2AZXA

Charged and uncharged trnas adopt distinct conformations when complexed with human tryptophanyl-trna synthetase
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
387
structure length
387
Chain Sequence
EDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYGDAVENAKDIIACGFDINKTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKMSASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/rna
molecule keywords 72-MER
publication title Two conformations of a crystalline human tRNA synthetase-tRNA complex: implications for protein synthesis.
pubmed doi rcsb
source organism Homo sapiens
total genus 133
structure length 387
sequence length 387
chains with identical sequence B
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2005-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00458 WHEP-TRS WHEP-TRS domain
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 2azxA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2azxA01
3CLTD 1MJHA 1V8FA 3ZIUA 2WSIA 3CLUC 1KQPA 1ZH0A 4MW9A 3AFHA 2PZBA 4MUHA 2A1TR 1EFVB 4QREA 2WQ6A 2QUIA 2QUHA 3OTWA 3NV7A 2YWBA 2PZAA 4G6ZA 1H3FA 4HJRA 5FO1A 4GU5A 3SP1A 3SDBA 4CDNA 3SEZA 3G59A 1N2BA 1XJQA 4CQNA 1Y42X 1WXIA 5DASA 3ISJA 3X1KA 2CYBA 4DDMA 1P7PA 4NX2A 2BYTA 2DERA 3N8HA 2IELA 4ZCQA 4JYZA 1MC1A 3IUEA 3HGMA 3KT3A 4GRIA 4QRDA 1J21A 1H3NA 3ELBA 3IOCA 1F7VA 2CUZA 2E0IA 5J5AA 3RK0A 3P0IA 3PNVA 4QBTA 1S4MA 1QRUA 3RFFA 2AG6A 4UZFA 3CVYA 4XFDA 1QTQA 2QTNA 2PZ8A 3IVCA 1JECA 5BNZA 3Q10A 1QNFA 3FOCA 1MAUA 2X0KA 5TS2A 5HUJA 1WXFA 2VTBA 1N2EA 3DPIA 4DDKA 1D2RA 3N2YA 2QUJA 1T6YA 1WOYA 2X1LA 2JA2A 2BTEA 2D54A 1KP3A 2X1MA 1ZJWA 1IQ0A 4NAHA 3UC5A 3MLAA 3PRHA 1O97D 4MLPA 2D13A 1XNGA 2QJFA 1M8GA 3GMIA 1NUUA 3RBAA 1KQOA 2Z3VA 1J20A 3L92A 1RQGA 2NZ2A 1Q11A 1LI5A 3DLAA 3TZLA 4MQ6A 3K32A 4MUKA 2H29A 1M1ZA 1IRXA 3LOQA 1OWLA 2H2AA 2VXOA 4JXXA 1GTSA 1JMVA 1MB2A 3FY4A 3A4IA 1T9GR 3VRHA 1O6BA 3CLTC 1O96B 1X8XA 2A1TS 4F4HA 4S1OA 2TS1A 2B7LA 1N2GA 4I6JA 1OBHA 2WQ7A 1GZUA 1ULHA 1JIKA 4ZT7A 4KKVA 1Q15A 4E1AA 1EUYA 5KWVA 4MWEA 1IFXA 2A88A 2A84A 3H05A 3ZJTA 1EFVA 1CT9A 3FWKA 3P52A 1N2IA 2DUMA 3PNYA 4ZT4A 1NUPA 1M8FA 4K0RA 3HFJA 3ZXIA 4YP6A 4CDMA 4DDHA 3IMGA 1O94D 4MUFA 5FNZA 4PBRA 3FH0A 3HL4A 1XNJA 4NDAA 4MUGA 2ZUEA 1IH8A 2C5SA 2A1UB 1GN8A 1A8HA 3MXTA 2HGZA 1KORA 1JEEA 1GAXA 1MAWA 1VBNA 2Z09A 3QE4A 3MLBA 4XSVA 3F3MA 2PG3A 5HG0A 1GPMA 2XRYA 4P2BA 4MUNA 3G5AA 4AS1A 4YMIA 2XRZA 1FFYA 1ILEA 1M83A 1NZJA 2PXHA 2J4DA 1F7UA 3KT6A 2OQ2A 2O8VA 4MVWA 2A7XA 3CA8A 5FO0A 1WXEA 2JAXA 3PXUA 1U3CA 1O97C 2J5BA 1M8JA 4MAFA 4MUIA 2Z08A 2EL7A 5K0SA 4BWVA 3ZXSA 2ZUFA 1WXGA 3KFLA 2OV4A 1KR2A 1TYDE 2CFOA 3ZJUA 1KAQA 3QTTA 1H3EA 2DXIA 3UOWA 1I6LA 1NUTA 3AKZA 1JZSA 5KHAA 3LE8A 1NUSA 2J09A 3SZGA 4YP7A 4MVCA 4OJMX 1T9GS 3DO8A 3TQIA 2E21A 1COZA 4MW1A 1O95D 4MUJA 2DEUA 3M5WA 1R6XA 1KQNA 1R6TA 1V47A 2PIDA 2QJTA 4MVXA 1OD6A 3X1JA 1WQ3A 1YUMA 2CYCA 4PBSA 4JXZA 1N2OA 1NI5A 4KR6A 2GKSA 2NSYA 3AL0C 3TNJA 2YY5A 4MVYA 1QQTA 2J07A 3H9BA 4EFKA 3IOEA 3CVXA 4L2IB 1H1TA 1I2DA 2D5BA 1N75A 1ZUNA 2QJOA 4G5YA 1MOPA 1TEZA 2ZP1A 3COZA 5LLTA 4ZCSA 3UY4A 1Q19A 2I1LA 4EG5A 1T6XA 1JZQA 3OP1A 1O94C 1UFVA 1G8FA 3RJZA 1WXHA 4DJAA 3SEQA 3NBKA 2CV2A 2JANA 4YBRA 3HZRA 1N2JA 3U1VA 1R6UA 5LM3A 3ND7A 3FHJA 4DE5A 1LW7A 3CLSC 2E89A 2A4MA 2A86A 4XFJA 3KT8A 2HZ7A 2A1UA 1J09A 1N2HA 3A05A 3L93A 1N1DA 3FDXA 3IODA 2CV0A 4RUKA 1WQ4A 3QTBA 3UK2A 2CT8A 3CLRD 1N3LA 1JHDA 5K0TA 2DETA 1MBZA 4MWDA 1I6KA 1XNHA 1EE1A 5KCMA 1K4MA 2X3FA 1VBMA 1U7XA 1KH3A 1QRTA 1O0BA 1NSYA 4ND7A 3IUBA 3FETA 4I6EA 3TS1A 2AKEA 5DB4A 3N05A 3NBAA 2DPLA 1IHOA 2PFSA 4ZCTA 3ZJVA 3AIIA 5J58A 3VGJA 3KT0A 2GOYA 4NATA 4U63A 3AG5A 1YIDA 1YULA 4TS1A 3IH5A 3IMCA 2YWCA 1QRSA 4J76A 4EG4A 4PY2A 2DLCX 3CLSD 5AHWA 1EJ2A 1SURA 2V0GA 1QJCA 2J08A 4HK4A 1FYDA 4ZT5A 1HYBA 3LCJA 4KR9A 3RHSA 1O95C 1PG2A 3P0JA 4YP5A 5TEVA 1MB9A 4MW6A 3AG6A 1NYLA 5HUHA 3COWA 1F4LA 5JBNA 1N78A 5J59A 1YUNA 2R5WA 3HV0A 1WZ2A 3FNRA 1QU2A 1YIAA 2RD2A 3SYTA 4PBTA 3COVA 3BL5A 3A2KA 3A04A 1U3DA 1OWOA 1TYCA 1KH2A 4OUDB 1YI8A 1OWMA 3C8ZA 4EGAA 4I6GA 4KPUB 3GUZA 1PFYA 2EJCA 3D6UA 3TQOA 1EFPB 1K97A 4NAUA 4MWBA 4L2IA 4F3RA 1KH1A 1TYBE 1M8PA 3D6VA 3K9WA 3RK1A 4X0EA 1PFVA 3CR8A 1IVSA 3JXEA 1PFUA 4JFAA 1WKBA 4JZYA 1G59A 1JIJA 4HPWA 2QTRA 1OWNA 4EF6A 1N77A 1G8HA 4H3SA 1VBKA 4EG6A 3ILVA 1JILA 1EXDA 1Q77A 1IQUA 2CSXA 4ND6A 3IVXA 3IVGA 4R2MA 2G36A 4DLPA 1K4KA 1BS2A 1O0CA 1QU3A 5F23A 4ZCRA 5IJXA 3H97A 3UMVA 3CLRC 4EG8A 1O96A 1K92A 4MW7A 1JGTA 4K03A 4MWCA 3IMEA 4UZEA 3IDFA 1DNPA 1MRZA 1ZH6A 1U0BB 2IP1A 1GLNA 4MW5A 3CLUD 4ARIA 1G8GA 3Q12A 3HMQA 1WJGA 3IOBA 4MUEA 1U7DA 2CYAA 3G6KA 3H99A 4ZCPA 5TEWA 1TQ8A 5LFAA 3ZUGA 1X6VA 1EUQA 1NUQA 3X1MA 3S3TA 1T6ZA 1KAMA 4R2LA 4A91A 1TFUA 4EG7A 1JEDA 2RE8A 4G5FA 5DEOA 5H16A 5H7XA 3FIUA 1PFWA 3MUEA 3FG9A 3ND6A 3CVVA 3FI0A 2E18A 1J70A 4RPIA 4WSOA 4WNYA 4EG1A 4R0NA 1KKUA 4CT0A 3SZ3A 3PNBA 2VTBB 2YXNA 3CVUA 4AQ7A 4MULA 4Q93A 5DK4A 1TYAE 4J75A 5TGTA 3GLVA 3H9CA 1VL2A 4EG3A 5EKDA 2O5RA 4Q16A 4HJXA 1NP7A 1OBCA 1J1ZA 2IJGX 4ARCA 4U7JA 1J1UA 2CV1A 3COYA 3TZEA 4OUDA 4MW0A 1NURA 3Q4GA 4NZPA 4KPUA 4U8HA 2GM3A 4ZT3A 1EFPA 2QUKA 1PG0A 3CVWA 1JIIA 1F9AA 2QTMA 3VU8A 1O5TA 2WB2A 4DNXA 1KP2A 1IQRA 3INNA 1WY5A 2V0CA 3E27A 4ZT2A 3P0HA 4FZJA 4KR7A 3N9IA 1GTRA 2DR2A 1VLHA 1B6TA 4MW4A 4MW2A 4ZT6A 3DV2A 3ND5A 1I6MA 5IHXA 1OWPA 3ZGZA 1M8KA 3MMXA 1LI7A 3I05A 2HMAA 2AZXA
