2AZXA

Charged and uncharged trnas adopt distinct conformations when complexed with human tryptophanyl-trna synthetase
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
387
structure length
387
Chain Sequence
EDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYGDAVENAKDIIACGFDINKTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKMSASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two conformations of a crystalline human tRNA synthetase-tRNA complex: implications for protein synthesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/rna
molecule keywords 72-MER
total genus 133
structure length 387
sequence length 387
chains with identical sequence B
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2005-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00458 WHEP-TRS WHEP-TRS domain
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 2azxA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2azxA01
4WNYA 3QTTA 1J1ZA 3GMIA 2CYAA 3CR8A 1GTSA 3CA8A 3ZJTA 2E0IA 2A4MA 4CDNA 2JA2A 1SURA 1EFVB 2ZP1A 2XRZA 1G8FA 1KP2A 1OBCA 1JILA 1JIKA 1YIDA 1PG2A 4FZJA 2J09A 4ZT4A 1TYBE 3NBAA 1Q77A 2OV4A 4XFDA 3H05A 4U7JA 3ND7A 3KT6A 1O6BA 4KKVA 4YP7A 3RK0A 1WKBA 5F23A 1T9GS 3MLBA 1GAXA 3TZLA 3FI0A 3L92A 3QTBA 1KQPA 2I1LA 1NUTA 3KT8A 1N75A 4PY2A 2BTEA 2Z08A 5DK4A 5KHAA 1EFPA 1WXHA 1JEDA 4MUHA 2ZUFA 1COZA 1EUQA 2QJFA 2VXOA 4OJMX 3FG9A 1K4KA 1XNGA 3H9BA 1H3FA 3AIIA 2EL7A 1DNPA 2BYTA 1OD6A 3JXEA 2DERA 4CQNA 1P7PA 1GZUA 1MJHA 1M8JA 1V8FA 2QUIA 3OTWA 3IMEA 1N2EA 4G5YA 4MW2A 2C5SA 1U3DA 1FYDA 1IFXA 3I05A 5EKDA 5FO0A 3SEQA 4ND6A 2TS1A 1N2JA 1QRTA 2X0KA 3IVCA 5TGTA 2CSXA 1Y42X 1GN8A 1U7DA 2PXHA 2XRYA 3SYTA 3ZJVA 3CLRC 1QTQA 4I6EA 4MAFA 2IP1A 4P2BA 4MUKA 4NZPA 5K0TA 1VBKA 4QRDA 4OUDB 3G5AA 3H97A 2A1TS 3TQOA 1O97C 1O5TA 5TS2A 1JIJA 3DLAA 1LW7A 1MB2A 1T9GR 3CLSD 5HUHA 1CT9A 1NUPA 3ZGZA 3AFHA 1A8HA 3FIUA 1YULA 1TQ8A 3CLRD 2A1TR 1O0BA 3BL5A 1K4MA 3KFLA 5J5AA 4ZCQA 1NP7A 2X1MA 2IJGX 5IHXA 4H3SA 4ND7A 4MW1A 3UMVA 3A2KA 4L2IA 1TEZA 1IQUA 1QQTA 1U0BB 1M8PA 3CVUA 1T6ZA 2AKEA 2GM3A 1M8GA 2QTMA 2DR2A 2A84A 4EG3A 1ZJWA 2CV1A 2DETA 2CYCA 4J75A 3H99A 4ZCPA 4JXXA 1ZH0A 4L2IB 1Q15A 4R2LA 1JGTA 3IMGA 2QUJA 1KQOA 5LM3A 2JAXA 1ILEA 1JHDA 4DJAA 2QUKA 5AHWA 3LCJA 2E89A 4EG6A 4MLPA 4U8HA 3U1VA 3SDBA 2DPLA 3A05A 1U3CA 3IOEA 4K03A 1JZQA 1R6TA 1YI8A 3M5WA 1N77A 3VRHA 1QNFA 1O95C 4MW4A 1LI5A 4OUDA 2PIDA 2D13A 1TYAE 2E21A 3IVGA 2RE8A 1ZUNA 3AKZA 5HUJA 1QU3A 4DLPA 1MOPA 3N05A 3IVXA 3LE8A 1N2OA 4RUKA 1N2GA 3Q10A 1WY5A 3AL0C 4EF6A 4EG1A 3COVA 4PBRA 4MUEA 1OWOA 2CYBA 1JEEA 3Q12A 3KT3A 4KR9A 3COYA 3HMQA 4MULA 1GLNA 1WQ3A 4NX2A 1O94D 1OWMA 1J70A 5J59A 4QREA 2HGZA 3IUEA 2QUHA 4RPIA 4Q16A 1JZSA 4NAHA 1KAMA 3PRHA 1NURA 4G6ZA 4MWEA 3A04A 1X6VA 1NI5A 4E1AA 1EUYA 4XFJA 3ZIUA 1KP3A 5TEWA 1MRZA 1N2HA 1T6YA 3CVVA 2X1LA 3ND5A 2PFSA 3HGMA 1U7XA 3MUEA 4QBTA 2CV2A 3AG6A 2YWCA 2YWBA 4YBRA 5H7XA 2D54A 3QE4A 4ZT6A 4ZCSA 3E27A 4HJRA 3CLUC 2Z3VA 4HK4A 4DDMA 2QTRA 3PNVA 4DNXA 4R0NA 1O0CA 2HMAA 4A91A 1I6MA 4DE5A 3ZJUA 1V47A 3IH5A 1NYLA 1O97D 1KR2A 1IHOA 3RK1A 3COWA 4JZYA 4EG8A 1O94C 1F9AA 2RD2A 3CVYA 2CT8A 1WZ2A 3TNJA 2V0CA 3CLTD 4MVYA 3UOWA 1OBHA 4MUGA 2A88A 3PNBA 3RHSA 3D6UA 5IJXA 2PZBA 3DPIA 5TEVA 4PBSA 2PZAA 3ZUGA 1H3NA 3DO8A 1VBMA 2DUMA 4ARCA 4DDHA 4JXZA 3Q4GA 1G59A 2YXNA 3IODA 3NBKA 2ZUEA 4AQ7A 1J1UA 3IUBA 2OQ2A 3RJZA 1KAQA 1MAWA 1N3LA 4AS1A 5LFAA 3P52A 1IRXA 3MMXA 2O8VA 1WXGA 4I6JA 1TFUA 1FFYA 1ULHA 1S4MA 3CVXA 2WB2A 4JFAA 1O95D 1F4LA 2AG6A 1XNHA 2QJTA 3IMCA 3ILVA 3SEZA 3UK2A 4YP6A 1QRUA 1J20A 3FETA 1QU2A 4EGAA 1KH3A 1XJQA 1G8HA 4UZFA 2CUZA 4K0RA 1KH2A 1I6LA 4J76A 4UZEA 1M8FA 3TQIA 4CT0A 1MAUA 1PFUA 1MB9A 3DV2A 2AZXA 1NUUA 1MC1A 3RBAA 3C8ZA 4MUFA 1M8KA 4XSVA 1IQRA 4EG4A 2GOYA 3H9CA 2QTNA 3GLVA 3NV7A 1EE1A 1GPMA 1NUSA 4MW6A 1KQNA 5JBNA 3OP1A 4KPUA 1R6XA 2D5BA 1KKUA 3IOCA 4I6GA 3K9WA 3N2YA 1Q11A 1H1TA 1B6TA 3ELBA 3PXUA 4WSOA 1ZH6A 1LI7A 4CDMA 2B7LA 4PBTA 3X1JA 1D2RA 5J58A 3K32A 4MVCA 3CLSC 1OWLA 2DLCX 3LOQA 4MWDA 1EFPB 3FWKA 1I6KA 4G5FA 4NAUA 2EJCA 4MUIA 2JANA 4NATA 1TYDE 3VU8A 4R2MA 3FOCA 1QJCA 2O5RA 1N2BA 2X3FA 2NZ2A 1WQ4A 1GTRA 2J4DA 4MUNA 4KR6A 1IVSA 1TYCA 4S1OA 5FO1A 4MUJA 1O96B 3TS1A 2IELA 4Q93A 1WJGA 4MW7A 1EJ2A 4MVWA 3KT0A 1EXDA 1VL2A 4EFKA 2DXIA 4ZCRA 1WXEA 5KWVA 4DDKA 2A1UB 4EG7A 1EFVA 3FHJA 1Q19A 3IDFA 1JECA 5KCMA 2QJOA 1J21A 3HZRA 3UY4A 2A1UA 4EG5A 4F4HA 3PNYA 1BS2A 3ISJA 1O96A 2R5WA 4MW5A 3ZXIA 1JMVA 3CLUD 3UC5A 3L93A 2V0GA 3P0JA 2GKSA 4MWBA 1F7UA 3G59A 3MLAA 2A7XA 4NDAA 4U63A 4ZT2A 2PG3A 3FH0A 2PZ8A 1YIAA 3COZA 2CV0A 3FNRA 1VBNA 1MBZA 3N9IA 1J09A 3HFJA 5HG0A 4ARIA 2E18A 3ND6A 4YP5A 5H16A 3FY4A 1VLHA 1WXFA 4ZT5A 2WSIA 4BWVA 2VTBA 1WXIA 1HYBA 3RFFA 2DEUA 1F7VA 3FDXA 4MWCA 1N2IA 3D6VA 1PG0A 4HPWA 5DB4A 1IQ0A 3GUZA 1IH8A 2J08A 1N1DA 4KPUB 1UFVA 1N78A 4MVXA 3SZGA 4MQ6A 4TS1A 5K0SA 1YUMA 4GRIA 1K97A 3X1KA 1QRSA 1M1ZA 1NZJA 3A4IA 3SP1A 1YUNA 2NSYA 4F3RA 2YY5A 4ZCTA 5LLTA 4HJXA 3TZEA 1PFVA 3HV0A 3G6KA 3ZXSA 2H29A 3P0IA 3MXTA 4JYZA 3HL4A 1NSYA 2J07A 3N8HA 5FNZA 3VGJA 5DASA 3IOBA 1PFWA 2H2AA 2CFOA 1OWNA 1PFYA 3CLTC 3INNA 2VTBB 1H3EA 2WQ6A 2G36A 1X8XA 2Z09A 5DEOA 4ZT3A 2WQ7A 3X1MA 1K92A 3P0HA 3AG5A 1WOYA 4KR7A 3F3MA 4GU5A 1KORA 4MW0A 1RQGA 1JIIA 2HZ7A 1XNJA 1I2DA 4X0EA 3S3TA 1M83A 3SZ3A 5BNZA 2A86A 4ZT7A 4MW9A 4YMIA 1OWPA 3CVWA 1NUQA 1G8GA 1R6UA 1KH1A 2J5BA 1T6XA
