2QJTA 2X0JA 2XADA 3QUAA 4R8VA 1QU2A 2QQ0A 4IQ4A 1OH6A 5B7PA 3U5ZB 1FFBA 4Q0MA 1JHZA 2DHQA 2HV8A 2NADA 2C0CA 4J0KA 2JA2A 1CR4A 3HJFA 1G60A 4F3YA 1TIPA 4QYWA 4WESB 1CULC 2BFCB 3L84A 1EDEA 1SUCA 4FYJA 5FLXA 3AF5A 1W4BA 4HYYA 4IW3B 4ZT7A 5FI0B 1P3JA 3FF4A 2LCQA 2BFNA 3IEKA 1MRNA 4PFQA 5U4QA 2FSGA 2X0IA 1F17A 4N9WA 2XITA 2OC4A 2VJOA 4J7UA 5KNLA 1YUMA 2JZNA 3HJAA 2NU8A 2O3QA 3F2IA 3GJTA 4XRRA 2XE8A 2ZYTX 2JIZD 4YI5A 3B6MA 3JQAD 2ZPUA 3EGXA 3FZGA 2QV7A 4L27A 1TI7A 1XDBA 3IR7A 4BNHA 1Q77A 4ALMA 2AFHA 3O4HA 4B79A 3FTNA 1WULS 5F3DA 5CEFA 2AOUA 4BNFA 1R0WA 2IV2X 3UJPA 4DQXA 1AO3A 5IM4A 5FIUA 1FDUA 2PKEA 2ZWMA 5F98A 3R9XA 2FQQA 3N2IA 3I9LA 3MXOA 2VHQA 1X94A 2Y1GA 2WWVD 3GFVA 2PKQP 4PZ0A 2XEXA 2W6CX 1EBFA 3LUKA 2XZDA 3GLTA 4L7VA 3WDMA 1NNLA 2I29A 2PA3A 3FGZA 3ER6A 5GMOA 2QTVA 5JDIC 3UWMA 4RV5A 2HEIA 2QNRA 1CVRA 1KC3A 2AOWA 2QLFA 4LZWA 1G63A 4HNHA 3BE6A 5KWIA 3A9RA 2JAUA 2ZJFA 1XSEA 3LZCA 4KN5A 4LBZA 5FPKA 4YN3A 1IZ8A 3P0HA 4TTQA 2PHZA 3ABIA 3H2SA 4AQDA 3HCDA 3K6JA 5EHNA 3RC2A 4OP3A 2CE7A 3WSTA 1ANKA 2HRRA 1FLNA 3GQBB 2HXGA 4EKIA 1CRZA 1SKQA 1X38A 2BKAA 2XE4A 4EHIA 4ZOAA 5G0UA 3DBOB 2GDJA 3P52A 5ABPA 3IO3A 2UZ4A 1TRHA 1MAUA 3RABA 4GKVA 1M0EA 2DMRA 1E5TA 2O2GA 3ROXA 5LSAA 4YIKA 3GT0A 1P4AA 2BR3A 2QRJA 3A3NA 3RSHA 5IDYA 3V2UA 5K9ZA 1RC8A 4O02B 3HEBA 2J46A 4ZCPA 1C9DB 1P1CA 3QY0A 3KR2A 3GWGA 1BRTA 3IYLW 3SFTA 4YAIA 1Z0KA 1DZ3A 2OY0A 2Z8XA 4W9NC 1A77A 3DBRB 3PA6A 1W52X 1KP2A 1G64A 1TGYA 3WIVA 2RIRA 4YWHA 2UZ3A 2ON6A 3OECA 1CVLA 5L51A 3AEUB 1YMQA 1N25A 2EAUA 1OHHA 3BKXA 3G3EA 5AKGA 1DG1G 5KSPA 2W5UA 1GNRA 1MENA 4EGQA 4KXFB 3KDAA 3ZHXA 1KAGA 1JG3A 1QVWA 2A9FA 1SIBE 5CGZA 4JK3A 5I4IA 1Y1PA 4PYNA 4C78A 1YWGO 4MV6A 4B6EA 4V3CA 2FCAA 2NXNA 4MV8A 5A0TA 3ADPA 1Z13A 3P5BA 5DGXA 3UJ8A 4QPDA 3CZAA 4PTLA 3S8MA 1YI0A 4YQZA 4F5DA 3RUIA 5DBFA 3MA0A 3KUKA 3D5EA 4W6QA 4HWKA 2XXAB 3IUPA 5IVDA 1M83A 3A27A 3E2PA 2EKPA 4ED9A 1F9EA 3L7CA 5HOEA 3UAXA 5ITZA 4D25A 1C4OA 5I9MA 4FR5A 2QRVA 4B71A 4M1TA 3NX4A 4OK5A 5KPJA 3HA3A 3CEHA 3LFTA 3ICWA 3BWVA 4IXMA 2IZ0A 4JXJA 1ILEA 3ESRA 2D5LA 4IH1A 4I66A 2J67A 3FNIA 2M6LA 3GDGA 4B45A 2GZHA 4QLBA 1PG2A 1WVGA 2AHRA 5LXTF 1M1YA 4YDQA 3W5BA 4K6MA 3PVSA 4H1UA 1NMYA 3NAZA 4LF9B 2PKXA 5AK6A 4BAZA 2W6IA 4CGYA 5J58A 4YCAA 5JAUA 1QYIA 1FTGA 4FFLA 5B2ZA 1JF8A 3NH9A 4RFSA 3EX7C 3KKNA 4FYYA 5AKYA 5UKDA 3VR4H 4ENWA 2CL6X 1EU1A 1GRCA 4P3NA 5BP7A 2JAQA 4C3ZA 2IITA 2XOEA 4OQ4A 1QGUB 2B25A 2JFVA 2ZS7A 4CLXA 2VI5A 3UOAB 1GZHB 2VH1A 5FOSA 4K7JA 4D3DA 4RMIA 3FXAA 4IJKA 4DA6A 2AKAB 1QVRA 1E6LA 3D8SA 2WMDA 2ZTVA 5L9AA 2XQFA 3GJ4A 1WR8A 3F6CA 3LQFA 3IAS1 2QQ5A 2OR3A 3B8HA 1M2VB 1E2DA 5ECYA 1W5SA 2VDLB 2I2AA 1T35A 2ADFA 4HQNA 4M0FA 4QWWA 4X45A 3QTLA 5TDHA 4BAGA 4EX6A 1RM4A 5AVYA 2NP7A 1CBUA 4M1ZA 1J5PA 1P1RA 4FYXA 2HIHA 2PJUA 3C87A 5KNCA 1YS6A 5J2TA 2H92A 1W85B 1GNPA 1SKUA 4KN8A 3JZDA 4EWLA 4V02A 3H2YA 5D2CA 2Z56A 1RKUA 1XRSB 2ZWPA 3GBVA 2ZWAA 4KEAA 4N4AA 2QN7A 2AG5A 1SCBA 3I9JA 5A05A 3DE5X 4IIBA 1HZZC 2K2QB 3LG2A 5DTJA 4V0QA 5A7HA 4D4JA 5IKPA 3NAMA 2WKWA 5L3QA 2OKCA 5IDWA 1S2LA 4GQAA 1PE0A 1I1QB 3AEUA 3F74A 3WSWA 1T3GA 3RW9A 2EJTA 1P0IA 5CK5A 2JH9A 1WS6A 5AW8A 3H3FA 2QLLA 1RU3A 3E84A 4AN4A 2WIKA 4YRBA 4QPNA 3RASA 1LJ8A 2APJA 1RI2A 2I6UA 3PHLA 4TLEA 1GQ2A 3ZGLA 3QF7A 2OLJA 2XDYA 4ASUD 2CXRA 4B84A 3DDOA 4EG1A 1T1GA 4U7GA 5HFAA 1ACJA 3SG0A 4KVAA 1OX4A 1T1RA 3EIOA 3NDRA 4B7XA 3FLBA 3ZD7A 3NI2A 3PXCX 5IJ0B 1E7WA 1N4AA 5LOVF 4AN1A 2LIPA 1H9CA 2E18A 2JFNA 3LK6A 3PIIA 4M8KA 1JI3A 4KRGA 4ZMRA 3W6OA 1YRBA 1T8WA 3FDZB 5DBOA 1GSIA 1QK3A 1XYVA 2W6OA 4OAQA 4BP9A 2JLXA 1FNNA 9LDTA 2V7BA 3MIIA 1EDBA 4NF2A 5EIBD 5A9TA 3W4KA 4YJ2B 5BWLA 2QU8A 4MB0A 4DWOA 4FYHA 1A9RA 1RWBA 4CR8A 3TL3A 2QD5A 4NENA 3SHTA 2HLDD 2OHVA 2UVQA 3PXDA 4LV8B 1D2CA 1V7PC 2IEGA 3PQCA 4CF6A 1J6UA 2BMJA 3WDKA 1C7QA 1XRMA 13PKA 4PV7A 4KV7A 4O8CA 4MXDA 2VP4A 2ECPA 4OHPA 3SXJA 1ZIXA 2AZTA 2HCBA 3P97A 4O5OA 4AY5A 3M82A 4K9SA 2IKSA 4RMGA 3R3JA 1RLUA 2B1RA 2C29D 2VSYA 3TJRA 2GBLC 5C35A 1Z6YA 1YJXA 2DH6A 2YHBA 1XD2B 3GLUA 1J21A 5E6UB 1GQSA 2WTAA 3CWQA 5A4AA 1KAHA 1PTJA 1FFHA 1TAGA 1ULAA 2VHYA 4W6ZA 1EFRD 2CWWA 4CM3A 4IFIA 1K3UB 2FR8A 2X8JA 2FMUA 2R6DA 3WWCA 5C5IA 