5T3YA

Solution structure of response regulator protein from burkholderia multivorans
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
125
structure length
125
Chain Sequence
MIRTILAIDDSATMRALLHATLAQAGYEVTVAADGEAGFDLAATTAYDLVLTDQNMPRKSGLELIAALRQLSAYADTPILVLTTEGSDAFKAAARDAGATGWIEKPIDPGVLVELVATLSEPAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Two-component system response regulator
publication title Solution structure of response regulator protein from Burkholderia multivorans
rcsb
source organism Burkholderia multivorans
total genus 26
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2016-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5t3yA00
2PL1A 4ML3A 1L5YA 1QP4A 1JX6A 4LE1A 1Z15A 5PNTA 4F06A 2NT3A 2QU7A 5TQ2A 2RGYA 1ZGGA 4Q6WA 1I3CA 4IMJB 1DCMA 2LIVA 1XWWA 1AB6A 4G0OA 5CNKA 3OO1A 3UK0A 4YP9A 2YHAA 6ABPA 4KQCA 3CTPA 4IMIB 3C6QA 4NQRA 4MS3B 2WY2D 1JF8A 3QELB 4LDZA 4MS1A 5IEBA 1NXWA 2WWVD 2H0AA 3JS5A 4MS4B 5C5EA 3GL9A 4RK4A 4KPYA 1KGSA 3FFTA 1BDIA 3C3KA 4OG2A 2IKSA 2WMYA 3BRSA 3H5VA 2WRZA 1A04A 3NHZA 2MSKA 4MAAA 2TMYA 3QELA 4WT7A 1Z25A 3A0RB 4ZPJA 1CYEA 3FGZA 4NCAA 4Q6BA 2FMHA 3CFYA 3NNSA 2CHEA 4Z4EA 4HNQA 4LDAA 2W42A 1WETA 3ROFA 3L49A 3HUTA 4OLBA 2FLKA 4ZMRA 3JVDA 3QX9A 1R8JA 5CHYA 1APBA 4IILA 2PUDA 1YIOA 2FN9A 2HPHA 4WZZA 1NXOA 3SAJA 2RJNA 4KV7A 5FWYB 2IPAB 1XHFA 1LBIA 4S04A 1F51E 4MGEA 1RXEA 5D2CA 4XARA 4MYRA 3SNKA 1M2EA 3QX8A 4CBVA 5CNJA 3KKEA 1JFSA 1J56A 4NCBA 1Z17A 1T34A 1JYFA 3LUHA 2PUBA 1YMUA 3N75A 5JNWA 1EAYA 4GNRA 3HEBA 5IULC 1ZVVA 5DGCA 3O2JA 4W5QA 2ZWMA 1B00A 1OXBB 3T95A 9ABPA 2B1JA 3GA5A 3JY6A 5EWMB 2A9PA 3GRCA 4YV7A 1JL3A 2A9RA 3OLVA 3EJWA 3S99A 3SG0A 3OQMA 1QP7A 2PUFA 2A9OA 4W5NA 1YS6A 7ABPA 3QLUA 1W9HA 1NXTA 1NXSA 3QLVC 4RKRA 5HM6A 4KMRA 4H60A 4F8JA 3C3MA 4Z0NA 1ZHHA 4RS3A 1ZH4A 1USIA 4RK7A 5I4CA 3Q7RA 4TLLB 1U2PA 1E6MA 4ZYLA 4MRMB 3KS9A 5DLEA 5FWXA 1QP0A 1DZ3A 4RXMA 3IDOA 1ZY2A 2PAFA 2HQOA 3G85A 3LUDA 3RVNA 5TE9A 3SM9A 2PUCA 1Z2DA 3K9CA 1USKA 3LUFA 3EQ2A 3TB6A 4N0PA 4WWHA 4MRMA 4PICA 1PUXA 1ISSA 1L5ZA 1ZAYA 5E3JA 2E4YA 5GOTA 5TPWB 1JBEA 3LUAA 4EUKA 1JDNA 2BGGA 2P4UA 3DLHA 3EDCA 2L19A 4KRFA 2E4XA 3LOPA 2DRIA 1P6UA 1W25A 2IYNA 4UHJA 4Z9BA 3KYIB 5TQ0B 3HDGA 1EHCA 3F7NA 5JS2A 4Z4CA 1JFVA 4S05A 4Z99A 5TPWA 3Q15C 4YS6A 3LKVA 3H1FA 4D74A 4ZJPA 1LJUA 3JPYA 1H9CA 3UUGA 4N03A 2N9UA 1GUDA 5IX8A 2AYXA 3HDVA 3LMKA 5BRAA 1QO0D 4QICA 2F8SA 3O1HB 4IF4A 1MAVA 2R47A 3M6MD 3O2SB 1YMVA 2FN8A 1DCKA 3QLUC 3MIZA 4EYGA 4KFCA 3T6KA 2FQWA 1ZDMA 2M1ZA 5EWLB 5KC9A 3M9XA 3ILYA 4PYRA 4NV3A 1TJYA 4EY3A 2V0NA 4F3TA 2AYZA 3T8YA 2NZVG 5ABPA 3NBMA 2FMFA 3H6GA 2NUBA 2GWRA 3FFWA 1M2FA 5DTEA 1TLFA 2FEKA 4WXEA 3I42A 3QLVA 2VUHB 3CG0A 3G1WA 3GWGA 2E4WA 2O20A 3H5IA 3D02A 1NXVA 4Q7EA 4RV5A 1MIHA 4YGXB 2B4AA 2KYRA 4ETNA 5JNUA 3RVMA 4G0YA 4MS3A 2FQYA 4RY9A 1S8NA 4TN5A 1QQAA 1GUBA 1EWTA 3C97A 4ETMA 4MS4A 5IUNC 2NT4A 1E6LA 3IP7A 3KTOA 2CHFA 4G0MA 4XXHA 4EVQA 3LUCA 2HSGA 1OXKB 2FEPA 3E3MA 3W9SA 4TLMB 2CD7A 3N8IA 4Z4GA 2RDMA 1FFSA 3HS3A 1ZH2A 2WJAA 4LRQA 4RY8A 2FXIA 1SRRA 3L6UA 1MB0A 3RVJA 6CHYA 3EULA 1JDPA 1DC7A 1ZGZA 3OLXA 4NICA 5JNSA 3OLYA 5KWSA 4H3HB 4PEVA 4H3KB 2QV0A 3JTEA 3O1JC 1USGA 3O2QB 3I45A 4G0PA 5GQSA 3M9WA 1QPZA 1TVMA 3JPWA 3FDFA 3MM4A 3IP9A 2I6FA 4QYWA 3OMXA 1K66A 2QSJA 3DLBA 2FMIA 4W5RA 5FWYA 1UDRA 2PUEA 3OMWA 4P98A 4O1HA 3GYBA 1YS7A 2PUGA 2LP4Y 1AB5A 3N0RA 1QMPA 2IPMA 4MQEB 1RNLA 3HJFA 1RXIA 1PEAA 5JNVA 1PHRA 3MYYA 3QEKA 5TQJA 1ZESA 5TPZA 4E7PA 2OENG 2JB9A 3I09A 1KRXA 3TD9A 4KVFA 4DADA 1DG9A 4MR7B 4MQFB 1DRKA 4TMYA 3RVRA 1NTRA 3IP5A 1MB3A 4G86A 2PLNA 2IPLA 5T7BA 4KNYA 2FW0A 3KCNA 4MQEA 4MR8B 4RKQA 3DBIA 1FSPA 3MMNA 1A0OA 1JYEA 2JVIA 2PJUA 5EWMA 4D6XA 1U2QA 3EQZA 3H5WA 4PZ0A 3HM9A 4DQDA 1Z26A 4G0QA 4LZLA 3B2NA 3DGFC 5KQLA 4N0QA 3H6HA 2MYNA 3TO5A 1RZRA 1A2OA 3GBVA 3MQ4A 4MQFA 3HUUA 4RWEA 5JNTA 2FEWB 4OLAA 1JH9A 3CKMA 1DBWA 4EGSA 5EWJB 2MSWA 5IBQA 1RPJA 4MR8A 3BILA 2QVGA 1YTUA 2J48A 3OLWA 3GBPA 2E4UA 3KJXA 3KSMA 4RZSA 2IPNA 2JBAB 4MR9B 1PNTA 2X7XA 4WUTA 2XDYA 2FLWA 1GCGA 2E4VA 2FKAA 4YLEA 1Z18A 1Z2EA 3HK2A 5DCLA 1DJMA 4FB4A 1BAPA 2LPMA 4JA2A 1JLKA 1P6QA 4YR7A 3I5AA 3RVLA 2A9QA 1FQWA 1VRVA 3HVRA 3F6CA 3KYJB 1D1PA 1U8TA 5HKOA 3CG4A 2WB4A 3OM1A 1ABFA 1M5TA 3K4HA 4MLDA 3EGCA 1LJLA 4YRZA 1QQBA 3D8UA 4EYKA 1ZITA 3N0XA 2QVCA 4IRXA 5KI6A 1E6KA 4JB2A 5TQ0A 3QLTA 3N53A 3T38A 3LFTA 1KMIY 5B3JA 2IDMA 3N0WA 1P8AA 4W5TA 2GBPA 3KLOA 1D4ZA 3HXMA 3CNBA 1GLGA 4IGAA 5IUKC 4FE4A 5IUJC 3E61A 1HEYA 1BDHA 3FFXA 3KLNA 2HQBA 2ZAYA 4G0XA 3RVPA 4YWHA 1YVUA 3NNDA 4RXTA 3Q9SA 2GX6A 1QKKA 1YK0A 3KHTA 1C4WA 4UHKA 4Z4HA 3OQOA 4Z4IA 3H1EA 3OM0A 3QK7A 2PMCA 4RK5A 3KG2A 1MVOA 3GT7A 2PKXA 5F64A 3FMVA 5EWLA 1DCFA 4MS1B 5BR1A 5HSGA 4D6YA 4RY0A 3H75A 4RU1A 2FMKA 4EVSA 1SXHA 2PE5A 3OQNA 3H5OA 2FSPA 1DRJA 3Q7TA 5IC5A 2VUIB 3UKJA 1EFAA 2PUAA 5CNMA 2MSLA 3RVQA 2HJ9A 2VK2A 4RXUA 2MYTA 3O21A 4L4UA 1ABEA 2FQXA 5T3YA 3H5LA 2GI4A 2R4QA 3H5TA 5BRJA 3P9YA 1CHNA 3BBLA 2OQRA 3LTEA 4LE0A 1D1QA 1U0SY 4RK6A 5ED4A 1ZN2A 2LUOA 4KZKA 4O5AA 4RDCA 2JK1A 5KQGA 4QPJC 2WJWA 3LUGA 4G97A 1Y1LA 4M88A 3ROTA 1F4VA 