2AZXA

Charged and uncharged trnas adopt distinct conformations when complexed with human tryptophanyl-trna synthetase
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
387
structure length
387
Chain Sequence
EDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYGDAVENAKDIIACGFDINKTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKMSASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 72-MER
publication title Two conformations of a crystalline human tRNA synthetase-tRNA complex: implications for protein synthesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/rna
total genus 133
structure length 387
sequence length 387
chains with identical sequence B
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2005-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00458 WHEP-TRS WHEP-TRS domain
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 2azxA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2azxA01
1QU2A 1V8FA 3TQOA 1WXGA 5H16A 1Q19A 5K0SA 4RPIA 4EGAA 1H3EA 1MBZA 2WB2A 1NUQA 2X3FA 2DXIA 1M1ZA 1M8JA 1IRXA 1QU3A 1T6XA 3H97A 1XNJA 1GZUA 1NSYA 2V0GA 1YUNA 3PRHA 1WJGA 3SYTA 3X1JA 3SEZA 4CT0A 4QRDA 4MVCA 1TYAE 2AKEA 1EFVA 1FYDA 2QJOA 4KPUB 2ZUEA 4PBRA 1S4MA 1JECA 1O95D 1EUQA 2J4DA 1N1DA 1U7XA 3H99A 5JBNA 1G8GA 1CT9A 3VRHA 1Y42X 4EG3A 2JA2A 4KKVA 4L2IB 3H9CA 1KR2A 2D13A 1GTRA 1Q77A 1G8FA 4MW0A 1N78A 2DR2A 1J09A 1KQNA 4OUDB 4JXZA 1N2BA 1N2OA 4J75A 1N2IA 3COZA 3TQIA 2E0IA 4G5FA 1T6ZA 1VBKA 1VLHA 2X0KA 2H2AA 4GU5A 5FNZA 3FNRA 4Q16A 5BNZA 1ZH6A 4MVYA 1MAWA 4ZCQA 3ZJVA 4BWVA 4KR9A 1NUPA 4JXXA 1X8XA 3IMGA 3QE4A 1KP2A 1JEEA 4ND6A 2PZBA 3CVYA 2CYBA 3G59A 3CLUC 3SEQA 4F4HA 1GAXA 3NBAA 2QJTA 3IVXA 3OP1A 2QUKA 1O0CA 3S3TA 3COYA 3HV0A 4MWBA 4ZT4A 5F23A 3UK2A 1VL2A 1YIDA 1WQ4A 5EKDA 2CUZA 2V0CA 1KH2A 1JZSA 1MB2A 1Q11A 3LE8A 3OTWA 5DASA 4EG8A 1D2RA 2H29A 1T9GS 4S1OA 4MLPA 4MWEA 2HZ7A 2CV2A 4U8HA 3QTBA 3ILVA 3RK0A 3KT3A 4EG1A 2CV1A 2OQ2A 1IVSA 4DDKA 4MVXA 1V47A 1EFPA 1U3CA 1R6UA 1KQPA 1UFVA 2DUMA 4CDMA 4MUHA 1VBNA 2IELA 3UMVA 3CLRD 5IJXA 4MW6A 1OWNA 3HGMA 2DETA 1IHOA 3PNVA 3COWA 2E89A 3E27A 4ZCRA 4XSVA 2PXHA 1MOPA 4U63A 1P7PA 1DNPA 1O6BA 1YUMA 1O97D 1YIAA 1LI7A 3ND5A 1IQUA 2I1LA 2A1UA 3MXTA 3H05A 1NZJA 5TS2A 1TEZA 4OJMX 4CQNA 1I2DA 1NYLA 1U0BB 4K03A 1NI5A 2NZ2A 1M8KA 3G5AA 2BTEA 3AFHA 3BL5A 1KQOA 1ULHA 3L92A 3FI0A 2A4MA 3NV7A 1GPMA 1MAUA 4ZCTA 3HFJA 3N05A 4WNYA 4MQ6A 3ND7A 1N2JA 1R6TA 2QUIA 2QJFA 2TS1A 4E1AA 4DJAA 1O96B 5KWVA 2PIDA 1YULA 2Z3VA 1U7DA 5IHXA 3IVGA 1JIJA 1GN8A 3F3MA 3FDXA 2A84A 3TZEA 1JZQA 3KT6A 2CFOA 1OWLA 4ARIA 3C8ZA 4MUEA 1TFUA 4CDNA 2O8VA 3FIUA 1KAMA 5HG0A 2DPLA 3ELBA 1XNGA 3FY4A 3UOWA 1M8FA 4UZEA 3I05A 1YI8A 4DDHA 5DEOA 2WQ6A 1N2HA 3SZ3A 4NZPA 5J58A 3GUZA 3D6UA 1EJ2A 1WY5A 2YWCA 3SP1A 4UZFA 2HGZA 1JHDA 3Q4GA 3CLSD 1KAQA 3HZRA 2YWBA 1H3FA 2QUHA 2EL7A 1K4MA 2QUJA 2J08A 4K0RA 3AL0C 1EE1A 4X0EA 1NUTA 1QRSA 3X1MA 4JYZA 4JZYA 5J59A 1OD6A 5FO0A 4PY2A 4XFJA 3PNBA 3DO8A 4AQ7A 1O94D 3TNJA 3ZXIA 3COVA 1MC1A 4YP7A 3ZUGA 1N2GA 1SURA 3RHSA 4YBRA 3RFFA 2X1MA 4F3RA 1N2EA 1JIIA 1J1UA 1VBMA 4MULA 3G6KA 2J5BA 4H3SA 4L2IA 1KORA 3N8HA 3IMCA 3H9BA 1N75A 2GKSA 2ZP1A 1I6KA 3LCJA 1O97C 2A7XA 3KT8A 3K9WA 4MUNA 3FH0A 1F9AA 2PZAA 3GMIA 1O5TA 3UC5A 4MW5A 1ZUNA 2VTBB 1F4LA 2G36A 3NBKA 4KR6A 3A04A 4YMIA 4ND7A 4KR7A 3X1KA 2EJCA 3DPIA 4WSOA 4YP6A 2RD2A 3P0JA 2B7LA 3GLVA 4DE5A 1GTSA 1QRUA 2YXNA 3SZGA 3M5WA 4HJRA 3IODA 2PFSA 4Q93A 2A1TR 1JILA 3CLTD 4DNXA 5H7XA 1F7UA 1A8HA 2D5BA 3DV2A 1O95C 4DDMA 3INNA 3AG6A 1EFVB 1T9GR 2PG3A 2Z08A 1F7VA 4MAFA 4EF6A 1IQRA 4EFKA 3ZJTA 3HL4A 3JXEA 1KP3A 3ZIUA 3CVXA 3Q10A 1TYDE 1QNFA 4MWCA 3RJZA 3VU8A 2JAXA 4ZT7A 4ZT3A 1NURA 3AIIA 3TS1A 2VXOA 3A2KA 5AHWA 1O0BA 1PFWA 1KH3A 1U3DA 1Q15A 1LI5A 1OWOA 1K4KA 5HUJA 4QBTA 1MB9A 3IVCA 1KH1A 3IH5A 1WXHA 4NX2A 1N3LA 1QJCA 1OWMA 4MW7A 2ZUFA 3VGJA 3IDFA 1J20A 2J09A 1MJHA 4EG6A 1NP7A 1H3NA 2C5SA 3CR8A 3MUEA 3P0HA 4DLPA 1G59A 1M83A 4NAHA 1ZJWA 1I6LA 1O94C 2DLCX 1J70A 4FZJA 1PFYA 3Q12A 1M8PA 4ZT6A 5LFAA 1IH8A 2WQ7A 4YP5A 3ZJUA 1RQGA 3A4IA 1WZ2A 3P0IA 2XRYA 4MUIA 4MUKA 5K0TA 4R2MA 1K97A 4I6EA 2D54A 4PBTA 1R6XA 1FFYA 3PNYA 1EXDA 5KCMA 3AKZA 2O5RA 3TZLA 3U1VA 2GOYA 2QTNA 1ILEA 3FOCA 1JMVA 4MUJA 2CSXA 3P52A 3LOQA 3HMQA 1WQ3A 3CA8A 4XFDA 4EG5A 3D6VA 4MUFA 1M8GA 3RK1A 4R0NA 3ZXSA 2CYCA 1H1TA 1HYBA 5J5AA 5LM3A 3L93A 5LLTA 1OBHA 1O96A 3PXUA 3IOBA 3FHJA 4KPUA 4NATA 2QTRA 4GRIA 4ARCA 3FWKA 3CLTC 2J07A 1XJQA 1PG2A 1PFVA 1MRZA 2AG6A 2QTMA 3CLRC 1TQ8A 4QREA 4MW2A 4MUGA 2AZXA 3ZGZA 1PG0A 1WOYA 5TGTA 1KKUA 4EG7A 2RE8A 1JEDA 2WSIA 5TEWA 2DEUA 3CVWA 4NAUA 1XNHA 3IUBA 3CVUA 2A88A 1BS2A 2E18A 4ZT5A 4OUDA 2DERA 2PZ8A 3FETA 5KHAA 4MVWA 1JIKA 5DB4A 1WKBA 5TEVA 1EFPB 2R5WA 2CT8A 1N77A 2YY5A 4PBSA 3AG5A 2X1LA 2CYAA 4ZCPA 1WXIA 4TS1A 4U7JA 2IP1A 4ZT2A 1WXFA 1ZH0A 2NSYA 3SDBA 3QTTA 2CV0A 1B6TA 2A1TS 1TYBE 3MLAA 2IJGX 3K32A 4MWDA 4HPWA 2JANA 1OBCA 1QTQA 1J21A 4ZCSA 2A86A 2BYTA 3IMEA 4G5YA 4HJXA 1JGTA 2A1UB 3FG9A 4R2LA 4NDAA 1OWPA 1WXEA 1IQ0A 3MLBA 4G6ZA 2E21A 1NUSA 3IOEA 4EG4A 1X6VA 4I6GA 3RBAA 2Z09A 4JFAA 3IUEA 1QRTA 4A91A 5HUHA 3CVVA 4MW4A 1K92A 2VTBA 3MMXA 4MW9A 1TYCA 2OV4A 3N2YA 3UY4A 4RUKA 5DK4A 1I6MA 1NUUA 3CLSC 1T6YA 1G8HA 3ISJA 3A05A 3ND6A 2XRZA 2HMAA 4J76A 1EUYA 3CLUD 4I6JA 3IOCA 2GM3A 3DLAA 4MW1A 1J1ZA 3KFLA 1GLNA 1COZA 5FO1A 4HK4A 3KT0A 3N9IA 1LW7A 4P2BA 1QQTA 1IFXA 1PFUA 4AS1A
