2AZXA

Charged and uncharged trnas adopt distinct conformations when complexed with human tryptophanyl-trna synthetase
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
387
structure length
387
Chain Sequence
b'EDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYGDAVENAKDIIACGFDINKTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKMSASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 72-MER
publication title Two conformations of a crystalline human tRNA synthetase-tRNA complex: implications for protein synthesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/rna
total genus 133
structure length 387
sequence length 387
chains with identical sequence B
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2005-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00458 WHEP-TRS WHEP-TRS domain
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 2azxA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2azxA01
1KH1A 5AHWA 4ZT5A 4X0EA 1X8XA 2HZ7A 3FH0A 1OWNA 5KCMA 3FI0A 2X1MA 4S1OA 1T6XA 2QUJA 2IELA 3UY4A 2AZXA 1ZH0A 1WXEA 3P0IA 4XFDA 2E21A 1WJGA 1N3LA 4ZCQA 1NUUA 3PNVA 4GU5A 1KP3A 5FNZA 1VBKA 1G8HA 4ZT6A 4RPIA 5DASA 1U3CA 2GM3A 3RK0A 3LCJA 1WQ3A 1OWOA 3U1VA 1Q15A 5TGTA 4U8HA 1F4LA 3OP1A 1EUYA 2BTEA 2H2AA 1Y42X 1NZJA 1HYBA 4ZCRA 1K4KA 4YP7A 4OUDB 1N77A 3HMQA 2AG6A 4BWVA 4CT0A 5IJXA 3QTBA 1MAWA 1EE1A 4NAUA 3CR8A 2ZP1A 3QTTA 3LOQA 4PY2A 1JIJA 3C8ZA 4KKVA 4YP5A 4KR9A 4EG1A 5IHXA 1S4MA 4EG5A 3H97A 1WY5A 5TEWA 1GPMA 1TYCA 2D5BA 4L2IB 2PFSA 1BS2A 1M8PA 2C5SA 1K4MA 2DETA 4MUHA 1JEEA 4WSOA 4JYZA 2CFOA 1EJ2A 4MWEA 4QRDA 1QNFA 5BNZA 2V0CA 1J1ZA 1KAMA 1MBZA 4ND6A 2GOYA 3CVXA 3ELBA 4OJMX 3RJZA 3CVWA 1VBMA 2OV4A 4OUDA 1OWMA 3SDBA 2Z09A 3K32A 3L92A 1PG0A 3PNYA 2D13A 4YP6A 3FNRA 4NAHA 2QJTA 2J5BA 3CA8A 4MVWA 3H9CA 4CDNA 3AFHA 4R2LA 1KQOA 2WB2A 1UFVA 1J09A 3FIUA 1M8KA 1F9AA 4MVCA 3SZ3A 2J4DA 4K03A 1EXDA 4CDMA 1H3EA 5TS2A 4DJAA 3SZGA 1NURA 4I6JA 4L2IA 1QU2A 3TQOA 3HFJA 4YMIA 2BYTA 1TYBE 3VRHA 2A88A 4R2MA 3VU8A 1LW7A 4MVXA 4F3RA 1IVSA 1NI5A 4P2BA 1WZ2A 1KQNA 5TEVA 4MQ6A 3A2KA 2CV0A 4Q16A 4DDKA 1NSYA 1IFXA 3SP1A 5F23A 2NZ2A 4NZPA 5FO1A 1QU3A 3ZIUA 3HL4A 4G5YA 3MLBA 2WQ6A 3BL5A 3FHJA 2A7XA 1QRTA 1O6BA 5LM3A 4CQNA 1O94C 1J70A 3L93A 1OBCA 1G8GA 1FFYA 3CVVA 3H9BA 2TS1A 3MXTA 1EUQA 3HV0A 3DO8A 3K9WA 1X6VA 2YY5A 3DLAA 5EKDA 1PFUA 3HZRA 4UZEA 1KQPA 1TYAE 4HPWA 4MW2A 3TQIA 2V0GA 1T9GS 1I6KA 1M8GA 1CT9A 3S3TA 3INNA 2WQ7A 1IQ0A 5J58A 1WXFA 4G5FA 1O0CA 5J59A 4ZT2A 2IJGX 1KR2A 4MW5A 1GTRA 3UOWA 4AQ7A 1P7PA 1PFYA 3GUZA 4Q93A 4MUEA 1O94D 3P0JA 2JA2A 4XSVA 1KH2A 1O0BA 1NUPA 1H1TA 3FWKA 3IOBA 2DERA 4ZT3A 3IDFA 1QQTA 1JIIA 1I6LA 3E27A 3COZA 3IMEA 1OWPA 3MLAA 3TZLA 1VBNA 2CYAA 1IQRA 2J09A 5HG0A 2PIDA 3KT3A 4PBSA 4MUJA 1JHDA 4MUGA 1M83A 1J21A 4ARCA 1KKUA 4MW0A 1O97C 3ZGZA 2CUZA 2HGZA 2IP1A 1LI7A 2VXOA 3N8HA 4YBRA 2A84A 2CYCA 4DLPA 3ZJUA 3VGJA 4MW6A 2QUIA 1JZQA 1GTSA 1JILA 1O96B 3ZXSA 3ZXIA 3G6KA 3CVUA 3RFFA 3COYA 2EL7A 3Q4GA 3FG9A 1WXHA 2AKEA 1NUSA 1MRZA 1F7UA 1EFPB 3AL0C 3KT0A 1N2IA 1XNJA 2DEUA 2QUHA 2A1TR 2XRYA 2QTNA 2X0KA 1YI8A 3G59A 2DPLA 4EGAA 1JECA 5K0TA 2J08A 1QTQA 2I1LA 3CLSC 1V8FA 4DDHA 1H3FA 2D54A 1K97A 2E89A 4TS1A 1G59A 1O97D 1N1DA 1RQGA 5H16A 1TEZA 3ZJVA 2ZUFA 1K92A 3ND6A 4EG4A 2B7LA 1O96A 3N9IA 3DPIA 4MUKA 4DNXA 1NUTA 3COWA 3H99A 3D6UA 3SEZA 1JGTA 1EFPA 4WNYA 2A1UB 1ILEA 1Q77A 2DXIA 1T9GR 3HGMA 5JBNA 1VL2A 1OWLA 2CSXA 4JZYA 4ND7A 1JMVA 2QTRA 4MVYA 5H7XA 1J1UA 1QRUA 3CLRC 4U63A 3ND7A 4I6EA 1PFWA 1WXGA 3CLSD 4FZJA 1T6ZA 2A4MA 3N05A 5HUJA 1I2DA 2DLCX 5KWVA 4KR7A 3ZUGA 2Z08A 1R6UA 1Q11A 1VLHA 2EJCA 3F3MA 2PZAA 4EF6A 1PFVA 4MUNA 3KT8A 2CV1A 3ND5A 3AKZA 1QJCA 1EFVB 1WKBA 3FDXA 2G36A 2OQ2A 3H05A 2A1UA 1KH3A 4MW7A 3FETA 3M5WA 1N2OA 4MW1A 3IVXA 1JIKA 1NYLA 4MUFA 2CT8A 3ZJTA 1XNHA 5K0SA 1NP7A 4MLPA 1NUQA 1Q19A 2J07A 3CLRD 1SURA 1N2HA 2PZ8A 1N2EA 3IOCA 4JXZA 1A8HA 1R6XA 4JXXA 4ZT4A 2X1LA 2E18A 3IH5A 4DE5A 2YWCA 1IRXA 3G5AA 3X1JA 4G6ZA 1LI5A 1EFVA 1YIDA 3SEQA 3X1KA 3ISJA 2WSIA 1KORA 1MC1A 1U7XA 1GZUA 3AG5A 3P52A 4J76A 5HUHA 2CV2A 1XNGA 1O5TA 3UC5A 4PBRA 3IOEA 2QJFA 5LFAA 1N78A 1V47A 2A86A 3CLTC 3GMIA 4JFAA 2YXNA 3TZEA 2R5WA 1TFUA 3NBAA 2H29A 4EG3A 3IVCA 3CVYA 2CYBA 2Z3VA 2VTBB 1U0BB 2O8VA 1GN8A 5DK4A 4U7JA 2YWBA 5FO0A 4MAFA 4QBTA 1B6TA 3MMXA 2NSYA 1F7VA 4DDMA 3IVGA 1R6TA 1WXIA 4AS1A 1M1ZA 2E0IA 3IUEA 2QJOA 1N75A 3AIIA 2XRZA 1GLNA 3OTWA 3PNBA 1JEDA 2RE8A 3CLUC 2QUKA 4MUIA 4EG7A 3FOCA 4NDAA 5DEOA 4KPUB 2ZUEA 3IMGA 3D6VA 2O5RA 1QRSA 4QREA 1MOPA 2PXHA 1XJQA 3RHSA 4I6GA 3KFLA 1O95C 3CLTD 1ULHA 1FYDA 2DUMA 2VTBA 1J20A 3Q12A 4GRIA 1ZUNA 1G8FA 1N2JA 3JXEA 3A05A 3IUBA 4EG6A 4ZCTA 3PRHA 1M8JA 3TNJA 1I6MA 5J5AA 1TYDE 1KP2A 3IODA 1ZH6A 3P0HA 2RD2A 4NX2A 4KR6A 3NV7A 1OD6A 4HK4A 3TS1A 3NBKA 4MW4A 1T6YA 4F4HA 4UZFA 3A04A 1D2RA 4KPUA 1MAUA 3PXUA 4R0NA 1H3NA 1YIAA 4ARIA 2JAXA 3CLUD 4MWDA 1YUNA 3RK1A 2PG3A 3A4IA 4RUKA 3DV2A 3ILVA 3UK2A 1YULA 2DR2A 4EFKA 1IH8A 2HMAA 4A91A 1DNPA 1O95D 3QE4A 3IMCA 4EG8A 3KT6A 3SYTA 4J75A 3LE8A 1U3DA 4HJXA 4ZT7A 1COZA 3COVA 3Q10A 1JZSA 4E1AA 4H3SA 3AG6A 2X3FA 4ZCPA 1KAQA 2QTMA 4ZCSA 1YUMA 1IHOA 3GLVA 2JANA 3UMVA 2A1TS 3RBAA 1GAXA 4HJRA 3I05A 1IQUA 1N2BA 4K0RA 4MULA 5KHAA 2PZBA 1MB2A 3FY4A 3N2YA 4XFJA 1U7DA 1MJHA 1WOYA 1TQ8A 5DB4A 2GKSA 5LLTA 1ZJWA 1WQ4A 4NATA 3MUEA 4MWCA 1M8FA 1N2GA 1OBHA 4MWBA 4MW9A 1MB9A 4PBTA 1PG2A 3X1MA
