2AZXA

Charged and uncharged trnas adopt distinct conformations when complexed with human tryptophanyl-trna synthetase
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
387
structure length
387
Chain Sequence
EDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYGDAVENAKDIIACGFDINKTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKMSASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two conformations of a crystalline human tRNA synthetase-tRNA complex: implications for protein synthesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/rna
molecule keywords 72-MER
total genus 133
structure length 387
sequence length 387
chains with identical sequence B
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2005-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00458 WHEP-TRS WHEP-TRS domain
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 2azxA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2azxA01
1JGTA 5BNZA 2ZUFA 1MAWA 2E18A 5LLTA 4MVWA 1LI5A 3PNBA 4S1OA 3DLAA 3CR8A 4I6JA 4HJRA 5EKDA 2QTRA 3RK0A 3BL5A 3X1MA 2CV1A 1CT9A 4ZCRA 3AIIA 4OUDA 3ISJA 1J09A 1N1DA 1IHOA 2GM3A 3IUEA 1KP2A 1IRXA 3ZUGA 3FIUA 5H7XA 1NUQA 3GUZA 1QNFA 2QJFA 1NUUA 1EE1A 2YWBA 4JZYA 1H3EA 3QTTA 1D2RA 4BWVA 1B6TA 4MW6A 3FNRA 4L2IA 3COWA 2E89A 2YXNA 2X0KA 1QRSA 1T9GR 4HJXA 2G36A 1JHDA 5DB4A 1LW7A 4CQNA 1M8KA 2X1MA 4Q93A 1N77A 2XRYA 4YP6A 3M5WA 3G5AA 2J09A 5J5AA 3VRHA 3S3TA 1QQTA 3AL0C 4E1AA 1WXHA 3ZJTA 4MVYA 3D6VA 1G59A 1PG0A 4NX2A 4NDAA 3ELBA 4F3RA 1YUMA 1WXIA 1EUQA 1O5TA 3FDXA 3QTBA 4DDKA 5KCMA 1K4MA 3A05A 1JZSA 2PXHA 1G8HA 1O95D 3Q4GA 1MRZA 1FFYA 4GRIA 2CV2A 4XFJA 4MUIA 2A7XA 3JXEA 1KAQA 1NUPA 2H2AA 4ZCPA 3D6UA 2JANA 3CLSD 4NZPA 3UOWA 1JIKA 3FWKA 1X6VA 1N2JA 5DASA 4MW9A 1K92A 3K32A 3P0IA 1U7XA 1TQ8A 2VXOA 4EFKA 3COZA 3IDFA 3LOQA 4ND6A 3FI0A 1QRUA 1MB2A 4R0NA 5TEVA 4PBTA 3OTWA 4AS1A 3N05A 3KFLA 2EJCA 3H97A 1F7UA 3FY4A 3HV0A 3HL4A 4EG6A 4HPWA 1M1ZA 1TYBE 1OBHA 3MLAA 2WQ6A 1O94D 3C8ZA 4K0RA 4RPIA 1JEEA 4UZFA 1GAXA 1HYBA 1O94C 2E21A 2CYBA 4P2BA 1XNHA 1I6LA 4ARIA 3TZLA 1WXFA 3TQIA 5JBNA 2A1UB 4YBRA 1T9GS 2V0GA 4MUJA 3LCJA 4R2MA 4MUHA 4R2LA 4MVXA 4QREA 3H99A 2DXIA 3ND7A 1MC1A 2DPLA 3H9BA 1WKBA 4EG7A 3RBAA 3HGMA 3MXTA 1TYCA 1TYAE 2Z08A 4DDHA 4ZT6A 4PBSA 3COYA 4JXXA 2DEUA 3CVYA 2CFOA 4CDMA 2QTNA 2WSIA 5F23A 1QU2A 4MW2A 2O8VA 2CT8A 1J1UA 5FO0A 3MLBA 3KT6A 2HMAA 5K0SA 3SEQA 1JMVA 4F4HA 3ZGZA 3Q10A 4UZEA 4H3SA 3TS1A 1KQPA 1WXGA 2Z09A 4OJMX 4G5FA 1IH8A 1UFVA 3LE8A 1GPMA 3SZGA 1EFPA 1EFVB 3IVGA 4MUFA 1MJHA 2VTBA 2QUJA 5FO1A 2VTBB 1J20A 1WOYA 2QTMA 1FYDA 1DNPA 3AG6A 3L93A 3KT0A 4Q16A 1IQRA 4CDNA 3IVCA 4DJAA 1OWOA 2CYCA 2HGZA 4WNYA 4J75A 2QJTA 1I6MA 1K4KA 1G8GA 3IOBA 3CVXA 3FETA 1M83A 1GN8A 1YI8A 4MWBA 3Q12A 5J58A 3IODA 1F4LA 1U0BB 4MVCA 1Q77A 2A4MA 1JZQA 3ZIUA 3A2KA 4MW1A 4ZCQA 1N2BA 1VL2A 4YP5A 1N2HA 1YULA 1O97D 5K0TA 1GLNA 3HZRA 3NV7A 3RJZA 4G5YA 3PXUA 1H1TA 2PFSA 1KQNA 1VBNA 2A86A 2TS1A 1NSYA 3SEZA 3IMGA 4JYZA 1NI5A 1J1ZA 4MW7A 1KR2A 4XSVA 3CLUD 5KHAA 2YY5A 4PY2A 3UMVA 1I6KA 1Y42X 2GKSA 1WJGA 2R5WA 1T6YA 4JFAA 4U7JA 1TFUA 2QJOA 1U7DA 1OWPA 1N78A 1Q19A 1KP3A 1N2GA 1U3CA 3H05A 3ZJUA 2CYAA 2HZ7A 3CLTC 1KH3A 4MW0A 4DE5A 2RD2A 3MMXA 4U63A 4G6ZA 4U8HA 4PBRA 4MULA 2GOYA 3QE4A 3TNJA 1QRTA 1N2IA 1O96B 2B7LA 4QRDA 3FH0A 4KR9A 2BYTA 2PZBA 3U1VA 1WQ4A 1PFWA 1IVSA 3MUEA 1EUYA 1EFPB 1R6TA 4KPUA 4KPUB 1IQUA 2DUMA 5HG0A 3G6KA 3ILVA 3HMQA 2ZUEA 4ARCA 3AKZA 4AQ7A 1G8FA 1KORA 3CLSC 4QBTA 3RK1A 4DDMA 3PNVA 1NYLA 2J08A 3IH5A 1JIJA 1O6BA 1KAMA 3KT8A 3I05A 4A91A 1Q11A 3K9WA 4YP7A 5DEOA 1J70A 1SURA 2IELA 1Q15A 2AKEA 3N9IA 1NUTA 1WXEA 3UC5A 1R6UA 1O95C 3F3MA 1XNGA 1MAUA 4NAUA 5J59A 1T6XA 2CV0A 2OQ2A 1PFYA 1RQGA 3RHSA 2A1TS 4ZCTA 3HFJA 4L2IB 3PRHA 2Z3VA 1T6ZA 1KH2A 4MW4A 1U3DA 4EG1A 1OWLA 1TEZA 1PG2A 1JEDA 2AG6A 1O0BA 3AG5A 1IFXA 2X1LA 4I6GA 4EG8A 1V8FA 5TS2A 3CLRD 2PIDA 4MUNA 3X1KA 2NZ2A 3AFHA 3X1JA 1EXDA 4RUKA 1QU3A 2D54A 3ND5A 1H3FA 4EGAA 1KQOA 2A1UA 4MUGA 1WQ3A 4WSOA 3FG9A 2XRZA 3IVXA 1NUSA 1TYDE 1N3LA 4EG5A 2WB2A 3N2YA 5H16A 2D5BA 3FHJA 2H29A 3A4IA 3KT3A 1ULHA 1ILEA 4KR7A 1O0CA 4J76A 1MB9A 2J5BA 5AHWA 1COZA 3P0HA 3DO8A 1PFUA 2CUZA 2OV4A 4ND7A 1ZJWA 1F7VA 4ZT4A 5IHXA 1OBCA 3GMIA 3G59A 4ZT3A 3SP1A 1YIDA 3RFFA 2PZ8A 3CVVA 2AZXA 1JILA 1VBMA 1GTRA 3IOEA 5HUJA 2CSXA 1XNJA 4DNXA 3N8HA 4YMIA 2QUHA 1M8GA 1X8XA 1NP7A 3SZ3A 1BS2A 2A84A 2A88A 3SYTA 1NURA 4MUKA 1ZH0A 1I2DA 2PZAA 4ZT7A 1OD6A 2JAXA 3A04A 4I6EA 2RE8A 1YUNA 3UY4A 1JECA 1IQ0A 1EFVA 3CVWA 1J21A 1MBZA 2PG3A 1VLHA 4MWEA 4KR6A 3FOCA 4EG4A 4KKVA 1QTQA 3TZEA 4ZT2A 3NBAA 2BTEA 5DK4A 3TQOA 1GZUA 3CLRC 4FZJA 4K03A 5IJXA 1YIAA 2DETA 2QUKA 1R6XA 2QUIA 4CT0A 2WQ7A 1WY5A 1NZJA 1XJQA 1GTSA 3DPIA 4ZCSA 1N2OA 1M8FA 5TGTA 1PFVA 2DR2A 2I1LA 4MAFA 5FNZA 4MWDA 2J07A 2D13A 4ZT5A 3UK2A 1O96A 4OUDB 3INNA 4NAHA 4MUEA 1N75A 3CVUA 4JXZA 2J4DA 1H3NA 4X0EA 1F9AA 4XFDA 3CLTD 1O97C 2IP1A 5LM3A 4EG3A 1A8HA 1KKUA 1ZH6A 3L92A 2YWCA 2E0IA 3IOCA 3ND6A 4MWCA 3IUBA 1MOPA 1QJCA 5HUHA 2O5RA 3P0JA 3ZJVA 2JA2A 4MQ6A 3CLUC 2EL7A 2ZP1A 5LFAA 3NBKA 1ZUNA 4GU5A 1JIIA 3GLVA 4HK4A 1M8JA 1OWMA 3ZXSA 2DLCX 4NATA 4MW5A 4EF6A 5KWVA 1P7PA 3SDBA 3IMCA 1EJ2A 3P52A 3VGJA 3H9CA 3ZXIA 2IJGX 4MLPA 1M8PA 5TEWA 4TS1A 3CA8A 1K97A 1KH1A 1V47A 1LI7A 1OWNA 3E27A 3COVA 1WZ2A 1N2EA 2V0CA 3OP1A 3VU8A 2X3FA 3PNYA 4DLPA 1VBKA 2DERA 3IMEA 2NSYA 1S4MA 2C5SA 3DV2A 2A1TR