1NXPA 4RSMA 4LX8A 1NY5A 2P9HA 3VNBA 4EVRA 5FBHA 1Z13A 2L2QA 4N41A 2YHBA 3CS3A 4XASA 2ID9A 4XFKA 4XLTA 3IP6A 3RVSA 1LK0A 5B3JC 4FE7A 4N47A 1PEYA 2H3HA 1PNRA 3URMA 1DC8A 4Z9AA 5JNRA 3EAFA 3R0JA 5CNIA 4B09A 3LUKA 3NHMA 1TMYA 3BRQA 2M98A 3HSYA 4N76A 4RK0A 1KRWA 1GCAA 2JVJA 2QZJA 2LBPA 4YCSA 3SY8A 5JS1A 1Z12A 3A10A 1BDJA 4Y9TA 4JAVC 3RVOA 3CU5A 1NATA 3O74A 4G0ZA 3HO1A 4E7OA 4OBBA 3F6PA 3O75A 4QYMA 1YK1A 4ZMSA 3N6VA 2CWDA 1M5UA 3NNNA 4YO7A 2IOYA 3CRNA 5KC8A 3HCWA 5IEJA 2JCGA 3VNAA 1ISRA 2QR3A 3CHYA 1U04A 2NZUG 3GV0A 5FBKA 1SD5A 2E4ZA 1BA2A 1Z16A 1JHZA 3IPCA 4EYOA 4GPAA 4L85A 3F73A 1TM2A 3DGEC 4JOQA 1DBQA 2R48A 4OTZA 2HQRA 3A0UA 4MR7A 3ILHA 3RH0A 4HNRA 3SQNA 4Z4FA 4XAQA 4JB0A 5FWXB 4DN6A 2L18A 3MA0A 4JASB 5HQJA 2L17A 3QEMB 5TPZD 5DKFA 4ETIA 3CLKA 1BVHA 1E2BA 4W5OA 3LUJA 2FTKE 3BREA 1K68A 1D2AA 3CZCA 3HZHA 5BQ3A 3A3KA 1SXIA 2ID7A 4F11A 3EODA 4RK1A 2Q5CA 1XHEA 5EWJA 4KREA 1P2FA 3QEMA 4MLCA 4O1IA 5C5CA 1CEYA 3O1IC 3RVKA 4HNSA 1RZRD 1D5WA 3MF4A 1EWKA 2JBAA 1DBPA 1IIBA 4MR9A 1EWVA 2RJOA 4P1ZA 4PE5B 5KQMA 1SXGA 1LBHA 3JVIA 1JWLA 2QW1A 3CZ5A 3Q7SA 1FFWA 3Q41A 1JFTA 4KK3A 3RQIA 3HV2A 4EYQA 1QO0A 2R25B 1C0EA 1URPA 2MYPA 3H1GA 2JVKA 3LKBA 8ABPA 3OO0A 4F12A 1FFGA 2MYUA 2FVYA 4MPTA 4HYEA 4KK4A 3TMYA 2JRLA 3C3WA 3OLZA 4WXMA 4JP1A 2PL9A 4LE2A 4OATA 5TQ2B 3TX6A 1VLZA 1VKRA 3IPAA 2QXYA 1NXXA 1DP4A 4KQ9A 2F8TA 1QNLA 3DZDA 2GKGA 2VYCA 5KQPA 1VPWA
chains in the Genus database with same CATH superfamily
1WTAA 1L5YA 5FOXA 2EIHA 1ONOA 2FWNA 1NJ2A 2ZB2A 4GYKA 2YNMA 4LE1A 1Y81A 4QJBA 3V4SA 4V1CI 2XOXA 1XU9A 3HMKA 1WF6A 1YGYA 2FPPB 2FR8A 2GEKA 1QHHA 4GDFA 1H8ED 1VE1A 3F74A 3BSFA 2JZOA 5E1BA 3P9XA 5L95A 4OA8A 2P2GA 4H27A 4EQZA 5EESA 3O0TA 4G5FA 4IJQA 4ZYYA 2P2ZA 1Q1GA 4FCWA 4H31A 2NSYA 4JJEA 4ON9A 6ABPA 3ZNPA 3NVKI 5KYUB 2AHRA 1EQ2A 4XRGA 4DV7B 1H3FA 2B21A 3VSCA 2J5RA 5IEBA 1Z4OA 5GZ6A 4B8YA 1DKOA 3NFRA 2X7JA 2QK4A 1RXCA 3AP3A 1A9RA 4J1QA 1XT6A 3WLJA 4F46A 2PZGA 4KPYA 4MVWA 3E7XA 4HS9A 2HYDA 4CR8A 2H18A 3Q7EA 4B6FA 4ECEA 1WWKA 2JLBA 3G9ZA 2UXCB 5IK2A 1MF7A 2J7KA 4XGQA 1T5SA 5CEJA 3ISVA 5HUQA 4NDAA 5EA2A 3DONA 4BZPA 3UM9A 4COOA 4DLAA 3WLQA 2BR5A 1U1EA 4FDAA 1YS9A 1B1AA 1K5GA 3RS0A 5CRIA 3VU1A 3G02A 2EGGA 4GZ6A 3TX2A 3FETA 3PSHA 3CFYA 4OQ4A 2GPNA 3CUEF 5HZGA 5JJKA 4JI4B 1LVUA 4QECA 1Q0UA 1C7JA 2AOTA 4MKFA 4UQLA 1ZIYA 1OV4A 1HDEA 1U2ZA 3Q5GA 1XEXB 3OOEA 2ISCA 5L3SB 1ZM2A 3A3YA 5C7LO 5I5EA 3NWBA 1E3IA 1ULBA 4I5FA 2CGEA 2BH2A 2WAYA 3AVPA 1GZSA 3MXTA 4UTOA 3TTTA 2ZQYA 4BNWA 4BWVA 1C0KA 2P67A 2NQ8A 1TCAA 2BLNA 1Z73A 5CITA 2XBMA 2ZRLA 3THXB 2LNDA 1N1MA 2DTXA 2YFYA 4J8PA 5T57A 1TRKA 2FLVA 5IF9A 3PF9A 2CE2X 3QVMA 4KR9A 4CCYB 4WZAB 1DWUA 1IHDA 3FYUC 2WIGA 1RJGA 3FYCA 3HEBA 5BMVB 2OPBA 5K8TA 2Z1DA 2II6A 3A7EA 3AH8A 3JQEA 1ZMBA 4TZKA 4HQLA 4XCQA 1UKYA 1ZZEA 5KYNA 4HNAA 2ISSD 3I9KA 1KZGB 3EG9B 3V1YA 5EJ5A 3GA5A 1XWFA 2X5KO 1U1FA 5KPJA 1T13A 4ZAVA 1KWKA 3AXSA 1XC7A 1OPRA 2GN0A 3GEEA 2CYCA 3PNMA 4MW5A 4UHBA 3BIFA 4KO2S 2P9FA 3UWPA 3TW0A 1VL0A 1RQGA 2A9OA 3GJRA 5FH9A 4YAFA 3WL6A 4YXWD 1PJRA 1FJHA 4KMRA 1DAOA 3OQ6A 2GVNA 2B4KA 1JE1A 1U3FA 3K0CA 4C5BA 3LY9A 4JJKA 4YLGA 3W5IA 2WK1A 4U4AA 2Q4EA 4GI5A 4RL4A 3Q7RA 2OO7A 3PQ3A 2D5AA 2VHUA 2X6QA 3KAPA 4HB4A 4M60A 4KSBA 2GO1A 5I3ZA 3A6FA 1UFRA 4K40A 4DDVA 4DV0B 1KS2A 2CJWA 4C2TA 2VDNB 1SD1A 3AM3A 1OAOA 1TJ5A 1PSDA 1NJ1A 5U1PA 2L69A 3DMNA 8ADHA 3R8FA 1TM5E 1DGQA 1N6PA 4BFSA 1A88A 3Q2KA 5AICA 1T0HB 3PLNA 1WKVA 1USKA 1HDOA 3LUFA 3MJRA 1I5RA 1EE9A 4Z9YA 3HU2A 3WYNA 3QKSA 3TTYA 4BO9A 5FOUA 3LLVA 1ENPA 1V96A 4JN6B 3X2SA 3JR3A 3VBCA 1U31A 3A9VA 3KJIA 5EL0A 3JWEA 3EGDB 1W9MA 3RYTC 2ZUSA 4U2CA 5ALOA 2HBYA 1RYBA 1VCHA 3ID6C 1K2WA 5KYXA 3WSWA 4O4HF 5HA5A 4JXJA 4R1QA 1Z4QA 3PQDA 4UU7A 2ZJZA 2C29D 3FFBA 2C1EA 1QM5A 2JJ2A 4QNMA 4BDTA 4HNGA 1FP7A 3A2KA 3TEFA 1UXGA 1NG1A 3HYSA 4DG8A 3IHWA 1V3UA 2CB0A 2PRSA 3P2YA 2OP1A 3P2OA 2DQZA 2IIPA 3O7WA 2EQAA 3P9QA 5I9MA 3TLXA 2ZUWA 2C8JA 3OKPA 1L5OA 3D5EA 1ICIA 3GVPA 3H1FA 2OORC 3FRIA 1MO4A 1ZGAA 2F3TA 5EY5B 3W6OA 3WKBA 2ENUA 2R00C 3CCCA 3VH2A 4EHNA 3REOA 2AYXA 1WCYA 1SJ9A 3EEFA 3KB1A 5ECDA 1LD3A 3RU9A 1L5GB 4BAUA 5CBPA 4B3MB 1QUFA 1V41E 2VR1A 4MI9A 3RWOA 1MAHA 5JWRA 5KWIA 5LIPA 4OQYA 4WBSA 5HR5A 5LNK1 2PRKA 1G9XA 3PPXA 4FHZA 3SK0A 4K6OA 1TJYA 3F1KA 1HA3A 1WPXA 4FFDA 4PG8A 1PUJA 1XU4A 3ODPA 4MWSA 4R54A 3AVXA 3AVQA 2HN9A 1HL3A 5D01A 2JLCA 4BE7B 5AW3A 4IZOA 1Q11A 4QDUA 3UEOA 1JVBA 3ZKWB 1XQYA 2X58A 4LJ8A 3WGTA 3ZKAA 4BTVA 7MHTA 3TB4A 2GHTA 3RUPA 2GQ0A 2ZJ6A 4NBSA 2G67A 2PRYA 3IAFA 2X41A 3I42A 1QOPB 1SKMA 4CMEA 4JD5A 4PPYA 1M2KA 2O0KA 2WI8A 4YPVA 3SX2A 1RS0A 4MB2A 4RV5A 2IY8A 1J7JA 1LUAA 2A0FA 2O2IA 2B4AA 4BLVA 4INOA 1FRQA 4FGUA 1EQUA 4F3YA 1P4RA 2GK3A 2GZ1A 2KHZA 4J2HA 3VJRA 2WJVA 1OYOA 1IDN1 1QRAA 2IOFK 4IIVA 3BJMA 1LX7A 2A2ZA 3NC1C 4IVNA 4AX4A 4Z7QB 1U2GC 3G2OA 3O82A 2B92A 4U5XA 3I92A 4EH1A 2Y2UA 3OPMA 3W9SA 2WHRA 1PZEA 3T41A 3RNLA 4BQPA 3WJ7A 1Y4UA 3F9CA 3TCNA 4EFMA 3B5JA 1Z38A 4X3OA 1JNYA 1SBCA 4X7MA 1SRRA 4BNLA 3JW8A 3SZLA 1JIJA 4GEGA 1Z28A 5HCUA 1CY2A 1LS1A 3I6QA 6CHYA 4KPUB 3RADC 4HATA 4PCUA 4US1R 2RC5A 2VN8A 2E9SA 4QUGA 4O08A 1RRPA 