2QI9F

Abc-transporter btucd in complex with its periplasmic binding protein btuf
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
245
structure length
245
Chain Sequence
b'AAPRVITLSPANTELAFAAGITPVGVSSYSDYPPQAQKIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKVMWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFGINPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITGGPDQIPKIKQYWGEQLKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vitamin B12 import system permease protein btuC
molecule tags Membrane protein
source organism Escherichia coli
publication title Asymmetry in the structure of the ABC transporter-binding protein complex BtuCD-BtuF.
pubmed doi rcsb
total genus 66
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2007-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2qi9F01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2qi9F02
3PSAA 4UTPA 4NNPA 5JOQA 3TEFA 1TOAA 5B58T 3AEQB 5GGYA 5KHLB 4WZBA 2ETVA 1G20A 1G20B 3BE5A 3R5TA 5BVHA 2WHYA 3ZTTA 4TKVA 1QGUB 1K0FA 2AFIB 3EIXA 3AEUA 3AESA 4XPIA 1MIOA 1QH8B 4H0FA 4TKUA 1FP4B 1EFDN 4LS3A 2Q8QA 5BVGA 3AEQA 3U7QA 2YNMD 3AEKB 1KAHA 2OV1A 3UJPA 2WI8A 3NU1A 4INPA 4FI3F 1G21B 2XUZA 1M1NA 4WN9A 1L5HA 4UTOA 1KAEA 2R79A 5CX1A 1PQ4A 3MINB 1KARA 3PSHA 3ZK7A 4B8YA 5M34A 2XH8A 2OGWA 4PAGA 1H1LA 1PSZA 2AFHA 5BVGB 3MWGA 3TLKA 5JG7A 2PS3A 1M1YA 3K1AB 4CL2A 2PHZA 5M29A 2PRSA 2X4LA 1M1NB 2AFIA 4MLZA 3MD9A 4ND8B 4DBLE 4K3VA 3AEKA 3ZK8A 2RG7A 1QH1B 1N2CB 1XVLA 4WESB 4HMPA 3AESB 4XPIB 2XDQA 1L5HB 4HMOA 4HMQA 3PDIA 5AFSA 4TKVB 1K7SN 2XV1A 1ESZA 4WNAA 2M6KA 3TNYA 2OV3A 1FP4A 2XDQB 4OXQA 5JPDA 5KOHB 3ZK9A 2QI9F 5KOHA 3AEUB 2O1EA 4UDOA 2MINA 3LI2A 4WZBB 3HH8A 5M2QA 2OSVA 3G9QA 4ND8A 4OXRA 1N2ZA 4FILA 4FNAA 4N01A 5M3BA 2YNMC 2PS9A 4H59A 4PM4A 3LHSA 1M34A 1N4DA 4WESA 5BVHB 1M1YB 3K1AA 2M6LA 1QH1A 4BBPA 4OVKA 2AFHB 1H1LB 4WNAB 3MFQA 5KOJB 3PDIB 1K75A 4MO9A 3MINA 3MWFA 4HN9A 4MDYA 5HX7A 4WZAA 3CX3A 4G07A 2XY4A 3BE6A 4WZAB 1N2CA 4FKMA 3HJTA 4UDNA 1G21A 3AERA 4INOA 5FLYA 5JJ5A 3AETB 5I4KA 3AETA 4GICA 2PS0A 3U7QB 4NNOA 5CR9A 4LJSA 3GI1A 5CX1B 4M7OA 3AERB 5GGXA 3HXPA 1M34B 1K2VN 2XQVA 4WN9B 5KOJA 5HDQA 1QGUA 3EIWA 1N4AA 3R5SA 4IRMA 4TKUB 2MINB 2Q8PA 4MX8A 1MIOB 1QH8A 2R7AA 4G09A 3ZKAA
chains in the Genus database with same CATH superfamily
5ERYA 1POXA 3S6JA 1EB8A 1T8WA 1C3XA 4M22A 2ERCA 1RBMA 2FFHA 2YFYA 4B7XA 2YDXA 4ARAA 5BR1A 1NYLA 2IHVA 3Q10A 1J0XO 4E94A 1R27A 3G79A 2Y0BA 3NC1C 5BMVB 4R84A 1E6LA 3KJHA 1G6KA 5FIUA 2WWFA 5A4MS 3LBNA 1NYTA 3Q1LA 3DTVD 2VPZA 4BQRA 4KFRA 4G1FA 1NHWA 3KVRA 2ECPA 3FF4A 1TTTA 4QTTB 5KJEA 4YT5A 4D99A 1NXOA 3ESBA 4TQAA 3PQDA 4U3JA 1LF5A 5EHZA 3K4HA 1HQKA 4U7TB 3SQXA 1FPMA 1V9SA 3BL6A 1CK4A 3IHKA 4L0QA 4LHVA 2W9XA 3NAZA 4MTLA 2Z6VA 5FA8A 1Z4OA 3DTVB 4JKIA 1TECE 1ZXLA 1Q0SA 3FPHA 1SA0B 1BXZA 1VJRA 1OZAA 1P1RA 2APJA 1D04A 2P5SA 1JG7A 1C8VB 2FF5A 2PS3A 2UVPA 2WOOA 1F17A 3TFOA 2V1XA 2YV4A 3BRSA 3JD1A 5L51A 1FSSA 1ZOSA 3AIIA 4MWEA 2PR7A 4N40A 5KYWB 4EATA 1VOTA 1NV8A 2ID7A 3F1KA 4GMGA 1KY4A 1P18A 2RG7A 4TZKA 3U3ZA 3FB4A 1W0KA 1TTQB 4DR2B 5F5LA 1Z56C 3RIHA 1U8FO 3RASA 1ZZEA 4C08A 4EFMA 4DF3A 3HB4X 1RHUA 3GCWA 3TLMA 2WHPA 4OHRA 1U7XA 1RLUA 2DAPA 2EAUA 3MGCA 4YJFB 1SPBS 2FWAA 3CS3A 1UKEA 2HU7A 4DUZB 1K63A 1IB0A 4PZ9A 3LECA 1L4EA 4S1OA 3Q8WA 4ZTBA 2PUHA 1P33A 1Z0IA 1DQNA 3BMCA 4FYMA 3ZOKA 1CRLA 4HF7A 1CKEA 2JA2A 3EGOA 1GD1O 3HYTA 1U2EA 2BDTA 4W99A 5D1HA 3GB9A 1LI4A 3G82C 5C53B 2JASA 1ENZA 1DAEA 2A58A 3AGPA 4JT2A 4NARA 1C0EA 1QRUA 1VSVA 4G01B 2BI8A 4HQNA 2YMMA 3NDBB 4XCVA 4EWLA 3P19A 3B89A 4R0MA 4QPNA 1P5FA 1IN8A 1VKNA 4KMMA 2EJBA 4PAOA 4PV7A 2OHOA 3RM3A 3THRA 1J8MF 1X8JA 3GG2A 5TPWB 4IYRA 1QE5A 3RODA 1RXWA 2N42A 3A1DA 3NFRA 4NNOA 1KI1A 4P4TA 3RNLA 2GBFA 3X1YA 1XU9A 1GFIA 4F9EA 3IIEA 1SMKA 1XN1A 4G0ZA 5FAXA 5FWXA 1ESEA 1I2AA 2B36A 1QRAA 2I6TA 5DBFA 5CBPB 2ODBA 3BT7A 4ZO7A 3GA0A 2FW9A 3KWJA 4WK0B 1VXOA 4AG6A 2X6RA 1HXHA 1G66A 3A2MA 1UC8A 3BSSA 1J56A 1LV8A 2QTTA 3A7DA 3FHOA 1RQ2A 3L07A 4NYMQ 2I8LA 4WWHA 3RC7A 5J2TB 4Z9YA 1O77A 5CAEB 1V16A 1KETA 1MIOB 1QLJA 2PZBA 3HYSA 4PPFA 1NPTO 2IT1A 3LWNA 2ICAA 3ETDA 3EZFA 2MYTA 5TGDA 5TRTA 4BRZA 2CUZA 5IABA 1ZHOA 1ATZA 4RANA 4FMCB 1OLXA 2IWHA 3H7IA 3VOTA 1TQ6A 2XWSA 4MQ4A 2CHQA 3UF0A 3BWMA 2A0FA 3AU9A 4I99A 4ZI7B 2RHGB 4N7RA 2PX0A 3B1FA 4H1TA 1FDSA 1QS0B 3RU7A 2PM8A 4GKBA 3ZXXA 1SK9A 5EVJA 4ESHA 3CVUA 4O59O 5IAOA 3GGJA 2O2XA 2WU8A 4NU6A 1RXYA 1UINA 2ZB4A 3U37A 4FBGA 4RH0A 3VU1A 2EX0A 2WKSA 4L5BA 4EW6A 2C04A 5A5VA 4ZJUA 2ZS8A 1JG1A 1K3FA 2F59A 2FN9A 2J30A 1RQLA 3AX6A 3OJOA 3WSTA 3FFBA 4D9HA 4A15A 7ABPA 3EG5A 4IGIA 3GCZA 1X39A 1RQXA 3N75A 4LGVA 5ALOA 4DL9A 2JHAA 3D0KA 2A4KA 3HO8A 4IQ8A 3KXKA 1NW8A 5LBTA 3ZHQA 3V4RA 2BC9A 1MW8X 1TFRA 5J58A 3RYIB 3H3JA 1HQYE 5AMXA 1U5BA 3OC0A 2CXTA 5CUQA 2Z5LA 1LPSA 5AM0A 1YIAA 1OTHA 2AOTB 3FDZA 3RV3A 4NU5A 1UBJS 5D85A 2QVXX 3AF5A 3WA6A 2DHEA 2H2DA 1I7NA 2VDOB 2VDRB 4H3KB 3VU9A 1ZIOA 2H9YA 3AVVA 3IAM6 2CNDA 4BECA 5F12A 3VU0A 2FE1A 4J75A 4PQFA 4KE9A 4OBEA 3WQHA 4NH0A 