3CRNA

Crystal structure of response regulator receiver domain protein (chey-like) from methanospirillum hungatei jf-1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
129
structure length
128
Chain Sequence
LKRILIVDDDTAILDSTKQILEFEGYEVEIAATAGEGLAKIENEFFNLALFIKLPDMEGTELLEKAHKLRPGMKKIMVTGYASLENSVFSLNAGADAYIMKPVNPRDLLEKIKEKLDEQEKEGHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Response regulator receiver domain protein, CheY-like
publication title Crystal structure of response regulator receiver domain protein (CheY-like) from Methanospirillum hungatei JF-1.
rcsb
source organism Methanospirillum hungatei jf-1
total genus 47
structure length 128
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3crnA00
2AYZA 4MRMB 3BILA 4N76A 3FFWA 4MLCA 5TPWA 2ID9A 3KS9A 4EVSA 4XARA 3RQIA 2PUDA 2AYXA 4LE0A 4ETNA 1Z13A 3D8UA 3MMNA 1K66A 5IC5A 3H6HA 1KGSA 4YRZA 1QP4A 4RK4A 4ZJPA 2L2QA 3Q7TA 1NY5A 3CZCA 5E3JA 3C3WA 3HUTA 4KREA 4F12A 3LKBA 1TJYA 4L85A 4QYMA 3NHZA 1MB0A 2O20A 2ZAYA 3FFXA 1SXIA 2NUBA 3FGZA 4MR7B 4UHKA 3UUGA 5C5EA 2GBPA 4RK5A 1JFSA 1OXBB 3OMWA 1PUXA 4MQFA 2Q5CA 1KRWA 4Q7EA 3JTEA 2PL1A 4JAVC 3CG0A 4WT7A 1JWLA 3C6QA 1J56A 1FFSA 1ZN2A 2VK2A 3DGEC 3MM4A 5KI6A 3HDVA 1S8NA 3ILYA 2I6FA 2HSGA 3H5VA 3O75A 2L19A 5KQGA 1JYEA 2FQXA 4N0PA 2A9RA 2HQBA 3OLVA 4IMJB 2WJAA 3OLWA 3JPYA 3HUUA 1GLGA 5EWLA 4E7OA 1VRVA 1ISRA 2JK1A 2XDYA 1U0SY 4EYOA 4E7PA 4HNQA 2QVCA 5KQLA 2B4AA 4JB2A 2PKXA 3EQZA 3Q7RA 1DCFA 1LJLA 5TPZA 3FFTA 1ZESA 1D5WA 2A9QA 4WXEA 1VLZA 5C5CA 4XASA 3JVIA 2BGGA 1NXOA 1YS7A 1PNTA 2FN8A 3KLNA 4PZ0A 4RXUA 1CEYA 4MPTA 1RZRA 1W9HA 4FE4A 4KFCA 5JNWA 3FMVA 1U2QA 2VYCA 1YK0A 2CHFA 1E2BA 3SAJA 2E4UA 4NCBA 1LK0A 5JNTA 1K68A 1NXSA 1JYFA 1Z26A 3N0WA 5HM6A 3P9YA 3C97A 4YV7A 2E4VA 5JNSA 1ISSA 3BREA 4Z4CA 1USKA 1DBQA 2CD7A 5CNMA 4YO7A 1LBIA 4HYEA 1SXGA 4PYRA 4JOQA 4G0MA 4Z0NA 4YLEA 3CTPA 4Q6BA 3KG2A 2RGYA 1NXXA 2J48A 2IPMA 2R4QA 1TM2A 5BQ3A 2VUIB 5IUNC 1RXEA 3IP7A 4L4UA 1QO0A 4EYKA 3IPAA 2M98A 3GBVA 3O2SB 3IP5A 2QW1A 1L5ZA 3N0RA 1C0EA 1F4VA 3H5TA 3CRNA 3LUHA 3TB6A 3NNNA 1LBHA 4RK7A 2NZVG 3QLUA 3EQ2A 3HCWA 5D2CA 1JF8A 4Q6WA 3OO0A 1XHEA 4RK6A 2FLWA 2IPLA 5CHYA 4XLTA 3H5WA 4LDZA 3HV2A 3OQMA 2LP4Y 3LUFA 3CZ5A 4KPYA 3H75A 5BR1A 3GT7A 3TO5A 1I3CA 1JX6A 4XAQA 1ZITA 1GUDA 1ZDMA 4YCSA 3QLUC 4RDCA 1TMYA 4M88A 3URMA 3LUGA 5IX8A 1TLFA 5IUJC 5DKFA 3F73A 3OM0A 4Z4FA 1YVUA 3KHTA 3I5AA 2L17A 1KMIY 2MSLA 2RJOA 4TMYA 2WWVD 3RVLA 7ABPA 1WETA 3L49A 2F8TA 1CYEA 2PJUA 3UK0A 4PICA 1U8TA 4MQEA 4EVRA 2FKAA 2PE5A 3O1JC 1URPA 3QEKA 4KQ9A 2FTKE 3CHYA 1L5YA 4RY9A 4DN6A 3EULA 5HSGA 3A10A 4ZYLA 1APBA 3LUAA 3GRCA 1QKKA 2PL9A 3IDOA 4XFKA 4Y9TA 4EYGA 1EHCA 4FB4A 4ETMA 3ILHA 3SNKA 4N03A 3Q15C 5T7BA 4HNRA 3K9CA 3MF4A 1ABEA 4F11A 5JNUA 3KJXA 3UKJA 3KYIB 4IRXA 4JB0A 2FMFA 4LX8A 3OM1A 3I09A 3QLTA 4N41A 4WZZA 2FMKA 4TLMB 3TX6A 1GCGA 3QEMA 3RVNA 5DCLA 1BDIA 5TPZD 1M5TA 3ROTA 3R0JA 3GBPA 1JDNA 3H5LA 1YIOA 3F6PA 3C3MA 4MS1B 3T95A 1SRRA 4H3KB 3DLBA 3H6GA 1A2OA 1DRKA 2FEKA 2PUFA 2FEPA 1RZRD 5TQ2A 3N8IA 4MAAA 1FFGA 1NATA 3LMKA 2OQRA 3MA0A 2NZUG 3BBLA 3EODA 4G0QA 2PUAA 1MIHA 4LE2A 3T6KA 2IOYA 2E4ZA 4DADA 3NBMA 5I4CA 3DLHA 3QELA 3RVJA 3SQNA 4W5NA 5B3JA 3TMYA 2JBAA 4PEVA 1JFTA 3N53A 1CHNA 5IULC 2JRLA 1AB6A 4Z4EA 4RU1A 1QNLA 4RWEA 1EWKA 2MSWA 4MS4A 2WRZA 4RXMA 2HQRA 4GPAA 3RH0A 3QLVA 3CS3A 3DZDA 4ZMRA 3D02A 2MSKA 1D2AA 1E6LA 1YMVA 2LPMA 1UDRA 5TPWB 1OXKB 3E3MA 1TVMA 1Z15A 4N0QA 1PEAA 3M9WA 1JBEA 1PNRA 3RVPA 2CWDA 3O1IC 4FE7A 2PUEA 4NV3A 5B3JC 3LOPA 1JDPA 3I42A 1JFVA 4EUKA 1QPZA 4KZKA 4RV5A 3KYJB 2FMIA 4JP1A 4NCAA 2MYUA 1BVHA 3IPCA 3JVDA 2PUGA 1D1PA 1JL3A 4DQDA 1NXWA 1RPJA 3VNAA 2QR3A 2IYNA 2VUHB 5GQSA 1DC7A 3QEMB 5KQPA 4YS6A 3LUDA 4MQFB 3HVRA 4G0YA 4KNYA 3RVRA 3H1FA 4TN5A 1DP4A 3F6CA 4QPJC 4S05A 4MGEA 2X7XA 4F3TA 1DCKA 2N9UA 3W9SA 4EYQA 5ABPA 1QQBA 2IDMA 2ZWMA 5F64A 2R48A 4YP9A 4RY0A 1F51E 1PEYA 2H0AA 3HEBA 5TQ2B 2IKSA 1Z16A 3MQ4A 4MR8A 5KC8A 4OBBA 4ETIA 5CNIA 2GWRA 1B00A 5EWLB 3QX9A 3K4HA 4YGXB 2NT4A 1DRJA 5KWSA 1VKRA 2A9OA 1KRXA 2GX6A 4HNSA 3GYBA 3O21A 3T38A 3T8YA 1DC8A 3EAFA 5DGCA 4KRFA 4GNRA 5EWJA 1P6UA 4D74A 3QELB 2F8SA 2B1JA 3N0XA 1EWVA 3O74A 4H60A 3EDCA 4WUTA 3CG4A 2M1ZA 1BDJA 1M2FA 1U2PA 3HJFA 2YHBA 1T34A 1MAVA 3QX8A 2RDMA 1Z2DA 4G86A 5DLEA 4RKQA 1Z12A 4KVFA 4WXMA 9ABPA 2QV0A 1A0OA 3OMXA 3HSYA 1XHFA 1ZH4A 3OLZA 4D6XA 3SG0A 3I45A 1MB3A 3H1EA 2P9HA 1FQWA 2LIVA 3SY8A 3F7NA 5JS1A 4P98A 2V0NA 2TMYA 3L6UA 5TE9A 4WWHA 2GI4A 3A3KA 5JS2A 1QP7A 1EAYA 1ZHHA 4ML3A 1SD5A 2IPNA 3O2JA 3RVOA 3G85A 1QQAA 3CNBA 3OQNA 3Q7SA 1MVOA 3CU5A 5ED4A 4JASB 3EGCA 5EWMA 1ABFA 1DJMA 1R8JA 4LDAA 2FMHA 4NICA 2FLKA 2JCGA 2IPAB 1GCAA 5CNKA 1Z17A 2R47A 1P6QA 4ZMSA 1NXVA 2P4UA 2PMCA 3LTEA 4F06A 1YTUA 4RS3A 4OLAA 2WMYA 4KMRA 3KSMA 1NXPA 3M9XA 4W5TA 4XXHA 3Q41A 5KQMA 4W5OA 1ZY2A 4EGSA 3RVKA 2FXIA 3S99A 3KTOA 3OO1A 3IP6A 1NTRA 4ZPJA 4MR8B 2LBPA 3A0UA 4LE1A 3HK2A 8ABPA 1JHZA 2NT3A 3CLKA 5KC9A 3CFYA 1H9CA 1P8AA 4W5RA 2QZJA 2HJ9A 1EFAA 4KK3A 4RZSA 2FSPA 1DBWA 1QMPA 1YK1A 4IMIB 5IBQA 4G0ZA 1QP0A 5BRAA 2H3HA 3HDGA 2QU7A 4TLLB 5EWJB 1FSPA 1BAPA 5T3YA 