1SY7A 1BDJA 3LX6A 3UBMA 2ZJ3A 3DHYA 4C2BA 3DV9A 1GLNA 3U44B 3EZXA 2P7HA 1Z39A 4RV4A 5CUQA 2P91A 2KX7A 5E4FA 1JH9A 2B0CA 2ZBFA 3N3BC 5CVJA 5LXTB 4ISBA 2NTEA 3QKUA 3TSYA 4QTZA 2BRUC 3UK2A 4C9BA 4MP6A 4OD0A 4ZVQA 1WMAA 4N3NA 1WXDA 4J43A 2TYSB 2CB9A 1E2LA 1TZBA 5FBKA 3G2NA 1ULBA 2GXAA 1A8UA 1DEOA 2VPIA 4FIDA 4G5QA 5JY1A 1YVDA 2PYZA 2XYHA 4LHXA 3TXAA 2GEBA 2CMGA 4C03A 5D51S 1KZ9A 2IH2A 3VKWA 3CF2A 3E4DA 4BLOA 2E55A 2P2ZA 4DGQA 2WT9A 2GM9A 7ABPA 1DKRA 3CVUA 1H6CA 2EBFX 1Z4IA 2AJ8A 3MPOA 4JUIA 4FEYA 1L8AA 3B70A 3JD3A 4WNYA 4FLEA 5KYYB 1IY8A 1WMEA 3GLRA 3JARA 3KR0A 4GQBA 3TI7A 2IYQA 5KU7A 1GGJA 3WIBA 1RW4A 3CNOA 2XTAA 5FOTA 1B42A 3DOCA 2FGKA 1YKGA 3V8BA 1WVMA 3IQIX 3W04A 4ZQHA 1TX4B 4X8LA 1IWBB 1TK9A 1G19A 1OLUB 1I01A 3MAAC 3WYDA 4DCCA 1X2EA 3K7EA 3TMKA 3BCUA 2QP3A 1T9BA 1WU7A 1DFIA 1QQ5A 4GHWA 4ESOA 4QE3A 2D5CA 1X9HA 3KLOA 2BUBA 1U2DC 3HGQA 3IUBA 3Q3VA 5CMLA 2C2XA 1FDTA 5JWRA 2HW8A 1NF3A 2ZT5A 2B83A 1GNLA 3FWNA 3IKVA 5IH3A 4D0GA 1QIIA 3LBNA 4Y6OA 5C3UA 4HNTA 1GZ5A 3F9IA 5B58T 4AP5A 4D46A 4ZVLA 4MS3A 1XPOA 1O8CA 1WQ4A 2BCGY 2J5QA 1H1LB 1KZ6A 5CNJA 1QK4A 3UK6A 1TB4A 3KEMA 2C03A 4CG1A 4UNRA 2ZE6A 1U1GA 3JPYA 2O2EA 3MJSA 4JGIA 4WBNF 2JLVA 3LQKA 4OHYA 1WTAA 2JVKA 1KI6A 1U7WA 2AXEA 1JHRA 4M98A 5K3FA 3ITNA 2A1IA 3ZKAA 4D9IA 3MFYA 2V6GA 3OFVA 4G26A 3A2NA 5A3SA 3FMGA 3SC2A 5KCZA 4IXWA 1IEWA 4M7WA 3COYA 4ZVPA 4D42A 4DT1A 1T4GA 3E81A 3G0CA 1ULTA 1ZOPA 3WGNA 5IVHA 3OZAA 5ELLA 1GUBA 1NKVA 2YFQA 2O8NA 1GXSB 2ZRKA 4WLUA 1HK7A 4CMIA 1NN0A 3A4LA 3B1VA 1E0DA 4G24A 4BFLA 1FNSA 1D2MA 3DMTC 3O0DA 4JLAA 4Z5XA 2OB2A 1XEWX 2RH4A 1SHUX 2MYTA 2RC5A 3DZ8A 3KPVA 5DKFA 5HF9A 4C08A 3STVA 3FOBA 5U4XA 2GZSA 2AE1A 5ELXA 3JQCA 5T5QA 2HPHA 4I9HA 5AVUA 2AMVA 4WINA 3E3MA 1PTJC 1WDLA 3PGJA 3ZQ6A 4CLHA 1A7JA 3HCRA 1OBVA 2FSUA 4J1TA 5ALFA 3BCRA 1OBOA 4ZCQA 2FG6C 3CR7A 5GJWC 3Q8LA 3I9V1 1E63A 1VL0A 2ZTMA 5IBCA 4FCVA 4NBUA 3FETA 3TOSA 4IDGA 1Q1QA 2ZKLA 3E9RA 1ZH8A 3HJTA 1ADGA 1VECA 3C48A 2GBPA 4Q48A 5FKJA 1R9JA 3FY4A 4OQPA 1WXWA 2FRDC 2POCA 5AW6A 3MXTA 3J81A 3GGPA 1FNMA 1NBAA 1NBOA 3LIIA 1I3CA 2G0AA 4AKTA 3IVAA 4AKHA 4YPVA 4IQ0A 5JBIA 3GUCA 1IB6A 3ZR4B 2RGRA 1MVLA 1FDOA 4U4AA 4W7SA 2BM9A 4YAJA 2ACKA 2F1KA 3WRXA 2B94A 2OCIA 5DHPA 2V9ZA 4FHFA 3AF6A 1EZZA 1RC1A 2VLIA 5EQDA 1XUOA 4EHJA 1VP3A 1K6MA 1RYDA 1K8RA 2A92A 2M98A 1E0KA 4EFDA 4YRGA 1LH0A 1QM5A 4ZC1A 3V1UA 2W6JA 3HUFA 1VHWA 2AOUB 4DMRA 1JDZA 3P0FA 3CXUA 5DOVA 3EVCA 5TQ0A 4TS1A 1J8FA 1XTVA 2Z1MA 1UBLS 5AJYA 2F43B 1UPCA 4ZCSA 3PJFA 2DXIA 1VJGA 1Y7IA 3CTPA 3GCWA 4BLWA 1CQJA 3SIWA 4XWYA 5EIXA 4DB4A 2YYYA 3AWIA 1CB7A 1D2RA 3ZGZA 3EY9A 1KH2A 3L46A 2F8MA 3DYIA 4QELA 3UBTA 1Y6QA 4K28A 1G8MA 1XZDA 3BG5A 3G2OA 4Q9DA 5BUSA 3N8IA 1IZ9A 4O6VA 2BKXA 1M3SA 1R0ZA 1T3LA 1C14A 1NXVA 2HX1A 2NIPA 3BUSA 1JA9A 2H54A 2PZMA 3JZAA 3KXPA 2BMEA 5H4HA 5JZMA 4YRIA 5JXWA 3OTIA 2P75A 4MV0A 2X41A 4LTMA 2ZU0C 1ZIPA 4C21A 1C3VA 5HR5A 2J4DA 3BB4A 1EM8A 2H06A 3U2QA 4KR6A 3AUXA 1H5QA 2AFHB 3UA3A 2MU1A 1DHRA 2VXCA 1C9EA 5YASA 4US1R 2BF4A 4R4JA 2ZSEA 4G0NA 5ALJA 2D1FA 2FPPB 4ZYWA 3HCCA 4GKKB 4RPKA 3QF4A 1VXRA 1X1DA 3EH2A 3ZDAA 3TW6A 1BJRE 1G3QA 2IXFA 4RPJA 4JB0A 1UOQA 4XZ3A 1WABA 5HWSA 2PGJA 1ADJA 1ODLA 2YJ5A 2QRGA 1W88B 2QR5A 2HB6A 2TMGA 4P34A 2EFGA 5JSYA 4C20A 2DFKB 2JLCA 1U0HC 3B85A 1TM3E 1QBKC 3ANLA 3O31A 2F3RA 4Q21A 4Q3OA 4Y2XA 5JWHA 3GN2A 1XVUA 3RRYA 4EYOA 4JLDA 9MHTA 2R6ZA 4S1NA 1I33A 2O20A 2DHCA 5AXBA 1KI9A 4TMTA 4WUTA 5TLSA 2EJUA 5EIHA 5IZCA 2A4KA 1NC1A 4JJ8A 1YB6A 3K72B 1TQDA 3M33A 4OSPA 1KR2A 1N9GA 2V98A 3JATB 3T9DA 3DOOA 3RB8A 5GIPE 4MR9A 3SGLA 1GCAA 3KSUA 3HABA 3FMIA 3IR5A 3NORA 5GAJA 4U7WA 4YFYA 3FSRA 4BVHA 3WLQA 4R1PA 2B2XA 3HPQA 4GVLA 3WGIA 4ZK2A 3QIAA 2PE5A 5JQWA 2XUFA 1YDGA 2Y6UA 3OPVA 1JHQA 3ECAA 1W2HA 4PPGA 2WJ6A 3ABOB 3RKSA 5C8YB 1KO1A 5C1DA 1B3BA 4LHVA 2WYUA 3UJ6A 2WFAA 2IWRA 1E94E 3L06A 4QOJA 3O8RA 3ZVRA 1JDPA 3AL0C 5D5PA 4TX1A 1JQEA 4BZPA 3Q15C 4PIMA 4ARUA 2Q5FA 2Y2UA 1Y1LA 4RY0A 2Q1SA 3D7SA 4N9QA 2IZ1A 1N5RA 2I0FA 3EA0A 3QEMA 4TXMA 5FJIA 2YBDA 2NO5A 2V5UA 4HH0A 4Q9HA 5IN4A 5KINB 3SHVA 4HNVA 2CKDA 2HRZA 1BMQA 4BUZA 1B6SA 1KIAA 1EQUA 1NBWB 1ONPA 2H2HA 3EEYA 3MS2A 2KBFA 1Y4UA 2DUNA 4J91A 