1VBMA 3FHLA 3N7UA 4CODB 4HNQA 3HCCA 1ZHFA 2L0XA 4MI9A 3JU3A 1HNNA 2XTJA 2B4QA 1HDXA 3F46A 3NWPA 1K86A 1EKXA 3E4CA 4NH4A 5DWDA 3TCKA 1NDUA 4JVSB 3NYRA 3CR8A 3U7EB 3ZX4A 4F45A 1WCIA 1VG0B 2EG9A 4M0UA 1DKQA 1F8FA 5DZSA 4DLTA 2HSEA 4MWSA 3WGVA 1PRYA 3DC7A 4E03A 4F8JA 1Z26A 1G1MA 2VYND 4UHCA 1AC5A 1WSWA 3U0VA 2VJBA 2PIAA 5CEEA 2RGDA 3CW9A 5IAGA 2PCJA 3UT5A 1AKRA 1E2HA 4V0MA 5EWMA 4B7ZA 2OAQ1 2OHIA 2PFGA 4B7CA 4X6LA 4QSHA 2QVCA 3B1VA 5EKTA 2C1EA 1TZBA 3RE1A 4B3SB 2QVYX 1FZTA 4RCYA 2PUEA 1BRTA 3B78A 4ANFA 4Z86A 1A2QA 5DCYA 3RRYA 3Q5GA 3BQ9A 4WOBA 2ZSJA 4JROA 3ZHUA 5J4LA 1C3OB 2H0RA 2ZXEA 1UM8A 4MQBA 5DYTA 5LMUB 5LB2A 3RBVA 3JSXA 4PPGA 4F86A 4OUDB 2WQ6A 2I67A 4K28A 1PWXA 1JJAA 5J1TB 1Q0LA 3HWRA 4EKEA 3UFBA 4XH9B 2ZB3A 3ZZ1A 5KREA 1TA9A 4EKNB 4YUWA 2XVZA 4CVNA 3QVOA 2WQ7A 1VIYA 3OX4A 3UOAB 4BXOA 2QRGA 3DF7A 2VNKA 1I4LD 1RDFA 3MJVA 4JBXA 4KH1A 4MPPA 1CUGA 1JEQB 2AA3A 4FW9A 3CURA 3HKBA 3K5IA 2PH3A 3VXKA 5HOEA 3OE7D 3R5HA 3ZLBA 4NBKA 1CUHA 3ZR4B 2P3SA 1KVRA 1W2HA 5EP1A 5H8WA 4RO0A 1RI3A 2AXQA 4BEWA 2XQFA 4C0KA 1BQ4A 2Q49A 1CSEE 2GKSA 2EJUA 1LPMA 4HWSA 1XEWX 3H16A 4IWNA 2HLNA 1ICIA 2QMQA 3WMXA 5KWJA 2PYIA 4R9NA 3B3GA 1Z34A 4L8FA 4UEWA 4UMDA 1E2JA 2IOFA 4YLYA 3LPMA 2ZVJA 3ELYA 1T9AA 3GX1A 3UQYS 4RVCA 2G9UA 2WJ3A 3QXXA 3R3VA 5KINB 2HPHA 2AEMA 4CM8A 4BNTA 2YJTD 2RBKA 4GR5A 2HXSA 5G4KA 3D6MA 1PZMA 4W5NA 1G2IA 4BKQA 1KZ6A 1XQVA 2ZVQX 5AIAA 1LBSA 1VDMA 2YYSA 1IEWA 1PQYA 4XWKA 4L4SA 1QYWA 2J3MA 1Q7RA 2W4IA 3OZVA 1G8GA 3PUXA 2IK8A 2VJDA 3WL4A 5IFLA 5BPFA 3MMSA 3F5MA 3QVSA 3HXQA 1D2EA 2ZJBA 1R0RE 3IEIA 3Q85A 1U90A 2AUNA 1V35A 2FF7A 4UHEA 1BSVA 2HJ9A 4P58A 1BGXT 4LDQA 3GU3A 1Z7GA 4CUJA 3GCDA 2EYQA 5DI9A 4GOOD 2W43A 3QE2A 4FDVA 1CC1S 4R2JA 4XUEA 3CNHA 1JX6A 2GBLA 4FIZA 4XTCS 4BFUA 2QYHA 2M9MA 1XRPA 3S2UA 3T1TA 3E6AA 3FF1A 3SF8A 3T9EA 4KQMA 3ANSA 2JGJA 3CLUC 4YI5A 3OJWA 4MQMA 3RWMB 3A1VA 1EJBA 5MGBA 4ZVKA 5HE9A 4BU0A 3GJ8A 5ALKA 2OV3A 2AUTA 3KXLA 1F06A 1DKNA 2C7VA 2ZE5A 4J4TA 1PNTA 1P9WA 1CQIA 2FFJA 4LDJA 5L4SA 1K6MA 1MUUA 1VI2A 3TO5A 3AHHA 3PC2A 1DEXA 4BX3A 3ZHYA 1T2VA 4ZKDA 5HKKD 3L8GA 1N2ZA 1ZW1A 4Y2JA 4QHTA 4WESA 1WUKS 1M1YB 3KG2A 2WFZA 3M5DA 4WK4B 3ZCPA 3JYNA 5JJKA 3DD1A 3FAKA 1ZXXA 4GLJA 3VPCA 4R7TA 1ODSA 1B8NA 4ZCTA 2IY8A 3LHFA 4DVJA 5K0CA 3A70A 1P91A 1H5QA 4JQCA 1EUZA 821PA 3FJOA 1VE3A 2RHMA 4YJ3A 3HS3A 4QUIA 4UM9B 1M5RA 1GDTA 1XZBA 1XZFA 2ETXA 3U4DA 3DP7A 1E79D 3EHDA 4FX2A 4MINA 2DHCA 4E08A 2ZE7A 2NVUA 2ODWA 4D80A 3I5AA 2PUGA 4HLUA 1TJ3A 5DDIP 1VHTA 5FPYA 5KNBA 2Z4RA 2OT3B 5IJZA 4ZVUA 4W8OA 3Q8LA 4IRMA 3ZWNA 1AUXA 4ZT6A 3VFDA 4AW9A 4DT1A 1YUMA 1XCBA 1OI2A 2WIDA 3LQ4A 5IXJA 4OX9Y 1BHJA 3NVKI 4U2CA 1JWBB 4JJGA 1XBTA 5IW8A 2MSDB 3UM9A 4FKBA 3MS7A 1XD9A 1TO1E 3C3JA 1CRZA 3BHJA 3H19A 4NI5A 1X7DA 3GO4A 4RY8A 3HA2A 5E7MA 4EHAA 5ALZA 1GN8A 4JJ6A 2PUFA 2DKOA 2RH9B 2QZZA 1WHSB 3FFXA 2VHVA 1NXVA 1IUPA 1JHRA 4N0PA 1HT3A 5D5PA 2VZEA 3VX4A 4DAEA 5A4KA 1FDRA 2YV1A 2REQA 2VTEA 4PXYA 1WXXA 2D59A 1ADBA 3PCXA 1T1EA 4MRNA 4D9MA 5I3CA 3PRJA 3ZQJA 3OU2A 4HO1X 3P9PA 4KIUA 2PLRA 2QSJA 3AT1A 2CXUA 4XJSA 1O6CA 1CR1A 1WUYA 4YP1A 1UC5B 3DL7A 4HPWA 5ETJA 4Q4AB 4GQIA 5IKMA 4M7RA 1YQQA 2QDKA 2XMQA 3PT9A 1JHVA 3PYXA 1UKYA 4IS2A 4HGPA 4LSGA 2GZ2A 4XIIA 4Y6QA 1YQXA 2X0FA 2VDWB 4OXNA 2O2EA 5IDQA 4OH7A 1XRLA 3M6MD 4Y18A 2ATXA 2CLSA 2XD9A 4NS4A 1T36A 3GJ3A 2QA5A 1NNEA 1GTVA 3K1ZA 3KCNA 2WAYA 3R9KA 3EAFA 3RVJA 5LZ2A 1QWSA 4JBIA 1YZYA 1YZTA 1MX5A 4YAIA 3T1YB 2JI8A 3CR7A 2WLSA 3LO5A 4J1TC 3FRJA 1TUGA 3EQ8A 2BZ1A 1MC8A 1MNQA 3HFRA 1CLEA 4MCAA 1T13A 1Z2EA 4P6VF 4WPGA 5AQ1A 1OSNA 2PT9A 1LK0A 5A6VA 1UT6A 1BD4A 2VP6A 4NOMA 1SPXA 3DH0A 3WICA 1XZEA 1Y5RA 1X80A 2XCQA 1P8JA 1WEKA 1YB6A 1R6UA 2IRWA 3QPBA 1G7CA 4K9QA 2O20A 1SKYB 3MJTA 5GVRA 1WB4A 3TJZA 1RYEA 1H2RS 1DCKA 1YRWA 4JELA 1E99A 1SU7A 3DLHA 3R77A 4JKYA 2HI0A 3H13A 4GMXA 4IYJA 4A4DA 2W71A 3VHLB 5JVDB 1Z63A 1MAVA 1Y48E 1NY5A 2EZ9A 5C7OO 4ZDIA 1JB9A 1UL1X 4TMYA 1QAOA 3ENVA 2YYYA 3IRUA 2WWIA 3K8YA 1W36B 1GTG1 1XNHA 4OJKA 2GNAA 4LPSA 4FZRA 2FQ1A 4CTKA 5LZ9A 5KI6A 4PAWA 2OB1A 5MFPA 1IXZA 1CFZA 1F12A 3PENA 1G0OA 1XRQA 2XECA 3HJUA 3NTQA 2KJQA 5EHIA 3ZW8A 2PJRA 2VYVA 3CEMA 5F98A 2V7XA 4E33A 4KXFB 2C96A 2VZ9A 1GCUA 1DX6A 3EFBA 5BN4B 1I5RA 1QLHA 4L4RA 3FUWA 1OI7A 4YRJA 3THWB 3F74A 1CE8B 3OAAA 1S2MA 3QXHA 3RYIA 3ZN2A 3MBIA 3T9DA 1ZG3A 2MYUA 2VPTA 3QVGB 3G85A 2YW2A 2Q1XA 1E3IA 4IGAA 3ZCUA 4PO8A 2P9QA 5JV5A 5LC1A 3VOBA 2JLWA 1VCIA 2BFEB 4LFBB 1JLLA 4HN4B 2QUIA 4D3ZA 2Z1MA 3GMIA 3ZQKA 1Y42X 2XHEA 5D6NA 1QP7A 3HJHA 1DXOA 4BKMA 2UUAB 2QR2A 2JIZA 2BFOA 4XDZA 3OZEA 3QVKA 4DMHA 4E2FA 4N47A 2HWWA 1KR2A 1RAIA 2VDKB 1MDFA 4Q12A 4Q3KA 4WSOA 2OYRA 3D8NA 2GR9A 2XCIA 3GVCA 3SX2A 1YJ5A 1ZN8A 3KKKA 3N2YA 4AJIA 4M1MA 4MUMA 3JQ7A 3E8SA 2XUDA 2I7CA 4E5YA 4LNUA 1OHHA 3OQBA 5DNUA 4D6YA 4CMIA 4EPXA 5CRIA 1WCYA 1YC2A 5ICMA 1KNQA 4KHPB 1BEUB 1V0JA 3PXAA 3IHTA 5HEKA 2FUNB 3VYSB 3WXMA 4ER7A 1CJCA 2FFAA 1UBLS 2YJNA 4Q16A 1EE1A 1KDRA 4GGOA 3TJMA 5EJ6A 5JRJA 1F2DA 3GLSA 3JWGA 3USCS 1PFVA 4X71A 3P97A 3FOEC 1X8XA 4CR8A 1TX4B 2DFNA 3O82A 5JZOA 