1E6KA 1DZ3A 4O5AA 4Z4IA 2JVIA 2PUBA 2QSJA 4UHJA 3LUKA 2L18A 4MLDA 4QICA 1DG9A 3LUJA 3KLOA 4O1HA 5TQ0A 4Z9BA 1U04A 3MIZA 2FEWB 1QO0D 3NHMA 1EWTA 3O1HB 3O2QB 4F8JA 1HEYA 3HM9A 5FWXA 3HZHA 4RY8A 3G1WA 4MQEB 1D1QA 1M2EA 1P2FA 1USGA 3E61A 3H5OA 3JPWA 3LFTA 4RSMA 4G97A 5HQJA 4JA2A 5FWYA 2E4WA 2FQYA 3DBIA 2MYTA 1Z25A 4RK0A 2E4XA 3HO1A 4MS3A 4Z9AA 1IIBA 1NXTA 4YR7A 4IILA 3TD9A 4EY3A 1JH9A 1VPWA 1C4WA 2FQWA 4H3HB 3A0RB 4G0OA 2CHEA 5IEJA 2WB4A 3MYYA 3QK7A 4MR9A 1Z18A 3BRQA 4CBVA 2JVKA 3QLVC 3JY6A 5BRJA 5EWMB 1ZAYA 4KV7A 4MRMA 2LUOA 1BA2A 1YS6A 2QVGA 3C3KA 2FVYA 4PE5B 3RVSA 3CKMA 3N6VA 2QXYA 3M6MD 1M5UA 5IUKC 1YMUA 3GV0A 5DTEA 3BRSA 1DCMA 5JNVA 3HXMA 3RVQA 6CHYA 4RKRA 3OLXA 1Z2EA 4P1ZA 5HKOA 6ABPA 2FN9A 2RJNA 3HS3A 1A04A 1Y1LA 4IF4A 4NQRA 3JS5A 5PNTA 4OLBA 4B09A 5GOTA 1ZGZA 2MYPA 5IEBA 4MR7A 4LZLA 3NNDA 1ZH2A 2ID7A 3LKVA 4Z4HA 1W25A 1FFWA 1XWWA 1LJUA 3SM9A 2PAFA 1PHRA 1RXIA 3ROFA 1DBPA 3RVMA 2JVJA 2KYRA 4MS1A 4O1IA 4D6YA 1D4ZA 4EVQA 3IP9A 2JBAB 2E4YA 3LUCA 1RNLA 2MYNA 1ZGGA 4LRQA 2GKGA 5TQ0B 1ZVVA 3GWGA 4OTZA 2DRIA 3DGFC 4MS4B 2YHAA 4QYWA 2WY2D 2R25B 4MYRA 5FWXB 4Z4GA 3GL9A 3KCNA 3Q9SA 2PUCA 5CNJA 3NNSA 4RK1A 3FDFA 2FW0A 3N75A 4G0XA 3B2NA 5FWYB 5FBHA 4KQCA 2HPHA 4Z99A 4YWHA 4MS3B 4KK4A 4S04A 3VNBA 1USIA 5JNRA 1SXHA 4W5QA 4IGAA 1E6MA 4RXTA 4N47A 4OG2A 3OLYA 1JLKA 1AB5A 3KKEA 2PLNA 4OATA 2A9PA 2HQOA 4G0PA 3EJWA 3H5IA 3GA5A 4MR9B 3H1GA 5FBKA 1BDHA 2W42A 2WJWA 5TQJA 2OENG 1GUBA 2JB9A 3OQOA
chains in the Genus database with same CATH superfamily
2OO5C 2EKBA 1RYDA 1PR5A 3NEYA 3BILA 3Q5EA 5HF6A 3TNFA 1C1DB 1RFGE 4AJPA 2ZR7A 1YZHA 2RGBA 4Y2HA 5CURA 1UBMS 1YS4A 3H7AA 1YKGA 4ME6A 4RVDA 3T0FA 3FJYA 3FUWA 4L16A 1RXWA 4IUBS 1K66A 1TB4A 3Q87B 2C57A 2OPHA 3R0ZA 4ZAXA 3UWDA 4AURA 2ZRMA 3BICA 4K9RA 2WAMA 2L2QA 3PC6A 4KQ1A 3GGCA 4NOMA 3VPBA 3ZGNA 1Y0BA 2J6HA 4FQ5A 2G1AA 7GPBA 4AY3A 3F9CA 4WOCA 1I1OA 1N3LA 1XQ9A 4ZOBA 5JNLA 1SCIA 3I2GA 2HMVA 1TJYA 5EIHA 3ORSA 1MB0A 1IU9A 2IITA 2ZAYA 1TGVA 1SXIA 2CXOA 3L4BC 2CXHA 3P26A 4QHTA 4BWVA 5IBCA 1XTJA 4ZAYA 1JMVA 1BVUA 2GCIA 1L7EA 4PZLA 3SIXA 2PSFA 1G3RA 1F0YA 1XGKA 4O4LA 5HGXA 2IH5A 1BH2A 3LP6A 4Q9JA 4Q7EA 2J1LA 2JIOA 4IO0A 1OBOA 3JYOA 4XUGB 2WTEA 5CGQB 1A2QA 5JWRA 1ISJA 1ZN2A 2O3TA 2ZJ5A 3KHKA 3MM4A 3O7WA 4RMHA 4WRRA 2GMWA 2D5CA 2CFIA 2VDJA 2VNIA 3FYTA 2O6HA 4JR2A 3D3KA 1YACA 1ZGHA 1R15A 3TDMA 1U7PA 2DSTA 3E15A 4ZALA 1XRJA 3SR3A 1YBFA 2XVXA 3OLWA 1M2HA 2JGRA 2P1DA 1I5OA 4HVTA 4DJTA 8ADHA 2HHJA 5LCXA 1E1MA 1BROA 5CX4A 5FJIA 1HMYA 2FQQA 4RPKA 1AZWA 2QVCA 4CQMD 3JQQA 3RKRA 1OB2A 3CUYA 1U9CA 4XRRA 4AG3A 2W6MA 3FFTA 1SK9A 3M3HA 2VBIA 4HNTA 2QX9A 5B7PA 3AHHA 3CVOA 4U2KA 4U6QA 4BTLA 3VPFA 2WIDA 4NZZA 3LT2A 2Y6UA 5LKRA 1RYHA 4ISBA 3LUBA 2HC9A 4XASA 3JYPA 2ZDHA 3G2PA 4X94A 1JUDA 1QGED 4PZ0A 1S7GA 1FP4B 1GT91 2Z83A 4XGKA 1BKDR 2VT2A 1YR8A 5JNWA 4WGFA 4U2FA 1QH9A 2VJNA 4GXTA 1W52X 3OECA 3N2LA 4JQSA 1C7JA 2WK1A 1JYFA 4H7HA 3W9UA 3N0WA 1JNYA 4GW3A 5BSFA 5LLTA 3UXEA 1KZYC 1CDDA 3L0IB 1JN0A 4LWPA 1CF2O 1DAIA 2IU6A 2IOQA 1OBVA 4HYEA 3RYCA 4CKBA 1I94B 4DT1A 5C8YB 4O2BA 5EE1A 4B5KA 2DH6A 4OD0A 1TYZA 4DBVO 3F7TA 4XVCA 3DZIA 1P80A 1QJ4A 3WADA 1XTSA 4CUKA 1U28A 3N2IA 3L8MA 1RXEA 3VI3B 4E2YA 1XMOB 1KERA 1FBTA 4LY3A 4C14A 4UVDA 2WG2A 2BZ1A 5BYBA 5P8WA 1CJBA 5T4EA 4LZAA 4US0R 3W7AA 4CWAA 1H6DA 1S4QA 3AYXB 1LBHA 5CM9C 5DT9A 2ZRJA 3HVKA 5DX1A 4CHGA 5HKLA 2P2YA 2ZT7A 3CLVA 1QIHA 2FB9A 5GZ6A 5HFNA 2ZVPX 4WGGA 3BGVA 1OFIA 2XWQA 1NM5C 1EE2A 1F2VA 3S27A 1USVA 5LXTF 3ZHTA 4DJEC 3L5KA 4PBRA 3RFTA 1YHZA 5B30A 1NX6A 4Y6PA 1SULA 1Z3CA 4BP1A 2CHVA 1GR0A 2AOUB 3JQGB 2CLCX 1HKHA 1PT8A 4XAQA 5BSUA 3K1AA 4DDUA 5DOZA 1GUDA 3DTTA 4YCSA 3RSLA 3RIEA 4C89A 3H83A 4AU1A 3RHSA 3LPAA 3PYXA 3RUCA 3FUCA 5HDBB 1F2DA 5CGZA 2A94A 5BW6B 4BWFB 1FJHA 1YONA 1UCFA 4RIHA 1COZA 2Z8XA 1RJ9A 3G5MA 3I5AA 16PKA 4F60A 4MYHA 2QN7A 1V3QE 3BXPA 4N7BA 1QVAA 4QUAA 3RVLA 3X3HA 1UZMA 2OLJA 3G0HA 1EEXB 4GI7A 4DMUB 1UDXA 2VF5X 4QEKA 3SX0A 4F2HA 2CKMA 3R5KA 5KOHA 1NW3A 3GFPA 2BEVA 1E8MA 1AS0A 2D1RA 4O6VA 4NKRA 2FTKE 3GK3A 2FPRA 1FNNA 4GVLA 4QHYA 1APBA 3QW2A 2FSFA 3A32A 3L1JA 3M0EA 4HNGA 2HJRA 1E9DA 4G09A 4X6XA 4EA7A 3HQ4O 1U5AA 1GPMA 4H1HA 4XH9B 4F21A 5JDIC 3DMYA 1X1DA 4P35A 3ZR4B 3R23A 4DPMA 2QB5A 5I7RA 1PTJC 4GI5A 2OBBA 2JAPA 3E03A 3EDQA 1D4FA 4B3RB 1YZQA 3KJXA 2GZMA 1XALA 5C31A 1Z47A 3H19A 2QRZA 1KEEB 2Z5VA 1E5VA 4ZC8A 5BXYA 1KAMA 2Q3DA 3QLTA 4YP1A 3VV3A 1B3RA 3CRRA 4D1YA 1E79D 2AUMA 3HU5A 3IUQA 3QVXA 1RRMA 2GFIA 1M75A 2GCEA 3HACA 3OEWA 2GAJA 4IUYA 2QG9A 2FEOA 5KJ1A 1QIGA 2EFEB 5FUWA 4ZOLF 4DZRA 5A1JA 4N49A 2O5EA 2BCEA 4WBXC 5CUQA 1PYDA 1MOSA 2C82A 2CB9A 3CRMA 4FE3A 2EBFX 4WEOA 3ZS8A 4BQEA 5I6DA 1L9KA 4Y6GB 4KDEA 3ACDA 4D99A 1RJEA 1NJ8A 4OV6B 1AXEA 1BGVA 3LBNA 4K6FA 1AN0A 3H3JA 3RK0A 3V1TC 5AUOB 5I8PA 4S1PA 2GPAA 4Y9UA 3ZZ1A 3N7AA 4CLRB 4AMVA 4CR8A 2DQKA 1Z4KA 2QL6A 4BX8A 3LS2A 1IUPA 3R76A 4EYEA 3L92A 4FMDF 3QVWA 3VC2A 3SVTA 3JR7A 4IGFA 4N18A 4KR9A 1PT9A 221PA 1OJLA 4ESOA 3HNPA 2WYIA 4BLVA 1DT5A 4R8LA 3OLCX 3ZK8A 3MC1A 3AFNA 3G5AA 3B48A 4HBZA 3GD7A 2JJMA 1RXVA 3W0LB 3GN2A 4N0EA 1QCCA 4F1JA 5CT8A 1JLMA 5AK6A 4ZZ3A 