chains in the Genus database with same CATH superfamily
1TAHA 2G5TA 3MB8A 4ZAWA 5C3UA 4YY3B 1D8AA 1T3HA 3LY9A 1R5BA 1MVOA 5A9SA 2DY1A 4HAZA 2EKQA 3SLRA 5LLTA 5LA6A 2YKGA 5IVIA 2CXNA 3SQLA 3CR8A 3ITDA 1IM8A 4HDNB 3EAFA 4IXMA 3VR2D 5C2JB 2AOXA 2JBHA 1PDOA 121PA 5H82A 4KDRA 2PZEA 5EZYB 2X3YA 5FPYA 3MERA 3T6KA 3C1OA 4D3DA 4DLYA 5IBCA 2WICA 3K31A 4HDSA 3R7BA 3EF3A 4PZPA 4ZO9A 4D9EA 3K8YA 1IAQA 3C6MA 1FDRA 3IV9A 4IIFA 4DS3A 1UZUA 2YWBA 4JZYA 3QBEA 3EF1A 4O29A 5BYJA 1LRLA 2SNIE 4BWVA 2WWWA 1GQSA 3N2LA 1T91A 1R4MA 5KHOC 3FNRA 4PYNA 1MZVA 1UBUS 2Z2KA 3COWA 2IVFA 1GILA 1M34A 5HX7A 3JQ6A 4DNFA 1AHHA 2BFEB 3JQ9A 3NGXA 1CWUA 3LYHA 3P0FA 1PI3A 4IHJF 3RUIA 4I3HA 3T52A 3X43A 3QWHA 5IAOA 3AR4A 3R3WA 2G1AA 2OLKA 5ADWA 4CQNA 2F4NA 4HDRB 1LTQA 3AW8A 5DHUA 4R8VA 4EO9A 2FQQA 4BUCA 1WUIS 2TMKA 4D8YA 3PSHA 3A1TA 3H7IA 1K7CA 3WP0A 1PR4A 5L3QA 4UEQA 3N0VA 1W93A 1Z4PX 4FWIB 1YA4A 4IQ0A 2B69A 5ALYA 3ZOZA 4G0VA 4ZI7B 1WXIA 5FLKA 4BX2A 4YRSA 4FFOA 4QDXA 1JPUA 1K9SA 1P1CA 4KO1S 4IIJA 2FDCA 2FMKA 1KAHA 2ZB2A 1Q0HA 2PXHA 3IDQA 1JJIA 3VM6A 1MRZA 2BD0A 3OTHA 1ZICA 1PFQA 2UZ0A 4MPRA 1B2LA 4Q19A 4FHEA 4KFTA 4QXQA 5B4VA 2OCAA 2PXAA 1KAQA 1L4MA 1U1EA 3QE0A 3ABOB 3DVAA 4MDHA 4HYTA 2AC2A 3C3YA 4QVKA 1EVKA 2IXAA 4RYLA 6PFKA 1BS1A 1UKZA 1LDMA 3C3BA 3Q8WA 2EATA 3PPVA 3X2SA 2VBGA 3E7PA 1P2TA 4PGMA 4IRMA 1N9ZA 3BK2A 1BJTA 3HB0A 3RVMA 2CFTA 1JKIA 1OAOA 2V7TA 3FKSA 3VPAA 1BS9A 2GPJA 2K87A 3A6FA 2R00A 1UM9A 2C3PA 3R3UA 1EGMB 1C9KA 1TQ8A 2I7CA 3IDFA 3NRCA 4CMCA 2JFHA 3IO3A 4R1PA 2R6FA 1C4XA 1HZZC 1P2VA 5C7YA 1P91A 2BEVB 3HUTA 5FR2A 2D2XA 4I4TB 1E8DA 2X77A 4RZXA 5DGIA 1JFLA 3DTYA 1Q1ZA 2VZEA 3KV1A 5JYBA 2FKAA 2BKAA 4LY3A 1V4VA 4YJDA 1LPPA 4OMUA 4F06A 2FF5A 1EGAA 3F6RA 4WLFA 4Z54A 2UVPB 4E03A 4CIBA 3IGFA 3OURA 4NH4A 2Z6VA 2J3MA 1HDRA 2WJWA 3MGKA 4CM3A 2GAAA 2Q6VA 2FX3A 1G2QA 3C8ZA 3SF8B 2FFAA 4JKIA 1TKBA 2W4IA 2BPOA 5HIIA 4OHYA 2FP3A 1RQNA 2VWHA 2VPZA 4LQ4A 4RY8A 1L5WA 3JZIA 3U7RA 4M49A 3BB4A 1TTHA 3FFWA 3HVUA 3QW4B 4Z99A 5G02A 2B9EA 1I3OA 3E5HA 1TUBB 3ZE2B 2A1UB 3HSYA 5ECWA 3NDIA 1RKQA 4GNKA 3MRXA 2RBKA 1CW2B 1UDAA 4RKWA 4G8BA 1IBKB 2VLBA 2BHSA 1ZCJA 3C6ZA 3DPSA 4LQLA 5DHPA 3TB4A 2I71A 1T4DA 3WLRA 1GZ4A 2Z1NA 2PUJA 5I7RA 2MCFA 3VYSB 1SA0A 2MINA 4LJSA 1WZIA 1B14A 1MH9A 2DWCA 3GFTA 2OMEA 1XDUA 2X0IA 1M1YE 2ENWA 2R8BA 3H5VA 1YC2A 3P9RA 4L50A 1YKSA 1FK8A 4DY4A 1TEHA 2Y77A 5IKXA 5HRAA 3LX6A 2VJBA 1E5VA 3COYA 1EVLA 5SY4A 2C5EA 2Q5HA 3CVYA 1NVEA 2O4CA 5AK6A 4BV3A 4BQIA 4L15A 2I8AA 2OXFA 3DNPA 3PUKA 4QUEA 4B0PA 2B8EA 2BEUA 1UPTA 4JLKA 4S2EA 5I7FA 3T5MA 3LG2A 3O95A 2RHLA 1EDBA 3LUPA 3MN1A 1GPAA 4XARA 5K0SA 3ZGZA 5ALKA 1FRVA 2XUZA 1ZCZA 3TS1A 5F5LA 4FMDF 5F1PA 1CR4A 1I1HA 2B6NA 2LDXA 2QVXX 4R69A 1WXGA 3SIWA 2HW8A 4F4DA 4RIGA 1UADA 3AP3A 4TLMB 1IH8A 5JMPA 1U2DC 5TB5A 4IDDA 3W8EA 4E88A 5A5VA 4NCXA 5FTWA 4P31A 1TM4E 2G70A 3PTLA 2FPMA 2PVPA 4GAEA 4UVGA 5H80A 5EJ7A 1L5FA 1NAHA 4DBVO 5I9LA 2ZOSA 1MJHA 2X7HA 1DQYA 1E2KA 3EZLA 2QTMA 4L5JA 2BBTA 4OYHA 4YT2A 3SQXA 1NRIA 5T8KA 1NNLA 2KJQA 4JCOA 1HDZA 1NX9A 4IILA 2DUWA 4C5AA 2QJTA 3VMMA 2XOKA 4H4EA 1W73A 1TVKB 4PONA 1WUKS 3IA7A 1F14A 2BTOA 2IOFA 4U7WA 4L78A 1OXVA 2AOTA 3DNMA 3DOIA 3KJHA 3HVRA 4DR7B 2XUOA 1Y82A 3NX4A 4TT8A 4E5NA 2SKEA 5SICE 5J1TB 1C8LA 1K5PA 1C9MA 1T3SA 3BX1A 1GDTA 1I14A 3ZIUA 2PFKA 4FGLA 2XXAB 2B83A 2GBGA 4LXUA 2YX1A 2ZI7A 5H81A 2NUPB 3QG1A 2XV1A 4IRXA 4NBVA 4ESHA 3FUVA 1FMTA 2QRNA 1E6WA 1L1QA 4QIHA 4C05A 4K8OA 1JKJB 1Y7PA 4KIGA 1X80B 2K5UA 4GI2A 1LCIA 4NU0A 5C37A 3KQNA 3AK4A 5TR9A 4Q37A 2B78A 3K6JA 2JH9A 2ZRNA 3PP8A 1ZI9A 4MW7A 2JLSA 4DRZA 4ZGGA 8GPBA 1OIVA 2ZRKA 3FGOA 1N6IA 1T8PA 2IP2A 3QELB 2OCPA 4IJ5A 3I0MA 4RGBA 1CC1S 3ZWDA 2IYZA 3VR6A 2EKLA 5KYNA 4D2IA 3OEYA 3R9XB 2H4XA 2KWIA 5KYXA 1OLOA 3ZG6A 1I30A 1N5DA 1Z2CA 2CXPA 4C4ZA 3GP5A 2P6RA 2AR7A 5FWNA 2FUCA 2CC2A 2JC3A 1A5TA 3AEXA 4WKNA 4F56A 3HBJA 4J0KA 4LFCB 4MW0A 1VPDA 1XP8A 3K05A 3NHRA 4KN8A 3L43A 1VLMA 2IDMA 4PBRA 1CUWA 4I19A 1IBLB 4FDTA 4BX3A 1URPA 1UXIA 1BFKA 3EQ9A 3M1LA 4ZYTA 2JDID 1U3UA 2B7LA 4KR9A 1AXRA 3PDIA 3GMSA 2H16A 2JHPA 3QLVA 4P8RA 4UNRA 2BAGA 2P4UA 3T5PA 4BKRA 4D82A 3QVKA 2N0SA 4J94A 3T8YA 3T3HA 3E7DA 3OZAA 2ZJZA 2H08A 1YOVB 2CL0X 3MPOA 3NKFA 3BD6A 3G5UA 2I2CA 5H70A 5FUMA 5JMTA 5L3QB 2PJDA 4AQ7A 4UM9D 1L4BA 3QX7A 1U7OA 1I1NA 2OTCA 2QYHA 2C3UA 1EUCB 4L6AA 2WPNA 3L8YA 2EFHB 1XYVA 1SCNE 2R7LA 1ZHOA 5DWVA 1ZDMA 3WNVA 1BWQA 5AFSA 5JSZA 2E6KA 1SURA 4YJHB 1NM5A 3Q0IA 3KJXA 1YL5A 1OX4B 1E89A 1XBTA 3FWNA 3PYMA 4N5DA 3W05A 4BMNA 4EHJA 4CM6A 1T6XA 3BS4A 2R00C 5KYYB 2XCSB 4JN6B 4Q4HB 1M72A 1MMFB 5HHTA 1ODJA 3NAQA 4R4JA 1BTOA 2ZE8A 5EQJB 3RHSA 2R6AA 3TIXB 3WOVA 1KPGA 5E9WA 2LDBA 2ASVA 2BH9A 4P0TA 4CQLA 4XVHA 2VEDA 2Z3VA 3G88A 3WY9A 4ER7A 2OM6A 3ELYA 1TKRA 1DRUA 2AG6A 2O5VA 2P2GA 2P7IA 2VH1A 3AG5A 3AP2A 3Q1LA 4G01B 3RAFC 1V8FA 3L7JA 2F90A 2XVZA 3GEDA 4Q4AA 2QDKA 1MQ8B 2N1MA 