chains in the Genus database with same CATH superfamily
1OPRA 1NTRA 4PYQA 1J90A 2FPLA 4Q6BA 4Q47A 3T5MA 4L4ZA 3WAJA 4Y2XA 5J1TB 2IW1A 5KCMA 4H2DA 4UM9D 5IAKA 4CMEC 1DG9A 3PE3A 4DLAA 1O57A 1KKLA 4K88A 3LUGA 3O4RA 2EW1A 2YV4A 1F5SA 1RBZA 1TO2E 2AFHB 2PUAA 1BD4A 4MARA 3AHJA 4MIOA 4AN1A 3K9HA 5E7MA 1KDRA 1VA4A 3OTGA 3QE9Y 5FNZA 5DGXA 3M3HA 4DC1A 2IYFA 3RANA 1CFZA 1U3CA 3TJRA 4FJ2A 4N03A 1CIVA 5CB4B 4JMLA 5FTMA 3IEPA 3TRFA 5J1SB 2EL9A 4U8HA 5EE9A 1WHTA 3GEDA 1FNBA 1F4LA 1ECGA 4ICIA 1TYZA 1VIMA 5H59A 4B2PA 3EASA 4CF7A 2XVAA 3W77A 4D0LB 5JNRA 5LQRA 4Y6QA 5SZKB 4D4MA 3RJ9A 3WBJA 4EARA 4LRTB 3RIMA 1B3BA 4M1ZA 2GCEA 5E2AA 4Q4JA 3AKEA 4AYTA 4CEIB 5ICFA 2XYVA 4PEVA 2PRKA 1FSFA 3AUYA 3K31A 4OQNA 3GIDA 3WGOA 2H1RA 3OE4A 1CF4A 4IJ6A 4HAXA 1GQOA 3I5YA 1G6KA 3H2BA 1XROA 2CDCA 3ESYA 4XFKA 3UATA 1SQ0A 2CXRA 2C59A 2HA2A 4JEHA 3JU3A 5LYYA 3GRZA 3CCCA 1GRNA 1X9IA 3MB8A 1Y4AE 1DO2A 3OQHA 3ZDRA 4ATNA 2X0DA 4CPDA 1YE3A 4L95C 4TRMA 5JS6A 1MHPA 2IXAA 2QP3A 4H35A 4OLHA 1KKMA 5NULA 4EEZA 1UAYA 3MBIA 1DDOA 1DEKA 4Q7LA 4JB8A 4ZO4A 1F2DA 1P1FA 2TYSB 1LRJA 2WG1A 1DKLA 2H4ZA 2XWSA 1TLTA 3DTVA 2V1XA 2IEGA 3PQ6A 3QVSA 3OZRA 4OGKA 3UJ7A 5LQDA 5LZ2A 1VPWA 1WBDA 3RO7A 2B2CA 4O5AA 3VNRA 1B74A 4AMBA 5BNZA 1CEQA 3ZE7A 4JJ4A 1TO6A 3O8NA 5FA8A 3CZRA 4HQKA 1EK5A 4JU8A 4C2TA 4FYJA 3F67A 4YUZA 3QVXA 3MCAA 5IJWA 3OZVA 3DKRA 1E2NA 3FNRA 4NAHA 1V8DA 3G0CA 2PZFA 5K3BA 3RS2A 4CR6A 2NAFA 1ZUWA 3LKDA 2JH9A 3CZAA 4GGMX 4XX0A 5F21A 3DAGA 2FA9A 2EG9A 4IOKA 3B60A 3UHJA 3O8RA 1E5QA 1UFVA 4DLKA 2J9FA 3IC5A 3GNSA 1C3LA 4IV5A 2JFUA 3L6CA 4IJMA 2LUOA 1RC8A 1EXDA 1RZ3A 1YH3A 3DXFA 3QELB 4YJ2B 3OQPA 1E9EA 1PKEA 8ATCA 4TMYA 1NURA 4TWRA 2Q8QA 3S2UA 1YBHA 4ZEMA 3CU5A 3TQOA 4XJSA 3OSUA 4N76A 4EWLA 1EBBA 2JCGA 1ZGBA 4D8XA 1Q22A 5A4MS 3PUVA 1L5MA 1ZM2A 1KWGA 2Q6IA 1K63A 1WZ2A 1FFEA 4P38A 3IQWA 4EYSA 1U2DC 4EH1A 5JMWA 2ZROA 3H18A 1ZHOA 3O31A 2EHJA 1EVEA 4HMQA 3SSMA 4D80A 1D9XA 3I2HA 2H63A 1P61B 1M2EA 2XVXA 1KOGA 3NEAA 4HLQB 3QX9A 1WPGA 2QPTA 4R01A 3L0ZA 4G4SP 5KYUB 1IWOA 1N9GA 3BERA 3LP8A 3ZIUA 3HKEB 4WJLA 2XBUA 1I7NA 4RESA 1US8A 3RBXA 4ER6A 3MLBA 4WE3A 2GNPA 3ZN2A 1S8NA 2AJBA 1DJOA 3ORQA 2QDXA 2Y99A 3UV3A 6CHYA 5KYXB 4EGJA 1KC1A 1AKEA 3V3TA 3C14C 2YV2A 2LV8A 3TIIA 2F55A 1DQSA 3G0IA 3CPEA 4RORA 1D2CA 3AEYA 5BN3B 3A9SA 3LA6A 1I5RA 2VYQA 2J6BA 2QL7A 4PR0A 3HFRA 1QC5A 1D4AA 3MT7A 4YS6A 3PPIA 3JPWA 2D6FA 5EKDA 3KK0A 3HYTA 1EUCB 2WSSA 4ARUA 4JGBA 2GHIA 5EESA 2FUCA 4J16C 2QLJA 4NBWA 3TEFA 4YV1A 3MSCA 2I4LA 3KSRA 4NBKA 5EVJA 4CQLB 1ZWLA 3F7TA 7YASA 3ENQA 1A9QA 4DCVA 2IYVA 2I3BA 3T15A 1HZZC 3HXMA 3HSYA 3M4NA 4HF7A 1HETA 4CTOA 5ADUS 1KJ8A 2W0SA 1I4OA 2OXRA 4KPYA 2BGTA 3EZFA 4CQMA 2Q41A 5CDYA 3WE7A 1H2ZA 3RB8A 2LXNA 2X5JO 3UOWA 2GR9A 4OK5A 2LGJA 4LE1A 3I8OA 4LRSB 1PYOA 5AM4A 5LC1A 1XTZA 3R7NA 2LDBA 4R05A 2BW0A 3SBOA 3QW4B 5IKMA 4CKCB 5BSFA 3MUFA 1F48A 3ZDYB 1HY3A 2WAYA 5IJ9B 4CU2A 1CUGA 4RVFA 1T5BA 2OOSA 4RTMA 2FX5A 1O77A 3FWKA 1I3CA 1NVMB 4JOBA 4M38A 4E5DA 4HUTA 3U09A 5K0FA 4E11A 3L0SA 1E62A 3E27A 3JQQA 3IMEA 3MTGA 4R68A 3T3IA 2WA2A 3DR3A 1E2JA 5LQAA 1T10A 1E9DA 5DHUA 3Q7QA 3SXPA 4URXR 2P2CA 1SCJA 5KHLB 2JLUA 3AUAA 4OPMA 4IWYA 2PL5A 4AF6A 3EIUA 5IDVA 3F9RA 2FPKA 1ILWA 1OTYA 1QIFA 2W2KA 3KSZO 4FZRA 4L08A 5KDLA 2IP1A 1LI7A 4FONA 1L8OA 4XUDA 1C7ZA 5TJHA 4B79A 4IIGA 4B7AA 5HILA 3IT2A 1H2AS 1Z0AA 3CX3A 3VAZA 4XVCA 5BWNA 2QUIA 2IGBA 3EY4A 3PGA1 2O4CA 2OCPA 4IQFA 3OQ6A 3TM4A 4DUGA 1ESMA 4G8DA 3TFQA 2YW2A 2OAGA 3QPDA 3BREA 1NM5A 3WOVA 1KZ9A 3UNXA 3FLEA 5B37A 1HRDA 4K5QA 3NVMB 3WGJA 1TMGE 4U6SA 1NX9A 2FH5B 1DB3A 2MSKA 3B8HA 1JHPA 3N70A 4EW1A 1MJFA 5I7OA 4ERXA 1UWLA 6ADHA 4ZQFA 1GXSA 4NARA 1UC5B 2ZBRA 2ET6A 3FCUB 1KEPA 4L85A 2DCMA 4B31A 1CK4A 1J2EA 4COOA 3KSAC 4HDKB 4KWHA 4QUAA 3K8ZA 5J2UA 2AT1A 3FFXA 1Z0SA 3QOYA 3AJ9A 4M98A 3H04A 2DBQA 4HC4A 5JH7A 4W5OA 1PZEA 4W63A 4PLCA 2IWRA 3O3OB 1I4DD 5I5GA 1N34B 2XSZD 3RVKA 4Q12A 1MO5A 1OLSB 1WB4A 2QAGA 2WFLB 4IDFA 5BYAA 2BKUA 1H2WA 3OQOA 4IDBA 3F8WA 3LVQE 3U60B 1JQLB 3H99A 1G2QA 3OT1B 3T8YA 2DR0A 3FHOA 4DV1B 2CL5A 3R6LA 2FWBA 4WKBA 4WFKA 3TQFA 1VLMA 1Q77A 1F0NA 4KVAA 1FFBA 2AQHA 2AX3A 3F7MA 1BHO1 3QEOA 3OCZA 3JQCA 3ER9A 1CJVC 2F43A 2BTQB 3UJ3X 5GY7A 2UYQA 3D7KA 4ME6A 3N6VA 4RQTA 5HFNA 1T3LA 1YA6A 1BWRA 3KVOA 1HFKA 4U2FA 1IDN1 3FDZB 4G0MA 3OC6A 3ZS8A 3ADCA 4M1KA 4RXUA 1GA6A 3IPYA 1G5HA 2DFKB 3EF3A 4K3UA 5ICSA 4N6GA 4C5AA 3VMMA 3F3MA 4B7XA 2PZAA 3EMKA 2HSZA 2WILA 3R3YA 4K9LA 4RETA 3RIXA 2ORIA 4H31A 1R0WA 3K35A 4XTRA 2GUWA 3A32A 3VZRA 2J5XA 3FDXA 5E1DA 2WTMA 5K6RA 4G5XA 3FETA 4MWGA 3MFYA 5ENVA 1L5KA 1QP7A 3LDFA 1L7PA 4D0GA 4G2NA 2H16A 3TQQA 3IR7A 5DP1A 4LTNA 3Q2IA 5TIIA 1ZLXA 2VYNA 2AJTA 4DIBA 1N9KA 4QGGA 4LDPA 4Y2VA 2CZCA 3AC0A 5IKXA 1GEGA 2D2EA 3PIIA 5AHXA 4HYYA 4TWIA 1ISJA 1B0PA 1U7OA 2G4VA 3PK0A 5F73A 4OHYA 3F5FA 1GG8A 2FETA 2AOTA 4LTDA 1GRQA 2I6TA 1JT2A 2J9YB 1MJNA 3IO5A 