1OZHA 3C0KA 1XAJA 4EKYA 2ZUEA 3QLVA 5BRNA 1VHDA 3DZDA 5KWVA 3A3OA 3N2NA 3D02A 1C3LA 3DP9A 5FHRA 4C29A 1RLUA 1YE8A 2BZ0A 2PT9A 4ZYUA 1E6LA 5EUQB 1NN3A 5JYCA 1VE5A 1SG6A 2ECKA 3K9BA 2XKKA 2QPLA 3KOMA 2Z2ZA 1BZYA 3KWJA 1UODA 4ZVTA 3W3AH 3CF0A 3QKSB 3C3CA 2D2EA 3B1FA 4PYQA 2HXYA 1EZ1A 3VTKA 3PQ5A 4YRQA 4JUIA 1FS5A 2YN0A 2ZS9A 1T4MA 3MB8A 5K8TA 3FBTA 4JP1A 4JU9A 2MYUA 3ASVA 3RNOA 2BC9A 3IPCA 1T1IA 3OE7A 3C1UA 1KAOA 3BL6A 5JPIA 4DIKA 2J3LA 1JR6A 1ORVA 3TR5A 2NUTB 2OGZA 4TKUB 1B1CA 1DEKA 2D2VA 3ICOA 4X61A 4X85A 4JDUA 2MDTA 2QTBA 4D9HA 1L5HA 1RI3A 3D2CA 4YS6A 1ZVQA 1BMDA 3O8DA 3H1FA 1A77A 1BJRE 1ND6A 2B2CA 2BUBA 2F3PA 2XB9A 3A9CA 4QPJC 4Q4HB 4COKA 4EJMA 4HYYA 4D8UA 1A8IA 4CLHA 5IJZA 2WD7A 1I33A 3MRVA 3DKRA 3GDFA 1SUSA 1YGYA 2AEMA 4YJ3B 1YIDA 5IM4F 3P20A 3VOSA 5COAA 3CGGA 3ZK9A 5CA0B 5HZMA 2X3FA 4B2LA 3O9ZA 3EF1A 3O5AA 2HDHA 1J90A 4G9EA 3N9IA 3WGLA 4KPFC 1U8FO 1PNVA 2C94A 4YRGA 4TX1A 3WE7A 1YZLA 1PI3A 2CZCA 2WICA 3C5WP 5FB3A 4BFVA 2PGLA 4YAOA 4YGXB 4DJAA 3IVMA 4LAFA 3I9V6 1SVIA 2YW9A 1Y81A 1VKRA 3E3LA 3IAUA 2A9OA 3VZCA 2X8JB 1SWVA 4Q4AB 4RACA 4HNSA 3U61B 5KDLA 1KK2A 2ZTVA 3GRYA 5FNVB 1TKAA 3EGOA 4FKMA 3W8NA 4AZ0B 4AX8A 1PT7A 1UDCA 1DNPA 2X2OA 3G88A 1O5TA 3B3GA 4I1VA 5G4KA 3VHRA 4A0QA 1KO4A 3JVEA 4CQNA 3N2YA 2PMDA 3O4JA 1LK7A 2NVWA 4O4JA 2XCQA 2DJIA 3L40A 3PC8A 3V1KA 4Q7QA 1EQUA 4QYIA 1XXLA 3TM5A 1CVRA 1NW9B 1Y8RA 2HSWA 3E7FA 2W6JA 1VRWA 5E6RA 1ENYA 3HI6A 2I1QA 3KHUA 3UT0A 2I9PA 5K99A 4MRPA 4UHBA 3IMEA 5BUSA 3IO5A 1NW5A 3SG0A 1GCIA 3MWEB 3V7WA 5IDQA 1BWPA 3LPDA 2NYAA 4BLOA 2HRBA 2V0NA 2TMYA 3L7OA 4HLDA 4M1EA 4NATA 4P36A 4NQZA 3VAAA 1GQOA 4EPVA 3TR0A 5CBPA 2OC4A 1MG0A 1ICEA 4U8HA 1Y6RA 1KVSA 3IXQA 2IS1A 3EGIA 3U56A 4P4SB 3RVOA 2CNLA 3LHKA 3VU9B 1JHRA 5A7HA 1O08A 4M7RA 5JAOA 5FX2A 5LD2C 1A9OA 4V02A 4OHRA 2DVMA 5DEIA 4M54A 1ZXLA 4DMFA 1SN7A 4XM1A 1KS2A 3IA2A 2JCGA 3OQ6A 5CYFA 2AG6A 1YS1X 4OJNA 2HA2A 3P9RA 3I6ZA 1TKRA 4MCHA 4F6CA 4HS4A 2GJ4A 3GLQA 3UHPA 3UF0A 2QS9A 4R1MA 4PX2A 2WFMA 3CV3A 3A1FA 2I0FA 4LV8B 3ZQ4A 4XXHA 1J99A 1NQUA 4GKKB 3DOIA 3GIWA 2Q4BA 1AIPA 1RRKA 2XXJA 1YSCA 1Q74A 3SEFA 4FMCF 4CLOB 2XNCA 2ADFA 3A25A 2FXIA 3BB1A 4WK2B 3VZSA 2O57A 3UIEA 4E5UA 1PZMA 1WULS 4D41A 3L1HA 4MR8B 4MQ5A 4OHKA 2G5CA 5K8IA 1SUPA 1J2EA 1DJQA 3NIDB 1KBOA 3BDVA 2R1VB 4TVKA 5I8ZA 1KYQA 2JFOA 1W85B 2CL5A 2CB0A 1L8OA 4EUFA 4MITA 4KFSA 2FSPA 1L4UA 3E2IA 3BXZA 3F6RA 1WXQA 2Q7DA 1UJ4A 4DMGA 4EHKA 1G2PA 4RWZA 4R8VA 2X9LA 3TM4A 4AJ4A 3LCJA 1SKBA 4ZT4A 1PVDA 3WWZA 4RIGA 5INTA 4M9UA 3MMZA 1I4OA 5C32A 3IE1A 1ZN7A 4KLNA 1ZVJA 1Z2AA 1SCKA 2IVFA 2P5YA 1MABA 2ZBPA 3MUEA 4CFZA 3EXG2 3FZQA 5ALIA 3O1HB 4OXYA 4L4ZA 1XI2A 1Y9JA 4EO4A 1GTSA 1XU7A 4DGQA 4MQEB 3FXAA 2O4CA 2G07A 1V7ZA 2BP7B 1USGA 3H5OA 1XQXA 3O1LA 1J4AA 4C5CA 4Z49A 5HHTA 5A4KA 2VPYA 1DL5A 5ECGC 2QN9A 2E4XA 5E8JA 4ZAGA 5FPTA 3QEJA 3P9IA 4MVJG 4JLWA 4BNTA 1E7RA 3JZDA 2HSJA 2D5BA 1GV1A 1DWQA 2DKOA 2VBGA 2ZLBA 3L5OA 4HLQB 1ORRA 5F9MA 2FQWA 3K0BA 3R0VA 1SHUX 4TMXA 3NRCA 4V03A 2OBXA 2OGSA 1U6IA 3QK7A 4QQRA 2V1XA 1TX4B 3LQ2A 2NVUA 4GPD1 2FA9A 3E5MA 5D7BA 4U9HS 1U3DA 4NFYA 3BH7A 3RJMA 1KZ6A 4MRMA 1TK3A 2HY7A 2PRKA 1MA3A 1YJ8A 1NI4A 1M6HA 3GRVA 4FYIA 4AVYA 1NPDA 1K97A 1JDVA 3F67A 3MOIA 3NM4A 4BWYA 1TZCA 3EGDA 1UQRA 3CKMA 4O4IB 2SHKA 5KYYA 3L0ZA 4RHXA 3HXMA 5I7WA 3NWPA 4B3JA 5HPYB 1G1AA 5ESRA 4L7VA 1W1UA 4LKOA 1W36D 1IIRA 5JO9A 4RKRA 5DM2A 4LZPA 2X15A 1ZCFA 4ZT5A 2FN9A 3WY9A 4QGAA 2AE1A 3TTWA 2PMWB 4JI8B 4JQZA 5A62A 4GOXA 5LKAA 3D6VA 1NUSA 2BKLA 4UEKA 2RHMA 5IKMA 1LDBA 2B8NA 1O9HA 1Q1AA 2R85A 1WO8A 1ZSNA 4MEJA 5DHSA 8OHMA 5G0WA 1R0SA 4DR4B 1WR8A 1N9GA 3U9SA 1V25A 4BKRA 3G5UA 3JQEA 1TZ2A 4Q9IA 2J5QA 1RXIA 2VR1A 4RV4A 4FFSA 5A0FA 2A9KA 2H1WA 4JOCA 1UBKS 4WZBE 4CTKA 2JNWA 1N5OX 3NBUA 4LW8A 2AOTB 4MEBA 4X00A 5G1OA 1E6EA 3DG9A 4OGKA 5KIAA 2KS6A 1VPDA 4HAUA 3T3PB 4L07A 2W6NA 5LQKA 3KU1A 4EEXA 3AJRA 4H77A 2YZ7A 4D0LB 2B30A 4YRNA 1NYRA 2EJBA 2DYKA 5CCDA 2ZUFA 2D1YA 5F1KA 4URWR 4XX0A 1MORA 1Y7LA 4NZPA 5B6IA 1Y80A 3R7AA 2J5XA 3RIXA 5K05A 4FM9A 5C4GB 3ZV3A 2UXBB 1YZ3A 3MGGA 3ADPA 1K08A 2ERXA 3ZV7A 5LQDA 4MICA 1I3KA 2PT7A 3E2MA 4IZ6A 4TMTA 5FBZA 2JGJA 1YDGA 2BI7A 1QQ5A 4MCAA 2BEUA 1XZQA 1P7ZA 4MARA 5CTJA 2FUG1 1CE8B 1BDHA 1XZDA 1KVUA 3OFNA 3CRW1 1FFXB 4NNPA 4ZVSA 2DPXA 4F2DA 1X70A 2GGSA 3AHCA 3BTOA 4YCMA 1OX4A 4EY8A 1C7ZA 1KI6A 3FCXA 3U4IA 4JC5A 5CJ2A 4J0KA 2QP9X 4N76A 2BGUA 4WCVA 4BMCA 2EV9A 2HDOA 2PUDA 1L4MA 2HXSA 2VP0A 4HMPA 4QOEA 2BCGY 3HG7A 5DHUA 4TS3A 3WV5A 4PS1A 5GONB 4BCDA 4FYPA 4CF3A 1HKUA 3AJ9A 4EF5A 3NT2A 1P4SA 1KGSA 3ONFA 3ZXSA 1IHXA 1RZUA 4QPNA 2J30A 2OHXA 3D8TA 3RBZA 3ZUPA 1QBKC 2QX6A 2BFDA 1OAOA 2O2DA 4LWZA 2YIDA 2B83A 3HMKA 4UTPA 4UKDA 1F5SA 3M6IA 4F12A 3HADA 2GAIA 4G5FA 1QTQA 2V3CC 1GAJA 5HA5A 2ORED 2XE7A 3N05A 2Q9CA 1S2LA 3NH6A 3QVUA 3WGZA 3O91A 4OCZA 4CW7A 4BJ1A 2HQSA 3FGOA 4RKEA 1QF7A 2ZI4A 3R6LA 1T13A 3QTBA 5JQWA 2NTNA 4OIFA 1Y34E 2H1VA 2Y1FA 1M1XB 3CG0A 4ZHQF 2F3SA 2HEIA 2VK2A 4AM8A 3SFVA 4TV9A 1XHLA 3OE7D 1JTFA 1XAIA 5THXA 2XXBA 5KTRA 2WM9B 4D3YA 1C0PA 3FSJX 2Q7OE 2ROQA 2VHJA 2EAUA 4IMJB 3QQPA 3PRJA 2QAIA 5MHTA 1DX6A 1E1NA 3BGDA 4ZAZA 