chains in the Genus database with same CATH superfamily
1D4ZA 2HK9A 3JAKA 1Y1KE 3KZVA 1GQ2A 3MINA 3RG8A 1W0KD 4NLLA 1FNMA 1NMXA 3LM8A 3MD9A 4GYJA 1C3LA 4RLSA 5DSXA 4BAGA 2QMOA 3K5IA 2A1TR 3LW8A 4FBLA 4MP6A 4QREA 2WQ6A 2C2ZA 2RCYA 3ZLUA 2QK4A 2BEVB 3MT8A 2ZR7A 3CX4A 2YDXA 2BUBA 3GLGA 3OJ0A 3QUBA 1BS1A 1XJQA 1ENZA 2PWPA 3TCKA 2Y27A 3SIPA 1FDIA 5J2UF 5IFLA 2JK1A 2VYVA 1XZNA 1XP8A 2QG9A 1P7PA 3WI7A 2PUFA 5EJ8A 2C2MA 4TWIA 2SHKA 3J80A 5F2EA 4DIFA 1EEXB 2O6HA 3LWDA 4UM5A 5ED4A 1CKEA 5D5PA 4ZCQA 5IEJA 5LOVA 3OM8A 3TDKA 4CCSA 1DE0A 2EXXA 1DS6A 4TTTS 3BL6A 4N0DA 3LY9A 4XIGS 5JARA 4NABA 5FQNA 2EZ4A 4ZHQB 5K45A 2RK6A 4PYIA 3ACCA 1NZFA 1G2QA 1YZVA 2QU8A 3W06A 3WGLA 4UMFA 5DXAA 3ZDFA 1Q91A 1QRUA 1U6IA 5H4GA 1XVLA 1MAHA 2LUOA 3CVYA 1SXQA 4M46A 2P90A 4UVDA 1FRQA 2Y6VA 3Q10A 1QZUA 2F2TA 1MAUA 5AO9A 1YVEI 3H2KA 2RJOA 4WY8A 3NTUA 1P77A 3WICA 1M1UA 4MQEA 1E61A 4WK2B 5M34A 2PUGA 1XC7A 3EXG1 2BTEA 4MPDA 3FLEA 1IQ0A 1YJCA 3TR0A 3T1YB 3LA6A 1ZUHA 5I9TA 2GAJA 2XBUA 3F8TA 3GEGA 3HPQA 3LX5A 2XXBA 2LD4A 2Q1YA 5F33A 2ZI5A 2CEAA 3H13A 4JVMA 1W76A 4F3TA 2C5FA 4L8WB 5SZJA 1P8JA 1EB9A 2VDRB 3IQEA 4Y1RA 4KQ2A 4YWJA 2A33A 3KOUA 3NHAA 2VBFA 3KTOA 3X1XA 3M9XA 2XODA 1LZKA 1LB1B 5F3RA 4IDPA 2EWMA 5LMUB 1JPJA 3LFTA 3I0ZA 4GBGA 4PO3X 4S1VA 2GNOA 3OPXA 4E5UA 1WW3A 5K7SA 1WXWA 3HDYA 1POWA 1YS7A 3O3OB 3BSSA 3S5UA 4L95C 3FB4A 3TN7A 5CB6A 3HH8A 2VNSA 4FHZA 5DTJA 3GX1A 4RD3A 1EE9A 5EWJA 4UHEA 4TX1A 4X41A 4DABA 1JG4A 1E1CA 3NALA 3DYIA 5IZ4A 4KFSA 2PA3A 1A2OA 1UR5A 3JATA 3VRHA 3R9WA 2GI4A 1TVMA 4BMSA 3CLTC 3IAEA 3QMPA 1T36B 2A1TS 1YI0A 2B8NA 3DEFA 3GUCA 2NXWA 3EEIA 1E64A 2YYZA 1U31A 5JXJA 1EH5A 2VDJA 2CBZA 1JUDA 3QG5A 3CUKA 4EECA 2WQ7A 1RR6A 1E5VA 1V5WA 1DRKA 3QBDA 2V7TA 1E1MA 4OHWA 1M2OA 3E7FA 2D3TA 4PPFA 2Z9CA 1KK1A 5I4KA 4O59O 4DUYB 1ZD1A 4KWTA 4ZOLA 3ZY6A 4TV8A 1F06A 4CEJA 3HVJA 1M3SA 4U1RA 4XD7A 3DLIA 1VI5A 3MSXA 2VDQB 3OTOB 2H4XA 3ZV7A 3A70A 1JG7A 1M8FA 4RHEA 3UEOA 1MQ9A 1WHSA 1BSVA 1WPXA 1DTEA 4G65A 2ZJ5A 4FSHA 4YP6A 3RTCA 5EIAA 4C7JA 2ZSIA 3KE8A 4MZXA 4PW0A 1EX7A 1AJEA 1EFRA 3R8XA 2Q5JA 3MT0A 2XGMA 1BE8A 4Q4JA 3FTFA 3S7ZA 4CM3A 2FWJA 3IXMA 1ZVKA 3IB3A 2NU7B 2YY6A 2QLNA 2JB9A 3FNEA 1KFKB 3RRFA 1DOHA 2VWPA 3WTBA 4RMIA 3RS0A 4HNQA 3W05A 2C95A 5ENZA 4ZI2A 4RQBA 3VDXA 5I9NA 2VYND 1IOZA 2GWHA 4Z1MA 4G3XA 1LUAA 5A3SA 4FE7A 5C9ZA 2GK3A 2PG3A 3KB2A 1QHSA 4F5ZA 4EIWA 3E61A 3M4JA 4JLMA 3GV0A 4GLLA 3O7WA 4ISBA 2AHOA 1QHIA 4YACA 1ZM2A 1V8BA 2VO1A 4N6GA 4YEDA 4YMIA 4AS1A 4KRFA 1JHAA 1KGDA 2XUDA 3V6MA 4PWZA 3VYTB 2G72A 3QE2A 4AT1A 4EJMA 1YL5A 1EWTA 2KM1A 1WOMA 1QOPB 1T10A 4IUYA 3FCOA 3DAGA 3G9UA 1D9ZA 3BMNA 4PGGA 1SFRA 2O8VA 1RVV1 5F1KA 2A7XA 2ZSDA 4LDNA 2IKQA 1N9GA 1SVLA 3SX4A 4UPEA 2ONJA 3EHEA 1UBTS 4M21A 2HDWA 3FFTA 2I3BA 2NSDA 1I94B 3NAMA 3QLTA 4MR9A 5IT9A 5DNYB 3ZHBA 3KHUA 3QTTA 1RAEA 1JFSA 4I9FA 3TW6A 4QJ3A 3SU8A 3ZU2A 2QOEA 4W99A 1PZGA 1NUAA 3O8OA 4J0EA 4TXHA 3IDZA 5DOZA 3EDOA 4YPFA 2J46A 2PQ6A 4RX1A 4F7DA 1ODTC 2GD1O 1US8A 1ZCZA 3TBHA 1SZDA 4O4HB 4AX8A 1Z0IA 2PJDA 3QOWA 2C7VA 3OTGA 3TQIA 2HU8A 3QHQA 2R2GA 4BKUA 4M49A 4OGFA 3DQQA 1M6HA 3P4XA 2Z6VA 3CO5A 4KAFA 4AKTA 3KAPA 2YNMC 2BGMA 3QOYA 3VHLB 1KZ7B 2PKRA 1Z88A 4NE7A 1EA7A 1Q83A 2XDWA 3K6JA 3QEKA 4KW7A 4TROA 2WWYA 5E6SA 5T67A 3DEZA 3DNPA 4LVNA 1NI5A 4B4WA 3G2PA 3DLBA 1HPLA 5D1NA 1SUWA 4EW3A 2WG0A 1W4RA 1WUYA 1ZMRA 3AHJA 3I2IA 3OT4A 4PNPA 4QOHA 4TMXA 4IGIA 5FIUA 3SF0A 3VPGA 3X1DA 2R9VA 5JLAA 1BJKA 1PSZA 5GY7A 3LDUA 3BF8A 4LK3A 4GX1A 4RVGA 1J6UA 1J9EA 1FP4B 1YTLA 2PWBA 2OLEA 3PQ4A 1TEZA 1MNQA 1C4WA 4UFPA 1WHTB 3DCJA 1Y6JA 4CKZA 4FQ7A 1XE3A 3B6EA 3GNLA 3RS5A 1FFCA 1U4NA 5DM70 5JYCA 3AP3A 4G0OA 3W77A 4DJAA 3PQFA 2QM0A 1NQWA 2DQ4A 5AUQA 4H15A 1K06A 4A8HA 4I5GA 4QNMA 4DWVA 1J97A 1Q3TA 1Z5GA 2MR5A 1AUXA 3KZCA 3UWPA 1EHIA 1U9ZA 3AESA 3DWEX 3EXG2 4GLOA 4JT9A 2WJGA 3K09C 3M9WA 4YRTA 4HDSB 4BFSA 2ZXEA 3OCCA 1DUSA 1E4EB 1T4BA 1ZI8A 2C7GA 2HA5A 2IL1A 3DHWC 3KR9A 2IVFA 3OLWA 4JOQA 2NU9B 3SQMA 2XUQA 2PX8A 2XQKA 1P1RA 4B6RA 1R37A 3STTA 3HI4A 1TQ2A 2N47A 4Y2GA 5IP5A 4MICA 1UZUA 1ZN2A 2HIHA 1NMEA 4ERXA 1NNEA 1C0KA 2VDKB 3VPHA 1RWPA 2BFDB 3MS7A 3KM0A 1Y9ZA 3MWEB 1XYYA 1FSFA 3HM9A 3RI3A 1R0RE 1P29A 5KYNA 4XXHA 1I0ZA 5KNDA 4GX2A 2JNWA 1FQJA 5ALNA 1GSIA 4HN4B 5LMNB 2ZYRA 1CIVA 2HNKA 3OZEA 4BB6A 1F0PA 1T9BA 3RROA 3JAMA 4IYJA 4RADA 5SYAA 4D57A 2VJQA 2Z2KA 1EDZA 1WU8A 1FQOA 3LP6A 5GM2A 3FETA 1E9AA 4GR9A 4U2EA 5DWVA 4TS9A 2JVJA 4D56A 1HYGA 2R7AA 2QSZA 1R4MA 4NMHA 2N42A 3QVUA 3UMCA 3IMCA 2IP4A 4G63A 2X0DA 4WLOA 2X7JA 1XZGA 1OX6A 5HR5A 3LBHA 4TQ9A 5EHNA 5TY0A 3TJMA 4ATNA 1QMPA 4NY1A 3E7DA 3BM5A 4FU0A 2ZXFA 1WKCA 3QPWA 4IDNA 1P7YA 1FYDA 2QX6A 2XQGA 1IOVA 3DL7A 4FDVA 2FQWA 3OFNA 1K7CA 2FOXA 1JAYA 3NM4A 4MV0A 3S2ZA 4FIZA 4RQAA 4JWTA 3EBLA 1HH4A 1I3NA 1T4CA 4P4TA 1GXSA 3HV0A 4K9KA 5FX2A 3PLRA 4E7PA 1QU2A 3HJNA 1LWOA 4M4SA 1HEYA 2IWHA 3UA4A 2XX3A 