1UKEA 4BMNA 1ULZA 3BFXA 2PSDA 4O4JB 4RV4A 2OBYA 2V7UA 3SBEA 4K28A 3CR8A 4TXJA 4UARA 1K66A 2BEUA 3C5CA 2ORYA 2QSJA 1P1FA 1K8ZB 3C3PA 3H4TA 1MV8A 5AOBA 2PUEA 1XQ6A 3NAGA 3OMWA 3GEDA 3RQSA 3WA7A 3RIXA 1XD9A 2QUZA 1Y33E 4GMFA 4HQNA 3HB5X 2HBRA 1VBKA 3DYBA 1ZXXA 1UBEA 4DIFA 3LQFA 1N2GA 1D6NA 5A4JA 3KDPA 4I19A 1SKYB 1F0PA 3C1OA 3JVVA 2YWEA 4TXMA 2VP5A 1KRXA 1KGDA 4DADA 5T8KA 2GEUA 3NANA 2VH5R 2WAXA 3F6RA 2EARA 5A9SB 5JCPA 3DXYA 3W6PA 5JRZA 5LKRA 3STXA 5FWNA 1OH7A 4CIBA 3F9RA 3KELA 4TMXA 1F48A 5F7ZA 2WF5A 3OF3A 4D6XA 1G8MA 3C15C 5LC1A 3I9MA 4PRYA 4ISCA 4GZ3A 4WFJA 3KZMA 2BELA 3JRNA 1II0A 1KJQA 2EOAA 4L78A 3TW8A 3M34A 1J97A 2AOVA 6AT1A 3H18A 5DRTA 3KT6A 1OA0A 1S7GA 2Z9DA 4UOEA 1GPMA 2X1HA 5A3RA 4H77A 2JGMA 4DLKA 8LDHA 3OA0A 3U16A 5L3VA 2QVGA 1DV2A 4GI7A 1PWZA 1LBQA 4AZ0B 1CZHA 1K7FB 2E4UA 1ISJA 1QG6A 2P90A 4HZGA 5IM5A 2OLJA 2C2OA 3KSMA 3WYBA 3TL6A 1MDFA 2QYSA 2R6AA 1KEEA 3HGTA 3WZLA 3TD6A 1TK3A 1KS9A 3B82A 3PRJA 3T1VA 4M1TA 5FFFA 1Y1TA 3FDZB 4AD8A 1NW9B 3WGUA 4IF6A 2ZRNA 2D3WA 1T25A 4P22A 2WJGA 4OQLA 1LDYA 1OE0A 1TI7A 4LVUA 4BQQA 2ZITA 3EZFA 3H5AA 2GK6A 3O4VA 3QWHA 5AK0A 5IDVA 1ISIA 3O7MA 4BAZA 5J4VA 1BH2A 3NHAA 2AC7A 2VCYA 4HBZA 1JVSA 2QX4A 1YQQA 1U0BB 2OK8A 4BEBA 5LR6A 3NRJA 1YI8A 3W2FA 1ONBA 1YNSA 3IAS6 4K7JA 3SQWA 3AI2A 1KI3A 2Y77A 2LVBA 3L01A 3BSSA 4DV6B 2ZWOA 5ENZA 2WA1A 2RIRA 4PQYA 1AMNA 4FDLA 5K4AA 5DW3A 3QLTA 1R6UA 4QXQA 3OJXA 4GOXA 3V97A 4BFZA 4I1OA 2C92A 1JI0A 1FUYB 3TLMA 3WO1A 4KOEC 1XE3A 5AESA 2DG2A 1G5QA 3IULA 3Q7QA 4FE4A 4IGAA 5CB0A 3W2IA 5LA6F 1GNRA 2QL7A 2UYYA 3PNKA 1WUYA 1YKSA 2IL1A 2VA9A 4BV3A 3IUBA 1YVUA 3B38A 1HC7A 2PWBA 1NFFA 3NNDA 2CSUA 2O7NA 1UWKA 4QDZA 2RH5A 1UKBA 3A6HA 4UXHA 4EJSC 4OHPA 3UAVA 4BCDA 1IVYA 1I7QB 5BR1A 4OYHA 4ZP1A 1B0ZA 1SXJB 4RY0A 4LJ5A 1E2HA 2C2HA 4YVFA 1A5ZA 1C1XA 4BMVA 4D26A 2ADFA 4G8CA 3DFZA 4LDQA 4QTZA 2ON6A 4E31A 5JQWA 5K5EA 1H2AS 3EXHB 1LCIA 1QR6A 3CNQS 3SEFA 3G1UA 4F93B 2FPGB 3PBKA 1U1GA 2R97A 3QV1A 4U3JA 4UBKA 2QY9A 3TQRA 5J2UA 5EQJB 1YA6A 3IOBA 1Q7CA 3IBCA 1ILEA 5H0IA 2FUG1 3P9YA 3KYDA 4NE2A 2AQIA 3EDOA 1QH8A 3UJ7A 1FSZA 1ZM4A 1AQUA 4BBAA 2G0TA 5CFPA 1U5AA 3IHTA 1BMDA 2Z2XA 3G8YA 3LW7A 4U2FA 4JMLA 5IP5A 3ROTA 4FFSA 5EZQA 4DMRA 1NXPA 3P97A 2UYCA 2XB6A 1U0LA 3A9RA 3QKRA 4UEOA 3L1JA 5JHGB 5KWJA 4RNDB 3G2MA 3U0VA 4BNJA 3LDUA 1TRHA 3CIFA 1GUFA 1U63A 3UAZA 4JJ7A 4FFPA 5CH5A 4C4SA 3WHKA 5K4GA 3D4LA 4E33A 1FL9A 2ZIXB 5A06A 2XJ4A 1ML4A 1CSEE 3RVSA 5JD5A 3AVTA 3PHLA 1CF4A 4AYWA 1RI3A 2I4TA 1WCIB 2PX6A 3D0OA 1J5PA 4CMIB 2ZKLA 2C7PA 4AKGA 1AKRA 5DGTA 1FSSA 1Z0IA 2C0CA 2ZJAA 3NTLA 1L8OA 2Z3WA 4P81A 1EH5A 4QUDA 4EFNA 1KNXA 2B4TO 4PO9A 1EMDA 1VIDA 2DFNA 4ZVPA 1W47A 4NF2A 3GVHA 3NWEA 4LJ6A 4QO7A 3EWAA 3QOXA 2AFHE 2GZSA 5J40A 3ZWVA 4YCSA 2OV8A 4J29A 5KSWB 1DELA 5AM4A 5SZJA 4AL4A 1T15A 1JKXA 1W93A 1II8B 2ASEA 3ONVA 2AXPA 1F8UA 3GLVA 3NETA 4JI1B 4EB6B 3GMSA 3PNSA 4PSKA 2P30A 4XW2A 2YUTA 1SIOA 5I48A 4IW3B 3U4HA 3EFOB 4JWKA 1EUDB 2RK3A 4MV1A 5BSTA 1W19A 5ER6A 1R27A 2FF7A 3F6SA 3LC2O 4BFXA 1HMYA 2Y71A 3BWEA 3UGJA 2PGLA 1JECA 4RA6A 4L85A 4DJ5X 1O9BA 5DOVA 4GYYA 4OTZA 1SWVA 3VOTA 1RBYA 3ROPA 5AW1A 5JALA 3PVZA 1IXRC 4EHBA 3BMQB 4ZO4A 1ZH0A 4J4TA 1K7YA 3O91A 4R81A 3VR2D 1LPSA 4FKMA 5BW6B 4XX0B 5K3SA 5TPZD 4XYBA 3STYA 4KH1A 4QULA 2GBGA 3Q88A 4Q3NA 1DJQA 2BSAA 3P2EA 3KX2A 2QOEA 3RK4A 1WABA 3RK1A 4LDPA 2O7SA 1FXWA 3RC7A 4IS3A 1TXGA 4Y2JA 4F11A 5KNBH 1RIFA 1RM3A 3AJ9A 3NDPA 5ER9A 4YDSA 2D5LA 4MLCA 5EINA 3MWGA 3V4VB 4O1IA 4OQXA 1NG9A 1W35A 3FF1A 4ABYA 1NNUA 2QLNA 1WSBA 4A2WA 4QFMA 3NV9A 4GKBA 3Q85A 4PE5B 3B6KA 1NOIA 1NRWA 1KYVA 5JAQA 5D5HA 4AJLA 4HNHA 3TQOA 5JBIA 3DDWA 5J59A 1LBHA 4QGAA 2AX4A 4C0HA 4HV4A 2V4MA 2XNKA 1UXJA 4BLSA 1E18A 5FBVB 2WHYA 2RAPA 4S0ZA 5EFZA 4L1KA 1J0DA 4OQEA 5ES3A 1IY8A 4TV9A 4RHEA 1UBCA 2XQFA 4MUJA 1JFTA 4EYQA 2WSSA 4AP9A 2BRUA 1PAUA 2V8BA 3EGEA 1GZHB 1D6JA 3H1GA 3MB5A 3MINA 1WBDA 1FFGA 1XF1A 2H8GA 1SUFA 4J1TA 2AG5A 3FRJA 1SCQA 5K3AA 1ZOSA 2ZJOA 1ODFA 2RHJA 1R6AA 4LE2A 3C5VA 5CLFA 3P9NA 4QTYA 3IPAA 1CY6A 2GETA 4ZKDA 3AONB 1JHRA 4RH3A 2R7KA 2W6ID 2Y27A 1EK6A 1RKUA 1DP4A 2YOHA 3SHQA 3WB0A 3L07A 1RFGE 1VI5A 4K6KA 5FTWA 3WIOA 1NKVA 1RQRA 3EQ6A 4PG6A 4QU0A 3ILXA 5DHQA 1ZUNB 4UBMA 1JX6A 3RV4A 2PKWA 4AKIA 1E4EB 1S2MA 1LJ8A 3QF4B 1SFRA 2BGJA 5K3OA 2O2ZA 4I46A 4QDJA 4WLEA 1YFJA 2XZLA 4FD2A 5TGDA 1FU7A 2H4JA 4N5NA 4IPTA 1A4RA 5DCWA 1LPNA 2GHQA 2ZSHA 5EJMA 2OYRA 3KOOA 2IS2A 4QWWA 1FUKA 1VCNA 2OM2A 4P3XA 4GLJA 4PR0A 1H2BA 4M0PA 4LJ9A 5DGHA 3STHA 5TXGA 1IQPA 3IBFA 1KY5A 4OI0A 4HWRA 2FDRA 4YUVA 3W7AA 2C4HA 3IAAA 2FOXA 1HNNA 2Q1TA 3M5WA 1MQ9A 1MDBA 3AUSA 3U62A 1KIFA 2DX7A 2O0MA 4P80A 2H0RA 1P0FA 4LPKA 3S29A 2ZSBA 1W29A 2YL2A 3F5FA 2IPXA 3IDQA 3JRWA 2TRSB 3Q1LA 4NMXB 2XGMA 5G4KB 4OG2A 3ZVNA 4IH9A 1NJ8A 3P9IA 2I29A 1ECGA 4FFWA 3A9TA 3MIIA 3CF4A 3AJDA 1QYRA 3O0DA 2WJYA 3QA9A 1P9WA 1HUQA 3QX7A 3WYFA 1JDBB 4RMIA 2GCOB 4DYDA 4UAGA 4R7TA 4RTNA 4ZPJA 1AS0A 1HG0A 2O5VA 1DQYA 4RD6A 4YTEA 2GDZA 1BJRE 1AJEA 2WIKA 2WVGA 3WIBA 2Q28A 2X19A 4D4IA 1HWYA 2ECFA 3DCYA 5BVGB 4ARCA 4GUAA 2HUPA 2HUNA 4C3UA 4MB6A 4JDUA 4PSUA 4N3BA 5LJIA 1E1LA 5HJ5A 2P79A 