1ADFA 4OLAA 1G9SA 5DCWA 3PFNA 1P44A 6ABPA 3UGJA 1QDUA 3V5NA 1TB4A 3RYFB 4CV3A 1LD3A 3RHZA 2XDQA 4BLRA 2H1OA 2EEZA 2IIBA 3N39C 4DG9A 3KSBC 2XKKA 2QNIA 3TSAA 1ISRA 1GKYA 1HE5A 3QMVA 3AEUB 4YR7A 5AXAA 2W43A 3UWOA 1VLLA 3DZJA 2WK1A 4UXIA 5ALWA 2YQZA 2JAPA 2WT9A 3OM1A 4RTPA 2RIRA 4Q1CA 5A04A 2O5CA 4ZTZB 3EZ9A 1T4BA 4B40A 4EL0A 1LTHR 2GNOA 3QM1A 1BEUB 1XN1A 2V7GA 3WV4A 4BXOB 2CUZA 5BSMA 2P0YA 1AHIA 3SI7A 4TL8A 5P8WA 3CINA 3LLVA 2ZYAA 2Q3MA 5L3SB 5IHXA 1ESMA 2E4UA 3HUFA 1XV5A 4J0GA 2JGLA 5IH3A 1PJ2A 3FCAA 4MQEA 1MGOA 4KMMA 2YJNA 4MWZA 4AKHA 1JNYA 3V8PA 3GJYA 4H0CA 2CXQA 2BSQA 1DIGA 5AVKA 3GJ5A 3S2GA 4EELA 1CKEA 1A72A 2WHXA 3VISA 3GFFA 2IOYA 5AVYA 1PUXA 1HLPA 2I80A 5BN3A 5IBQA 1W30A 2OBLA 3RS0A 2XAAA 1WETA 4Z53A 5EVCA 4ISCA 2GERA 3VV2A 1JPJA 5K6AA 3HUUA 3V8NA 4E2XA 1N5JA 4RLQA 2R6R1 4Q15A 4RW0A 4XASA 5CA1A 4X24A 1E96A 5EMNA 2Q4EA 1UPFA 1X7DA 3JARA 1OX6A 4YJGA 5JCZA 2I4RA 1JPVA 4P82A 1YUNA 3U4QA 3C16C 5KJFA 1YF3A 3VC1A 1HI9A 3HYLA 2FDXA 4HUTA 3U13A 1PSWA 4Z9FA 4DILA 1M5UA 3A31A 4YTEA 4K86A 4Q9LA 3JD2A 4CPDA 3CRZA 4TUYB 3U44B 3BWEA 3CIOA 1XRPA 2VDWB 1RXSA 2Z2XA 3NOOA 3W8FA 3ZDQA 4BMOB 1ZMTA 3E84A 1ODTC 1TU4A 4QNNA 4WGFA 5H4HA 4DIDA 2JJMA 2ZDGA 3PD7A 4KACA 4WCFA 3CLRC 1HNNA 3AR2A 5THXA 1VHTA 3IR6A 3J81k 2PUAA 4AK9A 1ZC4A 5JCOA 2QUIA 3IP7A 4KXYA 3UXMA 4M1YA 1KIFA 3IVAA 1DAEA 1SHUX 1OY1A 3H42B 2QTTA 3JAKB 4MGYR 3T9EA 5HA5A 1A2KC 1Y6JA 3TKLA 4B35A 3HWSA 3ZJYA 3H19A 2I1LA 1TF5A 1D0IA 2IT1A 4RX1A 5CDHA 5LOVB 1C3JA 1VOTA 4LHXA 1E61A 2QMZA 3EXHB 3A10A 1L7DA 4O2BA 2JLVA 1PWEA 2ZJ8A 4LTDA 5AW9A 4JI1B 3TIGA 5JAUA 3W90A 3CVUA 2KLHA 2CB9A 2PWZA 3HB7A 3PFFA 4RK0A 4LRWA 1OXMA 3UIEA 3JQQA 1F6DA 5HKKD 4CKCA 5I3CA 4R16A 4AXBA 1VL1A 2ISQA 1E9BA 3L07A 4JLNA 1ZU5A 2DUNA 1UJ4A 4IHKA 5CJJA 4UCFA 4CEIA 2X8WA 1GA4A 2UU9B 4QEKA 2IZOA 5I5EA 2FRVA 4EG3A 1V26A 2W9XA 1Q7CA 4NBTA 1SY7A 2ZSBA 3QELA 4G9BA 4KAXA 5LKAA 2B92A 3AFNA 1Q0PA 1YHZA 2CD7A 2EKPA 2ODQA 2V4ZA 5KSWB 1GZDA 2JKVA 3KYIB 1TM7E 2CV2A 4CN8A 4QLAA 1LF5A 2W6CX 4PR3A 3M4NA 4CG3A 3DE0X 1C2TA 3MCZA 1O0SA 2C5HA 1NBMD 5EUCA 5EXSA 3T4EA 3HSSA 3IP1A 4HSGA 1FY2A 3L02A 4ZI5A 4AJKA 1OWMA 3CW2A 2MIIA 5AVTA 3R0VA 4FCTA 4JVLA 1R5OA 2QG4A 5KVAA 1YAJA 2NSHA 3A4LA 3H8WA 4MV6A 1MA3A 2OBBA 3B9QA 1SOMA 2F3QA 3DKVA 3H6HA 4MW5A 3WQBA 2ZRDA 3CPJB 1RWKA 2HA4A 3E8SA 1ZJ6A 3CPHA 1PEAA 3VZQA 4G5HA 4ZYYA 4MHTA 1SM4A 4RJIA 4EGJA 5B2FA 4ZU6X 1YFLA 4WZ6A 3R5XA 1Y7IA 2X7XA 1U04A 2F17A 4FE4A 3KZKA 2VF5X 5DHAA 2WU1A 1KOGA 3ZU5A 1W4CA 2L18A 4EAQA 2ZQ5A 1NGSA 1ZGZA 4P58A 1LI7A 4IM7A 3Q87B 4ZEMA 2FPPA 3IJ5A 4MKFA 3KKKA 4OG2A 4DM3A 3ONNA 1T9DA 3QIVA 3K0SA 4WLEA 3ZDBA 2D1SA 3NNNA 1U1IA 4CTNA 3BMOB 1AV6A 1KIMA 2ATCA 3V3KA 1WDKA 3JQBA 4BP3A 3LVRE 2IEGA 4MB0A 4YYEA 4OQ4A 1DPGA 2PSJA 4XVCA 5CX4A 4HV4A 1R1DA 1JQLB 2OLJA 4LV5B 4A26A 2HJ9A 3V1TC 1HF3A 3LFUA 3KYCA 3V00A 5D7NA 5CXUA 1FLNA 3RVPA 2WINI 5JAPA 4ZK2A 3PEFA 5BQXA 2YXLA 4MQ5A 4EUKA 1QE0A 4IDAA 2YOFA 4KLCA 3LI2A 1YDMA 2VYND 3I52A 4Y2PA 3H0EA 2JIDA 3TKAA 5JV5A 3ZVRA 1QO7A 1WCIA 3OOJA 4U39A 1CUZA 2WP0A 4LYGA 3MHTA 4E3ZA 4MI6A 5DM0A 5TT1A 1R27A 1HL3A 1YKGA 2FCRA 2JLXA 1W8DA 4YCSA 2GILA 1WVIA 4BIIA 3EXG2 1FXSA 3VR3A 4ARZB 3FPCA 3VO8A 5EE3A 4DEYA 4HWTA 2X9LA 1JHMA 2JFXA 2QTGA 5TIIA 1D9XA 2FW9A 4I14A 3GARA 4JUCA 4CRWB 4MLZA 4YRIA 1KEZA 3CUYA 4RDCA 1C2YA 5EKXA 2XQFA 5HUQA 1XZCA 1SCUA 3LO8A 4W5WA 2XOKD 1HFWA 1EI9A 2HPHA 2WMDA 1GQ2A 4LXIA 3ZHVA 1VE6A 3BMCA 3GU3A 3EDQA 3QVOA 1DOAA 3G7NA 3NIGB 1VC2A 2RAPA 4PYIA 4MVJM 4WEQA 3C8DA 3TTVA 3FFBA 3I4CA 4BWYA 1ICEA 2DLNA 4IDNA 4X6LA 2V5VA 3TDKA 4UHKA 4GOKA 4K6OA 4RXMA 1NIPA 1XMXA 1CG6A 1VP9A 2XYVA 5HYVA 5K8TA 2VP5A 2IXBA 5EJ8A 2CXOA 2ZIGA 1QWSA 2MT9A 1N5LA 3V4OA 1UC5B 2NZVG 2YZ7A 4FMDB 3COJA 1CUCA 2J45A 1R4NA 1B4DA 3KVNA 5ELMA 2CNWD 5G41A 2EG5A 2B8NA 4YJFA 3QWBA 1BGWA 5K2MA 5H68A 3C4QA 3UG6A 5G0VA 4KMRA 3SS7X 1K4MA 1U0GA 3INRA 1X94A 2FEMA 1WB9A 2R0QC 2YJ3A 3ROQA 5KYTA 1G5PA 3WWOA 2F8MA 2FA9A 3ZE6A 3VR6D 1CE8B 1JQBA 1XALA 2ODNA 3VTZA 3PF9A 1KEUA 1VMAA 2FSSA 1KDOA 2G1KA 3UMCA 2QVCA 3B1FA 4G67A 3LWZA 5T6MA 2D00A 2I2WA 2W83A 4Y2JA 2YMPA 4GVLA 4AKTA 3V48A 2FUG1 2NXWA 5CBKA 1KEPA 3ZD6A 4MW9A 4JBWA 2IIPA 3MAJA 2M6LA 1XZFA 2OGTA 1U7XA 3RRBA 3H5OA 1C81A 4X85A 4XVRA 3QYPA 3VHQA 4D44A 4ZREA 1YBMA 2F1HA 3DLIA 3P5SA 5GY7A 3VH2A 2XT0A 1HSZA 2EBUA 3C3AA 4PBTA 5F64A 3M5CA 2OYCA 2HDNB 3D9QX 3FZNA 4KZPA 4AS1A 2QTAA 4A0RA 4KUHA 4ITUA 3BFVA 3HBNA 2QNBA 3HKEB 4G1BA 1BXRA 1WS6A 4CUKA 3HMKA 2JNWA 2ZRGA 4A8TA 4WJLA 4OXXA 3E3LA 3HA7A 1ATZA 2J85A 4N5LA 4OK6A 4E51A 4Z1MD 2WQ6A 2HIMA 2VTVA 1RNLA 1YKFA 5KPDA 1KMCA 4RPIA 2IZ1A 2YQ4A 1PV4A 3IJRA 1XPUA 3NGLA 2BIFA 2A0KA 2LPMA 3SBEA 5AW0A 2NYVA 4F96A 3UAZA 2II6A 4U7HA 3ESAA 1TZCA 3MOGA 2FG7C 4RQUA 1U3FA 3X0DA 1T1GA 5DCLA 2OZEA 1IWBB 3UJPA 2SHKA 3EQZA 4TL9A 4JJFA 4B3CA 1E20A 4O2AA 1KU6A 1N5MA 2VRCA 1OCEA 4QYMA 3ICWA 4J2HA 3RADC 4QUKA 3STUA 1GUAA 2O9JA 4KCGA 5B3JA 1N0WA 3THXB 4R8RA 3G2HA 1EGHA 4TX1A 4AAYA 2HDWA 1A04A 2ODWA 1PWZA 1T8TA 4FPXA 2UXDB 2NV2B 3CH6A 4JXXA 1CPYA 1P5ZB 2VNJA 3B6JA 3FZQA 3JW8A 1W1UA 5INTA 1GL6A 1YCFA 1X42A 4IKPA 1XDDA 5D01A 4JLAA 4PIPA 1MNQA 4KQWA 4JWTA 4R84A 4WK2B 4E94A 