3A2KA 3PI7A 1F8FA 2G3YA 4IS2A 1J7JA 2VPPA 5AOVA 1Q1QA 3UB2A 2JFWA 1IATA 4PQFA 3Q7IA 1G9XA 1QX3A 4I8XA 4ZRDA 1NG9A 3Q9LA 1CZHA 3LQKA 1FPQA 1ZG3A 1UAAA 5CBKA 4YROA 1KMHB 4PO8A 3WJ7A 2I7XA 3NOVA 2ZYAA 3HB7A 5BW8A 1IN6A 4DNPA 1JLRA 1B15A 2PSSA 2QY6A 2X42A 1KMMA 2QYHA 2ZVJA 3LVBA 3LUKA 4CJXA 1P1JA 4YCLA 4M9XA 5JQGB 2FCAA 4OOFA 1G8KA 5A2QA 5D84A 4RY8A 1V96A 1SB8A 1ORVA 2H5LA 5FOSA 4CNQA 4PHHA 4JLNA 5FBVB 3DAPA 4ZVSA 4TXLA 4FFNA 5IT0A 3MELA 4HX5A 4XA8A 2AT1A 2EFYA 1JIVA 3FFBA 1NVVR 3OZFA 4FT4A 1JDSA 3TMYA 1ZC3A 1OI2A 3BERA 3C5HA 4KXVA 4OHKA 2AQ8A 2F1IA 3EG9B 3EZ9A 2M32A 3IE2A 3ILVA 2IYLD 4PWYA 4F84A 4KE6A 1AUVA 1DQZA 2Z2XA 3H65A 1W0CA 1NXTA 1GIAA 1RHJA 1YZTA 2XAAA 4YJHB 2CZGA 3M6FA 2V5UA 5D7NA 1L5LA 2B98A 4U2KA 3U4AA 3W9SA 1J2RA 5I4CA 1HDZA 5I4IA 5KTSA 4PRLA 2Z83A 4D9EA 1F7VA 1H1LA 5F2NA 3VZRA 1RRCA 4ECAA 3EOAI 2G83A 1SQFA 5AKHA 2WKWA 3OESA 4UZEA 2WHRA 5B6PA 4F4UA 5BMVF 3SQXA 3A2NA 3LOPA 4ER6A 2KBEA 2VPTA 3ZDRA 4DR5B 3T61A 1WUHS 2PGAA 2YCBA 4IUCS 1GCIA 2RC5A 4MW5A 4RVSA 3VNUA 3N2GA 2P9CA 5BVHA 3BSYA 4B09A 3JQRA 2YS7A 1FVHA 2RGAA 3RYIA 3VOAA 2HEIA 3KSUA 4EMBA 3CQ9A 1GZSA 2WJVA 3K2BA 2IZ5A 3BD8A 1SOMA 3R5FA 4MUEA 1HT2E 2ZRCA 1F8GA 5IN4A 1KPHA 2WZBA 3DULA 3GWGA 3QX7A 3HCOA 1X1BA 3UAVA 1AQLA 1QGUA 2P9JA 4MI3A 1O87A 3N6XA 1ZSNA 2RHTA 3G0OA 3P2KA 4WL0A 1QX4A 4D3YA 4F9GA 5LFAA 5GONA 3RQIA 1OIXA 1PR4A 1TVKB 2P9TA 4H3HB 2Y8EA 3ZJ5A 3O2QB 4KQIA 3BWCA 1YA8A 2HSEA 4HF7A 4DXHA 3BJMA 1LKZA 1U5BA 2AFIB 2KW5A 3PC8C 1L8LA 1ZMOA 2RE8A 2ZQ5A 3GT3A 5BOSA 2VTEA 2YWFA 5K9ZA 2YH2A 3A6GA 3S2FA 4DZRA 3FIUA 2J9GA 4D99A 2YJTD 1LFAA 2C3OA 1KQGA 3FG9A 1X7XA 1OGIA 3NP9A 4FGUA 5FPYA 5GIPE 4KO2S 3QY9A 3E4CA 4RZQA 2JLXA 1D8TA 5LDDC 2G5TA 1DRJA 3SZ3A 2VQDA 2GK6A 2YJ4A 4CCWA 1E9EA 2J59A 1Q7CA 1G8PA 1XX6A 2KLBA 2GD6A 4OMDA 3T1HB 2FN8A 4OXXA 1XPOA 2WUFA 3FGZA 3PNKA 4HDOB 4PINA 4PLFA 4MI9A 1FTGA 4BFXA 2PSFA 1JTFA 4Q16A 4JKOA 5CX4A 1KVRA 3PYXA 4S12A 3TQTA 1Q50A 2O3UA 1MEJA 3L01A 4NBSA 4C4AA 1JKXA 1XLWA 2HKIA 4ZT3A 2XDYA 3KYCA 1JIIA 2C9BA 3FCCA 4D6PA 4JGBA 4KLRA 4JJAA 3DE5X 4Z8XA 5AVKA 1M9NA 2R86A 1G5PA 5COQA 1G3MA 5IC5A 4MVJP 4B3HA 1IXSB 1SZPA 1YU9A 4EHLA 5FWAA 3C6ZA 4XWAA 5CUQA 1KOLA 3N9IA 2OQRA 3Q3IA 1QO0A 4INAA 5B2FA 2YNMA 1X92A 2ZYWX 1VB3A 4L4ZA 3PZRA 4E0BA 3K35A 1I2BA 4RDCA 4WKPA 1R0SA 3PHHA 4GKVA 4I1YA 4JLDA 5EKTA 1PZFA 4W5RA 3OZSA 3W79A 2NVWA 2E4XA 4J94A 3DV2A 2UYGA 2BEUA 4X93A 3ZNQA 3UWKA 3FTCA 3EGIA 3QF4A 1P17A 3G82C 4GOMD 2OV1A 3GJ7A 4FOTA 1CP2A 2EBHX 3P26A 3UTDA 1G8SA 4UEQA 1PS8A 4KEAA 1JG6A 1FSZA 1XZDA 4RJTA 3O21A 4MLZA 2AFHB 2WKSA 4FKZA 4KI0A 3QUSA 3OJCA 2QTWB 4I14A 3ICEA 3TECE 2P9BA 4PYLA 2GSDA 2CL5A 2OWEA 4R9UC 3CTMA 1B8UA 5GQSA 2PKCA 1JJFA 1ESNA 4N47A 3UA3A 1FRFS 2AB0A 3DBOB 1NQVA 1OTHA 2FWBA 2QVGA 2LIPA 2VDOB 5DIFA 3N70A 4FE3A 3BE8A 4D4KA 3ETEA 4IDHA 1I2MA 1AGNA 3QNWA 4I2VA 3MWGA 2BFFA 2PX2A 1A8SA 1ML4A 4P38A 4OQNA 4UOEA 1XD2A 1UAYA 3K09A 3TLAA 3B3GA 5L4SA 4ER3A 1QTIA 5G41A 5B58C 3PTAA 1VKRA 2BDEA 2LDXA 1XU7A 5I4BA 3I9LA 3EF3A 2WWRA 1W2WB 2K87A 5AXDA 4OJNA 4TZ6A 3TPZA 3GARA 4N5LA 4ZO4A 1BOFA 3ZK8A 4AAYA 3PLAE 5JMTA 1CJCA 1E62A 1XQYA 3CVJA 4RD0A 4FBGA 1J21A 4D1YA 1UPAA 2CUZA 2GPJA 2WTAA 4XIJA 4XDGA 4QUGA 4UVEA 4EATA 1PR2A 1CDOA 1R7RA 1S4MA 1IEXA 1RIIA 1TUGA 2W2LA 3IB6A 3RFFA 5JWRA 2G5CA 3HDTA 4B87A 2GYWA 3P71T 1QTQA 1IVNA 2E85A 3OUUA 2A94A 4IMRA 1N4DA 4AX4A 2O2DA 5G53C 4Y2HA 3FNHA 1U3UA 3DDSA 3IIMA 4PZCA 1JHUA 4CMEC 1ISRA 1KEZA 2Z1NA 1UBOS 1X14A 3FX2A 1L4EA 2X1MA 4RF4A 3UAZA 2EYUA 3W5DA 3B9RA 3K0FA 2XBLA 4YJ2F 5CBPA 5A4AA 1AUOA 1SUBA 1PUIA 2ZJBA 3OQPA 4UE6A 2G4CA 3NCTA 2XCTB 4C7XA 4B4VA 2ZVPX 4BLUA 4ZK6A 1J39A 2PDAA 4YQFA 2B2XA 4AZ3B 5AXBA 3EEOA 4J0IA 4NEHB 1RYYA 3H2ZA 3KXKA 4PM4A 3HUDA 1KSHA 4BFYA 1T8RA 4JROA 4BE7B 3IV6A 2XGJA 3BIXA 4K46A 1NV9A 3A11A 3KVVA 4M1ZA 4ER7A 3CJRA 2IU4A 4K6CA 1GTVA 4X6UA 1Y48E 2B78A 3RYCB 3UFBA 2H52A 3DF7A 1GZ6A 4HAVA 1IMOA 4S1TA 1EFCA 3QBEA 3KLNA 3UHJA 2QXUA 4AKEA 1J5EB 1JSZA 4KWCA 3H0EA 1KZ6A 2JI6A 3AOEC 1ZISA 1HEUA 3C3AA 4EWLA 3LQRA 2FN3A 4PFQA 4CETA 2HT1A 3DWFA 3V55A 2FHPA 5CA1B 2OR3A 4BJHB 3QHAA 3HC7A 4IXTA 1I3CA 3RWBA 5K09A 2P9QA 3IAAA 3OPQA 5LYJF 5JJBA 3C7CB 1G20B 3IVRA 4I6JA 4W9NA 1W9MA 5J58A 1GU0A 1MB0A 2W7TA 4LV8B 4RA9B 1VHQA 3HXKA 4X1OA 4Z9BA 5JCOC 2IIPA 1TO6A 4FFWA 4BRWA 3SMVA 2JAOA 3FCSB 5KWVA 2ID4A 1NXWA 1PI3A 1GA6A 2DFTA 3RRJA 5CLFA 1E1QD 3C1AA 3HJCA 3JASB 1VHTA 5IKOA 4LDZA 3EPRA 3WADA 2RHCA 5JH7B 2W90A 4BAUA 1EVQA 4QKQA 3R0VA 4YX9A 2QLMA 3ED5A 4D4MA 2ANBA 5K8CA 2FF5A 1ODKA 1X1DA 3A32A 3BMOB 1KYWA 2WAXA 2FPXA 3D6MA 3W6ZA 4AUKA 2O2JA 4DDHA 5I7OA 1FNDA 3GP8A 4OGGA 3MTGA 4TSFA 3BRWD 2V7QD 4OI2A 2FSHA 1CTQA 3BE5A 5EE1A 3ZZNA 4AN1A 3CEHA 3HA3A 2C5SA 2QT0A 1SHTX 1F20A 4IDFA 3ZHTA 4CGYA 1EAMA 3ZHQA 1YB1A 1HC7A 4RJJA 2BFWA 3L7JA 1HE8B 4W5TA 3DB2A 4MSUA 4ZQEA 3WB1A 1YBHA 4BNJA 5IABA 1R3DA 3B1WA 4DIUA 4MHTA 2JCVA 3CFYA 3N2EA 4OGLA 3A7DA 2FH5B 1PT5A 3FYUC 1CRLA 5FTWA 2P6MA 3QFRA 2XRYA 3D8NA 3HCAA 4HDNA 4QUHA 4LJSA 1CS0B 4R31A 4XJVA 5CH8A 5D86A 5BSTA 5B6JA 4UHHA 3WWDA 3ZI4A 1ZKDA 1W88A 4PYNA 4YMGA 3VO8A 5KVVA 1U7UA 5JTUA 3TGLA 5TE9A 3BGSA 4UOQA 2OHOA 2PWZA 2YY7A 3N7TA 