1MU0A 5KU1A 1M33A 5MDHA 3RJZA 4QDOA 1ESZA 1LI7A 3ZCUA 2P3LA 3N2IA 2YRFA 4AIRA 1R4ZA 2IPAB 4NP6A 4F86A 3TZKA 1ZK1A 2GFHA 1MP0A 1AO3A 1WUHS 1H8HD 3BMCB 1UFKA 5NLLA 1NGSA 1F2UB 1T0UA 3LH5A 3TQHA 3OWHA 1JBQA 5AQEA 1CJVC 1Z0KA 3GR6A 1FUEA 2OVFA 3WRWA 2Z2KA 3OZXA 3I8SA 1HDIA 5G2OA 3MZ0A 3EUEA 4DRZA 1M2VB 5AJTA 3E4DA 3CH7A 5K0CA 1DBRA 4IXNA 2PUBA 2BI4A 3N75A 1F9AA 3UK1A 1V8BA 4J03A 3W5UA 1K3UB 3HLYA 4LI3X 3UFXB 5IYZB 1IN6A 3G9XA 1N6IA 3K5HA 1DKRA 2BT4A 1VE7A 2GM5A 2XZTA 4W7HA 1Y3BE 5BXQC 3WVNA 3GG9A 3K3PA 4XRRA 3K8QA 4UEKA 2A0YA 3SZ3A 5ADUS 1YS2X 1C9NA 2FI1A 1IYZA 4OHOA 1W44A 4G5HA 1H6AA 5CP8A 4DJDC 2Q5HA 3B60A 5ALFA 4WFQA 1R66A 1DO0A 1GPDG 1WPQA 3TZBA 1J5EB 1OIVA 5L6LB 3OX3A 5KDDA 1C9EA 3O4RA 1OYVA 1N6LA 2WTNA 5IBRA 1QGUA 3ANXA 4IIDA 1C8LA 2G1PA 3C3MA 3OTQA 1IUOA 1OZAA 4DC9A 1B23P 3AV0B 2WFMA 4JLSA 2BGWA 2BFEB 2LE0A 3RSOA 1Z6QA 4I3FA 2FEAA 2P9EA 2DWUA 4YRAA 1N2XA 2QSUA 5FWXA 4RLFA 4RXMA 3VKHA 2P6NA 2BGTA 4TMVA 3LCMA 3JQAD 1TPYA 1J90A 3LUDA 5F9FA 3FLAA 4R1TA 2QZ4A 4FHEA 3PEYA 1CU1A 4ROTA 3UAOA 4G84A 4F1WA 2UVQA 2BISA 3OPQA 3UFBA 4GL2A 4OHXA 1XMOB 1OBHA 2ATCA 5L51A 1GT91 4MV3A 3HA2A 1AKVA 1CKEA 3FWNA 3ISTA 4MICA 1WV0A 1QS0A 1T4MA 4PICA 1BJKA 1CRZA 1TTHA 4U39A 3DAGA 4XSGA 3BG5A 5LDDC 1R0SA 1RQLA 1FP2A 2OBFA 5JRJA 1GPAA 1JTEA 4FI3F 4TVOA 1JG2A 5ALIA 4AZWA 3AF6A 1AVTA 3DAFA 1SN7A 3UHPA 5BSFA 3EGVA 5GPBA 4EA6A 3SPXA 3FUCA 3OSUA 4JJIA 3ENQA 3EDCA 2NYUA 4ZEOA 2ODAA 2HREA 3M1IA 4CGYA 4CKZA 2DAPA 4FEEA 1ES9A 3E9NA 4KL8S 3KYIB 5DMHA 3HDGA 4AY4A 4B3SB 2N42A 4J1SA 3ZD6A 1VLQA 1XJCA 5LZ9A 3HTXA 3B20A 3W4JA 4DPMA 4S05A 1QVWA 3ZZMA 1CJTC 2F62A 1V43A 4ROSA 5EXTA 1KQGA 2BM9A 4YS6A 4LZWA 1M8KA 4PLVA 5FTMA 2ZT8A 3TRKA 2B7BA 3M81A 1X13A 4B2YA 4C21A 2BDUA 3PFIA 5LBTA 3QMMA 1N92A 2F1KA 1K7EB 3GLHA 5E6SB 5HE9A 4ZDJA 3T7IA 1MAVA 4NULA 1YJXA 2FN8A 3TYXA 2Y0BA 4HLNA 1E3DA 4R2XA 1H85A 2G17A 3EDMA 1TE2A 1HDGO 5ETJA 7ADHA 3FVQA 3TLEA 2D1TA 2EKPA 5BMOA 4F6CA 3D7SA 4KLAA 4P7KA 3AWDA 3GFRA 2IEGA 2PXAA 5ABPA 4N54A 3DL2A 1L4NA 4UFPA 2FPPA 2I7CA 3PL5A 4JLBA 2YZKA 3ETCA 4QBTA 5DTRA 1KQ3A 3QFRA 5UKDA 2ZVPX 2PIDA 1D1TA 2XODA 3GLSA 2EFYA 4BN4A 5CXQA 3PE4A 4FFLA 1DKPA 3GWGA 3HR7A 1G7CA 4GPIB 3I37X 3P5BA 5JEDA 4QNNA 3L4EA 4EAAA 2IX3A 3FZYA 4Q18A 2KYRA 5KYUA 4D2IA 3SSNA 1FDRA 5LM3A 1S01A 4A0HA 3P7MA 5GJWC 1SHZA 3U44A 1M1NA 2WD7B 3KVRA 4N3GA 4TL7A 5GV8A 4JX9A 2XGOA 1A9PA 1YZVA 2WAAA 3A31A 3GRPA 2IODA 4F2GA 4P0QB 2H4XA 3AF2A 3J7AC 5FORA 3UYLA 3RRJA 1NVEA 4KKVA 4XM2A 3WRVA 2JAUA 3KKOA 3PUJA 3HS3A 1JIVA 1R10A 2VAMA 5CIYA 3Q8LA 1N5KA 1BN7A 2G6TA 2FSHA 4FJ2A 4WY5A 3OHMA 3M5PA 3PC8C 3EVEA 3R41A 1OH5A 3MD0A 2JCBA 3OLYA 2VXOA 3C39A 2WC1A 4PEVA 2QEQA 3WSTA 4GVPA 3O2QB 4B4KA 4YUXA 1NW8A 2QD4A 3BFJA 3M9WA 3R7SA 2A0XA 2I3ZA 3KYCB 1XA3A 1TVMA 2FZWA 3NFYA 1V47A 4I4CA 4MVJG 3TXXA 1XEXA 2I6FA 4REQA 3UY4A 5KINB 2H59A 1UK8A 5L3SA 4RH0A 3TE6A 4ENPA 4JXKA 2M6LA 2NTVA 4FZ3A 4HQ0A 1M0TA 1EJBA 2BL4A 2XDQB 3IAS1 1I01A 5J5CA 4EA7A 5CA0B 2H1VA 1ST3A 2I4MA 3O6VA 4OBBA 5DI3B 2B83A 2R5FA 3DG9A 2HSJA 5LXTF 1Z3IX 3DF9A 1VE9A 4B6JA 2CCKA 3GJ4A 2CCJA 3HL4A 1VCMA 1RC8A 4CCYA 4WZAA 4XGKA 4GSKA 3BTSA 2AGVA 2C0QA 3ETJA 1CUIA 1NHWA 1VB5A 3KXDA 5BMVA 3DPIA 3GY0A 2B6NA 5H9VA 1J2UA 2VC2B 3WMFA 1MOZA 1NDHA 2VBFA 5J3JA 1XK7A 5KVVA 1RMQA 1ONSA 2PLNA 2IPLA 3X44A 3EG9A 4Q05A 1DEAA 3PGMA 1W94A 3DNFA 4B0OA 3V4FA 4J1NA 4M0EA 1QG0A 1V5IA 1Y4SA 3M70A 3L18A 2G5CA 2XYVA 2RHTA 2VHTA 1PK7A 3TTWA 2R68A 3VNUA 1HK7A 3GO4A 2Q1XA 3HH8A 3LPMA 2VPPA 4DNQA 3AU8A 3GBVA 4ZREA 1SK9A 1UL1X 2C3OA 5JNTA 2WJ3A 5KJ1A 2Z83A 2BZGA 4N3CA 3C7CB 4JQYA 3LF2A 5ALVA 2QRZA 1J06A 4URUR 1ITZA 3B1XA 3U1BA 4D44A 5EOVA 2H4HA 3C8HA 4ZOAA 2WZQA 1PNTA 3ZDDA 2QTNA 2X7XA 4PX2A 1L6RA 4ZI2A 5DNDA 4AS2A 1YACA 2DYKA 2WIFA 1GOTA 3IILA 3WXMA 1I3LA 4AMGA 1WD7A 4KMOA 3ABZA 1I3OA 5BWBA 1JB9A 1GYPA 3DTTA 3S1SA 4ABTA 4II2A 2DHQA 3U7QB 1P6QA 3OD5A 4YR7A 2VAVA 4Z5XA 3Q3JB 3K09A 3A8TA 3V7FA 5IU6A 2K6GA 1Q1NA 4GYWA 2NU8B 3GNQA 3RK0A 3CG4A 1HXHA 3PI7A 5IC6A 2RIPA 1D0SA 3PEFA 4GOJA 4RVNA 1KDZA 1UJNA 2LRHA 2OCDA 2QVZX 4EYKA 1LXCA 1P7ZA 2I03A 2QVCA 1QFXA 3CUVA 1NLYA 1LU9A 2AJDA 2IHKA 4NATA 1E6KA 3T4UA 3IOCA 1NVDA 1Y8RB 1TTQB 1NZJA 2EJTA 2R84A 3SVLA 2LW7A 3HYLA 1Q1QA 3OP4A 4YJKA 1N2BA 2DFLA 2F1RA 1HDYA 1HQDA 2QRPA 3Q10A 5ITZB 3QU7A 2WA2A 3W2HA 2WV7A 3U4CA 3I73A 4YV1A 2EBWA 1NUUA 1PF7E 1K5DA 5DYYA 5KTSA 1BKSB 1CCWA 1VPVA 3ZWQA 4F9GA 1L5RA 5CURA 4I0WB 1X7YB 3REQA 1FVOA 4IX1A 5ADWA 1FLVA 2EBFX 5G3YA 1G21E 4RVFA 2C2YA 3AB7A 4MX8A 5FOWA 2INGX 2GBCA 2RE8A 2IZ6A 3ZOKA 5HKLA 3FPHA 2VK1A 2ZTMA 5JDCC 4D4GA 3KSRA 1VL2A 3Q11A 4Z51A 4ER3A 2O2YA 4YA6A 1Y1SA 3ZKWA 2QN2A 1Z5VA 2DH5A 4NEGA 3V6LA 1E1CB 3VR5H 1ZU4A 1UODA 3Q3IA 4I4TF 5EKUA 2DLCX 2XWBF 4C03A 3R3VA 1KK0A 4U9HS 3SC4A 4C22A 3I32A 1CRPA 1T6NA 2BKUA 4LWOA 4C0XA 3HABA 4OXQA 3OZTA 4DLYA 4CQNA 2I99A 3HFJA 4Y1EA 1CIJA 2RGDA 1EZ4A 2FSIA 1Z88A 4OU4A 3TGWA 3C70A 3F3YA 4FGZA 3LCVB 1TQ4A 1WEKA 1Y3HA 4BWYA 4CJXA 1D2EA 1JMYA 1M8FA 2D5IA 1E3SA 1OWPA 1J8DA 1ORVA 3NHUA 2QY6A 1UK6A 3CS3A 5FTLA 3I2HA 4HH1A 2JLYA 3LXMA 5B7GA 1C7IA 5EJ7A 3VQTA 4M0FA 5HE8A 3NTQA 1UMDA 1A8HA 4WEOA 2KPOA 