chains in the Genus database with same CATH superfamily
3E7FA 4V1CA 5DWDA 1BDMA 4CDRA 5AM5A 3ETLA 3WIDA 1PK7A 1PNQA 3EGEA 4I8IA 4NP6A 5FTKA 3REQA 1BCSA 1WSDA 2F1HA 2VZEA 4OH7A 2FHPA 1U0LA 5JIBA 1UL1X 2BSAA 4FIZA 2Y71A 5C81A 1PL6A 3LDAA 1AZTA 1FVOA 2AWNA 1A4XA 1MB0A 3EOAI 3L7NA 1U90A 1AZLA 4UAVA 3W2TA 1OFIA 1ZN9A 4AMBA 1EFHA 1UKCA 1GSIA 1Z62A 3O7MA 5JDIC 4JNCA 2BCJQ 3N7AA 1J0XO 1SUPA 3H5OA 1M66A 4YMUA 1UBJS 1PZGA 2Q4RA 3OLVA 2ECPA 2H4WA 3I92A 3ICQB 1QO9A 3H5RA 3EDRA 3Q0TA 2CWDA 1RCTE 2X4LA 3R20A 1NAIA 4HMPA 3IUYA 2CFSA 5EZYB 2RGWA 3K71B 4CIAA 4XGIA 3VI3B 1CNFA 5TMBA 3BE6A 4PGAA 1UFRA 2I1LA 1NUTA 2CMDA 3LSYA 1RYMA 2REXB 5ABPA 3UMFA 421PA 2AHOA 4OP2A 4CMKA 2B25A 5DK4A 3THWA 4IDNA 4XD7D 5EE9A 5LQRA 4MVJA 3OT5A 3HRIA 4L72A 1Y1KE 2PBLA 4RYDA 5BRJA 1ISMA 3LF1A 1KYIA 4KQWA 4OOFA 3F97A 3TGPA 2IYFA 1JIUA 1U8ZA 3C6KA 3EK2A 1DC3A 4GSLA 2OT3B 3PEUA 2GEDA 2R5NA 3ET5A 4NCJA 2BCEA 4B8WA 1XQYA 5ARCA 2L2QA 3AIIA 2BYTA 4J4TA 1XQ1A 5CA1A 1YD7A 2BUAA 4TKMA 2RJ3A 4QPPA 1JALA 4JI4B 4KYTA 3SZRA 3DUFB 4R8VA 1HRDA 4BO4A 3AEQB 4D3SA 4PPNA 4ZI7A 1LQTA 1W2HA 1H5QA 1QZZA 1W5SA 1N2EA 1CUFA 2WWXA 3DBIA 4L4SA 5ALJA 3RRXA 2JI4A 3SHTA 4I1RA 4PC7A 4RKQA 3O2SB 1CUYA 1ORVA 3L7AA 3F1KA 3LQYA 1FYDA 4D25A 1U80A 5FO0A 4YPOA 1KS2A 3AY6A 3NXSA 3RHZA 5LYJF 3OQOA 2GXSA 4UVIA 1FRZA 3QOXA 5LOVA 4JUCA 3VR2D 1E1NA 2VF4X 3LRTA 4J2OA 5TGTA 3DVAB 4W7SA 1XCGB 1UQUA 1XDSA 4IV5A 4MOWA 4BQRA 1QGZA 2LBPA 4ND3A 4EMBA 2K2QB 5AM1A 4K6FA 2JLUA 4AFNA 4BFSA 3CSUA 2E4AA 1B2LA 1WPXA 1KEEB 4KU4A 2Z1DA 4UHKA 3TPZA 4PNEA 4R9UC 4LSZA 4UVHA 4MCHA 2HC9A 2VJDA 3FF1A 1QX4A 4ZMSA 1KNQA 3FPEA 3QV2A 4Y1EA 1S8FA 5K0BA 3JAWA 1A8SA 5JSHA 3MHTA 1PJZA 4M9SA 2ZPTX 4OHXA 4KGDA 2GERA 4W5OA 1EZ4A 2XQKA 4HI0E 1CSEE 3CPJB 2F1KA 4UPEA 1UKAA 5CNKA 1GQRA 2BCGY 1XB2A 4C5BA 3UPDA 2P8JA 4AROA 3KJXA 2E87A 1CUZA 5KAPA 5HSGA 1J2RA 4MKZA 3WJ1A 2XCIA 1SG9A 3FI9A 5D5PA 3HXQA 1RRKA 5J5AA 4GOJA 2GTPA 3SIWA 4YRKA 3OZAA 3BT7A 2LWIA 1DCTA 3TTWA 2LXNA 2IUYA 2NV0A 2OHGA 2X1MA 1J23A 3IAUA 4H3SA 1ECLA 4M49A 4RCYA 4AUKA 4IVQA 4ZOQI 3ZD6A 2HT1A 5AW8A 4OJYA 1MA3A 4Z7NB 1M8PA 3CNBA 5LQCA 4DLLA 1X80B 3CLKA 1E9VA 5CXSA 5FPSA 3N2NA 2A57A 2CJFA 1UIMA 3NP9A 4LSMA 3I04A 1JVBA 4RD3A 4TS3A 4M1OA 3RODA 2ODPA 4JXXA 2W7TA 1H66A 3O8QA 3PYLA 2Q1UA 1TVKB 4DVGA 4HRAA 4ZU3A 4EELA 3DYIA 4Q18A 1QCYA 1LH0A 4R2LA 3RAPR 3GGCA 5B1EA 2IEDA 1D03A 4DJAA 3QEJA 1UMCB 2XVYA 2ERYA 4LRUA 2CL7X 1WDTA 4XOUA 3AERA 3QVTA 3JTEA 2WJ6A 5DX0A 4CLOB 2DUUA 2I29A 4DT1B 1YHNA 3UWSA 3NHPA 1AZSC 1PWXA 1KC1A 5BSEA 5C8ZA 3K96A 4O6VA 1X7YA 1RD4A 2A92A 5TDHA 4R8KA 1Y4ZA 3G5LA 4LHEA 3R9XA 3GLFA 2I2WA 3CLVA 2OCIA 1GL3A 2XVXA 1DOAA 4S2UA 3HLKA 4BNIA 3IHLA 4D8UA 2CXSA 2C61A 4AKEA 1MOPA 1PL0A 1OLUB 1ZJ6A 2H7CA 4HNAA 1T1IA 3BFXA 1RC0A 4Z3OA 3RC9A 2JAUA 2XGMA 2E5LB 2G5GX 4R1OA 3QU7A 2QX9A 4QUKA 1P1RA 2G6BA 1RC8A 4TYYA 4GMDA 4QUGA 3SQOA 4A73A 4P36A 3EWIA 3QBJA 1GLNA 1NGSA 3GFSA 3QVSA 3MWLA 2ODTX 2PX8A 4ZU6X 5MN5A 2I2FA 2G0TA 2ID4A 1FX0A 3LYUA 3M6XA 3C3DA 3CRVA 3V2HA 4I1IA 4EUKA 5DIFA 2I7CA 4LNAA 5KOJA 1DBVO 4JQYA 5CXQA 1NURA 4X3OA 5LJIA 2VDJA 3NX4A 1MVOA 1WPGA 3TI9A 3WGVA 1X6VA 3QVJA 5L95A 1P7YA 2FGKA 1EUYA 3S1AB 4LXGA 4MITA 4KVGA 5AJVB 3V46A 4KMOA 2I62A 2P67A 5JH7F 2H5JA 2IYXA 2NZ8A 2K7FA 4F91B 3B5JA 4JXZA 1F14A 5DYGA 3EN0A 3CZPA 3TXXA 2AF4C 3URKA 1VJDA 4EY4A 3SG0A 5K0CA 5JARA 2QQFA 4H0NA 2BMEA 2J1LA 1T4DA 3L8MA 4ZVRA 4YJKA 5CTAA 4ZT6A 1NR7A 5E7MA 3CLUC 4YRGA 2O2IA 1TCVA 5BNFA 2AG5A 3O8CA 1KYYA 1CBUA 5LSAA 2P7IA 3CEJA 4R0NA 4Q15A 3GLFE 5F21A 1EX7A 3P5BA 4KE8A 1T9CA 4BX0A 3NBFA 4NE9A 2IVFA 3KSMA 3U7EB 1Z7WA 4ZXFA 2VJPA 3KHTA 2BI8A 3PXAA 4YUAA 4LDPA 2ETXA 3BMOA 1Z6TA 2C9OA 4FGSA 4QFBA 3DSRA 3T1YB 1QYWA 4G24A 1PZHA 4AYWA 2HK8A 3R3ZA 2JBWA 1RWMA 3C3WA 4JP1A 1QFJA 4DJDC 3TW4A 3LXUX 1T9KA 3LS2A 1C3VA 3UYKA 5BP7A 3F7MA 4FMDB 5HFJA 3CE9A 1N8TA 5I45A 4UW9A 2O2CA 4JSRA 2AD5A 5LQMA 1CP3A 3VR1A 4CNQA 3M70A 1YOVB 2CF6A 2YHIA 3LO8A 1SFRA 2GNPA 4EARA 1UJBA 2FZLA 2XAAA 4DR1B 5E3HA 1DAMA 4UDYX 3WQHA 4BZWA 1QQ7A 3UG6A 4F1JA 1ZW1A 3F5QA 2O8BB 1ZK3A 4NXNB 4PONA 2AT1A 2QMOA 2REBA 2VAMA 5EMKA 1RPJA 1NRXA 1O54A 4MRPA 3T1QA 2MSLA 4D3ZA 1L5FA 2Q6OA 2XA2A 3NWEA 3FLEA 4HDNA 3KM0A 1F60A 3P52A 1PZNA 2BBTA 3SX4A 3OX3A 1Q0SA 3ITEA 5A02A 3RYCB 2K5UA 3Q7IA 2PL5A 1TCBA 3IJ5A 1H2AS 2QPAA 4LBVA 3G88A 2DFKB 4D9NA 3KEQA 4UEKA 4C0QC 5AUPB 3VR3A 1FFYA 3AR7A 2I3BA 4K9NA 3IV6A 2JGKA 3B6ZA 1F4LA 1LC0A 2IY8A 3IMCA 2PUWA 1G5TA 4B7CA 4EGSA 3UK2A 3K0EA 3DNPA 4G0WA 1JAIA 1PR6A 1GXSB 1OFVA 5KU1A 1QK4A 4QLBA 1CF2O 1KH2A 4JQSA 5K03A 3COJA 4TWIA 3GYBA 4E33A 2V6IA 3AI2A 1X7HA 3AI1A 4KQFA 4RIHA 3EDMA 2ORYA 4LC9A 4PG6A 1WBBA 4I9FA 4LKRA 3C8ZA 1L5YA 3IGFA 4HQOA 3WO1A 4P4TA 1M8KA 2WWWA 3FFBA 3JVEA 4MR7A 1ZINA 4OGKA 5AI8A 4I1VA 1EA5A 1JFRA 2VT2A 1ST2A 1E1QD 2C8LA 1XEXB 1MVLA 1EE1A 1ZLYA 3KXLA 2ZE5A 4K6MA 4MW6A 4KXLA 2WAMA 1NVWQ 2EFHB 1MXFA 4XCQA 