chains in the Genus database with same CATH superfamily
3FGOA 3PQCA 4L95C 2V74B 1TUBA 2RCYA 1YQTA 4AZVA 2DSNA 2WWXA 3QIVA 2RAVA 4I4TF 4MPRA 4PLVA 4XKJA 1U3UA 3JY6A 3M8KA 1KMNA 2FV8A 1Y8ZA 1QV7A 1KRWA 4DJJA 2HLPA 1AXRA 2QSUA 4Q4DA 1SQGA 4PX9A 1M1ZA 3EXG1 2V9ZA 3INTA 4W5OA 3EIQA 3IP6A 1KO1A 4NBNA 4BMDA 4PC2A 3GVCA 5ICSA 4W7IA 1YDWA 4KPFC 1GQYA 1R5BA 1BIFA 3D81A 4PRLA 3R20A 4Z9FA 3ZVLA 4A10A 1K66A 1CR6A 3KFVA 4IVNA 3IQDB 4CT0A 1AA6A 4GRAA 3UANA 4E2XA 3I5YA 1EFDN 2I80A 1OZAA 3MJSA 2I5PO 3O8BA 3OEEA 5KI6A 2IWRA 5FFFA 3N8KA 3K0AB 1P19A 1PAUA 1T8WA 4DDUA 4I1PA 3USES 2ZJ4A 1GFZA 4DV4B 5F12A 4DGSA 2XQVA 1ND6A 1G66A 1N1DA 4K8OA 4BO4A 2W6ID 4L4RA 4HH3C 2QM0A 4YECA 2I91A 3KEOA 1P7WA 4FMCB 3RH0A 2VPQA 3HL0A 3VRHA 1H94A 1QGED 1JHYA 1U7ZA 2Q2OA 3LLVA 4H0CA 1F8FA 4OOFA 4PXSA 4XM1A 2GZRA 4A0RA 1A1VA 4OXQA 2XITA 3H9UA 3FLEA 4H60A 1OB5A 2GRUA 5F9MA 3N39C 1GTRA 1LVGA 3K9QO 1UXKA 2H2GA 3MBOA 2OAP1 2UYQA 1CLUA 1B76A 1A7UA 2O06A 2DUUA 3DP9A 5HJ5A 2FP4B 5A0TA 3ZD8A 4G0YA 3DO6A 1YU6A 2X58A 1IEVA 4XOIA 1TZ2A 3AHDA 1A2BA 3V1UA 3AEUA 1XHLA 5KYUB 1J33A 1XTTA 4YT2A 3FOWA 1UKBA 2QAGC 1XQ6A 4LXXA 3ROMA 3SIXA 5JECA 4ZTZB 1C7JA 5LQUA 1SPXA 2HBZA 4KAJA 4TWIA 5ECYA 3U80A 2YNMD 4HNTA 1I2CA 5FNZA 3L07A 3ZVNA 3KSAC 4ZCQA 4CF4A 5JZSA 1H2RS 2I4TA 2BCGY 2E48A 3O8OA 1T1RA 3WYNA 4C07A 3NAQA 1R37A 1YJCA 1SBQA 5KNDD 1ADYA 4X61A 3BILA 3MJCA 3WJ1A 2PZBA 3LBFA 4P7GA 5B4TA 4PG4A 2WNIA 4A0HA 1EGVB 2FFRA 2XQKA 3EIUA 3P5SA 4H6XA 2X5JO 2BBOA 4M0FA 1JEQA 2C2YA 2A6PA 4QTUB 3ANYB 1J99A 4NE2A 1X86B 1ZWKA 4LNHA 5K2MA 3I4CA 4LDJA 2BE7A 4TYNA 1CQWA 1PZEA 3THRA 1I3NA 2GESA 4RGVA 4DEYA 2DBQA 4ZT4A 1QLWA 3LC2O 1I1OA 3T5BA 4FGUA 5FADA 1JHUA 2R84A 4YJ2B 3VSDA 3HGTA 4XVRA 3F8TA 4M0DA 5ALYA 4YONB 3S2EA 5IJ9B 3C15C 3M6XA 1J7KA 3IEVA 3RSLA 5JCOC 1Q2UA 1JZSA 3C6QA 2ZE5A 1QQ5A 1U0EA 3VAAA 4HD8A 3EW7A 1M6EX 5HPYB 1WMSA 1OBVA 3EC2A 3RNLA 3KB6A 4Q24A 3A10A 3PUXA 2JRLA 3BBLA 1P33A 4GM1A 3R7SA 2QVCA 1PZXA 2CJWB 4GMKA 4JI1B 2Z2ZA 3II6X 3ILVA 3SPXA 3EH2A 4EY5A 1HYGA 2EZ9A 5ITSA 1Z7WA 5BVGB 1CIPA 2BGKA 3OO1A 1EA7A 1SXJC 1I6WA 4QXPA 4Q01A 3R1IA 4R68A 2WWGA 5C8YA 3DLTA 1H4SA 5BSFA 1JYSA 2Q99A 1YTUA 1BN7A 4NNPA 2DY1A 1RP7A 3JQ9C 1IBCA 1P4SA 4RHXA 5HBRA 1VKOA 2XF2A 4XXHA 4MS1B 1OVMA 1GRQA 2CDCA 4TMZA 2AE1A 5CX4A 4EB3A 1BU5A 3HXKA 4HBGA 4Y67A 5T8KA 2R8XA 4YV7A 1F2TB 5HM6A 1A8QA 2HLDA 4IAOA 3COWA 3K9GA 4W5HA 4X45A 3X1ZA 4IMJB 2PUVA 4DIOA 4G67A 5B3KA 2I8LA 5BWBA 2OCBA 4OKSA 3ZD6A 1XALA 2YWJA 4LPSA 4X93A 1X1CA 3U3XA 2BGIA 1XMXA 5J63A 4C2BA 3JW8A 4MI1A 3W0LB 3ST7A 1JV2B 3L7BA 2I7DA 4L8LA 4TRRA 4AG5A 4BV2A 1F2DA 4DV2B 5EJ2A 4B74A 1QM5A 2C7VA 3L7AA 3QE2A 1JIXA 1TCBA 3HJGA 1BDHA 3QJYA 5AVOA 3CMMA 3RI3A 4H6WA 2IQIA 2Y76A 3G5AA 4YRNA 1A72A 4RPGA 1PD0A 1T5TA 1EH5A 5BN4A 1V8BA 1YF3A 5JAPA 1KQOA 4UTNA 2BMVA 3VHLB 3W5DA 1HFEL 3PHLA 2ZRDA 3SVTA 1Y34E 3DMDA 4UFOA 1SJ9A 2B35A 3IRUA 3JQFC 3OLCX 4JUBA 2MSNA 3N05A 3QXCA 1FYFA 4MQ6A 2ATVA 1Z2PX 3L7NA 2VHVA 1WW3A 4ML3A 2W6ZA 1ZVJA 4MYRA 5AW6A 1ZU5A 1GZ6A 5DV9A 4MB0A 2YVLA 4TT3D 2D06A 5FTNA 1NJFA 5KVVA 2WYHA 5ELMA 3I23A 2AN1A 1U7DA 3F1KA 5JH7A 1JIJA 2X0JA 2WSMA 3OPVA 1B7GO 3ZHBA 3UJBA 4M9QA 3W4IA 4V2UA 1CEQA 4J1TC 1W4CA 5DEIA 3EC7A 2QN8A 2YOFA 1FDWA 1TFUA 3L8MA 3LC7O 4HQNA 3CRQA 3T5TA 4AS3A 1E5LA 1O54A 4JASB 5EIWA 2DPLA 1A82A 2M6SA 2H57A 3UOWA 4JJ6A 2EU8A 1TK9A 3CZ4A 3E4CA 4ZO4A 1E1MA 1WY5A 4MCIA 2R66A 4ZQBA 1V1RB 1IN7A 1P81A 3A2MA 3HKEB 3HUFA 5JXWA 5KHLB 2VHEA 3MMPA 2VT6A 1N0VC 2W2KA 2ZJ5A 3CLSD 5AJZA 3VR2D 1TU0A 3F6BX 4JB2A 1Q0HA 3CEJA 4KE9A 4B6GA 1EDOA 2ADOA 2IBMA 2DHEA 3CZPA 4V0LA 3UAOA 3N86A 3OEHA 4WNAA 1GZ5A 2I0FA 5FL7D 3SGLA 2JGRA 5GOZA 1EE1A 4YUXA 4U0JA 2EARA 4ZAFA 4YRSA 4DLLA 3UCFA 3PHHA 3BPSA 2C2WA 4NICA 1YVRA 1A0OA 2W2LD 3K30A 2G07A 4EA7A 4Q03A 3ORHA 1SVNA 4AQ7A 3RREA 4RV5A 1VJDA 4K9RA 4BVGA 4UTPA 3TTTA 4ZQHA 1XN4A 3RHSA 4XGRA 1MO6A 1NXSA 1KEWA 2A9FA 1DDIA 1YE3A 2Q6OA 4GI7A 2Z5GA 4LRSB 1QHHA 2BGNA 2PKQO 1F20A 3OZUA 4H3VA 4N8EA 3TUJC 3MYYA 4E5PA 1GRRA 2ECQA 1DC6A 1O97C 2Q29A 3G9UA 3NP7A 2WW8A 2R48A 4F72A 1D4FA 2H0QA 1PNOA 4OQEA 2Q5IA 2WP8J 3FBGA 4DMHA 1B0PA 4RHTA 1YNOA 4MW5A 4PX2A 1FLDA 4YNBA 1RVDA 5AI9A 3GF4A 4J91A 3EUFA 3AI1A 4Z9BA 3WLEA 1R16A 4RD2A 4ADSG 4EHNA 1GNTA 1U7UA 1U4NA 1ULBA 2C4NA 4K40A 3FLAA 3STWA 4O1IA 4E6PA 3S2YA 1P0FA 3C3XA 3O21A 1Y5NA 2QLMA 1PYOA 4A6DA 4D8UA 2P78A 1NBMA 1RHMA 1RYBA 2B83A 2XTNA 1TF2A 4KVAA 1ZKMA 1QH8B 2ZWAA 2CXOA 3QF4B 3G9ZA 4ZALA 3TBFA 5JTUA 2EQ5A 3MRVA 3CTMA 3DBRA 3L9XA 3C1TA 4BJ3A 4GX2A 4J8PA 4L22A 1ZK0A 2PGDA 2VWQA 3QE0A 1J0XO 4UBOA 3HJFA 4KXWA 4WK0B 1CS0A 2MDTA 4M21A 2GHTA 1FMFA 2XQGA 3D4LA 3LLSA 1QOZA 2BBTA 2P4HX 1ZG3A 1ZIXA 3H0EA 3O2QB 2ET6A 4IDDA 5HF8A 2X22A 1F1BA 3RWOA 4CR8A 4K6HA 5EE3A 3DXZA 1U2DA 4XWTA 5E7MA 4EEZA 4AN1A 3DKIA 2F4VB 3KSMA 1FNNA 1YZKA 3MD0A 2FPWA 1RJGA 4KIFA 3A6HA 5IK2D 3V2UA 4UUOA 2ZUBA 1R9JA 9LDBA 3TSOA 3CX3A 