4IKEA 4ZT4A 4C6SA 4L4RA 1XCPA 2AK3A 3F6BX 1MR3F 2QY6A 4RCYA 4HUQB 1SCAA 1PLJA 2A9QA 1T35A 3HKDB 2X0EA 1A04A 2VI5A 2GXAA 5DCYA 2H85A 5EXEA 3G5AA 2I2DA 5CFZA 1LDEA 3ITNA 4P4TA 3C3AA 3H2ZA 4TXMA 3HEBA 1GKKA 1PP4A 2C0PA 3FPJA 1GG2A 4J91A 5BNFA 1LX6A 4HUJA 4PF1A 1U31A 3BGOS 1NR7A 4GZ6A 1ZUHA 4UAUA 1HUQA 2ZRDA 3AG5A 4J76A 4U3JB 4EVIA 4MYCA 1BXRB 5EMNA 5J40A 3ZY4A 2JLSA 2O50A 5MGBA 2Q4TA 1E3IA 2QSJA 3FKSA 5CXQA 2XRFA 5HDBB 1DUSA 1JPUA 3WHKA 3I01A 3GMIA 1XT6A 3T0FA 2BGWA 3BSFA 1LA2A 1TFUA 2H29A 5LQMA 3SHVA 4YRNA 1V4VA 1JAZA 1W4RA 2JFOA 1KYYA 5FJJA 1XI2A 3WMGA 2ZSFA 1SK9A 3JD4A 3K70D 2PRZA 4ONEA 2AUTA 4UVGA 1CNEA 1EE9A 2ERCA 2Q3HA 5LXTF 2W6CX 1ZYUA 2OUIA 4M37A 5DHQA 3TSYA 1RZRD 3WMEA 1DJMA 4N48A 3KB2A 3RRJA 1UKYA 4PNEA 1SVUA 2AXQA 3KLOA 2ROQA 1JR3A 1JEOA 3U7QB 3QYFA 3HKCA 3V2UA 4G5HA 4UCQA 3BIFA 3OTWA 4FS8A 1JEDA 4Q7KA 1E3TA 3AB8A 2ZCVA 5F2NA 4NDAA 4UOEA 5DEOA 3H8SA 3WGYA 4G1BA 3D4OA 3D6VA 1Q91A 1QRSA 4QPNA 1JU3A 5JXGA 1GZHB 3MT9A 4RK6A 1JEYB 2YS7A 1DO0A 1S8FA 2DUJA 3LWBA 4MCHA 5BN5B 2BC9A 4BEJA 5I7FA 2JZCA 1N6PA 2C9OA 1XLTA 2AD1A 2VJLA 3JAWA 2CNOA 4MR8B 1K9VF 2PSFA 5CX1B 1EDEA 2FFBA 4OM8A 4BN5A 3JQGA 1DWUA 4CMEA 2A5DA 2LCIA 4O1IA 1A2BA 4FYWA 4NFLA 2JGDB 1JBEA 1GA4A 1NUHA 1K7CA 3I6IA 2TMKA 2YUTA 1TMYA 2YJGA 5ESXA 3M6IA 4MI3A 3AP3A 4WD3A 4IDPA 5B7QA 1KMCA 4H3KB 2YXLA 5T6MA 3ELDA 3TX6A 3E58A 3BPSA 2G1JA 1I30A 3QI2A 1G2PA 5E3IA 1VLZA 4AY4A 1I7QB 1ORVA 3OIUA 4NXNB 4CHTA 3IIMA 1XOIA 4IUDS 4K8RB 4BQSA 3HXKA 2Q5CA 3ZWWA 4DG5A 2PZKA 3RSZA 3R40A 3VTZA 1OGYA 5TSDA 3GD7A 3UQZA 4DHEA 2OENG 3A04A 3OCCA 1D2RA 4FU0A 3ABRB 3WKEA 1TVCA 4P93A 3EVGA 4BEVA 1OXXK 1Y9JA 3GEPA 4MGYR 4U2BA 3WK9A 4EPRA 3KKPA 3T61A 1PFQA 5IM4A 2P11A 1TI7A 2AG0A 3EZ2A 1Z83A 2IEYA 1P4JA 4NJEA 2Q5HA 4DCNA 2E6UX 4OLFA 4NENA 2OYCA 3FOBA 3GDOA 4JN6B 1T5DX 1ORWA 4DABA 1T2CA 2RI6A 3JX9A 1M34E 3COVA 2JL1A 4MB0A 1JZSA 1ML4A 4Q3OA 3HVRA 1HNXB 3LRXA 3GJSA 4RZXA 3TTSA 2L82A 3OU2A 2X3FA 4UNSA 3K0BA 4K3VA 5IBRA 821PA 3NAZA 3ER8A 1AGYA 3GLVA 2JHGA 2XDAA 3PA8A 2QMEA 4A8TA 2A1TS 2AGVA 4FOTA 2LR0A 2GLUA 4KFCA 3SIWA 5IYZF 2RKOA 2V9ZA 2Q3BA 2P4EA 3Q7SA 4GZLA 4QDZA 5KAPA 5KVAA 3WZ2A 4ZYZA 1JNXX 1U28C 4J0CA 5KCZA 1XCMA 1P4SA 1RQLA 3ZWQA 1UOQA 1Q0TA 4HGYA 4NQRA 2FU5C 3KHSA 1ECFA 3L6DA 4P8RA 4PO3X 4XFJA 5JDIC 2QA5A 1X0XA 3BKWA 3IA2A 2ES4A 1RWOA 4HGQA 1RAEA 1ZI6A 1GGVA 2Q9AA 4YASA 4ZO9A 1THGA 2BTOA 3NP7A 2P4QA 3IAHA 4NATA 2HPVA 2IOFA 4MV8A 4WEOA 1OYWA 1B1CA 3OH8A 3SX2A 3GRUA 3V8QA 1UBFA 2XNCA 1YRYE 3HP4A 4L8GA 1PG2A 2I1WA 4QBHA 1SCNE 3F8TA 1VB3A 2CW5A 3IEUA 1UBGA 1YI0A 4LMPA 3E05A 4M9XA 4YMWA 5I7RA 1MABB 2HMUA 1F0KA 1G64A 4IDHA 2QTHA 4JJGA 5E38A 2NQTA 4UOQA 4AF7A 4LJ9A 2OZPA 5K5EA 1WOMA 2DTXA 4C89A 3NC1C 2AZXA 2O5CA 4GLOA 4B4OA 3MBKA 1N3BA 3M9LA 4EJSC 2FLWA 4OQ4A 1CUAA 1S2DA 1SN7A 4M86A 2JGKA 3RJMA 1IPFA 2GCGA 3N7AA 5D1HA 2VP2A 1U1EA 2J0QA 4U7FA 3I4CA 4C4YA 5CVUA 5IM5A 3PNPA 2X0FA 1U2DA 3LD9A 1FIUA 4A10A 4CEHA 1ZNYA 1VM6A 1ZW6A 1LV7A 1AN9A 1H8ED 1RYMA 4RZQA 3OFND 4MB6A 5AVSA 1D09A 4NJMA 4RMJA 3VO1A 2I7VA 3GCDA 4TWJA 1TEXA 1GAEO 1VL1A 2FEXA 3KO8A 1RQNA 3MUOA 4QAQA 2H2AA 4TV9A 2QMQA 1E6KA 4HNRA 1YJXA 3IHWA 4MTCA 4Q05A 1QTNA 4BN4A 4BNHA 2XCRB 4Z49A 4RK7A 1GCGA 5D5QA 5DF1A 3GA0A 4BASA 3AEZA 5FPQA 1EVZA 4EW3A 3SDSA 3KKMA 4Z9BA 3VR1A 4P81A 1E3MA 5B58T 4JT8A 2NXNA 4QYTA 2HJHA 4KJXA 3TECE 3LT0A 4O4HB 2VDPB 2VO1A 3DS8A 1DAGA 3OESA 3OTHA 5TV2A 3SICE 1WE2A 4KIJA 3H5AA 4HWOA 4DGSA 1ORHA 2XLCA 4EHFA 1QE5A 4YT8A 5BNIA 2OZEA 5HIKA 5DOVA 4BUCA 2E4UA 1GPMA 1TB4A 3Q3IA 4J16A 5BNWA 2ZBPA 3O2NA 3AERB 3B1VA 4M9ZA 3R7DA 3AB3A 1HZZA 5K2MA 1N4AA 3VTAA 1VGQA 4XUGB 3DDHA 4ND6A 2H4WA 4PAGA 3GLGE 2HHJA 2NADA 4ZZ2A 3ONNA 2E6KA 1Z5OA 3BWMA 3WV4A 4PRZA 4HO1X 4OP3A 2WJJA 4YP6A 4DA7A 4XWKA 2D7CA 2O0HA 2EGGA 4QQ8A 5I45A 4TUYB 3ESDA 3ZWOA 5L3ZA 4R2LA 1YR6A 2V8BA 2PX0A 1Q1QA 4GLBA 3VI4B 4TYWA 2IXTA 3K9BA 4YRTA 1F9AA 1C1YA 3DW3X 3QENA 3HS3A 5CFMA 2VSFA 4IXDA 3EG5A 2V58A 2ZTLA 3OZIA 2NT4A 4OU4A 5CLIA 3DBIA 4S0ZA 5IMBA 4BMDA 2YJTD 2IT1A 3C41J 2FQWA 3PXDA 4FKBA 4E32A 4B3IA 4YYEA 4JBLA 3FWZA 3IAM6 4LZWA 2R1TA 3MGBA 3FW1A 4JA0A 5C5CA 1Z2AA 1I51A 2CK3A 3B6ZA 5J2TF 2A9OA 1OA0A 4R9NA 1IHYA 2OCYC 2QRQA 5IJAA 4Q3KA 1RPJA 2PUFA 1QAOA 1QFYA 4F2DA 1LBIA 2F48A 3NLLA 3DKKA 4IHAA 4J29A 5LUAA 3QQ5A 2P9HA 2PGDA 4B6SA 2UYYA 1E6CA 3D4BA 3KTOA 4RV5A 2RHBA 4UUBA 3EEQA 3HPQA 4XRRA 5CJ2A 3WDKA 5HSGA 2ZWIA 1IXYA 1EZZA 2C29D 1P1CA 1YTUA 3W6OA 1H0SA 3HXQA 1K7FB 2BFOA 4D26A 3HK2A 3EFOB 4AI6A 4K1XA 4PFSA 3ACBA 1CYEA 3V4FA 2HBZA 3JVDA 1PR2A 4MV6A 4GOKA 1W5SA 3RQSA 3DD5A 2WKQA 1EVIA 2GK6A 2F9LA 2H7XA 3A6EA 1BYIA 2R65A 3JZFA 2UAGA 3AFGA 2J7PA 3WHLA 4D9CA 3HDVA 2X2EA 4FXOA 1G8GA 4ZVKA 3IBYA 1LBEA 3TLYA 1TTPB 3FB4A 3FR7A 3UJDA 4DZTA 1Y82A 4HRVA 1E1KA 4B3GA 1TGVA 2W6JD 4DBLE 4YXFA 5TMDA 4BV9A 2ZSEA 5IN5A 5L51A 4DC0A 4M9SA 2ZLBA 1FQOA 3CUKA 1PFUA 1XZ8A 3O8OA 2HMVA 3DV0B 3ESQA 4C6HA 3KQPA 1NWCA 3PQCA 1SO8A 3HSSA 3DNPA 4XTCS 1XRNA 3OWHA 1XTBA 4V1CB 5DTEA 3OHMA 2O2EA 3LCVB 3WQQA 3FUWA 4HRAA 1IIRA 2D5LA 1Y1KE 2PANA 2XDWA 3BMXA 3FSJX 3L06A 3MPUA 3QBJA 5AVTA 3V46A 2IZ7A 3KJFA 4W7SA 1NF9A 3ECSA 1J2TA 1OOEA 4RVUA 3GO4A 4QDKA 