3U2QA 3ESAA 3ROKA 4UOQA 2H5JA 3KL2A 4KJXA 4LDRA 1S02A 4OQZA 3W6ZA 3NHYA 1YZTA 5JAIA 2OTCA 4BN4A 2ZYTX 3NFRA 4EFMA 5FI1B 1Z7EA 3E9ZA 4GZ6A 2AZTA 1SK8A 2GS9A 3HJNA 4WHMA 3FKSA 2A0YA 2VHQA 5ALRA 5ITWA 1GY8A 1OPXA 4EEZA 3KQUA 2INGX 4BPBA 2Z08A 3TUZC 3HL0A 1NBMA 5D1HA 5CA1F 5BV0A 2JBWA 1NDUA 2FF5A 3V9AA 4K05A 4ESEA 1JQDA 1UJ6A 3DKKA 4W5HA 4YN3A 1W9HA 1J8MF 2YQ4A 4HEA1 3L6CA 3D6TB 2GXQA 4DSNA 2C2GA 2ZJ3A 1QHYA 5LB2A 3P4YA 3WIEA 1ZD2P 4RCZA 2BRUC 1ZGAA 2IXBA 2Y1CA 1E2BA 2D5AA 1NYTA 1YB2A 4P3PA 5JEDA 1XNHA 4YECA 1GNVA 2QQEA 3UB2A 2D1QA 4Q05A 2J9XB 3G8BA 3UHFA 3P9YA 2PH5A 3CEAA 3EQ8A 1Z38A 1E9EA 4FOOA 2W71A 1W6RA 4OFZA 5CT4A 4YFYA 4ZPXA 2E48A 1FTNA 4CKEA 3MCZA 3W6PA 4K03A 4DWVA 2YHUA 4NF2A 2UKDA 1C0LA 2FPSA 2JZCA 4JOQA 1OVMA 2DFDA 4IDOA 4YLEA 4TVBA 3VUFA 3REOA 2C04A 1R88A 2W6JD 4JY7A 1VPTA 1AGRA 3U62A 3D2BA 5BQ3A 1KY5A 2Q0HA 3MNFA 3PNKA 1XP8A 4GOJA 4JJGA 1J49A 4LTNA 4JP3A 3B78A 2B4TO 3IP5A 3L6EA 3GVHA 2OUIA 4X97A 5CFZA 4YRBA 1TYAE 4KYUA 5JR3A 4X1YA 3AUKA 1ISPA 3TB6A 1L4BA 3TQCA 3PL5A 1K0FA 3SZLA 5EY5B 2QVZX 3LUPA 4ZOEA 3L7IA 2VDWB 3SFZA 3UA4A 3WYFA 1OMOA 2RGEA 3PNYA 1CG6A 4TV8A 1CDOA 4AMBA 3Q98A 3HCCA 2PMEA 1DPGA 4B7CA 4UTRA 2O7VA 4RIEA 4U0KA 3EZXA 5A3QA 1UL1X 3D1LA 2ZJ6A 1XRRA 1QHSA 2FLWA 3OZAA 1H69A 2PKWA 4BVBA 1CQJB 4CM1A 3IT2A 3MBOA 3GUVA 3OEHA 3VVCA 1PWZA 4KPYA 3AL0C 3RC8A 5BR1A 3W2TA 5BN5B 5EJFA 4IHJB 3JQ7B 4P38A 3CNEA 3W5DA 2W8ZA 2X0KA 3D7KA 2R00A 3GMIA 4HUJA 1FUKA 4E1AA 1SURA 5LFAA 3JQ9A 4FZVA 1C3OA 4W5WA 4Z51A 3DXXA 1W4LA 2D2IA 5TT0A 2QYOA 3SJAA 3M7IA 3VAYA 1LI7A 4C7XA 3NALA 2QQGA 3IHKA 4BFCA 1L6IA 4Z4FA 4K8OA 3A11A 4Q3CA 1X7DA 4UM8B 2O2YA 3L0SA 3R75A 4C21A 4IP0A 3NWEA 3KKNA 1VIVA 1D9ZA 1R4ZA 3F7MA 1OV4A 5KAMA 5DGTA 5EPEA 3UHOA 4LGCA 4L8VA 3ANTA 2IHNA 4RLQA 3VTAA 1NVTA 3CHYA 2DAPA 4HXYA 5IJWA 4AO8A 1BGWA 5EERA 2VH2A 5EC8A 3K1YA 1GFWA 3WIBA 1Y5MA 2WUDA 5CIYA 2OILA 2VOEA 3DE1X 2NO0A 2W9XA 3BFPA 4IVQA 4DCJA 1VQ1A 5J2UF 1L7XA 1SO8A 1N8TA 1NVFA 1OH8A 1V8OA 3DO8A 5KOJA 3A6KA 1C3EA 1QYRA 3MSCA 1U8YA 4MW5A 3E7WA 1CYDA 1VMEA 4OMFG 3WNVA 2QGNA 4Y0AA 4MKFA 5B12A 1NVAA 1XT6A 1T9AA 3AKYA 3O0TA 5HFJA 2JCXA 2JLXA 5EIBD 1GSOA 1PQUA 1OGIA 1GCGA 3PNLA 4JJ8A 2HH9A 2WWIA 4BTVA 2WKPA 3OTIA 4GLLA 1L4NA 4KTTE 1RD4A 4UVHA 2H18A 2F3RA 3ROTA 4BVFA 3EEBA 4O25A 4NIMA 5F3WB 1YIOA 3DS8A 3D8RA 3W6UA 3ZNPA 2AQIA 4LGVA 1E3SA 3BMNA 2CXTA 1DO8A 2Z56A 1D1TA 3CYFA 3HVJA 1UBOS 4R7GA 5AJUA 2FDRA 3UV7A 3VOTA 4D3DA 1JJAA 1MG5A 3UUWA 2JA2A 3PEFA 1VL1A 3H6KA 3BIFA 3CB2A 3DKPA 4MAAA 4WJZA 1TVKA 3LMKA 3WGYA 2J9GA 7REQA 3SM3A 1K8ZB 1G21A 1I10A 3SYTA 3WGUA 3SJUA 1YL6A 4JLUA 1TJ4A 2DPGA 1HYHA 5AHKA 4NOLA 5FBRB 5ILGA 2DY1A 3WKBA 2C5SA 3SHTA 3ZWXA 1Y1RA 5DHFA 4BMSA 3DPSA 4N5LA 2G9UA 3T6KA 1VCNA 5JSUA 3A1EA 3KCQA 5CFRA 1KXZA 2VIIA 2HMSA 5SY6A 1AHHA 5CMLA 3PNQA 4F7DA 2D00A 4TSFA 2ZIXA 2QAGA 1YQQA 4ABYA 1SQGA 1RAEA 1ZD5A 2I6TA 3GOHA 1CJTC 2YWHA 4DABA 4LV5B 3ZX5A 4HDOB 3HBLA 3ZY3A 1HDXA 2I1VB 2ZYHA 1EWKA 4O4HA 1BE6A 3OPMA 1J9GA 2XGOA 4L2IB 3IQHX 4A2PA 5K6AA 4AJHA 1P0PA 5CAEB 2PZMA 3M5DA 3CS3A 4RIIA 2B5OA 4P31A 1D2CA 4U63A 3IP3A 3O3OB 2GPNA 2YY7A 3JATB 4LK3A 4AICA 2WF5A 5ALSA 1Z15A 2QG4A 2CFCA 2P27A 3VFDA 1PEAA 1U1EA 3KP1A 1XB2A 3M9WA 3RT7A 1NYQA 3UMCA 2CWDA 2QTVB 1WKVA 4RD4A 4ZQGA 1DIAA 1BD4A 4NV3A 5B3JC 3I42A 2OHIA 1ZRHA 2OCBA 2YXEA 4RSGA 1X7WB 3UWKA 1DAHA 3PVSA 4S2UA 4RHEA 4EKEA 1NBME 5D6OA 1SUCA 3BH6A 4I9HA 3STUA 3TB4A 4ZDWA 3AZQA 4HNAB 3DDOA 3WLJA 3QFFA 3C87A 4OMCA 3VH1A 1L5FA 1RE1A 2QNIA 4HWGA 2WUFA 4QTZA 2C4TA 3MS7A 5EGNA 4OHZA 4PIPA 2FEAA 1KR2A 3LUDA 3BA6A 1IRXA 3DSRA 4M99A 6GPBA 4KR3A 2BFPA 1RPZA 2HIGA 3HC7A 4S05A 5JIBA 1YCGA 2WP8J 4L15A 3VHXB 2ZZKA 4WXRA 4BNDB 2QL9A 4Y18A 1QQBA 4G4SP 4MMYB 3VR4D 3KETA 1MO4A 2CLEB 5KNBA 5BQOA 4W9NC 3E7XA 2FCAA 2CF5A 4Q82A 1VB5A 4MRAA 2Q6OA 4R9VA 1GKKA 2XQFA 1QRTA 1B00A 1WEKA 1WUJS 1S8AA 1KH1A 2AE2A 3IEMA 1C9NA 3TJRA 4Q9LA 3TSZA 4TRJA 4WFQA 4C7VA 3P2KA 1L5MA 2XDQB 4H7FA 5KYUB 3V2GA 3ZGOA 4U9IS 2FZ5A 1R3UA 2H1FA 4KXXA 1VYVA 1GGEA 3FH0A 4LQCA 1IBKB 4DTCA 3ZVRA 5M29A 4FOSA 4BIIA 5IT5A 3ZN2A 5HDQA 5AW8A 3BWDD 1WZCA 1RWNA 3ZIAD 2VQFB 1DRUA 3OBIA 1QE3A 2XQGA 3E1GA 4LJLA 3F6EX 5IF9A 1JSLA 2B4KA 2E1RA 1DJPA 4GZ3A 1Y4ZA 4P81A 4RX1A 2B94A 3JXEA 2O9JA 4RFVA 4H9GA 3O8OA 5BMVB 3WK4A 1VA4A 1YQDA 2FR8C 4X8LA 1JHPA 3HY3A 1YB4A 3F7NA 2G5GX 2WOOA 1GRVA 3PWKA 4K6MA 2Z6VA 2VP4A 3R5TA 4CCYB 2XHZA 3CEHA 4TKLA 4BNNA 1KAQA 1W36C 1PV1A 1YHYA 3FOWA 2ZJFA 2PPVA 4LY6A 1WOMA 3O4GA 4PG5A 4QL3A 3FWHA 4C30A 3QU7A 1MB2A 1QIJA 1YGPA 3LLCA 4GIBA 4UU7A 4B82A 3HJAA 4DE5A 4JASB 4LGMA 3HKCA 3OOHA 3JD4A 4PCVA 4DG5A 5G1PA 4KNWA 1DQNA 1NRIA 3PQ8A 3BRCA 4F04A 2WJ3A 2ACKA 4C0HA 2ZRQA 4DMHA 5DBFA 3HXPA 3KKLA 4K0RA 4ZMSA 2J6IA 1I2MA 1CUIA 1IAVA 2C7BA 3FKSD 3BZUA 1RRVA 3FRIA 3ND6A 3QWHA 3H05A 4CV3A 5C4MA 1NBMD 4XR4A 3MTDA 3KDSE 5EKSA 4DHWA 4QYTA 4E32A 4TKVA 5ALJA 1MHPA 2YDXA 3P7MA 3ICQB 1U80A 1N8KA 2OK8A 3L7NA 1NTRA 2BKAA 4ND1A 4X1OA 4Q3BA 2QWXA 4QUIA 3UAYA 4Q47A 5ERXA 3TDKA 1TZMA 1Z2CA 1QH8A 4JEHA 1HDGO 3RC9A 3IBYA 4EPTA 3QU5A 2Z6AA 1LDGA 5A6SB 1U8EA 1VJCA 1FX1A 1BQ4A 4GOLD 3TLMA 2YV1A 2AF3C 5DSXA 1QP0A 1UMCB 