3FHTA 2ZT6A 4O3MA 4DR4B 2Q6OA 1JHMA 3DTVB 4Q1VA 2QTTA 2GCGA 4O59O 3HDJA 1KTIA 3QEJA 3OO0A 2WWRA 2GEUA 5FOVA 3WKDA 4D3SA 1NI5A 3AP1A 2O3JA 4C07A 3FJ1A 5B64A 2HCRA 2P9QA 1BKDR 1KS2A 1KQ3A 2OVBA 3JQBA 3JD0A 3NVAA 3TEJA 4DUPA 3HCWA 1MCZA 2FLVA 2QB5A 1OUMA 4DFDA 1GKUB 1E1MA 1E2QA 1O4VA 1ZM2A 3A9TA 1XYYA 3D6UA 4LRWA 5B3JA 5EJ5A 4Y2RA 4V2UA 4OJMX 1BJKA 5B1YA 4BEBA 5TGZA 5L6MB 4NH4A 4P4UA 4HZGA 3RSCA 4R0VA 1XROA 3N2LA 3TTTA 2H07A 1MH9A 3H99A 3V8MA 1WXXA 2H2GA 3W0LB 8OHMA 4RTRA 3D7LA 2DUMA 3L79A 1L6RA 1YU6A 4OI1A 4LRSB 4HQ0A 1RPNA 1E66A 1KXJA 4E4TA 2NXJA 4HQRA 4MVJM 3FYHA 4IDBA 3PF9A 4PFKA 1GU7A 3N58A 2Z30A 1I2AA 1SQ5A 1U9CA 2ZR8A 3PDCA 4M7OA 4DYDA 1PKEA 2OEPA 5JCXA 2MMGA 1E6WA 2MYUA 2FWBA 4LXYA 1SCNE 4AAYA 3ASVA 3IDOA 1Z68A 1N33B 4OLHA 3WVNA 3ORFA 4EI7A 1D4AA 1OD6A 2P2LA 4RWZA 3DEKA 4WT7A 3WL4A 4F85A 5CTJA 1VHDA 4AURA 3ACBA 4KX5A 5LYJB 5CH3A 3R3SA 3JATA 5IBRA 1BQEA 2JEYA 1YO6A 1MOPA 3IKMB 4IIUA 1WSWA 3C8HA 2GJ4A 4JLPA 4N40A 4TVKA 4P84A 2HRCA 2QL5A 4A3SA 1EGAA 1NLMA 3H1BA 5EMNA 5ITSA 4K9RA 2IE8A 3IOMA 1PGQA 3ZD6A 1A7UA 1N75A 1B7GO 2RJNA 5DISB 3I6YA 4PGMA 3LP5A 5ILOA 1AHPA 1HR0B 2QF7A 5CFMA 2YHSA 3LL4A 3QRWA 4QFMA 3FYUC 1RWKA 1W85A 3T34A 1T8YA 1NLZA 4AWAA 3B3AA 4D57A 1U63A 1KI2A 2HBYA 2RGGA 1D2NA 3JWHA 5FUVA 2EXXA 1FDWA 1Q44A 2JARA 4E2WA 3NHAA 2NO9A 3AX6A 3RS4A 4DY6A 2A14A 3EQ6A 4MPDA 4XGQA 4C2AA 4YGYA 4NATA 4NZPA 1PI3A 2WSLA 3AG6A 3TTUA 3B48A 2BIFA 5DZSA 4MW1A 3NWEA 2WWGA 4LVOA 4JCOA 3CA8A 4ZQEA 2QM0A 1PWEA 5GONA 1XZBA 2VXBA 4X84A 4KITB 5EWJB 5AW9A 4U2EA 1R0BA 5LLSA 2PT9A 3I45A 4QQFA 5IAAA 4KXVA 4ZMSA 1D1PA 4GMXA 5JSKA 5JVDA 1YQ9A 3ZE8A 1PJZA 1LPSA 2O8DA 1G5HA 1KKMA 2UYGA 3O3CA 1CUWA 4WJZA 1KE1A 2NG1A 1A5AB 2ZB8A 4IDNA 3GLHA 1B41A 1XHEA 3LD9A 2YMMA 5T6MA 2GD6A 4TV9B 1OVGA 4OXIA 4JYZA 4MVJG 2XH8A 5K6RA 1RAHA 4FE7A 3H5NA 1BVYF 4MR8A 3CZ5A 3G2IA 3R7WA 1OFTA 3B51X 3R3ZA 4R54A 3WAJA 3ZXSA 5J1TB 3KKKA 3L6RA 2WKRA 2DB3A 5CT9A 2SECE 3NXKA 3EZ9A 3V80A 3FWHA 2YWGA 5IAJA 2YN0A 3R75A 5AO9A 2XXAA 1JPVA 3RYTC 5JC8A 4P83A 1YFLA 3FMOB 1MG5A 3EOBI 5L3SA 1XN1A 2F67A 3B5IA 2RI6A 3E1SA 1RADA 1QR6A 2E4UA 4EDHA 2WUVA 2A3NA 3LPNA 4KK3A 4DANA 4CEJB 1G18A 1P91A 3AEQB 3K1AB 4NCJA 3MWLA 3HBJA 1T0IA 5KYXA 2AR0A 4H7IA 2BFMA 1JNYA 4F12A 5EIEA 1YIAA 1FS6A 1UQTA 5MN4A 3M6WA 2RHDA 3FPAA 3UC9A 4ERXA 4QYIA 5J5AA 4JC4A 1K27A 1P7CA 4NDNE 3NB0A 2VBCA 4KBYA 1H2EA 4TWJA 4D56A 3LQYA 4IWNA 2R5NA 4FLMA 1VP9A 5H83A 2FW1A 5DRTA 5I7SA 5D3MB 5IZ4A 1QV6A 3DFZA 2R4QA 3C3DA 1V26A 3B2QA 3MIZA 3OLQA 1BDMA 1GAQA 3UXHA 3M5WA 4XX1A 4PS1A 4U2DA 2ZG6A 1DARA 1UBGA 4GYJA 2QXUA 3ROZA 1XDWA 1KPIA 2W58A 3V4OA 2NZ2A 4XWWA 2H51A 4GOLD 4IOLA 3EGOA 4FGKA 3GFQA 3DKRA 1AY0A 4BV3A 1ZU4A 3SE7A 2FOIA 3DEZA 1MOQA 2O3UA 3EFHA 4QUDA 4CVNA 2BI7A 3EPPA 1LV7A 3HY4A 3SQMA 5BUQA 2EF1A 1VA4A 3JQ9A 1EB9A 4RTKA 4EB0A 1FMFA 2B3DA 2Y1DA 5KAPA 1TCVA 2VJLA 5KCMA 1W1WA 4MP3A 1CJVC 4LVCA 2NT4A 2QVZX 5GV7A 1VQ1A 3PENA 3ZN2A 2YWFA 3SZGA 2CNDA 3H5IA 4XQGA 3UXYA 4HDNA 2EX1A 4YPFA 4RIFA 2AVNA 1KEPA 2WTBA 2B8NA 4PONA 2J0EA 1FNBA 4DEXA 1CF2O 2FUG6 4LZOA 2CL7X 4MO2A 3VJLA 4PYRA 4NFYA 1SELA 4BO1A 5A5FA 4Z4HA 1S2NA 1AKQA 3UM9A 3NWBA 4P7BA 4HUQA 4RQUA 2C3YA 4KDFA 3DTTA 1K5HA 1PDWA 1I94B 1B8NA 2PFGA 3WXBA 4J1SA 2RK6A 3P0IA 4FFSA 1KOGA 4FI3F 1V4VA 1YR2A 2M2IA 2QZZA 4JCCA 2P1RA 3T99A 4WACA 5INTA 4AY2A 4YRQA 4ZZIA 3OMWA 2HRQA 1GM5A 1NSTA 3EWAA 4X8OA 2PBFA 2RONA 1H8EA 1L4KA 1C7IA 4X41A 1NAIA 5JAZA 5EJ8A 2CXPA 2PPVA 2OSBA 4UBNA 4FGLA 3PGKA 3R5FA 4ND5A 4YCDA 3OKCA 2F3QA 1JI0A 4Q9LA 1ZJJA 4JKIA 3G02A 3H8VA 2FN4A 2V0CA 4K86A 4X1IB 3ISTA 5DXFA 1ST3A 2ZRCA 3FCEA 2Q2WA 2CVZA 4UPVA 2CHVA 3AY0A 1K0UA 1M67A 1P5JA 1ZIOA 1RZ3A 3C3PA 3DH0A 2R7AA 2ECKA 4I50F 1ISHA 2XUAA 4DG5A 4AF6A 2EQAA 4Z51A 1RYMA 3TLJA 2WV9A 2YNMD 4JKOA 1NG9A 2ZVQX 4KJXA 3TCXB 2OGTA 3PHIA 2RHOA 3PDHA 5KYVA 3OZEA 3U3ZA 1EWVA 1QOQB 4G9EA 5GOZA 3UMGA 5BURA 5K20A 1ORIA 5DYNA 3ZS8A 1CUDA 3JS5A 3CMMA 4H3HB 4LJLA 1I3KA 1YZTA 4GZ6A 1DQNA 4J1NA 2BW0A 3BB3A 5HF8A 4TQUS 1FVXA 4TLLB 2G9QA 1C50A 3TLCA 3ZBPA 2ZQ5A 4MEAA 2YFKA 1V48A 1ZKDA 2P4UA 2X14A 4HRXA 3OJWA 3N6XA 1SVLA 4M9CA 4M6WB 1JG4A 1KZ1A 5KJFA 3B6IA 2DBRA 4HXGA 1RJGA 4BGIA 1NQXA 5EJ4A 1YC2A 