4HVLA 2ZDQA 3IPAA 3ZHOA 3IT2A 4YUZA 1HC7A 1QE3A 2QLLA 4MMZB 4IQFA 5EIHA 1OWOA 3UV6A 3KQQA 1EQAA 1WCIA 3EHEA 3GI1A 3I6ZA 4AJPA 5HM8A 1DAFA 1N2SA 1XF9A 2Q2WA 4L74A 4P3XA 5HWSA 4QSMA 1UMDA 4MV4A 2CJFA 4EARA 4IKEA 4W9NA 3SWWA 4QYTA 3N8IA 2BMWA 2PFKA 2GASA 4RD6A 5KSZA 4X6UA 3H83A 5HE9A 3WGGA 1Y33E 1CUAA 2C5SA 1A9YA 1ZN8A 2OFFA 2XSZA 1U5CA 5K8UA 1SXIA 3IKLA 4OHUA 1DIGA 1I6LA 2QS9A 3V80A 2WA2A 4G09A 4WERA 5ECWA 1PYGA 5A3QA 5LFAA 5IM4F 3N6XA 4HQFA 1QZ3A 3RAJA 3TFOA 1B6GA 1RQGA 2R44A 1LTHR 1NVEA 3DKKA 4MQUA 1OAOC 2XRYA 2UVPA 3OEYA 5C35A 1C2TA 5ER9A 3TZBA 2F8LA 1V25A 3T7IA 3B38A 3KC2A 2Q5JA 3EXIB 3S81A 4IRXA 4KQXA 4XUGB 4WFIA 3RYHB 2X8JA 1ZEMA 3LQKA 1CS4C 1T5BA 5IVPA 2UYOA 3ILXA 4NJEA 1FYWA 5CDFE 2O5RA 5IP5A 3RRJA 4B3SB 2XUOA 1PWYE 1NXTA 4U2EA 1GA4A 3K1JA 3MWYW 1HYEA 3OFVA 3U37A 4JB3A 1E9BA 3ETGA 4DYVA 1OFGA 3EVDA 3E7PA 2CLFB 4XFDA 3PWZA 1YQEA 3WGKA 4MUFA 3FB4A 3KJIA 1OXXK 4GI5A 2QGZA 3UMSA 5L3SA 3UJ3X 2XBLA 4HNVA 1Y6GA 1QYVA 3H2ZA 2MSDB 4OSEA 3TD9A 2XNDD 1FP2A 3GXOA 4AO8A 4JVLA 2QL9A 4NZ9A 1FP1D 5L40A 5LM3A 3K6SA 1WR8A 3R6LA 2BPOA 3UK6A 4U6NA 2SCUB 5KNBA 3BICA 7YASA 3VA7A 3H1FA 4GUAA 1YAJA 3ZH2A 5K7SA 1U28C 4IXTA 4HYYA 4LRYA 3X2FA 2W2OA 3R44A 3UKOA 1PG0A 1E5DA 3ZWVA 3RSOA 4XYEA 2WPNA 5BV1A 5T57A 2PS1A 5J2UB 1GPKA 4YQFA 4TKZA 3RYFB 3IKTA 4E31A 3GPDG 1MVLA 3IHTA 3THSA 3MYRA 1M0TA 4U5QA 2ZI4A 1CZRA 1K3UB 4RK6A 1KI6B 1PZNA 4QECA 2F1IA 3KIPA 4UBNA 3AIOA 3S2FA 3HTXA 4B6EA 2HR1A 2ZK7A 3AJDA 3FETA 3ETJA 3N2KB 2TMYA 3EXHA 4MVWA 1JIKA 4G97A 1SY7A 4LOLA 4UFNA 3C3EA 4YROA 4YAEA 1UIRA 4GUDA 3S1AB 2WNSA 3I0ZA 1QBGA 1UC8A 1WUYA 4DLTA 5ED4A 5FBVB 3KQNA 2OWEA 2CT8A 2W71A 1ONNA 3E53A 4I1YA 3B7PA 3K7EA 4JQCA 4QFMA 3CURA 4U7JA 5CDGA 2UZ4A 5DTJA 1QJ4A 1OJLA 3CIOA 1AX9A 1M73E 2HK9A 3Q3GE 4URFA 4KQ6A 7REQB 1CHDA 1WOMA 1FUUA 4GI1A 3QPAA 4G84A 4KIGA 1AKTA 2P40A 2A1TS 3H19A 1UT5A 3ITEA 2IJGX 4E07A 1OA0A 4ZEVA 2WM3A 1QFJA 3U3JA 3U13A 5TPZD 5F1YA 2RGRA 1LLDA 4MGIR 3IVMA 3SF8B 1SGWA 5AVZA 3L3BA 4BQPA 3VR5A 3PJFA 4FR0A 3HXOA 4INJA 2AZTA 2W2VA 2FXIA 3ZY3A 1MFZA 1G7CA 1SU8A 3IOEA 4X8LA 1SC6A 3GH3A 3ABRB 1X6VA 2VBGA 1USKA 2B37A 2ZQZA 2Z09A 4IY1A 1QP7A 3SXJA 2G4LA 3LBYA 3RSCA 1ZCBA 1OHHD 3EZXA 4L4UA 1OXVA 1DC4A 2QM3A 2I3GA 1HEYA 1MC8A 1TYEB 3PYLA 4GECA 5E6UA 5C32A 3W8RA 3MMXA 3L46A 4NBVA 4F3TA 1KEUA 4YREA 4G0XA 4IX1A 1IY8A 1FDTA 1UK7A 1W48A 4YAFA 4BNJA 3AV0B 4BO1A 2RAPA 5L3RA 4L3VA 2JLWA 4W99A 2V03A 3M4YA 3R4CA 4X8HA 5DM0A 4HLCA 4AWAA 3T1TA 1OX5A 2NUTA 3CZ5A 5BWLA 1MH9A 4I6JA 1M2WA 3SBXA 1RJDA 4AG3A 2E49A 3AB7A 2C58A 1EVJA 4MUXA 1NNSA 1SUCA 3KWFA 4MW1A 5HUQA 1OYOA 3QVVA 4LRXA 5IBRA 1NA5A 1NZFA 4Q7QA 3BXXA 3U7JA 3ZWPA 4I4TA 3JQ8A 3WMGA 5EKUA 4ZREA 3GFFA 1X80B 3KL4A 1N2CB 5EYPB 1JL3A 2WFMA 4U6SA 5BN1A 5TARA 3WKDA 1RYMA 3MTEA 3ET4A 4PFJA 2HV8A 4A3SA 1M2EA 1Z8FA 3DYIA 1AUOA 4RZUA 3T4XA 4Z7JA 2WB2A 5ADUS 3AUUA 2AG8A 2NLOA 5BOSA 3GDFA 1VGRA 4JGBA 4JK3A 1E1DA 3PJRA 1KFJB 1U1GA 1TA0A 5T8KC 2OHFA 4O2BF 5M3BA 3C98A 2JFWA 5H02A 1F8UA 1CRLA 2NO0A 4HZUB 5EIOA 5BN3A 1OI2A 2GEUA 3QWFA 3GFTA 4Z4EA 5DNDA 3WDLA 4BE9A 3V4SA 1U9CA 1W5AA 2EF0A 1S2GA 4HY3A 3K9CA 3ZU6A 3QPDA 5JS1A 4OTZA 1SBCA 1W96A 1VHWA 3GJZA 1G291 2NSLA 3OQBA 2X1VA 5C52B 4KSYA 3NEYA 2BEVA 2EIHA 2FUNB 1TXGA 2XTMA 3RSQA 3WSVA 4YCCA 4KIWA 1G8GA 2JEYA 4LNUA 3HKCB 4ZEWA 4H7PA 1Y7HA 3L0OA 4N8DA 2CDBA 2PVPA 4J7AA 3T34A 4GZLA 3B3AA 5EJ8A 4L4ZA 1KI8A 2R6AA 1OFUA 1AQYA 3FF4A 1GXSA 3H4VA 3QEKA 2XUIA 4GC9A 4D3SA 4KWCA 1X2EA 2H7XA 1LPOA 2CXNA 2KYRA 4WOKA 3FSJX 4HAYA 3MCAA 2W90A 2H08A 3FFTA 2WKPA 3LDFA 1KDVA 1RXUA 4ZICA 3F9CA 5E38A 3AR9A 2HU2A 2ZJBA 2CVPA 4HSEA 5IDXA 3OJOA 1H8ED 1X1SA 4X24A 1BVHA 1A5SB 1HE8B 1GCIA 2J6CA 3VSCA 4ZK6A 2YZKA 3QFCA 2IEZA 1Y0BA 1YDMA 2W2NA 4GEGA 1SULA 1D1SA 3NX4A 1ZBQA 1UXOA 4HLNA 2AYYA 4ICIA 4Y2PA 3EC1A 2AUTA 4BV9A 1W4AA 1KZGB 5D51S 3HBFA 3IAM1 4M89A 5I4IA 2HU5A 2WUFA 2OCIA 1NUPA 2J46A 3N58A 3MT9A 4NF2A 2FDCA 1K6XA 4MKHA 4ND6A 4HAIA 1FVHA 1HGXA 2XTZA 2EP7A 3CLHA 4K9DA 1GITA 4R2IA 4RA9B 3CVYA 3EXEA 1KVSA 2MYNA 1V8ZA 1E7SA 3HR8A 3TECE 1LV7A 4JXKA 1V9SA 2A57A 3EA4A 3PXCX 1KMMA 4QUGA 1S6YA 2C9BA 4J94A 2PVSA 3ICCA 4GYKA 2IY9A 2OP0A 4L0DA 1LH0A 5TJ9A 1P1BA 4WJZA 2WPDA 5DI3B 4NS4A 3RU2A 1B3RA 5H70A 3SN6A 1MOZA 4B44A 3OWXA 4C22A 4ETWA 3WY9A 5EKDA 5LJIA 1A50B 3ISTA 2XEXA 4J7CA 1I5OA 2P90A 4KZPA 1XAIA 1KP9A 3VU9A 1SO8A 3INRA 1O58A 1OC4A 2EWVA 2LKCA 2NM0A 1RXVA 1WUHS 2QN9A 4ALNA 2IXEA 2WWWA 3DS8A 1QUFA 2PQ2A 3RRYA 4ZAVA 2CV2A 1ZUIA 1ZW1A 3A2LA 4NG5A 4BQNA 4DQVA 3IR7A 1FZTA 5EE5B 3F73A 2ZI3A 2R0QC 3NOVA 5E6SB 3IT3A 4MVXA 1KFEB 1YB5A 2YTZA 1MX1A 2JIBA 1Y8RB 3WMWA 4M1WA 1SWWA 1U3CA 2DLNA 2F1KA 3L7MA 3O9ZA 1NZDA 2UDPA 1UZMA 3TZCA 2MCFA 2QR5A 3W8DA 3N2ZB 5KQPA 5KYXB 5LMZA 4HQRA 4TMTA 2LV8A 5GM2A 3UMVA 2LCIA 4NRDA 4LS3A 2BFNA 4R5HA 1SC1A 4GR9A 1BXGA 4NCIA 5ICMA 1AGNA 3DMYA 2Y05A 2DLDA 2F62A 1TKAA 3UW1A 5DSTA 3O8CA 5EHIA 1D0VA 2FZKA 4ME6A 4DARA 1UDAA 3KQSA 1PWEA 2JCYA 2JVKA 3KDSE 2QD2A 1VC2A 1PGJA 3NIBA 1XD8A 2C61A 5ES4B 2I4NA 2RGNC 4II7A 1Q7EA 2GNPA 5AKGA 2DQSA 2BCEA 2I8AA 3FCCA 4B7CA 1TQ4A 2A5YB 4PANA 2FCAA 2JLSA 5F64A 3ZQ4A 5A5FA 2GWHA 3EOZA 3OESA 2ZUSA 1VIDA 2C4HA 