5SYAA 7AT1A 1TFUA 1QGUA 5E9WA 3UVEA 3PDJA 1OOEA 3I9NA 1DZ3A 4JXKA 5AQ1A 2Q3MA 4GX1A 3QRWA 1QLHA 1G8PA 3SC4A 4Y6QA 3HUDA 4GPZA 2FPIA 4F4UA 4FUQA 1UPCA 4BNVA 4MCJA 3Q7EA 3ZUGA 1VL0A 3FSRA 2HWXA 3FDXA 2NZ8A 4JJEA 4NONA 5IAJA 1DTWA 4WK4B 1O96A 1OWLA 3C7CB 2E5WA 3KJNA 1TW3A 1D7OA 5H1YA 4IDFA 4DLRA 3MRTA 1M0WA 3IAS1 2VZ8A 4Q02A 5ANRB 4EY3A 2WU0A 4NBKA 2QLBA 4IL5A 4OXKA 3VR3D 1G4AE 1J42A 4R1UA 4RTRA 4LOJA 2F1HA 2QBYA 1RLIA 2DCMA 1CZOA 1IZ9A 1XMPA 3F5MA 2OP1A 3OEHD 2JVKA 3QLVC 4IDAA 2ZI9A 2IYZA 4OYYA 4C4RA 3PFBA 4GBJA 1V11A 2BDTA 2AN1A 2QJRA 2GUGA 2QY6A 4WSOA 3ABIA 1UWKA 5AH0A 4R1NA 1G6KA 2XSZA 4QJ3A 1CUBA 1EJ0A 3FWZA 3L0BA 2H48A 2QQFA 3NYQA 1YS6A 5ITZA 1G16A 3WKDA 1OTYA 2O8DA 3RROA 4KLCA 2DOKA 4ZZ1A 3LF1A 1PS9A 2QN6A 1UJ2A 2QEQA 1J8FA 3EVNA 3MWLA 4WXHA 1DCMA 1NQAO 4NRDA 5JS8A 3RHFA 2YV5A 1N7HA 1M6VA 1TL7C 2QD3A 3MTQA 3SKXA 4R1QA 4BVHA 2EBHX 1QGOA 4FW9A 4I8IA 5JBNA 3PGKA 4Q9NA 1EFPB 1JPJA 1E2HA 3R6GA 1E5QA 4EUEA 5KNCH 1ZLYA 3OZWA 3LH5A 2ZBUA 1I7DA 1JLRA 2BFMA 4UZFA 4BFLA 3GJ6A 4G1CA 4HDNA 4EG7A 1ZI9A 5JRDS 4AQ7A 3PJRA 1W25A 3AP1A 5K3OA 3KU4A 1PL7A 2O0KA 5ADWA 1AZLA 5ISMA 3HB5X 3UH1A 2Q3EA 1FC0A 3MMXA 4BMXA 3ED1A 3AB3A 4DQXA 1SOMA 1GTG1 2AI3A 3OOJA 4MS1A 4O29A 4ABTA 1XXHE 2VHZA 5AQEA 2FPMA 4BRWA 1RNLA 3GFFA 4I99A 1G3MA 4KRYA 4EB0A 3UAWA 3I52A 2NXCA 5EYPA 3WMWA 4MAMA 1WDMA 3INRA 4OQQA 2BV3A 3S1AB 4GRAA 1B1AA 1KI9A 1QOZA 3DE3X 4AJ1A 3MS2A 1ESMA 1L5NA 4ENUA 1XVUA 4UEQA 1QYDA 1HDOA 3AFOA 3DTYA 3G8AA 3GRUA 2HFJA 3V8MA 2QSUA 3WLLA 3AEKA 4NH4A 3K2IA 1U2RA 1YBAA 2YZGA 1WUIS 4AIIA 1RQ2A 1AKNA 1I01A 1T2CA 1BEEA 5C0OE 1P19A 2A7XA 2W6OA 3FPCA 3LO5A 4Z99A 2NSDA 3LWBA 4MTLA 3H8WA 2B99A 3MIIA 1CJCA 3FGNA 2LDXA 2AVNA 5I7SA 5LVAA 1JZSA 1SC4A 5CVCA 2PX2A 1C9KA 4NZMA 2IQ5A 1DU4A 2HQOA 1P18A 5FUMA 3GA5A 4A15A 4PF1A 2JCBA 2ZI6A 5REQB 4FZ5A 1E1KA 3WKAA 1X9IA 1HLDA 2PBRA 4YR9A 5B4TA 4B7ZA 4D25A 3ZWAA 4AZ3A 2RHTA 3AIIA 4U3JB 2R7KA 4XARA 4Y9RA 2QJTA 4N0DA 5F51A 4DZZA 4TSFD 4D0NA 4IOKA 3QU2A 4M9QA 1TKCA 2DX7A 3A4IA 4LNUB 4Q48A 4RGYA 1GU7A 4GKVA 3WQRA 4AMYA 1G8FA 4Q4DA 4KITB 4KFTA 2B6NA 2FP3A 3E7DA 1K92A 1S3GA 1I4EB 2H59A 1MU0A 4H2DA 4YCDA 4CM8B 4ER3A 3C3WA 3HKDA 3HUTA 4H7JA 4NU6A 4BGVA 3CZQA 4MEAA 2P9CA 2O20A 1Z5NA 3QMWA 3CKKA 4ND8B 1G5FA 3T1VA 4MR7B 5JCXA 5G0SA 3HO6A 3I34X 4RK5A 1JFSA 5KVCA 1UT6A 3ICPA 3ADCA 2ONYA 5BSTA 1H4QA 4JQOA 1DPFA 2E37A 3ILVA 1ZQ1A 2O0LA 2OD9A 3NTXA 4NCHA 3LX8A 1IVYA 1FFSA 1ONNA 2EBUA 2H17A 2OQVA 5KI6A 2WWYA 2ZULA 4LDPA 1NLYA 1RAHA 5EE3A 3UMJA 2W98A 1RXCA 4A0GA 2Q3JA 2YJ5A 5I5GA 4NHOA 1FU4A 5TEWA 1E1YA 1ZOLA 2IEDA 3GCXA 3GJ3A 4M0MA 5FULA 3TIFA 4B4UA 3QUBA 2PA3A 5B6JA 3BQ9A 2CVOA 1SELA 4M1YA 4IMPA 4E6PA 1IQRA 3AOEA 4EY5A 3COVA 3IAHA 5T4BA 5KEIA 2JAHA 2ECFA 4QDZA 1KWGA 2JK1A 1EZZA 4CFYA 5BQXA 3LY9A 3SSOA 3D7NA 4R2LA 1PR1A 5UKDA 3IOMA 3M1AA 3CCBA 3Q7RA 4FEGA 2B3DA 5G1NA 2J6BA 3ROXA 3V1UA 5LXTA 2IZ5A 2XKJE 4PLYA 4TYYA 1QQTA 1R6VA 4KOEC 3QI7A 1PG0A 3MHTA 3LXMA 4AK9A 3NRBA 4QM6A 1UBNA 4HDMB 4M0KA 5AKGA 1Q0ZA 4FWTA 3C1AA 2IDKA 3BWVA 2C92A 2OV3A 1GFIA 1PNTA 1KS9A 1Q83A 1NY6A 1XZFA 2REOA 1P9RA 3DMPA 4PQEA 4XE5A 2R8PA 3T3HA 4X3CA 5EKDA 5JI2E 4G5QA 3Q3CA 3ZI7A 1K7CA 5DXJA 4CMIB 5D00A 5DULA 1FXSA 1T9ZA 3CUEF 5EIBC 3RS5A 3WZ2A 3DD1A 3BSWA 4F0JA 3E3AA 4MDYA 1Z26A 5E1BA 5I7AA 1SPBS 4RKYA 4HP8A 3HB7A 1U1GA 2PK3A 3TSOA 2PS9A 1Q1QA 2AR0A 3W8FA 2AFHB 1LBIA 3H4VA 3FHJA 3NV7A 5LP6B 1VG8A 1KYXA 2OXFA 1QVZA 2D0IA 4HQRA 4ER5A 2JBHA 4XTRA 5G53C 2I65A 1KI1A 3QUQA 3VOBA 3PUXA 3EUFA 2RCYA 4GL2A 5HZHA 3D7SA 3AI3A 3WBBA 5DTQA 2OECA 1N5RA 2VYND 4MUXA 2PWYA 1C0EA 1K63A 1VIYA 3CISA 4O4LB 5CFLA 4ID9A 2NU9A 4LMBA 4B4KA 1XUOA 2VP3A 3EQ2A 4P08A 1VE6A 4L28A 4DWOA 2F59A 1TF5A 3GXOA 1V3TA 1CQXA 3I2IA 2P68A 3V8EA 2BE7A 3OZIA 3LY7A 2Q5OA 3OO0A 1UJ5A 3VUEA 4R3NA 3M2TA 4IDHA 5E2IA 3FCAA 1U8ZA 4GGPA 3HK2A 2WUWE 1T5SA 3BXFA 1JHUA 2PYDA 5CHYA 3O8QB 4C1BA 5EJGA 2IHVA 1MV5A 2CW5A 2Z2YA 3JALA 4AZVA 4GOMD 3ZHZA 1U2TA 2B2NA 4NAHA 4ZOLA 1L5LA 4Z3KA 3U6BA 3ZD9A 5FT9A 1GKYA 2Z3ZA 3IEIA 2ACWA 2JASA 4GUDA 5JZVA 4IWYA 3OP1A 4R0NA 2J8ZA 4ENSA 5KNLA 1YOBA 4DTIA 1KY4A 2O23A 3LUGA 3URMA 5A05A 1SCDA 4IQ8A 3G2OA 3L0PA 5CCXA 1XIVA 1FUUA 5IW8A 3RK1A 2CMHA 2O2JA 4CZ2A 2VCYA 5I4IA 3IBSA 2PLFA 3NOQA 1O6CA 4C6HA 2PUTA 2RKWA 3GFVA 4FP9A 2J3HA 1CUVA 2NIPA 3EXFA 3C8MA 5SYNA 2NNLD 2I4NA 9MHTA 3E48A 2ETVA 1ZO8A 2QUJA 1UPUA 3TJMA 4RVGA 4Z0HO 1F7VA 3MTIA 4JX9A 4D4LA 5DCUA 1QONA 1QTIA 3BQNB 3FVVA 4YH1A 4B4DA 1E2UA 3EIWA 4BHTA 4DMRA 4Z2AA 3GI1A 3RYCB 4CKBB 5TXGA 5JASA 3DKIA 3OTWA 1KBQA 4UBIA 2AEEA 2HCRA 2R2AA 1AS2A 1Z0KA 2C9BA 2ZSEA 3NC1C 5FEMA 3UZUA 1JNXX 4HYQA 3QVSA 4DG9A 2G83A 4FDMA 1XD2B 4NPHA 2X41A 3MGAA 1R4AA 3RODA 4AKHA 5DISB 4M76B 4XQGA 2YMPA 3TZHA 2OCIA 3II6X 3RVNA 2FW1A 5KSYA 4K9DA 4B1FA 3R0JA 3RH0A 3GBPA 3HZZA 1Q0TA 4FDVA 1XKLA 3WDLA 3F6PA 1BMTA 3UJPA 1PFUA 3L8EA 3IUPA 1PV4A 2VK4A 3FPFA 1ODSA 1Y3BE 4MHSA 3TDNA 3OZTA 1K75A 3U3RA 1QC5A 3QYPA 1A7KA 3DBHA 1E3LA 1NKTA 2NO6A 3B3JA 3MJSA 2Y99A 2GPJA 2P91A 2WNHA 2ZE6A 1ECGA 4H0FA 4IGIA 4R8RA 5H7XA 4CEIA 4P0PB 2X4DA 4G56A 5B6PA 4L5AA 2P2NA 3EVBA 4I5IA 3WMRA 2GHQA 4IHQA 4BX3A 4DLAA 3VU8A 