4J0JA 2Q49A 4Y2VA 4P1ZA 3ENNA 3R5HA 3QITA 3W5JA 4HQ0A 4ZICA 1DARA 3OJ0A 5CT8A 2M6LA 1E2NA 2NUAA 3IOCA 2FR8C 3BFPA 5GIPE 2DECA 1ZA2A 1A82A 2I67A 3L4EA 3RSSA 4FEYA 4FMCB 4IIFA 5IF3A 3I61A 2HNKA 4X20A 2X8BA 2TMYA 4U00A 5SZHB 1DT3A 3W77A 1L5QA 1NT2A 3KRTA 1AQYA 3AVPA 4QVGA 3RSCA 3X1JA 3G9TA 3AFNA 1ISRA 4EL5A 3ONDA 2I6XA 2HU2A 2ZOSA 4XB6B 4P3KA 5DHUA 1U02A 4B3XA 3CLSC 3EYAA 1I0ZA 4K05A 2HLDD 2IA5A 2PZJA 2MT9A 2ZVPX 3H1PA 1F3LA 3CN7A 3VR5D 5H4GA 4BTVA 9LDBA 5IH3A 2DFPA 5KNLA 1LUAA 4A8JC 2EJCA 2ZXFA 3H8JA 1MH9A 1THZA 2X1HA 3OMWA 2ON6A 4RLFA 2X0FA 2OGSA 1P6QA 2CLHB 5EXSA 4D6XA 1W9HA 4UCWA 3GD5A 3GLGB 3UENA 5A3QA 2C58A 2YH2A 2X2OA 3S7TA 3A9TA 3UW3A 1K88A 3SJUA 2Z8ZA 3DEFA 4BUZA 1PV2A 2P75A 3D6MA 5E0KB 5EHIA 1I7PA 2OXIA 2XI4A 4S1WA 3U9LA 3U48A 1VL1A 3B1JA 4XA8A 4RM2A 3L4JA 4POOA 1Z5VA 4MW7A 3OVMA 3YASA 2KJQA 4G36A 3V48A 4F5DA 3FKQA 4MKRA 3ZWYA 2BGLA 4KBYA 4EG7A 2QTVB 4KOAA 5E6RB 1B7GO 1SPBS 3N5KA 4P98A 1CUUA 3ETEA 3UWKA 8LDHA 3CTMA 5AM0A 1BFDA 1OXBB 4LFAB 3WDLA 4ISBA 2C59A 3SS9X 1VE1A 2CMFA 3LUHA 2WKRA 4OK6A 3UFXB 3T7AA 4NCNA 4S05A 3C8HA 1W85B 2VQ3A 2X23A 3MRSA 4OQ4A 2IVZA 3LA8A 2JI6A 2J30A 1FY2A 3DMYA 3G6WA 2QG6A 1KK0A 1UM9A 4BLPA 2AI1A 2XJ9A 3CX7A 4HNTA 4KXMA 5SY9A 4B3CA 4BMOB 2WHPA 2EWMA 2X4GA 4YRCA 2L42A 3IJPA 5KJEA 3O8DA 5AOCA 3L0CA 5CNJA 4DMUB 1U98A 2QMEA 1GYPA 5AIAA 3BGWA 1MJNA 1OGJA 3QYAA 5K0GA 3V1NA 2QBYB 3ZLJA 5H16A 3OSZA 4BRZA 4D3DA 1EUZA 1GTG1 1KZ4A 3MWYW 2EGUA 3VOSA 2RHMA 3EOBI 4OGWA 2XUAA 3TUJC 3WHPA 4C7XA 4D0GA 2DEUA 1NBMD 5C7IO 5EJ5A 4MS3B 1T8PA 3IHWA 3TVDA 2QM0A 4TOIA 3LK6A 4UMFA 3ZD7A 3DLCA 2OO7A 1SXGA 4JZKA 4N01A 1GNLA 1TTHA 4WASA 1SKUA 1ZVMA 3U19A 1M1NB 1PJ8A 1HNWB 4DW8A 2FRVA 3Q8WA 4WNIA 4DJJA 5EJFA 3NJ4A 3C2QA 1QDLB 2VDMB 4QSMA 4CV0A 2WF7A 5BNIA 5I4BA 3KQLA 1SB8A 2C7GA 2QUBA 4E31A 2FX3A 5F2NA 1VMKA 5BV2P 1E3SA 1FW8A 1Q21A 3O92A 4Z8YA 1Z2CA 1FP4B 1NQOA 5BQ3A 1LPBB 1RKVA 4PHCA 1M7HA 2XADA 1F0NA 2IOYA 3H65A 4JDPA 1BO6A 4PQFA 3UK1A 4Z51A 4ZRMA 2DVMA 2AJCA 4RVNA 4H7JA 6ABPA 1PEDA 4BQQA 4DBLE 3CIFA 1U4SA 4G9BA 4RADA 4F3RA 5HK9A 3D4LA 5LLTA 2HJGA 3ZXSA 4EF5A 3B3FA 4ECEA 3AF1A 4MWGA 3UKJA 4FYKA 3JAKB 1RZUA 3IP5A 3NJ8A 4QOHA 3FTCA 4UM5A 1GGEA 4F9EA 2FN7A 3K8ZA 1GQQA 3CX3A 1QVWA 1PFWA 1Z5PA 3OT1B 2AOVA 4XYMA 5TPWA 5IK2D 5BYJA 4AI6A 3FM9A 3IDZA 1WBJB 5C5CA 1ISFA 7ADHA 2K2WA 3F73A 3JARB 3A9RA 1QGOA 5ALKA 4OXKA 3RS0A 1DC7A 1G1AA 3BQ9A 2L17A 2DWQA 2OZVA 2DMRA 3W5UA 5IVKA 1VQ1A 2X6RA 1XTJA 1Z6GA 4IOKA 4OHYA 4MW0A 4B7AA 5TGZA 1F48A 1O4WA 3WL6A 1AU9A 1T0HB 4L5JA 2XD9A 4JI2B 4JYAB 4HUQA 3ASVA 2KPOA 1A9XB 4C14A 3OIDA 2QUAA 4LZLA 4ZT7A 1Z47A 5CRIA 4F1WA 3KJEA 3N53A 1R0LA 3LV8A 1R6UA 4P32A 1OSNA 2ZE8A 1Y1RA 4N3NA 4ND8B 1KYZA 4Z4FA 4TUYB 3CF2A 2AV6A 3WGGA 1TMOA 4QPNA 3GB9A 4A8TA 1NBME 1TD9A 2GBGA 2FRDC 2CYAA 2J5KA 4GSYA 4J0IA 1USGA 4RZSA 2OLKA 4Z0NA 1JFFA 5AHRA 2DCUA 1LSUA 4A0RA 2NU8B 4J0QA 1GDTA 1H0KA 4KAAA 1H4VB 3CKMA 1WLSA 2JA2A 1E6UA 1SURA 1U7TA 3MM4A 3PD0A 4OD0A 4URZR 3T0FA 1Y1QA 4MDFA 1SWVA 3LL7A 4A0FA 3JQGA 5IFKA 5LBUA 3GXBA 3I0ZA 5KDDA 5EC8A 2ZPUA 3HGQA 3PYXA 1Z7BA 4DMMA 2RH5A 4XFDA 2A3RA 2FCRA 4ZQHA 2GNOA 1YB7A 1Z37A 4JYMA 4ESEA 1TA0A 1NLFA 1FFGA 1UJ6A 3FI0A 2NIPA 3V2UA 3QHQA 2WMNB 3DXXA 3QEMB 1EFRD 5KQMA 1E4OA 1VPVA 4I7EA 5GV7A 5LD2B 3JZDA 5E9AA 3VV2A 5BR4A 3FKSA 2VA8A 1WXHA 3I23A 2ZBVA 2FQWA 3EEBA 3OWOA 4KQ1A 1MDFA 1QIEA 1U8UA 2IOFK 3FPJA 4MEAA 1MFPA 2XYRA 3A3PA 1GPBA 4UUQA 1QLJA 3EE6A 4P93A 1D3AA 2REOA 3DR3A 3B1ZA 3UHFA 1BC5A 3G23A 2GK7A 3K0AB 3VDMA 1I33A 1T2AA 4GPIB 1P1HA 2EL7A 2O3SA 3B51X 4U9IS 5D8DA 5K0JA 3DOFA 1QSGA 3ER8A 4UHDA 3PF8A 1JEYA 2BLLA 4NECA 4O2AB 1GKYA 1G16A 1COWA 1DWUA 2UV8A 1SBTA 4P4LA 3TSCA 4UOEA 2J32A 3FKSD 4CKEB 3TM5A 4EZIA 3U4GA 1M2VA 3DG9A 3NU1A 3OTWA 6REQA 2JCBA 2RCNA 4H6XA 5T4FA 3WFIA 4YRSA 2TMDA 1M6VB 3I32A 4YIHA 3DTNA 1ZITA 3EVFA 5JFGA 1Z5NA 4IFEA 1E1RA 1YVDA 1C7RA 3KR2A 1ZCAA 1N8SA 3I5XA 2VH2A 3LUBA 3HZZA 3NHJA 5DLPA 1PSWA 4WCVA 4ZYXA 2AX3A 1QRTA 3RO7A 2OCBA 4KR3A 1UBEA 3VZCA 1W48A 2PKWA 5EQTA 4AX4A 4FU0A 3WLHA 3KO8A 2RGNA 1H2ZA 4OM8A 1R66A 2WR8A 1OF1A 4YPVA 2HWYA 2B8JA 3FDZB 4LVNA 4BB0A 5C35A 5ICEA 3CVOA 5F7OA 2AMYA 1HSOA 3PPWA 1BU5A 3GUUA 4X5OA 4M8SA 1GSOA 4NZMA 3O8OB 3TQRA 2J48A 4EB0A 2UUBB 4JP3A 5E1MA 1LLUA 5CVDA 3DDOA 4OLHA 3V7YA 3H1EA 3OBIA 2IXTA 4N41A 3T5GA 2OUKA 3AKYA 4ENPA 2EDAA 4RZIA 1LW7A 3NPMA 1GRQA 3PYMA 4AO8A 1ACLA 3ENWA 3F4BA 4JP2A 3OU2A 3ZGZA 4GPAA 1G0OA 4IJKA 3AHIA 5FUQA 1WCYA 3CH7A 4WUVA 2HQSA 1JXQA 4P0TA 2XB6A 4CE6A 1ABFA 1JXOA 1I24A 1W1WA 3AR8A 2Q46A 4BJ1A 1U0FA 3E4DA 4EH1A 3FMIA 1Z28A 5JHHB 4RPKA 4L3VA 3WGYA 5ECYA 2PX0A 3L1HA 2AZTA 2NZWA 4MICA 5IUKC 5IKPA 2EZ9A 2B4KA 10MHA 4MSUA 1J42A 3IS3A 4JBWA 2IUFA 4RZ3A 3EVZA 1GRRA 2SKDA 2ASVA 4NLLA 4EW6A 2R8YA 3AF5A 5J40A 2HK7A 4M83A 3CNOA 3DB1A 4FCCA 3F74A 3I58A 5ERGB 1KDZA 5L7WA 2FR8A 3E58A 1ZJWA 4BKQA 1R9GA 4XUCA 3DFKA 3ZHCA 1UJMA 3RS2A 3CV3A 1T8YA 2ZVJA 3EFOA 4LHXA 4P82A 1RYHA 1OKKD 4IRXA 3FWPA 4E46A 1MA0A 3ABQB 3WNQA 1JAHA 5IBPA 2IXDA 2QUKA 1PIWA 1SC3A 3H5LA 3KYDA 1CZNA 4FI3F 3BHIA 4KVZA 5LIPA 1KR5A 1Y3FE 2JJ1A 5JAZA 2FG6C 1YVPA 1RWNA 3A05A 1E7MA 4MKXA 1NXQA 1XROA 5CFRA 2EFCB 4BX9A 