2XUAA 5D1HA 2Y1KA 5ARBA 3PQCA 1BMDA 1NU6A 1H2AS 2YUIA 3C16C 3NWEA 4JU8A 4UM7A 3E8MA 2PX6A 5EKSA 4EBFA 4IWXA 2J5BA 1VJTA 1PL7A 1QK5A 1T2VA 2NVBA 1OH8A 1ZCBA 1R9JA 2UVDA 2FK7A 4TKZA 3RB8A 3OU7A 1MG5A 3PC8A 5T7BA 1YS9A 3HB4X 1XKLA 3K4HA 1GEEA 2UXCB 1QH8B 4ZV7A 5KCZA 4QAQA 4J1QA 3UOWA 2WF7A 4II7A 2R7MA 1S8OA 3E6AA 2O5CA 5FH9A 1R9NA 4CKCB 4EFDA 2DHQA 4LJKA 1NA5A 4U6NA 1K8XB 3RAFC 4ZKEA 1SK8A 2WD7B 3L8GA 5HPYB 1NBHA 1NW6A 3MTBA 1ZSYA 4LZJA 1MW9X 1VJ1A 3HDGA 3RCBA 5EMNA 2DLNA 4HQRA 4E13A 7REQA 2OP1A 3GFGA 3V2GA 1Y33E 2Y93A 4Y7DA 4K40A 4II2A 4P3NA 3SSNA 4BVFA 1N9KA 3C5VA 3M5WA 5BW4A 1R6XA 4GLJA 5FV4A 4KXQA 3RBXA 3VAAA 1DHRA 1NRIA 3O7MA 1X7YB 2IYXA 5MHTA 4HWOA 4JQOA 1MNAA 4CTOA 1EM8B 4KWEA 1J8FA 1GCOA 4WFIA 1HT3A 1SBCA 3MZ0A 3ZE2B 1OKKD 4XASA 5CX1B 4P58A 1KO8A 2J07A 1F6WA 4PZPA 3URMA 1Z08A 1X8LA 2BJWA 5FL7D 1N0WA 4WERA 1M72A 1X1SA 3ZHXA 3B6KA 3IOEA 3FOAA 4DAEA 3U7JA 2OP0A 4L16A 2ZRFA 1ZUNA 1AE1A 1KERA 1ZPDA 4G5GA 2ZP1A 5CB8A 1GNRA 2H92A 1DAEA 2A5LA 3UG6A 1DCFA 2NAFA 4TLCA 1K98A 3ZZUA 5KAPA 4EGJA 5DNUA 1KYIA 4D9FA 1TA4A 3LPLA 1H0RA 1TTHA 4Q1FA 2B34A 1ISPA 3H6KA 4TV9B 2DUNA 1AV6A 1QO7A 4YBRA 1EFHA 3HZRA 5AM1A 3DPSA 3H1PA 2R47A 1T9CA 5E9AA 2HYIC 5D5QA 2XUGA 1VGVA 1RPTA 2AYXA 4LYEA 1IQPA 1BFKA 1U8FO 5CA0B 5BSVA 2JH9A 4O2AF 3Q3CA 3EA0A 3VR6H 5FNVF 4E6EA 2BUCA 5MFZA 4PSAA 1RXSA 2CUKA 1IXZA 5CLQA 2GPYA 2E5LB 2HZ7A 4D5GA 2P2ZA 1IB6A 1PJSA 1CX9B 1L4UA 2C4UA 1J8DA 1OGYA 1U3TA 4ISCA 3DM9B 4A2WA 3DFUA 4LHSA 4R1UA 3IQHX 4RUKA 2QTGA 3BMQB 3LT0A 4BRUA 4YRDA 2AR0A 2Q3LA 2DX7A 4HVAA 4EDFA 2XF8A 1XRJA 4UW9A 1MKYA 2EFEB 1NXPA 1SVIA 2RONA 3KSZO 4RY0A 3O38A 3L43A 4REQB 2OYRA 4ZDIA 1RBMA 4BQOA 3AUAA 3PR3A 4K9QA 3RM3A 5YASA 2CVPA 1VBMA 3DXXA 4FMDF 2X3YA 1JDNA 2IYVA 1KH3A 4D3XA 1E6LA 1QORA 5F5NA 3C7TA 3IUBA 3BWBA 2JIPA 2GS9A 2FW1A 1BMTA 2FLKA 3K6KA 5CP8A 3V9PA 3IV9A 3ZCSA 3U4MA 1F3LA 4FYWA 1IHOA 3ZYZA 4REMA 4FE4A 4UNNA 4PIVA 1M2WA 1H6BA 5CCXA 1ORDA 3T1QA 2YWCA 1SA0A 2D5AA 5T3UA 4B76A 1LSUA 2VOJA 4LYFA 4EG4A 3H4MA 5A5GA 5IASA 4H16A 2G1PA 1VP3A 5AHWA 4ZYXA 1NYRA 1SXJE 5GPBA 2OZVA 1QR6A 2IEIA 3VV2A 1RHKA 4MXDA 2J08A 3F5FA 1EQUA 2QMQA 3ETCA 3VTFA 4A0GA 1CVLA 5KKCA 1J5PA 1UXGA 2HCBA 3IDOA 4ZIRB 5HYVA 2CUTA 4YP5A 3UMGA 1BNCA 2OCIA 2VUTA 4N18A 3JU3A 4L1KA 4P3YA 1L1RA 1YZNA 4LYJA 3WGUA 1F4LA 1IBCA 1ZRMA 3LHSA 4DCCA 1QYXA 4BFUA 5CEEA 2WF6A 3VJMA 4RJLA 5K0NA 4M1EA 2XCRB 4EB6B 4DYDA 2PBFA 3K1TA 4M76B 3SR3A 1YI1A 4CMEA 3A04A 4C0XA 1UJ5A 1Q6ZA 1QONA 4FK8A 5KMGA 1AQ6A 3BZBA 3ICWA 4EA9A 3GUYA 4JL6A 5FBKA 1W25A 5BYJA 1GNLA 4A23A 4BKMA 3IEVA 3CUTA 1GL7A 3PHCA 2YWDA 1ZOIA 2A30A 3TMAA 1QVVA 2EJCA 3D6UA 2JW5A 3ZTTA 2GM4A 4OFBA 4ESVA 1QP7A 3ENZA 4PXYA 1Y3AA 3G85A 1MU0A 1OLXA 3DZDA 4WCDA 2C5EA 4A7PA 3G2HA 1U4OA 3K9WA 3ZKAA 4EKIA 2PYZA 1EZ1A 2OO3A 2VZEA 3UFXA 3OTHA 3VR5A 4C0JA 2IS6A 3SC2A 1DLJA 1LS1A 1ZITA 3CR8A 4UBKA 3JALB 4U2GA 3WV4A 1CJVC 4COKA 2ZIFA 3KQWA 3LBNA 2Q0XA 4Y0AA 3PR2B 3U31A 1ADJA 1NW4A 5BN3A 4G2NA 1WV1A 4HNUA 1JX6A 4H27A 3AOEA 4XX1A 4OD0A 3BL8A 4E5KA 1PL8A 1XF9A 1MMFB 1RMYA 3OE7D 3WKBA 1KY2A 4WFJA 5JRDS 5KTPA 3CW9A 1CS4C 2XV1A 4GR5A 4WOBA 1IK4A 4F97A 3RU3A 1XVIA 3OQIB 2V96A 4BNDA 2H18A 1V35A 2NTJA 4UMVA 5EZYB 5JCOA 2D2IA 4U7DA 1W5AA 2ZBGA 1Y9EA 1XDDA 1FXSA 1DKLA 2E1PA 1JVSA 4IS3A 4KQMA 4NICA 4GKKB 1MORA 3H8JA 1Y37A 3R20A 3EBOA 2IRWA 1P0IA 1Q14A 2Z2IA 4BZQA 2JLWA 4KOEC 1R16A 4R2XA 1P2SA 1BD3A 2RHOA 1K1EA 1XXHB 1KHTA 4MGIR 2DPXA 4C29A 2Q07A 3A1NA 1YR7A 5EA2A 1D2HA 2BI8A 3RSFA 3WC4A 2I66A 3KFVA 4LDPA 4AZSA 1KWKA 4MB6A 1EWRA 4ZU6X 3WIOA 3GLQA 3B9PA 2Q2WA 3DBRA 3DONA 2QE7A 4YRRA 3E70C 1FNBA 2Q0SA 1SB9A 1MG0A 2FYTA 1O6CA 5AHKA 4AXBA 1YK1A 1YR9A 4PSVA 4BV8A 1CRPA 3GAAA 1D3AA 1ZHHA 4IHAA 1XA0A 4EI9A 4W82A 1NDQA 3P9ZA 1LK0A 4TKVA 4XQGA 2BH9A 2C04A 1VJ5A 4P8RA 3BHIA 1XZJA 2HF7A 3PHGA 1C50A 1ZH4A 2EZUA 5CT5A 3DLCA 4R2LA 4B79A 2OB2A 4QUJA 3AOGA 4A91A 3DLHA 1QPBA 1Z0SA 3EW9A 1WCIA 1RRMA 3IPCA 3PJGA 2NGRA 1E8MA 3H4TA 4QU5A 3AVWA 4R4JA 4JLUA 2GA9A 3FYUA 4G5FA 4LF5B 1HLPA 4ENRA 2V3VA 1YVUA 4OM7A 3S2EA 1QH1B 2PPLA 3CJTA 4C0AC 3UK6A 5GOTA 1KDPA 2O06A 5J4VA 5CYPA 4BUCA 3NVKI 3PNPA 4EJ6A 2Y0BA 5CW2A 4G5XA 3RBVA 1Z4IA 1UH5A 3LDHA 3MWDB 1UDRA 3B12A 3CU5A 3Q7QA 4KMRA 5KVQA 4EKGA 5FDFA 3JQAD 5CLGA 4DSUA 2XB8A 5JPDA 2HLNA 5BN4B 4GI5A 4W7SA 2H00A 2ZSBA 5DK4A 4Y0VA 5DCWA 1X80A 1R18A 3ZEAA 1N7HA 1SD2A 4V3CA 5TGTA 1Z68A 1J24A 3N8NA 5E8RA 1ZCJA 3CLKA 1JPUA 2O5RA 3LPDA 4MYHA 4RQTA 1QIDA 3DVAB 4C20A 2D1TA 2XITA 4I4CA 2RH5A 4JL8A 5KX5F 2VHQA 2BZ1A 2QTCA 4XDYA 3LIIA 5KYYB 4UBOA 1ZR4A 5JNWA 1LRLA 4FNAA 2OMKA 4MQMA 5GTDA 5AI0A 3EX7C 4BKPA 4TWRA 3PKZA 3PQEA 4ETMA 2PYDA 1YK0A 3QVOA 3EH2A 4UNPA 4XH9B 1MFZA 1E7RA 4G0MA 1FFXB 3ABQB 1ADFA 3AFMA 3ZNOA 5IC6A 3U3XA 3KOMA 3E81A 2XKBA 4NOMA 4I8DA 3PEVA 5T64A 4X63A 5J5CA 1Z2AA 5AOBA 1U2PA 2BKUA 2R0QC 4MW4A 4IDDA 1PZEA 4MW2A 3L8MA 1A8PA 1NXXA 1V5FA 2XYVA 1VIAA 2VRCD 2F62A 3L2OB 1RJFA 1HE1C 4F6CA 5IUKC 2M6LA 1SKQA 1UBRS 3C41J 4YUVA 1XAHA 4BN5A 3IPAA 1Z4QA 3AVPA 1OWPA 2EZTA 1QP0A 1NJFA 1PJLA 2PT5A 4IDQA 1OAOC 2ZRNA 4E14A 3L4KA 2HV9A 1GCUA 1EGMB 5TGZA 2UXBB 1LQ2A 4D8XA 2BSAA 4QARA 3HKEB 3DEJA 4IIVA 3J81A 3AB3A 