2H4XA 1QHEA 3EOAI 4NOJA 2ZANA 3EG9A 1QJCA 4Y9UA 4DSOA 4XGKA 2GJ8A 2V7QA 3F8SA 1IUOA 3MCZA 1AUVA 1JEEA 2W0SA 4D9KA 3AVYA 1TU0A 4JYBA 4IGFA 4J75A 4X1YB 4Y9DA 3UWSA 4J2OA 4DCPA 2KYRA 3LUGA 5LXTA 2FN7A 3TAXA 3KZOA 4MQ6A 3ANSA 3CV3A 5JTUA 1AG9A 3BF7A 3DULA 1FU4A 5CJJA 1GKKA 4AJ1A 4RHEA 5CIQA 3WL8A 4Q5IA 3C1OA 2VK1A 3EXG1 4RSGA 2IS1A 4KQMA 2QAGA 3WBJA 3KZ1E 3N05A 4P4TA 5HQJA 5IVPA 2I91A 3W5UA 2JHPA 1J1IA 1EHIA 3QKRA 2YXPX 5JAHA 1I6WA 4HATA 4YHBA 4DC9A 3EXHB 5IT5A 2H4ZA 3QLVA 2FW8A 3QVWA 5HSGA 1PV1A 2CHUA 1NQAO 4Y7DA 2AFIB 1RXCA 4RZQA 2QP9X 4X5OA 3RTEA 4EHBA 1OAAA 3E70C 1L5FA 4QGGA 4EKDA 4F56A 5MGNA 2VHTA 1ZJ6A 3KE9A 3VI3B 1CTQA 1NSYA 2PRIA 2Y1WA 2OUKA 4HFJA 4KX3A 2D00A 5LR6A 1NUHA 4MGHA 1CU1A 2A1TR 2BMFA 4QJIA 2JGKA 4JBIA 2X3FA 2XUKA 1JHYA 1TO6A 4Q4CA 4XB6B 1G20E 2WJZB 3WO0A 1UEIA 2LR0A 4S1PA 3EW9A 3TSOA 1N9ZA 3QOFA 1QGDA 4KNVA 5EJ9A 1P8AA 1U2DA 4W99A 2FSFA 5IYZF 3HXQA 3NTUA 4CFYA 3DFKA 3C4QA 4GYWA 1B0AA 1U1EA 1P17A 3V8EA 3VDRA 1F3LA 2GXQA 6REQB 1V3QE 2HUNA 1XTZA 4Q9JA 4FFBA 4KJZA 1FTNA 3MHTA 1VPVA 2J3MA 2QQGA 1TMGE 2CLMB 4CWAA 4OQNA 3AOEA 1E9AA 4JXXA 4PXYA 5ELMA 4IV8A 1LQ2A 1PFVA 1PL0A 1NOKA 1KDVA 2CT8A 1EXNA 4FKBA 3QMMA 2IHKA 2X40A 4I4CA 5FOXA 5AYVA 2GMWA 1SCKA 2ZJYA 1O5TA 3LNCA 2EWVA 2EU8A 3N53A 1IB0A 3V42A 2EARA 4K03A 4FHZA 5FUBA 1MOZA 2INGX 2IV7A 3CR8A 1C3XA 2BFDA 5AW5A 1X8XA 3U9LA 5JJIA 4N7RA 5T3YA 1WB4A 1M2FA 2EW2A 3G8BA 2I67A 2WU4A 4MDYA 5FPHA 3CB2A 3ZJ5A 4Z2AA 1PR0A 4CQMD 1XR3A 4PG8A 1FSGA 3N2YA 2HQBA 4M8NE 1W35A 2O2XA 3F96A 5H68A 1RZRA 1UMBA 1VYTA 1DKOA 1YS7A 1HLDA 5FPSA 5C8YA 4HWSA 1EQAA 3S44A 4BNJA 1R88A 3F4KA 1RHQA 1SAYA 5IBQA 3F5SA 3M1LA 1ZHFA 1BFKA 4C6TA 2RGBA 3M2TA 1CHNA 1L9KA 2X15A 3CZMA 3FD8A 4NLLA 1XZGA 4Y0VA 5F78A 1QH8A 1TQHA 4DWVA 1JFRA 2VSQA 3WTBA 1XZLA 4NBNA 1U28A 1CDOA 4G09A 2QE7D 4MROA 3SJ7A 2IXEA 3SVTA 2HJWA 4MICA 1GV1A 4FMPA 1BHJA 1SU4A 1ZKMA 4FS3A 3NRBA 4I1SA 1YQWA 5AJXA 2UVPB 3GPCA 4JJZA 4O1MA 4E5MA 5HTOA 4KDEA 1FLDA 1U0BB 3TW4A 1JLSA 4URXR 4YXFA 5B4VA 4C7JA 3LDAA 3WJAA 3MOGA 4EUNA 2AK2A 4D0RA 2EATA 4U3JA 4I55B 4NRDA 3TEFA 4OTZA 3PKZA 1YVPA 4HO1X 3HKBB 1SQFA 3LKBA 5F77A 3TQTA 1NBMD 1XTRA 1XXLA 2C5SA 2VJPA 3BZUA 4IDOA 2DH5A 4DJFC 1T5LA 3S68A 1WXFA 3NV9A 5EYPB 4QQKA 5CRIA 2HA2A 3ZWVA 1U3DA 4JQCA 1I4EB 1C9JA 2C4MA 3A7DA 1QHYA 2PUWA 2HC9A 3C3AA 4ITVA 3SKVA 3VAAA 4D98A 4EO7A 3NC4A 2AA3A 2CL5A 3EODA 3W9BA 1BS1A 3VPSA 2GS9A 5AI5A 3QLEA 2H7VA 4YJ3A 1SBTA 1C7ZA 1DTWA 4D4LA 1K7CA 4Z1MD 2ZEJA 2O2SA 3DZIA 2Q3LA 3BK7A 3GEHA 2VZ8A 2PGNA 5ICGA 1M8PA 2Q8QA 1YZVA 2VZ0A 3SDBA 3FPFA 5E7JA 2G36A 3RVDA 4AW9A 2QE6A 3AERB 5KWEA 3H97A 1G17A 1V8PA 2OXEA 4IVRA 1NI4A 1CEEA 2Q6VA 1IBSA 3KD2A 2NO1A 4JA2A 1RLJA 5EXPA 4ECEA 1V71A 4XFDA 2H0QA 1V3VA 4P3XA 1QFSA 4R9VA 5JJ5A 2UZ1A 1DAMA 1MAHA 3KSAC 2GASA 5JJKA 2RBKA 2BEVB 1R5NA 3N3AC 5BSRA 1GDTA 3BEDA 5CLGA 3WL6A 3EQZA 3MQFA 4YECA 4TWZA 3EYWA 4V0MA 4BPBA 3OMXA 1AVTA 3ILHA 4G2NA 4QHTA 3WQHA 3T5DA 4BC1A 3TQRA 5EKSA 3D3QA 2AXNA 2VJCA 3MCWA 2Y8EA 2ZSIA 4IHJA 1YZNA 1HEYA 1TO1E 3QK7A 2RGNC 3R20A 1WY5A 4FHCA 4F9TA 1KSHA 1T29A 1WJGA 1MG0A 2R25B 1CWUA 4XEUA 1GJRA 4YRAA 3KYDA 1Z0SA 1I7PA 3NFYA 1T6YA 1XXHE 4FGJA 4DMGA 4M3NA 4UUMA 3PEWA 2CJFA 4JKYA 4OLJA 1XCJA 2B5OA 3AKCA 5E38A 4BFTA 1EVKA 1ZH4A 5CFQA 1I7QB 4ZYVA 4ES6A 4P53A 1E4OA 2OHJA 5DOZA 4JLOA 4PRLA 3DFUA 3I9V6 1LFAA 3SM3A 3CQ9A 4URVR 2Q27A 1YZFA 3GQBA 4ERNA 5KVVA 5EN4A 2O3SA 1QLHA 3ZI0A 2YXNA 1SOWA 1YBFA 1UWLA 4IKPA 4MQ5A 1MV5A 1TCUA 2PUTA 3U39A 1WDKA 2EZ9A 4G01B 4C0BA 5JFOA 1JEYB 1DAOA 4N8SA 1UZLA 4NXNB 3N8HA 4XJXA 4DKJA 1KHTA 2AEFA 4PNPA 4PWYA 2Z95A 1Y1SA 1XK7A 3UGJA 1S0UA 2BGMA 4OXXA 5K3BA 4JNCA 3FKSD 2WJPA 4H17A 4HC4A 2OBFA 4YVFA 4GOJA 3RK1A 4EY8A 1UBNA 4COKA 2ZJ5A 4CW7A 2XAUA 4NONA 1C0EA 3IEUA 3E58A 1I7LA 4OFZA 4ZODA 4BVAA 5BSVA 4MVYA 4ZIRB 3ZHYA 5HYVA 4F6LA 1NY6A 2NPFA 1A69A 3WA7A 3NEJA 3OU6A 3PJEA 2GAFA 1DFGA 1BA3A 1MO2A 1MO3A 2H2DA 3C3KA 3D4NA 4YGXB 1K9VF 3DBHB 4F93B 2JFWA 3M70A 1ORWA 1X7HA 3UJ9A 1EVZA 1GUAA 4IGIA 3VNAA 1PW5A 3BGWA 4QBHA 4MGEA 4WCFA 4ND7A 3SFZA 3LT2A 1YKSA 4LZAA 1ECFA 1RYBA 2IU0A 2ZJAA 1PWHA 1XU9A 1Z26A 4FFVA 4QQNA 3JYLA 3UJNA 1JDUA 1RKXA 1ZNYA 4JJKA 4EI2A 2NGRA 3L0OA 