3CPEA 1NFRA 2JFPA 2JLVA 4BNZA 4YJ3F 2PWZA 4KRGA 4OJNA 5EEHA 3NKFA 3R0VA 5MN6A 1Z26A 3PGJA 3J7TA 4MPRA 1KBOA 2HMUA 4TKVB 1SGWA 1HRKA 4BASA 2PE5A 4X3PA 1Z2DA 3OD1A 2V8OA 1NMZA 5CFLA 2ZXEA 3GEDA 3DHYA 3GZJA 3NRBA 4HQRA 4LX0A 2WNHA 1V8OA 2NTJA 4QGHA 1Z4MA 4JAVC 1Z8FA 4QNNA 5EE0A 4F5WA 1NNEA 5HUQA 4B3HA 2V96A 3CZRA 3CWZA 1E6MA 4JBXA 3RTEA 3IVXA 4RYLA 1J2TA 2FMXA 2Z4RA 2D1TA 3C1TA 2IP4A 2GKGA 1Y5IA 2JRLA 2JIDA 4J0GA 1AKVA 1CWUA 2E37A 1QTRA 1WY5A 4FEGA 4KXVA 5TRTA 3TAUA 4YAOA 4TWRA 4DVJA 1N0WA 4I55F 3LNTA 5K8UA 3FMFA 1ECJA 1QXSA 2R6ZA 4WFIA 3EGDA 3PWTA 1JBQA 4MJ7A 1Q84A 1B74A 2J7KA 1V9SA 3AHFA 4N76A 3G2OA 1D9ZA 2C03A 2GHTA 2QVYX 3DEIA 3HKEA 3QY0A 3FGOA 3PI6A 3KSRA 3PIRA 2AZDA 3O21A 3STWA 3OFJA 3MGBA 5AI4A 1X1CA 2P6PA 4B5LA 3A04A 1Z0JA 2RCYA 2I7XA 2H2GA 2C7PA 1S2NA 3TUIC 2E85A 3UM9A 3WGMA 1KP3A 1QOPB 2QJWA 4YCSA 1N1EA 2C57A 2B36A 2CJWB 4ALNA 1QONA 2JGMA 4NH4A 5FUBA 2PN1A 4JLKA 3ND5A 3OECA 3ZE6A 1R6DA 3WX0A 2FP4A 1F51E 1KYQA 3L6RA 4IW3B 3PJEA 2CLSA 1KJZA 2IU6A 4RPJA 1SC4A 4FQ8A 4P34A 2JASA 3CXUA 4CKBA 1E18A 2BGJA 3CRRA 5ENDA 2BZ0A 5GZ3A 4G07A 3RREA 3AR2A 3OLQA 2A5FA 4JIMA 3K6RA 4PFKA 5F12A 5A1TA 8AT1A 3FUXA 1C30B 3V5NA 1O0CA 2ECOA 2HMAA 3LY7A 4V1CI 1G8AA 4KN9S 1MO2A 2HPZA 1I4EB 2P3LA 1HI9A 2RAUA 3GG2A 2FWIA 4Y2QA 4N7RA 4I9GA 3EG9B 5BWLA 1XXHA 1TQ2A 1VL5A 2MINA 1PG5A 3GGDA 3OF2A 4R8RA 2FXVA 4RVDA 2C0PA 2HRBA 4AY2A 1QF7A 2Q5HA 3INGA 1JU9A 1RYNA 4G0NA 3CLTD 3LIIA 1CJBA 3AI3A 4NMLA 1T8WA 2DFNA 4MKIA 4FCTA 3VR5A 4EI2A 1P73A 1RADA 1W0KA 5HCNA 3OTQA 1IM8A 3RIYA 3EZNA 4MO2A 4TVSA 2A30A 2CF5A 4ZJPA 2NSLA 1C9KA 3RQIA 2OESA 1YH3A 2ZYDA 5IJXA 8MHTA 3WRYA 3B5IA 1W93A 2PTHA 2PZAA 4RJKA 1Z4IA 1Q12A 3ANMA 3DOUA 3F5MA 1VHQA 3WLNA 2HAEA 4REQB 1IHPA 1ECBA 4ERNA 5HKKD 2HA3A 4HQKA 1MH1A 1YZYA 2JLAA 3AIKA 1Q5PA 3UQYS 3TE7A 2FQYA 2BVNA 5CCEA 1P5JA 3GCXA 3M5DA 2R79A 4MV6A 4JKIA 2IQ5A 3OKAA 4K88A 1VI6A 3TL3A 4CIXA 3RVJA 1C1HA 1NFQA 1KDTA 1SRRA 2R87A 3JQRA 2DT8A 4R2KA 5DNEA 1FFXB 2O06A 2BKEA 2VYVA 2OCGA 1TVEA 2VCYA 3EC7A 3ESCA 3F8TA 3L9XA 4JY7A 3WQRA 3SKVA 2XOKD 2VBIA 5DNWA 2DFLA 4M0DA 2ZSEA 1DQRA 2WFAA 3ROPA 1XL0A 1O95D 5DCLA 4ZYUA 4HO1X 4IOJA 1KBQA 2FLVA 4LYDA 3JARA 4NHOA 4U9UA 4Q9JA 5A2GA 2VA9A 2QS9A 3NHMA 5B7QA 3UJPA 5FFFA 5KJCA 2GAJA 2GBFA 2IYWA 1PK8A 2NO0A 2WJYA 2YHAA 1EHCA 2HM7A 4Z8XA 3HDHA 3GLUA 5JTTA 2OB2A 3ESZA 3KB6A 1HZZC 2NADA 3N0WA 4L5BA 5HE8A 4RK6A 4CMIB 4EA6A 3WV5A 1GSAA 4PTLA 3QU5A 4EG4A 1L5NA 4EA8A 5JSKA 1H69A 1Q6ZA 4MV5A 4ZYLA 3EPLA 1DXHA 2O8FB 2I1WA 2XBMA 1GPMA 1NUSA 3TNYA 4XWOA 5H5JA 2EZ4A 1Z2PX 3JS5A 3OFKA 4I5GA 3HO1A 4ZREA 4OYHA 3U6BA 1K5DA 3ZDYB 3VUEA 3F4LA 3G9UA 4HWGA 2QN9A 4OL0A 4KPUA 4RD4A 2RBKA 4QSHA 5LP1A 5M2QA 1AD2A 3DV0B 4UJ5A 1M2OA 2PL9A 1E8NA 2BAGA 4O1MA 3PE6A 2G1AA 5H1YA 3A3NA 3GAAA 3GEHA 4QJBA 1W59A 1F4PA 4S2EA 3U4CA 4BB5A 3G13A 2GBIA 5AVXA 3HPQA 1SOVA 4OXYA 1QHSA 3PCRB 3Q87B 2MSWA 4ZJUA 3BRWA 3T3DA 5IJWA 1E3MA 2AA3A 2FPPA 3UV3A 3GHYA 3GT3A 3SCZA 3HJNA 3MTAA 1V3VA 2P4UA 2FK8A 1O8BA 4RFSA 3C3AA 2OD7A 1DLJA 2BGGA 1EGQA 4R69A 3JQ8A 2BMJA 2P9ZA 2G4VA 3SXJA 3VAZA 3GZTB 3V4ZA 3DBRB 2C3UA 4Q7JB 5ITSA 3E82A 1EAYA 3SSOA 2FN3A 2B94A 8ABPA 1WCIA 3N2LA 1LBIA 4B85A 1T36A 1ORTA 2CLCX 1UJ2A 1UZNA 5HZHA 1EZ1A 5CA0F 5CH5A 4G09A 3PCXA 1Q7CA 2KI5A 3OU6A 2J31A 3S44A 4FFOA 3LYLA 4EO9A 2P2GA 2OO3A 1QFSA 1WJGA 3AKEA 3QKRA 1DTSA 3CTPA 4JX8A 5JD3A 1F6WA 2WDPA 4IX9A 4RHFA 1O0SA 1Y8QB 1WXEA 2YY6A 5AK3A 1N0VC 2WVGA 5IARA 1E7SA 4Q01A 3FHJA 4WACA 5I6DA 1RAIA 1XQXA 5IMSA 5DOZA 3QWAA 4LWQA 3ANNA 2B8WA 1BFKA 2P9BA 2QAJA 4QT0A 4TPKA 5HXAA 2QTVA 2WT4A 1JP7A 1R6VA 1S8OA 2NVUA 3R7WB 1ODTC 3G5TA 3DBHB 4HY3A 4FOSA 5ER6A 1TCAA 2RHGB 2O2JA 4V1CB 5BUZA 1JZTA 1SHJA 2RGNC 3BH7A 3M4XA 3W6UA 1JJFA 3RS5A 3I8SA 3WIVA 1Y4UA 3CLUD 2TMKA 2BFBB 3RU7A 3VKWA 2O2HA 1CULC 2X58A 4MDEA 2ZDGA 1TEXA 5DLEA 4I99A 1XTPA 3NBZC 1XP8A 3D0KA 3CUUA 1DEKA 4DM4A 5BYAA 3EDYA 4ZOLB 4QATA 4ES6A 1KRWA 2OFPA 2J5XA 4Q7MB 2XMZA 2ZCUA 4OJQA 3VKUA 1NXOA 3FNRA 1YZNA 4PXYA 4ZWNA 4G0UA 4FDMA 5M3BA 4BNXA 4ZI3A 4YP5A 1PK9A 1Q7BA 1SCIA 1M2HA 1U4OA 1WVGA 2FPPB 2OKCA 2OSVA 2R47A 3PIDA 3SYMA 4B0OA 4GI5A 3N6VA 2HFKA 1C1DA 2AFHA 4BWVA 3DKPA 3RFFA 3B2NA 1E79D 2OAP1 1UWCA 1ZNYA 4JJIA 3N2ZB 4RS3A 1QORA 2HWUA 1YKSA 1Z5WA 4D4HA 3H87A 1A9RA 5JAUA 1XWFA 3DAHA 3JAKA 3KEOA 4KZKA 2K4MA 3GUZA 1JFSA 3RHTA 4E5MA 1NMSA 2NQ8A 2DBRA 4LMAA 3RSLA 1KI7A 3LWNA 1U94A 4FS8A 4MWTA 4BIMA 2G4CA 1KEWA 3KKEA 1FP4A 2QD5A 1F3OA 3Q7EA 4QHTA 2VN8A 5IBQA 3TSOA 3DZHA 5CFZA 1LSSA 3IKJA 2EF1A 1P6UA 3FHCB 2HWKA 2DHDA 3C16C 1X70A 2P1DA 3HUUA 4NBWA 4XARA 3X1KA 5JEEA 5J2TB 1GPAA 2EJWA 2ES4A 3JQ7B 2PKRA 4GLFA 4IIEA 2WSLA 5DRTA 1KVRA 2JIZD 4RY9A 4C4TA 3PRKE 4GOMD 1TPZA 3EZXA 1JLRA 2H4XA 3HCFA 3LQ4A 1R0XA 3LT4A 1INLA 4JUAA 4DCPA 2IHUA 4Y9DA 1YAJA 4ZVKA 1Y6JA 1TU3A 1B43A 2WG0A 3IPRA 4G1VA 4PLPA 2CFOA 4URWR 5G4KA 4NV0A 5D84A 1RPZA 4J0HA 4DIFA 2W2PA 2X3UA 2G36A 3BIFA 4G1EB 5HKBA 2QLNA 5COBA 3ZGNA 2R7MA 4RJLA 2C8KA 3H9QA 4IDHA 4AUNA 4O0LA 5F77A 3AP1A 3SJ7A 2LDBA 1AJEA 1RLIA 3ZK9A 2CLEB 1YDMA 3SZ3A 4JENA 2BRUC 4MWOA 4QQNA 1P0MA 5CDUA 3CNQS 4BO9A 4OG2A 4RV9A 4B6RA 2EAUA 6YASA 4DXDA 4YALA 1UMDB 4TZKA 4FJ1A 