3GCZA 3KUCA 2BL4A 5EWMB 1Z62A 3WMXA 1V8FA 2ZE6A 5ALOA 1HL3A 3I9OA 3LRTA 2PRZA 3PDHA 4JXKA 4ZQFA 3UT5A 2VH2A 2PMKA 4QM7A 4OQDA 2NO0A 2OZLA 2ZB7A 3N0VA 1E63A 2WUVA 1UKZA 4J0GA 4JEIA 4XPIA 5JDCC 1B8PA 2X13A 3RRXA 2SNIE 3RV4A 4AJHA 2F1RA 3LBYA 1J8YF 4MZDA 1QIMA 1XCOA 1E2JA 3DYBA 4MAAA 2NO6A 3ZTWA 3AVUA 3C4QA 3ER6A 4C3VA 1X9IA 2CYBA 3K6RA 3BILA 3L6RA 3PDIA 3W6UA 3X1KA 4JQSA 2W00A 5EESA 4W5NA 4IHJF 4G4JA 1ZAYA 3MJDA 1G6OA 4CHTA 5GINE 1FVFA 4QWMA 1M2EA 3ADBA 2E7ZA 4MYDA 2JD2A 2IFTA 5KZMB 3ONFA 4UUNA 4ZMSA 4JYZA 2ID8A 5TPWB 1NULA 3A9TA 3AUKA 3F67A 3QKSB 3DQZA 5JNSA 16PKA 4ZODA 1H3NA 4N54A 4FYKA 4B83A 2F3UA 3HKDB 4NFHA 4KG7A 2IT1A 1ZJ6A 1ZXBA 2HPVA 5AKXA 2OECA 1NLFA 5AM0A 1KEKA 2DT8A 1YDHA 4TT3A 1LPNA 1VDZA 3CF4G 3LL7A 3QVSA 4Y6PA 1ULUA 3E2PA 4X1KA 2W70A 1U8CB 1B2LA 1NHWA 3GL9A 1NVFA 1CFJA 6GPBA 1N6IA 2R6HA 3GROA 3U9LA 2IXAA 2OV3A 3MUOA 1LRJA 1WXFA 2VTBA 1EJBA 2JVIA 3TG2A 1JXOA 2QRUA 1TUIA 1WOYA 5G3YA 3OJWA 1KDVA 2BC9A 4H59A 2D0PB 5P8WA 1FFEA 4QBGB 4O4LB 1UBMS 1E96A 2GKGA 2ZSKA 4KV7A 5JWOA 3ITNA 3RAGA 3OWXA 4PHFA 4E4RA 1BWSA 4MLPA 4QEDA 2D13A 4YI5A 5CG2A 1S01A 2QJFA 2XTMA 1SVSA 3EFOA 3VPFA 3EGEA 3GOHA 4N5MA 5AJTA 1WXDA 2ORED 1NN5A 3FPAA 1NV8A 2MSWA 2V7EA 5BQPA 3RUHA 5KOJB 3E3NA 4Q1BA 4K9LA 1Q7EA 2H1CA 3LRXA 2AN5A 3L4JA 2A5YB 1XCMA 4Q1AA 3VJRA 2X0IA 3L92A 5ES3A 4ZAZA 5IKXA 1Q11A 1LI5A 4LBYA 1TOAA 4F96A 1Q2XA 1DC4A 1DG1G 1ISFA 4I2NA 3WK7A 4R7TA 1IRXA 3KHSA 2VXOA 4JXXA 3EC2A 4QNRA 5E1BA 4BXOA 4J9VA 2NSHA 4CIVA 1M1XB 5AMXA 3WL8A 3Q8XB 4NSNA 1RC1A 5JBQA 4AG6A 2CXOA 3ES9A 2PV0A 3DA8A 2JEZA 2XMZA 1NE2A 4TTJA 1X8XA 3L49A 4NYIR 2JIRA 1L8QA 1QG6A 3L9XA 9GPBA 2NZXA 3B6JA 1BAPA 2F3QA 4M1TA 5A71A 4BYMA 4DY6A 1P62B 3L9WA 1G8MA 1N2GA 1ZRNA 3G7NA 3QUAA 2DCMA 1D04A 2MINA 1JIKA 1S2MA 2KQUA 3HVHA 3BEDA 3MBKA 1PKEA 3PQ8A 4IH9A 4UDOA 5JS6A 1WUIS 4KBFA 1Y8ZA 1ZM3A 1IFXA 2DULA 1SCDA 5J4YA 2VSYA 3E8SA 2WA1A 1SHZA 1SO8A 3BB4A 1JSLA 2BKVA 3NGLA 2BEVA 4ZDWA 5D51S 5DM4A 5F98A 4P31A 1LDGA 2Q3MA 2R68A 2AKAB 4BTEA 2I62A 2I6FA 4D0NA 2A0WA 2GXQA 3A3PA 3C3BA 3R5KA 5CURA 1RMTA 2IEZA 1LPMA 1ZGAA 4L02A 2YW9A 1GQYA 3KQYA 2IGBA 1OV4A 2JEOA 3GG9A 2P3OA 5DNDA 1A8HA 2AE2A 5JAZA 2V6IA 1ENOA 1JEEA 5B36A 1C3OB 1WKVA 1XFDA 2Z09A 1RU3A 2ZYUX 2OOSA 1VHJA 3A6DA 1Y0BA 3A6KA 2BV3A 1PNVA 4V2IA 1KVTA 3WYNA 4AY4A 4YUXA 4PNHA 2HXYA 4LVCA 5JASA 5JNRA 1DXHA 3F3MA 2WI8A 5B6IA 2ZJOA 4DADA 2AX3A 3LQFA 1WULS 3A9CA 3WBJA 4ZHQA 2VJDA 4OFXA 3CONA 1KZ9A 4M9ZA 1WCXA 5U4XA 5JD6A 4OLAA 4FR5A 3UXEA 4MVJE 4N5HX 3WWYA 1ZK2A 2NQ8A 1USWA 3C87A 3MG9A 3MCVA 2OCAA 1KO7A 2I2AA 3UV7A 1F7UA 3K0SA 2XNKA 3FHOA 3NJ4A 3V4VB 4NCAA 3HB1A 1RM5A 4RLHA 2JIZA 1NFQA 1PQUA 4IIBA 1AS2A 2RH9B 2Q7DA 2ZI9A 3AJAA 1G19A 3H6HA 1RLMA 2QJRA 4JUFA 5CDSA 3Q3VA 1CUDA 3ROZA 3C98A 1TCBA 2UYQA 3EQZA 2X15A 1H3EA 4JWKA 4NFLA 4RVOA 4W1QA 5DHTA 5F12A 1XMXA 5J40A 5IJ9B 1XAJA 2GJ8A 3ZGVA 1L1QA 3I9V6 4YCCA 4IMIB 2GARA 2FPPB 2J09A 3K31A 5CHEA 5K3BA 3D5TA 1HDOA 4M60A 4UQPA 4PTLA 3IQDB 3QSGA 4E1VA 1EWKA 4MWSA 5B1IA 1ITZA 2NVUB 4JT8A 2PMCA 4NXNB 2OMEA 4Q9AA 2E21A 2PA0A 2JIDA 1O95D 3G9XA 3GLGE 1WM1A 3DMRA 4F7WA 2HR1A 3K0EA 2ZIAA 1TDJA 3FWZA 1WF3A 3MMPA 4RIGA 3BMCB 5DEIA 1W4LA 4TMKA 1E9FA 3U6BA 4Z4EA 4ARSA 5AUNB 2GKSA 2HA4A 4MVJF 1UUFA 3I04M 4FW9A 3WWOA 4RFVA 2WYWA 4Y6LA 2CEKA 3JPWA 1T36A 4QSMA 2VUHB 2HUNA 3K7EA 4EFKA 1LTHR 1I2DA 1KBZA 1GTZA 4RCZA 3S1SA 2FOIA 3TDNA 2FZKA 4Q1EA 4MAMA 4EI2A 1SPBS 4M88A 3R3YA 3WAKA 3LCRA 1T6XA 3T9BA 3UJAA 3U13A 4F2WA 3DKIA 1AZLA 2FDCA 4BGVA 3GFFA 3D3JA 1G0OA 4KK4A 4DRZA 3HKCB 1T3ZA 3OZUA 2QJWA 2H2WA 1BS9A 4OJQA 3H4IA 3LWNA 4ALJA 5C2JB 4D0LB 3AYZB 5JIBA 3RAEC 4CODB 4X6LA 3BK7A 4GXRA 5AK6A 3JD4A 2D62A 1U94A 1ZRHA 3EUWA 1OAOA 5CVVA 4ENWA 1IE3A 4KXWA 1QYIA 4X94A 3CMMA 1ZH2A 2CLCX 1NJ8A 2ZGVA 1G5IA 2B83A 2NU7A 1J09A 3GJQA 3OBBA 4QUBA 4RZUA 4J2HA 2GPTA 2WP0A 3R5XA 4JJ4A 3VTAA 2C61A 2X2OA 1EGQA 5JNUA 3ROQA 1OOEA 1UK9A 4NDNE 5EC8A 1I32A 3QTBA 2G9QA 1N5OX 2OQIA 3G9TA 4UDNA 3HFRA 3H2BA 2RB5A 2PUDA 1QS0B 2I03A 5IUNC 5JSUA 3B3FA 3FD8A 5JDCA 5LOVF 5JJKA 2FGKA 2W0MA 3UJHA 1RJ9B 3R76A 2Y0DA 4OIFA 4S24A 4B4UA 4RDXA 3GJXC 4FYVA 5JWHA 4AFNA 3ZDQA 3DW1X 1V0JA 4CR6A 1C7JA 5BWBA 3BWEA 2ZRIA 2UDPA 3AVTA 1KAHA 4N0QA 3GEBA 1N5IA 1PDOA 2YRFA 5J4LA 1SXPA 3IP5A 3JPYA 3TS1A 1UPXA 1X1CA 4QBFA 5EE9A 3NBAA 1VI2A 3K1AB 4MOWA 2PFSA 1X2BA 1T1RA 2HB6A 3EWIA 2IE0A 4GOLD 3VC3A 3W2TA 4ZCTA 1B23P 1T43A 3H1BA 3R0XA 1JFFB 1YULA 4PG4A 4RELA 3E18A 3L1HA 3OU6A 2Z9BA 4DM7A 4YJ3F 4Q4CA 4TYYA 3O84A 1JL3A 2BI7A 2NIPA 4XD2A 3S2GA 2D06A 4EBBA 1R1DA 3R77A 1N6KA 1I4TD 2Q8QA 1Z25A 3AUFA 3P0FA 4HATA 3TIXB 3VU0A 1B4DA 3KYIB 3QE9Y 2OXCA 3I37X 3SMQA 2II6A 1Z2EA 4HK4A 1YACA 2O2HA 3OT5A 3MTIA 2G25A 1ZEJA 3BDAA 1SZCA 1MB9A 1C8VB 2OB1A 4O4HA 1NXSA 1MA3A 4P7JA 3GRPA 4QXRA 1NONA 3R3VA 3I23A 4R1OA 1FDTA 4KQHA 4IJMA 4E51A 3OE5A 5JBNA 3ASZA 3VV3A 1HSOA 1F12A 2F1HA 2FWPA 2X41A 4LTDA 3HY6A 3WBKA 4P83A 2DHDA 2NTNA 2I3AA 1QAMA 2RHHA 4B46A 1J2TA 1UANA 1OA1A 3WSTA 2HZBA 1KJZA 2ODNA 5FUMA 3MOIA 4C6SA 1POXA 1GNQA 2P0YA 2PKQO 2YMPA 1X0XA 1OWOA 1VHDA 3GCDA 3QIVA 3QJGA 4OYRA 4AG3A 4EB3A 1A8QA 1N0HA 3T4UA 1Y6RA 2IYRA 1NTRA 2XHEA 1JT9A 4RZHA 1SBNE 