1Z39A 2XKBA 5GM1A 1F8XA 1DPGA 2JAPA 2IU4A 3E3LA 3LYHA 4G63A 2I87A 3ZCRA 1IOVA 2WJJA 5DNYB 1YOVB 2B3TA 2VJCA 1GA6A 3TSYA 4OMUA 3EAFA 3OOYA 4A2PA 4F4FA 1UXOA 1TAUA 3HXTA 2JFFA 2M98A 1YOBA 1RHJA 2PMDA 2UZ0A 2PU7A 3N2KB 2WLSA 1MB2A 5LQMA 1GCAA 4K88A 3F90A 5JUWA 3ZWOA 1G0NA 1SU8A 1WIWA 4MRPA 1YRBA 1DDGA 1ZK2A 3LZDA 3O4GA 1BWSA 1HLFA 2WJ4A 4TLDA 4NK5A 3V4ZA 1IK6A 1CB0A 2HK8A 1XMPA 3CF6R 3EW9A 5F2EA 1C7RA 4ZVLA 4GZMA 4BWGA 2H54A 1P9NA 2AUNA 1AKWA 1NATA 3QE2A 4FFVA 4WA7A 5F4ZA 4UATA 4DLXA 4ZEVA 1BE0A 3CH4B 2R2GA 3K0SA 4W5JA 1M5UA 5JTTA 1AHHA 2GD1O 1CDOA 5IJZA 4KAAA 1EG7A 3L0IB 1XDBA 4O4LF 2GCNA 1YRHA 2EFDB 4KQIA 1QQ7A 4QLAA 1US8B 3F73A 1R0RE 4DY4A 1J8MF 2GARA 1DBQA 2FWJA 3IXQA 3A0UA 2VNIA 1GKUB 2YZNA 5HGJA 1Q7EA 5LZ7A 1H0RA 5IWAB 3BWDD 3NM6B 4BQFA 5EXDA 3OOJA 5E8RA 4X1IA 2Z8ZA 3B6IA 1OBOA 3MA0A 4E12A 3D7RA 1CZUA 2EFHB 5A4KA 3K2EA 5F7OA 2FPXA 4KITB 1S0UA 3ET5A 3UAWA 3KPWA 4HAUA 3ILSA 4C7MA 4B3RB 2XRFA 4WPGA 4P92A 2WF9A 1IU9A 1VXRA 5ALJA 5C2JB 1AK9A 2EAUA 3SSOA 5JS8A 5KZMB 2EGHA 4MRSA 3MJFA 4BLOA 1ZNQO 2WF7A 3KOWA 1LRJA 5C5CA 4BCBA 4AZ0A 4PLCA 1B0UA 1EHIA 4AM8A 2OLEA 4Q9HA 1TQHA 1FK8A 2P6MA 3UMMA 3GXOA 3JSXA 1IM2A 5IAGA 2PPLA 3C7DB 4JKYA 4DABA 4Z7JA 1IHYA 4ZI7B 2ODWA 3JD2A 4DBZA 1CVIA 3CZ5A 5EP2A 3FDZA 1Z4NA 2IYXA 3L7YA 3VR4H 2BZ0A 2QM8A 1JH8A 4PCAA 1WZCA 1GPKA 1QO0A 3KKMA 5LBUA 1KVSA 2MYPA 1SGWA 1G6KA 3PQEA 1E4OA 3MGCA 3OO0A 4OLJA 3RBZA 3REGA 4CM9D 2J33A 4IH1A 3ZS8A 2O8DA 2OXRA 2PLWA 2QTTA 4IV0A 3GH1A 3R77A 1FVFA 3C3WA 4L16A 4QBKA 4GWGA 3VR6H 4J0KA 5GIPE 2VHCA 4UZFA 2EZ9A 1ZNYA 2P2YA 2N46A 1P7WA 1E1RA 3P0FA 1P74A 2FWBA 2JGFA 1NR7A 4R0VA 5BNFA 1SH7A 1S2IA 1P29A 1POXA 5ELXA 1P9RA 1R6DA 4QQFA 4XLZA 2EW8A 3IOYA 1LNZA 2W2QA 3EVTA 2PA0A 4HF7A 2PCJA 5L6MB 2DETA 1Q3KA 5LOVF 1MZPA 2RGYA 4G8DA 4FR2A 1CHDA 4WINA 5BUQA 1I3NA 2B6HA 3FNGA 4LX0A 4IMJB 1PNQA 4GIBA 2O2DA 3EFBA 3GLFB 1Z07A 2ZTSA 4X0EA 3VYVA 2V9ZA 2CLLB 3B48A 1P45A 2YZ7A 4LN1A 3N8NA 5ALUA 1ENZA 3OCVA 2VNSA 4CCWA 4ZDKA 1PLLA 4DQKA 2ID4A 3MMZA 4BGIA 3RRZA 3BHNA 1MG0A 1PJ4A 1G8PA 1SXJA 2B8NA 5HEKA 4D4HA 5IKEA 2C4MA 3GK3A 4NZMA 3EUFA 5E2IA 3X1WA 4DCTA 3AHIA 3IEUA 2YN4A 4IYRA 4L07A 3LD9A 2H52A 4XB1A 3EXHA 2WMYA 3BD7A 3LLSA 2FPGA 1MOSA 3NT2A 2UUCB 4C20A 2AVNA 4WFKA 2WNHA 3G0BA 5GGXA 1YBHA 1ISHA 2PLAA 2XNDA 2ZYVX 2BR4A 5ESDA 1I51A 4Q6BA 3U80A 1QZTA 2OGTA 3DL0A 4M1KA 2J5XA 2LDXA 3FCSB 2Q3CA 3EEOA 3EIUA 4LDAA 2W42A 3MERA 4IHJB 3VDMA 4ZMRA 4MQ4A 4MVYA 3IALA 1GLVA 4GX2A 3T54A 1WUJS 4X00A 3TRFA 5KWVA 1NI5A 1UPTA 1PV2A 1SG6A 2MHCA 3CSSA 4HDNB 3EZXA 3QMWA 4Y6RA 1B7GO 2OESA 2OQVA 4BX9A 2EJUA 3VDNB 1TD1A 4IVPA 2ZIXA 4UD6A 4CLOB 2ERXA 4INPA 4Y7CA 4M98A 2OK7A 4DPKA 3V33A 1OXXK 4FSXA 3NBZC 4HX5A 4BNTA 5G0TA 1GGMA 1N0HA 1RQPA 2A3RA 2DUMA 4NV0A 4JCOA 5EXPA 3WQHA 1XBTA 3A28A 4PSAA 4MEJA 5EUMA 1YMUA 5K2OA 2OOKA 4Y9SA 3F1LA 4ALKA 4JJ6A 4CMGA 2QUAA 1AGPA 1R6VA 1AUVA 1BE8A 1JLMA 2WYIA 1B00A 2JF0A 4QYIA 3R3SA 3NZEA 5C8YF 3DMDA 5IW8A 1FTYA 9ABPA 5LWQA 3I01M 1B73A 1II8A 3DVLA 1PK8A 4P38A 4EO9A 8AT1A 4MUGA 9LDTA 4XOIA 3CX6A 4DR4B 4HDAA 2IEDA 3I9V1 3F5QA 4XJSA 2XDAA 4O8CA 1FA9A 1QONA 3UATA 1NXSA 3T5AA 5JU6A 1M7BA 3EFOA 1TK2A 1EUDA 1QFYA 3DE5X 3GX1A 4MJ3A 4MUHA 3GLGA 3W6ZA 1BIFA 1K6IA 1VP3A 4Q1DA 4GKVA 1PV1A 5A03A 3KFXA 2F1IA 5AMXA 5EIEA 1VBFA 4GX0A 1NRXA 4CFSA 1H3NA 2O07A 2H51A 4U7HA 3WV5A 2IOQA 2PV0A 4DR7B 4ZYLA 3BMQA 1QBKC 1ESEA 2QRNA 2DPMA 1X94A 1IXKA 3R76A 3ADDA 1XKTA 3C1UA 1XI2A 1G8KA 3KT3A 4XX0A 4ITUA 1YBMA 4CM7A 1X86B 4Y2HA 2BZSA 2HLDA 4HEQA 3RVNA 4AN4A 3BGSA 4IV8A 4J9UE 3CJRA 4L8YA 2GASA 4QQRA 1A71A 3CLUC 4RPHA 1FQJA 4OJQA 3K96A 1GRCA 4C0KA 3K9CA 4HJRA 1C29B 1Z62A 3EQ2A 1U0RA 4K6GA 2A57A 4LYJA 1JDBC 1EA7A 4N0PA 3VM6A 1DVRA 2GMWA 1LRKA 3B53X 1E9CA 2Z56A 1DIHA 3CLSC 3GJ5A 4M1WA 4K46A 5IABA 2R86A 1R6TA 2GRAA 2ZBUA 2AX3A 2CVFA 2YIJA 1H22A 2Z0MA 1OKKD 3LP6A 3N6XA 1XVVA 4R05A 4ZGBA 1HYHA 4ZKEA 3WZ2A 4DT1B 1LPBB 4EF6A 5I7OA 1XTRA 2R11A 3VZPA 4IDFA 2AUMA 1PT8A 2V59A 5TQ0B 1T3LA 1LVGA 3U4IA 5YASA 3O9ZA 5HRUA 4RQBA 4TZ0A 5JSUA 5JS2A 1P44A 1DOHA 4WAUA 5AOAA 1PQWA 4IV5A 3VV2A 3D7MA 4NBUA 1A9YA 2G7MC 1UJMA 4D74A 4KQMA 1O9HA 1TDJA 1WXGA 2JBWA 1MKYA 4C7XA 4GSYA 2FMXA 5AXCA 2RMKA 4MV8A 5DHTA 1FSFA 3HDVA 5J4YA 4E5YA 1C1DA 4R83A 3MG9A 1GTMA 2AOWA 4Q3OA 4FYMA 3RJ5A 3T9AA 3MIZA 2ZIWB 1EWYA 2C3PA 1JTVA 2FQWA 1ISPA 1ZDMA 1YMQA 1ILWA 2VWHA 3KOYA 4OI1A 4CHGA 1UIRA 1R6BX 5TF0A 2AJ8A 6YASA 5CJ2A 4RIIA 1ZUNA 3ZTYA 4G5XA 3LYLA 3IRVA 2AYZA 2ZANA 4L4ZA 2NSJA 5HTOA 3RF6A 3QF4A 3OWOA 4RDHA 3EVGA 4Q03A 2DLDA 4PANA 3WO0A 4E2FA 2UYQA 3FFWA 3WNZA 3V1MA 3IP8A 4Y6SA 1BHO1 4X1KB 5WRFA 4BP9A 4HGYA 7MDHA 4ZQIA 2HYIC 5K7SA 3CGWA 2D2EA 4CL3A 2AR7A 4RVUA 4BNNA 5ITWA 3D02A 4EGJA 4O29A 3MJSA 3U60B 1N4AA 4M0DA 4OGLA 2UZ1A 4Q47A 4E2WA 1EWRA 1ZVMA 2P9ZA 1PJZA 2G8NA 3PE3A 3PUKA 2FSVC 3L1KA 1C0LA 5IFKA 2XA1A 5KTRA 2AQ8A 2GNPA 2VKTA 4FDMA 4LHSA 4BBPA 2FPLA 4YR9A 2H1IA 1GNLA 4PFSA 5DSTA 1E6LA 5BWOA 4DIDA 4EY8A 2O0JA 1JHVA 2NXEA 3RRMA 5G4KA 2H31A 5KNBD 4B8WA 2FPIB 2Y0CA 4MUIA 1YIAA 2R66A 3PUIA 3KT8A 4FLFA 2OFPA 4TKVB 3OJFA 1H4SA 1TF5A 5BWMA 1ZH2A 5ADHA 4C05A 2GCOA 1U8ZA 3F6BX 5L7WA 2GZ3A 