4Q4JA 5K0ZA 5LFAA 4S2EA 1E9BA 3D4OA 2X42A 1L7PA 1G291 5JD3A 5CNJA 4QQRA 3OCJA 4TS9A 2Q29A 3NVMB 4I9UA 5ER6A 4MS1A 4F85A 4LEIA 1P29A 5IBRA 2J3HA 3N7TA 3OCYA 3VBCA 5JSQA 1GTL1 1Y5LA 1O4VA 3GLFB 2NTNA 1JJ7A 4JLJA 4YS6A 3NH9A 4MV6A 3KOUA 3FNRA 2FPPB 1KO7A 3WWYA 3PLAE 2PVPA 4JFAA 2O59A 1AZTA 3PKZA 1Z7EA 1ZNZA 4HY3A 4ENSA 3A3PA 1GL9B 1S01A 2VSYA 2O7SA 3BSFA 4MLCA 1ZVKA 3LQFA 1CUUA 3KUCA 3C24A 1A7JA 1OC4A 4L15A 4ABTA 2Y1GA 2W2VA 4J07A 4FFBA 121PA 4L75A 2P79A 1ZJJA 2CNWD 3DE5X 4RKFA 8GPBA 3HFGA 2Q3HA 3BCRA 1SCDA 5LA6A 2XYVA 4KFUA 2YWDA 1Z5VA 1BOFA 1RLJA 4E5NA 3PE4A 3C7KA 1EK2A 2YWXA 2E85A 1W59A 3O4FA 1Q0ZA 6PFKA 3WKBA 1DX4A 1XOIA 2QRQA 2X5KO 2RB5A 3OEEA 2AZ4A 3PHGA 4MRSA 3X43A 3ADDA 3EGDA 5AVQA 5EE9A 1U0TA 4ML3A 4KB5A 4FDAA 4H9GA 1WQ3A 1M6VB 4JBWA 2N46A 4RXTA 2R4QA 1Y8QA 3QBEA 1O94C 4FFVA 3UUGA 4AURA 2IC5A 3UK6A 2O3JA 3SYTA 2GCEA 1UP4A 1LNSA 1FP7A 2A30A 4W5TA 2RGRA 3O3NB 3HH8A 2PQ6A 3K73O 5IKXA 4DDHA 1F5SA 2Z2KA 3KKQA 1NPDA 4JN6B 4QXQA 1DSSG 1U3FA 3HKEA 4LYYA 2A2ZA 5JSHA 1ZOIA 2KLHA 5L9AA 3AL0C 1FUIA 2IYSA 2CXSA 3NHZA 4HCJA 3VR5A 2HKIA 5EIWA 3ZBPA 4X7BA 4RTJA 3HLKA 4ZVNA 2A3NA 3D31A 5ABPA 2O7VA 2R1VA 4BVKA 1H23A 5IXSA 1GJRA 1OAOC 1PR3A 1WZCA 5E3JA 4D46A 5K6RA 4LKRA 3KU1A 3TBFA 2RGXA 5C4IA 4C4SA 4WINA 2QMZA 4KRYA 4HH1A 2OILA 4CKYA 4JSRA 4OUDA 3WWCA 1H2XA 3ZV7A 3ZD6A 5EI5A 2QZ9A 3UK7A 3BKWA 3P96A 1JMKC 2RHCA 3VR1A 5J4HA 3A6LA 4Q47A 2A0KA 1O89A 1KAMA 2QP3A 2XUPA 3EF3A 3MT8A 1W0KD 2ZWAA 1J21A 2VIIA 4GG1A 4I9GA 1A9QA 2REOA 4LJKA 3VA7A 4C29A 1EP2B 4WKGA 3GA7A 4MCHA 1JVSA 2HF8A 1B73A 2CBZA 2IYEA 1I6KA 2IEGA 3ND5A 3PDCA 1UOOA 1D8TA 3LCMA 3JZMA 4GYWA 3W1VA 2JZNA 3T0GA 2AQKA 5F1YA 3B7GA 5EMLA 4PBRA 1H94A 2F43B 2RFLA 2X40A 4OY3A 3V1YA 4QBGB 3S81A 2ZRKA 3B6MA 3IERA 3LVFO 4ZVVA 5KCMA 3PJRA 4JEHA 3TK1A 4MVJH 2XMDA 2CJWA 3IP1A 1E9VA 3FPJA 4BZWA 2PEZA 4HP8A 4GECA 4TWZA 3FVWA 3FZNA 3EQ7A 4FR0A 4Y9RA 4QM6A 4B35A 2P9HA 4UVIA 4X8HA 3UAXA 1OGIA 1Y81A 3K5HA 1W47A 3BL5A 1S3FA 1N1GA 1PJRA 4HEA1 4PIVA 3NXSA 1H93A 5EIOA 5SZJA 4BEVA 2PGXA 2QM3A 2DUJA 1UMCB 4H3VA 4CQLB 1R64A 2WKPA 2SBTA 1JFSA 4WFJA 4JI6B 1JKIA 3BUSA 1OCEA 1ZGCA 3AJDA 2Q6OA 1RYZA 2IXEA 2CVFA 4DSNA 2ZWIA 5CB4B 3ESYA 3ETEA 3GT3A 2X9LA 2YKGA 4YHBA 2C5EA 3PD7A 3SHOA 1ZMBA 3PI7A 2WWTA 3IVGA 2NWQA 5FNZA 1WBJB 1KARA 1KZYC 3A6FA 2BFNA 4NFLA 5HXAA 3PTZA 1WCXA 2WWXA 2YS6A 2V8OA 3QFRA 2Y92A 4P0TA 2UV8A 3I4CA 5C4GB 4D1YA 2GUGA 5JADA 1XL1A 2UUPA 4X92A 1QK4A 4G0VA 3LY9A 3GLQA 4QPPA 4O5OA 3BM5A 1B0ZA 1UUFA 4Y1GA 4DSTA 2QX7A 4QAJA 3U4MA 1RWOA 1ZM3A 3FLAA 1GCIA 3I01M 3I6ZA 3MMXA 1OLSA 4R2IA 1U9IA 1L1EA 1V4BA 5I9TA 1BKDR 2BH2A 2PAFA 4JY7A 2Q4DA 1OT5A 2WV7A 4P8RA 2J46A 4J94A 4JZKA 3RHFA 1E2IA 3WWDA 5LQMA 3CWCA 4PS0A 2VP9A 4LRUA 3MN1A 4J91A 4RK7A 4Q9HA 4JI5B 1NFQA 1ZVMA 3U31A 4NG4A 3R6GA 2D6FA 4DAOA 4ER3A 1FMJA 1T5IA 4HFJA 3ZIUA 4F91B 5AI6A 4EYKA 3NPMA 4DPMA 4YP5A 1D1QA 3LBHA 1M1XB 4XYGA 2WMNB 3KQMA 3L8FA 4CMHA 3IPYA 3EGXB 2G3YA 1ETHA 4YMTA 3I9V1 4FE4A 5HQ3B 2F3PA 1QTRA 1U0FA 1USWA 2J8ZA 3C3YA 1RI5A 3NHSA 4DM7A 4BMVA 1P6UA 1CUWA 1EUDB 2PU5A 4TZ0A 4JXJA 4JUBA 1Y4AE 1ZN2A 3K8ZA 4QULA 5GQSA 4WHMA 1TQ4A 4OXIA 4HT3B 5J2TA 3CVXA 3R75A 1MFZA 1U2GA 4B4WA 1YFJA 3U3JA 2D2FA 4R2KA 1QQTA 4ZQGA 4EF6A 2GN2A 4KPFC 4BLWA 2XY4A 4P9NA 5PNTA 3FYTA 1JKJA 1DAKA 1GLVA 2ESRA 4RY9A 2XBMA 3GLIB 2XUGA 1Z36A 1COWA 2R96A 1CZRA 3OOSA 5EL0A 4XFJA 5C31A 2I78A 2FRDC 4L9AA 1ODCA 2FOXA 4O2AA 3IDZA 4YJHA 3CCFA 1FP1D 2AJBA 2QE7A 3ILVA 5F1KA 5ALVA 4E5KA 2UUBB 1MO3A 3GBPA 1CR0A 1CB7A 2NSYA 1DS6A 1KJ8A 1TYBE 1O8CA 1YULA 3PPWA 4V0ME 3DCYA 4S3MA 4WIAA 1KGDA 5ALHA 3LDGA 5E1MA 3ROEA 3ASVA 4Q48A 4YJ2A 2QD5A 1C9JA 2R7AA 2AJCA 3GHYA 5ELLA 3EEQA 4XYEA 2QD4A 5CA0F 1CQPA 1MB3A 5AXCA 3AI7A 3EVNA 4OSOA 1R4NA 3A4YA 3PWZA 4EYGA 2VT6A 4HFNA 2YWHA 2NU9B 4BGVA 2P4SA 1HDEA 3IQDB 3OSZA 1FTQA 4M86A 1VMIA 5DN9A 3UUWA 2O9JA 4FBLA 3OBBA 3M9WA 3C8ZA 2BKEA 2H1VA 5DM1A 2D8AA 4JR1A 4ALKA 2GM4A 2YCLA 4LCJA 4FLMA 4OB8A 4RGBA 3DV9A 3F3KA 3IPXA 3LDAA 3T7RA 4C21A 4MMYB 5JAMA 1DQPA 5DXFA 4NPCA 1V8PA 4R9UC 1ANKA 4YXWD 1P72A 3ZEAA 1ECBA 4HSGA 5JAZA 1JU3A 1H2WA 2LV8A 4YRLA 1PQUA 5AQEA 3U26A 1W4AA 1NVWQ 2VKTA 4X1IA 1YKFA 5C7LO 3OIWA 4LZJA 2AN4A 5A2QA 1H2AS 5BN4A 2EVWX 5FWYA 3E05A 1KKLA 3GRFA 4A7PA 2XWBF 4O0MA 5LMCA 1YFLA 2VKQA 3MF4A 2RGUA 2BFPA 4V38A 2VUHB 3A1WA 2PJZA 4P1ZA 1U8UA 4FCCA 5T3UA 3B1YA 3F6RA 4FOOA 1JJVA 1MF7A 1NX9A 3IYLW 4GHWA 2DQKA 4L0CA 3ZQUA 3CW2A 1ZHHA 2GHTA 4CGYA 1PVOA 3GRAA 1AUPA 2AI3A 4J9VA 3D3JA 3CF0A 1ULHA 1RNLA 4L3WA 2BFDA 4ZU1X 4CLXA 1MH9A 2WYWA 3I9JA 3SS7X 1XZLA 4QG3A 3D4LA 2X7XA 5K6AA 2YIJA 5I9LA 1S2IA 1ZGZA 2JD0A 1FP4A 4OQYA 4RD6A 1X19A 4V1CI 1E2MA 2DUNA 2MOKA 4ID9A 3QXGA 1GTRA 4GH5A 1LLCA 3F8TA 3GMDA 3ETHA 5BV2P 3PNLA 3SG0A 1KI4A 1BN6A 4JNCA 1THZA 3IS3A 4RTQA 1ONSA 1BE0A 2YHIB 3LYHA 1T3GA 3OURA 3T3OA 1Q16A 5FPSA 4URFA 3G2QA 1I9GA 1WZNA 1M34A 4OEHA 4U2FA 3YASA 1FFSA 4XARA 4ENQA 1XPRA 4WXHA 3I1YA 5YASA 3TX2A 3LW7A 5D3MA 4L1KA 4MYTA 4DC9A 1XD8A 1LNQA 1UT5A 4LF6B 3K6RA 2GKGA 3ME5A 1C0KA 3HNOA 2C57A 3AP2A 3JAKA 4BQOA 1SAYA 4AWAA 1BOOA 1SUPA 