2B21A 2P9GA 4CMJA 4D79A 1HQCA 3C3JA 4PNEA 4ZVNA 3WQBA 5JECA 3VVBA 4QOGA 1SC4A 4DLYA 2ZTVA 5FPPA 5E1DA 1FP4A 1U0NA 5JVDB 1AMUA 1JF8A 3F3KA 4B6QA 1GPJA 1R6BX 5KVAA 1JH8A 1WHTA 2WWHA 4RS4A 1IPHA 2G09A 2VP5A 3LKDA 2P77A 2IBSA 4JYMA 1EP3B 3MGKA 5EUQB 5BSKA 3U7EB 3DDZX 3K4PA 4S2EA 2BTQB 1SH7A 4GL2A 3VYVA 3DR5A 1TT5B 5H7XA 1O89A 8LDHA 1G5HA 3GJYA 2YOFA 1RWKA 5DYWA 4ZOLF 3SJCA 2VYNA 3AF1A 3VPCA 2B8TA 3C3MA 4GPAA 1HOXA 2JFXA 1DO0A 3ZV4A 3E1SA 5ALDA 4HDSA 1BS2A 4D0GA 1KARA 4FLFA 2AZMA 1E4EA 3NBYC 1A04A 2PR2A 1VPVA 1SN7A 2VJCA 3AVOA 3H97A 2NU9A 3OPNA 4FUQA 2R62A 4PZDA 5BPFA 4FNMA 2IKSA 2OM2A 3ADOA 1JGTA 2P2SA 4K03A 1JQLB 2E87A 3FDFA 4FNOA 4RK7A 1VL6A 3PX3A 1ECBA 4TTRA 5LVAA 5KKAA 3ZD6A 5IJZA 3PB3A 3JQ7B 3JWIA 3CH6A 5J2TF 4JI6B 5IN5A 1Y82A 2BFDA 1QCYA 3LLUA 3MWEA 4TSKA 1E9DA 2H1VA 2BBOA 2YC4C 2ZT5A 1AXGA 2ZYIA 5K8TA 3CHYA 5I7HA 1A5ZA 1QE3A 4ARIA 1BXRB 4HNHA 2I7TA 2JFFA 4EFNA 1HNWB 1CVIA 1S8NA 1UDAA 2AC2A 3W2IA 1JEYB 1J0DA 3BAFA 3PPXA 4JNCA 2QN6A 4P7GA 2NPFA 2JDID 4X71A 3O8BA 1M10A 3P20A 3SE7A 3A2MA 3OLVA 3WK6A 1QYRA 2XEXA 2ZIWB 2EP7A 2FXVA 2V54A 3AEKB 1H6CA 4JP3A 1NM5C 2NXJA 4WOPA 4D2IA 3HRHA 1VG8A 4TLMB 5LBTA 5INTA 2B99A 2ETXA 4MKHA 4LE1A 1WMEA 1Y5NA 4XYLA 5CDYA 1GKKA 1LNQA 3IUSA 3RG2A 3N86A 2VHEA 3FSEA 1V7PC 3IIEA 5KNBH 3EMBA 2Y1XA 3UJDA 3OD1A 2AA3A 4H0FA 4RANA 5KS2A 4R2WA 1EDEA 4XARA 5I9BA 4FOPA 4UNQA 4E2XA 3GEDA 1KWGA 2FFBA 2ET6A 2XGOA 2H2DA 1KSGA 3RTGA 4H6PA 1FS6A 1M0TA 1OU0A 2I1VB 1E7MA 3B60A 3JWEA 4X61A 3O94A 5FLXA 1E7QA 4Q1VA 2HXSA 3MRSA 3LBAA 1B0ZA 2MSDB 3RADC 3DKVA 1E59A 2OT3B 2B36A 2IYQA 2VDMB 3FHLA 3GPBA 3DKKA 3T4XA 4E7OA 4YJDA 1SKYB 5LXTA 3T3HA 3I9JA 4L85A 5AK4A 2FSVC 4B47A 3K1JA 2NUAA 4YCSA 2BVNA 2VJBA 1YC2A 1SCUA 3DT9A 3WR5A 3ZE8A 1U1DA 3AR4A 1PZXA 3GYGA 3KIPA 3HJFA 1TTQB 3C8DA 1KMHA 1AX9A 2DBVO 3FMVA 4IQ0A 1PVDA 5LPNA 4X6YA 1PQ4A 2QUKA 1E5DA 2VDWB 3A1WA 4Z7NB 4X24A 1ZINA 1F9AA 2GVZC 2QMEA 2ZT6A 3KJEA 1IYZA 4LC0A 4EHKA 3V46A 5HRAA 5JQGA 4FYJA 2JLYA 1IQRA 1ECLA 1YE8A 1FB5A 1TZBA 1XHEA 1DAIA 1DVRA 2VKTA 3E27A 4G5SA 4L57A 2ZG6A 5CIWA 2DJ5A 2XVYA 3TI9A 5DKFA 3W1WA 1BYIA 5D5HA 4F91B 3ABIA 4WTOA 4LY3A 3B6IA 2MCFA 5IH3A 3V4OA 3UHPA 1TAGA 1P75A 1TA0A 3ECSA 2YWHA 4B80A 2PRIA 4I66A 3PHIA 4I8IA 1JSRA 3EA5A 2EIXA 5HF5A 1T2EA 4TWAA 3RVBA 3IO5A 3PFWO 3PXAA 1I7SB 3EG9A 4IKEA 1PWZA 5T6MA 1I6MA 3VH4A 3QEAZ 3S7TA 5CT6A 4D3SA 3GT4A 3FXAA 2C3YA 3JQBC 2WIBA 4YJHA 4DCUA 5K6AC 2OORC 4DR4B 2JJYA 1BMFA 3UT0A 4BWYA 1UDWA 3A1EA 1FFGA 1NIPA 2FW9A 3RVQA 3LTNC 2PMFA 1HM5A 4H4CA 2IIBA 1Y3CE 1Z0AA 3IBSA 4MLDA 3CLHA 3AL3A 2RJ3A 4Z7QB 3ORQA 5AUPB 5K3OA 1FDVA 4D45A 4JOCA 4JR0A 1KQPA 1PSWA 2C0PA 2CNOA 1UXHA 1NVAA 3DZBA 3GJ3A 1GPH1 1OTXA 3L4BA 5EE3A 1K2WA 4EY5A 4DV6B 3LKVA 4L74A 2F8SA 1NHGA 3GZNB 3OEHD 2QUIA 2V8OA 4GNKA 5K4HA 1D2CA 3BORA 3P8ZA 1KO1A 3RUAA 1E6UA 4BFWA 2EF0A 2XCQA 4AJIA 3L7OA 1VSBA 4ME6A 4BZZA 4K3VA 4QYIA 3RUCA 4G86A 5AI9A 4PPQA 1M76A 3ENVA 3PC2A 3PX7A 1JVNA 3I9V1 3R0ZA 2CJFA 4KFRA 4BEVA 4RTOA 2IDZA 2Y0PA 3V1LA 2ERYA 4YCMA 5K0FA 1JNYA 1M5RA 4ESHA 4CDGA 1KAGA 1RRGA 2PUWA 2P6UA 3LC2O 3HXOA 2K6GA 4QELA 5CJPA 1TVKA 3VR4D 4ZPXA 1ICIA 2OFWA 5DHFA 4PCAA 1MC1A 2C5LA 4OLBA 2NUTB 3ESRA 2AFIA 1EB8A 3M81A 4OYHA 4QRDA 5ECDA 3SXJA 3NWJA 4HWKA 1CPYA 2O4CA 2ISQA 2YFKA 1P9NA 3D64A 3O3CA 5SZIA 1VM6A 3GIDA 4ZVLA 3MB5A 4WXEA 2IODA 3VJKA 2P4QA 4U8GA 2BGWA 3K5WA 3C43A 5LLDA 1A2KC 2XECA 1Q0RA 1Z26A 2I67A 2RHWA 5EQDA 4UUPA 4D74A 1JECA 3QU2A 4AICA 3HA2A 3RVJA 1EZ4A 5FUXA 3HVKA 2AOVA 2X0KA 4XOIA 4CCYB 1PT6A 1TAHA 2GAOA 5IJWA 1ISMA 1E79D 3UG7A 1E8NA 5K0CA 1VPEA 4ND5A 4ZRNA 2OCBA 2VSFA 1LJ8A 2WT4A 1HTWA 5JBIA 2B8EA 3CRZA 1AGPA 2YXEA 1KNXA 4A36A 2AK2A 2M9MA 3OBIA 3QWFA 5AW2A 5B58T 3GLFB 1QFJA 3I9NA 2AE1A 4IDGA 2ZKLA 1NUHA 2JIQA 5BR7A 2NO1A 5C81A 2P8SA 5EHGA 2P2YA 5LP6B 4US2R 1A96A 4RHUA 2WKPA 3QVGB 2X0EA 1H22A 2PH5A 2V7VA 3G2MA 4LC9A 3ILXA 4EW6A 4KGZA 1J8MF 1M5UA 1TEXA 5ED0A 4UD6A 3GZTB 4FDTA 1DU4A 1VIVA 1JQ3A 3TD6A 2G0AA 4MARA 2OBNA 1BJTA 1DRWA 2P2DA 3K2EA 3BCUA 2YMLA 1PJBA 5JHGB 1RE0A 4IDOA 4NCXA 2C9MA 3OLYA 3FGPA 5HE8A 2EP8A 3WGYA 5CITA 4ZO8A 1GTSA 3LO5A 3QWHA 4GAEA 1YV9A 1MB2A 3AILA 2Z6UA 3FLBA 1LNZA 3W7VA 1MVLA 4DR6B 1LPSA 4NYMQ 4KZKA 4TOIA 3OZGA 1DLIA 3K4QA 2BFBB 2PS3A 3T9FA 4ZICA 2QD5A 2GSWA 4A6DA 4P5EA 3V2HA 2IHKA 2R8YA 3AEUB 2OYSA 2BPOA 2AFHA 1F5NA 3CR7A 4F71A 2CFRA 3VR2A 3FPJA 1ZWLA 4JI1B 4X5OA 1WCWA 2I87A 1KJNA 3FCXA 3FTPA 3L8ZA 1X77A 1E18A 1W30A 2GBLC 3TRFA 1EUCB 3MCWA 3WDSA 2IH5A 2BTOA 4BV3A 3H05A 4ALMA 3QXHA 3QXSA 3ID6C 5A7GA 3M4YA 4QX6A 3EZFA 4QVKA 1XFAA 4ZAWA 4Y8VA 3P9IA 2CVHA 1YDGA 2HHCA 4GG1A 1PO7A 4PS1A 4UBJA 2CMFA 2VNAA 3I4LA 3ET5A 1B16A 3W2EA 3H3FA 5FNZA 1TF5A 4N5NA 3SBEA 4RCYA 3DFZA 4ZOBA 3WZLA 1NLUA 2ZUEA 1D07A 2J8ZA 2PCLA 2O57A 3EW7A 4GIBA 2VTDA 1DAOA 1WVGA 3G68A 3P94A 4PYRA 4QATA 1CULC 1GN8A 2ZSHA 3A4LA 4URFA 1Y34E 2POCA 5H59A 3U40A 1WVIA 1GAXA 3I2KA 2PKEA 4CM9D 4RKQA 4Q9KA 1KDRA 4MRMB 3VPBA 2ZJFA 5T3YA 2IPAB 3AWDA 4X62B 4C5AA 2BBSA 5JAHA 3ESAA 4G89A 3T7CA 5A4JA 1FRZA 4JBGA 4OQFA 5GONF 5HG0A 1MB3A 2A5JA 2WUEA 2W6NA 4J0CA 2A14A 3CBGA 5DYGA 1DBQA 1TCCA 3GVPA 2X6QA 3PF8A 4I4TF 5KTKA 1FFYA 2C4MA 