4OU5A 5LN1A 4ZEWA 5IJ9B 3RVJA 4PYQA 2HT6A 2Q1YA 4UU8A 5E1OA 5HQTA 1IZ9A 4IOKA 3H2KA 1GTSA 1O5OA 4H3KB 3O1JC 4KU4A 5BVGA 2RBEA 4DNFA 4NENB 3IHLA 1IONA 1OFVA 2HCRA 4JOBA 4MW2A 1TNDA 5IVDA 3UTCA 4LHVA 4BLWA 3TQQA 5FPQA 2O2SA 5F9HA 2W4QA 1WB4A 4YT2A 1ODJA 1XMVA 3N8HA 4PTZA 3BRWA 4W82A 1G20E 4XEHA 1QWOA 3NVDA 2X5XA 4L3WA 1E7MA 1YC5A 3BMCA 1TU4A 4L9RA 4NJEB 2A5LA 1GCOA 2H0QA 1F2UA 3GGPA 3O93A 1DDOA 3QNUA 5LU8A 3ZGZA 4R69A 2ZB4A 3EY4A 2CFOA 2WUGA 1UBUS 1BXKA 4X1IB 3GP3A 1V8FA 2FUKA 4R51A 3RWMB 5NULA 1M2VA 2PRJA 4CETA 4MITA 1ZESA 1B2RA 1ZK3A 1SOAA 1XTJA 2OENG 1O0BA 4FCCA 3W2TA 4C0AC 1K7SN 1CZRA 1JPJA 4MR7B 4RSHA 3UPDA 3FNHA 4GO1A 3LT0A 5IYZA 1T2UA 1F7VA 2YBDA 4JV5B 3MTGA 4MHOA 3KCNA 4PXAA 5F1KA 3BUSA 3WWCA 1M8JA 5LMUB 1A0OA 4A82A 2WPNA 4F60A 2J4FA 4WN3A 1CNMA 1T1JA 1UJ5A 3I6ZA 1C7ZA 2NACA 1G0OA 3K9WA 4ND4A 4NU0A 1OLXA 4XH9B 1XMSA 5IKXA 2BE7A 3L82B 5MGNA 2B1IA 2EG9A 3LVFO 1ZX1A 2I6GA 3R5SA 2EX1A 4HLUC 4TL9A 3F3KA 4RPJA 3PVSA 4ZRMA 3L0YA 3T3PB 1R9JA 4AY3A 1KPGA 4D4MA 3CWCA 4WNCA 1W4RA 2BFEA 2JGEA 2ZRDA 1RCTE 3BC1A 5E9JA 3T7TA 4C08A 1IJKA 4CLEA 5LPNA 3OY7A 1LQUA 4B5LA 3EN0A 2ENWA 5LZ8A 4X20B 1WF3A 3U2QA 2M32A 2Y99A 2J87A 2YV2A 2P11A 3C3JA 4NG4A 4OKNA 1WXHA 4GQBA 1Y9ZA 2Y66A 4R71A 4F1JA 3HK2A 1C9KA 1R64A 4GXTA 3S1AA 2PG3A 3I2FA 5HCNA 4AMVA 3SZGA 2OOSA 4J16C 1JLKA 4CN9A 3HVUA 4DMCA 5CFQA 3EAGA 2G1AA 4IX9A 2I7DA 1G1MA 5F21A 3I5AA 5FV7A 1HOXA 4RJ2A 2JNWA 1UUFA 3THOA 1J42A 1AN0A 2AW5A 1GU7A 3R6GA 1K6JA 2BR3A 3MVEA 1KJYA 1MABB 1T36B 2GT1A 2HQSA 4M8NE 5DO9A 3K6SB 1N36B 3AVWA 4XWOA 4KO4S 2HH9A 4WDQA 1QQBA 2YR0A 3HCPA 1M2OA 1NF9A 3LDFA 4BDSA 5BR7A 2C57A 1XAGA 2QX9A 1Z35A 1E94E 2R6R1 2Z5VA 4H7DA 1ZONA 4H6XA 5FQOA 4DMLA 3L6EA 5JOQA 4JXZA 4W5TA 2I76A 3Q8KA 5FT9A 1JR3E 5FIUA 2R3SA 3CPJB 4B45A 1EFVA 2VJLA 5CVEA 4V0MA 5DX0A 5EFOA 4MA4A 1PR0A 5CFZA 5SV2A 1FRZA 3GYGA 3K0FA 3CNLA 1Y5IA 3R0XA 4JQCA 1RSZA 1XL1A 4M99A 5BSMA 3RBAA 4CMKA 1MTZA 1PFKA 1DAHA 4F4UA 5U9CA 2BMJA 3KDSE 5E6SA 1V39A 4BVEA 4BVBA 4CNQA 1V4BA 4KGZA 3DDCA 4P31A 1RLJA 3IDAA 4NYIQ 2C58A 4XUCA 3T5MA 4J3FA 5DULA 3DMRA 3QPCA 3OM8A 4GPTA 1YUBA 2FUEA 3HNPA 5IC4A 4OJMX 2AHOA 3L84A 5TIIA 3NIWA 4DLPA 3I12A 3AUTA 3OT5A 5F12A 3F2VA 1ELOA 3WB1A 3JYOA 2PUAA 4IINA 1UKVY 4R9VA 4CNBA 4ZEXA 2BE9A 1L7AA 2VPQA 4PBTA 2ACWA 1OOEA 2H11A 3TQCA 2RH8A 4RQTA 3ZQUA 4AMUA 3ZHQA 4EUNA 3OFKA 4A1OA 2PZAA 2EZTA 2I1VB 4BBJA 5EP4A 4LMAA 3BBLA 5G0SA 3SIRA 3CH6A 4US2R 4Y2YA 2A1TR 5CA1B 3PXGA 1OI3A 3DD1A 4DXDA 1H2YA 4CKWB 4Z1OA 3THWB 2P65A 2ZAMA 4CMHA 5D1HA 2WD7A 1LRLA 2FGKA 2H2GA 2Z6QA 1PZNA 5FBHA 1L7NA 2A35A 3LLCA 3TOVA 2UUOA 2B1RA 3HC7A 2QT0A 3PQ6A 2PT6A 4UDYX 5DWDA 4H7PA 3JYPA 4FJ1A 1T1GA 4QRIA 1X77A 2F43B 1N5MA 3E53A 4UJ3A 1TAHA 2WP8J 4MAFA 4L5CA 4QU5A 1DKUA 2H2DA 5THQA 2JIDA 3CNEA 3NOVA 3LY7A 5REQA 2POCA 1BRTA 1JHDA 4Y6LA 3AC0A 4I9GA 5DE3A 5DYWA 1IN5A 2QMZA 4X61A 5CB4F 4B17A 1X1CA 4NH4A 3ENZA 4OIMA 4JBNA 4EEXA 4MQLA 2HWKA 1A76A 3ETHA 4DNXA 1AA6A 1A72A 2HGZA 2P77A 2QPLA 3KYCA 4KN9S 4OQNA 1NFRA 1IY9A 3QU2A 3K2IA 3UK2A 1TQ6A 4R2KA 3MOSA 4YFVA 2F1OA 4AUEA 5CMLA 9ATCA 3CT6A 1S3SA 1PJTA 1VFPA 1XD2A 2XDQA 5IT0A 4NCJA 3P9ZA 4IO0A 4C4AA 4ZFNA 5CA0A 1PLJA 3PDIA 1MO3A 4MCHA 5DI3A 2PO5A 2O50A 3MWLA 3K0HA 5DDIP 5AYVA 1JHMA 5I9BA 1AHPA 2FRDC 1TAGA 3OD1A 1GY8A 4RD0A 4BFLA 4K9LA 4P5PA 2E1PA 3IQXA 4P2BA 4LJRA 2FRVA 2QZSA 2GZAA 2ZU0C 1WZUA 4WZBB 3UJ6A 2X4IA 1T9KA 5KNCH 1SD5A 2Q7OE 4A16A 1BA2A 1WSAA 3KQKA 1XEAA 2HQRA 3LTNC 4KIGA 1DXQA 1FOEB 2HHJA 2WV9A 3F67A 3X1DA 3NXSA 4CF7A 2YXNA 1OHHA 2L18A 3ONNA 4ASUD 5BSHA 2AL7A 1LBSA 1C41A 1XOIA 4H6WA 1CUZA 1QHGA 3UJAA 1JXMA 2HLPA 1NU6A 2FG6C 3RRFA 5DK4A 3QXXA 2Y1OA 1D2GA 1PZXA 1AG9A 5EMHA 3MYRA 3ER8A 1QIHA 4HPWA 5LJLA 2ZETA 4M87A 2JLAA 5DLYA 4MRNA 1PR4A 1Z5UA 1N2CB 2Q5CA 4JBGA 4JQSA 4E30A 1BVRA 3Q9UA 1BD4A 4JBWA 3U3ZA 4XDZA 5L7TA 2AKYA 4LZZA 3MLBA 1PZMA 3PFCA 4HXEB 3ZD7A 4ZCQA 1OU4A 5EE1A 1CUGA 1PDOA 1VIYA 2DHRA 5A3JA 3LF1A 5LIRA 1BDBA 4J90A 3GRZA 2QXTA 2RJOA 3G8BA 2ZBFA 3NO4A 1SXGA 5FNVF 1CR2A 1YKFA 5BVHB 5LQCA 2W2LD 2XNHA 5CM2Z 1JJ7A 4P33A 5JW6A 4AKSA 3IP3A 1HE3A 3BVPA 4JBYA 3HJHA 2G0NA 4LECA 3HV2A 1ZAKA 2H06A 1KYZA 1XNQB 3N5KA 5LP6A 2D7CA 5INTA 2P6RA 4YJHA 2ZUTA 4QGBA 3TIXB 1VKJA 2PEYA 3JQDA 3S70A 3K30A 4LSGA 1OBCA 3FPSA 4IDCA 2C9CA 4A9AA 4U02A 1UDWA 4PIVA 2BMWA 4ND2A 3WNQA 3ZUGA 4MCJA 1MC5A 5LXTB 4ENUA 2QRKA 4J94A 1C9JA 3I9LA 2X0DA 4FWTA 1ZMTA 1NXXA 2GHIA 3PG5A 3D6TB 4L9AA 4YP5A 5T41A 3OCXA 4PLZA 4ITRC 4JK3A 4CM8A 2XYQA 1Y8RA 3QJGA 4ND8B 4BGEA 3DAYA 3MRSA 5EZYF 4QZVA 3TG8A 1Z15A 3BTVA 2J46A 1FQKA 4F7WA 5ITZA 1I24A 1P2BA 1CQJB 2H2FA 1KWGA 3D3EA 3ISJA 3VNSA 2Q3EA 1OZHA 5K99A 2OL4A 5A0FA 5GZ3A 2PSFA 2GJ4A 4U9UA 5G1NA 1KA9H 4XVCA 1AT1A 1I80A 4Q48A 5HVNA 1N57A 3PC6A 1ZC4A 4YP9A 2DR0A 4GP6A 1DFIA 4C0WA 4RHFA 1GPUA 1N9KA 2DUNA 5FUVA 3ESXA 1LFAA 1U5CA 1JSXA 3B1JA 3H8JA 4OHVA 3WDMA 4AROA 1FLNA 3IMFA 3SE7A 1S9DA 1BWPA 3ENVA 3ZHBA 2PS9A 4PYOA 2VHZA 2VJNA 1NWHA 1U9IC 1GYRA 1KOJA 5I7VA 2FSUA 4RM2A 5JTUA 3MC1A 1GDTA 3R9WA 2YY5A 1NIPA 4LISA 1BWRA 5EMMA 3INTA 5CW1A 2VF5X 2Z1NA 1QP8A 3P5SA 3CVXA 5JD6A 3FYDA 4G3XA 3MTJA 4BRWA 1KRHA 4FIZA 