1ACJA 1W73A 3O38A 1RIFA 4ATNA 1FIUA 2NO9A 3P20A 1JZQA 4FR5A 3U17A 1R3UA 1M7BA 1BCRB 3PXXA 2B7LA 4G26A 3W3AD 5KWSA 1POWA 1R16A 3PQ8A 1REQB 1GSHA 5BSWA 3PR2B 5JDIA 1OXUA 1T2NA 3CPSA 3O1HB 3PGJA 1VL2A 2CVPA 2WPDA 3NCHA 3OBIA 4DJFC 4K46A 5F7ZA 4N3NA 3EWAA 2NZXA 5FTLA 3MW8A 3ADPA 3TLAA 4WACA 5IF3A 5ULLA 3GA5A 1P2DA 1DIAA 4HQLA 1U0BB 3MQFA 3Q0IA 2PD6A 1U2GC 3OPXA 3ZD9A 2RAVA 2GAAA 4RKWA 2YWJA 5A06A 2VBFA 4YV7A 4URWR 3MG9A 1YI8A 4ZA2A 1W44A 1TFUA 4HBGA 4V24A 1KQFA 4YR9A 1IXSB 1SVNA 1QX4A 4AKIA 1I13A 5CLLA 5DBIA 4OMCA 1EM6A 2XBUA 1YAHA 1N7JA 4QXOA 4TYMA 1N7GA 4Q4JB 4EBBA 3F47A 5I9IA 5EXEA 2PZMA 1SC3A 2WZCA 2GAOA 4C5BA 1A9TA 1Y9AA 4EL0A 2J7PA 5BSTA 2AL7A 1C4XA 2KQUA 1NN1A 2JFVA 4UD6A 5AW4A 4O2BA 5ES3A 2DECA 4ZDWA 3WGQA 4K1XA 2DFPA 3WL7A 2OK7A 4IF4A 3QUAA 2OV2A 1EGMB 1LJ8A 3MGAA 3NAGA 1OU4A 4W6QA 4UCXA 4A5OA 4F5YA 3PR3A 4B6PA 1IN1A 2Q62A 1OAOA 3B36A 1NQOA 3I9MA 4DG8A 2HLHA 4E09A 5MF6A 1IG3A 1QE0A 4XASA 2DBQA 5EN4A 1D2CA 1C7IA 3V1KA 4MDFA 4G1VA 2PR2A 5AM4A 3K1AB 3DCJA 1WMAA 1GKUB 2HRQA 4FX5A 2B7BA 2HHLA 3AW8A 3BD6A 2XADA 4M0DA 3DLAA 3H86A 3K2EA 4R8LA 4N5DA 2RCNA 2ZJ4A 1UDWA 4N8DA 1PNVA 4MI6A 3AR9A 2IEIA 3OZ7A 5JZVA 2F62A 5A4FS 5JMOA 1VIVA 3C6YA 5JH7F 1I7LA 3EGEA 3K8QA 1RTTA 4TKVB 1UJ2A 3RUCA 1FB5A 3GLGA 3BMOB 5BP7A 2GPYA 1BH2A 3LX5A 1H2YA 4GFDA 4HVTA 2VJCA 1NG9A 2DWPA 3PWKA 2V3VA 4HWTA 4PG7A 5AW1A 2D4AA 3PL5A 4IY1A 4JWTA 1FYWA 3A3YA 4KIGA 2GEUA 4L8GA 5ECDA 3T38A 4A6DA 1IHUA 1C81A 4PHCA 1VMDA 3MOSA 2CMKA 1PD0A 1L4FA 2IXBA 3UA3A 4C4XA 2Z43A 3HSKA 4S1NA 1H4QA 4P3NA 3EQZA 5IM5A 1Y1SA 2R751 4HB4A 3WADA 1NUUA 4CDMA 5TMPA 1C7ZA 1KZ4A 1MOQA 4NLLA 2VHTA 1TM3E 2Z2ZA 3OFNA 3R8CA 3VJLA 2Z1DA 6GPBA 1D07A 1UBKS 2ZM5A 3Q9UA 1L4YA 3FJ1A 3VI4B 1WZ2A 1R4AA 2NOAA 3GMTA 2HQBA 1KHTA 3WG9A 4BNXA 4PYRA 4ZJYA 1OR8A 1HO3A 5KKNB 4MW6A 4DJDC 2O8EA 1RAAA 3ROGA 1UJ6A 3QU4A 2YW9A 1FYXA 2WZDA 4MEAA 1AV6A 2OQIA 3LFHA 4ZAZA 3TLEA 5HIKA 1VTKA 3OUUA 5KNDA 2X1VA 5HA5A 4E0BA 2DQZA 1G60A 1S3GA 2XWJI 3DBHB 3A6KA 1K4KA 1BZYA 1M10A 2QGNA 4RVSA 3AFIA 1YNOA 1P4SA 3F78A 2Z98A 4LJAA 1ND5A 2E4XA 4NE7A 3ONNA 3EIUA 5E2AA 3WL5A 1J20A 3CYFA 2YHIA 3JS5A 4FJ1A 3RKRA 3W77A 3WNDA 4IJWA 4NMHA 1BYIA 3WP1B 2J07A 1HL3A 1V37A 5H4HA 3H99A 4TRMA 1I4WA 4XD7D 1X13A 2EWWA 4WJKB 1ODLA 1ZQ1A 4W9RA 5JFGA 1NVDA 3GWZA 3OEWA 1JGTA 3BIXA 1KDPA 4PCLA 5FTJA 4YT2A 3IKVA 4ICIA 1G38A 1Y82A 5I5GA 4X3OA 1JZSA 1DC6A 1WF6A 4XXHA 4ZIRA 3K70C 2B8TA 5JJCA 4NFHA 1GTMA 3R40A 1N6PA 2OCAA 3BMNB 3PRHA 4EGJA 2HO4A 4Q3OA 4GZLA 4A1OA 2RH5A 3HZOA 1IE3A 2PWPA 3JVDA 4D8YA 3KUDA 1TGYA 1V26A 2OXTA 4OJNA 3NOXA 4FCTA 2NYRA 2PJUA 4IHJF 2HJGA 1SU4A 4K6OA 2XKBA 3VR0A 1PFGA 3MINB 3DEKA 1AG9A 2WZBA 3TQTA 2GM3A 3VKHA 3IBFA 2FZ5A 4GPEA 5ADWA 2DQSA 2OVFA 4LYAA 4EG3A 2D1YA 4OHKA 4RHCA 3WWEA 4QQFA 2ATVA 4BUZA 5K51A 4E21A 2Q07A 3AFMA 2DTXA 3H04A 1IVYA 1SD1A 3PG5A 1JDTA 3FPCA 1OW3B 1NG1A 5EPEA 1B0PA 5CFQA 5L6MB 1J39A 1JN0A 1Q91A 2X4DA 3ZDRA 4AECA 5AHKA 3JQQA 2ORYA 1R5BA 5JNWA 1IN5A 3GARA 5HIIA 4I4TB 1B1CA 1JU9A 1Y7TA 3DKIA 1Z0AA 1AB5A 2VJYA 4P08A 3R3XA 4RYLA 4ZYTA 4Q3DA 3F4BA 2GT1A 3MT0A 4LJLA 1M0TA 1ABFA 1PEDA 4RSHA 4ER5A 1VPWA 5H68A 2XGGA 5CYOA 4E3ZA 3QLVA 4HYYA 4YRBA 1O8BA 4UTRA 3IULA 2B69A 1JIKA 2TSYB 4LTMA 4JI2B 3BMXA 4KJZA 1SZJG 1TJPB 3HA5A 5JAPA 1AF4A 2PL5A 2SKDA 2P2YA 3U4HA 1DRJA 1JIXA 5P21A 1PLLA 2HJVA 3UHPA 1KBZA 1UWVA 3ZJYA 2D1RA 2F8SA 4L07A 2CXQA 3KOYA 2NVUB 4DREA 5KCZA 2XXAA 1ISHA 3LX6A 5JLAA 2Q4TA 3LXRA 4FD2A 1XF9A 2HXGA 4FFPA 2O2ZA 4GMHA 4DMGA 2WD8A 3AWDA 3DB2A 2X3UA 3EIQA 5FP0A 3AJRA 4QJIA 1JE1A 5CVEA 1RRCA 3MFQA 2H92A 3FKJA 4HAWA 2HLPA 4UBJA 1Z75A 2BSQA 2YYAA 3IP5A 3PHHA 2L2QA 1KZ9A 4JU8A 2MSKA 4L7VA 3RSZA 3V8PA 1DUIA 2CJFA 3AERA 3FTDA 4DHEA 4IO0A 2R87A 5AIBA 1XQWA 3BL8A 1TAGA 1PJZA 1S3SA 3EFOA 3V33A 3P9YA 3ZHTA 5CX1B 3UMCA 4BWGA 1KAGA 1WEHA 3ML1A 4A0FA 1OZ0A 1M33A 3DW1X 5CBPA 4B6JA 5J63A 1HV8A 1RAHA 3KKNA 1KP3A 2AYXA 4R1OA 4KW7A 1JFVA 1PG0A 1ULSA 4WXPA 3RAGA 1KEPA 1LPBB 2Q27A 3ZHCA 1A9OA 5NLLA 5FF9A 2QSUA 2P6UA 5H16A 1GZDA 3IUSA 4GWKA 4X1KA 1PJSA 2I62A 4YIKA 2XRZA 3W5JA 3ZXSA 4OPMA 3AR3A 4G0XA 1FX0B 4UHBA 1QB8A 2QQFA 3KV3O 5D86A 5JSKA 3GRVA 3X44A 1AA6A 5EMNA 2XCSB 1E9AA 5HRAA 1Z29A 4P83A 1K9SA 4RM3A 5FQOA 4HLUC 3I53A 3BXFA 3ICPA 1B76A 2PYDA 2C4TA 4ZVSA 2PO7A 3T1QA 3ZI0A 4F8YA 1HE8B 3A6DA 2BI7A 4ZYLA 1DMSA 1XZCA 3A9UA 3MELA 4DMFA 4IIJF 2VRWA 4H2DA 3IQFA 5G1OA 1GUDA 2QRHA 4XUGB 1OVMA 2P4EA 2Q5FA 1QQ5A 4Y0AA 5EERA 1EINA 4JMLA 1OFVA 2QT1A 3LKBA 5BOVA 2PMFA 2TMYA 1KXZA 1IDN1 1BN7A 3ER9A 3EXIB 1YMQA 1KS9A 5EEGA 3SEQA 1UBTS 1X7XB 1L4NA 1DC3A 2EL7A 2OZVA 3FCSB 3OJCA 4WX2B 1TM1E 2X8BA 1GNVA 1SQFA 3UV3A 2VQ3A 5KKAA 1PQ4A 4IIVA 1WVMA 2UZAA 1U3WA 3S99A 2C7OA 4X9XA 1SVKA 3DGFC 4RX1A 2FW0A 2DHRA 5GP1A 3RS9A 3EPLA 3MLEA 1RFLA 4FYKA 1N6NA 3VX3A 1K27A 1JIQA 4TSRA 3GFPA 2OGZA 3HDJA 4DMRA 1JPNA 4B4DA 3ZNQA 2FEMA 5HK8A 1QB7A 3C1AA 4K3VA 5DHTA 4TXJA 1Q7TA 3VPFA 4PEVA 5CB4A 3KQLA 4KXLA 2Y0PA 5K8CA 4RXUA 4QTXA 1RACA 3D5EA 3ENZA 3LMKA 3FKQA 4PY2A 3DFMA 1EM8B 4Q6BA 4W7SA 5IBQA 2Q3CA 1GFZA 5BT8A 1QIDA 1O97D 1EGHA 1PG5A 