4G09A 1MC8A 4BVEA 5E6RB 5A6SB 5JNTA 1P4SA 2IXGA 2PRJA 1LW6E 1CUBA 2YJ5A 3DO6A 4O4IF 4KE9A 4AJ4A 4BVJA 4EPYA 4Z4FA 2CMHA 3L1VA 3TO5A 1Z38A 2ZIEA 4FFOA 1GP2A 4CEIA 1OYVA 3LDGA 3OG9A 3SCZA 4V1CB 4QQKA 3X44A 1I2AA 1FJHA 1SUIA 2WDZA 4X00A 4R1MA 1XDWA 1QLWA 4KB5A 2BM1A 3AJDA 3DZ8A 5E7JA 3NW9A 4DA9A 1G66A 4O1MA 4DCTA 2V9PA 3KFLA 4H60A 2OV4A 2FUKA 2H48A 2IHUA 3ZPXA 4EJ0A 5C4IA 5E38A 4KODA 5BRNA 5A9TA 1H9BA 5CFLA 2ZREA 4X8LA 2P9FA 2X2EA 4K2HA 2JI8A 5CVDA 4AZ3A 4ZVUA 2DWCA 1AS3A 3U4DA 3VGPA 5ELLA 3DFIA 1G0NA 3R40A 4IO1A 5DLDA 3VOBA 2BLNA 3SJ7A 3SM9A 1KRWA 5JS1A 3ODGA 3NYQA 3TQCA 4BP8A 1A82A 3CURA 1J5XA 4GGPA 3Q7TA 5DPMA 1OXTA 2B7CA 2GZAA 4TS3A 3D0QA 4KKXB 2DUWA 2JLAA 4Z9YA 3WYBA 421PA 4F45A 3AK4A 5EAIA 5BYKA 4Y6OA 4MVXA 2FU5C 2PH3A 1JLKA 1XQXA 3IPLA 4NJEB 1IBKB 1YUMA 5LR6A 2FSVA 3AF4A 5ALIA 1X1EA 1ZS9A 2WHPB 2YFHA 3LCCA 2BFEB 1NBEA 3NHRA 2HMVA 4B2IA 1HLDA 1XVVA 2EQ5A 3ANMA 4INJA 2Y1WA 1C80A 1NVGA 1UKVY 4JVOA 1TC2A 3O5AA 2P1RA 1LDBA 1NI4A 1I3MA 3AFGA 4H7PA 4JBHA 3IBGA 3F4BA 1P2DA 2WJZB 1ST3A 4L2IB 4AC9A 2AIRA 1G20A 4G5YA 3TRJA 4ASUA 1T9KA 2WT8A 1LY1A 5FPQA 4RA9A 2ZSEA 1GNVA 1M6EX 5TC4A 4E07A 1Y6GA 1T2UA 3HN6A 5BRAA 1DG3A 3LT2A 4WIAA 1VLQA 1RC0A 1IM8A 2HBYA 4LXHA 3G9QA 1O94C 1UBGA 4LECA 1RTTA 1FX1A 2XNJA 1UWCA 3KB1A 3RVKA 1SUSA 2IZZA 1H2ZA 3QXCA 2R79A 5JH7A 4LTNA 3UMRA 5HDBB 1PNTA 1B1CA 1YO6A 2HQSA 1GPBA 2VJNA 2VF7A 3AQIA 2HC9A 3I3OA 3NFRA 3BMOA 3NWPA 4FEEA 1CQXA 4R9NA 5D8DA 2A35A 3TR5A 3VHXB 4JBLA 4BMDA 5JUWA 3JQBA 4WHMA 5B1HA 1P7WA 4IQ4A 1N2CB 2ZQZA 3GPCA 3TGPA 5JNVA 3JQDA 3A9WA 4WZBB 2PS9A 4O2BB 1QLHA 1JFTA 1EP1B 2WE8A 1L7QA 3HLTA 2J6BA 5B7NA 3EIQA 3A3YA 1PYDA 3B89A 2E37A 3BWDD 1V5GA 4O4JF 4W7HA 3ZVNA 2GTPA 1N1DA 4LQ4A 4RHTA 3BDVA 1L4YA 1XKXA 1PGJA 2VT2A 1Y1RA 3E03A 2BCEA 1T2DA 2HFJA 3DO5A 4Q9HA 4ALKA 3E84A 1FU4A 1S3SA 1RJWA 5ESRA 3UGKA 1TZKA 2NZ8A 4MTCA 3CW2A 2HNAA 3OQHA 2Y1OA 4HEQA 1HE4A 1CS0A 4ND4A 4WXPA 3AXTA 4JBNA 1XNHA 5B2EA 1JJVA 2WTXA 2AL7A 1RRVA 2NUPB 4YA6A 4B5LA 1GAWA 1Z45A 2QMHA 2REQB 3G8YA 5F35A 3MWYW 1EX6A 1JQJC 1MVNA 4RIHA 1JRLA 3C1OA 4KDFA 4I6EA 4I1VA 4LGMA 5AKJA 4E5PA 3UO8B 4RK6A 4ENTA 4OOEA 1I5EA 3N05A 2XVMA 3E9CA 1PLKA 4KQGA 3AIIA 3GEHA 3OE4A 3P97A 2OFFA 1XPJA 5AD1A 4TS1A 2AXPA 2WY2D 4KQKA 3NOOA 1SZJG 2FUG6 2QPTA 4YAEA 4EUKA 1QB7A 5KINB 1CUYA 3TK1A 1V41E 1ZOSA 1DC5A 4OMUA 3PRJA 1OXMA 2OGWA 1XJ0A 1YQQA 1QH8A 1C9NA 1M6NA 1XCJA 2VWHA 2WWXA 3IP3A 4JJ8A 4NG5A 3JAWB 4KR9A 1MH1A 3R74A 2CVQA 2NPOA 2YHIB 3TKYA 4CKCA 1FFSA 2J3QA 3RR2A 4C1NA 1MLDA 1VLZA 2WD7A 4XEUA 4CHGA 4E46A 5AR1A 3T8YA 4TTSA 1XR3A 3KQPA 3B8HA 4JUIA 4L9SA 4Z0TA 3OVMA 4BGDA 7YASA 1KMNA 4GEGA 1E9CA 4LDRA 3MC1A 4MWOA 4PX9A 2RD2A 4GBED 3NIWA 4Y6RA 2YBEA 3CINA 2W43A 1G2OA 3RRNA 4EPVA 7ABPA 5AW7A 1RKUA 1X7YA 2OAEA 3HN2A 2ZAGA 2O3SA 3AIKA 3IS3A 1EM8A 1R0LA 1YFZA 3BD7A 1PNRA 1E1NA 1P18A 1SOUA 3O8LA 4LBZA 3UMFA 2A0FA 1Q7RA 4Q7QA 5BQOA 5LB2A 5KDDA 1VKOA 2ZQYA 1X87A 3UYLA 1NW9B 1U0HC 5C8YB 2RIRA 1YQUA 3RVNA 1IPFA 2IC5A 5K3DA 1LV7A 1VXOA 4QPDA 1Q44A 1WWKA 4HNSA 4CLOB 2RGCA 5KIAA 1TUBB 2IV2X 4CLHA 4F8EA 2C07A 1GGVA 4LHYA 4W6ZA 4HH0A 2J9YB 1XB2A 3FRHA 2E6KA 4FZ3A 1AD2A 1AKTA 2V5VA 5J1TB 3KVRA 3TRDA 2VPXA 2BY4A 4TV9A 4PN7A 5CFMA 1MGPA 2YVAA 3SEFA 4NCJA 5FEMA 1LX7A 1G8HA 2QN3A 1K0UA 1VBKA 3CYFA 2R1VB 5CU7A 2NZYA 3OC0A 1MHPA 4IEFB 2I6TA 1UWLA 2WLSA 1CJTC 2YHBA 4TM8A 3TB6A 3F1KA 3NNSA 5CA0A 3FCEA 3I4FA 3RVRA 3A9VA 3OEYA 3FNFA 4OH7A 4JEHA 3QFFA 4A2CA 5JMOA 1V6AA 4CLRA 3IAHA 4ZCRA 2OCYC 3EXFB 2FKAA 1GVHA 3ZHRA 2ATXA 1A50B 2Q9CA 4P5PA 4JLWA 4C3ZA 1UK6A 4C7KA 3OQBA 4TLBA 1O96A 5EPOA 2RB4A 3HCWA 1CYDA 3TG8A 1NW8A 2D8AA 2ZPAA 2GBLA 2F8TA 2QNBA 3JZMA 3ZQUA 3GCXA 3AGPA 3BMQA 4XTRA 2MSEB 5B7PA 2IP1A 4B3CA 4CIDA 5I45A 4N7BA 4CF3A 2PUAA 2DP4E 5CJ2A 1D2AA 4GVLA 3VU3A 2YXDA 4IZOA 3BRQA 4REQA 4ND3A 5HNKA 2GM9A 1Z2CA 3PV0A 1BEUB 1Z8HA 4J8PA 4ESEA 1B76A 2XMDA 4CMKA 4IIYA 2BHRA 3F4KA 4HLNA 4JSYA 3K6SB 4QXMA 4UUBA 1JJAA 1TQ8A 4HQLA 1I7QB 2ZS7A 2VQ6A 4LYGA 4JFRA 1MJNA 3R5JA 1G1AA 3NEPX 3OOSA 2W6OA 2P9ZA 4IJ5A 4M6WB 4F4CA 4DUGD 3W2FA 1IY8A 5C5CA 4YJKA 1GRQA 3UXHA 2XXAB 3D2BA 2IQIA 2R66A 2A9RA 2G77B 3TQRA 2HJGA 4BFLA 1FL9A 4CMGA 4CIAA 1A97A 3LSTA 2VUSA 2B9VA 2GPWA 1RHQA 4BMPB 3NEAA 4ZIRA 5LSAA 4MDYA 3AF6A 3E7XA 2XCIA 1OKKA 2QN1A 4HRXA 3N75A 2ZRHA 4RH3A 1ZVQA 2FZCA 4A10A 5KNCH 2C5AA 5E9QA 1N1EA 4M86A 3A4NA 4MV3A 1IBSA 5DN9A 3PNBA 1PCXA 3T0GA 4DQLA 1N8KA 4MULA 1Y8QB 4EB6A 3GHYA 2IEGA 4YGXB 2I5PO 4CF6A 4E4YA 3O4JA 5JO0A 2NVOA 3OY7A 4L72A 5ITSA 3PJRA 2I91A 4EG3A 3BQMB 3HADA 4RESA 4W8GA 3L84A 2Q3EA 2R6AA 1S2LA 4HOYA 4I1SA 4XB1A 1UXIA 4XE5A 8MHTA 3TZEA 1T34A 2R60A 3Q7RA 4HX9A 1Y4DE 4OK6A 1PG0A 3IXLA 5CAEB 1K08A 1P6QA 4HGQA 1W94A 3EEFA 3NUZA 5LQNA 1DXQA 1QGZA 3RFVA 1RZRD 1CP3A 3IPRA 4M0CA 1HOTA 1WY5A 4Y6SA 1T5HX 2JGEA 4ZT2A 3TZQA 2H7VA 1NAHA 3JVUA 4TZ0A 4FZJA 4QUIA 1HG1A 3LLMA 4XLZA 1S1MA 3PFBA 1D5CA 3JALA 4UXHA 1X3SA 2DR2A 1FFWA 1ZM4A 2HA0A 1D5WA 1CEYA 4HN9A 3PFHA 2C8JA 2B3TA 3C4VA 3CEPB 4GMGA 4IFEA 4ZZ2A 4GZ5A 1IN5A 1XL1A 4J1TC 5BW6B 1B73A 1QZXA 1TIBA 3ZZ0A 5HP4A 4R54A 3EIOA 3IE1A 1T8UA 1JHPA 4HTFB 2FRXA 4ZZ3A 1DQYA 1G41A 3AVYA 4UQLA 1AKVA 1GUYA 