3N2GA 3OY7A 3UMRA 5C5EA 2AW3A 4AMUA 2ZRDA 3CCBA 4EQ6B 4WIAA 4LF7B 5F23A 5JSZB 5DPMA 2OB1A 3GLIB 1RXVA 2C1EA 3EFEA 1R27A 3CVOA 1P5ZB 1DC7A 4JOSA 1UT8A 4UU8A 2O8FA 1E1RA 1ZD2P 3FBGA 4GSKA 3KAKA 5DYIA 1J8YF 5BSGA 1GY8A 4MCHA 3SNKA 4NCNA 3IVMA 4NIMA 1E2FA 4NOMA 2X86A 1A8IA 4BU1A 4UXHA 1GQYA 3I5YA 1K7YA 3HGMA 3MTJA 2PUBA 2H4JA 3RTAA 1Z45A 2WAMA 4CQLA 1Z0DA 5LUAA 1F2VA 2IP2A 1EVJA 1ODKA 2ADOA 2DUJA 5IAKA 2F6RA 3O9VA 3TSCA 5TS2A 4EFLA 5KMGA 1K6XA 1XDSA 3CISA 5CK4A 1Y5NA 1VJ0A 3O1LA 4MJ3A 2A4MA 4NBSA 4ID9A 3I01A 4PRYA 4UHJA 3R3WA 1G9SA 3P9YA 3KOOA 4C01A 1RM3A 1QWOA 2PS9A 2D1QA 1ORTA 4F9FA 4PLFA 2WF6A 1CG6A 2C2WA 3WMEA 1L8OA 1L4GA 2BFEA 5EJ6A 2G3YA 1UAYA 3FTQA 2VP6A 1F9AA 4C05A 2D54A 1L4FA 4AZ0A 3UFXB 1ZCAA 2IH4A 1QZXA 3KVRA 3ROGA 2AOTB 5JMWA 1TJ4A 2FETA 1WQ1R 3IE2A 2PUEA 3VJKA 3VNSA 2QRLA 1J99A 1E9EA 1U1CA 2IFTA 3ZDBA 5E6UA 1RCFA 2DWQA 4HH1A 5I7VA 3E15A 2R44A 1IN5A 3A28A 1L7NA 1QWSA 1RYNA 4PHHA 1T8UA 2AMLA 4XPIB 2O2CA 3UF0A 2BE9A 3ML1A 3I58A 2QJOA 2ILTA 5F1KA 2GPSA 3G5UA 1EMDA 5IULC 1YS2X 3IL2A 1CZHA 4XCQA 1Q0RA 2IEBA 3KQMA 4P6VF 1FYDA 3AV0B 3CT6A 4QEKA 1JEDA 4YRLA 5IUJC 2JCVA 1WVIA 2VEDA 4P82A 2HDNB 4KMSA 4NYIR 5LNK6 4OMUA 4RKQA 4XR4A 4QUGA 1KIMA 1OFUX 1MABA 1E2GA 1MX5A 1U81A 4CFZA 1SBQA 5IWAB 4Z9BA 2CNNA 1SKAA 4LZLA 3HRIA 1TD9A 2HHCA 2G17A 3HB0A 1Z83A 1ZK1A 3KOYA 4G56A 2V1XA 4L6CA 1CRPA 1K8QA 5AI9A 2B5WA 1TOAA 2HLNA 1DRKA 4MRPA 4FD3A 5HOQA 1QPGA 2PMDA 1I7DA 1F8UA 3G5LA 3R0IA 4IIDA 5C5CA 4PN3A 2CV0A 2DFNA 2IUYA 1MHPA 2X9VA 2AN5A 5KNDD 1PNRA 1E0SA 4JVNA 3U7HB 1TLFA 3LT1A 4CCYB 1H0RA 4LJSA 2RH5A 4MAAA 1VFNA 4G0VA 5AVSA 1V2GA 4C6SA 1T0HB 3K2EA 3L8FA 3WRWA 1C0KA 4CI0B 1ZLXA 2PSJA 3PNKA 4I46A 4TYYA 1UDWA 4MYSA 2CK3D 4DSAA 3CLUC 4BX3A 3RYHA 2HK8A 3OCCA 4WD3A 1G8PA 1UMCB 4BO9A 4EGSA 5COAA 5A9SA 3ANYB 1UDCA 5AUOB 4AZWA 1KARA 2V97A 3GVIA 3KHKA 3U0BA 2EZ4A 3NBFA 3IOYA 2VQ6A 4LI0A 4Q9KA 1JIIA 1PSDA 2O2YA 1ZCJA 4I4LA 4M1YA 4MYRA 4PQYA 3OM8A 3RH0A 4AI6A 2II6A 4MKZA 4BRWA 5EKXA 3AQ4A 4NMHA 4X1OA 3C6KA 4EVQA 3LHSA 4YYZA 3ASYA 2JRLA 1JYEA 1KGSA 1M5UA 3WBKA 4UNPA 3WWDA 3T1TA 3AB3A 2OORC 1J8QA 3WXMA 1FFDA 1YCDA 4PQRA 1M6HA 2GF2A 3P9SA 3G2QA 1QGUA 1VC2A 4X71A 5D3ZA 4DL9A 1V5GA 5KPDA 3CTMA 5EESA 4RD6A 4ZZ1A 2DHRA 1QX3A 3A0RB 3IP3A 4DCSA 4EY5A 4MUKA 5C81A 4IV0A 5C1PA 1L5NA 4QYXA 2JCYA 2JGRA 3QQPA 2GOYA 3TBKA 2FXVA 2NTJA 2XIJA 1B2RA 1I24A 3OLVA 5FNVF 2QSJA 3V7WA 1JQDA 3HVIA 4WZBA 2QL6A 3Q3CA 8LDHA 2GN0A 1DHTA 2C78A 3VR6A 1B73A 4MGIR 2RD2A 2HD4A 1GTL1 3QVOA 5B3LA 2VAPA 2Y6VA 2P6NA 1F2DA 2OM6A 1T4CB 3BL5A 4NPCA 4OV6B 5AJUA 2HF2A 3R7NA 4A0QA 4B2YA 5I7WA 4C2TA 1IK6A 1X1QA 1NW9B 1TW2A 2H9AA 4P3PA 3SK0A 3T5BA 1W2GA 4WNCA 4FSDA 2GD0A 3FCSB 4LJAA 3KWJA 1OLXA 5LC1A 4HUTA 1W34A 1LLFA 2O1WA 3EIHA 2FTKE 2JBWA 2M1ZA 2PGIA 2WAYA 3EZGA 1N2CB 1LBSA 4BKMA 3FWYA 3MGGA 5FORA 3TKLA 3WLKX 3L9XA 3G17A 2Q9CA 5HZMA 3CFYA 3NLLA 3M34A 4F45A 3OT1B 1MPXA 4FDVA 5B1EA 4A8JC 4DLWA 4UUNA 2ID7A 1WEHA 2RMKA 4BC0A 3FDIA 3I5XA 3KRTA 4ZTBA 3GUZA 1I7SB 3M3PA 4R68A 4RMNA 3A1CA 5IM5A 1GKIA 3PU6A 4TLAA 1BFDA 1E2KA 5HCIA 4L02A 3JSXA 1OU0A 1SURA 4YB8A 2QRHA 5K8VA 5F7ZA 1RI3A 3TD6A 5J2TB 2VHCA 5CG1A 1XE3A 2ZE7A 1ARZA 3MWGA 4D9FA 5KJ6A 1Y9JA 1L3BA 3WC4A 4B4KA 4E07A 3Q8MA 2JIBA 2XUPA 5JZOA 4O2LA 1KZ7B 3E8XA 1XALA 2POQX 2F9FA 1IZYA 1L7RA 3JTEA 4NBVA 5L7YA 3I28A 2VWGA 4RW0A 3AVWA 4TLCA 3M3DA 4BKPA 4EYEA 2C7PA 3WDLA 1C3JA 4KQ2A 3P9PA 2R00A 1I51A 3H2IA 1S3GA 2P3OA 4BFSA 1TC2A 2NQ2C 4GMFA 4R9UC 4YV7A 3GEIA 4DHWA 1W30A 1U0OC 3TL6A 4QG3A 2ZS8A 3QM1A 4FLFA 1Q0QA 3L0SA 4RMJA 2Y0CA 4L8WB 3TLGA 1LVGA 1T25A 1NP6A 2DAPA 3IIMA 4HMQA 4RFLA 3CONA 1CE8B 1SEVA 1KZHA 1SRRA 4F06A 4LXIA 3WGQA 4G1EB 5ALMA 4ENSA 3UZUA 1H3NA 1PQYA 3KQNA 1KK1A 4DDUA 2QXYA 4OHBA 2OPHA 3SKYA 4DJJA 2BH9A 3WOVA 1KHHA 2PZBA 1GNTA 3M9LA 1MO6A 4MUYA 4QXPA 5D87A 2H7YA 3JY6A 4YPOA 4NNOA 3THYB 3HLYA 3F47A 3CUEF 4C06A 2Z1DA 3HJBA 4DCOA 1E1KA 3HB4X 1JWAB 3I8OA 4PXAA 3CZQA 3VO2A 1MMFB 2BEWA 5FHQA 4BJ6A 2CXXA 4NZZA 5EWMB 1DXQA 1TUBB 3MRTA 4U9HS 2C1ZA 1EUDA 3JR3A 3GGSA 1SOAA 3GFBA 3I5MA 2FDCA 2N1MA 3IKLA 3KVNA 1LNQA 4JL8A 1Q50A 4KMOA 3FUTA 4MQ4A 1WB9A 1IWPB 2LBPA 6ADHA 4EY6A 4JMPA 5EE5B 3TR5A 2H08A 4YTEA 1G0NA 