4RVUA 3FYCA 2UXBB 1YV9A 1DAOA 1P4HA 2XNCA 5KSWB 1F0KA 1H2XA 1WV0A 4KX5A 3RUCA 4PCAA 3FI0A 1PL7A 3H8WA 1NL3A 1LBEA 3AP1A 4KXYA 5GY7A 2BFPA 3TG8A 2UYYA 4ZCTA 2X6RA 3IDOA 5H4HA 3OX4A 4BN4A 2F43A 2Q9CA 2X9NA 2CNLA 3AO0B 3ND7A 1A2OA 3EUAA 3R3JA 3OE7D 5TPWB 1J9GA 1PZFA 2Z6VA 1U2DC 1ZUWA 5KPDA 1L7QA 4WJKB 1W0JA 4EUEA 4UU1A 4R2XA 2BFWA 1P9WA 3TIXB 2CJYA 4JLJA 1E6CA 3MN1A 1AGRA 1ND5A 1NQVA 2XADA 3SX0A 3MGGA 4M7OA 3TW6A 5B7QA 4NCAA 5BWOA 2O7VA 1NC3A 1PQPA 2W6OA 3IBTA 2ZIAA 2EEZA 3M33A 3PKIA 3PSAA 1AURA 1R8XA 4MUEA 4RSRA 4Y8VA 2AXNA 1J23A 2WVHA 4AL4A 2AR9A 3KSRA 3RFTA 3VKUA 2WT9A 4BX0A 2Z5VA 4LWPA 4CFZA 5T3UA 4ZJYA 3NHAA 1SUWA 4DDHA 3PUYA 5IAOA 1ZOPA 4B83A 1GZ4A 5DNEA 2GXUA 1T8RA 3E03A 1VLMA 1RR6A 1YMUA 1TC2A 2R1UA 4NI5A 3UENA 3S8YA 4D3YA 3DLPX 2FEMA 2HGZA 4J0IA 3BC1A 1EJ6A 1JVNA 2GZMA 3HZRA 3D8TA 5DGXA 4KNYA 1M1YB 2PMBA 3PR3A 2XA1A 2EHJA 3BFVA 3QA3E 4IDBA 5JW6A 1ZMRA 1VPDA 1Q2XA 1TM7E 4DRXB 2MJLA 4YT8A 2CCKA 4FONA 3GROA 1K8RA 5K3FB 5K51A 2BCJQ 1H8HD 5DULA 2A78A 1HDYA 2QPTA 3TEMA 4IQGA 3TNJA 5BP7A 3GGJA 3LFTA 3L9WA 3SLGA 3HY6A 3VXKA 3ORYA 2ANBA 4R0VA 3K6JA 4XE5A 1W73A 2FPXA 3DFMA 3Q88A 1BWSA 1DUVG 2NXEA 1C3OA 3NHJA 2ZYRA 4UU7A 3V00A 4H3SA 3TEJA 5IKPA 2JGEA 1KORA 4CIDA 2I87A 5CLIA 3H9BA 2NO1A 3V48A 1G8PA 5GJVC 4E5MA 3F5MA 4LHVA 2HT1A 5BSEA 2YS6A 3LCJA 3RT7A 2A7XA 3ND8A 2DBZA 5FUVA 3M9XA 4H15A 1T4BA 2Q1WA 3B1FA 4MUNA 4G9GA 5FUWA 3P1JA 3MD9A 2XE4A 3R0XA 4NL4H 3U4HA 3W9BA 1Y4SA 4DXAA 3LO5A 3EPPA 3KX2A 2DF8A 1LS6A 1NU8A 5K3OA 1F2VA 1TTTA 2C54A 3R5TA 1U0GA 3BSYA 4D6YA 3A1EA 4MARA 4A6EA 2O7SA 2ZG6A 4B35A 2QP4A 4K6FA 5D00A 2PL3A 3JPYA 1KAGA 3M4JA 3UMRA 4FYXA 4O4IA 3UPUA 3ABZA 1V4VA 4IG4A 3L06A 5CP8A 3UJCA 1LJUA 1VZ3A 5CFZA 1PTKA 2RD2A 1BYUA 3KUUA 4A8JC 3DL0A 1EX7A 2PL1A 4MR8A 3UG7A 4ISCA 3IODA 3M2TA 1FTNA 4G5SA 4O5AA 2Z1MA 3PDCA 5COBA 5LWHA 3OTQA 4MR7B 2QZPA 4HXEB 3U7RA 2PLNA 2AFHB 3IHLA 1VE9A 4G1EB 5DYWA 1MHPA 1U2ZA 1Y1QA 3SYNA 5FPPA 3B6MA 1BKSB 1T9GR 1IATA 1ZN2A 3HZHA 3RYTC 4EYGA 4TZKA 7GPBA 3LQFA 2OFPA 4J1NA 4XWOA 5KNDH 2HW8A 2ZYHA 5ALWA 5DSZA 5AJTA 1PLJA 2HHAA 3ANNA 3TBHA 4CYMA 5B5SA 1ULSA 3CVXA 3PNLA 1HT3A 1QC5B 5A5EA 3HDYA 1J2YA 3RJZA 3LUJA 1IUOA 1JQBA 4QARA 2ZUVA 3SXUB 5L4NA 4RKYA 1FOEB 4FC7A 4OAOA 3EDMA 3FKQA 1QH1B 3A2KA 1P7VA 1QZTA 3Q2OA 4DB4A 3U9TA 3DZIA 2H48A 4J1SA 4V24A 4DM4A 3ZBQA 5HTOA 3GBVA 1KH3A 2TMGA 4JODA 1L4BA 421PA 3OF5A 1S3IA 1P0PA 1YRLA 1S3SA 4QBTA 2C4TA 2XYRA 3NAZA 4WXRA 3WYCA 4B76A 2P7HA 2Y93A 3GUYA 4G07A 2E1RA 3IH5A 4B43A 3A0UA 3SSOA 4EJ0A 1E63A 4FHCA 5HW0A 5G4KB 2JG3A 2QG9A 4B7UA 5F21A 4DLKA 4GP6A 4HBZA 4UTZA 1PV4A 2ZTVA 4LKOA 3FYUA 3SKVA 1KI9A 3WGHA 3WLJA 3QW4B 3A6FA 3HBLA 2ZBRA 3NBQA 4UKDA 1DCTA 3MUEA 3A1WA 1R5JA 1RSZA 4PZUA 1SKYE 5IM4A 1RJ9A 1E1QD 5DCUA 1ONPA 5DN6D 5IXSA 4WINA 2JK0A 4ZRNA 3CB2A 5JS6A 5BV7A 1Y5MA 1SHTX 4WW0A 2FWPA 1B1CA 3K5PA 3BS4A 1QKJA 4GPD1 4OA8A 4P3KA 1GQ2A 2YHIB 1WUJS 2ASEA 3ESYA 1H23A 1IUNA 1GPNA 1L4MA 2ZSJA 1YQWA 4I1IA 3I1YA 4K46A 4KUGA 4MV3A 4X7RA 1UDBA 4BECA 2QRKA 3FB1A 3RTAA 5KX5B 4ER3A 3PNYA 5DX1A 1TZBA 4A8JB 4NMHA 1RZ3A 1KO4A 3KPVA 3N2EA 3PL5A 4EJ6A 1APBA 1ILEA 5JADA 2I8CA 1JMVA 3IUPA 2RI0A 1NMQA 4TLEA 5LZ5A 1DO0A 2WTXA 1XQVA 5BW8A 1WPXA 5CVTA 4EMUA 1P61B 4UUMA 5EJIA 1YH3A 2Z1NA 2AX3A 2TECE 5L45A 1ICEA 5CU7A 1E7WA 1MVOA 1P1HA 5J5AA 4BQOA 2X4LA 3EPLA 5EIAA 4UPVA 2CBGA 2XUHA 3IOBA 4L0CA 4OU5A 4RZ2A 4ZAZA 3U0VA 3TTYA 5JI2E 1ZFNA 4OGKA 1Y80A 4P38A 4B40A 4YRBA 3FD8A 5CTJA 2PKWA 4JYCA 1QH9A 3HU5A 1VKJA 2Z2YA 1LQUA 4MGZR 2WTUA 2GCIA 3IV7A 3LW7A 1MLDA 2HSDA 5AW9A 2I6GA 3OM1A 1FYEA 2JJ2A 1DAKA 1HMYA 3O4VA 4LC9A 4XB6B 1TUGA 4CCAA 2FQWA 2J0VA 2PKRA 4J9UE 5C2JB 3BT7A 2WJPA 7MHTA 1MAAA 2REBA 2XGOA 3WS7A 4BIMA 1NXPA 2BP7B 3IALA 5DTRA 3CVWA 3PC4A 2O3QA 1U9YA 3PV0A 4JCCA 1WZNA 2VRBA 3H0KA 4O4JF 1RQXA 4JLUA 3NLLA 3V8BA 2A67A 3CVUA 4KMRA 1PR6A 4D9JA 3FMGA 3O4RA 3QNWA 3VR4A 4DKJA 1Z4IA 4FSXA 2FPGB 3DQQA 5DB4A 4UFPA 1XA0A 2ZB7A 5KYUA 1MEEA 5CIYA 4NNJA 3HP1A 4L16A 4UASA 1VJTA 2GD2A 2HSZA 3AG5A 3T7AA 3U48A 2VP4A 3MCZA 5ISMA 3I42A 1IMOA 2BGLA 2WU3A 3PFBA 4LDPA 1CUUA 3BRWA 5A4DA 1CUBA 1SOVA 2H1RA 4BJHB 2A0KA 3TOVA 4D82A 5DWVA 4D9CA 4OOEA 5EGSA 4BYMA 1XEWX 3GJTA 3GEDA 5T6BA 4PIVA 3COSA 2PR7A 4QD3A 1TYBE 2Q50A 4FP9A 1R9GA 1QO0D 4F5ZA 4HPWA 2QNRA 1U8YA 4BXOB 2FWAA 2G6TA 4ZVNA 3LPDA 1DKMA 2GLXA 2MU1A 2P11A 1NJ2A 1QIDA 3OT5A 2PEZA 1ZGJA 3L6UA 3JQCA 4JVMA 4QDUA 4QQRA 4DLSA 1QGYA 1TE2A 5FUQA 3EG9B 4B4VA 3MLBA 3B70A 1MCZA 4Z2YA 2J3LA 3U4IA 2AKAB 4YJ2A 3UJAA 4IICA 3GEGA 4MKXA 2AJDA 5T41A 2C4MA 3AHFA 3DZBA 1GPWB 3ILSA 4LYEA 1JFSA 4O0MA 4HWRA 3CVVA 3COJA 1Q50A 3H5OA 1OU4A 4UVHA 1EDBA 5C5DA 4CEJA 3Q3VA 3PBKA 4LBYA 1R6VA 5JNLA 3AVXA 2OO7A 1Z4NA 2ZYIA 1X42A 2NYUA 3N2YA 1MTZA 2OP1A 2X8LA 3OICA 3ONNA 5THXA 4D3ZA 3KQLA 4BPBA 1JB9A 2FDRA 1M34B 1XB2A 3E5RA 3ND6A 4HEA6 2XH8A 3KHTA 3R7AA 2JIZA 4AKSA 5I4CA 2CBZA 5K3SA 2YX1A 3RUIA 3GD5A 4M9CA 1EFAA 1RQRA 2QRHA 1UJ4A 1CP3A 4N3GA 5FV7A 1YS6A 4CQJA 3SXPA 2H2HA 4RE5A 4UDOA 2ZDHA 2XE6A 4BNYA 2PQ0A 3PJDA 2BGUA 1IZZA 2ZXFA 5ALPA 3V42A 1MUUA 3KJEA 5EWLB 1PFQA 3KZMA 1EFVA 1F2TA 4GVPA 2WWFA 1D6NA 3DOEA 5DBOA 2NTEA 3ZV5A 3WNDA 1MV8A 3ONVA 