3VH3A 2L19A 1DEOA 4WEOA 2DOKA 4B3JA 4DDUA 2FWRA 4A0QA 1JHQA 1R5NA 3O4JA 4NZ9A 1NN5A 5AKGA 3OAAA 1RLJA 1ODKA 1U7UA 2ZSKA 1DO0A 3BSWA 3KTDA 2A4MA 2QIOA 3T3NA 4AK9A 4IH9A 1RI5A 2B7BA 3LX8A 4YRBA 4BGEA 1SHTX 1CEYA 5DLYA 9LDTA 5FWAA 1WZIA 3R0IA 4NTZA 1AG9A 1PUXA 3OE7A 1SUEA 2F00A 3PV0A 2PT5A 4R7TA 3LUFA 2OFWA 3VR2A 3RJ9A 2IDJA 2RGDA 3TRDA 3CBGA 4WGFA 4ZOBA 1I4TD 4HT3B 1Q7RA 3PKIA 2W43A 3NASA 4UBJA 3UHOA 5BV7A 4MGYR 2PX3A 2Y4OA 3NYQA 2J7PA 4EQ6B 1KMIY 3TDMA 1UDAA 3RW9A 4B2LA 5DN6D 2WWVD 1PI3A 3L1IA 1RBYA 5CDFA 2AXPA 2R6DA 2PT6A 1YDFA 3K15A 3I39X 2Y1OA 4LXIA 2D0PB 3EZ6A 2WVJA 1JIQA 5I9LA 1PGNA 1BGWA 1G9SA 1QIGA 2ZCJA 2OE2A 1YRQA 3Q9LA 2VXOA 4CG0A 1HEUA 3K9NA 4MCAA 4RKEA 1EESA 4C03A 1ZWLA 2O5EA 3ZVLA 1QVRA 3UGKA 3LXMA 3W5IA 3AVXA 2BL4A 2FGJA 1DC5A 3KOXA 4IF6A 2O54A 2ZS9A 3AX6A 4DIDA 1CR0A 5GJVC 1S89A 1DOHA 4N03A 4OU5A 1W4BA 1JHXA 2ZUVA 2FZGA 3IMEA 3WRYC 5IVIA 4IUDS 4JR1A 5JCPA 3JU3A 3FWYA 1RQRA 2FMHA 3VI4B 1BOOA 1TUBA 1B16A 1K3UB 3TTTA 3B6IA 2FE4A 1U3DA 3B8EA 1F2VA 3O9MA 5E3IA 4JBYA 5ALEA 1QIHA 1MC4A 5LMUB 4HKTA 1V1MB 4GVPA 4YJHB 1OFHA 2EBUA 1RIIA 1XDWA 3ACBA 4XR9A 4S0XA 3H3JA 4JN6B 3ECSA 3HADA 1Q0LA 2QGFA 2LKDA 1NN3A 1QB8A 1XTRA 1EBBA 1KPHA 3LT5A 1HE5A 4BP1A 4NE7A 4TQAA 1Q74A 4LY3A 4P7JA 3ZV5A 4DTCA 4ZP1A 3ZNPA 1MPXA 4DEYA 1AGXA 1UXKA 3NIGB 4G67A 3AUTA 1Z75A 5K0TA 5I9SA 4F96A 3GDWA 4D0NA 4XLZA 4J7AA 4KXNA 3A2LA 4J16A 4CKXA 4H3VA 1P4HA 3GJ0A 4BTEA 4CIVA 1WUTA 1YQXA 1SXIA 1MB2A 5C34B 3ENVA 1VL6A 2VQDA 2A3NA 1I1QB 2BDEA 1R5BA 2ZYWX 3OTGA 4EECA 1AQJA 1KQFA 1RHKA 1TQ8A 2GILA 4J7XA 1PR0A 2WNIA 3JYNA 3L8HA 5I3CA 4IO1A 2UZ0A 3AO0B 4C05A 1QBGA 1S01A 4JWKA 3TDNA 3K4HA 2PRZA 1GM5A 1NPTO 3G0GA 3P8ZA 1SCDA 1U3VA 4LDRA 3A4MA 4LYEA 1P80A 1YZTA 2VZ8A 3H2JA 4M46A 1AUXA 5DM2A 5KHOC 4KMSA 1XKXA 2QENA 2H63A 3AQIA 3KOWA 1FNSA 2KE5A 1HT3A 1PJLA 2XEDA 4G2NA 3RYFB 2A84A 2YW2A 1W76A 3HG7A 4CLXA 4R2WA 1ID1A 2XGJA 1NQAO 1MTZA 5G3YA 4N8EA 1CJMA 2EWVA 3DKRA 5BMVF 3V1KA 2OHFA 2WTNA 1IZZA 2UUPA 3WISA 5I51A 3T7CA 4B45A 3H83A 2WTXA 3ZY6A 4BXOB 4TMTA 3A1NA 4HNHA 4MLPA 4CEIA 1PWYE 1WG8A 4NL4H 1JLKA 2A94A 1L1FA 2WM3A 5EJ8A 5A4FS 1ZI8A 2FN9A 3RVLA 4RV5A 5EJ4A 1EFCA 1LV7A 3HFGA 1GFZA 4FHZA 4S1VA 3TR5A 2HV8A 1GV1A 2ACKA 1GTVA 2AC7A 4CI0B 3JPYA 4KR0A 2B3DA 2FUKA 4ENRA 1A2BA 4C6TB 5CBKA 4YJ3A 1L5HA 5FWYA 1J8VA 5DM0A 2VG8A 4DBZA 3EDCA 2ZRAA 4L75A 2Y0CA 3ECCA 5TPZA 4KWEA 4ZVUA 5HUJA 2RJOA 5JNWA 3WMXA 3AUJB 3H5NA 4FR2A 3PWSA 4DDWA 1DZIA 5EJMA 2X14A 1C3OB 1L3CA 4CM6A 4YAUA 4YDQA 3H2YA 3S1AA 5KSZA 1S9HA 3EF1A 2O3RA 3KQQA 4M55A 1GZ7A 2I71A 4RVOA 4YT5A 4MA0A 4MRSA 3WLPA 5T8KC 1JEEA 1ZJJA 2RC6A 4ZI2A 2IS1A 1U1DA 4E13A 3WSTA 3HMQA 3VC7A 3IDAA 1E7YA 3C7CB 1H2BA 2B5WA 3BAFA 4ERXA 1Z6YA 1PHRA 1M6VA 2XRZA 1DI0A 1P91A 4NKRA 2W4MA 2W2TA 4JGBA 1T2CA 3AP3A 5IN4A 2X0NA 4BJ3A 3PRHA 1UANA 3ESXA 4N0DA 1Q7EA 2DTXA 1JX6A 2C9YA 1M2FA 2HJSA 2XMGA 2W9XA 3F90A 1X94A 2BC9A 3PQ7A 4P4GA 1RYYA 3U7RA 3D6AA 1XRJA 1HFJA 3IILA 5DN9A 4WD3A 1MQ8B 5CA1B 2QR5A 4ED9A 1Y9JA 5CITA 4G89A 4HQFA 3HYRA 5GVRA 5MFZA 1FFWA 1V1RB 4GLOA 4AG6A 4PLFA 2Y1CA 3JQ9C 3FNIA 3G2LA 4BQSA 1GGFA 3QFTA 1VRVA 3P2MA 4Q19A 1H8ED 2YWBA 5A4AA 1BXKA 2WHXA 3LU1A 4OO3A 3WLOA 3QE4A 1SBHA 3ENQA 3E23A 4LA4A 1NVFA 3O75A 4YRQA 4O29A 2C5GA 4YCJA 1H2FA 4HVLA 4UATA 1BN6A 1IY9A 2F67A 5BQ5A 3CUWA 3ZVNA 3BREA 1BROA 4D41A 1UPAA 3KETA 2XDWA 3VZQA 5CEJA 2NNWB 3TH5A 3TSZA 3KK0A 2QL9A 3FDJA 1N7HA 2GBCA 2I6GA 4JBLA 3T0GA 3HXMA 3R5SA 4GKVA 5JH7B 1ZC4A 2ZTSA 5DTMA 4EG8A 2HA2A 3BUSA 5B2ZA 4R8MA 4S1TA 4NS4A 4AZ0A 2FPIA 4JHLA 4EIWA 4BVEA 2ZE6A 3UOWA 5L3SA 1KNXA 3AEUB 5DGHA 3L7LA 3VGPA 3I6IA 4JLDA 2ZRLA 3ZWAA 3EEYA 3V55A 4MO9A 1NYQA 1JF8A 1VJ0A 1K7EB 1F9EA 2FR1A 2M6KA 4EHJA 1X80A 3VOBA 2PZBA 1Q1ZA 3CCCA 3DPIA 5EKXA 4BS9A 3ZUGA 4K9QA 1L5RA 2OCYC 2NYAA 4PZDA 2XCQA 1V6SA 5EL0A 4L9SA 3M3DA 4L8FA 1JYFA 1UBCA 3N0RA 3GDOA 5EVJA 5HBGA 2P9JA 3I52A 2OBMA 4GYKA 4XPIB 4C0JA 4IZ6A 4YEDA 2C5HA 4CQMA 2ZB2A 3QJYA 4BU1A 4F84A 1J9EA 3I2FA 2MYUA 2LRHA 2Q5OA 2PH3A 1ARZA 1U0RA 4EDFA 2X9GA 1NJ5A 2O1WA 2P2YA 2B9VA 2D1FA 4GEGA 3QBVA 4W5HA 5E1DA 3PTAA 4C21A 1OUMA 4KDRA 2FPKA 1K27A 1QRDA 2NTVA 4XVHA 3RU3A 3WL8A 4D6YA 4V0OA 2Y05A 1J6UA 3AUXA 2WZQA 2VH5R 3AJRA 5FBZA 2E4VA 4UHEA 5HFAA 5CFMA 1P4RA 4P3PA 4A8HA 1DT5A 3C1UA 2O2SA 4QYMA 3WQSB 2F3RA 4DMHA 4EW2A 1QU2A 2AYXA 3SXPA 1JHUA 1NVUQ 2EVWX 3T1TA 2O50A 3CF0A 1M9NA 1ETUA 1L5KA 3DUWA 1KVSA 4LNUB 4D9JA 1H1LB 2ZETA 4J7UA 1PJAA 1C8VB 4Y2XA 2W42A 4KEAA 4A5SA 3R41A 1JTVA 3FTPA 5LOVB 4H35A 3CVJA 4ZTBA 1XSEA 2JGIA 3BBLA 2X41A 5A04A 3EOZA 2P1RA 4D74A 3K70C 1U0OC 1ID8A 4DTIA 2ZR9A 5KU7A 2ZB8A 3MCWA 4MS1B 5FWXA 1KGSA 3HJRA 3H5WA 4YRMA 1RXIA 1JEQA 4FYPA 2HIHA 4H15A 1EB8A 4QFCA 3IUNA 1NLMA 1TMKA 1R6XA 1RJ9A 2YN2A 3I30X 1T5DX 2V7EA 2HRDA 3L7JA 4XYGA 4BFZA 5A5EA 3LBYA 2GZSA 3C3CA 4I3FA 4ZAYA 4W7IA 4D0RA 5IXSA 3ZY2A 1M1NA 1Q0QA 3FKJA 3FUCA 2R84A 3VHQA 2IQIA 4UBOA 2FTKE 3GFTA 1AKEA 1DIGA 4R81A 3DL7A 4GX5A 2B7LA 2PDAA 3E15A 2ZW9A 3N5CA 3L7YA 4Y6OA 3W6OA 4D45A 5KTSA 3UO8B 3U3KA 1OFUX 2EKQA 3O5AA 4ZMRA 2DLCX 1EG7A 1N9GA 1RQ7A 1L3BA 1RWVA 3MRXA 5G41A 5H3CA 1VYTA 5C8VA 1DUSA 4LDQA 2Q45A 3U39A 1EA7A 4OQEA 4JUDX 