3UJ9A 3EEYA 4F21A 1UAGA 2F9FA 1UBJS 1XRLA 4S1VA 3WKCA 1A7AA 2EGHA 4PFKA 1OLUA 3G6WA 4GM1A 4FYPA 2QG9A 2FDCA 1R0YA 2HRCA 4P0TA 5DSTA 3HU1A 4ID3A 5KQGA 1KH2A 1QHYA 1UJ2A 3B5IA 3TEJA 1RTTA 2Z4TA 4GX5A 4RELA 3U19A 4TGLA 5EWJA 4XGNA 4DDWA 1JFVA 1II8A 2DERA 1UJMA 4EP1A 4OM7A 4WHMA 4EB6A 1I36A 2CLEB 3H42B 1JLKA 1SM4A 2C5FA 5KAMA 4UHHA 2OV1A 1PK8A 2OD2A 1SK8A 4X71A 1YHZA 4I5IA 4FCVA 4MRSA 1I32A 3OU7A 1DKRA 5E6UA 1TZMA 4B75A 1T2NA 2QM0A 4GI3A 4QQKA 2C8JA 4Z3KA 3H3XA 1KJNA 2HMTA 4G25A 2JFNA 3RW9A 1J97A 4ZOLB 3RIHA 3T3NA 1I4WA 5ALQA 1J2UA 4RK1A 3DH0A 1W5EA 2Q62A 5A2QA 4DLPA 3ICEA 1E4OA 2FZ5A 3I6ZA 4PC7A 5AXBA 1GTSA 3Q85A 4KJZA 4W8HA 3ZOZA 4UW9A 2UZ3A 4P6VF 2R8PA 1YQTA 2WHEA 2JRCA 4EA7A 1QH8B 1AC5A 1WV0A 2RARA 2VL7A 2X4LA 1EQAA 3TRDA 2P90A 3K20A 1Q7TA 1LDGA 4H77A 5EZYA 1CQZA 1UT8A 3CIFA 4Q39A 4A6XA 3GLFB 1YZYA 2WTXA 3SI7A 1XNJA 4Y0VA 4F6RB 5CW2A 5I9TA 2HCFA 1QG6A 2X0KA 2PT9A 4REQA 5DM0A 5FYQA 2KHZA 4OP1A 3UB3A 2PRYA 1RWXA 1N9ZA 2X7HA 2BI8A 1SHLA 4AJPA 1DUIA 4HNSA 4FWIB 2C0CA 4CIXA 4P84A 1DLIA 2GARA 5KTMA 1JWBB 3C2QA 4TKVB 3WIBA 5KVSA 1QHHB 1H1LA 2P8JA 1V8FA 2ODTX 5IT4A 1QFJA 1CLEA 1D2GA 1D4FA 1FDRA 1MN6A 3ZE0B 3TGPA 3IAXA 3G9UA 3Q5EA 1Z37A 3P96A 5HGXA 4XB6B 1ZIDA 1GPJA 5JPDA 1XZNA 3W4JA 4MINA 4RF2A 4IHKA 3OQJA 2AQ8A 4A15A 4WCVA 3CRW1 1C0LA 4Y6RA 2Z2IA 1T9CA 1AKRA 3CUTA 1H9AA 4JOQA 4DNXA 3U6BA 1GL7A 3EXFA 1Q7BA 5H80A 3RADC 2JHPA 3NX4A 4G65A 4PANA 1BJTA 4WNYA 5B1SA 5SYMA 1FW6A 2FZKA 1UKEA 3KKOA 3JAKA 1RRCA 1C8VB 4RVGA 1HQCA 1D3AA 2C82A 3AFNA 3BGVA 5D3MB 4LRYA 4WZBA 1U2TA 1VL6A 3JATA 4M0KA 3D3WB 4PTLA 1MIHA 2BHSA 1J1UA 3CKKA 4KLAA 1BHSA 1XEXA 3DOOA 4ZKDA 1FNCA 4JLSA 3C7CB 5IF3A 3BCSA 2A2ZA 3F96A 1NT2A 3BMNB 1NMZA 3PLRA 4Q1CA 3SS7X 5JVDF 1KQGA 4ZK6A 3HCPA 4HNVA 3ZHXA 1XMVA 3FTNA 1Y8ZA 2JLXA 3BMQA 4PO1A 4ETWA 1RABA 1V0JA 1FDWA 4NG4A 3ZWXA 2E5FA 3A9CA 1WLSA 3OD5A 1UBNA 2E2WA 4OXXA 4DDTA 4EF6A 3PRJA 4OX9Y 1JFFB 3VU9A 3LKBA 4CIYA 3RIYA 1X1AA 3Q3CA 1QBKC 1E2FA 3V8BA 2RH5A 3S4YA 1OYOA 3C8DA 3QFRA 1MORA 3S5JA 2NP6A 4AUEA 3N87A 3TRHA 1ADBA 1O4VA 1PDVA 1JIKA 2JLRA 1ZVJA 4J7XA 2V7EA 2CT8A 1CE8A 4OYYA 1BWPA 3AUFA 1ZICA 3PDCA 4LE2A 1Q1GA 3WLTA 3OQMA 1QGDA 4PAMA 4N12A 4C30A 5C35A 1IJBA 2J3LA 4NBUA 2F8MA 3C3MA 1Q19A 1V9CA 2CUTA 3QBEA 1ZP6A 2QF7A 4FXPA 5AKKA 3NIDB 4YI5A 3W7BA 3T95A 2B0JA 3M7IA 4HFMA 1R6XA 2C1EA 1P2TA 4C0QC 1PQUA 1UWVA 5AI6A 3ZWNA 3T99A 1P5RA 1MQAA 1PGJA 2YZMA 4MCJA 3NDRA 5ALDA 3JD1A 4MZDA 2OK8A 3M6XA 1ZA2A 4IJUA 1L5LA 1YIDA 1GZVA 1X7YA 2YC2C 3LKZA 4KLCA 3EUEA 2GM4A 2DY0A 3P2EA 2AEJA 1MC1A 2HMWA 2IA5A 4L51A 2QROA 3STYA 4IIJA 3OAAA 3W79A 2CFRA 2V5AA 1Q0QA 5IEBA 3S2YA 1MAAA 4M7OA 4J6FA 3O9VA 4MAMA 2KI5A 5JLAA 2P35A 2Y2VA 3HY3A 4AZ0B 1C2YA 5ALOA 2JBAA 2OLKA 4N6NA 3OZUA 4Q9IA 5EINA 3V8RA 1Y0BA 4DCGA 1T5OA 1JJBA 3E5NA 4HHEA 5CLLA 3DT8A 4V0ME 2ZB3A 4X90A 3CVYA 3MTJA 5JPIA 1V16A 4GI7A 4IFIA 1X7XB 3L79A 3VH4A 1ZD9A 5MDHA 1B0ZA 2YWFA 3TCXB 1OZAA 3WL5A 1B6TA 1L4YA 4Q9NA 2RGWA 3RF6A 3DZBA 3WO1A 2O2SA 3FWNA 4QNRA 1TT5B 1U28A 3U9LA 4I1PA 2YQ4A 1HDCA 1K5GA 1R5BA 3FA2A 4LZLA 5KJEA 3T9CA 3ZU2A 2Q9BA 3KOMA 4LGMA 2ZZNA 3L0DA 1U8FO 4WCFC 4FHCA 5AKEA 4ED9A 1ABFA 3H5RA 1UP6A 3IQIX 1Y1LA 1WETA 3ESCA 5ERGB 1QCZA 3ONFA 2AHOA 4CMBA 4HVAA 4C5CA 4C20A 4EMSA 4JQSA 1SUIA 3NC0C 1FVXA 1RNLA 4DWVA 2FK7A 4QECA 4BB9A 4F1WA 1TIBA 2PMFA 2WJAA 3ENZA 3FPBA 4HP8A 4JP5A 4ZDIA 1SHZA 3AR6A 2NVWA 2JHFA 2FB9A 2PXHA 2O2XA 2ZI7A 5FBHA 4YAIA 2PE5A 1FYDA 1XCGB 3BE5A 3KJHA 1J20A 5KNDD 4QQFA 5CDGA 3T4XA 1XSEA 1XLWA 4ESOA 1N1EA 3CR7A 4LJRA 4C6RA 4TXJA 1Z4MA 2J1LA 5F3WB 1ESCA 3DVSX 1M6VA 5FAKA 2A3NA 3F9IA 3P4XA 1DC5A 4EQ6A 1T4CA 1G66A 1Z0DA 3NHFA 2FJ0A 3EDRA 3MJEA 4GL4A 1T2VA 1GEEA 2PXXA 3WGLA 2FRXA 3BAZA 3LQKA 2PPLA 4EYGA 4JYAB 1ORRA 3AL2A 4UBJA 4MW4A 4F4HA 3LY7A 3EZ6A 3O92A 1KMNA 1PSWA 1Z73A 2FWIA 2ZANA 1C7IA 3H5WA 3LFTA 3RBZA 3SKYA 1O87A 2E4YA 3NETA 3REOA 3VR6H 1HM5A 2R6R1 3C4VA 1FYVA 2VDOB 1OI2A 3H1GA 1M67A 3WLOA 2BJWA 4YJFA 4A91A 2RHWA 4KDFA 2W22A 2C4UA 1JQ3A 4JVSB 1MU0A 2V4MA 4DJDC 4JI8B 3Q98A 2FOLA 2C9YA 3SYTA 3NS7A 1AHPA 1TD1A 1I2ZA 2B7CA 4NSNA 3E3OA 2IVZA 4HXGA 4BTLA 1BEZA 3AG6A 4NESA 1SWVA 1OILA 3I5UA 4CM4B 2R97A 1KZGB 3B1ZA 3MJ4A 2ORED 2WJGA 4LYHA 1YUMA 5BYKA 1KVTA 3C4QA 2ZYWX 4XSGA 3SQLA 4BQEA 1E4YA 3I05A 4UCFA 4ZYWA 2FUKA 5BPHA 1KS2A 4M7PA 1C2TA 4MULA 4RVHA 3STTA 1WUIS 2IHUA 3WNBA 1KK0A 5I9SA 3T7IA 4IVQA 4PIPA 2HSDA 4QGAA 4WOKA 2O3SA 3RS8A 3EUFA 4P4SB 3RYFA 3HEAA 2ACKA 1M2GA 3DYIA 2G04A 3TIFA 1XKTA 5I9BA 4Z8XA 5F4ZA 4KZPA 3ZS9A 4YRLA 5JNTA 4L3WA 1SXJD 1RT9A 4TXNA 2FRDC 3IDSA 5K8CA 1T1JA 1Z63A 2GXUA 4WL0A 3M1AA 5DNEA 4V0LA 4KQ6A 2SCUB 1L4EA 1DBWA 2GKGA 1A97A 3LBFA 2REXB 3MTIA 3PX7A 2OM6A 5BOSB 5HMLA 5THQA 5FQNA 3H19A 1XFAA 1EG7A 1VMIA 4LHZA 4MQFA 4DA0A 4YRAA 4RTRA 3UICA 1ULZA 2D1QA 4CKWA 4F8JA 2FKNA 3WSWA 3EPJA 1N5OX 1Z82A 2BUCA 1RJGA 2VHWA 2BI4A 4Y2SA 1YZ3A 2IELA 4EGQA 1H69A 4G4GA 3TNLA 3QXHA 2GZ1A 1A4RA 1PE0A 4NOJA 3RT1A 2GCOA 3HCRA 4Z8YA 3G2HA 4FWTA 2ZBVA 2YNMD 5B2EA 1E96A 1OV4A 3D3EA 3WJAA 1IOVA 3EBOA 4TMWA 4I1YA 1SHKA 1VRVA 2MWMA 3OPYB 1QRDA 5K3EA 3DWEX 3EOBI 1KSGA 1SAYA 3TCKA 5TGTA 1H9CA 3ZHUA 3EWSA 2YN0A 4DLWA 5CXSA 