3LPMA 1K88A 3GHYA 1NPTO 4WI1A 2Y92A 2AT1A 3U6KA 1L2TA 2HA6A 2HXSA 2O8VA 5SZKB 4K87A 3B6EA 4E3ZA 5CA0B 3TG8A 1X7XB 2EERA 3VMMA 3TS1A 4II2A 3PI7A 5FL3A 3HY6A 1OV4A 1T1JA 1OYWA 2DKNA 3QHPA 1HMYA 4U7PB 4D4IA 2FZWA 4LZNA 3THXB 1G5PA 5BPFA 2W11A 3RF7A 3ZLJA 1ZN9A 3DGEC 1DTSA 5E2BA 4H4DA 3K4HA 2H5EA 3IQZA 5AESA 3AJEA 2P6RA 1PS9A 4QG7A 1CIPA 5EXXA 3PUHA 1E1LA 1Z4NA 2I4IA 1ZM7A 4OK6A 5DLEA 3TQQA 4PRKA 4ZN6A 1BHSA 2BGIA 4MVJE 4AY4A 1D9ZA 3PRKE 1CRLA 1TYAE 3ADCA 2OHHA 4MQBA 3RRZA 4D8TA 4ALNA 3C74A 4MQFB 2BD0A 3VKHA 3HM9A 2ABWA 3KELA 3LO8A 3PFIA 1Q7BA 1WHTB 3EA4A 4U6SA 4D1YA 2Y27A 5K0CA 2Y0PA 2DQ4A 4NCKA 5FFFA 4L2IB 3QU9A 4MI9A 3Q7QA 4JOCA 5EPOA 4ZJUA 5CNKA 4TTAA 1YBHA 1JEOA 1V47A 2RIPA 3ME5A 3I6ZA 2FPPA 1YCHA 2XTZA 2JGLA 2Y3IA 3K0AB 4KLAA 5EINA 4CIVA 1KJYA 3CM0A 4IGKA 3U56A 3SEAA 2AL7A 3LT5A 4L0DA 3PUVA 2PYIA 2FP3A 3RGGA 5LKAA 1HNZB 3QWBA 4NYMQ 3PL5A 3Q0IA 1VHLA 3KTAB 1NLUA 3UW1A 1XVAA 3DL0A 4EUSA 3EG5A 4XD2A 3NM6B 2VG8A 3B6KA 3HCBA 3AR8A 2BE7A 4HD8A 2QM8A 3F1KA 3I09A 4KYUA 1CS0B 1Z0FA 4MWTA 4Q1BA 2XVMA 4RO0A 4FHGA 5TB5A 4OXNA 2R8ZA 2R7KA 3N86A 3NCTA 1Z9BA 3ZHOA 1W94A 1PT5A 1IQUA 5JYDA 3DXXA 3QSYA 1H94A 4GC5A 1N1DA 4KNYA 1E92A 4HXEB 3AEZA 4JR0A 2LDXA 4E0BA 1RRVA 3EQ7A 1RM0A 2PV7A 3LF2A 2NSDA 2O2ZA 4HI0E 5B1IA 4HFMA 5C7YA 3NJRA 3CSSA 1H2HA 4QC2A 3STTA 3BBLA 4WCDA 4X93A 1M6WA 1U5BB 5IG2A 1XJCA 4E30A 1UCFA 1SULA 5J5VA 2ONCA 1NP7A 4AVYA 4B44A 5JNTA 2PQMA 1E1QA 2IY7A 4H18A 4C6TB 4YASA 621PA 3GLFE 3IVCA 1E98A 1YB5A 3MD9A 3U81A 4XD7A 4KC0A 4QFCA 4CKEA 2H1RA 3NHPA 2OD9A 3JQEA 4HYQA 3JU3A 1YB2A 3VDNB 2OZPA 4MYHA 3UB2A 1IOLA 2KMLA 4X0EA 4JASB 4TTVA 1Y5RA 4GRDA 5BYBA 3NBKA 3PNVA 3V2IA 3USZA 4DF3A 1NJGA 4PAMA 1NXSA 1GWNA 3EBOA 3A25A 3ZZ1A 4ENTA 3H18A 1Z3CA 3ABZA 4GT1A 1GAEO 2JFFA 3DKVA 4WJLA 1Q3TA 2C58A 2G25A 3B60A 3E2MA 3RGWS 5AM4A 4XIJA 5KKAA 1ISPA 3DNMA 1MU0A 1QIKA 1DWPA 1QDEA 2CZQA 2HF7A 2GBIA 5AJZA 5B7NA 3VSDA 3ZWKA 3M89A 1X7GA 4U3JB 5C8XA 4MW6A 3ZHSA 3RJ9A 2GWRA 1E1CB 4RD0A 1RKBA 2FEOA 5BSEA 1UK6A 1YL5A 3NHZA 2I2CA 2Z3WA 1GQFA 1OBFO 2QX9A 1HYBA 5B5SA 5BWCA 2AR9A 2IOFK 4PSUA 4ZYUA 5CU7A 1OA0A 5CA0F 3HKCA 5FB3A 3ICEA 1ADYA 3OAAA 1K5PA 1LF0A 1KFJB 2I99A 1LJUA 2Q07A 4LDAA 3ROQA 4Q7EA 4AIIA 1Z35A 1JTFA 2NXWA 3V6MA 4PVDA 3SSAA 4TN5A 4AUMA 5M5BA 3CSDA 1KO8A 3O4RA 2JIMA 2CL0X 2IHTA 2WWXA 3COZA 2CLOB 1B26A 3OIFA 1DCFA 4NL4H 4Y6PA 3ILYA 2VIIA 2R11A 4KB5A 3DHEA 2YDXA 1RQGA 4BLUA 3OOHA 1KJIA 2P2YA 2C2GA 2CBGA 3G2MA 1MGPA 4KI7A 3HZZA 4Y9SA 5IJ9B 1T9KA 1TK2A 2QUBA 4KFUA 3PXUA 4LDRA 1KFEB 2YXEA 3CLRC 1KPHA 5AI6A 1HNWB 4BGEA 4Q9NA 1YRQA 5EHXA 2XJ4A 3UK1A 2WD8A 3TKAA 3EVAA 4QOSA 3Q9NA 3TZQA 3QNMA 3GVXA 1TM4E 4CR6A 4QGAA 3V9AA 3WI7A 2LPMA 4TPKA 2D2XA 2V7EA 4DPMA 4B2LA 4G8CA 1EB8A 4TKVA 2JGDA 4UVIA 3RSFA 2IYRA 1WHTA 1G66A 3C1UA 3E5RA 4LSWA 4MPJA 3SI7A 4XR9A 4RL6A 2IXAA 4ZAYA 4GX1A 1D8TA 4C4RA 3GBSA 4Q12A 2BDUA 2JJ1A 4F2WA 5L7WA 3MAGA 4JUCA 1F7VA 2PVCA 3D2AA 4EVSA 3KUDA 4BMVA 5KTMA 1II8B 4G6ZA 3IAXA 3EZNA 3F78A 3L4BC 4IRXA 4PLGA 3N0WA 1UOPA 3OQHA 4R8MA 3UNXA 5BNWA 1I32A 2XYQA 3EJ6A 1IPEA 4R1OA 4FFPA 5JDCA 3CEMA 3EYAA 2AFIE 4IG4A 7ADHA 1KP9A 4QECA 4DYVA 5JDCC 1DWQA 1ZH6A 5HVNA 3U3DA 5KSYA 5LU9A 1E3EA 1ODJA 3DZFA 1KA9H 1T3ZA 3MT0A 4Q7KA 1IC6A 3LP8A 4L9SA 3M9WA 3SQWA 1ACLA 4DN6A 3TNJA 2PYDA 4QYIB 2J87A 3T06B 3PVCA 4MWOA 2PX8A 2QHXA 4TV8B 4ZO9A 3DDZX 3N8NA 3BDAA 3D7KA 2QQEA 3LQRA 4UD2A 4DQLA 4L3OA 3PPXA 5ARDA 4KOEC 4KI0A 1NN1A 4D3FA 3L6UA 2NAFA 4MA5A 3UHOA 1TEZA 1PS0A 4NBRA 3MJCA 1EWTA 1PJAA 3IMFA 2ASVA 2R85A 3H9CA 3TKYA 5K0GA 1FF9A 1RWQA 5E6SB 2VJAA 1GZUA 1NNI1 1YONA 2RB5A 3WJ2A 1E9CA 1VKNA 4G86A 4MI3A 5A71A 4UBOA 5BW5A 2A5DA 1YH3A 3OD5A 1NOJA 2KB0A 1VHJA 1EG7A 2G6TA 3H2JA 3KYDB 3R6GA 2FZ5A 3CRQA 4R1SA 4UBIA 2OV4A 3FCYA 3URMA 3ZDFA 1GPH1 1VCNA 3EZYA 1R4MA 1YS9A 1KU0A 2AUMA 2C7VA 3QVSA 4NP6A 2Q5HA 3TMAA 1G2IA 3I5UA 1NXTA 2W70A 1DJNA 1KAOA 4X66B 4CCWA 4IIJB 3NNSA 1GG9A 1UBUS 2PG3A 2YHIB 3FOAA 5D84A 3RQIA 4AWXA 1DSSG 2X9GA 3EDMA 4IKEA 1JR3A 4CMAA 4JS0A 4HUJA 4DADA 1VL1A 3F3YA 2JCBA 1SVIA 4JLSA 4UNNA 3FCXA 3IPRA 3KC2A 4J4TA 3G68A 1ENOA 4X85A 4C30A 1Q0ZA 2X2OA 2YIVX 1OYOA 1SXPA 4LJRA 2XNKA 3AV3A 3Q9SA 2C98A 4HHEA 2DYKA 5EUBA 