4F2HA 2PRYA 1XRLA 4Q4JA 2EP5A 1NW9B 4BNGA 3QLVA 4RSHA 2JJ1D 3U62A 1WTCA 3KXDA 4G0XA 3X1YA 4H3HB 1CR2A 1WD7A 5AXBA 3GFPA 2F8LA 4WZAA 3VU9B 3FDIA 2W6PA 5KHLB 1B42A 1JMKC 3CMCO 3GZNA 2CDCA 1JNXX 3GRVA 3AOEA 2DWCA 3KZKA 4C78A 4DIBA 2VTDA 5TX7A 2XB2A 1SCUB 2WA1A 3G1WA 3KKLA 2XKJE 1HSZA 3IEUA 1KAOA 3EF0A 4DCUA 5A03A 2GJSA 1NM5A 2I7VA 2VJYA 1VCNA 2W4QA 5EGNA 2XYVA 2AJTA 1QTIA 1QYXA 2HF2A 3NANA 4JYCA 4HFRA 2ZUUA 3R6GA 4XQ9A 2FSFA 5EWJB 1X1QA 4IWXA 1P0FA 4TVOA 2X42A 1TLFA 4O4IA 3Q1LA 5HQTA 4AKGA 2R5WA 1YE5A 2RGGA 3TSYA 3TFQA 3NHLA 3PZRA 1R15A 5FBKA 2GEVA 3BRQA 2XQJA 3K0SA 3LH5A 2C1XA 2WE7A 2Z2YA 4GNRA 4HX9A 2DQKA 3NH6A 5KVQA 4JJ4A 4X71A 4NJOA 1PKEA 1JLLB 2PG3A 4J16C 2QI9F 1UQTA 4K6HA 2PX4A 4GE3A 1P7VA 2PL1A 4CEHA 2WM9B 621PA 3IQIX 1HZJA 1USVA 2W2LA 3MAGA 4KV9A 4ARIA 1UODA 3FMPB 1OX6A 1K7YA 1P0PA 2OZKA 5FADA 3E9ZA 2OVBA 2PUGA 3RBZA 2J41A 1SA0A 1M3SA 3QPUA 1ESEA 2WSIA 3N70A 5DNYB 4R6XA 1RJWA 2AR0A 2PWAA 1KZ6A 1HYBA 1SKBA 3HKBA 1K6IA 3O2JA 5I7OA 5KQRA 4G41A 2HPAA 1GGKA 2QN3A 2W6NA 2EOAA 3PK0A 4H60A 3B1FA 2GUGA 4YAGA 5MGNA 1MJGM 4HADA 5D6OA 4CDGA 1U0HC 1U3WA 2I03A 2J5RA 4BMSA 5JVDF 8ATCA 1XEAA 2Z2JA 3S29A 1M67A 4NG4A 1Q50A 4EHKA 3DDWA 5DM4A 4JL8A 4EFDA 4MVXA 1OHHA 7ABPA 1D6JA 1W88A 2EW8A 4HDSB 1C0EA 3A9CA 4RMGA 1ZXLA 1IQPA 5HNKA 2C4WA 1I9GA 3WYBA 2PMFA 1J9GA 1ULSA 4UUNA 5IUJC 4HS4A 4B81A 4MR7B 4WERA 2R1TB 2YCLA 3F96A 2HDNB 1SD2A 1P75A 1WX1A 3H6HA 3HL4A 4HN9A 2JD0A 4IIJA 5AQEA 1XN4A 2PR7A 1RQ2A 2VDNB 4L6CA 3IOBA 3TCXB 3LQQA 2NYUA 4TROA 1ZSYA 5JCOA 2VSOA 3KWJA 4FGZA 1F8XA 4I1YA 2DH5A 2R8EA 2JFBA 3S2YA 5ICSA 4F3TA 2RAPA 4XGKA 3LRXA 5JCZA 3VR6H 1EFTA 4QPZA 1QYCA 3Q15C 2RI1A 1RAEA 5IMBA 5BUQA 1YU6A 2ADFA 3JWEA 3TX6A 4P7GA 2VHVA 1WOYA 2Q0QA 4W1PA 1NASA 4DV1B 3BZWA 3FNHA 4XYBA 2YZKA 2OGZA 4II3A 4RABA 2HWWA 2NXJA 1W1IA 4OHMA 1KXZA 3LCVB 2RC5A 2FVXA 3LUDA 4FDUA 2VHCA 4XJXA 3SZLA 3ZN2A 5CG1A 2XZPA 3DTVB 2DUNA 2QR3A 1C9DB 4DQXA 4UTOA 4KR2A 1KH1A 4HDCA 1XMIA 1E32A 1GN9A 1VXOA 2O7QA 2P35A 3CKKA 3JASA 1RXYA 4GPZA 5EJGA 2QAGA 4Z7OB 1SELA 1ZHHA 2ATXA 5DBHX 1AXRA 4YYZA 4CXMA 5EWJA 4ZN6A 1V3TA 1GTSA 3KSZO 2EL9A 3RVOA 4UVGA 3MMZA 1QF6A 1TAUA 1DQSA 2EKZA 4YRPA 4ENUA 3IXMA 5K8JB 1JKJB 1GR0A 2X2PA 4BLVA 4LRWA 4Q6BA 3DT8A 5JLJA 2OGUA 2RHDA 3IBFA 3ODGA 2IOFA 1YMUA 4NZZA 1DGQA 2WVAA 3L1KA 1G8FA 4Q0MA 1KP2A 2XNKA 4ZAZA 4C4SA 1RBMA 4UOQA 5JMWA 1NXVA 4KKXB 3JQEA 3OOYA 4GR9A 3NTQA 1IXKA 2IGBA 5ETJA 1Z56C 1NU8A 3WKEA 3U7HB 1MLDA 2H5IA 1E3TA 2AN9A 1UPUA 5EIFA 2OK8A 4D79A 3K35A 1T9GS 2QI9C 3F0TA 3M9LA 3NM6B 2BMWA 5KPDA 1P4SA 3FOWA 3D8UA 4FYXA 2YWRA 3VYUB 1U2ZA 2A33A 3FJ1A 1THGA 2X9NA 4OQNA 2P3OA 5A5DA 1SUSA 1VSUA 2C96A 4JV5B 2JGDB 4QBIA 1Y8CA 4RA6B 5DCYA 2X9LA 3RUFA 4F86A 5A4DA 3AP2A 1LPSA 5AESA 4EGFA 4D9EA 5IVDA 2LGJA 1COZA 4DKXA 1EUQA 3JATB 4BN4A 4OJMX 1ICEA 1PW7A 2VRNA 3PXBA 4KACA 1FDTA 1F2TB 1SEVA 4MHOA 3MAJA 5SZKB 2P9TA 2J0VA 1OD6A 3IQGX 3PD7A 5ER9A 2VO1A 3SM3A 2C0QA 3WDSA 4QC2A 3ZDRA 4D3YA 5A0FA 2WD7B 3QYFA 3SIPA 3Q8KA 1EXWA 1RYZA 2BFNA 4CT4B 1KEVA 3HSYA 4DLRA 1BJTA 1RQPA 1IJEA 2CFTA 1JEQB 2C5AA 3WS7A 3K5WA 1E3LA 4PYOA 1AF7A 4BL5A 3PDIA 4D5GA 1MTOA 5G1OA 4EJMA 1VFNA 4EQZA 4XIIA 1BTOA 1E6WA 2QQ5A 1N2JA 2ZRGA 3GYGA 4A03A 4AJOA 1U3TA 4TTSA 3TLCA 2B2XA 4J4HA 1S3IA 1Z4KA 2YMLA 1MABB 2VNIA 4ZXPA 3UK0A 1S2MA 5JZBA 1Y6FA 4B5KA 1NDHA 2A6PA 1L8QA 3AB3A 2BGNA 3M6LA 3NYIA 4NY1A 2OA0A 3SYTA 4YMHA 5J63A 4AO7A 4JJ6A 1PHPA 5GMOA 5JRDS 1E0KA 1J0DA 3IELA 2VJCA 2QYTA 4P2BA 4LJRA 3RWMB 3ZQUA 3G0HA 2HEGA 4UBMA 3TQHA 2HF9A 5FPPA 3X0DA 2IS4A 1EP1B 5CAEB 1YB1A 3EMBA 4JA0A 3GLKA 4FOTA 3X1XA 1GZSA 3U4QA 2VNJA 1XMPA 4AVYA 3I1YA 5CIQA 1GNTA 2AEJA 1Z4OA 2VK8A 4OHVA 2IPNA 2VDKB 3KSUA 1CPYA 3STVA 3P9CA 3FIUA 3GT7A 1R8JA 3MB5A 4GOOD 4EOGA 3MELA 1YIOA 2GO1A 1QH9A 3C4QA 5AW6A 4X6LA 1SOAA 5JSUA 2NUPB 3QPWA 4K9MA 2GWRA 1L4LA 3C97A 1UMBB 4B31A 2OORA 4KRYA 4NCAA 4YWHA 4UZSA 1FYXA 1TVKA 4GWLA 3OZVA 2V4ZA 2HQOA 4GR4A 4BMDA 3CPHA 3T38A 5TF4A 3LPMA 1S7CA 1QYIA 1KP9A 2Z4SA 1OA0A 2ADMA 4R7GA 2H65A 1MT0A 1XAHA 4DGQA 1UM8A 1Y3HA 4WZAE 4D98A 3CEHA 3RUPA 4REMA 4B75A 2B6HA 3KLPX 3ONEA 1XD2A 3S68A 4R9NA 1A7AA 1CE8B 1GPH1 2NZXA 2VQSA 2AUTA 2HSDA 3A6DA 4O2AF 4PYNA 4RF2A 5AHWA 5IANA 1RJGA 1ZH8A 2A4KA 3E84A 3FNFA 3GW8A 1T3TA 2OFXA 1IM5A 2P2LA 4AQDA 1YB6A 1FXWF 3D6NB 2GEJA 4ID9A 4W9RA 5GM2A 2XQVA 5EVCA 5GY7A 2V7VA 2BMFA 4LYAA 3V1LA 4A26A 1V48A 3QLVC 4GXRA 4OU4A 3U4QB 1WCWA 2PYZA 3BZUA 3RBVA 2JEYA 2ZROA 1LI5A 3PQ4A 3KU4A 4RM3A 5BWCA 3J81A 4XQEA 2GI4A 4MI9A 2YRFA 3P1JA 2Z6VA 5D87A 4CTKA 2E21A 3VZSA 2V5AA 3L8CA 3AKDA 3AOEC 4GXQA 4I4IA 4UE6A 3DHNA 4A2QA 1GCGA 3VOAA 1HWYA 1U0NA 1NBAA 1S2LA 4BC0A 2HY7A 3W5VA 5A4KA 3VO8A 3H19A 1ZUWA 2FJ0A 4RUKA 5CH3A 1VL8A 4TS9A 3BIOA 4B3TB 3D1JA 3OM0A 2JI8A 1C0LA 4LMRA 5KTNA 3B1KA 3QKWA 2ZSFA 3KJZA 3CVXA 1XCLA 1ZRHA 1KERA 3BK7A 4MYHA 3L02A 3UAOA 2F9LA 1ZS9A 3KQKA 2ATVA 3OKCA 1HR0B 4PYMA 5JWRA 4YX9A 1UBNA 5I7HA 3QNMA 5JSZB 2YS7A 1WNFA 1YZLA 2C99A 4IGIA 4QXRA 1IWBB 3VHXA 3NRJA 4ACAA 1USIA 2GYYA 3HZOA 3PIIA 5AUQA 4G6ZA 4M76B 4BNDA 2J6BA 3KPJA 2WJPA 2H48A 2BV3A 2XTNA 3JZFA 3PGA1 3RWOA 5HQ3B 3W7BA 4OI1A 4P0PB 4CMAA 5FOQA 1T6YA 1QRAA 2IW3A 