1JEAA 2QLLA 2IIQA 2IEAA 1CS0A 3KZCA 3UMRA 2YMMA 4QTUB 4L5JA 4EO7A 2IE8A 3GJ0A 4DMGA 2VZ0A 3OP1A 1P1HA 3C4JA 4X3CA 2ZRGA 4U0JA 5JO9A 4UUPA 3REFA 4WUTA 4EA6A 5ALNA 4XIIA 4OBXA 2YJ6A 1ABEA 4NQZA 3UG7A 2RJOA 4LZPA 1Z22A 3OZWA 1RFLA 1EFCA 3A9RA 3F5QA 3RHFA 4CV0A 1I2BA 1ISPA 5BT9A 3RYCA 1QVAA 1IJKA 4YXWD 1MUUA 5IDYA 1BFUA 2W6PA 2JLWA 1P91A 1IY0A 1QMGA 1OXVA 1YKFA 5AKIA 2QTGA 3S7ZA 2K7FA 1TVMA 3DBRA 3HCCA 4AQDA 1S4MA 1YDFA 5AKYA 1WHSA 4QD3A 4B8YA 1ZJZA 3OTOB 4Z4GA 1QIKA 2FFQA 4AFNA 1TYCA 4PC6A 4MROA 5C8YF 4ENPA 3IA7A 2O19A 2F6RA 1G20A 2OYRA 1AMUA 2NU6B 1XZHA 1P0MA 2CFOA 4JQCA 1VPDA 3DFMA 3A14A 4J1SA 2OHFA 1M0TA 2AHRA 3MF4A 4GUAA 4AO6A 3HJFA 1J5PA 2FEPA 4TYYA 3ANYB 1HT2E 4KRXA 3L6OO 1KDZA 3UT5A 5DBHX 1SQ5A 4XIYA 2IDZA 4O4IB 4MVWA 3N1UA 1JLMA 1U0HC 4Q7JB 9ABPA 5JPCA 1T0IA 1L8XA 3ZQKA 4LQLA 4M1EA 1W0KA 4KQWA 4B3TB 1R8YA 2OK7A 2AMFA 3DOHA 1WPRA 1R0RE 1XCLA 2JHAA 2ZJ4A 5BSRA 2NV2B 4CN8A 3TRIA 2HWYA 2J45A 2PYZA 3C5WP 3CH4B 3HXLA 1G41A 1NF3A 2VJOA 2CNWA 2DT8A 3PPWA 3R3JA 4NMLA 3I8SA 4QJ5A 4X94A 3ANMA 5AP9A 4LFCB 3NNNA 1T5SA 2A0WA 2AQKA 3KEOA 1K8XB 1YS7A 3AM5A 3TGWA 4MWZA 4R3WA 5DHRA 1L4GA 1UQTA 3N53A 2XUOA 4GR9A 1BAPA 3P26A 3SS8A 3X1WA 3W06A 2DLNA 1RSZA 2WHRA 1VPLA 1Z26A 3R5FA 1J42A 1L4KA 1W4AA 1MGPA 2ZUWA 1FLDA 3BOSA 1GVNB 5JJCA 3C6QA 4PX9A 4UMVA 2P6UA 3SF8B 3PWKA 1AXRA 2XIQA 3AY7A 4L9AA 5F1OA 5KTSA 7MDHA 4G86A 4RVNA 2FX3A 2EQBA 3R24A 4NK5A 2UKDA 4ZDJA 4GMDA 1FBTA 2NU8B 1P7WA 2OGWA 5KWJA 1EPUA 2B4TO 3ROKA 8ABPA 4A6EA 1P72A 4DIMA 1TUEA 3P2YA 5AESA 4ILEA 1M9NA 1WMSA 1ZKMA 3Q5DA 4M54A 3DXZA 4I9UA 2O20A 1BO6A 1ZL2A 2XODA 2JAWA 4DDVA 3WP0A 4KC0A 5CCDA 1Z13A 3WTCA 2DHCA 2XTAA 1U1DA 2IH2A 5LZ7A 3P9QA 2R7AA 3W90A 3A4VA 3CRNA 4OIMA 4Q1EA 3FCEA 2IY8A 1S0UA 1DIAA 3MXTA 4CE6A 4DEYA 2C4VA 4AU1A 1BXGA 2VZ9A 4EKGA 1U4SA 3QEMA 1GT6A 1ZQ1A 4H16A 4L9RA 4X92A 3ISTA 4XJTA 3UIEA 2C58A 1U7UA 2QYOA 4HDOB 2HSJA 4PVDA 2NO1A 4I14A 4TRJA 3INTA 3BRWD 4B46A 4MW2A 1E2EA 4KQKA 2HPHA 4ARZA 1X80B 5JR3A 1P73A 4WBNA 1Z4QA 2POCA 4M1QA 4NMXB 4OREX 1I2AA 2WQ7A 2G6TA 2PBFA 4KAFA 1DAFA 4K26A 4OG2A 1NAHA 2G25A 1DCKA 1M2WA 2ZDGA 4N47A 5LOVB 3BFPA 4FCCA 3KRTA 3LHIA 5BWOA 2YOFA 5AM1A 2XUGA 1Y4DE 2PAAA 3GYBA 4WA8A 4DCOA 4JBXA 2GWHA 1UXKA 3B6IA 3EZXA 5J4VA 5T4BA 1UBRS 5B53A 1ZOOA 3GLIA 2EBUA 3PKIA 3RC8A 1II9A 3USCS 5LKRA 1MNAA 1CUBA 1NU8A 1NUPA 1N0VC 3EUAA 3MT8A 3NW9A 3QITA 5ETJA 3LF2A 5FOSA 4ERNA 2ZVJA 2YZGA 4JSRA 1EX9A 3B20A 1QQTA 1JIIA 4MI9A 3T3PB 1GNPA 1V8ZA 3E7WA 4UXHA 1OWPA 4YWJA 3OJWA 5EJ7A 1WSAA 2JFXA 4PTZA 2ZJ0A 2G1KA 2Z98A 2AJCA 5E9WA 2O3QA 1U6JA 4MA4A 4ZOBA 2ZJZA 4OQMA 4CM3A 1JHDA 3OX1A 4F8YA 2IIBA 1EGHA 1TCBA 5LUBA 2GS9A 4H6PA 3T3MB 2IXEA 1E60A 4IY1A 3RE1A 1CP2A 2I87A 5BUCA 3S8MA 2ODPA 5KQMA 2HUPA 4F71A 1K3TA 3PHGA 3WIEA 3AI1A 1IHPA 1USVA 3ABZA 4ZJYA 1VGRA 3D81A 4R8KA 1M2FA 4KXLA 4OAQA 4AZ3A 1KIFA 1OC2A 4M0PA 5K8TA 2JIRA 3JVEA 1YQXA 5BV7A 2Z8YM 3GUVA 3V7UA 2VPQA 5GVSA 1JDUA 2C3YA 1T3TA 4GOND 4A0QA 3D3NA 2P2DA 3O2SB 1EEXB 1TKRA 1JYSA 3LK7A 4M3NA 3CT6A 2C5BA 4DPKA 3FUTA 4DMKA 3QLUC 2VYVD 5CA1B 4ZIRB 2P9GA 2PUWA 3DJFA 5TMEA 4H7KA 3VOSA 3TMYA 1AIPA 1BE0A 2HFKA 2HF7A 3UWPA 4C76A 4EZBA 1ISHA 3VYTB 5K0TA 2IKSA 2W37A 1OXTA 1KJYA 3GXOA 3A10A 2I7CA 1R3DA 3AEKA 5L7TA 3NEJA 4Q1VA 4AIIA 3CW9A 2O2GA 3KQVA 4L5BA 4MQBA 4DWJA 1SXIA 1HE1C 2E89A 2EJUA 3ZOKA 1N1DA 1OU0A 1RQGA 3CO5A 4ER3A 4UQLA 1U5BA 4INAA 4JI7B 4BX8A 5EXTA 1U0LA 1NW4A 4QUGA 2VSNA 3U3DA 4RKFA 2NU9B 4R8LA 5DLYA 5D85A 3NVDA 5KNBH 3ED5A 1TQ2A 2JGFA 1NUTA 2CKMA 3GMSA 4PX2A 5JZSA 4PQYA 3PXXA 4G01B 1X1QA 1FU8A 3HO8A 1UM8A 2NIPA 3E7PA 2F3QA 2RSLA 5JBNA 1R8SA 2GA9A 3IAUA 5BY2A 3ABOB 4DB2A 3WYFA 2EX1A 2QTRA 2ZRJA 4NCIA 4RVSA 1JYFA 3AEUA 3KQYA 4WESB 4C01A 1II0A 1AMOA 1OZ0A 1NONA 3QGMA 4I6EA 4A5OA 5EHZA 4WCFA 1XPOA 2WD8A 1VG0B 2MSEB 4D4GA 2PLRA 1O08A 1W25A 4X85A 1GPKA 2IZZA 3RS9A 1ZCFA 4RQUA 5ALUA 4FHGA 2BOVA 3CPSA 3VPHA 1DC8A 3AZOA 5BT8A 1UK9A 2WFZA 2WYHA 3D0KA 5DSXA 4LQCA 3UMCA 2P68A 3QEAZ 3D1VA 1J8VA 2GSWA 3DPUA 3R0QA 4I4LA 10MHA 1NG1A 2KW5A 1FMCA 3AJAA 3HO6A 4JBHA 3UK6A 3OZDA 2M9MA 4Z1MD 4Z7OB 1F8XA 1DQPA 4EUKA 4FS3A 5KX5A 5JJLA 2ZAIA 2Y77A 4MP6A 3WISA 2IHNA 2PAFA 3C1OA 1JG3A 2FP4B 4HN4B 3UXMA 1E0KA 3D3JA 4BXOA 2G36A 4XOIA 4DLTA 4NCNA 4ZJUA 2FR8C 3IUQA 1ONNA 2PGXA 2EWWA 1L7EA 4N7JA 5FOUA 2IBTA 4AY2A 3L18A 2FZLA 3U9SA 2UXBB 3I6BA 5TMPA 2QAIA 5G4KA 4AYWA 2HLDD 3I4FA 1BDBA 3FOWA 2HPAA 4Y6LA 1C8KA 4HVLA 1G6Q1 4R69A 4RHEA 3FNHA 4FFVA 2I4RA 1X86B 4ANFA 4P7FA 1Z8HA 1X1EA 4ZKEA 4A0FA 1KDYA 5JYEA 3K70C 5DNCA 1Z62A 1FRQA 4K6HA 1G6HA 5CLQA 3V7YA 3VPSA 2NNLD 3IESA 3PYLA 1JL3A 2RHDA 5ESDA 3WGHA 1OUMA 1QOPB 4B3HA 3ZD6A 2QQ5A 4RK4A 2WSBA 3F2VA 4E5UA 3O38A 3GEMA 1FUYB 3LHKA 2V6IA 4AO7A 4BE4A 2WWVD 3ZDDA 3DL7A 2R9VA 2J9GA 1ML3A 3PCTA 2QE7A 3PGMA 4G6ZA 4OLAA 3E9MA 4HDSA 2JKVA 4YR7A 4XAQA 3FTEA 3ZVKA 4L6IA 4R9RA 5FYDA 4BO2A 1E7RA 3LI2A 3I76A 2WSIA 4L5YA 3WLIA 1OKKD 3TO5A 2GSDA 1ZSVA 4GKKB 2CUKA 2F59A 2PSHA 3HV2A 3U39A 1XNGA 3W1EA 1AO0A 1U2GC 4L0CA 3FTPA 3TOSA 1FNDA 2HMYB 2OG2A 3LVFO 4IJ5A 4PSAA 1VHLA 4F91B 1UK6A 4JFAA 4NLLA 3EGXA 1TFRA 3AR3A 3Q7PA 4NTZA 1MVLA 3TZQA 3SEFA 4XYMA 1OI7A 2LKDA 4KWTA 