2VYVD 3DFMA 1A4XA 4MW2A 1DIRA 1WQ1R 2WYIA 4XB1A 2ZW9A 4MKXA 1QOQB 3V1YA 3NWBA 4RGQA 2BKVA 3S1SA 4K6HA 4DDTA 4F4HA 2JBAB 3EAGA 2O57A 3DFFA 4IX1A 3NTVA 5A0TA 1YZQA 3EJ6A 5DW3A 1XWWA 2ZWMA 3E9MA 1CEQA 4R41A 1A98A 1DAMA 2Z09A 1ISSA 5T6BA 4D0GA 5IJ0B 1G8YA 1XZPA 1YR6A 3C6KA 2JJ2A 1FNMA 4PVCA 1OJLA 3I01A 1J06A 5BN4B 2P6NA 5AOCA 1L5SA 2QK4A 2HNBA 3CVOA 3P2JA 4HGNA 4QM6A 4GDMA 4RZHA 1ZK0A 2FJPA 4L8LA 3VMFA 1PGPA 4KLZA 3L93A 3KT0A 4UCWA 3ZEAA 2C78A 4MWGA 3IVCA 4IUCS 5DI3A 1C7ZA 3LHFA 4UULA 4LDAA 3O4GA 4JXKA 2CDAA 1K86A 3K0AB 3BYZA 2JGNA 3ACCA 3WDMA 3KSUA 4CKWB 2ID4A 5CA0F 1OT3A 4B6RA 5FBQB 5J58A 2W2LA 2EW1A 1CUEA 1IBRA 1IUNA 1GNVA 1JIXA 4K9RA 3UQYS 3WZMA 4N41A 4HG2A 2JH8A 2D1QA 2OC9A 1LNZA 1MPXA 4LYDA 3PC7A 2WHQA 2O1SA 5AVJA 3ROKA 1M2NA 2CWWA 4I1VA 5SZHB 4CIVA 2C7OA 1BX0A 3BJRA 3OU6A 2Y1XA 2Q3JA 1VG0B 2FPXA 4MYCA 4EW6A 2D5LA 2J7PD 4C3ZA 1GLNA 3AU9A 4IFEA 5EA2A 1POXA 4MAAA 4PS0A 4ZMBA 1U0HC 3IBSA 5BORA 5TSDA 4UUPA 4QXRA 3F4BA 3GDFA 3OLQA 1RJ9A 1UBRS 3ICVA 5DKFA 3TYXA 2HH9A 1NI5A 5BN4A 2CXHA 2VZ9A 2EKZA 3M3HA 5KOIA 5IM4A 3ILXA 2EGHA 2Q3BA 4B34A 3L8HA 5FOUA 3A3KA 2FFBA 1VKJA 1XD2B 2GEJA 1ATIA 2J8ZA 4Q3NA 4ZVQA 4BEJA 3R74A 1ST2A 4J7UA 1L5OA 4EF4A 1LZKA 2WF7A 2NTVA 3KS9A 4JIMA 1WPQA 2ZUUA 4CHTA 2WE8A 2GCPA 1OI7A 1NLMA 4HN2A 1IDOA 1QZTA 1TO1E 3TLCA 2ERYA 1JQ3A 4F3KA 1UKVY 3EW7A 2W2PA 5EHXA 3FDZB 3HXLA 3H1AA 3W3AH 1M7BA 4PGFA 3SFZA 5LR6A 5THKA 2GA8A 2R4TA 3QE4A 5I8WA 4BFYA 3SJUA 2H7VA 3MD0A 4RAQA 2FGJA 3ZOKA 4Z9AA 4PZDA 5TQVA 3WMFA 2BBSA 4DCTA 1JH9A 1QYXA 1I4DD 4QTTB 1EUYA 3NYQA 3N7AA 3VJLA 4YRLA 1H4VB 2NZUG 1J0XO 4GWLA 4RD1A 3RVKA 2VK1A 3W5BA 4UHJA 2X5JO 1PR2A 4EYKA 4QATA 4D4MA 4QBTA 3WK7A 4YV7A 2VPIA 1W4BA 4UNSA 3KT8A 1OI3A 1V3TA 1YVRA 4EDHA 4REQA 2ENUA 5BR7A 5HJ2A 2HCFA 2G88A 1U8EA 3U61B 2J0UB 1YQDA 8ADHA 1ENZA 2GH1A 3KUUA 2PWBA 4MRAA 1UFQA 3DOHA 3T7JA 1KDRA 1JB9A 3LC1O 4NAUA 4BRSA 2BLLA 1W4LA 2HSJA 3I3SR 4L9AA 4NLLA 2YASA 4RSHA 4F6RA 5CBPB 4LV8B 1Z0KA 3F74A 5E6UB 4ZARA 1BRMA 1YB4A 2X8BA 4RVUA 3GDGA 2I7DA 3Q6MA 3KWMA 1GCUA 1G1AA 1KZ9A 2CCGA 3GLIE 3B1JA 4MW4A 4BMVA 1TC2A 2ZJ2A 2XZOA 2R7MA 3EVGA 3R09A 1DKQA 3KKQA 4KHPB 4I6GA 1M54A 2IU3A 2LIPA 3DGFC 4JP2A 4QUHA 2BFOA 3CG0A 2JGRA 4OQQA 3IPLA 1GGHA 1YFKA 2EJUA 4UUAA 3DZBA 1P17A 4EGAA 3KD3A 4FSDA 3N2ZB 4JJ6A 1Z45A 2IE8A 3W3AA 5AW4A 2XYPA 2YUTA 3FVTA 3L6OO 3CG4A 3LLUA 4KN9S 4Q4HA 4RTKA 1H2YA 4FYPA 4ACBA 1PIWA 2W2KB 4JQSA 4LRXA 1N3LA 4BO1A 4PAGA 4UTOA 4HZIA 1GPJA 1U8XX 2XR1A 4TYNA 2HIHA 4RJLA 4ALKA 5K0EA 3ZHSA 3OOYA 1XKQA 4GLLA 2FSHA 1ILEA 2IY7A 3IR5A 3F8TA 1KVQA 4ZVOA 2ZRPA 4E2YA 1X7HA 3GB9A 5HWSA 1V7PC 1CULC 1H93A 5CLQA 1ZMBA 3FHLA 5AI5A 1W5TA 2FX2A 2FWRA 1UBHS 1YGYA 3KCNA 3KJFA 4MHSA 2XBLA 3O9VA 1RWNA 2C5LA 3MW8A 2OV4A 2I1WA 2HRRA 1YD7A 4GQAA 3L06A 4TTIA 5EIOA 4EUNA 4GYWA 2P90A 5EHGA 2HZBA 4B76A 4P5PA 3D6AA 1WHSA 1RTKA 1BJRE 1CP3A 2DVMA 2VT7A 3ELWA 2AL7A 2PZ8A 3EZ2A 4TV9F 13PKA 4LKOA 2X86A 4JUAA 3IUPA 1VBMA 3M8KA 4MVJA 2FETA 2CSXA 2FLWA 5B7PA 1ZGBA 5HE8A 3HYTA 5M5BA 2WG0A 4LE1A 4NFSA 1EX6A 3F3YA 3N6VA 2XDQB 1INLA 1JA1A 2XB6A 1OTXA 1FEZA 2RJOA 4HYEA 1PL8A 3NM5A 1Q92A 5AR1A 3K0CC 3HP1A 1TADA 1L4FA 2EJTA 4EAAA 4KBGA 5C1OA 3IDZA 2X5NA 4NQZA 3L0PA 4Q1AA 4MS1A 1RWQA 1QCZA 2IHUA 2XCTB 2PZAA 5ALTA 1KKMA 4UE2A 1MC4A 2R1ZA 3O3NB 2AJ8A 4FD3A 4ZVKA 4LSGA 3PFBA 1JQJC 2H5JA 1BE1A 4ZZIA 3PS9A 3EMVA 1XA4A 4MRMA 5F1OA 1L1RA 3BRQA 2ZREA 3SXUA 3E7WA 4FOLA 1U8CB 2HYDA 1MBZA 1P81A 1QK4A 2ZQYA 2QL5A 5DP1A 1X7YA 5GZ6A 3UMFA 4BQOA 1R15A 1DBRA 2H1WA 3UJHA 3QH4A 4PPNA 3Q3CA 2JLZA 1GQRA 3PEWA 3K6KA 1P4HA 3UYLA 2HJGA 1QGYA 1KJIA 1U9JA 2VUTA 4A92A 2UKDA 3KU1A 3G8CA 3IP5A 2B7CA 2Z9DA 1L4KA 5HFJA 5CU7A 3AFMA 3D6NB 3S5UA 1YZKA 4OM8A 4U2GA 2O07A 3L9WA 2FPKA 2RG1A 2QVBA 2BGWA 3NHAA 1HG0A 2ODBA 3FGNA 4B4KA 1JLMA 5EP4A 1LLFA 4R8KA 4KZKA 4WKOA 3TGLA 1E0DA 1UBTS 2CJWA 1CIVA 3MTBA 4JGGA 5KSPA 1Z6TA 2QBYA 3BGOS 2SKCA 2VQEB 3RVOA 4DCJA 3H9GA 5P21A 5A2GA 4L1KA 2P9YA 2XVMA 3UHOA 1GNSA 4ZO4A 2BGIA 3GLSA 2NVBA 4V0RA 2P40A 3SOZA 2HU7A 3LWDA 2MR6A 3HY3A 3T35A 1N0IA 1VMEA 1Z5VA 1GYQA 1N0UA 4LK3A 1NR1A 4RIEA 1DC4A 3A7DA 3QVWA 5HBRA 4PSAA 3R7SA 1DCKA 4DG5A 2QTCA 2NW6A 2UXCB 5K4HA 4U6SA 3NOXA 1RWOA 5BWCA 3N6RA 1R4MB 2GPAA 2AQHA 1ZH6A 2WUEA 3ICPA 1YZGA 2IYQA 4BFUA 1QF7A 3LVQE 2P3LA 4BEWA 4W4TA 1U4OA 1X1QA 3CLUC 1AO3A 1Z4IA 3WJ7A 1RJDA 4HX5A 4BO4A 3LDUA 1NE2A 4P4LA 4Q4JA 3GFVA 5WRFA 3TTSA 1DO2A 4XDZA 4GU5A 3DZDA 1AGPA 1YFJA 3FOWA 2VDRB 1E9FA 2Q3FA 4WXMA 4NYIQ 5D3QA 1L6IA 2GFHA 4G86A 1JDUA 3C1AA 4IFIA 4CL2A 3NXSA 1AQYA 2AN3A 3CNHA 3KB8A 3BDVA 1NBME 1OZAA 9ABPA 2OEPA 2B8JA 1QONA 1HMYA 3GUUA 3M34A 4FP9A 2CMGA 1XTBA 3KDAA 3IPCA 2R5NA 3I8OA 5DHTA 3TDNA 4AFNA 4C6TB 1Y8QA 4H7KA 4Y0VA 2YFYA 1ZSVA 3L6RA 1QHFA 3RARA 4JI3B 5CFPA 3W7AA 5FR1A 1YHNA 3GNLA 5EINA 1YJ5A 4MWOA 1SXJB 4KQCA 1K7YA 4MV1A 1Z6YA 4OP1A 3SXJA 5C3MA 2J9RA 1TJPB 4JD5A 2QR5A 3FGZA 1E5DA 1QVRA 2ZG6A 3F7NA 1QH8B 1SZPA 4I0WB 1N2XA 1FDSA 1QH1B 2XVAA 3AX6A 3WRXC 4F5ZA 4QFDA 1HLDA 4PZ9A 4TTTS 3I9KA 2DERA 4WAUA 5D85A 1O03A 2CLOB 3BE5A 3LZ6A 4A8HA 3VKHA 2FY8A 2FNAA 1ZNWA 3IPRA 3INYA 1P5RA 1SVMA 1FSSA 3IE2A 1BVRA 2VJKA 3GFQA 3I5UA 3E0QA 3LQRA 