3K09A 3T5GA 1FUKA 3JQRA 3EF0A 1ISRA 4I46A 2BHSA 3RAJA 1CDEA 5JPDA 2QT0A 3AEUB 3UXMA 3ZWOA 1EXMA 8ADHA 3NANA 4D42A 1O5IA 1NNLA 3LCCA 4KTTE 1B8VA 2A33A 3LYAA 1NF8A 1NFRA 1NP3A 4G5GA 4HDSB 1DAOA 4IDDA 4POAA 3WQBA 4BVEA 3F7NA 2M1XA 4MV7A 3LKDA 4MQLA 3ZHZA 3ASUA 4UMFA 1IWBB 3WWZA 4M1QA 3V4SA 2C31A 2IOHA 1DZ3A 4LXHA 3RYFB 5I48A 5IUNC 5IU6A 3EQ2A 1B41A 5F4BA 10MHA 4ND6A 2QMHA 1QFMA 2PMDA 2CF5A 3R09A 4U8GA 3HU2A 3OM8A 3T7KA 3C3DA 3HDHA 4KX5A 4BGIA 421PA 2PUVA 3V4VB 4HHEA 1NI4B 4DGQA 2MSEB 3WSVA 4QODA 4B74A 2MIIA 2UUOA 4C89A 2JF0A 5AK5A 4XQ9A 4AYWA 2FEWB 1KC3A 4HYTA 3TIGA 1D7AA 5F3DA 4X1IB 3ZU3A 1ZGBA 2H16A 3PD0A 2JLQA 1X8LA 2ZAIA 2GM5A 1Q5PA 1TLLA 1YBMA 1U2PA 2ZWOA 4IIYA 1P1BA 3S1LA 4X60A 1P77A 1JRLA 2H8KA 3X2EA 2PGIA 5DT2A 2GZSA 4BLTA 1O4WA 3GUZA 4Q7QA 3N0XA 2YV3A 4C7OA 3ZGVA 2OXIA 3DHVA 4DG9A 3VDNB 3F5QA 3J81k 2R8XA 4LCBA 3ITNA 4F8EA 4M0LA 3RD5A 5KUTA 2ON6A 2ZAMA 1NQ5A 3I1FA 3WGKA 2HDNB 5I7OA 1Z3CA 1HFEL 4XD2A 4NBRA 2VAPA 5J5AA 4MW5A 4P7BA 4XGKA 2AW5A 3SY8A 3E7PA 4DGSA 1FS4A 4R9RA 3H3XA 3NEPX 4WRRA 4Y2QA 1K0FA 1K8YB 1QK3A 4HNAA 1Y9JA 4Q9JA 5B2FA 2WVHA 4A2WA 3N0VA 3DZCA 2EDCA 1HQDA 3E7DA 4KJXA 5E3HA 3UMJA 2EV9A 3LC7O 4CW7A 3IP9A 1E2PA 1ZICA 4EJSB 2I2AA 1E4VA 3NDPA 4JBLA 4MV8A 4N18A 4W1SA 3CG4A 4PG6A 2PMKA 1D7OA 3MUEA 4OTZA 4L9RA 2OZEA 3AR4A 3A8TA 4KQHA 4A2CA 1JH9A 3NAQA 3DE3X 3MCUA 1ZUNA 2GJ4A 1YTLA 2JJ2A 5TDHA 5KMGA 4ILKA 5JG7A 1MABA 4W7HA 2VNIA 4X90A 4PINA 4QPDA 4NAUA 5FPTA 2X4LA 3Q98A 1ADFA 4TS1A 2JIOA 5BRJA 2Y1CA 4I5IA 4UXHA 2BDUA 4RDHA 4PTYA 4NCBA 1VHDA 1YKGA 5DYNA 3FNFA 4YP9A 5JTUA 4D6XA 2W8BA 1HQCA 3OM9A 5FTMA 2ZANA 3NNDA 5L3ZA 4RFSA 4INJA 5AK4A 3G8DA 3ND6A 1CS0B 2EGHA 2IBSA 3R9XB 2FX5A 5GJVC 3RUPA 1ISMA 4R1NA 2O5CA 2IGTA 2QYSA 2TMKA 2OLEA 3LLVA 1RKXA 4FW8A 5KYXA 3K0HA 3DF9A 3U7FB 2QI9F 5CAEA 1RWMA 3QI2A 3DWGA 3V32A 4MNTA 2UYOA 2AKEA 4U7WA 2XDYA 3FTNA 221PA 3HUEA 4QPCA 4BO2A 3JQBC 4G24A 2EARA 1FQOA 4K6FA 3FOWA 4PM4A 5JXHA 2P9EA 4HADA 3EVZA 2AHRA 1G8HA 2G0TA 3AVPA 2ZXUA 4QFBA 1AD2A 1NQWA 3NHWA 4DDTA 1G6HA 1GL3A 1T0HB 2XMSA 2JIDA 3BXXA 4MO9A 4PLGA 4QDOA 4Y6SA 5I8ZA 4GOLD 3KSBC 1FFDA 5JUWA 4Q18A 1K5HA 3T1VA 1LDGA 1V11B 2CDCA 3GFRA 5ICGA 1U28A 1D4AA 3CF4A 5FBHA 3S1AB 5BOSB 2J3IA 5FD8A 4Q21A 5DNAA 4BN5A 4XB6B 1KQPA 1JG3A 1TM4E 5T8KC 4AYXA 2XAUA 1QPGA 3LZDA 4NZYA 3RSHA 5GGXA 3LCRA 4YRDA 2B8WA 2YVLA 2LWIA 1P74A 3O9VA 3NOOA 3SHVA 4F2WA 2P75A 3KVOA 2BJHA 1NUPA 2DWQA 3EIWA 1SNYA 1JA0A 3IPLA 1Y3BE 3BMCB 3KXPA 3DTVA 4IAOA 4S1VA 4UXJA 5KDOA 5L7TA 2JCGA 2PN1A 4XWAA 1ZC3A 3BX1A 4Z9BA 3WZ2A 4B85A 4YV1A 1UMCA 3AFOA 3QLJA 1I6WA 3AF4A 3IJEB 1DO2A 5EQJB 1ODJA 3UAOA 1G8SA 4E13A 4YT4A 3ILSA 1YRYE 2G88A 4ZQIA 3TMYA 1PDWA 4X6XA 4N5NA 3ZJTA 4PQEA 2J4FA 1MJGM 3L0ZA 2OFOA 3GEGA 4FNMA 1DGQA 4DPLA 1U0RA 3B8EA 1QV7A 4BBJA 4YH1A 4B5LA 1MVNA 1QR2A 2JFQA 3S2IA 4DUPA 4ZFNA 3BBLA 3BC1A 3O8QA 1CJVC 2JAHA 2R8ZA 1TW3A 1ZL2A 1G98A 5HGJA 3L79A 4XI9A 1JHMA 4C7KA 4YACA 4PFJA 4MIEA 5ALNA 1GQQA 2BMFA 4AP5A 5EZSA 4CQMB 3L7NA 3OCCA 2WJYA 1VCHA 4OD0A 3KHUA 1CR6A 2OHHA 2XCOA 4RPKA 2I55A 4I6GA 4CMEC 1R10A 2C3UA 1XL0A 3BEDA 2J0UA 4TMXA 2W58A 4EHIA 1A9XA 3KB2A 2XCLA 3BFKA 4BWFB 7ADHA 4RD2A 2QXUA 1F8YA 4RHTA 2BUBA 3CWQA 4XB2A 4E31A 1KRHA 1DCTA 3D5TA 4TUYA 3VMMA 4B87A 1Z3IX 3M6WA 4ENWA 4OA5A 4PHTA 2QL6A 4KLZA 1RWNA 2ZR7A 5FHQA 2PO5A 2XQKA 3GAZA 4JJIA 5BUQA 5KVCA 2BE7A 4MVJI 5CW1A 2R6GA 3BIJA 3E2IA 3VH3A 3SLGA 1MJ5A 3LUFA 3SMVA 4DN6A 3CZ5A 3FNGA 4C03A 4OKNA 5GAJA 3NYIA 5IT4A 4YRFA 2R66A 3CSSA 1JT9A 4OQFA 5GINE 1ZR2A 3KAQA 3EIEA 2FWIA 2QLJA 1KJWA 1UKBA 2H1SA 1SCJA 1TYAE 2CVOA 1A2KC 1MPXA 5DHFA 3M6VA 3U4CA 4X66B 2OQRA 1DWPA 2GFHA 3DOJA 3DTYA 3IKJA 4IDNA 3UK2A 3ROTA 4OGWA 4JOSA 4PC7A 2IPXA 2FOIA 2TYSB 5AKKA 1PWZA 3W5HA 3Q6MA 3U3MA 3D02A 4K9NA 3CG0A 1HE1C 3CE9A 3OZUA 4IM7A 3UXEA 1Z08A 3ZY5A 2O8NA 3DZDA 2J7PD 4G5XA 4Q1DA 4QOHA 3TEMA 1XLWA 1KPGA 2I6XA 4EVIA 4M6WA 2M6LA 1QH1A 2RB4A 1Z83A 2QRLA 2YZ2A 4JYCA 4C7MA 3L8DA 5BW4A 1JAXA 1I14A 5AKZA 3DOFA 3U0BA 4RZ2A 3CRNA 2KW5A 3H4MA 4JQZA 2BEVA 1LVHA 3N2GA 1D0VA 2ZOSA 1DTWA 4MA5A 1DHRA 4UM5A 2JLVA 2H2WA 1WMEA 3TTVA 4JJ8A 2GHRA 1U98A 3JQ9A 2BKXA 3MT7A 4KQFA 5BMVF 2QW0X 3E9CA 1EE9A 2HRBA 3O4GA 1MA0A 4HGQA 5AK0A 3DYVA 5AXBA 1RC8A 2L18A 2YWFA 1AK2A 5ALYA 3RYTC 5H81A 4KYVA 4CKCB 4YCLA 4JVMA 2QN1A 9MHTA 2Y4NA 3NALA 4C7BA 3ZXUB 3H0EA 2BEKA 5B12A 3IO3A 1YAJA 4MS3B 4ND7A 5B1SA 3RJZA 4AZ0A 1U3DA 3W5DA 5GADl 4JODA 2GETA 3S2ZA 4RSGA 1SG9A 1L7MA 2WG1A 3TLKA 1U04A 1MEEA 3KHSA 3HLTA 2GJSA 4J1NA 3UY4A 1EK1A 3RUFA 3TEFA 4LQ4A 2QLLA 2ECOA 1HE2A 5B58T 2XE8A 2RBEA 4O3MA 4D82A 3UUEA 1W1UA 3I05A 3AK4A 1EDZA 2RH4A 1E3EA 1WDKA 2Z4TA 3DDNA 1NJFA 4MWDA 3VR3A 3QEMA 5ITVA 4J1TA 1NBHA 1PZNA 5FRDA 4E12A 1VKZA 1XB2A 4FFWA 3WFJA 4EI2A 9GPBA 4RJ2A 5C51B 1SUIA 5FADA 2VTDA 3GFVA 2QTCA 4IDQA 4DUGD 1NOKA 4WEOA 1A95A 5K8TA 2V7QD 1QHHB 3VSAA 2H2AA 1D6NA 2GN9A 3B3QA 1OI4A 1EESA 3JV7A 5BWBA 2DTEA 4LJ9A 3V9PA 5DEOA 1LDYA 1I9CA 5K0SA 1GYRA 1N2HA 2W4MA 4BIMA 1MDBA 3O03A 1JAIA 1CUIA 5AW5A 4QUHA 3A0UA 4L2IA 3UJ8A 5CX1A 4Z5XA 1OV6A 3EDOA 2Z0MA 3A4MA 3F98A 