2QV7A 4DV0B 3GCGA 4MDHA 1Y7PA 3RRBA 1RWVA 3WTBA 3D81A 1TA4A 3S5UA 3EQ9A 3WL4A 4JP5A 1QUEA 4YAJA 5L3RA 2UU9B 5LMCA 5IM4A 3PQDA 2D7JA 1XNJA 2YWXA 4ZU6X 3U26A 2GYWA 3U19A 2UZ3A 3HEMA 1GEGA 2B61A 2Y1KA 1M10A 4WCFC 4X6LA 3BFVA 3DHNA 4JYPA 1IJBA 1LPNA 3HKEA 3WGVA 3PDIA 4RHYA 4W1SA 2VPTA 1QIKA 2FRDC 5IDYA 1MFZA 3Q7PA 4E07A 2R11A 5IVPA 3SYMA 4Z8YA 3S7TA 2DLCX 1NFRA 2RGAA 4G41A 4R54A 5DHQA 5BXQC 4ND5A 1T36A 2DWOA 4CF5A 3V8BA 2CJPA 2QUZA 4N0QA 5KYWA 4TLCA 1PZFA 1WWKA 2XY4A 3OICA 2PWAA 1PSDA 1T9GS 3DEIA 5JVDF 4BO8A 1R6DA 4DY6A 4WJLA 2E7ZA 2GA8A 3O4HA 1Z4MA 1PGOA 4YROA 1T9CA 2UVQA 2XQVA 4MVWA 2NO4A 4CMBA 3W3AA 4NZ9A 4QOHA 2VRCA 4E5SA 3K8QA 3NIWA 1Y4UA 3PR3A 5DM1A 4MIYA 1Q95A 1NLMA 5DLYA 2OXTA 5PGMA 2YZMA 4BB9A 1OYVA 4WA7A 4EL0A 1V8ZA 2I78A 4XVUA 2WJHA 1TE2A 4MQFB 2ORVA 1P2SA 1E1LA 3DCIA 4YVFA 4HT3B 5ICCA 1SG9A 3KT8A 5A9SB 3P8ZA 4JJKA 5CDHA 4YRPA 3HY6A 3DBLA 4IJWA 5DK6A 5ALLA 5FTWA 3LCUA 2R65A 5CBKA 3S5JA 2XIQA 3FROA 1GZVA 5FR1A 3V7UA 3ZE1B 4EW6A 2VWGA 5JJKA 5IMSA 2HT1A 1UDBA 13PKA 1TQDA 1EE1A 1UXJA 2C84A 1QK3A 1TUGA 4OOEA 4YJHA 5E1DA 5BV2P 2WWFA 2ZJ7A 2DWUA 1VKZA 2C4VA 1JE0A 3G0IA 1ZR2A 1YQXA 1FLNA 1DRJA 1PK7A 3Q40A 1Z9BA 5BUQA 2FUCA 3ROMA 4DA7A 1W4RA 4UU8A 4DLNA 2NOAA 2C2WA 1IMOA 3HJCA 3RARA 2Q9BA 4DG8A 4B71A 3E5RA 5LBTA 3R1IA 3WQHA 4GNRA 5HM6A 4WCDA 3FSEA 3KX2A 2ZAOA 4QEZA 4F2WA 2F8MA 2I4TA 1IZ7A 3OCUA 2KLBA 3EH1A 3KJEA 3OCZA 5AKZA 4Q34A 3IH5A 1FTWA 3C16C 1A5AB 2HCBA 4FDTA 1ACLA 1O3YA 2I87A 4H18A 3RWBA 3W5VA 3OFVA 1MAWA 4RKQA 3SHQA 1G3IA 4TL7A 2YJNA 5B3AA 4A26A 3OKCA 2MOKA 4EHDA 4IXTA 2O8VA 1QHHA 1F2TA 2QI9F 2N0SA 1NUAA 1XHFA 3EEIA 4H0CA 5DDIP 1AUQA 4XA8A 4PYKA 5L3QB 2WD8A 3ZJVA 2A3NA 2LIVA 2V6MA 3UJ6A 3VX4A 3L6UA 3LVFO 2RK4A 4U7TB 3SDZA 2REBA 3NU1A 2JIDA 3AVOA 4YK7A 1PQPA 3PGLA 2X1VA 4OHWA 4BO3A 4PO9A 4IXMA 2KM1A 3ZHQA 3FYHA 4AKGA 3RO7A 2WT8A 4PSCA 3VSDA 3I9LA 1N2JA 5P21A 5A2GA 5K09A 4AXBA 1XPRA 1RZ3A 5IDXA 1AMNA 3N8NA 4HX2A 3M5PA 1JR2A 3U4GA 2VF8A 1V1MB 3ZCQA 5BR4A 4BO5A 4YRCA 2HBYA 3O03A 2R86A 1N6RA 2HCTA 2YW2A 4G1BA 2J0QA 3RRYA 1P6QA 4ZKDA 1OBCA 3LTEA 3FPJA 5BYKA 3EH2A 2HCJB 3M9XA 2OCKA 4I7EA 3ZWVA 4G0UA 4H7KA 4B79A 1ZY2A 1Q0SA 5KTTA 1QF9A 3C15C 4Y2XA 2WC1A 2ZDQA 4V0MA 4ICIA 4WESB 1T6NA 5A5VA 1E3WA 1DV2A 4OB8A 3ZDRA 2B8TA 4RVHA 4X8HA 3WGOA 5E1MA 3DULA 2NUPB 2NAFA 3AY6A 4I8XA 3CLKA 3CR3C 4KXWA 4X7RA 1T4BA 4CDMA 5J47A 3F3MA 3O47A 5KJEA 3NT5A 4NK5A 4CKWB 1QFYA 4JU8A 1PW7A 3OIYA 2GPBA 2OSBA 3HLKA 1P4JA 3FX2A 4KXUA 2BD0A 4JB8A 5G4KB 3ETCA 1BW9B 3ERCA 1TPYA 4BEBA 1SBHA 2FOIA 2O7RA 3JSAA 1OYYA 3LUKA 3OY7A 5DWDA 1NIPA 5C8XA 5KO2A 3P4XA 2BTOA 4X0EA 1J20A 3KLOA 3GD5A 3ONVA 2YWEA 4QFDA 4CVNA 2Q8NA 1I24A 1Y8RB 2JGAA 4KYIB 4RY8A 1V5EA 4HAOA 3K6SA 1UXIA 2WG1A 1ZH0A 1HXHA 1K6MA 3CONA 4GH5A 4F3TA 2X5JO 1SQFA 1F20A 2C2KA 2GVDC 2P5SA 2R8XA 3DNMA 2E4WA 4TKMA 3DBIA 3SC6A 2LKCA 1H05A 3WGMA 1M6WA 3D4PA 4MS3A 3X1KA 2ACVA 3REFA 4EW1A 4IILA 2YVLA 1XLWA 3VKWA 2ZKIA 5CH5A 1ECPA 5CBPB 1WY7A 5IHPA 2QM0A 1Z8FA 2P65A 4Z4GA 4FYXA 2QOEA 2FJ0A 2GVNA 1ULTA 4RHTA 1CF4A 3ZWQA 4BBZA 4MGIR 4X9XA 2RH5A 4J0HA 5K4GA 3LBAA 1UXKA 4NU8X 5JJLA 1OXVA 2NGRA 4UDNA 5E3IA 4CEHB 1CZUA 3B52X 1GQFA 4I5GA 2AR9A 1PZGA 4YP6A 2IXTA 5C34B 1XPUA 2IUUA 4CIWA 2FVYA 3P32A 4KAAA 2XX3A 1FLDA 5BT9A 1RQXA 1GPUA 4HF7A 3G7UA 4KQJA 5AYVA 4M1MA 4RYDA 3NBXX 1JVNA 1E5TA 1PGJA 2PWZA 4KI0A 2FUG6 3TKAA 2BCJQ 2WKRA 3OCVA 2ZUBA 2XA9A 2QQ5A 4DVJA 3BX1A 1UK7A 4OSOA 1N2SA 2NTVA 2BGJA 2OVBA 1YFZA 3L7DA 3O4IA 1WDTA 3RYTC 3WL6A 3I62A 1L7MA 3TMKA 3SQXA 3GWZA 1U7HA 4L5IA 3LVBA 4OHFA 1II8A 4D44A 2QDKA 1BOOA 3HN6A 4PSKA 5FWAA 3AG6A 5I9SA 4DS3A 5AVXA 2BBOA 3L1KA 5E7JA 2VT6A 3DXFA 3LGSA 4TWJA 4YPOA 4M98A 5L8VA 4L0MA 1B6TA 4ENPA 3FUTA 5K0TA 5IS2A 4Q3OA 3CWCA 1O89A 1XJCA 2A9FA 2OZEA 3HY4A 5G2OA 1I3LA 2M6KA 5AVTA 2XB2A 4U1RA 1KQOA 1J5EB 2C4HA 4WKPA 4TRMA 1PFQA 1EFLA 3BL8A 4MS4B 5FI0B 1P1HA 2R8OA 3QPCA 4UU0A 4RV9A 1OXTA 5IC6A 4Y2YA 1JIUA 3E8MA 4ZHQA 1JALA 3F97A 4KQCA 1NOKA 4HNHA 2QVXX 4FDUA 4H7EA 3HB0A 1B93A 2ALJA 2R97A 1RYBA 1I2ZA 2C4KA 5L4SA 2GN2A 3FZYA 4J2OA 2ZT6A 3PQ2A 2P5TB 2NQ2C 2I3AA 2AQKA 3OPYA 4G0PA 1GCOA 4J9VA 4XX1A 4H6WA 3RVDA 5EXEA 5ARCA 3EAGA 1KETA 1KDVA 2NVUB 4O2RA 5KNDH 1C50A 2ZIAA 5JFTA 2DWCA 3LBIA 4MRMB 3CM0A 4PAMA 1JLSA 1M67A 3L9WA 4KDRA 4BEJA 4F3NA 5KYYB 4PZAA 4TQUS 5K0NA 1WBBA 1QORA 2F1JA 1LBQA 2V5VA 5IC5A 2CSUA 1OZAA 1CY1A 2GN9A 5CA1A 1QP4A 1W1WA 4MWSA 5I7FA 4FZRA 1PWEA 2G0TA 2X42A 3N70A 4FSXA 4RLHA 3UKDA 4HEA6 1TCUA 2R751 3W6NA 5E4YA 5EHIA 4AJEA 4M55A 3S0JA 1JG3A 4BPRA 3IRUA 3IEKA 4FIZA 1S2IA 1S3FA 2FZCA 1DLIA 3GJYA 3QUSA 4JX8A 1QG2A 3BWYA 3FLEA 1HQKA 3R8FA 1T8WA 2EZ9A 2VQSA 3KYCA 4GRIA 2EGHA 1NC1A 4WZAA 5IKOA 1W5AA 4KQIA 3K1TA 3TRIA 1KQGA 4RABA 2JD0A 2WU8A 1P72A 2BT4A 2JH8A 2VWHA 2RHWA 3HDVA 4J3NA 3AR2A 3CCFA 5DNCA 2G06A 4MV6A 1RC1A 2GK3A 2FQXA 2QZZA 2PL3A 2EP5A 4UM5A 2VQ6A 1ZC3A 4QDUA 4V0ME 4YI5A 5DGHA 5KHLB 3R7LA 3EDOA 3S2SA 1FXWF 2Q6LA 4JELA 4FMBB 3A9SA 2ZFUA 3HUUA 1GLGA 4TQ9A 4R3UC 1KIAA 2EGGA 3OZGA 1W93A 3WWOA 1K3UB 4XX0B 3RU3A 4E6EA 3WYDA 5KQLA 2OGTA 1EVJA 5FAXA 5GV8A 1SRQA 1XZKA 4ZQFA 4D42A 2CZQA 2N42A 1JSCA 1KVQA 4K9PA 