1D2MA 3RVBA 6GPBA 4YIKA 5HE9A 2B34A 3EUEA 4POAA 4Z7JA 1YJBA 2B1GA 2ENUA 1F1JA 2ZE7A 3I3OA 5K3CA 4OYRA 2IU0A 4YBZA 2CHQA 1E2PA 1EM6A 3KALA 3VH4A 2ZT8A 3J81k 1SMKA 1YZHA 2PKCA 1L5HB 2X8JB 3QVVA 4UEQA 4YJ3B 5GAJA 2VYNA 1XAJA 3HBFA 3MZ0A 2FFBA 3PPYA 4U6NA 4YBRA 1PUJA 5G2OA 3U3DA 3VV3A 1G4UR 4RA6A 2E82A 1UPBA 4GC5A 4Q3CA 5FJIA 4AG5A 1GA1A 2PFGA 3GNSA 4XXHA 1V2HE 3RC1A 3BJRA 1IWPB 2FAXA 2VWGA 3VO2A 3R7DA 2HXGA 4ZU1X 4BU0A 1N6HA 5DV9A 3N8IA 4IEIA 4TTAA 2OUIA 2Q3HA 1NYLA 5ADVA 1CLEA 1GGNA 3F3KA 4QOEA 4ZAVA 3GRFA 3A6KA 2YNMA 5I9TA 2H8GA 3H11B 2AEMA 3I9MA 1JVNA 1A7KA 4L5YA 2GK4A 1U7OA 5D85A 4YUXA 5BY2A 2C20A 2WZCA 3A6GA 3HRKA 3V4SA 1M34A 1C0KA 2C2OA 3H7AA 3LPLA 3EWSA 1JKJA 1KI4A 1XF9A 2PZMA 3IEPA 4A9AA 4CM3A 1DX6A 3UGQA 4NS1A 3FYCA 5JATA 5CT6A 4MQ5A 5DI9A 3UJDA 4RXMA 5BW6B 1SUDA 3E81A 4XCXA 2WWTA 4JEHA 1YGPA 1Y5LA 3A1UA 3SY8A 4BZZA 2DU8A 4X44A 3BXXA 2R86A 3GGSA 2B21A 4KIJA 3VNBA 3WYNA 4C4YA 4GL2A 2HK9A 3WZLA 3EQ8A 4YUZA 1X2BA 4WUTA 1ECCA 1UXHA 1XFDA 3ZQ4A 2BGIA 1KWGA 1F8UA 4MQLA 4AF6A 4EK9A 1FVXA 3IPYA 5IRCD 1IBLB 4HYTA 3ME5A 3RNOA 3M0EA 3WK6A 3ECAA 2EYUA 4RQAA 3RIGA 1CY4A 1NIPA 1PFKA 3I0NA 2WIGA 4Y7DA 1DRWA 1E61A 3MVEA 2ZJ7A 1O6CA 3MC1A 4EX7A 1U0TA 3OZXA 1V8ZA 1BVUA 2J6CA 4UZFA 2EJUA 1EJ0A 3BGSA 4G0ZA 1CYDA 1XJCA 3BRWD 2VWQA 3ON5A 3SM9A 3T54A 3FWHA 4E4TA 1YTUA 1JG7A 2QGNA 4IIJB 1U1CA 2C2BA 5TT1A 4ODIA 1F6DA 4FDVA 3OQNA 1J1IA 1GKLA 1FRVA 4HYQA 2HEIA 2YXPX 2P5TB 1E5QA 1SPXA 4IH4A 1SNYA 4LZJA 3GLVA 3NV7A 2GN9A 3GT0A 4HDOB 1V3UA 2AE1A 4PSAA 3RGWS 4LRXA 2NZJA 4MDYA 4L4ZA 3MTGA 2PSEA 3FHLA 4QOFA 5FL7A 3KOOA 4FBGA 4D99A 1L1QA 4LI0A 1P1KA 4RWEA 4B6QA 4EJSC 5DISB 2AW3A 5JD6A 4MP3A 3IR5A 4Y9UA 3L0BA 4EZEA 2ZJ3A 3K9WA 4M1ZA 2NGRA 3OEHD 4O2BF 1EWQA 3PNKA 4OX9Y 3OWXA 1MG5A 5FULA 1MD9A 1QZUA 3RRJA 2C2KA 3TQQA 3O4RA 2GHQA 5E8RA 4WLVA 1C3XA 1Z7EA 4CDMA 1ZD5A 1UP6A 3F49S 1A4UA 5LMZA 2YFHA 3F2IA 1ZK2A 3IT1A 3U7QB 4C7OB 4V0SA 1E58A 3DHWC 3SHWA 1NLUA 3HM2A 2H1IA 4WKNA 3TYXA 3PUIA 2XAUA 3RV4A 5LNK6 3GGPA 4F06A 5JMOA 1AMNA 4BPBA 2BGTA 3RTCA 2HHLA 3UAZA 3O38A 4QTYA 4G5FA 5DCUA 3HJUA 3B3JA 2ORVA 3NNNA 3TR6A 4CGYA 4BE7B 3VPFA 1HDEA 1VPDA 1YFJA 4YVFA 4WPGA 3PJFA 3A27A 2X3FA 1SEPA 3G79A 1IUNA 1JLLA 4H16A 5ESWA 5T4HA 4UUOA 3ZZTA 2C78A 2EFGA 4MUNA 1Z0DA 1L7OA 1TYCA 2GUWA 3IBTA 4HN2A 3E2IA 3KDPA 1Y80A 2ZU0C 1BX1A 4WECA 1O96B 4H4CA 3VJRA 2DBZA 3H8VA 3TS1A 1OLXB 4RX1A 4RXUA 1J7KA 2BEJA 4UDXX 4ER3A 3DJYA 5JQWA 3KT0A 13PKA 1KQGA 3U56A 4KPYA 4S1NA 2Z30A 1GL6A 3CRZA 3QVWA 5HOEA 3L6DA 3CX6A 4DDKA 5KWVA 1JHAA 2B4RO 5TQ0A 2FY8A 1FNBA 1GPNA 1JECA 4Z53A 3FNEA 4M54A 1E1MA 4YLGA 4JWTA 1LNQA 2PMDA 5AXCA 1X7XB 4LVOA 4CMEC 2QQEA 3EUAA 1W6RA 3UPTA 4KLZA 1E9CA 1UBUS 1C4OA 1BS2A 1DAIA 1VYUA 2M98A 3GUYA 3IV9A 1D2EA 3JASB 4NCXA 2E5WA 1V43A 1IN5A 4YN3A 4MW5A 2V0GA 1JMVA 3K0FA 1SQ5A 3WTCA 2XNDA 5JAOA 1EE2A 1G66A 1FNMA 1XGKA 1MRSA 2C9BA 3CG4A 1VG0B 4GAEA 3OZIA 4R9SA 5HA5A 5SYNA 4X62B 4L7QA 4CM4A 1L7DA 1L7XA 1XP5A 5ALPA 1Z6PA 1H8HA 2JGFA 4LE1A 2JL1A 2PD3A 2QF7A 4KWTA 1ZH4A 3SQLA 3P26A 1C7IA 2R44A 3EULA 4BIIA 4EITA 2JFUA 2PNFA 4MUYA 1N9GB 3G7UA 1G60A 4O1HA 4GBGA 9ABPA 3D8SA 2NT4A 1QGYA 2A58A 1OXXK 4C01A 5AH0A 5G4KB 1SQ6A 1F7VA 2GRJA 3CKYA 1PRYA 2F1JA 4Q1CA 4JJEA 2C5EA 2F1OA 2R1VA 3EBOA 3GLGE 1DIRA 3IQDB 1DBIA 2MTBA 2ZFUA 2COKA 3GMSA 4K0KB 3L40A 1RU3A 3K8YA 3CT6A 2QVLA 1QG0A 1JLHA 1IH8A 1F0YA 5I47A 4K86A 3TLZA 2QTZA 3FZGA 3WLLA 2X7XA 2QPTA 4OP1A 4FMPA 1T9DA 2JFZA 4Y2GA 4IL5A 4AP9A 3IEKA 3PL5A 4A7PA 3KCNA 1G2QA 1DXOA 4OI2A 5LNK1 3KAQA 1YUMA 3AFOA 1BVRA 2ZQZA 5KINB 1U6IA 5FFMA 2PV0A 3TLAA 5GOZA 3JYPA 1W4ZA 5B7GA 1YUNA 1VIMA 2E2WA 1EFDN 5IWCA 2IHNA 3WIEA 1G21A 3NBXX 4MGIR 4ZQIA 4JLJA 4F5ZA 1DWQA 1QV9A 1NSYA 2QD1A 3IAM1 2CE2X 3N2KA 2FCAA 1CQXA 3I1JA 5EIBD 2WUGA 5FEMA 3NBUA 2I2XB 4KTVE 4CKCB 3QVKA 1Q1AA 4LN1A 4BNYA 2BKAA 3FLBA 1N7IA 4O5AA 3UBTA 3G0IA 1EGHA 2Z09A 2R0QC 4QUDA 1SIUA 3TK1A 2ZYSA 1EIWA 1QKJA 5E9WA 4BWFB 2BMDA 3L8GA 3IA7A 5AUNB 2WSSA 5C53B 4D4KA 1AUVA 2H1HA 1SXJE 3KUUA 3Q11A 2ATEA 1JIIA 1U2QA 2A9RA 5DLDA 5AVUA 2IX9A 4ZAWA 5K3OA 3KQNA 3QKUA 4JB3A 3U4MA 1QHIA 1ONNA 1IY2A 2BGMA 5EPOA 4XUDA 2PJDA 2OFFA 2W2KB 5BURA 4LDJA 3DFUA 5EUMA 1NUQA 1MZVA 2GPNA 3AB7A 1E2HA 2J5BA 1TB4A 4EFNA 3E5NA 3AJDA 2OV3A 1ST3A 3OCYA 1SC6A 5KTRA 4I50B 3RUHA 1HG1A 2VHQA 3KNZA 4XJSA 4FFBB 1BDHA 3GELA 1KU0A 1QO0D 4XVCA 2G82A 1A2QA 1OC4A 5JI2E 1G63A 2REQA 1YAHA 4DN6A 1XDBA 1ZU4A 4RIEA 2XCOA 4NU8X 4QYIB 2GK6A 2JJ2D 1WQ1R 1D1SA 2Q3JA 4QYWA 4A2PA 2HMTA 4OMCA 3VXKA 4LSWA 2RHOA 4PYQA 3B70A 2NMVA 4RTRA 3DKVA 5EHGA 1ZX1A 2HJHA 4ZT4A 5BPHA 4AMYA 1VG1A 3NEPX 5F3RA 1PJBA 1ZHFA 3I2KA 5CX4A 5F78A 1T36B 1W25A 3GA5A 3ORHA 4NC9A 4C4XA 4D9CA 2QRLA 1VSBA 3ZH9B 5F23A 4LQDA 1TM3E 4JL5A 3ZY5A 4CL8A 3AXTA 3HYTA 3A6HA 3FGNA 2CMHA 4YCDA 1UAGA 1UKVY 1KQPA 4X00A 1HPLA 2DHCA 3Q7TA 2O3UA 5EQDA 5F9FA 4QGAA 3PP8A 2Z6QA 4Q4JB 3KHSA 4QM6A 1QQAA 4RDHA 1TTPB 3KYCB 1JEDA 2GD6A 2WT8A 3Q7QA 4M0PA 2X6TA 4XVRA 3S55A 1BOFA 3ZY3A 3KDSE 3Q0EA 1Y8ZA 1WRBA 2V3VA 2C7QA 2NXEA 2AQIA 3S2ZA 1K4KA 4M60A 2VIIA 4FFLA 2Z2XA 2JF0A 4J07A 1TMGE 3RC7A 1P3DA 2WLTA 4LCJA 1OIXA 1ZNQO 1UEIA 1L0BA 2J3MA 3Q7PA 2JARA 5HQ3A 