2AZXA 1HNXB 3I2YX 1VA5A 3RWOA 2AFHA 1ZH6A 1IY0A 2M1ZA 4WOPA 2IQ5A 1VP3A 4D2IA 2IHKA 1BVRA 1RKVA 5M29A 2CLLB 4XUCA 1FOEB 3FI9A 3HSSA 2MR5A 4NPAA 1SB8A 2Z5FA 3KALA 4JGIA 3IAXA 4RC9A 2G77B 2CE2X 4OGGA 5HKBA 1MJNA 1Q44A 1NLYA 5G1PA 3RT1A 2WW8A 2CN1A 2R68A 3FY4A 1VSQA 2ZSBA 5EUBA 3D0OA 2O52A 4TVBA 4G56A 5TX7A 4K8RB 2Y05A 2GF2A 2GCGA 2JCBA 3EZNA 4NOJA 1ZP6A 4KIFA 3RHTA 3RVPA 3WIOA 1JHQA 1TB4A 4GP7A 1JHDA 3LYLA 2IXTA 3L40A 4M1KA 3V2UA 4IXWA 2C84A 2GNOA 3IMFA 5LVAA 3DMYA 4JITA 4INZA 3E82A 5JVDA 3H2JA 4D3YA 3FMIA 3ENQA 4WV3A 4D9CA 3OTQA 5AVYA 4IXMA 2O5RA 3N58A 2HMUA 1NBMA 4JLDA 2A9FA 1JQAA 2ACEA 2EQAA 3TVDA 4Q4HB 2XCTB 4N03A 5EC8A 4ND2A 2BZ0A 4I4TA 3L5KA 1XTBA 4W9MC 4O4JB 5C1PA 1LW7A 2PQ2A 4Q66C 3IJPA 5SY4A 5GIOE 4DC0A 1R6TA 1KJQA 2P78A 2PX3A 2Z09A 3AIOA 3O3MB 3D4PA 4MVJD 1JE0A 2NTYC 3B48A 4RF4A 2I6GA 3PQEA 3TG8A 2C59A 3GW8A 1C9NA 4MP3A 4MW2A 2ILTA 4CL3A 4EF4A 3L46A 4QU0A 3KT6A 3IOYA 1AGRA 2IHJA 3MB5A 4D98A 2WJVA 3SJCA 1NI4A 5JS2A 1XRRA 3I6IA 2IS1A 2CE7A 5HF6A 2F1HA 2X8JB 4Y9UA 2QYTA 1NC3A 2BFAA 3O3CA 5DBHX 4I1OA 4H6XA 5BW6B 4L3OA 2B2CA 4BMNA 3PXEA 1Z82A 3GLKA 2FZEA 3O5AA 1KS2A 2IF0A 2JD2A 4DCCA 1ETUA 3KEOA 3PDWA 1LJUA 3CKYA 3FTFA 4GLBA 1G9TA 4WE3A 1E2KA 3LNCA 2K7ZA 3OVMA 1N0HA 3BE8A 2GCOB 1SU6A 1IXKA 3K92A 5I47A 1GG9A 2HCJB 3HLYA 1U1CA 2P9JA 4I1YA 5AW7A 3HO1A 4UTPA 1XQ9A 2DVMA 3IA2A 3COSA 3RVLA 2WYVA 3LUAA 4WNIA 2O8FB 1QH0A 3GOQA 3B85A 5KYTA 4W63A 2GD0A 4YO8A 5TVGA 4MV0A 2WSIA 4V3CA 3VSBA 5E0KB 1VKJA 5FWAA 4HDCA 1LBTA 3BE5A 3OT1A 4OYLA 4G0WA 2NO5A 1IN6A 3RUEA 2AGVA 2IUFA 2C5SA 4HKTA 2CLCX 1XHLA 1K5PA 2J0VA 3UQZA 6CHYA 2VTBB 4JLMA 5FAKA 2W6QA 4MZDA 1YB5A 1NVVQ 3B7WA 3KZCA 4RK1A 5IDYA 2DPLA 2IEBA 5HJ5A 3HBJA 5JY1A 1RQNA 1HBJA 4FMPA 3EBPA 4M9XA 2Q9BA 2FOLA 2MSWA 4B09A 3G6WA 4F56A 1A50B 1N8SA 3L1UA 3NAMA 3BFJA 2H2HA 2K2QB 4MR7B 1VFPA 4AZWA 1U4OA 1HE4A 4RADA 1FE8A 2VT3A 5TXGA 2PSSA 1PL6A 2IBMA 4TYYA 2O50A 4U2DA 1YS7A 1QQ6A 4GBJA 1MHTA 2OB2A 2C78A 2IXAA 2EP8A 3S2EA 4E51A 2AXEA 2ZUWA 2FX2A 4ZOBA 4YY3B 3D2BA 4IOMA 4F71A 2C5HA 1G41A 2WSMA 2OCYC 2W2XA 3K9CA 1QIHA 3N86A 2QTHA 4XIJA 5FUVA 2H5IA 4EKIA 1EK5A 5F2NA 1T0UA 4B6GA 4KO4S 4ZVOA 5L45A 1SELA 2CKDA 3FSGA 4U9IS 5AJZA 5A0VA 3BGSA 1CIVA 3DNMA 3RCBA 3TI7A 2YIDA 2AR7A 1VPDA 3Q2IA 4DNPA 2X15A 3PQ7A 1DB3A 2ZYSA 4F38A 3JAMA 1R9GA 2R00A 5EP4A 3ZGOA 1DQSA 3OF2A 3ZE6A 1ESZA 4RAQA 1GV1A 5FKJA 4OHXA 3VYRB 1E2FA 2RIRA 5FXMA 2VP5A 1XNGA 2HIGA 2XZPA 2LTAA 2W6PA 1FJHA 4DMUB 2E5LB 2IEZA 3LWBA 3QPDA 4S35A 5COBA 5EJ5A 3RUDA 3X1KA 4Z7JA 5AJWA 1U0JA 2HBYA 2IS6A 3E5NA 1UKAA 3SFVA 1YWGO 3GOHA 2ZPAA 4HOYA 4IIHA 3QLVC 2EWVA 4TS4A 4X54A 5HIMA 3KYJB 5DBOA 1CY1A 1EBUA 4QOEA 4DIMA 2N0SA 1OQAA 1SKBA 3RW9A 3RTEA 2C98A 2NM0A 2OCGA 4DIOA 1QFZA 2AFHB 1DWOA 1T5SA 3HABA 1KEVA 1Z06A 2ZTMA 3NHRA 3PQ3A 1L1QA 4RJJA 4NENB 4JBNA 1TYDE 2FEKA 3ZV4A 2YVQA 2P77A 2VQDA 2V7WA 3MAJA 3W34A 3A3OA 3ELBA 2H3EA 1VYVA 1DINA 4NENA 3RFTA 1TYZA 3KD3A 4P4NA 2GEKA 4EUKA 3A1CA 4TWIA 4J7UA 3OIGA 2NU8A 2GK7A 3OZTA 2WIAA 1JDSA 3FFAA 3I9NA 4LWZA 4QJ5A 3PC6A 4DHWA 5FJIA 1T43A 3AG5A 1J5PA 2YWEA 1RQGA 3N5CA 1II8B 3PZRA 3LY8A 3Q1KA 4FGWA 1XJ5A 5AUQA 4BE4A 5TPZD 4OP3A 1N4AA 1XNQB 3U7GA 5IMSA 3ER8A 5L40A 2JNWA 2X0IA 4C87A 2XD4A 4R8VA 1XZKA 1QO7A 2C3YA 1MB4A 3H87A 1G3MA 5A4AA 2SKEA 3I73A 4Y9TA 2PUDA 2JGDB 1HEYA 3AKEA 2QAGA 2R6AA 4MLDA 3WZMA 2ANCA 2DT8A 1ZZGA 2QRZA 1EB9A 3GJ6A 3JRNA 1NLMA 4M1ZA 1JFLA 3NHAA 1TW2A 1P1IA 3DEYX 4PGFA 3GDGA 3VSDA 4B31A 4NDZA 2ZYDA 2I7XA 3OD1A 4B7UA 3C41J 4JCCA 4R3NA 1YUNA 4IWYA 1KO5A 4WZAE 1BMFA 2Q6TA 1KZGB 2RMKA 3C7CB 1T3ZA 3MSXA 4NCKA 5H70A 3ZD8A 4RK5A 3V1NA 4LSZA 2AC4A 4KBYA 4AJ4A 2C1XA 1Z12A 5CHEA 2QHXA 4FDMA 3E18A 4B46A 1DJPA 4Y2TA 1NASA 5CIQA 4TV9B 3BGWA 3CWZA 3CNQS 1SWVA 4IXTA 3UJDA 4Y30A 4LHWA 1R8XA 4QPJC 5KWEA 4WVFA 4YRRA 2WIBA 2JAOA 2YN2A 3LA8A 3VKGA 4D57A 1G21E 1PS8A 4Q1FA 4JBHA 1ZIYA 1SZCA 1GZSA 3AZPA 3V42A 5KTSA 2DULA 5DNCA 3SHQA 1LFDB 2PK3A 3SSMA 3AP1A 4R68A 4EUNA 2G83A 3C3MA 4IO1A 2W48A 3ULKA 2IE0A 3A6GA 1MTZA 3O2JA 3L6CA 2TS1A 3QWAA 3R7DA 2A59A 5ARCA 2B2XA 2CCGA 2KYRA 4AUNA 1QIGA 4II7A 3CZQA 3I6QA 4TVSA 3TQFA 3I61A 3CUSA 1T3TA 1L8LA 4FIDA 3K09C 1LWNA 4AY4A 2QVBA 4RTPA 1Q84A 2FZLA 3N05A 4ETNA 1RWKA 5KQRA 4B17A 2QGFA 3T1HB 2X1HA 4HRVA 4W5QA 1DPGA 1RD4A 3ADBA 5DWVA 1JLSA 1J90A 1WDTA 1WMDA 1TCVA 5FA5A 4AS1A 2XDQB 4XCXA 5M5BA 2DLCX 3EZLA 3FCXA 3ECSA 3N28A 1CHDA 3ZUPA 1MB9A 2XKKA 4NE9A 3LM8A 4L85A 2O3RA 1AGYA 5AK3A 1NBIA 3AJ8A 3BIFA 2X8LA 2OG1A 1U7PA 1Y4ZA 3P71T 5B4VA 3HG7A 2N9UA 2OK8A 4TM7A 5EWLB 2I91A 4Z4GA 2W2QA 1N4DA 3LHSA 3NHMA 1Q2UA 5ITWA 4BO0A 5DTMA 1WUJS 8AT1A 1H4TA 2X8JA 2PY6A 4MGYR 2H00A 1K7EB 5ED4A 3BERA 1L4BA 3N8NA 1WHTA 3H2GA 4RVFA 4GP9A 4E70A 3VR6A 4HI0E 2NMVA 3TDKA 4DCPA 2XTNA 4MB0A 3A2NA 3AM3A 1A9RA 4KGZA 2NXWA 1IC6A 1P1FA 3CZPA 1H85A 1VA4A 4U63A 3ROPA 3UOWA 3D64A 3BMQA 1DELA 2HHJA 3A11A 4PU0A 4F0JA 2IBTA 4I9FA 3ZX5A 2OOSA 3UMMA 4BP9A 4IW3B 1QYIA 2JLUA 4OXKA 4DRYA 3CZCA 3F6SA 4XOIA 2CVQA 1JVNA 3I04M 5JH7A 5ADVA 2G9RA 3VKWA 2GK3A 2QTRA 1NMEA 3LPLA 3O74A 4PBTA 5JI3E 3VHXA 2JVJA 1EYZA 