1BSVA 2PIDA 2A9QA 3T1YB 3THOA 2QPTA 1ZMXA 3O8NA 3U7RA 4HLUC 3UGTA 2REQA 4IZHA 2ZREA 5H68A 3HDTA 1K8XB 3CW2A 3IBCA 4IVPA 4UUMA 1SQ5A 5FI3A 3R77A 1N34B 1Y6JA 4EMSA 1U3GA 3LE8A 4N3GA 5JXIA 1MFPA 2C5BA 2C0QA 1ULZA 2VEDA 1EX9A 3HJUA 1YI0A 2JI4A 1JYSA 4OXRA 1MOPA 1FK8A 1TIPA 5JNTA 1XTVA 4HO1X 1F6WA 1KHTA 3UG6A 5H3CA 2CV2A 1NBWB 2V98A 3RV4A 4HXGA 3K8YA 3QXXA 5JNSA 3HLYA 1Z22A 3U09A 3BREA 4IDEA 1C4XA 2CBZA 4CXMA 1WHSA 2NPFA 3CN7A 2V58A 4G0MA 4GMHA 3V80A 4RENA 5B7GA 5D5PA 2BFDB 3OIGA 5ARDA 5T6BA 1NXXA 2ECQA 3R9KA 1YRBA 1FRVA 1Z5OA 3KOWA 4YJ3F 4MROA 2O8BA 1HO3A 4QE3A 1PBNA 1EDDA 1G5QA 2H4ZA 4IGEA 3ROGA 2PDAA 1PO7A 2KI5A 4BAGA 3U44A 4JFRA 4RKFA 5LM3A 1RLJA 1U94A 1V95A 3FE2A 3TXYA 2WPDA 5J2UA 1WHTB 1WDKA 2C3OA 3WHKA 1AKMA 4A82A 3DL4A 3PPXA 1WW3A 3UH0A 3LRXA 1P17A 2Z1DA 2C2BA 3WWEA 1FVOA 2L42A 1XZLA 2NZWA 3OIDA 4HWKA 4K3UA 5FNVF 4GX0A 1XF9A 2Y1EA 2GQ0A 5AHOA 4GICA 1GQRA 2NP6A 2WA1A 4L72A 4Q37A 2FE1A 1L4KA 1M73E 4Q9HA 4RTLA 1T91A 3T5BA 3H65A 2PR2A 4RGQA 2EKLA 2PT6A 3OQVA 4TXLA 4N65A 4XIIA 5FLKA 3NIFB 4DGSA 5A1TA 2WQ6A 2XYGA 2A67A 4N3BA 2KHZA 3ZNNA 1UBJS 3MUOA 3GFQA 1QVVA 2DF8A 3PUVA 3ZY6A 3PUYA 5FV4A 2BGLA 1LJ8A 1GDTA 4AWXA 1BEZA 4RFLA 4ON9A 1U9JA 5TMDA 4EKNB 4PQRA 1Y4SA 5HIJA 1W29A 5KTYA 4LHZA 4ZIRA 1AQNA 3GEIA 1Q21A 3DBVO 4CN9A 4OJMX 4DAEA 4MUFA 4JSRA 1DMSA 2NZJA 4F45A 2P2SA 3V1NA 5JG7A 3VDRA 1MH1A 2AG8A 2HA7A 2C03A 2Y1GA 3OE1A 4PC7A 2Z8YA 3V8QA 1NNLA 4EAAA 2JKYA 1L5YA 3EULA 2LNDA 2JFBA 1CDZA 1H2XA 4Y9TA 1E7MA 2CMDA 1PJ4A 5G0VA 2L0XA 2YYYA 1C8VB 3K0EA 4NXMB 3GPCA 4CKEB 2C99A 4LVUA 4KSBA 3UN1A 3OX4A 1MTZA 2CE2X 2JCVA 3SC2B 1VKJA 3KZKA 3FFBA 1XCJA 2HEGA 5JTUA 2GYYA 3KUUA 3IVRA 4JIGA 2OHOA 2XRZA 1HT1E 1NR5A 4G4IA 3RF7A 1M1NA 2D74A 2ZS7A 1J9ZA 2FMFA 3OZRA 2PSSA 1J2TA 2C2ZA 2G76A 4IZIA 2C9CA 4ARUA 4A03A 1CZKA 1SBNE 1HNZB 2CNOA 1VJGA 4GNKA 4X1YB 1OWPA 1BDIA 4WZ6A 1XAHA 3FUXA 3UMBA 3IKVA 3W04A 1R6BX 3BJRA 1XEFA 3T95A 1KO1A 1YULA 4TV8B 4GI2A 4GYWA 2EFDB 2ZB7A 3AV3A 3H6GA 4AJLA 1LDYA 4TS1A 1X1QA 3BE8A 4LTDA 4PNPA 4NJEA 3F0TA 2YJ6A 4LRXA 4QUGA 5EXXA 4M46A 4UHFA 1J5PA 1T10A 4KG7A 1NF9A 4QO8A 4M1TA 4NS1A 1FMCA 4TKZA 4Z6KA 5K3FA 3IQIX 3HCOA 2Z1MA 3I23A 1ZH6A 3CW9A 3GP3A 1EUDA 2JAXA 2VQ3A 3U7IA 3ZIDA 3R0XA 2D0OB 2QR2A 4BP9A 1DEOA 1DIBA 2IYRA 3AL3A 4DADA 3R9XB 3A6FA 1JG2A 3QELA 4A5SA 4NFHA 3FIUA 3PD1A 4GL4A 3SQNA 4B8YA 4B6EA 4PEVA 4DARA 4M1KA 4EIWA 4F4HA 1ZM9A 2V7VA 1KOGA 1A2KC 1TNDA 3AR5A 3QVOA 1Q1BA 4E4YA 5IXJA 1XQ1A 5CVUA 2OYSA 1WXFA 4G85A 1G0NA 1UQTA 4LXHA 1J00A 4I14A 1N8NA 3F74A 3G13A 1UM9B 4E33A 3GZTB 1P1FA 2MINB 2V4MA 4EI9A 5K0EA 2HSDA 4UFOA 1ZUNA 4N54A 1I51A 4QBKA 3REGA 3D1VA 1FZQA 3QIVA 1KEZA 2G8LA 3I5MA 4CTOA 5J3JA 3BH0A 1GA6A 4FE7A 2XHEA 2DBQA 4PRKA 1RCFA 4EUKA 2I1WA 1NKVA 5FBVB 3F4BA 5CYPA 4QASA 3ZHUA 5KOJB 2WF9A 3H97A 2VF4X 1BS1A 1DAMA 1EKXA 2YYZA 4B31A 1M33A 2ZROA 3LHDA 2WVJA 2PUGA 5JARA 1VSTA 4BVAA 3IIJA 3OQBA 1I6LA 1I32A 4ENRA 5FUQA 4G4GA 4LI3X 4RTMA 3MCUA 1ODIA 1UK6A 4E15A 1QSGA 2AFRA 2BUCA 4FR5A 3NHRA 2JEYA 1DP4A 1Z8HA 3I9OA 3R09A 4FNMA 3QJGA 3U39A 4E11A 4NZOA 4JXZA 2RH8A 2C88A 3PXEA 5BWNA 3ZWCA 3BMNB 5BWMA 4CT4B 1E8DA 1DCKA 1YV9A 1SBQA 5CDSA 4ED9A 2X40A 2W2TA 3DFFA 2ZWMA 3U49A 3WA7A 3TR6A 5ED0A 3A9WA 1TVKB 4IJKA 3WFJA 1Z16A 5A03A 1G21B 2Q1XA 1MO5A 4QDKA 3DJYA 3RU2A 5KC8A 3FWPA 3L4KA 1IWPB 1C0IA 3AJEA 4EUHA 3DZ8A 3VNUA 1E3MA 5HQ3B 3FR7A 1E96A 3HBNA 4B6RA 3BJMA 2CD9A 1YMQA 3KZOA 3ZNQA 1PRYA 2ODEA 4KRFA 5G0UA 1F1BA 4B2IA 3P52A 4C4AA 2QAGB 1HWYA 3H4MA 1CBUA 1MR3F 2HN9A 3DZKA 3ID6C 4GMKA 1WB6A 4QATA 4Y6SA 4KN6A 1AT1A 2IHBA 2GNOA 4O4HB 2IY9A 3L8ZA 5FQOA 3LLSA 5JTTA 2XXAA 3FGPA 4CJXA 3HXOA 1ILWA 2FRXA 2QDXA 1P5HA 1SUFA 3IO3A 1V6SA 1Q16A 4O59O 3IAAA 2P4QA 4WLEA 3A2LA 1ND5A 2BVNA 1WU8A 2HHCA 2HBZA 2HRZA 2ICAA 4LRYA 3ZHOA 4HVLA 3SY8A 4AJKA 5HTOA 4U7WA 4NYIR 3BCHA 3A26A 3B8HA 2RHGB 3HP1A 1XROA 3DEYX 5AP9A 1R0CA 5BNFA 4P33A 3VR0A 1ZHHA 5GONF 5ALKA 4NYMQ 4KR7A 4K9LA 3SN6A 1H2BA 1VJRA 3E3NA 3V8PA 1DKOA 3W34A 3CX4A 3CNBA 3OESA 1Y1SA 4PX9A 4XUEA 3OQNA 2OCGA 3EK2A 5ED4A 3KR9A 3LKDA 4BDTA 4WXPA 1BOFA 1B42A 3M3PA 3P27A 1QGDA 2A86A 3V4RA 3IAS6 3OA2A 4EA8A 2R47A 4D7AA 2WBLC 2Q41A 3WB0A 2PN1A 5DMHA 4DXDA 3Q1KA 2M2IA 3WSVA 4RJJA 1BFUA 4DIMA 4ZOQI 5A4IS 1XQWA 4IM7A 3U3XA 1E0DA 3U6KA 1I6KA 3FHCB 1RXSA 1JG4A 1C41A 2X76A 3CX6A 3QJYA 3QPBA 3LX6A 1TCCA 2LBPA 1KYYA 3HCDA 4AQYB 4LE1A 5D85A 4IIBA 4N9WA 4BFWA 3V2UA 4NDNE 1TJ3A 3P9XA 3S7ZA 4JJZA 3M6VA 5CFMA 4JL5A 1U8CB 1ZHFA 1FMJA 4RZSA 1P8JA 1WZIA 1E18A 2IYTA 1Z5GA 2OZKA 1KTVA 1U5CA 4ZEMA 4TT3A 3ELWA 4YQEA 1VE1A 2PUJA 3KD2A 1BAPA 2VNKA 3BE4A 4QOIA 1KZHA 2IIQA 4UHJA 3WV4A 4JLJA 1DG9A 2DBZA 3AR3A 4ZP1A 2QRLA 1M8KA 1MIOB 2GASA 1PZEA 2Y8EA 5IG2A 2BBTA 4ZCLA 1HEYA 4P5EA 1IWBB 3QGMA 2ZIGA 4HWSA 3DT8A 1EFVA 2DTXA 4I55B 3LFTA 3IT1A 3K2EA 4YV2A 5FWYA 5ICGA 3QLEA 1WMSA 2VP2A 3O8OB 2XF8A 3UC9A 3T0GA 1U0HC 1WCWA 3HUEA 4LSZA 4N8SA 4P7KA 2J5BA 1L8AA 4YR7A 1HURA 3ENVA 5IN4A 3FCSB 2GZAA 1R9GA 4JT8A 3V2HA 4F6RB 3MJCA 5SZHB 4HDKB 5DP1A 4LDNA 3HVUA 1XEXA 4AKIA 5HW0A 2IXEA 5IN5A 1XVAA 1DAPA 3TL6A 5BSVA 4ZI7F 4M1QA 4JI3B 2QX7A 1WB4A 3PC4A 5D6NA 1ISFA 3ZWWA 3HDHA 