2QP4A 1QP4A 2AKEA 2PD3A 2RHGB 3JASB 2AOVA 3N6XA 5G0SA 3SGLA 4Z4CA 1A2OA 5AVZA 1X38A 4BFWA 5J2UA 1P9OA 4HLNA 3FCYA 2H5EA 3PNLA 2GZSA 1GJRA 1HL7A 1SKBA 3TW4A 1K6JA 4I55B 4PX3A 4L3WA 2IYLD 3ZDXB 2BFCB 3B85A 3JSXA 3ZIAD 1L1EA 1SVIA 2WIBA 5EYPA 4RVGA 2Z4SA 2QW0X 4ZCRA 1NQUA 3TLGB 1O7JA 1UP7A 3K1TA 3KPWA 3R5HA 2C7GA 2IEZA 2B34A 2O14A 3P9QA 4GPBA 3D4IA 2I2AA 1TQ2A 2BMAA 2C95A 4ZRDA 3ZVMA 1S7CA 2ATIA 2NIPA 3GUZA 2X9QA 2B6HA 4ZHQF 1UAGA 1MIOA 1RHJA 4UDXX 3AY6A 4J0EA 4BV9A 1RYHA 4DT1A 4MX8A 1Z4KA 2NO1A 3NFYA 3QUAA 4CN9A 2XGMA 4DLBA 4BU1A 1NVFA 1PNRA 1FPMA 3CUEF 3GT4A 3WJ1A 1I2MA 2J5XA 2AN4A 2YN2A 5F78A 2RGRA 2E85A 3I83A 3RW9A 2DHQA 4ZHQA 4EQ6B 3OQIA 1N1MA 4TMZA 1LW7A 2QENA 4B82A 1GVNB 1L4EA 4JI8B 3K2BA 4NDNE 4JP1A 1DX4A 4EYSA 3IURA 2HKIA 1SAYA 2G67A 2GPTA 4FFPA 1SU7A 3G7UA 4OYLA 2OFPA 4RABA 3ND9A 4MVJE 4QUJA 5JHHB 1NF8A 1D0SA 1J33A 4B3TB 4NBRA 1ZAKA 3FOBA 5A3RA 1F0YA 2PXXA 4WA7A 1X1EA 3NWJA 3HJCA 4NX2A 5AVVA 4A36A 3D1JA 4GP6A 4DJEC 1EWRA 1P4JA 3TB6A 3ZIAA 3HY6A 1WSDA 3LA6A 1G17A 4A0QA 4DLNA 2FV8A 1RYZA 1Q2UA 2QRJA 4ILEA 2HEGA 1P9RA 2RDMA 1W49A 4G63A 5DV9A 3VVCA 3ZQUA 3ZI4A 1FRFS 4P53A 4HNVA 1G6Q1 2L0XA 3QXGA 3DV0A 4AO7A 1K7EB 4CL3A 1DRVA 3KNZA 3OUZA 3T7IA 3UOWA 2VL7A 3FWKA 4TM7A 1GDHA 4DM7A 2CN1A 3B82A 1GUDA 1B42A 1GPYA 3LZCA 1DAPA 3WRYC 2AS0A 4FVTA 1P62B 4O1HA 1SHZA 3MF4A 3PT5A 4RJJA 3CX8A 1WF3A 3LOQA 5DZSA 3IUNA 3V2GA 4DMRA 4ZOQI 1MB0A 3UV7A 4OMCA 4LG1A 4R1MA 1R3UA 3CNEA 2P1ZA 2FMXA 5ALHA 3O03A 5GWXA 3HDTA 3FBWA 2HY7A 3L8ZA 4DMGA 4LYEA 2IX9A 4EJFA 2ZIVB 2NO4A 4LX0A 2R4QA 4PQGA 5L7WA 4ZCIA 4WOPA 2ZSJA 1R0WA 4AZTA 2NNLD 3UJ6A 5FUBA 2FEWB 5FB3A 5BXYA 1M1ZA 4Q9NA 3O4JA 1TYBE 1U9IA 3ZIDA 4RVNA 3KZNA 5JZSA 4MKIA 4UEJA 4MV3A 2CZCA 4J4BA 2CEAA 4X6UA 1O94D 4YALA 1YB1A 3BBLA 3ZXUB 2TRSB 1AMNA 4JI6B 4R0MA 5JSFA 1ZD2P 3K0EA 4IDEA 1BFDA 1XKXA 3MXOA 4YC7A 3ZWBA 2HA3A 2X76A 3H9JA 4G0ZA 4JR1A 4NDZA 1XMSA 4R3NA 4RHYA 1LDBA 4AULA 9MHTA 4TT3D 1VL6A 3PXXA 3QKWA 4AJNA 2QTBA 4M0EA 3M6XA 5JRZA 4FNMA 1D2AA 3RS4A 4YMWA 1D6JA 4PLPA 3LGXA 3RWOA 3TZQA 2VSQA 3WNBA 4CYMA 5DMXA 5KSYA 1V71A 5F2NA 1GP2A 1GITA 2L17A 2XAUA 2PL9A 1OASA 1Y3BE 3W9SA 3H9BA 5EZYA 3QUBA 1Y3AA 3M9XA 3MT9A 4TV8F 3E03A 4EMUA 5HOEA 1E4EB 3BWCA 2AD5A 3CFYA 2JD1A 2PGJA 3IAS6 1NXWA 4CUJA 2VDUE 4O8ZA 3D4NA 2LR0A 3RS5A 1RSZA 5IN5A 2H0QA 1QU2A 5EZYF 5IJWA 1XFDA 2WMNB 1FQJA 2X1HA 2YZNA 2Z43A 4JQZA 4Y8VA 2ZYDA 2DBRA 2JLCA 2AEJA 2JATA 2A9OA 2NQ8A 1LRJA 1KDVA 4UZEA 4ATNA 2HA0A 1SZJG 5FTNA 1Y1SA 2ST1A 3BB1A 2H4YA 3B13B 1CR1A 3F78A 3F96A 3LE8A 3O7WA 5DBHX 5DM2A 1XTIA 2VTDA 5F21A 4YASA 1CFZA 3UK7A 2JB9A 2UUAB 5E0OA 3VVBA 5KKAA 1SKAA 2VTBB 3WHPA 1A7UA 5IDXA 4FKZA 1X80A 2HBRA 1Z5OA 2JGIA 4EIWA 3JQAA 1YR7A 1MVLA 2YNMD 4HDQB 1JTEA 4WNYA 1G66A 1FMLA 2FW0A 1AKRA 2O3UA 1ZX1A 3GRKA 5AUOB 2QU7A 3I1JA 2H9IA 3W5SA 3CVXA 4R1TA 2BJVA 1P7CA 2XZLA 1ZL2A 4EUEA 1LU9A 5LA6F 3UB2A 3RTGA 5LUAA 3T1HB 2GZDA 3VNUA 1HEYA 1T9ZA 4MVCA 4OF4A 4F45A 5IUNC 1DE0A 4JNKA 1IPHA 1VSTA 2P5YA 3SBOA 4CFZA 1E0KA 3IPXA 3OY2A 4MS4A 2G40A 1RRFA 4TTPA 4TV8B 3ZDZB 2B2NA 3C8UA 4ZAFA 4CKEB 3L2OB 4GLJA 4C7OB 4W5HA 5LC1A 1AN9A 1T6BY 2TMYA 2GCIA 3O8DA 4PYOA 4KITB 1XJCA 1JG7A 3TZHA 1OBOA 4AJEA 1EVZA 3U5ZB 1O9GA 3Q7EA 2C3YA 2HWKA 4OQLA 2DLDA 2VDJA 5BVHB 4DR4B 4KRYA 5JNLA 2O2GA 5KSOA 4FNOA 5ED0A 2F3PA 3CURA 4JYZA 1LJ8A 1YNOA 4HD8A 3TJZA 4XSVA 3USZA 1Y9EA 3P8ZA 4LI0A 1BIFA 3OEED 4YDRA 3K9NA 1MEJA 3KEOA 3UMVA 1YCDA 1GGFA 1I6KA 1VLQA 1G8AA 2WFZA 1C29B 1GR0A 3KE9A 3A3PA 4GH5A 4MI1A 3OLWA 4JLBA 5FOTA 3WOHA 2IV3A 5FA5A 2AMJA 1X8LA 3BJIC 3KPVA 4MMYB 1YTUA 2ZPAA 3OICA 3HA3A 1Y80A 3EUFA 4K5QA 4UHEA 3OC0A 5GZ3A 1FP2A 1H9CA 3GP3A 5F51A 7MHTA 5SY6A 5J5VA 5F2OA 1UT6A 3KKOA 3PPIA 2E4VA 2O3TA 2PU5A 4R05A 2D2FA 2DHRA 3JAWB 2VDLB 4H35A 4Q1EA 4Z0TA 1J2EA 5DYWA 2DFVA 3ASYA 1H2BA 4BBPA 1F2UB 3PZBA 1N2IA 1QX4A 4C9BA 4BY9E 3IB6A 4B71A 4IDQA 4BMYA 3PWZA 4Z4FA 1E3WA 3PC3A 4BMPB 4UPVA 1BGVA 1WV1A 3MWEA 5J2TB 1K6EA 4O08A 4X3OA 3UTCA 2JAOA 2TECE 4O2AB 4XIJA 1DCFA 4GI7A 2NU8B 4JU8A 2IH4A 1NTOA 2WFAA 3CZQA 5HW0A 2VNSA 5I7UA 1JIJA 3HCBA 4FHCA 2G1UA 2AH5A 4MRVA 1RM3A 2R47A 1UWVA 3OWOA 3CUVA 4UAVA 4LOJA 4QVIA 3F5SA 1XPOA 5FOSA 1MC8A 3OMXA 4XM1A 2DBVO 1JE0A 4CM9D 2FFJA 3RTAA 3LYLA 4QDUA 5DN6D 4RXTA 3VFDA 3VNQA 1IOLA 2D8AA 4G0YA 4DJ5X 1ABFA 1RAFA 4YV2A 1U2DA 5BSTA 5K03A 3O2SB 4QU9A 1O6FA 3HCDA 4C07A 4KJZA 3W5IA 5FPPA 3WLLA 1SCUB 3I2FA 4JAVC 1E32A 1JJFA 1VIDA 2G07A 2WW8A 3FVQA 4QQKA 4IH9A 1PG2A 1SHKA 2HO4A 1KBQA 5IXJA 1N36B 2ZAOA 1MAAA 1T5LA 3EOAI 1IFXA 1Z2EA 1QC5B 3JQ7B 4CCWA 1JR6A 3LECA 2VRWA 2CNOA 821PA 4JJAA 2GVNA 4L57A 3JYLA 4L5BA 4XGQA 1KQOA 5CLHA 2GYYA 3WWZA 1YB5A 2ZAYA 1PZMA 2FPSA 3WQQA 3EWNA 4KPFC 2O20A 5AD1A 1Z0ZA 3A1DA 3LUKA 1HBJA 1N9GB 1UZLA 2BEUB 3BSSA 2F8LA 1U02A 4OBBA 4DUGD 5DN9A 2W2OA 2GEBA 3N2YA 3IQGX 4XJXA 2VVTA 4H60A 1Z08A 4U7GA 2W71A 5CM9C 3JPYA 3U09A 1FVHA 1Z5GA 1AURA 1O0CA 4B2YA 4TSFD 1ZMXA 4WPGA 3VC7A 3CKMA 1CZRA 2ATXA 4R9NA 4MPPA 5EGSA 1BH2A 1AS2A 4NMLA 3P0HA 3LDHA 3DMPA 2HQ1A 4ZANA 4TYPA 3IEUA 3IPYA 3LUFA 2J0EA 1KZHA 2WYOA 1YJCA 4PC1A 4NYJR 3EW9A 1KEEB 2PX8A 4NYIR 4NBNA 2GO7A 3AEQA 4QQFA 5ALJA 4D8TA 5L6LB 4MAMA 