3NTLA 5LP6C 1EFHA 4Z7OB 4EG4A 1EUCA 1OAKA 2VYCA 1QHFA 2ZYTX 1VE9A 4B2PA 4TMTA 5JASA 1OPXA 1VBFA 3DKVA 2OKGA 4TKZA 5LCXA 3ZY4A 2XT9A 3F5FA 3V1MA 3MLAA 1E3JA 4ZALA 4CN8A 4X61A 1N5DA 2PZKA 3GL9A 2FDCA 4MKFA 3QWHA 1AO0A 1G20B 1F51E 1SUBA 4JYMA 4FC7A 4XSVA 1GAJA 2P9TA 4F4HA 2O8DA 2HNBA 3U62A 3CLRC 1BJKA 1FSPA 4PG8A 1UFRA 2AFIE 5AICA 4EUHA 4IOLA 5UKDA 3SEZA 3LRPA 5DIZA 2WLTA 4RF5A 1UDBA 1XTPA 1SC9A 1Z4KA 3WNQA 4GS5A 3WHIA 3F6YA 1IH8A 2X9VA 4QO7A 3EDMA 1ZN9A 1US8A 2WABA 3HE3A 3ICWA 2FZVA 3KVVA 3PBKA 4MQ6A 4R69A 4WDRA 3PNMA 4QIHA 3JQCA 2R84A 4G5QA 4IGEA 1PR4A 5IAKA 1Q7GA 1XPUA 3NTXA 4GNKA 1BCSB 3EXEA 3IESA 3WK7A 3HU3A 2X19A 4D0SA 5IS2A 3ZHVA 5A5DA 2D5LA 3DFUA 1EX7A 3Q11A 4ZT3A 5FWXB 4Z2YA 2RSLA 4IKOA 4QHSA 4XR9A 3E3AA 3TTXA 3UJAA 3NNSA 4AN0A 2L42A 1ZWKA 2UYQA 2C95A 4JS0A 3OHSX 5IC4A 3DVAB 3GROA 3K15A 4HD8A 5HZGA 2ACKA 3BDVA 2W98A 2VSQA 4NKRA 4DCSA 2EIXA 3EVFA 1SIBE 1MT3A 2ASEA 3GFOA 3CUTA 4M54A 2BRUC 5HFNA 5BYJA 1JQJC 1VKRA 2YL2A 3GEBA 4EI8A 4HNVA 5JIBA 3NIDB 1K92A 3A9WA 3NO4A 1BA2A 1RFGE 1ZH4A 5ALWA 1Z62A 2ZJAA 4HNGA 1T5HX 2OMEA 4RV4A 4PN3A 1FRNA 5JAIA 2R47A 2VEOA 1PX2A 4XJXA 1HDYA 3GFTA 2D2EA 2R1TA 5BV0A 3GH1A 5KOHB 2CV2A 5DLPA 1JG2A 4W5HA 3P2EA 5COAA 1QVRA 2ZETA 3TQCA 1G8JA 3T3NA 1I0IA 3GEPA 4YMUA 4WZBB 1AQNA 1JLKA 3BDIA 3NP9A 5HJ2A 4BE7B 5LU9A 2WM2A 3QM1A 4CV0A 1X92A 2BRUA 4JLAA 3AF1A 5EGNA 2OXEA 3HU1A 4DM3A 2DX7A 3U61B 1U28C 4I4CA 4IUDS 4CM4A 3U6BA 3P2JA 1ILEA 5AJXA 4PSUA 1E3MA 2Z8XA 5KJ1A 3AONB 2AI2A 3LRXA 4MYUA 2PXCA 3G2NA 2F1KA 2ONJA 4EHDA 1MORA 3PDIB 4R1MA 4MYSA 3UAGA 1P7WA 1UBRS 3U7IA 1V25A 3WK5A 3IV6A 5ALDA 4C7OB 2VT2A 3H1FA 4G25A 3LDUA 2H8GA 3AFHA 4QDXA 5CM9C 1C0PA 1TJ4A 3WDSA 3ZWBA 4GX0A 2WFLA 3P0IA 5C8YF 1BJTA 3JQAD 3C4QA 4JC0A 3PF9A 4F2HA 1Z2PX 3B5EA 8OHMA 2VUIB 1N92A 2B83A 2ILVA 3A06A 3HPRA 4M6WB 4QEKA 4D92A 5E6SA 5FDFA 5DFAA 1Z7BA 3HDTA 4LZOA 4JLKA 2GMWA 3JWEA 3NG1A 3SEAA 2MTBA 3LSTA 3OOEA 4W5JA 4BV2A 2WMDA 4C22A 4GKAA 1N57A 4MV3A 2A9PA 1S2OA 2H7CA 2QTGA 1BEZA 3O0DA 4RDCA 4CQLA 4N3BA 3QX8A 4BPBA 1RJFA 2ZQYA 4MQ5A 2O48X 4N82A 3FOZA 4URUR 4G4JA 1CRWG 2CHFA 5FOWA 5AW2A 3MVEA 3DL4A 2ZI4A 4W1RA 1T0JB 4TL6A 1TMOA 3IEXA 4O4LB 3VPHA 1ML3A 5L3SB 4ZYUA 4O8CA 2FPKA 1XJ0A 4MRRA 2F43A 3V8MA 2YWCA 4RLSA 2RHRA 4O29A 4ZZIA 4OSEA 2C2MA 3QKIA 4JXXA 1QF6A 1L5LA 4H7HA 2V3WA 2FKNA 3GFQA 5TY0A 2QNIA 4H1WA 3LUDA 2GTHA 2MU1A 4H4DA 4IDHA 5AI5A 5DTEA 2GJKA 2NZYA 3FLMA 3NUQA 3U1TA 3I2GA 1Y5NA 1UK6A 3G5LA 4NECA 1PK8A 3GDHA 1XJQA 4CFYA 4F6LA 3TZQA 1D03A 2JAXA 3TX6A 1W9MA 1P6XA 1EEXB 3KM0A 3MS4A 1FA9A 3TMKA 1K4MA 4H3SA 4KODA 3T4PA 2C97A 3LUJA 3RS8A 2PKXA 4N3CA 4Y8VA 2C2XA 2E4ZA 2EGUA 2QVZX 3T4EA 4L5AA 4AUKA 2JHPA 1X74A 3B5JA 1DFIA 1CZHA 1FLVA 2IHUA 4GM1A 3UGTA 3EUEA 5B5SA 3PEYA 3GZNA 1BHO1 5AVWA 3WRXA 1X0XA 3E5RA 3L8CA 2DERA 1TT7A 5H02A 2ZRAA 3C5EA 2IGBA 4JZYA 3VO8A 3U6KA 2FPGA 1J0AA 4LDNA 1V1MB 2ZCJA 5DLYA 4TSFD 5EZYB 4OATA 4OQZA 3UV7A 1QDUA 3P45A 3WLRA 5C8XA 2DY1A 2H59A 2PZLA 3S1AA 5CCXA 2BMWA 1Z2OX 4RE5A 2B37A 2QMUA 3REFA 3DUWA 1SXGA 5CB4F 3ZY2A 1O87A 1YB7A 4FMDF 5KYGA 1E9SA 3VR4D 4UPEA 2H5LA 3JYOA 2YHAA 5ALJA 5CDHA 2HSDA 2I2XB 3CF2A 2FPSA 1IZZA 1R1DA 2I1VB 3LQQA 1PNQA 2VQSA 4QOJA 3GP8A 3FNBA 4NPHA 1U80A 4K9RA 2X4GA 3DE2X 2OYSA 3I5UA 1A72A 4Y2SA 5G53C 1WTCA 3F9CA 4BMYA 3Q88A 4EJFA 3PNYA 2Z8YA 2YYZA 2POCA 4I3HA 5JI2E 2VDNB 3UW1A 4JYBA 4Z49A 4UVGA 1YZQA 2HIAA 2QTMA 3QXCA 1FX0A 2C8VA 3UCEA 3PC4A 5CIYA 2DPMA 3FSRA 4NZZA 2C8KA 3AMVA 2H08A 3GRKA 4BCCA 4D45A 1EFRD 1VXRA 1IBRA 3ZWDA 4RK6A 3FTQA 2NUAA 4H6WA 3VDQA 4CI9A 1E5VA 4DXDA 1B00A 1VJDA 3D7RA 3NBFA 4RORA 3MJRA 3OLWA 2AFVA 4IH4A 4PLCA 2FSUA 3VHQA 1GV0A 1XTRA 2GILA 3O8LA 3L7YA 1SCIA 1UBFA 4WERA 4C78A 4QZVA 3F7TA 4BNZA 2WD9A 3PNSA 1QG4A 1TIBA 4OLJA 1MOSA 2FPPA 3OIYA 1FF9A 1V4VA 2Y1OA 4NU8X 5E2BA 4XFKA 4PLPA 1R00A 1NFFA 2O4UX 4QGSA 4YRSA 5JHGB 3ZCRA 1XEXB 1AKUA 2IUYA 4QYWA 1G2OA 4GOND 1RKQA 5IM4A 2RH8A 3A58B 2Z2JA 4EMUA 4G63A 4BMZA 4QU8A 4QLAA 4RTRA 1VHJA 3KV1A 3Q5EA 1EPUA 1IQ0A 1RSZA 4DLVA 5F35A 1SG0A 3ZVMA 3EWIA 2WK1A 2BJWA 1G20A 4M1YA 4MUIA 1AUQA 1N3LA 5B3AA 3MGKA 4EQ6A 4S04A 3BWDD 2FYTA 2BVNA 3SDBA 1XMJA 2Y93A 1A96A 2KM1A 2E82A 4DNQA 3ZKWA 2JBAA 5EHGA 4RA6A 4K8OA 4LVOA 2ZBUA 1YS9A 3Q7EA 1AMOA 4J0DA 2V0NA 1N2CE 3EJ6A 4OQPA 5IVPA 4HQRA 1UZMA 2BFBB 3NDRA 5AJYA 1B8PA 1J4AA 5IJXA 3AEQA 3P0FA 3FHTA 2ECFA 3F4KA 1WABA 1N77A 3OIUA 4IP0A 1AXRA 2ZYAA 4X20B 1CNMA 5L7YA 3D6HA 3DZBA 1JLLB 2K5UA 2WB4A 3OPYB 1PGJA 3LGAA 4YGXB 5EQTA 4XSHA 1TXGA 2D5AA 2DBZA 3U60B 3ZZMA 3QY9A 3BILA 1LY1A 4MTCA 2ZRLA 5FORA 5BRNA 3P52A 3QVLA 2OCLA 4AX4A 1MGPA 4GBED 3PA8A 1JVBA 2UVQA 3TFQA 1GYQA 1QHEA 1RLMA 2AIRA 2NUTA 2ZRGA 3EC7A 4AJPA 1MTOA 1NONA 2H1IA 3HYCA 4HAYA 1APBA 2ZS7A 5KJCA 3C3PA 1FUEA 1NU8A 5FFMA 1B14A 1XTSA 4CTNA 1QHYA 4KACA 1OX5A 3GRUA 3QWIA 4OQ4A 3OF3A 1YR9A 3E9QA 1XEWY 3NBQA 4GF5A 4RJIA 4LFAB 1HE3A 2N1BA 3TIVA 5IFKA 2ZTHA 5F52A 4Y1RA 1YHYA 4ARSA 1JHOA 1YJXA 4AXXA 1PJ4A 2FZCA 1DAFA 3BXEA 5SZHB 4M99A 5LMNB 5A02A 4WFKA 4R83A 4DE5A 4CIWA 3EIFA 4TSKA 1XK7A 2CMGA 3E7XA 1WMSA 3O8DA 5IZ4A 4A0SA 