3TOZA 4J8PA 4I4TB 1E9BA 5EUBA 4KV7A 2C7VA 1AXGA 2RGUA 3VR1A 2BJHA 2HLDA 4GRDA 4JEIA 4GX2A 4PSDA 5EMLA 1NVMB 2Y0PA 1T2UA 2EFCB 1E9AA 3ANXA 3G9ZA 3JRNA 3GGPA 4NV0A 4RE5A 1C9YA 1J5XA 4C3OB 2NN3C 1JXMA 3HYCA 1DXOA 3MS4A 3KOYA 2UXDB 4DLZA 2PQ6A 4C08A 4NDAA 1VCOA 5ITSA 2IX3A 3A36A 3ZWYA 4B80A 4YT2A 5FBWB 1AKVA 2IYVA 2RJNA 3GRPA 2KSQA 3NC4A 1RWXA 1V8DA 1XO1A 4N3CA 1F9EA 1Z6XA 3AQIA 3FVQA 4JKYA 2G28A 2D4HA 3NDJA 2FYTA 1CZNA 4OSPA 5DN9A 2QN2A 2GEDA 1CRWG 4N7MA 4P93A 4CL3A 1KSFX 2O4UX 3U4QA 3FYUB 1ZUHA 4JNCA 4R05A 3DOUA 4YACA 2X0DA 3JYQA 4IHJF 4YJFA 5KNCA 2ZTSA 4N4AA 1QGUB 2IEZA 3ROFA 5I3CA 2C3YA 2JVJA 1MGPA 4MI3A 4V24A 4XYMA 3M4JA 4YYZA 1SY7A 3VU0A 3LX4A 3DMRA 2XUKA 3ESZA 3LUCA 3LQRA 5L6MB 1ZGGA 2Q46A 2Q2OA 1Z68A 2FPIB 4B85A 5K4HA 1YJCA 2D59A 4MINA 3UK2A 4ZI2A 1IQ0A 2AEFA 4EX7A 3PQCA 1JG6A 1ZJ6A 3EYAA 1TUBA 4UE3S 4BNKA 1WSBA 2BISA 3GLGA 4PGMA 1N3IA 2C9ZA 3TNLA 4RK1A 5THQA 1SCBA 4UTOA 3UTCA 4G0XA 5FBHA 2IUYA 3H9GA 4P92A 1O96B 3CZMA 1U7XA 4IDQA 5WRFA 2QLLA 5ADUS 3AVWA 1G1MA 1NG1A 1SB9A 2C2MA 1TF2A 4IG9A 4Z3DA 2GM5A 5BOSB 4C03A 4ALNA 1GU0A 1K6EA 1PFGA 3G2LA 4WH0A 2D7DA 3DFUA 3GT0A 3KWFA 4QGBA 2IXFA 2I7VA 3JVUA 4OATA 1ACMA 3UICA 4C2UA 2I67A 1SVSA 2R4TA 1DX4A 3KDPA 3D8NA 2WVHA 3OT1B 4B3CA 1PK9A 2PWBA 2XDYA 1E3EA 1Z8NA 3C1TA 4ZVOA 3AF4A 1PZHA 2W00A 4QOFA 1EZ4A 4MLCA 2OG1A 2ZUVA 4RZ3A 4FX5A 1OT3A 1TTQB 3P2EA 4YPVA 2O8DB 2OK7A 4A8JA 2ETXA 3ZOKA 1G8YA 2AYXA 5CPBA 2H2AA 2WABA 3WK5A 3NVMB 4PW0A 3RSZA 3TF5A 3PRHA 1Z37A 3TW4A 3AY3A 1HDRA 2P9TA 1M6VB 1RJWA 1OIVA 2QD2A 3EXEA 4YPFA 3WNDA 4EHHA 3IODA 4Y30A 3KZVA 1H9AA 2GN1A 8ATCA 1YQTA 3LLVA 2JLYA 1KI4A 2KW5A 2Q0XA 2XUAA 1DHRA 1YNOA 4KBYA 1OV6A 2FPXA 3OD1A 3P97A 2JIZA 3NP7A 3A14A 3EIEA 5FOXA 3TW8A 4INOA 2PZAA 3FGZA 5BURA 5CFNA 4QBIA 3OCJA 1T5OA 3WDMA 2GBPA 4YIKA 4HDNB 1RYYA 5IASA 5JS6A 3RG8A 3X1YA 2YIVX 4NS4A 2BBSA 5AW0A 1U0NA 2BSXA 3NLLA 3SHOA 1U7OA 4QUHA 4WT7A 1P2BA 3RPEA 3K20A 3DGEC 3NCTA 1K7SN 1PYGA 2GCOA 2VHVA 3DC2A 4LYHA 3S2GA 2FY8A 1CHDA 4WNIA 1X1EA 3P9ZA 1V3VA 1AU9A 1PP4A 5DE3A 5EYPB 4DNOA 1GG5A 1W59A 4D43A 1FTQA 1VXRA 5AI0A 3HNRA 1FP7A 1UFVA 2RGWA 5DHPA 2WJAA 2ZP1A 5AKXA 1WKCA 4B73A 5EWLA 2ZWIA 4OFWA 1U98A 1T8TA 3NPMA 3TX2A 5D3MA 1GZ3A 3NTQA 5T6MA 5JFGA 3JWHA 3ETEA 4XCVA 5A5GA 3C8HA 2YKGA 2WYWA 3C85A 2KMLA 1PJTA 2HHAA 4KMOA 5MN6A 4PRZA 1M34A 3ICWA 1TA9A 1E89A 1KFCB 4P22A 1IHOA 4JVOA 1FCJA 4AMGA 4KIWA 2I7CA 2ONJA 3WA6A 3G0CA 1SQSA 2HPAA 2FN8A 3FNBA 3QXCA 4J7CA 2D5LA 1ZYUA 1CEYA 1TT5A 2JLCA 3DOOA 4OA5A 1UDWA 1VLMA 3MW8A 2QIPA 4XFDA 3UMRA 4L4YA 2C97A 1YK0A 1L4HA 4YX9A 3C4QA 3ESRA 4TZ6A 1EWYA 2J31A 2BOVA 1C9MA 4ZANA 1A27A 6AT1A 1H2WA 3A70A 1O95A 2W83A 4N48A 4A6XA 5FORA 4KR2A 2FW8A 1GRCA 2A1TR 3T99A 5HE9A 3UV6A 1XEWX 3OZUA 2EHDA 1XKXA 4GAEA 5DSZA 1D03A 2RGYA 4IFTA 4RH0A 1S9HA 4ZK2A 1VSVA 2IPMA 3HKDB 3OEEA 3PWZA 4H35A 3VPDA 2FDCA 1ZFNA 1DUVG 5F35A 1BEUB 4L4UA 4D9MA 3UATA 1BX0A 4J3JA 1OTHA 4FZ3A 4N40A 2YMMA 3NHLA 3RK4A 2PFKA 1P74A 5AW5A 4TRRA 3FZGA 4JP2A 3N0RA 2E0IA 3WHLA 5AK4A 4DQVA 4XSVA 4EGJA 4ZTUB 3E8XA 2XBLA 3VJRA 1QJCA 1C30A 1OA0A 4AF6A 4MI6A 2PO5A 4PBSA 1HSOA 2QRVB 4PG8A 2NO9A 3R7WA 1J8QA 1L7OA 4UMEA 4ARVA 1B15A 1NFFA 2RONA 3WGQA 1IY0A 1L7BA 4QYSA 3NHFA 4O02B 1SXPA 3MXOA 3PT9A 3ZI4A 2IPLA 3F3YA 2EJTA 3PNBA 4FI3C 1UPAA 4PQYA 4N9QA 1P9NA 3TG8A 4N5HX 1D2EA 4RTPA 4DR3B 1ULSA 3N58A 2XZTA 2WHQA 2FOLA 1M0TA 4UAJA 3E22A 1ECCA 4JK3A 1CJSA 3GT4A 3RJZA 1X7ZA 3WLEA 3HR7A 1EJ2A 3K4PA 4D9BA 3PJDA 4GVXA 5KDDA 4NMLA 4DV5B 2X3UA 5D8DA 5HBGA 2XH8A 5LXTB 2GHIA 2O50A 1L5OA 4ZCSA 2AJDA 1FFHA 4INAA 1XA4A 2G7MC 2OA0A 5FNZA 3UMFA 3PEWA 1XJ5A 2RJOA 1W34A 3SQLA 4DPKA 5B4UA 1WETA 2AN9A 3AUTA 5EHQA 2GH1A 1E4EA 1LX6A 1SAYA 3DV0A 5CCBA 2XB4A 2NG1A 2Z2IA 1AKYA 1JQLB 1URPA 1YZNA 3AM5A 3BJIC 1P0FA 2ZRKA 3ETJA 3I92A 1PAUA 3MGBA 3PFCA 2J9FA 3LUAA 2BSQA 2O2CA 3DUWA 5F2OA 2IYPA 2HIMA 4LQ4A 2VCEA 1D0VA 3DBRA 3FCYA 4CI9A 4TTJA 1M1ZA 4CGYA 4D80A 2MR6A 4J76A 2YWCA 2YWDA 3A6ZA 3BKWA 4C2AA 3EPHA 4X45A 2ECOA 1PKXA 1KE2A 4L7QA 2VNSA 2FZKA 3G0OA 1LPOA 1F2UA 1U5BA 1O0CA 1B0AA 3BSYA 4KO3S 3KYIB 2R7AA 2CCKA 3RFFA 1KQ3A 1QTNA 4N41A 3IAM6 4GS5A 3EX7C 1A72A 3HVIA 3WSTA 3EBPA 3WI7A 3QE9Y 3C7KA 3RHZA 2K2WA 4KCGA 5JVDA 5DCLA 2HK9A 2ZVJA 5D3QA 1L3BA 4WDQA 2CNWD 2IELA 1M1YB 2DWPA 4F5YA 4BECA 1CUGA 3C3MA 2VTEA 1ESZA 5HK8A 2ZBEA 2FG7C 4NBWA 2J85A 2XMGA 1NW6A 2F62A 2WAYA 3FCOA 4XQCA 5IJ0A 1EQAA 2VAMA 2OHVA 4A23A 3WJ7A 5IU6A 2B8WA 3DDNA 3SMVA 3IQFA 3NPAA 4MV4A 5J2TB 5AOVA 3Q3JB 5CDYA 1IJFA 2HLDD 2B0CA 2ATXA 3A1UA 4OP2A 2PQ0A 3JALB 5TLSA 3RRZA 3EODA 3OTHA 4O8CA 2J9ZB 1JT2A 2YZKA 3ORHA 3P2OA 6REQA 4HY3A 4I36A 4TWRA 3OUZA 3WB1A 3CRQA 5FBLB 2ZUWA 4KPGA 4JUDX 4X44A 3DNPA 3U1TA 3UWSA 4AJ9A 1WBJB 5CLQA 3VC3A 3AMVA 3VNQA 4BJ3A 4I6JA 3FTDA 4TTVA 4BP8A 2PX5A 2DUMA 3O9VA 1NWCA 4A91A 4Y8VA 3ANNA 1AB6A 1U2DA 4D2IA 3EPJA 5IPFA 3TZEA 4FMDB 3ZW9A 1FX0A 2G0AA 5IDWA 1G20B 4R6WA 2PVSA 1M0SA 1LRLA 2NV0A 2IW1A 2LGJA 3TLCA 3UXYA 1RW4A 1L0BA 2CXUA 2LPMA 4RJIA 3H8VA 1L7DA 1Y6FA 2Q8PA 1PKEA 4ITVA 5KNCD 4YMUA 1CJMA 4GF5A 3EXFB 3FCCA 4M0EA 4UTNA 3VO8A 4DMLA 1M8JA 2ZAIA 5DNWA 4DDHA 2BWJA 3AB8A 1GWNA 1ADYA