4GDFA 2FSPA 2JW5A 2OORA 2XMGA 3GJYA 2GHIA 1P8JA 2MDTA 3L4SO 1HEIA 1XDDA 2GEFA 3X1YA 1CY8A 2EV9A 1XZIA 2I1QA 3R7SA 2HK6A 1SUPA 3B1KA 4RNCA 2VAVA 2Q2NA 1GFSA 3LBHA 4JI2B 2H16A 4P7FA 4JVOA 3KLPX 3UPTA 3N0TA 1NKSA 4HH4A 2XYPA 4G89A 4OOFA 2YHUA 1N2CA 3VXKA 4NCIA 3OE5A 4HGOA 1A7AA 3L6BA 4XYEA 3TN7A 1MT3A 5L8VA 2YV4A 2ONYA 1JQ3A 4L4SA 1GT6A 1ECCA 5ALQA 2Q1WA 4BFCA 2C82A 2VFAA 4YRMA 2XLCA 4TQAA 2BONA 1WF3A 3CNHA 4PC3A 5G4LA 3BM5A 1WBDA 3GZNB 2HREA 4Y6SA 2Z8ZA 3IBTA 5DNDA 2IYZA 2WQ7A 4FE3A 5BR7A 2PGAA 3B1XA 3KUXA 3WE7A 5LP6B 5HDQA 2C99A 3V1NA 2XOKA 4UE2A 4A92A 5IAEA 4E14A 1E99A 1PR3A 3JQGB 3LC0A 4D45A 2B9EA 2C2YA 5DSTA 1G291 3GG2A 3ZIDA 2IUFA 4JMLA 3JAMA 3OWXA 4HH3C 4EO9A 4HLDA 3K0BA 1UDAA 2DJ5A 3VI4B 1QFJA 1P2BA 1L7BA 1YASA 2Q3HA 5IUNC 5KX5A 1BAPA 4OFWA 2WWYA 3PQ6A 1G1AA 4EFNA 4QNMA 3FSJX 3ZDXB 2WILA 4YRTA 5AMXA 2JLSA 1JEYA 4BWGA 1EK5A 1DC5A 2C2HA 4FZ3A 3SC6A 1BQ4A 4TZ6A 4B7UA 1ZNZA 1U0GA 3H17A 3G0IA 4KQ9A 3TOXA 1O57A 4LBVA 1OMOA 2HJSA 3TQSA 4WAUA 1BH6A 1GZSA 5CFRA 4MV1A 3FVRA 2JJ8A 1KMQA 4NG4A 3VC1A 1NJFA 2PMEA 3V33A 3MSCA 4CL3A 2H63A 4DA0A 4TV8F 2Q6KA 1AV7A 3IRVA 5F9MA 3BMXA 4UQLA 3T8YA 1CS4C 4A10A 2NU8B 3GELA 1GRQA 3U7GA 3ELWA 4BEVA 4ZGWA 4LY6A 3FRHA 4Y2PA 5H0IA 1LLUA 1WX1A 4I5IA 3DEIA 4WXRA 3OFNA 1ZY2A 3CX4A 3JAKB 2I34A 4J2HA 2OV6A 5ADUS 5K8CA 1BE1A 2VQSA 5FWNA 1O54A 4AS3A 2Q2QA 1RMQA 4EGFA 2G1PA 5KOIA 1ETUA 1ZA1A 2YOGA 4LOLA 1KDOA 5JQGA 3ZEIA 3GPDG 3QMWA 3ZNQA 1J7KA 2YDYA 4EMTA 4YMWA 3BHNA 3ZGNA 5EWLA 4WNAA 5A0FA 3EIXA 1NDHA 5LMNB 3IBGA 3TSWA 1A9PA 1VL6A 2HBZA 2XQGA 4J7AA 3AJDA 4YAKA 4GLJA 1GGKA 4IKOA 4P5EA 1Z3IX 1M1NB 1T9AA 1IBKB 4MS3B 1SWVA 2C5BA 4EG6A 1WD7A 2PVSA 1WXHA 4LW8A 4TXJA 2R47A 5B12A 1HE1C 3PUJA 3KLNA 3P96A 2ZJ8A 1USIA 4ZTZB 2O6HA 2C92A 5AIAA 1F8XA 1YOVA 4IHKA 1S6YA 3AIOA 1GV0A 2MSDB 2YRFA 3JD2A 4L8YA 4HADA 4LRYA 3T3GA 2EFCB 4YREA 4F86A 3CLSD 3KR1A 1QRRA 2YWEA 4FFMA 5H7XA 3WGVA 2HSEA 4W7HA 3D2LA 1GYPA 3I8XA 1X80B 1YHZA 4CIXA 1QGOA 5FBWB 3OC0A 4RZ3A 4GI2A 3KJXA 1PU2A 2YV5A 3JYOA 3L1VA 3E82A 3LLSA 2DKFA 4L4YA 3BJEA 2R7LA 1D8AA 3FFXA 2PMKA 3BXOA 4NCXA 2R5FA 4ALKA 4KUEA 3TGPA 1HC7A 1HE3A 4X6YA 3A6EA 5JANA 1R18A 3X1WA 1PGPA 1KI4A 1C2YA 1ZW1A 3K32A 2Z98A 1PTKA 3MMXA 1AQIA 5BWNA 1PEDA 2E4ZA 3FFTA 1EFDN 2CZGA 1P7ZA 3VU9B 3BFPA 3IXMA 3RRXA 2P11A 1C4WA 1KYWA 1BC5A 1OXBB 2GHRA 4WLOA 2XR1A 4EF5A 3PD1A 1EK1A 4Z8YA 2X0EA 1G8KA 2GN6A 2X4LA 4MB6A 4MVCA 5A3JA 1JXMA 1UBMS 1A76A 5B2FA 3ETDA 5AVZA 1DLIA 4L2IA 2AN3A 4PICA 5BV8A 1UBTS 2VHZA 1E9FA 4INPA 1QDLB 3FAKA 5IKMA 3OPYI 1YR3A 3SJCA 3DBVO 3DD1A 3C3JA 3EGDB 4QJBA 4Z7JA 2OE2A 2Z9BA 4O4JF 2GUGA 4M54A 3KM0A 1D6MA 3AFHA 3N7UA 4MV5A 4DDHA 2K5UA 2WZCA 4JQSA 3NONA 1I6MA 2ZB7A 4CDRA 3FPBA 3QG1A 4Z9XA 2RBEA 4AJKA 2EW8A 3BAFA 3EIFA 2CNWA 2EEPA 1NZJA 3JALA 4GLBA 4WCVA 5EQFA 4UUBA 2LGJA 1N77A 2G5CA 2GJ9A 3D6TB 1TIKA 2OWEA 1NX9A 3NU1A 3I64A 3P32A 4ER5A 1QP0A 4DQDA 1B0PA 1KEUA 1KYYA 5ESRA 4IIVA 2GTHA 4P1ZA 3IRUA 3QI2A 5DHRA 3E3NA 4EKNB 5E6RA 3Q6MA 1I80A 3K6KA 1MZVA 3WYBA 2MYPA 1S1MA 1MJHA 1WCWA 4MUHA 4A6EA 3R9WA 4YV0A 5DBIA 2IYXA 5J63A 4GPD1 2AQIA 3TDKA 5LOVB 3OLYA 3EDOA 4BKOA 1AHNA 2D4HA 4M21A 2HI0A 1FFAA 2BI4A 1ZGAA 2HKIA 1ICIA 3N6VA 3P9QA 4L73A 3ZVNA 3SD7A 2AN4A 2PKYX 4OHFA 3TIFA 1MQSA 3A6FA 1HE4A 2JBHA 1BGXT 1LDYA 2ODWA 3DCNA 1O96B 2XNCA 3R5JA 4EA8A 4YACA 3ZHQA 3GGGA 1SUDA 2WUWE 2JLAA 4Y2UA 4YO7A 5LZ5A 4B8WA 4Z1OA 5DN6D 3BE5A 2C7GA 3KAJA 1E59A 1RCUA 4CKXA 4HX9A 5DMHA 1O95D 5AD1A 5K09A 2IHNA 4HFRA 1DKNA 3D3JA 4PZEA 4CMBA 1AJEA 1SUAA 2HY7A 3BORA 2YH2A 2PBLA 5I6DA 1PGJA 2FPUA 4PZZA 1YJCA 2FUG1 3Q7SA 1WQ3A 3CURA 4KZPA 5G1PA 1D03A 4A8PA 3TX6A 5SZIA 3DTVD 3E6AA 3T7TA 2YL2A 3F2VA 3QNUA 4XQ0A 1Y48E 4RZSA 3DVAB 4OQZA 3T3EA 1L5SA 1CF4A 4IMJB 3O8OA 4WK0B 2QV0A 3NHJA 5FAXA 3A9SA 4V0SA 4WW0A 3U9SA 3W2EA 4QFBA 1RQRA 4E2FA 1DAEA 3K70C 5HA5A 4CQNA 1GNQA 5LKRA 3CH5A 4I2VA 1MUUA 4M0LA 4M0EA 4YR7A 1KNQA 5IM4F 2FU5C 4J90A 5IASA 1LPBB 1ZUD1 1WRBA 1L8XA 4RVNA 4OIMA 4NNJA 5KOJB 2P9BA 1CSEE 1TUEA 2PRYA 3FJYA 4FX5A 4PLPA 4WV3A 5TMDA 5E3JA 2J9FA 1HWYA 1GA4A 2P1ZA 2W8BA 2WOJA 5CT6A 1Z25A 1YVRA 1NVMB 2PAAA 2ZAYA 1RAFA 4TXNA 4XB1A 3V4SA 4XWKA 2BFBA 2HOQA 2D62A 3NPAA 3LDGA 