2JD0A 2X5KO 3QENA 3HR4A 3IA2A 5DWDA 4P1ZA 5GIOE 5JDIA 3G17A 4MQ4A 4EJMA 3VPCA 1E9DA 3BERA 3N07A 2PSSA 4O2BA 1U5BB 3VNQA 3DEJA 4E3WA 1XNJA 2B4YA 4UEQA 2R2GA 1G5RA 4OMFG 1ENZA 4ZZ0A 4TSFD 3Q7SA 1SXJD 2BJWA 3SYTA 5CLHA 1R0ZA 5T6MA 2Q5QA 3AKDA 4EM6A 2R86A 3HBAA 1AK9A 5IULC 2GZDA 1CLEA 4ENWA 13PKA 1M2NA 1M6NA 1RKBA 2IE0A 1EX1A 1SCJA 3A4VA 4FQ5A 5H82A 5JVDB 4AY3A 2JGJA 1P1CA 5JSKA 1X1DA 4NYMR 1B42A 3VTAA 4FXPA 4GKJB 2ISCA 1RLMA 2EHDA 4NXNB 3H99A 4IXNA 4R2WA 5B1DA 1KIMA 3ZDDA 5AVTA 5FPHA 3JQDA 3BB4A 1L5ZA 3U6BA 1PVOA 3V8VA 3HVUA 4EG3A 1G19A 4LYAA 2OHJA 3RFCA 4E4TA 4MVJI 1XTSA 2P9EA 1H2YA 4NE9A 1RRVA 2CW5A 3PC6A 1E98A 3SS8A 4EKDA 3G02A 2XYQA 4QGFA 1N78A 1G3UA 3LY8A 1NYTA 3DHWC 4YMHA 3C3JA 1N2OA 1T9KA 3F3YA 5EESA 2XIQA 2VL7A 4UNNA 4X20B 1DB3A 1P0CA 4DSUA 2O54A 2Q2NA 2HB6A 3I73A 2QLFA 3GFRA 1TX4B 2OAEA 1ZUNB 4BCDA 4LK3A 2WRZA 5CJJA 4IILA 4CBVA 1J8YF 4QL3A 4WOJA 1O1YA 1QMPA 3QNMA 3CH6A 5J4LA 2JFOA 4DAEA 2IY7A 1E66A 1T9ZA 1U7WA 4I2VA 3NVAA 1S8NA 3AHIA 4CTOA 1IVYA 2H7VA 2RHDA 4D0RA 1IZYA 1KOFA 2IZOA 2ZB8A 2IU0A 2TRSB 1J2JA 1R4MB 5D7BA 2HWWA 2E9SA 1I9CA 3AFOA 4C3OB 5KQGA 3EULA 3R7BA 3OT1A 1E6WA 4JHLA 2GD1O 1TAUA 2HQBA 4H16A 3DW1X 3WK7A 2YOGA 1TCUA 7AT1A 4MV9A 2M6KA 4KXUA 5DNUA 4CEIA 1GAXA 4EPXA 2D5IA 4FBGA 2NW6A 4TTPA 3UPDA 3HV0A 4CE6A 4LGVA 4G8BA 2PZKA 1YIDA 4O4LF 2GPSA 3CKKA 4LSMA 1C1HA 3TM5A 4A82A 3AM4A 1CR1A 4MZDA 5K0CA 3M5DA 3C16C 1XZDA 5H8WA 2I2DA 2R6FA 3KAJA 5E1OA 1CE8B 2QX4A 2Y2UA 4XLTA 2IIVA 5SYMA 2CUKA 2VH1A 1D2RA 1KEEB 3BORA 3ZS9A 4C2UA 5LYYA 3VI4B 4Z4GA 5JWOA 1ECGA 2J1LA 3FTPA 5AI8A 5I7RA 1KY5A 4HNRA 1SELA 4S1NA 4R8MA 4Q1VA 3SNKA 1PBTA 1ZX1A 1L1FA 1DKUA 1A8SA 3OZBA 2OQ2A 1XPUA 2NU8B 5A71A 4H27A 4HWPA 4ZYWA 3PJGA 4OHXA 1S2LA 3HYCA 3WNVA 2X4IA 1MD9A 2QTCA 3VR5H 4EUKA 1AV7A 2R7NA 3CLRD 3R3VA 4K9LA 3ULKA 5BMVF 3RKSA 3PC7A 3B1KA 1QCZA 2W6PA 3EE6A 1AZTA 5THKA 2AK3A 3JQGB 1O9BA 4FNOA 1C9KA 3QF4A 1YBMA 4OD0A 4OQPA 3T3EA 5A5GA 3DW3X 3K9FC 4WNCA 2X8WA 5F1PA 4H7KA 4IIEA 3VV3A 1TKRA 2RGDA 1YDEA 2G77B 1DG1G 1JSRA 2V3WA 1J2RA 3QXJA 3H16A 2EIXA 2WVJA 1O97D 2I4OA 5AVKA 4V0QA 3WR5A 4OHBA 1MFPA 2I1LA 3U7IA 2JAPA 2X7HA 3KPUA 2GCPA 2AVDA 4H6VA 5JV5A 2X14A 2IIPA 2D1QA 3DHNA 5TS2A 1HSOA 1NVVR 4ZOLF 2FJUA 4OYLA 1AXEA 3AYXB 1WCWA 2DPMA 1RHRA 4Z2AA 3AQ4A 1UXIA 1PJCA 1QGOA 1SQ5A 3MT7A 1M8KA 1Q7TA 3AF6A 1SBHA 3ESAA 1UMBA 5G1PA 5H3CA 4LZOA 1OR8A 2Z8YM 3EUWA 1Q44A 3LQ4A 4HFMA 4E2YA 2XCQA 3PGMA 2O3TA 3MTAA 4HDSA 5T5QA 1EJ0A 5DBHX 1XYVA 1OW3B 4WNYA 4JI7B 4XW2A 2FN7A 3WSTA 2HI0A 4LYJA 3TTUA 3FZQA 3WXBA 3OPNA 4NECA 2FZVA 2PT6A 4CL3A 4A8PA 5K0ZA 5IHXA 2W2TA 4DQLA 1GN8A 3OQ6A 5J2UF 3TZEA 4ABTA 1IN5A 4BMPB 1Y9DA 3TAHA 1WEKA 3NHZA 2R65A 4KODA 5EHNA 4Y1EA 3L79A 5DYIA 4JUDX 4O2AB 4GPEA 4FNMA 3OF3A 2ZM6B 3SIRA 1TJ5A 5EQJB 1C1DA 2GDZA 3OU2A 4GFDA 1PUXA 4KOAA 3RG8A 2HUPA 2NQTA 2CMHA 5IC4A 2Y1OA 5EXDA 4F1WA 2VRWA 2QHXA 4MI9A 3D7LA 3EAFA 2VQSA 3FAKA 3FYUC 3NR2A 4NU8X 1NATA 2ALJA 4AJ9A 2X4GA 3DL4A 2VDKB 5CXUA 2Y6VA 2P2ZA 4NBUA 4AZ3A 5P8WA 3UJ8A 2PH1A 4XQGA 3VO9A 1B0UA 1RI5A 1T0BA 4JLNA 5E0KB 5IVDA 2GN4A 1EAYA 2P62A 4DR3B 1PK7A 4AROA 1KGDA 4D0LB 3HYRA 2J08A 2QRZA 2C9OA 1VYTA 3PQ8A 1NUTA 5EJ6A 5IDVA 1YZLA 3EFOA 3UFBA 1BE0A 4KUHA 2RKBA 1WCV1 4MVJF 3U44A 3WFZA 3QXHA 5DHSA 3F8SA 3HEAA 3ZV3A 2ATIA 2WJZB 3GLHB 2VIIA 1Z4PX 2JGDB 4FYPA 3M6UA 2WQZA 4IHJF 4JEUA 4RGYA 5FD8A 3OJEA 3V1KA 4YGXB 3MUOA 4Z0TA 2SCUA 1GAEO 3TTWA 1N2EA 4F2GA 2FN3A 4TMKA 1R8JA 4L2IA 1KI2A 1CRPA 1B3BA 3N8HA 2HF9A 1II0A 3VZBA 4C4XA 1DC3A 5A62A 3SX2A 3PFCA 2W8ZA 3DM9B 1B8OA 2GKSA 2P2CA 3I37X 1ECCA 3WAKA 3Q8KA 5KVCA 2ZSIA 1UKYA 2LDBA 3O26A 1BXZA 4NOKA 4WACA 1QIKA 1W4LA 3ASVA 1Z18A 3C6ZA 1AUQA 5ESXA 2BGJA 3B2NA 2Z3WA 4ROTA 4EP1A 3AUXA 2HCTA 3KV3O 2VPTA 1K7CA 4B3GA 2J30A 4I5DA 2XT6A 5FXMA 4CJXA 4EIWA 4P54A 1I0ZA 3MT0A 1KI6A 4OP3A 2LCQA 3QX3A 3UV7A 3JQAB 2C3PA 2GAAA 1FSZA 1OXUA 2JGFA 4UHFA 5CT5A 3PUIA 1JG3A 1RCFA 1AQJA 2ON6A 4GHWA 3KWLA 1TDJA 4X64B 4JSTA 1V7ZA 3GLVA 4ZIRA 2PRIA 3I3SR 4I4NA 3VPBA 1FMJA 4BC1A 2EKDA 4AN0A 4JLKA 4TTVA 2ZRHA 3CJTA 1O6ZA 1P6QA 2R751 1S2NA 5H7XA 1A9RA 1EX9A 5DTQA 4DLBA 1TUEA 4BV8A 1POWA 4H4EA 1J42A 1FEZA 2FR0A 4E7PA 4GMDA 4U2BA 1L7BA 3BMQA 4TVSA 1YR3A 4GICA 4MKZA 3OEED 2QPLA 1O5OA 3CF4G 3L5OA 2GF9A 4J4HA 4BQQA 3ZIUA 2FEWB 3IUSA 5CJPA 1T43A 3PQEA 5AKXA 4BKPA 1C1YA 2DFLA 2PH7A 1EEXB 4M83A 2LD4A 1XC7A 4MR9B 4C05A 2V96A 3SF8A 4B5KA 4ZT7A 2WTBA 4BNTA 3NANA 4YCDA 3KSBC 1Q1QA 3FPLA 3ELDA 1F2UB 1PSWA 1AXGA 2V54A 4MLDA 4YLYA 3KBBA 3X1XA 5EY5B 1OMOA 2AV6A 2ZTUA 2CFRA 3MRTA 4F84A 4HVCA 1YR2A 3BWYA 1G8YA 2IUYA 2P4EA 5CD9A 3GRRA 4ZYTA 3QLUC 2YBEA 3ITKA 1U8XX 1OTXA 2A3NA 5LMNB 5I9BA 1XL0A 4NX2A 5BV2P 1MGPA 2ZBDA 1VLJA 4UD6A 4M6WB 1A97A 4RXMA 1GCGA 4CMEC 2ZUFA 2HKIA 1NVVQ 4P3PA 1B26A 1IBKB 1H3NA 1HNNA 3O3OB 2GLUA 5EE0A 4DLPA 4C14A 1G59A 5C4MA 3WTCA 2GPBA 2FSFA 2OG2A 4JT4A 3A1NA 4NG4A 4DN6A 3QEMA 3WYEA 3BL6A 4C4RA 2WQ7A 1VKNA 3GGGA 3JZFA 1WZ2A 3D3WA 1A76A 2NTNA 2GK7A 4CM3A 3KEMA 1PLKA 5CYOA 5AHOA 5P21A 3WHKA 2QVBA 2C2GA 2UZ3A 3OFND 4B33A 5LOVB 1LV8A 2O5VA 2RHWA 3OY2A 4JELA 5ARCA 3WGZA 1C9YA 1XLUA 4EY8A 4RLHA 4L8YA 2FPIB 2PUWA 5KWSA 2QTNA 1PFKA 1SIWA 3DDUA 