3EJWA 1K5DA 1JL3A 3AIKA 3SVTA 4IVPA 5C5IA 2YWEA 3GRRA 5AI4A 4OJQA 2OWDA 5DGTA 2FFHA 1TFRA 3W4JA 1XZ8A 3I04M 2F3TA 1XNJA 4ZALA 3SZMA 2QRMA 1J23A 1YV9A 2C04A 3BMNA 4UTXA 5JLAA 5JS6A 2GJ8A 5DK6A 5ERXA 1I36A 1LRKA 2C97A 1UKBA 2PZGA 2A0XA 2WJPA 1SVWA 3GO4A 4N6GA 1BAPA 4TTAA 4Y9SA 5FOQA 2P3OA 4NZ9A 3F6SA 3GJXC 1NLZA 1IG0A 4ID9A 1X14A 4PCAA 3IAAA 3NPAA 1W6RA 2XE8A 2UUBB 1BO6A 1Z37A 3O74A 1J0CA 1T2UA 3I6YA 1ZRNA 4L76A 1M0SA 1FUEA 2LXNA 4IWNA 2W6IA 4I6EA 4M98A 1ZS9A 4WTOA 1COWA 5HF9A 3Q2KA 1T2AA 3AF0A 2DBQA 3B6ZA 3TFWA 2XNHA 4XOUA 1Z12A 4A23A 4FE7A 1XVTA 2IPXA 1J8YF 1ZM7A 1B6SA 2GUWA 1GPNA 1TCVA 1VLHA 2VHYA 3CZ4A 4IGEA 1TCBA 4L8FA 4IF4A 1M2VA 1KSHA 2HREA 4P7BA 1G9TA 2CNKA 4KKVA 4XSHA 1RXEA 3ETJA 1WRBA 1K5GA 1GT91 1K3TA 2B25A 2Q6LA 2QVGA 2VKTA 1XKTA 3TQOA 1QS0A 2EZTA 3MQ4A 3RRMA 1FVXA 1I80A 3C3PA 1F0KA 4TROA 1IY9A 4F6LA 3PUZA 1NN5A 2VUIB 1FFHA 4YJ2B 5AQEA 2ZIEA 2QUKA 2FPUA 2Q3LA 2RC6A 3L04A 5LZ9A 3HJBA 1GZ6A 2QGZA 3N2KA 4NG4A 1S3IA 1KMQA 1Q7GA 2IXGA 3LD9A 3OH8A 4FYJA 1L9XA 1RRKA 3FJYA 2AE1A 3AIOA 4KNYA 1N2OA 2FWAA 3MBKA 2HAEA 3HCEA 1FLDA 4URYR 5EFOA 3SKVA 2APJA 4BKOA 1V6SA 1QHHA 2PGNA 4MCJA 3DL7A 1M0TA 1GQQA 4TKUB 3NEYA 5K0LA 3EIHA 4G4SP 4N48A 3JQPA 1MRSA 2GD1O 3BG5A 3GLHB 4FX2A 5FH9A 4G3XA 1NBIA 2P2SA 1G7RA 2KBFA 2QYOA 4TQ9A 1E0AA 4DTCA 4NOMA 2HF2A 2WA1A 5IYZB 5I9IA 1DWPA 1COWD 3DBHB 5FORA 4QPNA 4KTTE 2Y2UA 5E95A 5KJ6A 4JT4A 2YHUA 1ZGJA 3AM3A 1CCWA 3QWAA 2WSSA 3BTOA 4BCCA 5K8JB 3AFOA 5HDBB 2IP1A 1PK9A 1ZUIA 3VXKA 5LM3A 2PRZA 3O2NA 5BQFA 4RH0A 4EO7A 3FCXA 1NUAA 4RHXA 2BGKA 4CV1A 4DREA 1DBWA 1WLYA 1PJLA 1SUSA 1UJ5A 2W2MA 1VB3A 3QI7A 2O6HA 2JFFA 1Y37A 3KZ1E 2P2DA 1X8KA 4MVJF 4MWSA 3BT7A 3HXKA 1UBNA 1EA7A 1UK9A 4Q4AB 1CS0A 4OHXA 4OHPA 3VPSA 2IITA 1UMKA 1M6EX 2FAXA 3HCCA 1EWVA 3T06B 1VCIA 5EXTA 2AVDA 3OPXA 5FBHA 5GTDA 1M5RA 5JD4A 3NHJA 4PC6A 1E5LA 4KP7A 4UATA 1II0A 5JPIA 1YASA 4F92B 1OSNA 2BFDB 5CAEB 3LXXA 2ZYVX 1DJLA 1XAHA 3CN7A 3AVTA 3VNVA 4DXHA 3NJ8A 2IXDA 4C22A 4E5DA 3WGJA 4Z9YA 2UYOA 4UCXA 4YAWA 4DCVA 3ZE9A 4FSXA 5BV2P 1L4HA 1X70A 1P9WA 4INJA 4O4LB 1L3IA 1WY7A 4PZLA 3M1IA 3U9LA 3K53A 3VR4A 1EP1B 2OUIA 4UHFA 3QXSA 2PAFA 3DEIA 4PLVA 4XUGB 1N0HA 1G8MA 4FMPA 1PT9A 2OCKA 4ZO6A 3RJTA 2VHXA 3NHFA 3VSDA 2ZZKA 2GK7A 3PEYA 2X3FA 1OPXA 1XMPA 3T41A 5TMEA 1VKNA 3MFYA 4HQ6A 1U0SY 1GG8A 4B6EA 5GJVC 4DN6A 1T1RA 4W7SA 3VTFA 4D25A 3BTSA 2CVFA 1OYOA 1YACA 4E1BA 2ZS9A 5IT0A 1CEEA 3TEMA 1PNQA 1W9HA 3BHMA 4D9KA 3ADBA 2UYGA 5T4HA 2I22A 3OUUA 3FMFA 3KTAA 4D9CA 5KPJA 1OFVA 2A35A 4DBLE 2R8ZA 4BVLA 4Z7QB 1ST3A 2Y8EA 3C1UA 3LH5A 1OXXK 5DHQA 5ISMA 1LK0A 4I9HA 1JZTA 1G6HA 2XNDA 1QANA 1LPNA 4L4XA 5EXEA 4AY2A 1BXRB 1U0FA 4D43A 4LXGA 1SC4A 1N1DA 4HP8A 2Z30A 4LYJA 2P8SA 3W3AD 4D97A 4LI3X 3UOAB 1IRXA 3BSYA 1U7WA 3FTDA 1USGA 3KSAC 3ANMA 4MNTA 2CLEB 5HQTA 2IV7A 1V3QE 5KO2A 1P3JA 2E2WA 1X7ZB 1LPAB 2DJ5A 3RNLA 2JFVA 1PQUA 5K8CA 2ZRAA 1J5PA 5FD8A 5KAMA 1OU0A 3DHEA 4JVMA 4TN5A 1I94B 1TX4B 2Y0CA 4JB0A 5ENVA 1FQKA 4A10A 4YMTA 3QE3A 4H0FA 4I55A 4UQLA 3A27A 1U7ZA 4YX9A 2FX5A 2QQFA 2VS1A 1F3OA 3MA0A 1YS7A 4KGXA 4KV9A 4QOJA 4W5JA 4WESA 5CVCA 5DB4A 3ABSB 1Y5IA 4D41A 2O8CB 1YXMA 4LBVA 3HGTA 2OYSA 1J90A 2IXFA 2J6HA 3ITKA 1LLQA 3BF8A 3REFA 3Q8LA 3DOFA 1Z39A 1QOPB 4DQXA 2CEKA 4MITA 3JALB 1TJ5A 1W29A 2XUFA 4M1WA 1KJZA 1LSUA 3F3SA 1YIOA 1FX0B 3BB3A 1FRNA 1WB4A 4GG1A 2RBGA 3W9YA 3ELBA 3B70A 4NNOA 3TQHA 3OQMA 1QH1A 1X92A 3HQ4O 3O1HB 3K71B 1N3YA 3U0VA 1HDYA 2GM9A 4KLAA 1QB7A 3NATA 1E2QA 2XODA 4Y2UA 2ID7A 3FHCB 3GLIA 2JCVA 4GRIA 5DLQC 1T1JA 1KO1A 2VUSA 4Y6PA 4DMMA 1KK0A 3R0QA 3CEHA 5C46F 2I4MA 3ZPXA 1VLVA 2F6RA 3PXEA 1AKWA 1RWMA 2PBLA 2PEYA 2B20A 3QFSA 1IJFA 3UY4A 1G8JA 3JXEA 1SXJD 1ZG3A 2IYXA 3FI9A 1W44A 4Z1OA 1N34B 3GBVA 4QXOA 3W5HA 1N7IA 4DGQA 3HCPA 1S3FA 3UATA 3UWSA 3CF0A 1GKKA 1GPWB 5AHOA 3LZDA 2LRHA 1IATA 4JBGA 1NW6A 2PLWA 3MQFA 4OI1A 1NSTA 1RZRA 2WWFA 2WG1A 1DAKA 3COZA 2CGEA 3EVNA 1JT2A 4PSDA 5IVDA 3IAEA 2GK3A 3JV7A 3VYTB 5EJ5A 1G8PA 4MDFA 4ND6A 2GD2A 1TUEA 1Y63A 4WKBA 5AW5A 4ZYLA 1NC3A 5JI3E 1QRUA 1TJ4A 4R0NA 4L95C 4ARZA 1X1CA 3DMGA 3NBUA 4YPFA 1DIAA 3IX7A 2JARA 3OTWA 5BN5B 4BNLA 4ZHSA 3STYA 1UDRA 2YICA 2ZCUA 2JA1A 3A14A 3OZ7A 1PO7A 4B7UA 4CQLB 1VI5A 4NESA 2X4GA 2X2FA 3GPBA 3LX8A 3HE3A 1I8TA 2HPVA 2NZ8A 2WJZB 3JYQA 3MLAA 5ALRA 3WBFA 8OHMA 5JSUA 4CF5A 1XTJA 3D6FA 4BYGA 2Q0SA 5HFNA 3UZUA 4UZFA 2IHKA 3M9LA 4CQMB 3VU3A 4DKJA 3AWDA 4GBMA 3EARA 5T64A 5JZ9A 3ODGA 5EJFA 3T15A 1QV9A 4DJTA 2N9UA 3TQIA 2HSDA 2QSYA 2C94A 2WAXA 4B1FA 4NOLA 1KK3A 4Q7LA 4R2MA 2P41A 1ETHA 4LTNA 2VP0A 4P22A 4GKKB 3E5RA 1GCOA 4FFBB 3H13A 1N6PA 1OZGA 1M2HA 3H2IA 4DA7A 3K92A 3P2KA 3EDMA 4XJTA 1YU9A 1MC1A 4UUQA 2BM8A 3EUEA 1TYAE 1UQTA 4J3FA 4RVSA 5HKLA 3PUHA 4BNFA 4WX2B 2DEUA 3IS3A 3N2IA 2VPQA 5DU2A 3A0RB 4QXMA 1D4FA 3D8RA 4EQZA 4LFAB 3M7IA 5B3LA 1Q1GA 3TG2A 5B3JC 4M89A 1H22A 4LX8A 3PFCA 3LC0A 4OXNA 4ZVTA 3LC7O 4K9OA 1HMPA 2O1WA 1WP9A 1E60A 1YL6A 5G1PA 4ZJYA 3PIIA 2QNRA 1YC5A 2W2XA 2QX6A 2VHZA 2IX3A 4TTJA 1YS2X 5LZ5A 4LMPA 4L0MA 5LQDA 3EG5A 3KYJB 1UP4A 2QZPA 3KAPA 1ISJA 1ZMOA 3RS2A 4DMLA 4B3IA 4X63A 4BO2A 4B2PA 4PPYA 4UU8A 1PNOA 1MUUA 1WOYA 2RGNC 2LD4A 1RI5A 5SZIA 