4P82A 2OV1A 4EX6A 1VPLA 4Z4EA 3A6KA 1X19A 3JZDA 4OLBA 2VJYA 2CZQA 2FLKA 4JQOA 4BEVA 4UZSA 2VEOA 5B57C 3CUTA 1QZXA 1ABBA 4YP7A 5I4KA 1U98A 3CEAA 5ALPA 1Q50A 1NXQA 4C0QC 4ILKA 3VISA 2XUKA 1UJ2A 4J0FA 5JPCA 4M38A 4A6EA 4QAQA 4FXOA 5C1BA 1YOVA 3PA6A 3DZCA 1JA9A 2DQ4A 2Q27A 1N5LA 3JXEA 1JJIA 1M2EA 3GP5A 3PR2B 3PFFA 3OQ1A 2PGDA 3KVNA 1XRQA 1YDMA 4ZVOA 3WGOA 4N3NA 3LUHA 4F2HA 2F67A 1F5SA 1JNXX 3N2KA 4DR5B 1B93A 2V65A 1X80B 2OYSA 4CEIB 5FDFA 1XLTC 1N33B 4NBNA 2ZS7A 1OAKA 3DB1A 3H04A 3O8BA 3ZE7A 4MA5A 5K8CA 4C6HA 1LX6A 3L8HA 4B9EA 5KKNB 4LGMA 2GBIA 4QHSA 3TECE 2VOEA 3NALA 3K8ZA 1JL3A 2H1RA 3VR2A 3EIWA 3R2JA 2YC2C 4DJTA 1JAYA 3L7NA 4K9SA 4Q0MA 1XPOA 1YS6A 4P86A 1QP7A 2W2KA 4H1VA 1T9AA 1XN1A 4OBXA 3SZOA 4Q16A 2A9VA 3OTGA 3ICQB 4F8JA 4V02A 4JJFA 4N0MA 2UZIR 2ZPAA 2ZCUA 1DG1G 1US8A 3C16C 3FIJA 3PI6A 4GOKA 4I4TB 3RAGA 1R15A 1X1SA 2BEVA 3VGPA 3OQPA 4MDFA 1ZM9A 1I0ZA 1KOFA 3BE5A 3PUYA 5E7QA 4S1NA 3K9QO 2R6ZA 3D3QA 4KW7A 2X9VA 4HAOA 1N9ZA 1TT7A 1M0SA 3RRBA 3ZI0A 5EJ2A 1C3JA 1P33A 4UXJA 5CDFA 3VR5D 4R2JA 4NYIR 5FJJA 5GP1A 4P3YA 3EXIB 4BUCA 2PBRA 3WKEA 4BX3A 3RF7A 4DMHA 1MQAA 3H4VA 3PD7A 5BQFA 4LC0A 5B6IA 2NVWA 1I9CA 1L7VC 3A6ZA 3VYUB 3VTKA 3FHTA 1Z2OX 3VHXB 4BMYA 2QX7A 4GVXA 4TRMA 2I3BA 3QE4A 1E77A 4TTQA 3O8CA 1ISSA 2PZKA 4EEZA 3AB3A 3WWEA 3FCCA 1OYYA 4HH0A 4EUKA 1J2JA 4KO3S 2XB9A 3R0VA 1N2HA 2JASA 4YI3A 3CNNA 5T3UA 5C1OA 5JJIA 1I1QB 2ZJ7A 2DCMA 4ZI7A 2E4XA 1L5VA 1CNFA 3ZWBA 1AGRA 2VO1A 4UHJA 4E5DA 1FPQA 1W0JA 3E3NA 3H87A 4AT1A 3AZQA 1O08A 2VJOA 3AM5A 4A8HA 1YZTA 1GZ3A 5HDQA 1HT3A 2CL0X 2ZYRA 4WTOA 4G07A 4H2DA 4MYCA 4C07A 5L53A 1O77A 2R87A 3WGVA 1CP2A 1COWA 1CUHA 1KMNA 2C2XA 3NBKA 3OTOB 2XBLA 2QLJA 1GUDA 3M1LA 1GTG1 2PXXA 5GMOA 1ANKA 4FZ5A 3OZFA 4RGQA 3CBQA 1LI4A 5DHUA 2MU1A 1IMOA 3ML1A 3O1HB 5CT4A 4IF4A 1P5HA 1WKCA 1YUNA 4GM4A 2YJGA 3M6MD 3IUQA 4MUFA 4WNAB 3BXZA 4CLRB 1HNZB 2CHVA 3H17A 4N9QA 4O4LB 4FDUA 5JCXA 3OFND 5CTAA 3RB8A 5KTYA 3WWOA 1HTTA 1VLHA 3ITNA 3CVVA 5AOCA 3VOBA 1UFOA 1Q6YA 1ZUHA 5AI8A 3WGKA 1J5XA 4HDKB 1JDZA 4E08A 1PW7A 5J2TF 1RXVA 4LZAA 3DM9B 4EBBA 2C94A 3H6GA 2QZZA 2VPYA 5KNDA 2ZBVA 3HNOA 5J4KA 3GLFA 3PFBA 4GC9A 1VJDA 3V5NA 1D6SA 2IA5A 1V8ZA 2ONJA 3ABSB 2NTNA 4IIJF 4JVLA 4QE3A 3VO1A 4ED9A 1LA2A 2WKWA 4E5KA 4CCAA 5EJ8A 3P9CA 5EQDA 3MTEA 5A4AA 4MRVA 1XO1A 1EZZA 4BKOA 3C6XA 1Q95A 5D5QA 4EUHA 2ODQA 1FW8A 3KWMA 3AJAA 2R6GA 4FYXA 3SNHA 3TBKA 4XLLA 5IS2A 1UXHA 3PU6A 4MIEA 2D3TA 4TWZA 1AX9A 3CINA 5I3CA 1XDZA 3RYIB 1N7GA 5ALEA 2WJPA 3AZOA 4MIOA 5DN9A 4CU2A 2HNKA 5JAHA 1PNVA 1L5HA 2QLTA 3D7NA 1JIKA 4F45A 4EVIA 4HPJB 3WS7A 1FFSA 2A9JA 1CJSA 2FN7A 3G7UA 2JJMA 1YGPA 1E8DA 1Q19A 1DC3A 3ZDXB 1P5JA 4FINA 4M36A 1MX5A 3SBOA 4FZVA 2PUVA 4BMDA 2XGSA 4LAFA 2G5TA 4RVGA 1UC5B 2G28A 4NY1A 1AQ6A 1KF0A 3OLXA 5FI0B 5C1IA 4DMKA 4DUGD 3AKYA 5J23A 1E59A 1H1DA 4JUDX 1J7KA 3MTBA 5GQSA 3EGXB 4IHJA 1YR3A 3VR4D 4PPQA 1QDEA 1WW2A 4YB8A 2ESRA 2DSTA 5JISA 2Z98A 3WZMA 5FL7A 2QENA 3PNBA 2I7TA 3RHTA 3CPHA 4HDNA 1FFBA 2P2CA 2QE7D 5IDYA 4YCLA 4R3UC 3S8YA 1BOOA 4R5HA 2QP4A 4M37A 1KSGA 1TZJA 4MK4A 3WE7A 2W90A 1XD8A 1NJ5A 1EUCB 4CLOA 1ZHFA 2YCBA 3VR6D 4EI7A 3VYRB 2JS7A 3ICPA 4WCFB 1ST2A 1L8AA 3VH3A 1JDUA 4HFNA 4JLKA 2HQ1A 1G6HA 3FNQA 1PHRA 4IDEA 3LCJA 4E88A 4FUQA 1CFJA 2ZATA 4PZYA 2EBHX 1Z45A 1UDAA 1EBUA 3QPVA 4FW8A 1PTJC 2FP3A 4OXNA 3AFMA 3EA4A 3IMKA 3CX7A 4JH0A 5FUXA 2AMYA 4BPBA 4HGQA 2IP1A 3OJCA 1R8SA 1PJ2A 3L0SA 5FPKA 3NDBB 2FW0A 3DBOB 2A1IA 3L79A 4XTCS 3K1YA 3LGSA 2XHEA 1Q1ZA 4KH0A 3EQZA 2E7ZA 4ZOLF 4OREX 1TT5B 4KGDA 4H6PA 2DBVO 3B2NA 3PGLA 1CY8A 1UOOA 1XFDA 1D2CA 3OOSA 4HRVA 4ALNA 1Z4KA 4G9BA 2FEWB 4HWKA 3OE4A 3RYCB 2Z4TA 4CLXA 3KAJA 3TQTA 4KPEC 1V3QE 1JPNA 4Q1AA 2HJSA 1U2SA 4BE9A 1B15A 4ZZIA 2ZRMA 3NBXX 2IS4A 3GEMA 3WWDA 2I2FA 1KO8A 1GDHA 4EZEA 3S2YA 3TUIC 1V9LA 5F76A 2RKBA 2C97A 1KOLA 3OETA 4QG7A 3WYGA 1PK9A 1KEKA 1PIWA 4IXWA 3QEJA 5B6PA 3N2YA 1D9ZA 2PMEA 3SIXA 3FOCA 3R7LA 1S8FA 2ZJ4A 4GL4A 4DQXA 3IEVA 2B20A 2E5WA 1TTTA 3R4CA 4X94A 1HFEL 1UJ6A 3FPAA 2A9QA 3SYRA 2B1QA 1PG2A 1ORWA 2BGKA 1R88A 2JZNA 3NHFA 1ABFA 2FF5A 4JJGA 4NCIA 4XYEA 4EUFA 5JZVA 4FMPA 2JH9A 4DT1A 3D8UA 4YIKA 1ECPA 3O47A 3EMVA 4GPD1 3CEJA 4JT8A 4P8RA 5GINE 3PLAE 4FEGA 4NX2A 5TQ0A 1NASA 2RBGA 3IT1A 4FHDA 1LTQA 1W36D 1GILA 3ILVA 1IHUA 1OT5A 1XNJA 2VZLA 3EUAA 2VXCA 4M83A 4F84A 3TBFA 4C2BA 3CY6A 3O3MB 1KPIA 3CC8A 3F8TA 1U9JA 3CLVA 5AKHA 2DBRA 1I4DD 2J1LA 3OP1A 3IKMB 4Q34A 5F2OA 1QKKA 1YK0A 4I9UA 5JATA 2ZIVB 3A2LA 1XPRA 4Q1CA 3O9VA 4IHKA 4TS1A 2A4MA 1NBEA 3GFQA 2O1EA 3RU2A 5HKKA 4NABA 5EIOA 3DL7A 2NAPA 4H1HA 1QXSA 1HFKA 1SHLA 4A5OA 2GK7A 5K3FB 4MWDA 3OQHA 2AOXA 3UC5A 1PVVA 1T9BA 1YU9A 3R6WA 4Q3KA 1SB8A 2Y92A 3R5FA 4X1KA 4IFIA 1U2EA 4HAXA 1PRYA 5D7BA 3KHKA 3EQ7A 2Z43A 4GNKA 2VOJA 4COKA 2I80A 1ZL0A 1Q1AA 5C8DA 5AR1A 1AS3A 2PBLA 1T4DA 5JI2E 2J31A 4O5AA 1N6KA 1NUQA 1ORTA 4QYTA 2WJWA 4RQUA 4G97A 1OLSB 1LSSA 4MVXA 1E61A 4BTLA 3GPDG 4PIPA 1GWNA 1MBZA 4B85A 1QLJA 3CVJA 3GUVA 3ZGYA 2Z09A 2ZR9A 5D1NA 3MHPA 2H1HA 3E2IA 3UJPA 3KQVA 1H5UA 4IH4A 3ZEAA 3QIVA 1AU9A 2FPIA 5AQ1A 5LD2C 1GDDA 2WF8A 4TKVA 1E9DA 1GFZA 1XRRA 1UM9B 5AI6A 3VU9B 2C20A 1PJ3A 