2BGWA 2JAPA 4MIYA 1AMUA 1MAAA 1TQ6A 1X7WB 2PZAA 5CIWA 3CR3C 1GRVA 4OHWA 3QZUA 3EY4A 3M5PA 2BGKA 1EGVB 2C95A 2VRWA 3I6BA 3DEYX 3C8ZA 3OX3A 4XDGA 5CM2Z 1ADCA 1L5QA 4IJQA 3K0FA 1VSVA 3MHPA 2AZDA 3REFA 2HAEA 3ZE1B 3GR6A 1NW4A 1K08A 2FA9A 4Y8VA 4I6JA 5SY9A 3AVPA 4M22A 4HXFB 1GPDG 4P0TA 4BGUA 2ILVA 1E9DA 2VHJA 3H83A 1KI6B 4L1KA 4Q05A 3TLYA 4FC7A 3ELYA 4CFSA 4O4JB 1DIGA 2BHRA 2IY9A 1NVAA 4OYHA 2J07A 1FCJA 1SXJA 5IBPA 2JFPA 3ESBA 1K6IA 4ZV9A 3AC0A 4RF3A 5P8WA 4DJTA 1HE8B 1E3DA 4Z4EA 1COWD 3KV3O 3I61A 3HJNA 4OY3A 3W5JA 1KGDA 3DCJA 3HEAA 4HR7A 4H7JA 1WMFA 3PRJA 4W4TA 4GNRA 4HJRA 3W2TA 3ZIAD 1VZ2A 1XDGA 2WG1A 2YNMA 4YH1A 2UXCB 3DT8A 2ZIAA 1G7CA 1UWVA 1DEXA 4G1FA 2D8MA 4QA9A 3TK1A 1G7TA 1RWVA 1U1IA 3LSTA 1RQLA 3DXZA 3UGQA 1XMQB 2NTVA 3HDGA 2QY9A 4YHHB 2XRYA 3OT5A 4JOQA 3TW8A 3VSAA 3ITDA 3W77A 3HFGA 4CNQA 2XVAA 1IBLB 1AHHA 4K88A 2X0DA 4Z4CA 1NUTA 1OT3A 3OQMA 1QG4A 4TKLA 1K4YA 3RUAA 3PZBA 4AP9A 1RAGA 3LYLA 3UMBA 2OG1A 3QFTA 1NVFA 3LYUA 3MLEA 5J2UF 1WG8A 3ZZUA 4MRNA 2OAP1 3EBLA 3A1TA 4N8DA 5TMBA 3U4QA 1FX0A 1C0IA 1W44A 2IHJA 4CKYA 4EG5A 2B69A 5EZ5A 5E9AA 4AKEA 2R0QC 1QUEA 2J5BA 2A88A 4KVZA 4AZVA 4FDMA 1UBHS 4H15A 2EIXA 1QZTA 3ESDA 2Q5CA 1XKXA 3QVGA 1QH8B 1Q74A 5ERXA 3D6FA 2FVXA 5AK5A 4PPNA 2CE2X 2WVJA 3NTOA 2ZRIA 3ENNA 3DSRA 4FQ8A 2I5PO 4DA9A 1Z5PA 3DB1A 3SLKA 3HV2A 3KCQA 4AC9A 4V1CA 5IS2A 4AMBA 4YQEA 3D7MA 3T3PB 5KKNB 2OK8A 4WCFC 1SXHA 3R09A 1R5OA 4A6DA 5AW4A 3KJZA 3PXGA 2Q7XA 1KEEB 4Y2QA 2DUUA 5H02A 1P44A 2WHEA 1N36B 1LVUA 1V8FA 4ZU6X 1N4DA 5F12A 4MGZR 4UHBA 1R0LA 3FPGA 4KQKA 2PT7A 1PFYA 5EWMA 2CN1A 4ZYYA 1HTWA 4HY3A 4WL0A 3K0HA 3FPJA 4P31A 3UPDA 3AR6A 3QXGA 4JEHA 5ESWA 5LLDA 4EHFA 5C7LO 2HMWA 4CCYA 3C39A 4CKZA 1UKYA 2G8LA 2O5CA 3VHXB 4ZGGA 4E2XA 3AIKA 1SFRA 2QUZA 5FAKA 4PAOA 1WLSA 3BD7A 4G9BA 4PAWA 2WMNB 3GJ8A 2WB4A 4DBLC 3BICA 3EB9A 2DFVA 1X7XA 5MGBA 2P7IA 2PAFA 2HBRA 2QVBA 4MIOA 1I8TA 4BO4A 3EZ7A 3FGNA 1ISMA 4EYGA 3GJ7A 5HPYB 1PZHA 3BGSA 3MTAA 2VWQA 4TTPA 1ODSA 4WOJA 4U7FA 5AUQA 4K8RB 3W34A 1IPHA 1IY0A 1YGYA 2VDRB 4GXTA 3FOEC 3IUEA 3BPSA 4EW6A 3LPDA 4DV1B 1EDZA 2FHSA 4ENRA 1Z56C 2WR8A 1RACA 2Q6IA 4ARZB 3V7UA 1GPUA 1TJ3A 1VCOA 4X1YA 4HLCA 4PNZA 3KOUA 4B87A 2I2WA 3M2PA 5F4ZA 4FBMA 2X9NA 3QMVA 5DK6A 5BNZA 5CCEA 3RF6A 1GYRA 2VHVA 5LM3A 2C20A 1E4YA 1X92A 2BEWB 2LNDA 2OCGA 5FOWA 1W9MA 2A9VA 3WFZA 4TV9A 4KQ1A 4EHHA 1EK0A 4F3RA 2C94A 2I7XA 3U17A 5KTNA 3PFCA 3TTXA 3KZNA 4YCSA 2AF3C 4RX1A 4X60A 5IVKA 5IJ9A 1W7AA 4Q3CA 3JPWA 1N92A 2ZSAA 2UV8A 1Z6AA 3P9NA 2P9ZA 3RBXA 1RRPA 5JZ9A 2QENA 3B7GA 3EGEA 1U1DA 4RK4A 5CDGA 1V43A 4RH3A 1QS0A 3NHSA 3CWZA 4N39A 4U7JA 3UFXA 1UJBA 1JV2B 1IHXA 1XAGA 1T2NA 1OIVA 1K3FA 3OU2A 2DULA 3M81A 4YDSA 2AD5A 2Q1UA 3D9QX 3N8KA 5DVZA 5E4JA 1AZSC 1YDHA 1THTA 1VA5A 1HETA 2HJHA 1D2HA 1U7OA 2J5RA 2RGEA 4OHCA 5AKXA 1TUGA 5BYJA 4LBYA 3E1GA 1GOTA 4B9AA 5AUNB 1FVFA 1NJ2A 1X7ZA 3IV6A 4RWEA 1CHDA 4OHZA 1MB2A 5EKTA 4A2PA 2ZUCA 5IN5A 4DG9A 1T26A 1BXKA 2FWRA 1USKA 3G1TA 3K9HA 5CCDA 3UC5A 1E32A 2A5JA 2DJIA 1L7OA 4E03A 3MQ2A 3HO8A 1JG7A 1L5VA 2NZVG 5JALA 1F2TB 2GZ1A 1ECPA 5IU6A 3QU4A 4ETMA 1JGTA 2JIDA 3FUUA 1VBFA 3C3CA 3D1VA 4HPJB 2WKQA 1L4UA 4QATA 5H59A 4A0RA 4RC9A 3AY6A 1W36C 3C2QA 2JANA 3GJ6A 2V3WA 4L76A 4LCEA 5DTMA 2RH9B 5E95A 4YLGA 3ROEA 1RBMA 3E7PA 2C84A 5AVKA 2DQYA 1GFIA 1Y1QA 3M0EA 4RHUA 5TV2A 1OB2A 3OKPA 5IUKC 2ZW9A 1ZGBA 3PC4A 3I9FA 3NUQA 2VWPA 2ZYGA 5DW0A 2FPIA 4CTJA 2FFHA 2JGFA 1E79A 2ZIXA 1ZD8A 1N8SA 1Z8HA 1ZK3A 2OZLA 5C0OE 4E7PA 4EY3A 4CKEB 4PR3A 5H70A 1KMCA 5CVCA 3SVZA 1TLLA 5LN1A 2VRCA 3DTNA 1I2BA 3ZCTA 1Y82A 3LLVA 4AIRA 1YZLA 1MO4A 3HSKA 1EZ4A 1PZNA 3NUZA 3PGVA 2IHVA 3DVQX 2RGAA 4G8BA 5JTTA 1OLXB 2E4AA 2HA3A 1EX7A 1U0SY 2Q3CA 3LA6A 3MOSA 4IJ6A 4NV0A 2PT6A 1CETA 1EUCB 1OLSB 2PTGA 3O8CA 1IQ0A 1UPXA 4GDMA 2Q3JA 4EPTA 2CFSA 1U2SA 5LUBA 1XO1A 5A9SB 4JI5B 1Q19A 2CUKA 4YMTA 4NH0A 3RIHA 2EZ8A 1C5KA 1ZVMA 2WZBA 1LLCA 4PX5A 2PLWA 3KSDO 3DWFA 3OSZA 4GSLA 1XRLA 4JN6B 3KVYA 4QU5A 3V1KA 1YK1A 1MVNA 2W2LD 3AR9A 2HPZA 3C98A 3GUHA 2JFQA 4N18A 4NCHA 2HHHB 4YBZA 3WRVA 1WNFA 3PE4A 1U2RA 1QF6A 1XJ5A 2V54A 4N5DA 1VMDA 2H4YA 4OP1A 1TF7A 3UHPA 4GLFA 1GSOA 5LFAA 5I3ZA 1TJNA 2B8TA 4FGSA 3H19A 1Z08A 1W8IA