3WGGA 3MWDB 5DXAA 1KI3A 2J3IA 3FKSD 3L0SA 2JIPA 2YS6A 3ESRA 3QOWA 1R4NB 3MWKA 3LL4A 4TZKA 1TF2A 4Q7JB 1NL3A 5EJGA 1GSOA 4L8YA 2DKOA 3FRIA 4AJ1A 4BJ3A 4EI9A 2UVQA 1I7QB 3QVMA 3K0FA 5MF6A 2OGUA 5GIPE 3DCNA 3HCAA 4FGSA 1GEEA 5H5JA 1GN8A 1UINA 2RI6A 1W8IA 2VHWA 4F3TA 5FAXA 4RPKA 1GRCA 2FF7A 2E4XA 1OA1A 3GN1A 1AXGA 2AYYA 4M9RA 5F4ZA 2BZ1A 3LJKA 3O8OA 5BR8B 3P45A 2FSVC 1II8B 2A5FA 1E63A 2BMWA 1G3IA 2WUWE 2AQIA 3ABRB 3TRFA 1VL2A 5AK3A 3VNAA 1OQAA 1DX6A 2HHAA 2ABWA 2QY6A 2UYHA 1HFKA 2ZWOA 5AMXA 1GZ7A 4IV8A 4DA9A 4UREA 1H1TA 3RC7A 4AU1A 3E15A 2K6GA 2VSXA 4M8NE 3LLSA 3PDCA 1ZW6A 3TRIA 1DHTA 1KZYC 3TCNA 3IEVA 3IXQA 1D2EA 4L72A 2QKYA 2W6QA 3FCSB 4XE5A 4H0NA 1GWNA 2CJPA 3V7FA 2VTEA 4RETA 5HQ3B 1K7SN 1UPAA 2A9JA 2VJPA 3DMNA 1RJWA 4J6FA 4W99A 2B36A 2ZBDA 1OU4A 2AC4A 3R7NA 4EI7A 1NV9A 1AK2A 2A0FA 6NULA 5AKJA 4BVHA 5A5GA 1USVA 4XTRA 5DTRA 1Z6GA 1U3CA 4HQNA 4QJBA 4DQUA 1WBDA 6ADHA 2B8WA 1XHLA 3TCXB 4CF3A 4D02A 1AV7A 3AYXB 3CLKA 5K3DA 3E7FA 4DE5A 3M89A 4LK2A 2FE1A 2IYOA 2RK6A 1ITZA 1RT9A 3G9ZA 4RNDB 2GWRA 5SY9A 4HN9A 3HU5A 3S8MA 2XSZA 4GICA 3FCEA 3LBNA 2IF0A 3MWLA 3TSYA 4W9NC 2EBWA 4A0HA 3MYYA 4C4YA 2G6BA 1ISMA 4RD6A 1I2CA 1K89A 1MHTA 4JI2B 3BXEA 4KPUA 1M2OB 3GEEA 4N5IX 2Q99A 1SD5A 5CEEA 4D3YA 4OAPA 4JYBA 3ZK7A 5CB0A 4KDEA 1FUUA 3ILHA 3AKZA 3CTPA 1A9XA 3CLSC 5TPZD 2WJIA 3SX2A 5KC9A 3ZWPA 1OAOC 5A1TA 3OMLA 3WRXA 1ORWA 5JLJA 1OH8A 3D4BA 4DLVA 3I05A 3QEMA 1QJ4A 1W2GA 4H1WA 1UK6A 3D6MA 5DBFA 4YP7A 5JISA 1HFEL 3PR3A 3ECSA 1DX9A 4CMGA 3N9IA 4RKRA 1RZUA 4NICA 5J59A 3DZGA 1Z2AA 3QUCA 3JPWA 4HB3A 4DA8A 3IE1A 4IJKA 2E3JA 2EERA 3G2OA 1K75A 4NJEB 4OXIA 2CBZA 4FR0A 4KE8A 1FCJA 3AJ8A 3K1JA 1UBCA 3DR5A 3M0EA 4WV3A 3EFBA 3S2YA 5AJUA 1ZN8A 4HH0A 4IV0A 3WLPA 4M2LA 5LU8A 1QIEA 1NZFA 1KH2A 5A02A 3GH3A 1OWLA 3RGWS 1H6DA 1T43A 1PJTA 1UKAA 2VBIA 1H4QA 5B36A 4D6XA 1U6JA 1XCGB 5DOVA 4A16A 1DRKA 1FLVA 3VBCA 2PTGA 3ILYA 3MUNA 2IQ5A 4UARA 4PS1A 5JNSA 3L05A 3BCSA 3EFHA 1IEWA 2C9BA 3RYCB 3GPIA 1T5DX 1T8WA 4GWGA 3UFXA 2MSKA 2QD5A 4LHWA 2OECA 1H66A 4LZPA 1M6NA 2XZDA 3D2LA 3D81A 4XIIA 3AEUA 4EP1A 3L0DA 5BV0A 4I36A 2IGBA 2ZIXA 3SAJA 2A9QA 1JH8A 1C0KA 4YYZA 2QIOA 2D7JA 1TMGE 3HB5X 1WDWB 1DTWA 4KK3A 2R1TB 4GX1A 5IDYA 4P38A 1B8NA 4HLUC 3P5BA 1JDTA 2JGMA 1EE2A 4OBWA 3VO1A 3CGWA 1AKUA 4OJYA 2FPLA 2G0AA 1RIFA 2I78A 4Q39A 3SJBA 4D4GA 2DWPA 2QUZA 2E6UX 3NIFB 2PNJA 2GQ0A 4C0BA 1H2FA 2XMGA 4BB0A 6YASA 3FNQA 1HDIA 5CMLA 1JU9A 3HKBB 5F35A 5TV2A 5IZ4A 4LF5B 3D7SA 2GN0A 4XFKA 2HRCA 1BD4A 4XA8A 2O8EB 3A9RA 2PLAA 4QOIA 2VJYA 5BSHA 3OPMA 2FLKA 4DLTA 3PIRA 5DXFA 1T29A 3E5NA 5FL3A 1EQAA 1LPOA 5KWJA 1PTKA 2X8JB 3CONA 5LMCA 1A5BB 2IXEA 4Y9UA 1DJNA 1FYXA 2PNFA 2RAUA 4LGYA 2XUQA 3JR3A 1J2TA 4BNZA 1O5OA 1VGRA 5B4TA 1BC5A 1VIYA 4RQBA 3GPLA 4C43A 4JX9A 5TE9A 1U0EA 2I2BA 1GPBA 1TQHA 2RAVA 1ISPA 3A1VA 3A6JA 3FX2A 2A84A 4OA5A 4CFYA 5BY2A 1VYUA 3Q3VA 5JSQA 3AI2A 2PHZA 3PZRA 3WRWA 1IHUA 1G5FA 1Y5NA 2BFBB 1SQFA 1QDEA 2X13A 3CB2A 2OXIA 2O8NA 2Z3ZA 4RM3A 3OE5A 4ZODA 2PSDA 4LDNA 5E6SA 4ZVRA 4ZMRA 4GR4A 1Z38A 4DVGA 4LBYA 3JARB 4RKEA 4BECA 3PGA1 1JFVA 2V7UA 5CDFA 3O73A 3AJ9A 1IZ0A 3KSDO 4XX0A 3RFXA 4IXNA 2P7HA 2XADA 1MU0A 3JQBC 4JT8A 3GZ4A 5I51A 1XRNA 4IUBS 3C5EA 4ESEA 1YRWA 1C9YA 1Q1AA 1RAEA 4O3MA 4MGIR 3TRHA 4DPLA 1OH6A 3QI2A 3IP3A 1JNXX 3FZEA 5TDHA 1PBTA 1U7UA 3L77A 3WSTA 4XVUA 2A9FA 4Q1FA 4DPMA 3LFTA 2Q0HA 1N6HA 1N6LA 1OAAA 4K87A 4UBOA 1EP9A 4AY4A 4QBHA 4AUMA 1PE0A 1DFIA 2YVKA 3LVBA 5D7BA 5IJXA 3RSZA 1ZCAA 1L7OA 3EAQA 1DIBA 1JJVA 1EDZA 2OXCA 5JJBA 2VDNB 1Z28A 3QKTA 2GYWA 4QICA 3R6WA 2VDOB 3G23A 2C8KA 4B2IA 2O2YA 1CQPA 3QEBZ 5FI1B 3X1ZA 4A27A 1R4ZA 2RGGA 1BA2A 1KRHA 2XNCA 1U28A 1MA0A 4XUEA 5JXIA 2PUHA 4RZSA 4D8UA 1D07A 2NACA 5EESA 3RUPA 2QM0A 4UAUA 3UK2A 3F73A 2P77A 2V6IA 1UXOA 2O8CA 1OMOA 1XWIA 2H4WA 1CQZA 4LRTB 1N75A 2J41A 2VRBA 1KI4A 4EW3A 1B8PA 2WJVA 2W6OA 1SUDA 1FRQA 2VDWA 5BV8A 5KOHA 1XCPA 1VL8A 5LOVF 4GL4A 3O26A 2XB4A 1PBNA 1Z06A 2QLLA 2FPIA 2AUNA 2GHTA 2DHCA 5KKCA 1O2DA 1LB1B 2Q6OA 4QOEA 4GP7A 5CYFA 5BR1A 2OV1A 2GJAA 5KOJB 2AMYA 4BFCA 3G2LA 4W5NA 4UDOA 3BWBA 2XB8A 3GT0A 2VA9A 1O57A 4KB5A 2PYDA 1TU0A 4OFWA 5MHTA 3KWLA 2EL7A 1M2FA 4B6GA 1NW5A 3JZDA 2WZQA 4M1TA 3BWXA 3L01A 3RTBA 1KQFA 1NF9A 2DFNA 2FQWA 1KFEB 3GJ4A 3JVDA 4PC7A 4EB0A 1EG2A 1QYWA 3WDKA 5EXXA 3T3IA 3ZV4A 1WOMA 2DQZA 3DULA 3NH9A 3I12A 1JG4A 1Q1NA 2BFCA 4AZ0B 1VJTA 2VP4A 3UFXB 1KC1A 2FQYA 3Q6IA 1CY6A 3SG0A 4YHHB 4DUYB 1QPZA 1H4SA 1XNRB 4FNGA 5L7TA 3TFOA 1Y8RA 2VT3A 3ZXXA 1TYEB 5EL0A 4R8SA 2ZB3A 4MV4A 3UKJA 3JQ8B 1HE2A 4U2BA 3H4TA 1LFDB 2HA6A 4YT5A 2IEAA 2OCYC 2OFXA 1V47A 4LGCA 3CH7A 3W2IA 5AOAA 3HBAA 3CO5A 621PA 2X0JA 3AEKB 2Y2VA 4ETMA 2GT1A 3L9XA 1KI1A 2V0CA 5ITWA 4UBJA 1FJGB 3WKEA 1REQB 4DLPA 2G08A 4B6JA 3QFFA 3SX0A 1HTTA 4M53A 5H0IA 1QGUA 4BCBA 3LT1A 2HK9A 2W7TA 3UN1A 5HJ5A 1XUOA 3FPLA 1FYFA 2IHBA 3TW0A 4IO1A 4B7AA 2QROA 4X1YA 2BUAA 4HNQA 3ZKWB 1Z6PA 5IXSA 2W00A 4IY1A 4CIDA 2NTEA 2O2JA 2GUGA 1DDIA 1WBJB 5BWMA 1UMDB 3AVUA 1RXYA 1XAIA 2VJQA 1CY7A 4J90A 3ZHCA 2F2TA 4RZIA 3RYFA 1JI3A 1XLUA 1XU4A 3BDIA 1V5EA 2FGKA 4B6FA 1U0NA 3WYEA 1H2WA 1RYBA 4MMZB 3TBHA 2VP9A 3EZ7A 3D1VA 4NFYA 4ZQIA 3WDLA 