3FOCA 3JWGA 5ES3A 3G0HA 3OZAA 1EHIA 1H4TA 4F92B 5EXTA 5ALSA 4ILEA 2OQVA 4BJ5A 2AN5A 1PG5A 4D41A 2HUNA 3EGOA 5BWNA 1E18A 1NDHA 4Y18A 4BVLA 821PA 4Q9KA 3QW2A 1DOZA 3DB2A 4H08A 1ATIA 2OAGA 3FPKA 4G1BA 4KHZA 4Z4CA 4RL6A 1QB7A 4HZUA 1J8DA 5CDSA 5CDUA 4E3ZA 5IDWA 2AT1A 1P44A 3LLUA 1TVKA 2V59A 3M1IA 1CQIB 3WK5A 3LYAA 3AXSA 1ENOA 2V7PA 3LS2A 2V8BA 4KPGA 1JKJA 3KKZA 1Z5PA 4BX2A 1QORA 4RY9A 5TVKA 5EIXA 4OBXA 2WHEA 2ID4A 3W5HA 4FDVA 1G3IA 3GRVA 2FZWA 2PYDA 2ZDGA 4FLEA 2D6FA 3TLEA 5J5CA 3OH8A 1V8PA 3N3BC 2PY6A 4FDLA 1OKKD 1M6VA 4TV9F 2H16A 1KY2A 3A36A 3V4RA 2BI7A 1F0YA 1JR3A 2EZ8A 3OJXA 4INOA 3UATA 1XDUA 2V5AA 3DOFA 4Y6SA 1IXZA 2E4XA 2I29A 3ANTA 1FIUA 3QV2A 1JHVA 1PX0A 2J3HA 4XCXA 1O9HA 3IUBA 4OU4A 2LDXA 1CJMA 1M1UA 4H7FA 1BS2A 3AHEA 3H2IA 3QM1A 2CVFA 3KYCB 1C7ZA 4FCCA 4MQFA 1CZUA 4B3HA 2WP0A 1OX4B 1TVCA 2QENA 2FHSA 1ODLA 5AK3A 3UCEA 4D46A 4ZCIA 3Q1KA 3K0SA 2VJDA 3MMSA 5FA5A 4B2LA 2X1LA 3JZDA 4CV0A 1KNQA 3B8EA 3C6XA 3IE2A 3STTA 2GZSA 5F3WB 1CV2A 1V8OA 1IN6A 1Z7EA 3GV0A 1F12A 5H5JA 4E5YA 3SYLA 1VSUA 4OBEA 5SICE 3WI7A 5F7ZA 1DHTA 2HIAA 3AF0A 2XRFA 3DAYA 1N5OX 2HRRA 4S2UA 5CA0F 3U49A 4RA9A 1KPGA 2BF7A 3BFXA 3NWEA 2BR3A 2W4IA 3FCUB 2ZZMA 1Y3DE 3ACDA 1E3DA 3EQ2A 3K32A 4LMBA 3IB3A 3FOBA 3ZW7A 3N74A 4XRGA 4CL8A 1KRHA 3B7WA 2DPXA 1ZVQA 3OZVA 4MJ7A 4FM9A 1FQWA 4P2GA 2A1UB 3F4LA 1M1NB 2ZR7A 5L4LA 2AQHA 3FNIA 1ZM3A 3DT9A 4XTCS 1YMVA 1EG7A 2XI4A 1BAPA 5HQ3B 4YRJA 5L95A 3EGVA 1E2GA 4HWGA 2ZATA 1WEHA 4RMIA 1HYQA 2F48A 2D2XA 1FUEA 4DG8A 1H85A 4IDEA 4LKRA 1P75A 2C9YA 3DMNA 1LBSA 1R0RE 3ILHA 1TZKA 4U2GA 3SLRA 3ZE6A 1H0KA 4AW9A 4C0SA 4TSKA 1EWQA 1R1DA 1YTLA 2E4YA 3L4SO 3AEKA 3ZHQA 1FFWA 2C0QA 3RIHA 1I6MA 2OHIA 2RB4A 4MYHA 5E6SA 2F67A 3BF7A 2V7EA 4YX9A 3RC3A 1XTUA 3ICOA 2P9YA 4Q3KA 1K98A 1M5RA 1O4WA 4J76A 3SI7A 2CHVA 4M0PA 3D4BA 3IOCA 3SIPA 2P1RA 2DU8A 2BTQB 1DMSA 4XIFA 3ZCRA 2EV9A 1F3OA 4DSTA 1YA6A 3RUPA 1KNXA 1GSHA 3C3KA 3PEUA 2X4DA 4WZBA 3T7JA 3TMKA 2GJ9A 4ENUA 3T61A 1PNVA 1ZMTA 4RK5A 1X70A 4K88A 4QUBA 4OQMA 5FUBA 3P2JA 1TZJA 4RACA 1WSAA 1ZYUA 4P86A 2HJWA 1OBFO 2HV9A 2ZAIA 4PLFA 2PT7A 1X9IA 1O5IA 1P9OA 1DFHA 4QO7A 2QTZA 3G0DA 3QY0A 1KOLA 3F78A 4C4TA 4RD3A 6YASA 4PNHA 1R2QA 1I36A 2R47A 2C5EA 3MRSA 1EB8A 4XVQA 3LX6A 1NVMB 4RLQA 3AM5A 3OTGA 3JCZA 1L7XA 2G5GX 4QYWA 4RQUA 5EWMB 1VSBA 2IYQA 2PGJA 3W2EA 1NX9A 1Z2DA 3GFQA 4RPHA 2ZIUB 4LISA 2WYUA 3OE4A 2GERA 1P6XA 4JUCA 1CRWG 4MKRA 4O5OA 2FUG1 1R0KA 3SHVA 4J90A 2OD7A 4S24A 1JQJC 3F5SA 3UHJA 1OXMA 4P53A 1UFOA 3CCFA 3PE6A 2JS7A 1ESZA 4JWTA 4LOKA 1XEXB 1Y1RA 4CI9A 3GDOA 4AJHA 4HXYA 3ZY2A 1UZAA 1WD7A 2XVXA 4ZAWA 4KITB 4RHEA 2QMOA 1XKXA 1RXWA 2XE7A 4ENRA 4YMLA 2R8PA 5TPWA 4Q1EA 3I30X 4B3FX 1ZDMA 4N6GA 2G08A 1E2HA 1I7NA 4LBVA 1AOXA 3SNHA 4MROA 3URKA 4Y1FA 3P9RA 4C7OB 3DVAB 4TKMA 2HQOA 2VF2A 4A7PA 3FRJA 2V7TA 4YRIA 2PCJA 1JAYA 2ECFA 3H9CA 3ZNOA 3I39X 1L9XA 1GLVA 2IYZA 3K72B 4BLQA 3OD1A 1H2FA 1F5NA 2H4WA 2XQJA 3AETA 1DAIA 1NBMD 1RAIA 4JN6B 4OUDB 4AY6A 1A96A 2ZANA 1UOPA 3RHZA 3X2EA 1KYYA 4N39A 5FOXA 5CB4F 2A14A 4N6OA 1UQUA 2BH2A 1JRLA 3V32A 3ICVA 1U8AA 1XMQB 4AD8A 1QYIA 2D2EA 3IUQA 4QEDA 3MZ0A 1HDCA 2P0YA 4G8DA 4WUTA 2XOEA 1M3SA 1UL1X 1ESEA 1RQ2A 2FN4A 3OLVA 4OIFA 3RRMA 1FNCA 5F77A 3MGCA 3LYLA 4DWOA 4HNUA 1R3DA 4RIEA 5JFOA 2D8AA 4C7KA 1U2EA 1T9HA 1TTQB 3BTVA 1RCTE 2SHKA 1KU6A 2CHUA 3A4YA 3TOXA 3HN7A 1P0QA 4EYKA 1UMCB 2I6UA 4O1MA 3WNCA 2WVAA 3RRZA 5IU6A 1B16A 3TLYA 2NZJA 2Z5FA 3AFNA 1X1AA 4PPGA 4QPDA 3WBFA 4K86A 4WNIA 2XMGA 1OH6A 2VPYA 4PAGA 2G71A 1DKRA 1EVEA 4IH9A 4O4LA 3SY8A 4I08A 1E1CA 3A6JA 4WY5A 1MW8X 4I50B 1JF8A 1W2GA 2UAGA 3C5HA 1F48A 2F9MA 3FUTA 2PV0A 3KRTA 5INTA 2EW8A 1A9PA 2WU4A 3G2LA 5JC8A 4AVYA 2O0MA 3RVSA 4YT4A 1VL1A 3PWSA 4FHFA 1H6AA 1RNLA 1OY1A 4J3FA 3V97A 2CXRA 4WXEA 2BM1A 5IKMA 4B3JA 1OH5A 4PQRA 1KEKA 2IZ7A 4XASA 1B23P 2R5FA 5E2AA 3C7TA 3K9LA 4MLPA 4MRRA 2IZ5A 4KE7A 4HDMB 4S1OA 5FIUA 3K09A 1NTOA 2D3TA 3I2FA 3RTGA 1GDTA 3DEFA 4RHUA 1PP4A 1JS1X 2HA7A 4LOHA 5KDOA 4MP8A 1GPYA 3DKRA 1IY2A 5DTMA 2J0EA 3WA6A 1YQ9A 1RI2A 2PSDA 2IXTA 4U2FA 4RZ3A 1NNEA 1DXHA 4NWIA 2DUMA 4YRPA 1X7DA 4REQB 4D4IA 5JNWA 5CA1B 5JO0A 1TIPA 4RKQA 2C88A 4RADA 5BMVA 2CE2X 3VOAA 3S0JA 1VQ1A 5JSHA 3CNEA 1XTIA 2W83A 3KQOA 4TUYB 4RIHA 1IWOA 2XODA 4ZU6X 5EHQA 1DLJA 3X1YA 1GTVA 4BVHA 2PH3A 1I10A 1XDGA 3A6KA 3RJTA 1DJLA 1TK3A 4NBLA 1PL6A 3E27A 2F1RA 3RB8A 3GZNB 3KOOA 3AERB 4ZXFA 4ERNA 1MOPA 2JCSA 2O8CA 2PD6A 3U7EB 3TW8B 1D2AA 2QRQA 6ADHA 4NNOA 4E30A 4DSOA 1BWPA 3OZEA 4L9SA 2GPAA 2NVUB 3MOGA 4MV8A 2I03A 4ZOLA 2FAXA 4R6XA 1AKWA 1UAYA 1WSDA 2VYQA 2I99A 4RKEA 3IX7A 4LPKA 1JVBA 5EQDA 3RVRA 3B51X 4QOEA 5AVVA 4G36A 1I2DA 1GV0A 2PVCA 1ZM2A 1E3EA 1V7QA 1HTBA 1NVUQ 2Y9MB 3JD1A 3B12A 4XB2A 3VGPA 5A4MS 3GT3A 3SXUA 1OZGA 3PPVA 4E5NA 5CFMA 3R41A 4KR3A 4L4XA 2I9PA 4O29A 3ZV4A 1NT4A 1T3LA 2WG2A 1V1JA 3PD7A 4V3BA 3TJZA 3VTFA 1MAUA 3DCJA 1QH1A 3KZVA 4JY7A 4ZI7F 4GQBA 4HDKA 1Z0UA 3B1JA 5FV4A 4CIVA 3BGSA 4JROA 3W6OA 4TQGA 5HSGA 2QUIA 3PFGA 3R9IA 4XYBA 1EIZA 3Q6NA 1X39A 4I55B 3GOHA 3VH2A 2C04A 4BTVA 2ZWIA 3F3SA 5CB6A 4EHJA 3VR6D 2W8BA 2NTJA 2Y71A 3FKSA 2PIAA 4UARA 5G4KA 2OA0A 4ER7A 3BM5A 3QMWA 4GNRA 4XARA 2EZ4A 