2VJPA 3M3HA 4N47A 1S7CA 2CN1A 4Z9AA 1Q74A 4TZTA 1Z6XA 1Y6RA 4B09A 1WMAA 4KXUA 2X8LA 5BT8A 2XMDA 4MTLA 4ZK2A 4NENA 1UEXC 4DJJA 2VQ6A 2OO5A 1ZU5A 1GLNA 2DWCA 4NRDA 4HDCA 1JI3A 3H3FA 1ZOOA 4KI7A 1AM4D 4DPLA 2VNJA 4OK3A 1RRFA 4Q9NA 3F3SA 3RVOA 1JQAA 1UK9A 1UP7A 4B5KA 5JXJA 4DR1B 3LHSA 2JI6A 1XRMA 2IC5A 4ZVKA 3S27A 2GZHA 2HTFA 1BCRB 1KJWA 3O75A 4PNHA 2CJYA 4NBVA 3COJA 3R5HA 3RRYA 4ZTBA 1KBZA 3TDNA 4BC1A 2IYLD 5J1TB 2OFXA 2HTEA 1A95A 2QR3A 3LPCA 5FHQA 4BASA 3LX5A 2F8MA 2E4ZA 2GOYA 4Z0PA 3Q6MA 4FK8A 3RREA 5I7AA 1YL5A 2PIAA 2H48A 5K8LA 5KUTA 1J8YF 2R48A 3BKXA 3DV2A 4MR7A 3ILHA 1AUOA 3CUKA 4XIFA 5EUBA 1M2GA 3FPEA 5LWHA 3HXQA 1QK4A 2C99A 4A8JB 5GIOE 2Q3MA 1T1IA 3D6NB 5J43A 1NW6A 3CW2A 3GWZA 3R74A 4FYIA 3CLKA 5HF6A 1PS9A 3MWFA 5EE5B 2EHDA 5K0EA 1QRRA 4GKKB 2CXQA 2FWIA 3ZU2A 4ER6A 5U4QA 4LUCA 2TMKA 2X0FA 4B3GA 3DVSX 1ZGJA 1A27A 3L1IA 2JZCA 3WOVA 1IOWA 1SM4A 1QNFA 3ENKA 3QPBA 1GNVA 1FIUA 1A4IA 3QHQA 4ZOBA 1UC9A 1QB8A 3GGJA 2XCQA 1JMKC 4RZIA 5LQDA 5AJZA 3G2NA 3OZAA 2YHSA 2VJBA 5TMEA 5JCOC 3U4QB 2UYOA 3MTQA 2C4TA 2EYUA 3LT2A 3K05A 4IKOA 5FPHA 3UT0A 3DWGA 3ZV3A 4EUEA 4XVUA 2GFQA 5JH7B 2WOJA 4X20A 4E09A 4FI3C 4LHZA 3C1AA 3VNRA 1XXHB 1J99A 4CN8A 2I78A 1G1AA 3Q7SA 1C3OB 4L7VA 2IU3A 2O3TA 1ULHA 2W6JA 1ZGHA 1KYXA 1ND6A 2IEZA 5FBRB 4CV1A 2X3UA 5JZBA 3VU8A 5BORA 3LKBA 1L5MA 1XKXA 1FRVA 1TYDE 3Q9LA 2C8VA 1NLFA 1RZUA 1SBHA 3KHSA 3KOZA 2RHHA 1CEXA 5C5IA 2YQZA 3A25A 4OCZA 1PT6A 2XD4A 1MABA 4GU5A 4OOEA 3O31A 3TIVA 1LPMA 3K6SA 4HL6A 3PDHA 1TTPB 3D31A 4ERNA 2XPCA 3F9IA 3CM0A 2BC9A 1LI5A 2YRXA 5ITSA 3T5GA 5AVJA 2QBYB 4WSOA 3F3MA 4DC0A 3T5PA 1JVNA 2JLXA 4TS4A 1RRMA 4XIJA 4YJFB 1BRMA 2JFQA 4C04A 3GEIA 1SOWA 1RKBA 3OQJA 3R0IA 4LOJA 2AT1A 2FP4B 3QY0A 2O7QA 1KDYA 1SHUX 2BGIA 3CISA 5CGQB 2BOVA 3UH1A 2Z2YA 3UA3A 4D3XA 2XEXA 3NBUA 1QGAA 2ZUUA 2ZZNA 4G0OA 4BJHB 2W2NA 1GAJA 3D0KA 1OX6A 4MKGA 3AF0A 4C1BA 4IVQA 2PM8A 3RC8A 3R6TA 4F3CA 1GG8A 1VBMA 1B14A 1KJJA 3L6RA 2X0EA 1BWQA 2WY2D 3OIDA 4X8LA 1E98A 2O9JA 3M5CA 4XWWA 4ZWNA 2YYAA 3GZ4A 1IPHA 2F9MA 5ICFA 4EARA 1I94B 1JAHA 2H0AA 3DEZA 5AKJA 4C4PA 2ZJ5A 1K98A 1MC1A 3D6MA 4BE4A 4UPEA 1NQVA 3GH3A 2R8RA 3FNFA 3DZGA 2BEKA 3BRSA 2H4ZA 1YB6A 3V48A 5D85A 4ARAA 3FMIA 3TZLA 1Z6GA 2TMYA 1S02A 3C7AA 4KXLA 1YZ3A 2IH2A 1W0KD 4RADA 4PG4A 1AV7A 2I4IA 1VL1A 1O9GA 1TVCA 2HRCA 2PZFA 1JG3A 1RACA 4KDRA 2VSXA 1GTRA 2PT9A 5HTKA 3S0JA 5CA1A 3IQZA 4MDEA 4CKWA 1U8FO 3RJMA 3THWA 1H2ZA 4Y30A 1U1CA 4ZRNA 2Y9PB 3SJZA 2V74B 3GLUA 1H1LB 1UZLA 2FWAA 4HOYA 1O97D 2RGBA 3DO6A 3QUTA 3UTDA 5K6TA 5IN4A 2RHOA 4RORA 4IIHA 5K6AC 2DUUA 2I67A 2RGAA 2YIVX 2F43A 2C3UA 3HL0A 1NMEA 4G09A 3IVGA 4BO5A 3KQMA 1RXEA 3SC2B 1M6VA 3BKWA 2IYYA 1DWPA 3H8WA 5D2CA 3BJEA 2QGNA 4MV0A 1P18A 5IT4A 3NBQA 2HJRA 4POOA 1RWMA 1DEKA 2IF0A 3MGAA 2KMLA 4Y6QA 1CERA 1JUDA 2C00A 3UT6A 2KJQA 1EAYA 4LYFA 1GQFA 3THRA 1KMHB 4QT4A 1DQSA 6REQB 2XMQA 5JAZA 4TYNA 1JBKA 3B9RA 4EGQA 1GGHA 4WD3A 1AUXA 3M82A 5I9SA 3VAAA 1YFKA 4YUWA 3HHEA 3K1AA 2OXTA 2EP8A 2AZMA 3KLMX 3R3ZA 2I62A 4GP7A 4JITA 3TRDA 4QOHA 2FV8A 3P0RA 2JIZD 3VPFA 2A9RA 4EJ2A 3UPTA 1GRVA 3NCHA 2XEDA 2QM7A 1B16A 1B76A 4U7GA 5ENDA 1PGJA 1XZDA 3RHZA 4CE6A 4DS3A 2QQ0A 4UHFA 3UCEA 2EKDA 3RUAA 4XWAA 4WZBA 6NULA 2HIMA 4QELA 4MYDA 2BJVA 2GM4A 5JFGA 2Y1FA 3HKBA 2X4LA 3TK1A 3BYZA 4TTAA 3K2BA 5H81A 4MRMB 3NQ41 2D8AA 4NFLA 3FZGA 3OKAA 1JEEA 1GQQA 1IH8A 3HB4X 4AAYA 1YB1A 1QP0A 3IDOA 2IH5A 2JKZA 2PAFA 4PC7A 2PBFA 3GDHA 1SCUB 1L4BA 1XDSA 2WU4A 3AKCA 1IEWA 3LQKA 4UQOA 3NRCA 5JVDB 2QS9A 3QVVA 2R4UA 3K70B 1JFRA 2AR0A 3FE2A 1TVKB 5IXSA 1Y4AE 1UBHS 2YBEA 1N2CA 4WWHA 1X0VA 4RTQA 5I45A 1O87A 1LTHR 1PJBA 2FZVA 1U11A 3AMVA 4BOYA 3AKZA 4GUDA 4MPDA 2CXNA 2Z04A 4J6FA 3ENWA 1JS1X 1O95C 1Q0LA 5JCJA 1X1QA 2LXNA 1JXQA 2RG7A 2V7PA 4QFBA 4H16A 4Q19A 2D2FA 4LFCB 4YAIA 5CB4B 1W25A 1E2IA 3GRKA 3ZGOA 5BYAA 2GO7A 4JBHA 4DARA 3R44A 5FPSA 1YB4A 1S4MA 2JGAA 3JYQA 4LOKA 1PWYE 3SYMA 2YASA 3L0ZA 2DM6A 4IFBA 1JR2A 2IW3A 2QTMA 4TM8A 3MCTA 2XA2A 2H1FA 2YWGA 4S2EA 4EP1A 4OPMA 3DE6X 3QUSA 1OFUX 4M7WA 4CG3A 1O5TA 1X6VA 4JOCA 1PFYA 3BL6A 3BOSA 5BRAA 5KREA 3IQDB 1SKBA 4YRDA 1YONA 4PVDA 3I8OA 3A11A 2R47A 3LK6A 3OPVA 1QIDA 2HOQA 3FNRA 4MWTA 1C8VB 3ZGLA 4MVJA 1JPUA 4ZOEA 1QYXA 4ZAFA 2CL6X 2IQIA 3MMPA 4K2AA 3E3OA 2M6RA 3NT4A 1JKJA 2IYPA 4JT9A 5HGXA 4OUDB 2QE6A 3IFSA 3PFWO 2SKCA 3ZHRA 4TTPA 3U09A 1CQJA 1NVVR 3RSZA 4IFEA 5KNCD 1BHSA 4BKUA 1R5NA 5KOJA 3LWZA 2C95A 2JDID 1TA9A 3TZHA 2FEKA 2FW9A 3DNMA 1UP6A 3CG0A 1G3RA 2D2XA 2YNMD 2O20A 3PUWA 5A05A 3RIHA 3DV0B 4RZ3A 1HI9A 1ZRHA 5JZMA 5KS2A 2R4TA 1GTJ1 1NM5A 3PZBA 5B7PA 2PUTA 5BV0A 5L9AA 2CJXA 1HE4A 2JGDB 2VZ8A 4DMGA 4BN0A 4JLMA 3CKLA 4YMSA 4EY6A 1GUBA 4M1SA 4ETWA 1NX9A 5JROA 5A9RA 3WB9A 1LH0A 4MXDA 4UASA 2ZYWX 2NT4A 1N2OA 1OLUB 4RM3A 2ZR8A 3LUCA 4YJ2B 4RTLA 4R2HA 2O0LA 2O5CA 1OXKB 2BKLA 2VPWA 1W5AA 1ULUA 4ZODA 5EJGA 4KBGA 5JQGF 2UXBB 4XPIB 2BTQB 2CNLA 2DQKA 2JFGA 4Z4GA 2VT2A 1CK4A 1Y5MA 4LRQA 3PUVA 4BIIA 3CEPB 5K05A 1XCLA 3TFOA 1MB0A 1JDJA 2XMSA 2OC4A 1ZGZA 3O8QB 3G2JA 1G7TA 5IK2D 2RB4A 4E2ZA 4DIMA 3EQ8A 3VZSA 1T2EA 2PVSA 3U7IA 4HAWA 4JBXA 3D1LA 4FHFA 4WK0B 1KH3A 2GEJA 4DGQA 2PGNA