2R87A 1L7NA 1UOQA 4RTMA 2N46A 3GYBA 2OV6A 1HT3A 3V55A 1N5KA 1QUEA 1SQ6A 1LF0A 4Z8YA 4BOYA 1UP6A 3BEOA 5J5CA 2IYYA 1W5EA 5BSRA 2YHIB 1XEFA 3UHPA 1DZIA 1AS0A 3HP4A 4QGHA 3EXHC 1ENOA 4TV9A 3W06A 4Z51A 1U7HA 5C5EA 1M5TA 1ECBA 1ZCFA 2R11A 1XKLA 5JYEA 4KSCA 3CF4G 4UUBA 2XCRB 4L2IA 1TKCA 2QRUA 4XD7D 2LV8A 1LSJA 3QXXA 2LCQA 2HLPA 3VPHA 3PA6A 1R0BA 4HDNA 3KOZA 1KJJA 3OM9A 5LQMA 1UFOA 3LMKA 4N82A 3R0IA 1S2LA 2GZRA 3FM9A 2XRYA 3MC1A 3FMPB 3LIPA 2FYTA 2XMQA 3Q9LA 2RCNA 2JGDA 1SRQA 2BDEA 1U8TA 4OFZA 5K3SA 3VRHA 1EIZA 4S1TA 3QX3A 4IMJB 4KI0A 3NPMA 2WOOA 2QLMA 4QODA 3A4TA 5E7IA 4ZIRB 3W2HA 5IX8A 1Y6GA 4NCBA 1RXCA 3TW8A 1GSHA 3F9RA 3OP4A 1JQAA 4X95A 5AO9A 3EULA 1GFSA 1EUQA 2FXIA 1O5TA 3FDXA 3L7OA 3PPWA 4IEEA 2BMVA 4GSKA 2UZ1A 1JZSA 4J4HA 4LZOA 1IEXA 4P08A 1WMFA 4YP0A 3L4BA 2BMFA 3PFHA 4UQPA 1K5HA 3FFAA 4OHFA 4FFDA 1XEXB 2ZIWB 1HA3A 3CGGA 1DOHA 2X40A 3E3OA 3GLKA 4B32A 4CEHA 1Y9JA 2CFIA 2WHRA 1XF1A 4NYMR 2D8MA 4IIGA 4LW8A 4TKVA 1P9NA 5AHXA 2H1CA 3W04A 3DYBA 1EH5A 3GLFB 1R12A 4HXEB 1RM0A 4ROSA 2Z1DA 1CF4A 4YAUA 5EPOA 2N75A 1NVAA 2GCNA 1HE8B 3OKAA 3TXYA 4EY3A 5DNCA 5FWXB 4DV5B 3G0IA 1X6VA 4CM8A 2CFRA 1MF7A 1HDEA 1YQTA 2VXOA 2ZJ6A 4HGRA 1IUPA 2VP3A 3DTTA 4H9GA 2VAMA 3DE5X 3ISVA 2PS3A 1Y98A 3F7TA 3URKA 4CF6A 4U7FA 2HLHA 3OC6A 4M88A 1TU3A 1H69A 1VG9B 1YHYA 3GVHA 4B5LA 3MAAC 4FXPA 4TYMA 3QRWA 1ZJYA 4JOBA 4V1CB 1EIWA 1T1EA 3NBZC 1VE7A 4LDRA 3VX3A 2Q07A 3T9BA 2GBPA 1XDSA 2ODEA 4JITA 2D7DA 4A8JA 1AH2A 1XCMA 4UTRA 3W2TA 1M1NB 2K2WA 1E4YA 2ZB8A 1EFHA 4OXQA 3LPCA 5FOWA 2JBWA 4F9GA 2EW2A 4EGFA 1HYBA 1ZSYA 2GLUA 1CP2A 4AICA 3TAUA 4BIMA 3B2NA 3ACDA 3KRTA 4JOSA 3LP5A 3IQHX 3ETCA 3KZXA 2PZKA 2WJGA 3NQ41 4WKGA 5BR4A 4C4AA 4KQFA 4DCPA 4B3MB 2QEQA 2F9LA 4LRSB 4DV7B 4CG2A 1W85A 2HV9A 5TRTA 1U3TA 2P6PA 4M1EA 2JW5A 2ANBA 3WISA 4BRUA 2FPPB 1HDGO 1WE2A 2B98A 3IUMA 4REMA 5BP7A 4GPTA 5ETJA 1SUAA 3RBAA 3MXTA 4IMIB 4RSMA 1DT3A 4HATA 4G1EB 3EHEA 5FOXA 4U6NA 3TECE 3AVQA 1EXMA 1PS9A 1SBTA 4KE6A 4NF2A 4GX5A 4DLLA 5JS2A 2PL5A 1TGVA 3EH1A 3GCWA 2J7KA 2X23A 3A2LA 2G76A 3U6BA 4ONEA 3F9CA 1YZTA 4UPDA 3DVAB 5E3JA 1KEKA 1CVLA 1RWXA 2ASEA 2GNPA 4YCNA 4A8PA 1S1CA 2GSDA 3Q10A 1ZLXA 1A8UA 4B48A 1RWPA 1G2IA 3D7LA 3QBDA 1GSAA 1KQPA 2A57A 4JCCA 4ZHQB 4FI3F 3V4PB 1Y7HA 3CISA 1MEEA 2UYYA 3K8ZA 3TQQA 4E3WA 3EPLA 3UUWA 5IC6A 1F8FA 1SXGA 1Q6YA 3PHLA 4P54A 1JB1A 1RHRA 3ZY6A 5LJLA 3K9CA 3U5TA 2AWNA 3PEUA 1OH5A 4URFA 4N12A 1AIPA 1Z73A 1ZW1A 5AM0A 4EB3A 3WL5A 5AVUA 5JFTA 3OEHD 4CDNA 6REQA 4IWYA 2HGZA 4II7A 4J75A 2EFYA 2ZU0C 3EPRA 1WV0A 5AQ1A 2AG8A 2Z56A 5B7GA 1CZUA 1WZUA 1X87A 2FHSA 1SVKA 3QJYA 1PSZA 3AY3A 3I2KA 3P2MA 3UYKA 1U0LA 4H7FA 3WIUA 4JVOA 3REOA 4FDUA 4W82A 3LX4A 3IKMB 3IODA 3MRSA 1WCYA 4PQYA 3ZVKA 1A7AA 1CZKA 1H1LA 5EWJB 2QX4A 5EXDA 3PHIA 4E32A 4YUWA 1SXQA 2ATVA 3P19A 1Z0UA 5EE0A 1P77A 4AJLA 1Q0UA 3AH8A 3T54A 2PZMA 3BORA 1E2PA 4QBFA 4E2WA 4XJSA 5G4KB 5K0TA 2FWJA 1FW8A 2F3UA 4BBZA 5BW8A 1O3YA 1S9DA 1KAGA 1NLUA 2H92A 3L18A 4UMFA 8ABPA 2GZHA 1NI4A 3QJ5A 5DI3B 3RS9A 4DYDA 5KJ1A 1IN8A 4YMVA 1R18A 1US8B 2BHLA 5AESA 2GZ1A 4L8WB 2W8BA 1J1ZA 1HT0A 1EK0A 2YS7A 3RU3A 3OIYA 3Q7PA 2P11A 5E1OA 3UH0A 4QTYA 3CSSA 4LHYA 3LGSA 1ZVQA 2QN2A 1NVDA 1NW7A 5AXDA 5JQGB 3LOPA 1PU2A 3HKDB 3TR6A 3NVMB 1P29A 3ELDA 5K1ZA 4ENSA 1KP3A 2PR7A 3T7CA 2CKMA 5AKGA 2PX5A 2OBXA 3PL5A 3SN6A 4P4NA 3VU9B 1WUTA 4EPYA 2AXPA 1QNLA 1OI4A 1IIRA 3WIOA 4AWXA 1VE1A 4U63A 2H1LA 3O2QB 1ZRHA 2E82A 2JJYA 4I8IA 5FXMA 2WAMA 2LGJA 4IF6A 1O96B 4FYMA 3W8RA 5K4GA 1N5OX 1VPTA 3X1WA 5J4VA 3REGA 4X41A 3EY4A 1SC9A 3OECA 4NMMA 3ROTA 2KB0A 4KXFB 3OJ0A 3QEOA 3NU1A 1V95A 1N6KA 2DHEA 3GJ6A 1IULA 1YB6A 2H1VA 2YY6A 3EFOB 3OE7A 1MIHA 5IJZA 3SZRA 3RB8A 5IVHA 4ZVUA 5DH9A 2Z3WA 2ZQZA 1U0TA 2Y71A 1NQWA 1Y34E 3ENNA 3LYAA 5DEOA 1OGJA 5C8ZA 3SLGA 5LXTA 1PSDA 3N07A 2W2QA 3Q7RA 3EGIA 5F98A 1VCNA 2ZE5A 2Y05A 3NUQA 3VQTA 4DA0A 5I7WA 1GQFA 3DZ8A 2GR9A 2PXCA 5T57A 3HGQA 3L3BA 3WLHA 4KR6A 4IQ8A 4EFLA 4FINA 2QSUA 1KSGA 5K8UA 1ESEA 4MGZR 4MYDA 3I73A 3G7SA 4IJMA 4OGLA 4ZCTA 5L45A 3NHMA 1KK2A 2BEWA 2NG1A 2XUHA 2NUAB 1Q12A 1TE2A 1ZBQA 3B12A 1EBFA 3DPUA 1XRQA 2J30A 3ROFA 4AKSA 1HOXA 4YAJA 2H52A 4UM9B 1DWOA 2D4AA 3SBXA 4QSHA 2P9BA 4DC9A 2HA7A 1UDCA 4LOKA 5EMHA 5HKKA 1TI7A 4RORA 1VP3A 4EHAA 2JJQA 3BOSA 1X74A 1S1MA 5HOQA 2QN3A 3X1JA 4Y2GA 3KQTA 3KTFA 1L5KA 3AERB 1H3FA 4I9FA 2OB2A 1EHCA 2IYFA 1NYTA 2JD0A 3B52X 1RJEA 3OD5A 2QXYA 2HFKA 5FNVB 3WQRA 1XLVA 3N1UA 3OZBA 1QP0A 1NUSA 4GXRA 2YMQA 1EAYA 3JQEA 2AW3A 3HNRA 5EWLB 4KGVA 2EZ9A 3FMOB 3B7WA 4TTQA 4JLOA 5JADA 2WTUA 1CQXA 1EMDA 2OO3A 1W76A 1NTRA 2GBIA 5ARDA 4ANFA 1OLXA 3KT3A 1DBSA 4WGGA 1QP7A 4KR7A 2H2FA 1A97A 2O0KA 1GRQA 5BV7A 3E9RA 4KG7A 1KR5A 4DSZA 1V96A 1XMOB 1QGED 2OG2A 4ZZ1A 4PLGA 3N8IA 1SOVA 3U7FB 3GMTA 1L0BA 4LXHA 5DM4A 3DHNA 1ETUA 1S02A 5KNDA 1KO7A 2AKAB 5FBLB 3A9TA 1C7EA 1JKJA 2LUOA 4U2DA 3R20A 3SR4A 2POCA 1S2GA 3RD5A 1W1IA 1Y1TA 3HVJA 5JZBA 3SPXA 3PVCA 4YEDA 3PWTA 4WHMA 2VOEA 2JEOA 2HPAA 1PT6A 3U7HB 1L1FA 4ZU3A 1WXQA 1GNRA 1VKOA 1JILA 3V9PA 3PQ7A 2J46A 3PWKA 3GEBA 5AYVA 3JYHA 2H48A 5EQTA 3EH2A 3MWJA 4H7JA 4DB2A 1OV6A 1EXVA 1VSVA 4GPEA 2W37A 3U3ZA 2RARA 3N8DA 5AKLA 4X84A