3JVVA 1JU3A 4HZIA 4J7UA 4EVIA 2CFOA 3KLNA 4XJSA 3UAVA 4ARIA 1ZITA 4X1IA 4YO8A 2V6IA 1JEAA 1FNDA 1R9MA 1UBTS 3L6DA 3JS5A 1DKOA 2RG7A 4X41A 4JP8A 3GK3A 1G20B 1UXJA 3IKJA 3FOZA 1M67A 4G1UC 4UZEA 4AICA 4F06A 3TLXA 1XO1A 5FTLA 3PCRB 2H5LA 4HFJA 2O59A 1N2HA 3RBXA 5IKXA 3HPRA 1EFKA 2HCFA 4AP9A 3AUTA 1K2WA 3LL7A 4NMMA 3U7GA 1EG2A 4IWYA 1I4DD 1D5WA 1GPDG 1WVMA 4L57A 1O89A 1ADBA 1VPTA 2MSKA 4LV6A 5FHQA 4EZEA 1M54A 3WQRA 3KYDA 1VYUA 2NSJA 2XJ4A 2G0TA 2P4QA 3B2QA 3LCVB 4NCKA 1W5TA 2AQKA 2FE4A 1ZOIA 3TKYA 2A1IA 4QJ5A 3AZQA 3FPCA 4TWBA 4XUDA 1QCDA 4WESA 4K2AA 3KXLA 2O52A 1I7DA 1W35A 1EMDA 1K4MA 5E7QA 3IQEA 2OV8A 4TQ9A 1E2JA 2KHZA 3N1UA 4MVJA 8OHMA 3OHMA 5AW0A 3ZZTA 4BO9A 2BGWA 2CLCX 3DG9A 1E96A 5LD2C 2K6GA 2GVNA 5D7NA 1PR0A 4RIIA 4V1CB 4J2HA 1WWKA 3U4GA 1RMTA 3D0RA 4X1KA 4CU2A 4RM2A 2PX6A 3GVIA 4X60A 5DHFA 1K06A 1YS4A 3AR8A 5JCJA 4DREA 4E09A 4N48A 2DWPA 1E9FA 4ZYZA 3BULA 3UK0A 3OKAA 4F3RA 3K1YA 2SKEA 1BZYA 2D7DA 3A7EA 3G6KA 3UAWA 2VZEA 3D02A 2J0QA 1BQEA 4W1PA 3DOHA 3L05A 4R84A 1QR6A 3GEPA 5ADWA 3RYIA 1HURA 3LUFA 2IRWA 1MU0A 2FGJA 2I4IA 2JFXA 3IVAA 4UULA 3S27A 5DHQA 5JEEA 1GU1A 5ALXA 2JDID 2A4KA 4IF6A 5IRCD 4MI3A 5KKNB 2BP7A 3F5QA 2H00A 4DG5A 2IWHA 3JR3A 4XWAA 2Y67A 4UDNA 1WUKS 1GKKA 1ZLXA 3OHSX 3SIWA 3GJ4A 1Z6TA 1I32A 1Q0RA 4DLUA 2OCDA 2OZEA 4GMFA 4CG2A 4ZI5A 2Q0SA 4DUZB 1CZNA 4NXMB 2QMYA 1XRJA 2FPGA 3KTAB 3IXQA 4UQOA 2R8BA 4ZK2A 4NPAA 1OIXA 2W4QA 4YJHA 1SKUA 2VCHA 2VBFA 3V7YA 5CT4A 2Z5LA 3A9WA 1JVSA 1NRWA 1UQTA 3AH8A 1UPTA 3BD6A 3TLGA 3PZRA 4F9EA 1A9XA 3THXB 3EWIA 4WFQA 1DBIA 1RP1A 1RABA 1RE1A 2QT0A 4LY6A 5CYFA 4DNXA 4F6CA 3D7NA 5AICA 4FYVA 2OBYA 2QXTA 1HETA 2IC5A 2EJBA 2ID8A 4IDQA 2BEWB 1TM3E 2ZAOA 1N1EA 2GCOA 1GGVA 2HPHA 2B2CA 3AY6A 1AMNA 2DAPA 4LHEA 3A9SA 5ARBA 4XYGA 2IHZA 2XLBA 2WJHA 3A3OA 2J87A 1SZCA 5HFJA 4D74A 3O03A 5H1YA 3CEAA 3B1ZA 4Q6WA 3E3MA 3AIIA 4LG1A 5JXIA 3RT9A 1DC7A 3F7MA 3RVQA 1EWRA 1FDIA 2BFEB 1Z6AA 1ESCA 4LGCA 3VOBA 4AUMA 4CEHB 1RD4A 3HE3A 3Q6IA 1S89A 4L5JA 4TL7A 5HUJA 4XQ0A 1WB5A 2ODAA 3JV7A 4NFLA 4BTEA 4D0SA 4AQDA 1IAVA 1AK2A 5FOTA 4AKHA 3IGFA 2W9XA 4ZI3A 2JH9A 1NHGA 2EFDB 3OX3A 4DS3A 3ECAA 1D2CA 1TCAA 4EG6A 1NP7A 2FSHA 4GPAA 3T7CA 2PYIA 4JLDA 1I4LD 4JKIA 4JJ4A 4MB6A 3PEVA 1T3TA 4Z49A 2WM2A 1M34A 3G2PA 3UICA 4D81A 2MSCB 2GM4A 4FI3F 4EVQA 3CVJA 2JJMA 4B3RB 3ZBPA 1WG8A 1YC2A 1O94C 1PJLA 1KHHA 4Q21A 1W5BA 3RWMB 4CTKA 4DNPA 5HVNA 1IUKA 4M4SA 1EUCB 1GN9A 4YP5A 2OILA 2MYUA 2XNJA 1VLLA 2YMQA 4ARAA 3DTVB 4OQNA 2IHKA 4L51A 1KAHA 3KR1A 3QWAA 5DHPA 3RBVA 2IV7A 5JCZA 2RONA 2OV1A 3G2KA 4DRZA 3K70B 2G7ZA 3B6ZA 4PBTA 3QPCA 1F3LA 1PEYA 3GLFA 3NDIA 4A6PA 2P2NA 4PLTA 3FGPA 3R9XA 1CDZA 3ZZNA 1BRTA 4DR2B 2DYKA 4MJ3A 1CW2B 4PYMA 5FR1A 4PYLA 5JG7A 5FI5A 3NCHA 1R3UA 1NFFA 3NYIA 5EQTA 1AB5A 5AVUA 2YVQA 1CNFA 2QE7D 1VMEA 2RFLA 4DWWA 4XYLA 1Q1EA 2ZTMA 3OZTA 4GAEA 4CKBA 3E05A 2PDAA 1CZHA 3VBEA 1YR9A 2AW5A 3ADBA 1R6AA 1VL5A 1AGXA 1ISRA 2D74A 2NTVA 2OXRA 2HH9A 3L93A 4Q9LA 3UYKA 5KOIA 5LXTB 3S8EA 2HDOA 3LT5A 4KYTA 1W88A 4EX7A 2QA5A 3WGYA 5EXEA 5IFKA 4UCFA 5JVDA 1QHNA 1UBMS 1T9BA 4V38A 4IFEA 2I2BA 3BXZA 3FNQA 3UJ6A 3O83A 5D3MB 3CW8X 1ZXBA 3WDMA 4DQKA 3ZGZA 5IKOA 1OGIA 1PF7E 5IYZF 5EJGA 4OXIA 3WLPA 2ZRQA 4GX0A 3ETLA 5LYJB 1UH5A 5LNK1 1K68A 1BWRA 2GD0A 2VS1A 4MI6A 5CEFA 4QICA 3TQHA 3G6WA 4RQBA 3O0DA 1VDZA 1P2DA 1Z5OA 1MO3A 2H18A 4FSHA 3KZKA 5JYBA 1AZLA 3NH6A 1I3LA 3ZWNA 5ITWA 4ZVPA 2D1TA 2JLAA 4BLRA 3BB3A 1ZMBA 4FLMA 4PN7A 4RTSA 5A02A 3FSEA 4PYOA 3VZSA 1I1HA 1V9CA 2OLEA 2WSSA 2GHIA 3LDAA 4X20A 1IB6A 3SVZA 2HPAA 4YRCA 2QKYA 2J3KA 2D59A 4MS3A 1JKMA 1Q12A 4YAOA 2HNKA 2XOKA 1CVRA 1CY4A 2QX6A 4ZCLA 3TRDA 1NFRA 3F7TA 4L08A 4QUEA 4MDFA 2ATCA 2ZJ8A 4FOPA 4B4DA 1YRBA 4NY1A 2B2NA 2BUBA 3AQIA 2JFGA 3N0VA 5AXAA 1UAAA 5CA0A 3OA0A 2TSYB 4BRZA 2QLTA 5CB8A 3GGPA 3RRFA 1XZFA 1I2BA 3INGA 2GZ1A 4B48A 4J9VA 1PGQA 3CRW1 4HQOA 1U0OC 4ZVSA 4IJ5A 3W6PA 3W77A 3KD2A 1NQTA 1IJEA 3V55A 2B1GA 5J40A 4XX1A 2PO5A 3KR9A 4ROSA 2VHWA 1QGUB 2WHRA 1U8CB 1IIBA 2W58A 4IDAA 4Y2UA 4FFPA 2Q27A 3ESQA 4N40A 3T06B 3R3XA 1OWPA 1F1JA 2XKJE 1IQ0A 2PZJA 3H5WA 3Q6MA 4W1SA 3EZFA 3JQPA 3W2GA 3W4KA 2BKUA 1P73A 3UTDA 4ZVMA 4CV1A 3HJHA 4YB8A 2P5YA 4J0JA 4J3NA 2IS1A 5EC8A 4IDFA 3ZHSA 2XDQB 4EYSA 5IH3A 4F2PA 5IT5A 5LSAA 4Q3BA 3MAJA 2N47A 3BF8A 3QPVA 1RPZA 4R1LA 4PE5B 4M60A 4DNFA 3GAMA 2IXGA 3ZK9A 5AXDA 1E62A 3HFSA 3I09A 4Q48A 4ZQEA 1CSEE 2PGAA 4O4HB 4E46A 3QFTA 1EUYA 3Q3CA 3SQLA 2IVFA 3AVPA 1KR5A 1N7GA 1XTVA 2QTHA 2ZUCA 2Q0QA 3BK2A 5JUWA 3EDCA 1ODTC 3KFLA 4G23A 3K09C 3P9KA 4TXHA 5CX1A 5K8IA 3VNRA 3TF5A 2VZ9A 1W1UA 2OCGA 2FRDA 2PU7A 4WK2B 4BZXA 3WZLA 4G85A 2BN4A 4M22A 4R40A 2R87A 4WIAA 2NO5A 5TF4A 3GYGA 3IPLA 3E58A 3BHNA 3JQGA 4A15A 1WXGA 5H16A 5CLLA 2KWIA 4KI7A 2ODWA 3LUHA 5DMHA 1IDOA 2XNKA 4YN3A 2CVZA 3DNPA 4OLJA 3IXMA 1NQOA 3CNNA 4H7DA 1QU3A 1M2VA 1NMXA 3TZKA 4RMJA 3A4TA 4DJTA 1O6FA 4FNGA 1DSSG 3G1WA 2DT8A 4TN1A 5J2TF 1FQKA 1KK1A 2IBSA 4QU8A 4C0JA 1IHUA 2FPPA 1YUNA 2EFJA 4N5DA 2O9JA 2XXBA 1NPTO 4TXJA 3UK1A 4B75A 3B3QA 4QRDA 1Z82A 4HWTA 1PS9A 4PZYA 4RTPA 1XEWY 3DL2A 2XY4A 1FYDA 4DUGD 1ZRMA 4O2LA 4GLFA 1LCIA 4MQMA 3ROFA 3T1YB 2XUQA 3A1FA 5FPYA 2ZUEA 