3GCWA 4IR7A 1LI7A 1NXQA 2HWKA 4FFBB 3I32A 1CE8B 2G9VA 1QHEA 3OQIA 4OHMA 1NVDA 1QHHA 1RWWA 1AM4D 5EZYA 3ZLJA 1UMBA 2EKLA 4MRAA 2FQYA 4XB2A 3I2YX 2WM2A 4GUDA 1ZH0A 2JAQA 5FRDA 3DKRA 4N3AA 5KYKA 3ZCUA 1O94A 3U49A 4QODA 2O19A 4AJ9A 3OTWA 1XXHA 2E3JA 4G6ZA 1L6IA 5AI6A 1U3GA 3GEMA 2ZWMA 2LW7A 4L5YA 4NV3A 1ZDMA 5ECYA 1DC6A 4O6VA 4YR9A 3H1AA 3K0BA 4OF4A 3DL0A 2G0TA 3MYRA 4GRDA 4LOJA 2C94A 3G7SA 2FG5A 4IIDA 4WLNA 1J9ZA 3ILYA 3TPFA 2J3DA 4IWYA 5DASA 3DDWA 3KUXA 4KSCA 3ISJA 1GKIA 5CNMA 3MXOA 3JCZA 5HKKD 3MRXA 2PT6A 4G2TA 4N65A 3PIDA 2FWRA 1CG6A 3ZCQA 3FLMA 2IELA 4Q02A 1M2VB 4WJLA 1H6AA 4NIMA 3VC7A 1KTVA 1K7YA 3RSGA 2DMRA 5DO9A 1MV5A 2I4LA 3F78A 2QSYA 4KQEA 5CM8B 2IHTA 4Q48A 4XZ3A 2GZHA 1TJ4A 2JH8A 5CIYA 3P0IA 1J0XO 5HK8A 3WGGA 1SKUA 3LVFO 1DT3A 5DGTA 1HORA 4D4JA 4RYLA 1DAKA 1H93A 1W0JD 3BE6A 1B0AA 1DC7A 1MP0A 2CF5A 3FGOA 2F4NA 2BMDA 4I5FA 4N8SA 4YT8A 5FR1A 3GPLA 3KQSA 4M0FA 3H2GA 4POAA 5B4UA 4JCCA 5FV7A 4YMSA 4FEGA 2WJ6A 3MWDA 5BNZA 5JSQA 1CQJB 2R1TB 1NMQA 3O82A 3DKPA 4Q9DA 5BN4A 2X0NA 4KDCA 3RFTA 1JTVA 1XZLA 2XMRA 1ZK1A 3ROFA 3JYNA 1J0EA 1FFBA 2ZTUA 1GEGA 3G5UA 3NT5A 4UM8B 4F06A 2FPWA 3M3DA 2Z8YA 4JDUA 4ZOCA 1Z0UA 1HSZA 2PUHA 1DQRA 1K8YB 2P0AA 3AI3A 3ZGXA 2ZUBA 2FI1A 1V8PA 3TKLA 3D3KA 3IQGX 3M5CA 3NFYA 3OX4A 5EWLB 2CHGA 5KYYA 3L7KA 4IQFA 1JAZA 5J4KA 2I4NA 2BMVA 3HHPA 2VOEA 4CXMA 3OE7A 4D8TA 3CF0A 1RQ7A 1X1TA 1Z37A 3PXCX 1GD1O 1ODJA 1Q17A 1FFXA 4IICA 1DOAA 1TMGE 3X3HA 1QSGA 1Y3HA 2Y2UA 3IT1A 4RZ2A 2PTHA 4LOIA 4OXIA 1Z5UA 5JFGA 2RAPA 5L4LA 1JMVA 1KVUA 3GFVA 1ATZA 1A7KA 2H85A 4FDUA 3S0JA 5HZKA 1AMNA 1V3QE 4K9SA 1XTPA 2QLJA 1G55A 3GA0A 1OILA 2A4KA 2RK4A 2EIHA 3N2NA 2BCJQ 2WJJA 4HD8A 1C9JA 5JE8A 1VPDA 2GETA 1MT3A 2WZQA 3DZJA 2XWJI 1R6DA 1B0PA 3D6AA 4J1NA 4RE6A 4NBRA 4KN8A 3HKEA 4G37A 4MYUA 1GZUA 4MV6A 4ZT7A 1UKEA 4EM6A 1EKXA 5IAOA 1RI4A 4EGSA 2EV9A 3PE6A 3T5BA 4L5AA 1A69A 3GJRA 3T9CA 5IDQA 2PT7A 4MS3B 1RI5A 2E4AA 1N6NA 3GH3A 5EKUA 5A7HA 1RYHA 2NM0A 4B73A 3MRVA 5KYWB 1T3TA 1N2IA 3V34A 3CNHA 4P80A 3QGMA 1CUXA 2FUG1 2EKBA 4OBBA 4OH1A 4WGGA 2AMJA 3SIXA 1A5TA 4EHDA 1UDBA 1I7LA 5JCJD 1KZHA 1GFSA 3KUUA 5CXXA 3L6OO 2DQZA 5AVWA 4B3SB 3AEQB 3K1YA 5B1SA 3UXMA 4COOA 4QDZA 1T2CA 3S81A 2Y0CA 1Q12A 3FPLA 1ZESA 5EGNA 3SZLA 2OUIA 3N3BC 1KC1A 2B8WA 2IDMA 2KSQA 4X8OA 5AM5A 2Q27A 3NR2A 5TVKA 4OHZA 2BH2A 2CB9A 3QE4A 4G5HA 4HVTA 2XYPA 1IWPB 5TPWA 3HP1A 1N3BA 1LK5A 3AZQA 3QKSA 4H1TA 5LQDA 4PLPA 3QLEA 4LWOA 1WS6A 3IUYA 1YRWA 2J33A 1PD0A 1J99A 2WRZA 3HKDA 1FTWA 3KYDB 5HGJA 2Q5IA 2O3QA 2QGFA 3DXZA 3EVNA 4HQNA 4P2BA 3ZDXB 4TN1A 2IYAA 5CMLA 3VBCA 1AKUA 2ATCA 4JEMA 4BOYA 1TW2A 2QD2A 1RADA 2X6RA 4AXXA 1JBQA 2REOA 3D59A 3LWBA 4N6NA 1VCOA 3AU8A 4R2IA 3TW8B 5TSDA 2HLDA 2JAUA 3U44B 1P3DA 4QQNA 2YV1A 2CMGA 3H9EO 3LLCA 4ITVA 1YE3A 2HRDA 3T5AA 2X8AA 3I39X 2BCGY 3N8GA 2ZRJA 2EG5A 3O2JA 4KFTA 3WB2A 3BOSA 1P1IA 3MAJA 4Q6BA 5JG7A 4BWVA 4Q12A 4HFJA 2PVSA 4O4LA 1IJEA 1U8ZA 3NVDA 2RK3A 3ZCTA 4QO8A 1D0IA 2Q1TA 3U9SA 2GESA 1UPTA 1AN9A 4UCWA 1CERA 1XEAA 3RVDA 1JHRA 1CZRA 3EXIB 3MWJA 4AJLA 2OZKA 4Z4GA 4C0LA 2VRCA 2OCPA 4IOJA 2Z4TA 4NJMB 4OI0A 1Q0UA 3MTAA 3K71B 1YJBA 2VH5R 5IWAB 1TPYA 2ZXUA 1PSDA 4NS1A 2FMXA 1USVA 3AC0A 3K16A 2EJBA 1CY0A 2V6GA 3RSCA 2XWPA 1VJGA 2NV0A 3IC5A 4HWGA 3L8EA 3G2KA 1ETHA 4Y9TA 1E60A 4FJ1A 5DYTA 4PGHA 1KQNA 1QFXA 3GZ4A 3X1JA 4UCQA 2PN1A 2V4ZA 5EEGA 4X7RA 3UYKA 1GAEO 4TWJA 3M3PA 5BY2A 4BIIA 3L06A 3QKIA 5H68A 4BHTA 2Q6KA 1UL1X 3MINB 5JAUA 1MX1A 1W1UA 4RL4A 5ISMA 2O0HA 4RNDB 3AKEA 2O7QA 4ZAGA 3DVLA 3AVVA 1KDZA 1UIRA 2AYZA 2C98A 1HE5A 1W581 1E0AA 4BVGA 4ZCSA 3WK9A 4R84A 3RRMA 4UULA 3HXTA 4KJZA 5B1DA 5EJEA 3FPGA 3O8RA 4RKWA 2CXHA 2I8CA 2YZNA 5G1PA 2XBMA 1D4AA 2WU0A 4PC2A 2CV2A 2QZ9A 4NBVA 1OHHD 1AKRA 4OGKA 3T9DA 3ELYA 4J16C 1OH5A 3AM1A 1Z73A 3LZ6A 2I6XA 4IZIA 3HV2A 1SNYA 1U9CA 4IGKA 1F4VA 1QQ6A 4J1TA 4MINA 5FYQA 2PM8A 4DCSA 2SCUB 4HDMA 2Z2JA 2VHCA 2HV8A 4YVFA 4F9EA 4OYYA 2O8FA 1JU3A 1ADBA 2GQ0A 3GGPA 4XD7D 4HFRA 1P3JA 3ETGA 1PT7A 1RXUA 4QO7A 3L18A 4C4YA 1Z5ZA 3LY8A 5JT1A 2FMIA 2ZM6B 2DHRA 2IGTA 1F14A 5I7VA 1VYHA 3EE6A 4GM0A 4MVJM 3V7FA 1YRHA 2P6PA 1REQB 1K3FA 2EX4A 4NH0A 1NLZA 2ZRAA 3ORFA 1EFRD 1BDBA 1PKXA 3OFVA 2B0CA 4HUQB 4Q3NA 4ZP1A 1Y1TA 2FB9A 4EGCB 2QTZA 2YWEA 4G24A 2P91A 2WU3A 3SSAA 2QL9A 4DC0A 3N1UA 4XWOA 5EMMA 1JQBA 2RARA 4QULA 4RPHA 1ULBA 3ELWA 3TYXA 1JHDA 5KNDH 5JSYA 3FOFC 2HW8A 1CLEA 2F64A 4YYEA 5KQGA 3UUFA 2VPZA 4IIHA 4RAOA 1K6XA 2IIVA 2OA0A 221PA 1COWA 3GT7A 4MQEB 4Z1MD 3QJYA 3W2HA 4ZWNA 2EW1A 1O0BA 1PUJA 4Y2RA 4ND7A 1YDMA 4DEXA 3H19A 3KR0A 4HI0E 4D82A 4E6PA 1YCDA 4YAIA 1E7SA 1NRJB 3R0QA 1EMDA 1XJWA 3K0HA 4EUNA 5A1JA 2GCPA 3H84A 4YHHB 1KKMA 2GF0A 1S89A 3EGXB 1N32B 4BBJA 2I3ZA 4A5SA 5C52B 2C2XA 3NHBA 1SUFA 2ZI4A 3L5OA 2H9IA 4MUYA 4B2LA 5FBWB 3CLSD 1DOZA 3QKUA 5I8PA 4G5QA 4PZLA 2CDBA 5IJ9A 3ASUA 1GITA 4DYHA 3WP1B 5L4NA 2VAXA 4XCVA 1HKHA 3OF5A 4Q21A 2WJIA 5EMJA 1E3QA 2APJA 3P0JA 2FPPA 1ZVJA 1Q0ZA 5LM3A 3HEMA 1HRKA 4HNGA 4MX8A 3TLKA 1D2MA 2YYYA 1ZNYA 2YRWA 3GDWA 4IDBA 4ZYWA 2NVUA 1YUNA 3V4FA 2VS1A 2FEWB 2BLLA 2X0RA 5EWJB 1S1CA 4JR2A 1XEWY 2ZWAA 4HXGA 3LU1A 1EWQA 1JEOA 3WNZA 1QF9A 3COVA 3F9CA 1IHXA 3KQLA 3I01A