1CZOA 3B78A 2CDNA 2VUIB 4HEA6 4RF5A 4QBFA 4NNJA 3ED1A 1XMSA 3QBDA 2TECE 3ADOA 2P5YA 3KBBA 4NBUA 1G8JA 4OVKA 4B3SB 3VVLA 4YASA 4NIMA 4DZZA 5FOSA 2WMDA 4KQIA 1ZWKA 2V6GA 4IFIA 2J6IA 4NCIA 4LJLA 5DN6A 4ER0A 4HD8A 1XCJA 1E1RD 1E8DA 2WUWE 2LW7A 1DJQA 1ZCBA 5EKDA 1N2CE 2O8NA 2OVFA 1QH8A 3A4NA 4ND6A 4IWNA 3GO4A 4M38A 5FPYA 3TB6A 1XKQA 3A10A 3UK7A 4U2BA 2IODA 1NDUA 1G6KA 1T13A 3WWOA 5A1JA 1E9DA 3OCZA 4L0QA 2YFKA 3LHKA 1DC8A 1DX4A 2OC4A 2QP4A 1TLLA 3ZJVA 3MMNA 3ZWKA 3BG5A 3FZNA 2O8DB 1CV2A 1ETHA 3D7SA 4CF7A 3OMLA 3IR6A 2CHGA 5FOVA 3VYSB 3FR7A 1YS1X 1I4LD 2JA1A 2VH1A 3LFTA 5IJZA 3O26A 5FWYB 4FFRA 3GDHA 3GVIA 16PKA 2ZBDA 4C6TA 4R40A 3GR6A 4V38A 1AHHA 3A6LA 3ZZUA 1JG4A 1M74A 4AB1A 1OJLA 1TGVA 4N5DA 5LWHA 2OQVA 5CD1A 3KQTA 3PUWA 1VHJA 1M0TA 2D2EA 4H4EA 4RMIA 1PT7A 2CHEA 3AFHA 1UBMS 1A8HA 3DZJA 3G49A 3QVLA 4YJGB 4AU1A 4D7AA 1I4WA 1XHLA 1E89A 1YULA 2G72A 5IASA 5LIRA 1EFRA 4EGQA 5LN1A 1CS0A 5EIXA 4HGPA 5G0WA 4CQLB 2HDWA 1TKCA 1V8BA 5JBIA 1CE8A 1N6LA 4XPIA 2QU7A 3LP8A 3VNQA 3GJZA 4COKA 1RJFA 3C7TA 4HNQA 3MXOA 1T9HA 3LVBA 5G40A 5KTYA 3I1FA 1SG0A 1YQWA 2XHZA 3BAZA 4MS4B 4REQA 5HS6A 3UCEA 4DBLC 1KI3A 2ZSIA 5E4YA 3T3MB 4DIUA 5IG2A 2XW6A 2BOVA 4LFBB 1PTJC 2P9FA 4GRAA 3UHPA 4XCVA 4AWBA 2A9JA 3DZCA 2G83A 2IV3A 4RFLA 3RYFA 4CCAA 2IDKA 1GD1O 4DG9A 4LTMA 4PHHA 1BWQA 1WU7A 5AVVA 2C9MA 1C2TA 3RYIB 1N8KA 1Y6GA 3KE8A 1Q2UA 3WFZA 1MX3A 5CDGA 3CW2A 4QRIA 4YRIA 5SYMA 2IYUA 1LJUA 1TU0A 1XZIA 2PGNA 2V4MA 3BB4A 1CD5A 1RVDA 1BEEA 1UT6A 2NUPA 2FSPA 2ODQA 3PKZA 2GAIA 5C8XA 5JH7A 1RT9A 1WKVA 1F8YA 1KJ9A 1WPRA 2QZJA 3IHTA 3U1VA 1CKEA 4DOMA 1L7PA 1SUWA 4OF4A 3IKMB 2G70A 2VBFA 5D86A 3RIXA 3RAFC 3WGKA 3UKOA 1E3WA 3OX4A 4HSEA 5G0SA 2SICE 1BVHA 2FMUA 1PD1A 1JHRA 2CVFA 3CONA 3IAEA 1Q1GA 3ANXA 1RRPA 4OUDA 1B3RA 2E4WA 3QXCA 4CKBB 2Q2VA 1U1GA 2VSFA 5KNCH 5C52B 2PMKA 2YZ2A 4IHJF 5BOSA 1OFTA 4DWWA 4FOLA 3HJCA 3Q5GA 1P8JA 5F2EA 4IDBA 2W98A 2YV5A 3UVEA 1DDGA 1E3IA 1DTEA 1EM8B 4F7WA 4BKPA 1KMHB 5FRDA 3WBFA 1G7TA 5IK2A 4QT4A 4OBBA 1QF9A 4ZIRB 5KTPA 2V0NA 4CLEA 1NHGA 5KNDA 1FDOA 1OVMA 4DR2B 3AUUA 4IOMA 3CU5A 3HUFA 4ZGBA 4DB4A 3X1ZA 3G8AA 4WCFA 5ALOA 1O94D 2QRMA 3GRCA 2R97A 4ZZIA 1H6AA 3ESAA 4CMEA 5ERXA 3UMJA 3RS4A 1VM6A 3UOGA 2H9YA 2VPWA 4TSFA 3V33A 4LBZA 1VPTA 3JPWA 4GRDA 4RPIA 3ZHQA 3ZJ4A 4FHFA 5BSGA 5AVYA 4M1TA 4JXKA 4NZNA 3LTNC 4L27A 4YI5A 3LPNA 1U2DA 1AUOA 2WYVA 3TJRA 2IHBA 1EVLA 4JBHA 1YR7A 2ZSBA 4AJHA 1ZOLA 4XD2A 4Z9FA 1JR3D 2P4EA 3E7DA 3K0CA 3AI7A 3BQMB 1DEAA 2PLNA 2VK4A 3N2EA 1GG5A 3DMNA 4OHRA 3TZHA 2PUFA 5TMPA 1Z7YA 3G89A 2WWGA 4L9RA 2B2NA 3G9XA 4YMTA 1LVUA 1RMTA 1XVLA 3K9BA 1E0SA 1NUHA 4LAFA 1D2GA 4LYYA 4CFZA 1C1XA 1LK0A 2XB4A 3BJZA 2AQKA 3QW4B 3AG6A 1FQKA 1JV2B 5AI5A 5H7XA 1WSWA 2YWJA 4D8XA 3MERA 2EX4A 2QTTA 2YV1A 3ZWWA 2JGDA 5A3VA 1V5WA 4XB1A 2YR0A 4KQ9A 3GNTA 3KYBA 3SXUB 2Y67A 1A97A 3K8OE 3VAYA 4WK6A 3TLYA 2FW7A 2TMGA 4A91A 1ZOSA 1WDLA 3H2ZA 1DBSA 1GRCA 1HEIA 1PZEA 2WYIA 5F5NA 5TQVA 3ZYCA 3IH5A 2XE4A 1LTQA 4X84A 3TFWA 3T4PA 5IPFA 2JJYA 3L77A 4JJKA 4O4HF 4MR8A 3KQUA 4XDZA 1E98A 2VWHA 1I1OA 3GFOA 1NY5A 5KTMA 2GLXA 4IJMA 5DEIA 1J0EA 4GI3A 4GWKA 4JODA 4UE3S 3G0DA 4TL6A 4Y2UA 1W5FA 3KSBC 2WLSA 4Q4HA 2A5JA 3OD5A 2X3YA 3DMRA 3T95A 2E6UX 3H2HA 2GZAA 4G01B 6ADHA 2ZIUB 4L8LA 4A6XA 1EQUA 4UQPA 1PT9A 4KXWA 4WOPA 4ARCA 4DDHA 4GMGA 4K5QA 2BKVA 2XJ4A 1FTYA 2GPWA 2ATCA 3QWBA 1GNVA 2FA9A 1NMYA 4LK2A 4O4JA 3W5AA 1SXHA 2JEZA 3J80A 2HCJB 3IUBA 2DSTA 3N7UA 4C2AA 2YKGA 4Z5XA 3ZR4B 2H9IA 2HW8A 1J07A 1N3LA 3EMKA 3RUCA 4B76A 2CJXA 1GITA 4NMHA 1YDGA 2I65A 3G0CA 1CY1A 2H4JA 3ED5A 3BOSA 2CFRA 2YVKA 2VYND 2XT0A 3ODPA 1QGUB 5L45A 1MEJA 2ETVA 3T5AA 4KQ2A 2VL7A 4CLRA 2R62A 1XRMA 2YVLA 3HJHA 4HRXA 1NNLA 2H1SA 3V6MA 2WB2A 4MKHA 1W4RA 4M86A 4PO9A 4CLHA 1U7PA 4DEVA 1YZ3A 2R7KA 4YP6A 2GXAA 4RHTA 4TTJA 2I9PA 4MINA 2JG3A 1L5VA 3K9GA 5KNCA 1QAMA 2RHJA 4LDNA 5F33A 4WN9B 3TQIA 1P8AA 2YOHA 3MQ2A 4CT0A 1QPGA 3O9ZA 2QL6A 2IHYA 1NUUA 2EP7A 4K3VA 4M7WA 2X77A 1K5GA 4CUZA 2WHRA 5IKEA 3UICA 1X3LA 1QFYA 2GHIA 2V98A 3SS8A 1IDN1 1X7DA 1VE3A 2OZPA 3KELA 2CHVA 3LFHA 4TMXA 5F35A 4CL2A 4R1LA 4KFCA 1QR2A 5DK6A 1HDGO 1T9BA 2YRXA 1YRBA 2J9FB 4CTMA 4R3NA 2JH3A 2IHVA 4GPEA 1KQNA 3WXMA 1IATA 2BFWA 2EC5A 5HRCA 5EEGA 1T6NA 1JG2A 2APJA 1BIFA 1TM7E 4WOBA 2PAFA 4MEJA 1NTOA 4DDTA 1W2WB 3B2EA 3D02A 4C2BA 3O1JC 2I55A 2Q4BA 3N2YA 1EIZA 1T8UA 1N1MA 1ZM9A 3OY7A 3QPVA 4HTFB 4Y18A 5CCBA 1P9NA 2JKYA 2WF8A 5FAXA 4BUCA 4YRNA 3K1TA 1MIOB 2OAGA 4RHUA 1SVMA 1ZH6A 4JQZA 1NE7A 1D2RA 1I0IA 4BMYA 2ZVDA 3BB1A 3L05A 3DOHA 2V1XA 4D46A 1IZ9A 3ZU2A 2IZ5A 4N8DA 2HZBA 3D2BA 3G3EA 1DKUA 1JR4A 1S3FA 4PEVA 1G5HA 1GP2A 4YAEA 2N3ZA 2IYAA 5LVAA 4DV3B 3FWKA 1PDVA 4C07A 1NVEA 4IG4A 5BR7A 2RDMA 2EBWA 5CDTA 2A35A 4PNPA 2Q5FA 3AC0A 1FFAA 2ZUWA 4TRNA 3H2BA 1TYEB 4YGXB 3RSQA 1T2FA 1Z8NA 1L7QA 1RI4A 4K1LA 3SAJA 5C1OA 3VR3D 3PPVA 3ULKA 1UK6A 5HZMA 1AGNA 3Q7SA 1G5FA 1PGPA 4I3HA 1GGJA 1N6NA 1P9WA 2A5YB 1ZD9A 3CRNA 5FO1A 5IDXA 3S8YA 2BI4A 3WMGA 1CK4A 1WDWB 2FX2A 3QVMA 3R3XA 2VRBA 3HDTA 3MT9A 4DB2A 1EXDA 1P4GA 3G1UA 4X1KB 1VJCA 5BVHA 4F92B 1VI5A 3KKNA 3SVZA 5JUWA 2QE6A 4ZRDA 2V1UA 4I5DA 2VPQA 1HMPA 3B6MA 1FVFA 4EPTA 2IZZA