4DT1B 4RNCA 3L8YA 4TTIA 1Z0JA 5JMWA 2DFVA 2YS7A 1NP6A 1P31A 3EGDA 4JQSA 1QO9A 1FZQA 2IP2A 4BFLA 2J85A 4ZHQF 5KVAA 3NIGB 2G4CA 4KAAA 1HDEA 4Q7MB 3WNBA 4O3FA 5CLJA 2F3QA 2IHTA 4L5BA 3VH3A 4Z51A 1QSGA 1C9DB 1T8UA 1VCHA 2RC5A 5BUZA 4F9GA 2VTKA 2I66A 3EZ7A 2COEA 2V4UA 2NACA 2QTVB 3ZE9A 4BZWA 1BHJA 5CB4A 3LAWA 4C5BA 2ZULA 2B82A 2HA3A 4FHGA 2ISSD 3WKBA 4UCXA 1RQLA 4HI0E 1JT2A 3F6CA 1ZGCA 1S7GA 4F3YA 3T3NA 2J7PD 3TQIA 4TROA 3OIYA 4YI3A 4A5OA 3RFXA 4TYMA 2WFAA 3LVRE 4KG7A 2Q0HA 2BZSA 3HB4X 2X0EA 3ZK8A 4CXMA 2VNHA 2ATEA 1QE5A 3EARA 3NVDA 2REQB 3KJFA 3P71T 2ZLBA 4FGJA 3I9MA 1P5JA 1QAMA 2NZUG 3ZJVA 1Z8HA 2O07A 4B8WA 2NNWB 2ZS9A 1V4NA 2YW9A 1RLIA 1G5HA 1FDVA 2CYBA 2HA0A 1T5DX 4HNAB 3GUVA 4U2DA 3FZYA 1BCSA 3EOAI 1GNRA 1IY0A 4IP0A 4C4AA 4YPFA 1C0PA 4LCEA 1UC4B 4C21A 5JYCA 4OHYA 1F4VA 3OP1A 3U9LA 2MSWA 2Q45A 1EM6A 1Z4KA 4CMAA 1Z29A 2YCBA 1VE6A 3I6MA 2ACVA 3JZAA 5HQTA 2C7BA 3LMKA 1CQJA 5AHRA 3PU6A 4Q9JA 5JNSA 1KYWA 4Q0MA 1EYZA 5FBLB 1CZLA 2WWIA 1Y37A 3K16A 1DAEA 4P84A 4RGBA 4TWRA 3SHOA 3WMRA 1HDXA 2IOFA 5KMGB 5SZIA 2RHJA 1NW5A 2H9IA 4QBHA 4YCAA 4YJGA 5T3YA 4DMMA 3PUZA 4GRDA 3IVRA 5BYAA 5ILQA 4UZSA 3ZD7A 5JZ9A 5E3IA 1EFCA 4GX1A 3N8NA 1D6SA 2I54A 1QVAA 2JBWA 3FUVA 1IOLA 2Q4BA 2QL5A 4IZIA 1T4MA 1SUFA 3TQQA 4QTXA 2PS0A 3ZQUA 5IVKA 4JUAA 5DHRA 4B3IA 3DZHA 1C29B 3FDFA 4ZYYA 3EXG2 4Y30A 1ODFA 2ODNA 3ELYA 4QTZA 3EEFA 2H5IA 4OQFA 1ZNXA 2O2DA 4WKBA 5JE8A 2CNWD 1A5BB 3JRXA 2GQ0A 1NVGA 2OUKA 3OE1A 4ZZ3A 4Z0NA 3PSHA 3AFGA 4R9SA 2HF8A 3F2VA 4IKOA 1DDGA 4JBYA 3OZIA 4O33A 2BFOA 4CT4B 5AUOB 1C3JA 1C8KA 3FZEA 3PX7A 1QVVA 1CWUA 1YS2X 4FYYA 4HTFA 1SC4A 3K2QA 4G0WA 2GB4A 1WDMA 2AL7A 2GPJA 4KQEA 5KJEA 4C9BA 2DPGA 4BAUA 1MG5A 1N6IA 1KDOA 1NRJB 1SA0A 3JQEA 4HF7A 4WXHA 2VT7A 3TR6A 4AYWA 3U09A 3IIMA 1L1RA 5IBCA 2C5BA 1Z6QA 3IP8A 4IJWA 3CT6A 2JJ1D 3QKSB 5EUMA 4BQRA 3U44B 2XWBF 5A6SA 4GL2A 4QM6A 3HA2A 1I80A 4BGVA 1J8FA 1GP2A 1GGHA 3CWZA 3QSGA 3RODA 3GCWA 4F1JA 3WRWA 3LPNA 4BLSA 2ERYA 2VT2A 1FFEA 2VJKA 3KUCA 2X5XA 3KYIB 1OASA 3KDPA 4FOSA 5LA6F 5U4XA 4GOXA 4ZI7A 2K2WA 1VSVA 1ITZA 2W6QA 3EAQA 3S6JA 1N6OA 4MQLA 4CQMB 1XRNA 4PTYA 1IOVA 3GIWA 3HMKA 4B9AA 1DQSA 4KYIB 1BN6A 1H6CA 1LW6E 2ETVA 3DV0B 3ICPA 2B4RO 1T4DA 3H11A 2X7JA 2WF8A 2WYOA 3H17A 2GPNA 3HFJA 4C6TA 1E92A 3OURA 3V5NA 5AJUA 3AESB 3T99A 4E1AA 4G5GA 4TXMA 1PS8A 1NGSA 3ECSA 3WKAA 4UHJA 1O96B 4JJGA 4UTVA 4CTNA 4FYJA 2ZUWA 2GNOA 2NVOA 4M6WA 4LF5B 4XIIA 4WDQA 3KL2A 3PDJA 3WXMA 2W6MA 3L8EA 2R6JA 1OH8A 1EE2A 2PMDA 3DCYA 3G13A 2JLRA 4C7MA 3O2JA 1A5ZA 3NNNA 1L3BA 1GA1A 1OLUB 2P2GA 1FRFS 4KDEA 3G8BA 4KQFA 2O8VA 3LECA 3LM8A 2ZBFA 4LJ5A 2GO7A 1CEEA 3SR3A 1FBTA 5KYWA 4NEHB 4G25A 4MZXA 3JALA 2CK3D 5DEOA 1TUIA 2BFBB 2XWQA 3I8SA 3OQ1A 1KI7A 1JI3A 3OZSA 4C4SA 1PEAA 2XW6A 4E94A 3TOCA 3G8YA 3HCNA 3K0EA 4NOJA 1OGJA 1R7RA 4AMZA 2RGYA 4E2WA 1NAIA 2FPSA 2WJJA 1FW6A 4ARZB 1VG8A 2VK8A 3D6JA 3H1BA 4OIMA 3M3DA 4Q9HA 1KVUA 1PJQA 3I04A 3B7GA 4ON9A 3DBVO 1NV8A 2XRMA 1DRVA 1ETUA 1KTVA 4WBXC 3SICE 1U7HA 4G89A 2WSLA 4U9HS 3EZGA 2R6DA 2PX8A 4YI5A 3NRCA 1WHSB 1BHO1 3IYLW 4JYZA 1NLZA 3TLJA 5BW6B 2ZJ6A 1HE5A 4LDRA 3ASUA 1NBOA 3E5HA 4QHTA 1RHKA 5FA6A 1BDIA 3NYRA 1E99A 5F3RA 2ZRBA 2WD9A 4BVJA 3BHIA 2EGUA 1I4WA 4HPJB 3I62A 1EFTA 1KJNA 3B20A 3CW9A 3PWTA 4YR7A 1NPYA 1L3CA 1PD1A 1A4UA 3LUKA 3QU4A 5ALTA 3O1HB 4RJJA 1TLTA 2X1MA 2VATA 2VDMB 5LWQA 1KO5A 1UM8A 1TLFA 1K63A 3W3AA 3C39A 2PWBA 1G8MA 1XIVA 1V43A 4FYHA 1LDGA 3WDSA 1IRIA 2G06A 3GGOA 2DKFA 1V41E 1WBJB 2FSUA 3HCRA 3UEOA 1ZD3A 3IC5A 3MTDA 2FDXA 3HHEA 4YAGA 3PR1A 1GKUB 4RXTA 2DTDA 5UKDA 3T7RA 1I13A 2WEKA 2C2KA 2X6TA 4QU5A 4HRAA 5JJLA 2X9GA 2XOXA 2PGOA 4OQ4A 3RSSA 1GYQA 3M70A 2C8VA 1E3WB 4HNQA 3OM0A 3LX5A 1CDDA 4RJTA 2Y1CA 2VRCD 2WVGA 3ONDA 1U5AA 2WAXA 1XZAA 3PRJA 1ZIYA 3VUFA 1WPGA 3LBNA 4P22A 4F56A 1JA1A 2NSHA 2OVFA 1A04A 2B7LA 3OP4A 3OECA 3QBEA 4FTWA 4MV1A 2O1WA 4CLRA 3ZDZB 1I8TA 1Q92A 1Q0TA 4P4LA 3M6LA 1F5SA 4JLVA 3AOEA 2RGEA 5DE3A 5E8RA 2IYEA 5ALMA 4Q39A 1QRAA 2QAIA 3RVLA 2PUFA 1E2NA 3ETHA 2NZXA 1EP3B 3H6GA 1VCMA 2LWIA 4CHTA 1FP4B 2R68A 2P3LA 4C3UA 1QYDA 3PGVA 2XNHA 4J1QA 1THGA 4WT7A 1CJCA 1RW4A 2ETXA 1QXSA 3I9JA 2ZRIA 1MX3A 3E15A 4LTDA 2C4KA 4WV3A 2NVWA 3ZE2B 1G2PA 4CQLB 3R3WA 1S02A 5IUJC 3T3DA 1Z0SA 4LFAB 2I2WA 3RARA 1MXFA 2V1XA 4MINA 2FMFA 4LXYA 3IULA 2VPWA 5D6NA 5HE8A 2B5WA 3WDKA 1FC0A 2G67A 2V4MA 3I2YX 1MJFA 3LC1O 3NRBA 3QI7A 1N33B 4Q4JA 2B98A 4HNHA 1XCJA 1P2FA 4O25A 3AU8A 3G2MA 2Q5HA 2AFVA 3MF4A 4ARSA 3OT4A 2OZLB 4TRMA 1HEIA 1JIUA 3IAS1 5DNVA 3AEQB 4DILA 1BFKA 3OOSA 1QF7A 5GMOA 3W9UA 4EJSB 3A6EA 1ZJ5A 1JHZA 2IU4A 1DRWA 2YY6A 1NDUA 3BE8A 4NZOA 4EHKA 2WWYA 1ZGGA 4TRNA 3RS0A 3TYXA 4KN6A 4BGDA 3ZDFA 2FFHA 4M1SA 4BNIA 3EBOA 3G8DA 1FF9A 3O1JC 4JI6B 4G1VA 2Z6AA 1BOOA 2YYAA 2AFIE 5K0JA 1W36B 5J47A 4PHFA 4DV6B 3RBZA 3OZFA 1L1QA 5I9TA 2L0XA 5LU9A 3IPRA 4CIAA 3Q12A 1N9GB 1Z35A 5EPOA 4MLZA 2RHTA 2EP5A 4BLOA 3T1OA 2BTQA 3RWBA 1UOEA 2Q1YA 3P0IA 5JMOA 4J16A 2R3SA 2HDWA 1V5IA 4PLGA 2QG6A 3BJIC 4S35A 4G24A 1UBJS 3TE7A 3LV8A 4JBIA 1B0AA 1V3VA 5CVJA 3C6BA 2I55A 3L7DA 3PLRA 1H2AS 4IGIA 2XKKA 3VDRA 4UAVA 1CTQA 5I7OA 3ZU3A 2J9FA 3KEFA 2V58A 3S28A 5EWMA 4B6SA 1GUBA