3VZSA 2O8VA 3EXHC 3DVAB 5DK4A 2ZS8A 4W6QA 3WLHA 3U31A 3ACDA 2DJ5A 3WNDA 1CF9A 1WM1A 2FY8A 1JA1A 4NZYA 1QO9A 3OU6A 4IFEA 2R8YA 2C2YA 2ZYAA 3OIDA 4KWIA 1KFEB 3JQDA 4R1SA 1JDJA 4PN3A 2NVUA 4O2RA 1KRXA 2XB9A 3LX8A 3RVRA 4BGEA 5KKNB 2OCXA 1R6VA 2P6PA 3MNFA 2VJNA 2H4XA 1JG2A 3GVIA 4V0NA 2XRZA 2FRDA 4X1KB 4X95A 2WYIA 4P2GA 3D2BA 2FOIA 4AMZA 1AOXA 4PZ9A 2D4AA 1CB7A 2PMWB 3MJTA 4R40A 3A06A 3VPFA 2FPPB 1YQWA 2PU7A 1ZD8A 1XJQA 1N5MA 2L42A 1C0EA 5F2OA 3UA4A 5KPDA 3QUQA 1A82A 4J4TA 4RHUA 1ZN7A 4Y9RA 4ZI5A 4X3OA 2DUMA 3VH2A 4DRXB 3L8HA 5EAIA 4U0KA 1NR1A 3M6WA 4WVFA 2X7JA 4KPGA 2VP4A 3W34A 1OFUX 1K9SA 1GU1A 2P2ZA 4QXOA 4KVGA 4PRKA 2G9QA 1I3OA 2WJVA 1IIBA 1OXMA 5C8ZA 5BQFA 1ODFA 2QMUA 3NBUA 3RVJA 1Z5WA 4ZU3A 2UVQA 4D57A 4DCPA 1U0BB 3WBKA 1UMDA 2PMCA 4IYJA 2J41A 2Q7XA 3LVRE 3ZUPA 3B9QA 2XNJA 1VCIA 5J2UF 4C08A 3EX7C 1GL9B 2IYEA 5DYNA 2QD4A 5FX2A 3MD9A 1LLUA 5JH7F 4G0OA 5JS7A 2Y9PB 5LU8A 4KR2A 2IUTA 3JZMA 3O91A 2O2JA 1GFZA 5AW1A 1QYCA 1P80A 2Q50A 3A6JA 3HFSA 4IOLA 4ESEA 1YV9A 4MWDA 4YDQA 1GARA 3T7TA 4Q34A 3UK2A 3INYA 1XAHA 3T7RA 1SUCA 2XV1A 4QNMA 1WXQA 2GYUA 4B81A 2BH2A 5FAXA 1A5TA 1YZVA 2ZBGA 5DBOA 4RD4A 3BWVA 4HN9A 1X7GA 2NO9A 1AKWA 4OLJA 4B76A 4X7MA 5JW6A 4YIHA 1U3DA 2FPRA 1NW8A 3GDFA 2IYSA 4P5DA 3WLMA 1UFOA 2LRHA 4F45A 4FFMA 4ZCPA 5KJ6A 1ZPDA 4CFYA 4MKFA 4RL4A 3GA5A 4PLFA 2PS3A 4F4DA 5IJ0A 2F3TA 1IAVA 3T3GA 3A11A 3UMVA 2V03A 4PLVA 3P2JA 4GR5A 5ILQA 3TB6A 2XRMA 3STUA 4UMFA 4JJKA 1R8QA 5M04A 2AEFA 2WTUA 2PU5A 1EK1A 1GY8A 1AKVA 1LF0A 2PVSA 3IOYA 3PYXA 1FF9A 1MB2A 1O7JA 4HDNA 4S3MA 5EPUA 4JENA 3LVBA 1E5VA 4PO9A 3V55A 3DOUA 4P98A 1W48A 4M0DA 1D6NA 2GHRA 4FK8A 4IGAA 4OMFG 4RXMA 3TQCA 4CG0A 5I4CA 3NWJA 5L4NA 1TTTA 2AN4A 2ADOA 2IS2A 6LDHA 3SU8A 4NE9A 4EPXA 1W30A 5C1BA 1XHFA 1XNRB 3MA0A 2WB4A 1W6RA 5A7FA 1FJ2A 5BQ5A 1K6XA 4ZOEA 1WQ4A 3GRKA 1POXA 3G9ZA 3CZCA 5CURA 4MR9A 1T1SA 1U99A 4M36A 1N2GA 4OAOA 3C7TA 3GFFA 1QH1A 2GTIA 4RVOA 3HE3A 2Q1WA 4C4XA 2X2PA 3AQIA 4P33A 4BP8A 3LL7A 3EAFA 4UXJA 4YECA 3KYDB 2BM0A 2J9ZB 2O1XA 4URWR 4XVQA 4ZTBA 5JAUA 1VFNA 2BEJA 4Z51A 3UPUA 3PJDA 4LF6B 1QLHA 1VA5A 1HWYA 4OXIA 2WDPA 3TNDA 2ZIXB 4LHYA 3S55A 4YV7A 8LDHA 2Q45A 1LEHA 2VHZA 4TM8A 1ULBA 2QV0A 1GQ2A 4A5SA 2ZE5A 4EHAA 1W88B 1ZVMA 4XFDA 3CH7A 1T6BY 3UMJA 4DJTA 1SCIA 2D1TA 1XMQB 1E2GA 5KYKA 2PS1A 1SZJG 2QL9A 2COKA 3MWDA 5T5QA 4DR6B 1D1QA 2HHHB 4JB0A 1UOPA 3EG9A 4JI2B 4L4SA 5L3QA 2V6FA 2Y4OA 4X1IB 4C1NA 3K6JA 5AHKA 3L0YA 521PA 3UWOA 3IMKA 4LWOA 1QGED 4X6YA 2IYAA 2WHPB 3LO5A 1L7VC 1ZO8A 3PZBA 3S40A 3IB6A 4V39A 4KAAA 4NJOA 3SOZA 3X1DA 3NUQA 4L4XA 3WKDA 2F3PA 2AJDA 4KQIA 4OXKA 2NUAB 3EGWA 4B5LA 4BVEA 2V7XA 9ATCA 2Z6QA 3U13A 1Q0ZA 2YZKA 3KVNA 5JD3A 3VYWA 4E08A 4P7GA 5JXIA 1F2VA 1XWWA 1Z0JA 2OQVA 1AK2A 2CEKA 1PBNA 1ZMOA 4QDTA 1XC7A 5E1OA 4DLNA 4QM7A 2FW1A 3G5MA 4Z4HA 3PTLA 3Q8KA 3BRCA 1XPUA 1HE8B 1Z75A 1RKXA 4H6WA 4K6FA 5JAOA 2JEZA 5BUQA 1RAFA 1OTHA 2R2GA 4P35A 3QMMA 1C9MA 2ZRQA 3IR6A 3PT9A 1P6QA 4YP5A 4BC0A 4EG1A 4P3OA 2PL9A 4J0HA 3DL0A 2AJLI 3IPXA 1AZLA 3HHPA 2EG5A 2I65A 1HGXA 4YLGA 4BCCA 1K4MA 2DETA 4MUHA 5JD4A 3FN4A 2CXXA 4NE7A 3ZXXA 3VC2A 1QNFA 4XXHA 5GM2A 2EQAA 4P5PA 1YBVA 1WDMA 2HIMA 3HBLA 1QFMA 1WV1A 3CVXA 3M70A 5ELMA 3UUFA 1WDLA 2OZLA 1Z7WA 4AWAA 4I5GA 3DLIA 1QK5A 3SDBA 2ONCA 2FDXA 2SECE 3AIKA 1O1YA 1U2PA 4Z4FA 2YQ5A 3IP5A 1KXJA 1YQGA 3GJQA 2BGNA 5FFNA 5HCIA 1RI4A 4W7HA 3RQIA 1GZ7A 1HNZB 1U0SY 4OQZA 2YWHA 4K03A 2GJSA 5EWMB 1YUBA 3ZVMA 4JYPA 4WXHA 1L8QA 1WWKA 4EUEA 5FNVF 3FMGA 3I73A 1SGWA 4U2EA 5IWAB 1VI2A 1KEEB 1ZESA 4M4SA 3D8UA 3AFIA 3BULA 4QRHA 3IDZA 3H6KA 4Q1AA 4CKXA 5TQ2B 2EQ5A 4I55A 5GP1A 3AHGA 2QY9A 3FPCA 2ID9A 4X20B 4IILA 4MVXA 3FTFA 1NC1A 1HEIA 4J0QA 3A9TA 2E1PA 3FMPB 2J4CA 5B3AA 3I30X 4GH5A 3EZ9A 3IQDB 4GYKA 1H5NA 4O4JB 5TEVA 4R9SA 4BATA 5FUMA 5D01A 3RUDA 1EVKA 2H9IA 4YQZA 1T4MA 3O03A 5A4KA 5IANA 1YDEA 2YV1A 3OFJA 5AH0A 2C42A 3C3DA 2CL6X 2YJ3A 1T1IA 3JQAA 4TROA 5A3SA 4CI9A 1RBQA 1IEQA 2J0UB 4ZAXA 4LSWA 1AO3A 1KMHB 3W7AA 4IGIA 4QLBA 4JUCA 2XUDA 1DBSA 1P44A 1TPZA 2YXDA 3QNUA 5FULA 3GJTA 1TADA 2YIJA 3C39A 3H17A 1N57A 4C3OB 1R9GA 1KVSA 2P27A 2R6GA 2GD6A 2R8ZA 1GQRA 4GKVA 1I33A 1IN6A 2TS1A 1VL5A 1HYEA 3JARA 4XPIB 3SY8A 1T5IA 2BEUA 1Z45A 2QRJA 3BHMA 4XIJA 3AHCA 3K9WA 3BB4A 4MRPA 5T4FA 1CHDA 4L0QA 5AKLA 5JFOA 3ROPA 5IT5A 2GF9A 3HM2A 3V2IA 1XQVA 3T38A 1JVSA 1XDUA 3GEBA 4MAAA 3O4VA 1QIMA 1FUUA 1RRFA 2RGDA 1M8GA 1RJFA 4YCMA 2HIHA 3MCUA 3GFRA 5K3OA 5AJHA 4LDNA 1YI1A 4LHEA 4U9UA 1NW9B 1WXFA 3F3YA 2BFCA 4JY7A 2ZJ8A 3DLPX 3N6RA 4NOMA 1INLA 1CWUA 1GPDG 3MJFA 1GCIA 1GG9A 3BHJA 5CT9A 2R0QC 4H60A 2DYKA 3VKVA 1MPXA 2JFHA 4MVJM 4UTVA 1IZZA 4L57A 3R7FA 2MYPA 1JH8A 3R74A 4ENWA 3QWFA 3AB7A 1G60A 3ES9A 3JZDA 4RFLA 4JB3A 3E18A 5AK6A 5DYIA 1EUDA 1PV2A 1SNYA 1WBJB 5A3QA 5JIBA 3PXAA 1JG4A 3K1ZA 4X65B 3BK7A 1YIOA 4WBXC 4A36A 2Z58A 4F84A 2REQA 3UAXA 1T0BA 4CR7A 3V1MA 2OZKA 2FQYA 4DSZA 2V3VA 2B94A 2H48A 3JWJA 3TPFA 3W8FA 3L82B 2JIQA 2AJ8A 3EZLA 4TTQA 1CDDA 1GSIA 4TTAA 4XD7D 2QRHA 1ECJA 3D8HA 3O4GA 4RWZA 2HQSA 5DT9A 4LJ6A 1KKUA 1LPMA 4IQ8A 4J8PA 5DT2A 3FD8A 3MHPA 4Q4AB 3UKOA 3AFMA 1ZLYA 2W2PA 2BVNA 2FR8A 2I4OA 1LVUA 4WKOA 4YIKA 2FPWA 3BHNA 1D2MA 2KWIA 4HG2A 3I3OA 4Y30A 1O5IA 2KM1A 3ZWYA 2EDAA 2O7VA 4JH0A 1G18A 1W85A 2JLQA 2EP8A 3ZXIA 1RDFA 4QHSA 1JU9A 1UKZA 4LAFA 2CNKA 4KE9A 4DWWA 5JBQA 4DQUA 5SZIA 5JAHA 4Q00A 1F7UA 3X2EA 4TZKA 3GARA 1A9XB 3KT0A 1E98A 4OV6B 1F6BA 2XRYA 3A25A 5I7HA 3OWXA 4CEIA 3NAQA 1YKGA 4PZAA 5I4KA 4I9HA 1RZRA 3I9LA 1EIZA 2DPLA 2FVYA 1VQ1A 4PFQA 3L4SO 5DISB 5TS3A 2PKYX 2YMLA 3EXIB 1M5UA 4KH0A 4B3CA 4CLOB 1X7ZB 1N2SA 5DBGA 2B8EA 2I1LA 3RPEA 3VUEA 3PQ5A 1IBKB 4K46A 4Y9TA 4JJZA 2IOFK 4L02A 1RXVA 2EFJA 3JR3A 2C4KA 3EGOA 4M55A 4O8CA 2P2GA 1S1CA 4LCJA 1B93A 3GGCA 5GONB 1T2EA 2VBCA 3WQSB 1P62B 2HDNB 1JE0A 1UIMA 3NHWA 3OJCA 1U2GA 1Y1TA 3KPJA 2MR6A 4OMCA 1G6OA 3V1KA 3ZPXA 1GOTA 2WAOA 3CWQA 3ORRA 3N9IA 1OFUA 4NZOA 3KKNA 1NW7A 1ZINA 3ELWA 3CONA 1NBWB 1U7HA 5A71A 1YU6A 2RH4A 3TOXA 4CJXA 1ORIA 2QMHA 1L3IA 4KNWA 3IAEA 1NOKA 5CFPA 5G02A 3EXHA 2PUEA 4ZHQB 4EIWA 3C6YA 1JP7A 1U7WA 3CW2A 3EVAA 1NPDA 3KLNA 4GLJA 1DMRA 2BN4A 2WQZA 2YFKA 1OWLA 3ILYA 3K2EA 3HB4X 3EIEA 1I2CA 3TBFA 3AKYA 2ZI9A 5H7XA 3I12A 4HTFB 2AB0A 4WOBA 4UTRA 4PYLA 3A1NA 4ISBA 1ZD1A 1U1CA 3EPRA 4U63A 1S2NA 1O8CA 2OE2A 3VZDA 4MMXB 3C3WA 1EAMA 1Y9ZA 3NM6B 1WVMA 3PE6A 2RAUA 3SF0A 3OM8A 3VKFA 3KAJA 3OP4A 1MT0A 4MKHA 3QW2A 2WM2A 4V1CI 8MHTA 2FK8A 2CY0A 1ZAKA 2EJCA 2WWIA 2XYGA 3NAGA 4MRVA 4YPOA 1EA7A 4X9XA 4DTIA 4D74A 4US0R 2ZRAA 4D4IA 4WLOA 1ACLA 2IHJA 3I9OA 5FI1B 2C83A 1A9TA 3ZGYA 4QPJC 3AETA 4EFLA 1X2BA 1RACA 5DN6D 1PGQA 3KTDA 5D7BA 4HWTA 2ZTHA 1NV8A 2VSXA 4I8XA 1EFDN 4BMOB 4URFA 1IM2A 4BKPA 4UBOA 3TLBA 5AM2A 4EUNA 2JD1A 3PJFA 1IXSB 4Q15A 2YRWA 1EWVA 3T0GA 3OQVA 3R20A 5KI6A 1EHIA 3WRYC 1OXKB 5EIXA 1NUQA 2B61A 4RMIA 3CLRD 1NXVA 1XDZA 2VJBA 2W7TA 3HB7A 3HKEA 4RY0A 1M5RA 2Y1XA 2VK1A 4D43A 2DEUA 2OHOA 4C9BA 3C6KA 1LNSA 4K28A 5CD9A 1FDIA 4TS9A 5KVQA 2YOHA 5C3MA 1Z12A 1JHMA 1YASA 4AD8A 2Y0EA 2Y0DA 4FKZA 3SJUA 2V96A 1SB8A 5BN3A 1UK7A 1GPBA 3CZMA 2ZZMA 5CBKA 5JWOA 1VI5A 1CUUA 1JLSA 3FXAA 1EBUA 1TL7C 3SEQA 4Q4CA 2DZDA 3WLSA 3THWB 1SUPA 3VNSA 3DE1X 3LDAA 3CEJA 3QEJA 1S5PA 3OO0A 3TXYA 3C43A 5C8DA 2Q1YA 3ZHRA 2HCBA 3OCXA 2ATCA 3ND8A 5FHRA 2Q3EA 4D9MA 1PVOA 2IS6A 3NT5A 3VC7A 3B85A 3SZLA 5MFZA 4CQLA 3LLSA 4TRNA 5I7EA 3AHEA 2H54A 4IVRA 4MV5A 1RP7A 1P5ZB 2X86A 1ZVKA 1UJ5A 2D8MA 2HWKA 1E9AA 2VCYA 1M1YA 1TK3A 1YL5A 2XKAA 3R3ZA 2QIOA 4JFRA 5IK2D 1MJGA 1GUDA 1QDUA 1NLMA 1GN8A 3DWGA 2EP7A 4FR0A 3W2TA 4A6DA 4I36A 1PK9A 5IT9A 2B3TA 1YB5A 5EG5A 4QVIA 2ZYVX 3QVJA 2MYUA 2BFWA 1X3LA 1EFRD 2W58A 2XTZA 3PXBA 1DOZA 3VU1A 4YLYA 2ZYIA 3ESAA 5IZCC 2ZDHA 3IXQA 1E5XA 4YRBA 1YQEA 2AFRA 2EBFX 2XUFA 4V3BA 1N33B 4CKCA 3THXB 4B3JA 1SC4A 2Q0XA 3HWWA 2ZT5A 3JQFC 2OHVA 2OILA 4W7IA 1H8EA 4AJNA 1ZH4A 2X9VA 3OUZA 4CMKA 2COEA 1MIOA 1AHHA 1EDBA 4MQEA 1JFTA 4MUIA 2Z6UA 1P39A 4EKDA 4EHJA 1L5FA 2ZUEA 2E87A 1JDBB 5AIAA 1JLHA 4BU1A 4I5DA 1TAUA 3E5RA 3K9GA 2RK3A 4AIRA 5KWSA 2OO5C 4HDQB 5CMLA 1YVPA 5ICEA 4DSTA 1E1MA 4HFRA 1U6KA 3ZH2A 1YZQA 1J56A 1Z88A 3ZD7A 1BCSB 2PT7A 3PP8A 1OX4B 1VHDA 3VUFA 2QTCA 1I5OA 5EZYF 3E0XA 2FZVA 1IBRA 3M6AA 3BEOA 1ZVVA 1Y6GA 1DAEA 2YDYA 3CN9A 3W2HA 5HF5A 5HKAA 4FBGA 3L5OA 3JSXA 2O8CA 1D8TA 3W5AA 1LXCA 2J5KA 2ZE8A 3VPGA 2R00C 3OC0A 4TZ0A 4MVJH 4YO8A 2O7QA 3TR5A 4AKHA 4WV3A 5E7QA 4DSOA 2B82A 2AI2A 1N25A 4HK4A 3OKPA 4UNRA 3UWSA 4EEKA 1ADGA 2PHZA 2QMZA 2Z0MA 1BMTA 2OD7A 3FNEA 4UZFA 1ZL0A 1Z4KA 4EF5A 1ZA1A 2C03A 3TLAA 2OXIA 1OI3A 1PO7A 3PUZA 4RD0A 4TN5A 1T26A 1PYGA 1RMTA 5E4TA 2FG5A 1SXJC 4FGZA 3GHYA 2MSNA 3AFOA 2DR2A 2RJ3A 2X5KO 5BSWA 2MMGA 3N0WA 1FX1A 4WOJA 1OZGA 2FPGB 2J31A 3WB2A 2R87A 3CNHA 3FWYA 2B20A 4L16A 4LKRA 4RY9A 4WZBE 1DU4A 3ZNPA 2EJBA 5DTJA 3T7DA 5F35A 5CH8A 3H1BA 4IDDA 1ODLA 1R88A 4HQLA 1AT1A 3ZBTA 3ROGA 3ZNOA 3ZJ5A 4F7DA 1VSUA 3R6DA 1B14A 2HYIC 4WQMA 1IHOA 2BLLA 2P9JA 1RYNA 3MTDA 2MDTA 2V7GA 4LC1A 1GU0A 4LXQA 5J5CA 2VTVA 3VOBA 4C7VA 4FEEA 4V02A 2A5YB 4BOYA 1DAIA 2ORYA 1UKBA 2IXBA 1ZGJA 2VDVE 3IPLA 2RHGB 3LBIA 4G5SA 1YDMA 2D4HA 2GZ2A 2AG8A 2JI9A 1G98A 2YNMC 2A14A 1K6EA 2IPXA 3PWZA 4GNKA 2PZBA 1UWCA 4BVBA 5B6JA 4YV2A 3O83A 4IRUB 2BTQA 4J7CA 3TEMA 4EKNB 2FMKA 2CLCX 1MA3A 2YVKA 4E2WA 3KKKA 1NW6A 4NY1A 1EVQA 1DCMA 2HI0A 1K75A 3VOTA 4A2QA 4DJ5X 2B21A 5AFSA 3ITEA 3Q11A 1ZU5A 4B3MB 1P9NA 4LWPA 3E84A 3J7AC 4IH9A 1PJZA 4QDJA 2Q6KA 2I6XA 3TGLA 4FBMA 1OBHA 1OHHD 3N0VA 1VJGA 4DCSA 1GPWB 3L1JA 1SKQA 2X6RA 3M9XA 2QM3A 4FUQA 4JDPA 3M2PA 4OJTA 2VWPA 4PM4A 4G4IA 1G3IA 1T3SA 1AK1A 1OWNA 3EWIA 1DV2A 4FGWA 1LDMA 3WLKX 1J5XA 3CPJB 4HH0A 4PNHA 4DMCA 5JHHB 2ONZA 4YFYA 5J43A 2OHGA 2GK7A 2NO7A 2AOXA 1P19A 1R4NA 2QZPA 2Y1DA 3LYUA 4BZWA 2E21A 4RNCA 4FB4A 2VDMB 2V97A 3E0QA 1JMYA 3NIGB 4GU5A 2H1FA 2DKNA 2X8AA 2OHXA 1R74A 4Q3NA 1I6WA 1N77A 1WP9A 3CS3A 3GPDG 4YMGA 2QPOA 2GM3A 4X6UA 3A3YA 3ZWVA 4E5NA 4HDMA 3E3LA 1SKBA 1XMIA 2XF2A 4TWZA 1MOZA 3TAUA 3P94A 1AUPA 4QUDA 4MP8A 1U7ZA 2QAJA 1GSHA 4GBED 3RVQA 2CHVA 3B3JA 4GLFA 3QPCA 4HUQA 3TLCA 4IIJF 4C4RA 2YFQA 2CJFA 3ASVA 3LY5A 5JZ9A 4MR7B 2UYOA 4PLGA 2GPWA 2QP4A 3BTOA 4RXTA 3WYAA 1U3WA 1XX6A 3LFHA 3GJRA 3B6JA 1XK7A 5C31A 3KHTA 4XR4A 3UYKA 3WLJA 4E88A 2DUWA 3LMKA 1CNMA 2J3IA 5B1IA 3CGWA 4WDRA 1MAWA 3QMVA 4E94A 3MMZA 4HR7A 3QF7A 1WPQA 1OF1A 3NPMA 5DTMA 1THMA 5B55A 2EEPA 3DNFA 3T7JA 2WTNA 4QOSA 2WPDD 1PW5A 4D8TA 4JL6A 5FV4A 1QQ7A 1QTIA 3I37X 1H2RS 2X1VA 2YWRA 3QVGA 4FFRA 5A7HA 2Y4NA 4INOA 3ZW8A 5JJBA 1ENOA 1K6MA 1R66A 1DAHA 3I5XA 3UK7A 2H2DA 1M8PA 1PBTA 2XZTA 1SVKA 1VXOA 1BQ3A 3EXG1 2DE0X 2OECA 4IKPA 4KG7A 4XIFA 1E92A 4H0NA 5C34B 1EJ2A 1L7DA 1ZOPA 2BH9A 2CLOB 2NO4A 3V00A 1QYIA 2YINC 2VH5R 3A6ZA 3ZI4A 1EWRA 2PNJA 4KGVA 4AN0A 1EBFA 3D0RA 1TJ4A 3SZMA 2DKOA 2PKCA 5D7NA 5TF4A 1F2UB 4OKSA 2QJTA 3NGLA 4PPQA 4IF4A 1IAQA 1YD7A 1F3LA 3JZIA 3H9CA 1TDJA 1VTKA 1Z34A 3AFHA 1IG0A 3L9XA 5H9VA 3WGZA 1AS0A 1PRYA 1Y8RB 2GESA 3TM5A 4MRAA 4D98A 3BMOB 4EYOA 5IXJA 1P7YA 2QQEA 4K40A 5EHQA 4MMYB 2AG5A 3PC3A 1QUFA 2G5CA 5BO5A 3SZGA 3A7EA 1NVVR 2ZZKA 3F6SA 3ZWKA 4B6RA 2VJCA 3JQ9C 4MR8A 2COUA 1YQQA 2R68A 1XVIA 2G72A 4TVKA 4LSZA 4U1RA 5ANRB 2UYCA 3C87A 4IXTA 2O06A 1A71A 1D9ZA 3QUCA 3Q87B 5M7EA 3S1SA 2R7MA 3O73A 5DYWA 3R3UA 4FGUA 1DAPA 4RWEA 4O4LA 4Y6OA 1GRVA 1F38A 2FWAA 2WV9A 5AK0A 1CB0A 4YMLA 3RAEC 1BJRE 1E1CA 5AW2A 1TUIA 4EBFA 1QLWA 1Q3KA 1HORA 1Y9EA 2OG1A 3VHRA 4H6VA 3CZ9A 4DL9A 1QX3A 4MQ6A 2IU4A 1WO8A 2Q29A 3A6PC 4GBJA 1QPGA 1SU4A 4BCBA 4MH0R 1L7XA 1IFXA 2Q6LA 2WC1A 1GAQA 4AKTA 5F23A 5COAA 4MGEA 2AOUB 2LZ0A 4M88A 4PXYA 4UHEA 3EEFA 2JD0A 2FWRA 2C5LA 4GOOD 2WT9A 1J99A 4G5YA 5F1YA 2C20A 4Q9KA 5KB3A 3UC9A 2EKQA 1FNNA 1JKJA 3D6AA 4FSXA 5BSGA 1HKHA 4J1NA 1QRTA 5EFOA 5LA6F 1HNNA 4PC3A 3LU1A 4LOAA 3LQFA 4REMA 1GQSA 4MVJD 2VAXA 2IYNA 4FYIA 3O21A 4C4TA 4FDLA 4RK0A 4P83A 3V7WA 1JAHA 3EGCA 2UUAB 3P5SA 1P29A 1QMPA 4HGZA 1ZMTA 2QBYB 2AXEA 2YY5A 2R6JA 2ZIFA 4P92A 5IRCD 2IEBA 1B2RA 1R8JA 2J3MA 2WWGA 4MP3A 1B73A 2PYDA 5EE5B 2OAP1 1QBGA 1V1MB 3EQ2A 5B3JC 3A1SA 1ECBA 5LXTB 2QGFA 1MV8A 1X92A 1ZIYA 1ISFA 1SBCA 4MWOA 3PF8A 1W4CA 4MO9A 1R0CA 3ZCQA 2PMDA 3HDTA 1LC3A 2XMSA 4UBMA 1AS2A 3KAKA 1NN3A 3NJRA 4G4JA 2CMDA 3OPNA 4I19A 3AUUA 3PPXA 1N8KA 2PX3A 1X13A 2ZJ1A 1CUZA 3ZLUA 4NCBA 2GRJA 1E3QA 4QAJA 5E7IA 1REQA 2XUKA 3MMNA 4H18A 4TVSA 3AH8A 3QM1A 1GFIA 1ADFA 4EGFA 4D4KA 2MU1A 3GN2A 3GP5A 5BSVA 1UWKA 1BDJA 3HBAA 1DKQA 1L7AA 1BKYA 1QLJA 2GB4A 2WYWA 2F7SA 3GG2A 3H1EA 1SZDA 2QR5A 3UAOA 3A6FA 4PGGA 2EWVA 3BWCA 4L5IA 5AVQA 3J7TA 2REBA 2AEEA 4F3TA 1I3NA 7MHTA 4D9BA 1OB2A 1G55A 2BCEA 3DZIA 2QT9A 2XVMA 1HF3A 3RYIB 4EI8A 1FFGA 3BD6A 4DG8A 4Z53A 1E8NA 1IPEA 3ONDA 2N9UA 4CN9A 3FKJA 5HX7A 2IBSA 1Y5IA 3L9WA 1TD9A 2IFTA 4GMGA 3UAVA 3EF1A 1GGKA 4FYYA 5ECWA 3OQBA 3TH5A 3EEBA 2FMTA 1M6YA 1VIDA 5BWMA 2AC2A 3GW8A 3EDCA 1W94A 2CUZA 1E69A 1RKBA 2VXOA 1NU6A 2I67A 2ZTUA 3DJYA 3F6YA 3GUYA 1N6RA 4KP7A 4DQKA 5FWNA 5EXXA 5A9SB 1JFSA 3OIVA 4ZAWA 2NU7A 2X58A 4US1R 3E81A 5HFJA 2VXYA 5EZQA 3NGXA 2VP9A 1XIVA 2X6TA 1XZIA 4R8SA 5EHIA 3B1XA 4G8JA 1ZFNA 4B82A 2C4TA 1C3EA 3KCQA 3Q9NA 4IDQA 5HKBA 2EARA 3WRYA 5BRAA 3FG9A 1H1DA 2QGNA 1KIMA 5LB4A 4RIEA 1DKOA 3VDXA 4CUJA 2IYYA 2WSYB 3KD3A 3NIWA 1EZ4A 3H5LA 4GE3A 4HTAA 4X7RA 2QUHA 2P78A 3FPGA 3GJ6A 2F00A 4E07A 1G20E 5A5FA 3K96A 4QXAA 4IHJA 4LJLA 2RDMA 4GD3Q 2P0EA 4B6GA 1RWWA 3OEWA 1RZUA 2CLHB 1M34B 2CZQA 4E2ZA 4P86A 3FUUA 1OIWA 1T24A 3IB3A 4JGIA 4WIAA 4WJZA 5GJVC 3M82A 4DUPA 4NS4A 5E8JA 3EMBA 1B4DA 4R51A 5IYZB 1LW6E 1ZJ5A 1AUQA 4YJ3A 4Y8VA 4JI4B 2GO7A 4HLCA 2XT0A 4RZ2A 4DMMA 4LV5B 3ZJVA 1K92A 2O1SA 4HEA1 1G9XA 3FX2A 3N5CA 3NNSA 4O08A 5HW0A 2PMBA 2O7NA 3AY3A 1FTGA 2QOEA 3EK2A 5LP6F 1P9RA 3M4YA 4JI6B 1TGYA 1P0QA 2V8OA 5KNDA 1N3IA 4MGHA 1PJAA 1TF2A 2Q9UA 3CRRA 3LXMA 4MS4A 9LDTA 3OZFA 2I6UA 2HT1A 3F8SA 1QK3A 3AZPA 2G9VA 2CNDA 1XYYA 4E14A 1T2DA 1Q14A 1BE6A 2FPUA 2HRZA 1AZWA 4LXTA 5IZCA 1QHEA 2O8BB 1XRRA 4ZQEA 4MVYA 4BLSA 1IZ9A 1EU1A 2G71A 3I0ZA 4TUYA 2YXEA 2WMYA 5DV9A 2FLKA 3FF1A 3BFJA 1V7QA 1E6MA 1HYGA 2B78A 3GUUA 3JQFA 5ARBA 2AV6A 2CCKA 2QEQA 1LPAB 3E7DA 4WA7A 4Z9FA 5LN1A 2HA3A 2X9LA 3MUNA 3VA7A 3K6KA 1XDSA 4KQMA 1PTKA 1AKTA 3LPDA 4JEUA 6REQA 3KZVA 3X3HA 5I01A 3ZUGA 5HRCA 1C8BA 2A59A 2OCLA 3ICCA 4ZTUB 1FLAA 2I3GA 3BXOA 4L0DA 4OP2A 4PS0A 4A9AA 2DAPA 3IVAA 4AKEA 3QVKA 4WK0B 2O8DB 1K8YB 3PD0A 1VPTA 2HTEA 4MA0A 5C5IA 3NHAA 1IQPA 1L3CA 3K4HA 1EFVB 1H6DA 3NBXX 3MS7A 2WF6A 1T4BA 5G41A 3V4LA 2WHXA 3HYSA 1KH3A 4BKOA 5K7SA 2FZ4A 5DM2A 3M5WA 4KBFA 2QUBA 2X8LA 4KDEA 4KW7A 3TUJC 1BWQA 3DZDA 4GVPA 1VJTA 2NYAA 4MZXA 4B6PA 1V41E 3PC2A 5HWSA 1NXXA 2O8FB 1R0SA 4IXWA 1BJKA 4W5RA 2KE5A 3SYLA 2GWRA 2HJ9A 2VHVA 3U44B 1MJ5A 1NW5A 3A6LA 4YGYA 1NP7A 2R00A 4MLPA 1P2UA 1NY6A 3KU1A 3L7BA 3JYNA 3S68A 1PL6A 4JEIA 3ZQ6A 4DEVA 4NIMA 2Q7DA 3BGSA 1IRIA 2XCIA 1AJEA 2ZUSA 4BNLA 4UULA 4ZZ0A 3IE0A 1W35A 3VPXA 3GX1A 5AVWA 1PAUA 3BAFA 2GLTA 2E18A 3N2KA 1C81A 3MXOA 3N8IA 3PD1A 1XF1A 4G1UC 1R4AA 4UFOA 1P9LA 2WD7B 4ZAZA 3U0BA 3LC1O 1HMYA 4G1FA 1D8AA 4OQEA 1SXJA 3SMVA 1FDUA 4BV2A 3G8YA 3THYB 3P9KA 3G85A 4N7MA 1DRUA 4B47A 4WBNF 4ZICA 3NWBA 4Y2HA 1P4GA 1ZJ4A 4NI5A 3ED1A 1BROA 1DXQA 3JTMA 1U9IA 3K72B 4YTEA 2VK2A 1KORA 3OCWA 1TLLA 4IIEA 3DV0A 1N4DA 4K9QA 3UMBA 3HH8A 1T6NA 5E1BA 3DHYA 5LP1A 4PZZA 3WSVA 3GLIE 1Q17A 3K71B 1K8QA 1U2ZA 1IZ7A 1W36C 2ZSBA 2FR0A 4B6FA 2XTJA 3WGMA 3M6MD 2CMGA 4YJGB 3RFCA 4RA9A 1JHVA 2W83A 3D5EA 4KGXA 4EG3A 1R50A 1M6WA 1VPEA 1I10A 2RGEA 3ABQB 3MC1A 3MSXA 4TS4A 4Y2GA 1R6AA 5CLHA 3ZBQA 1T2AA