2PKWA 2V7UA 1IY1A 2O8FA 1M2OA 5D3ZA 5A4JA 2OV8A 2JVKA 3R0VA 2WTMA 3G6KA 1M74A 2AJLI 2F2TA 1W87A 1J7KA 4RQUA 3RUAA 4DLYA 1MZPA 2MDTA 2OCKA 3BK7A 1SUWA 1GL7A 2E4WA 3MINA 3KB1A 1UZUA 2VK8A 3GPDG 3K31A 3WIUA 4BMSA 4DNFA 3AHFA 5JNUA 3WA7A 5DOZA 3WLIA 4TROA 5AKJA 4BQPA 4U2EA 5CTJA 3KQSA 1LNZA 5JD4A 1KEZA 2C4KA 1W2WB 2AS0A 5JPIA 3SM9A 3OFJA 4UCQA 4LF4B 2ZAGA 1T2CA 2PTGA 2GPJA 2FN7A 2W93A 2ZSIA 3DBLB 5HM6A 2J85A 2ZJ8A 3B9QA 2ZI5A 2O1XA 2RKWA 3SX4A 3X2SA 3P9NA 1DV2A 3BJZA 1ULBA 3O2SB 3PU6A 4LY3A 1NQAO 1ORWA 2R97A 5T5QA 1IBLB 2GHIA 1JEOA 2WHEA 3SYKA 5JZ9A 1PO7A 1GZ7A 3AL2A 3EA5A 2AWOA 2WYIA 3M1IA 1EE2A 4KLAA 1DC4A 5HBGA 2B2NA 1N5KA 1E5LA 4PICA 2FRXA 4JXZA 3DR5A 4CCYB 1Y34E 4UAGA 5C8DA 3AUTA 3WGTA 2BTEA 1WHSA 1YJBA 2VWQA 3AQIA 4GUDA 5IKEA 1Y8QB 2Y4OA 1IZ7A 1T1SA 2ZT8A 3QELB 4PZYA 4BQFA 6AT1A 1H2EA 2O4CA 2EG5A 1J99A 4D7AA 4DMKA 2ZJZA 1INLA 1DUSA 2DUWA 2VSNA 3IXMA 3QUQA 1YA4A 2V97A 5F3RA 3L8YA 2H52A 4GD3Q 4PFKA 5K09A 3M0EA 4EPWA 3KFLA 2JLSA 3MERA 4RZXA 2FH5B 4X8OA 3DO8A 4ENVA 4MVJG 1UPTA 2PX2A 4DXHA 3E3MA 3ENKA 1NZJA 4QE3A 1KNXA 4MV4A 5AYVA 4DIKA 2R9VA 4Z4EA 5IVKA 3AF6A 3AFGA 4X1KB 1BXGA 2JBHA 2QG9A 1SBTA 4F4UA 2QUAA 4EJ6A 4QUKA 1X2EA 2ZM6B 2PZ8A 3U3KA 3JRXA 1C8BA 1QQAA 4R81A 3PXBA 3DLCA 1HDRA 4P7KA 1YONA 3HUUA 2P3QA 3MMPA 4JOBA 4MXDA 1PT9A 1D4FA 3V1LA 5TPZA 2X7HA 1G5RA 4U9HS 1GARA 2C2ZA 1X1AA 3MD9A 3UMRA 5B2ZA 3BICA 5I5EA 4L8VA 1PLJA 3WKEA 1C9YA 1CQJA 2UXBB 4HPXB 4I3FA 1WNFA 2I6UA 1R8SA 4BYGA 1VLQA 2J0EA 4LK3A 4YC7A 1C3LA 2J9XB 4GWGA 3K9QO 4G97A 2QZJA 2M2IA 4ARZA 4B2LA 3NGXA 4HXYA 4RLFA 3DMRA 4OJYA 1R50A 1L3BA 2CXNA 1U2QA 2JFPA 2EGGA 3FSEA 4PSVA 4LGYA 4DLRA 1LTKA 2IWRA 5DVZA 2RGNC 2FAXA 3LH5A 2A5YB 3KR2A 4H7IA 2C88A 4IX1A 4I81A 4LC1A 4KAAA 1F3OA 4WKBA 4QUJA 2WMYA 2G6BA 3DMGA 2WNIA 4GPZA 3FYCA 1JIVA 3PX2A 4BVHA 1CS4C 1QJ4A 2H9IA 2IVFA 1EU1A 3LV8A 2PS9A 4R0VA 5SZKB 1UXKA 1H42A 5IVIA 3SF8B 5B6JA 1OH6A 3W5CA 1SBYA 4ZOLA 4YONB 3ZHRA 1SIOA 5FUMA 4LJYA 4JSTA 4MVJP 3EF1A 4MS3A 5D7BA 3RRMA 4LV8B 4AZ0B 5A5EA 4CKWA 3N6XA 3SZ3A 1W1WA 3BOSA 2HSWA 3TCXB 2HYDA 1WPGA 5JXJA 5JO0A 2AG8A 4TQGA 4BLSA 4W1PA 1XMXA 4LXYA 1W581 3IB6A 1G20E 5G3ZA 3QVGA 2ISSD 2WJGA 3H97A 4ZAFA 2G70A 3IVRA 3SDSA 2FWPA 2EKLA 2HDOA 1LDNA 4CDRA 3MJDA 1BHQ1 2G07A 4Q6WA 4BNYA 5FBWB 4IQ4A 2IXGA 4Z4IA 1A9ZA 1MMFB 2IYNA 2Q2NA 1WNTA 2ZBVA 1E7WA 3OCWA 1G3UA 1L7VC 3VNVA 4C0BA 2P5YA 1CY4A 4AMZA 1AX9A 5KQSA 3WLTA 4OXYA 3R3WA 4GPBA 2IP2A 2QY9A 4NYIQ 3T35A 4QOIA 2OZLA 3BFVA 3JAKB 3H0CA 2VJLA 2FMIA 4MVJM 4NNPA 1HOXA 3GLVA 3NATA 4KP7A 3ZYCA 3DR3A 3A6PC 4HL6A 4K88A 1OV4A 2N75A 5DISB 5KPDA 1EP3B 4R16A 5AM5A 1Q6YA 2BFFB 2COEA 3ESZA 5HUJA 1XTJA 4G1EB 2COUA 4EGAA 2BIFA 1WXQA 4YLGA 4D3DA 5FBVB 5DASA 3AHEA 3I6YA 3LUGA 1V3VA 2BTQB 4KSBA 5GV8A 4A2QA 5E9WA 4KAXA 4M1OA 5F51A 3REQA 4POOA 4HDNA 5TT1A 4P31A 2ZI7A 3LX8A 2JEZA 1AF7A 2G25A 2E1RA 1GZVA 3R6TA 3L7IA 4FYPA 3LBYA 4C6HA 1VHQA 3PGMA 4RMIA 2ZG6A 1XQYA 1Z5GA 3NTOA 3UKJA 3X1JA 3NV9A 1JDNA 1F8GA 1U94A 4KQXA 1E4EB 1M2VA 1QK5A 4PCVA 4UE6A 2GF9A 1A9YA 4Z0PA 5JSYA 4TYPA 5EXSA 5K03A 2QBYA 3MFYA 3PSHA 2P9ZA 3H11B 1XA4A 4S0XA 4WUVA 4R7GA 4TUYB 2P3OA 2V7BA 3LKVA 1DEAA 5FOVA 5H7XA 1SRQA 2QT9A 1JQ3A 1U1GA 2FUG1 1BWPA 3TW4A 1W8IA 2F1IA 2YR0A 3G9TA 3MHPA 4GEGA 5WRFA 3S2GA 5C1OA 3C4VA 4GRIA 1UPAA 2A9RA 3PK0A 3UKOA 1YMVA 2W5UA 5ECWA 1O1YA 2VDWA 4QQKA 3L92A 1C7EA 5ESXA 1M34E 4K7JA 2XYHA 3KOMA 3QNUA 1QDEA 3GAFA 1IUOA 3IILA 3R23A 2IELA 3HR7A 4I3GA 4CI0B 3PGLA 3DPUA 1DX9A 3QJYA 2NSDA 2YOGA 4O4JA 4XGIA 4YRAA 4Q37A 5AI0A 2EBUA 3AH8A 1I7DA 2CNOA 2P1RA 3BS4A 3QFTA 1DDOA 2EJTA 4PVCA 2C5FA 3WIDA 3ZLTA 1RJDA 4OJTA 3EVAA 1VJCA 2FQWA 2BGUA 4JFRA 4JHXA 4LW8A 3M4XA 5JR3A 3IEMA 1NBWB 2HA6A 4KZPA 4HNUA 2I4TA 3DBHA 2C4VA 4LRTB 2V6FA 1HG0A 2K2WA 1A8UA 3T3PB 3M33A 1DV1A 5CFLA 4MKIA 4F3KA 1T0BA 1GRRA 3E2PA 3EUFA 5CG1A 1PUXA 4L3VA 1JYEA 2YNMC 1UAYA 2NO4A 3N76A 4NATA 4RIHA 4F9FA 1LEHA 3MJEA 1XR3A 3IL2A 1KI7A 2BHLA 2CMDA 3O4IA 2HRCA 4UREA 4MYRA 4WLFA 5EG5A 5CT5A 4D97A 1XEAA 3N8KA 3W3ZB 1USKA 3CJQA 3TLBA 4D3FA 3B9RA 4FS3A 3I52A 4RKRA 4QATA 4YBRA 3AHCA 4ZCQA 2PH1A 2HUNA 1T24A 4YFYA 1QYXA 1S8OA 2RJ3A 1A5ZA 2AMVA 4GPD1 1Y1QA 2GX6A 1LPNA 3KR9A 1YR3A 1KZ7B 1OFGA 4YWJA 4GWLA 5MN5A 2QDXA 4PCAA 2QVGA 4GUAA 3TZ6A 4BZZA 3QSYA 1Z4QA 4FNGA 3PHCA 4O2AB 1ISIA 1YKSA 2EZUA 2Q5EA 2M32A 4B82A 2Y71A 2JW5A 4JIMA 3HUFA 4LZAA 3J7AC 1FRZA 4I66A 1EQUA 4YQZA 1CUBA 3GRPA 3UGQA 3GLIA 1MBZA 2HJSA 2YIVX 3O6VA 1LQUA 1N5LA 2IFTA 2KI5A 2ZE8A 3AM4A 4YJ3F 2GYWA 4N39A 4V0OA 1QRSA 3OLVA 3F6EX 5C34B 5C35A 4LI0A 1T4GA 1G8PA 1QIEA 2ZBGA 4FZ3A 1KOFA 3KLNA 1CR4A 3I1IA 4RVUA 1W85B 3T0IA 4C4TA 3ICCA 1RCFA 2I4RA 2YXNA 2AE2A 4X44A 5AXAA 4EABA 4XGNA 4EQ6B 3WXBA 1EUDA 2BH9A 5A2GA 3I5MA 3WAKA 1KEEA 4IV8A 3SSNA 3VZDA 1IEQA 3KS9A 4HAUA 3IAS6 2Y99A 3SYRA 1CJBA 1PR0A 1NUAA 1KEUA 1DBPA 2JBWA 2IODA 3E53A 1JR2A 2XF8A 3GC6A 3KLBA 1VSTA 4H15A 4K3UA 2AMJA 5D1NA 1HYGA 5DN6A 4EI7A 1GQYA 4ISBA 4B3FX 3HZRA 3DHEA 2XOKA 3DBRB 2NADA 4BX0A 4RW0A 5EKDA 5ICFA 2G36A 2Q41A 1GQSA 1ZNYA 3B53X 4NBSA 3ZCXA 4AJLA 5BYAA 4EEXA 2YZNA 1FX1A 4EY5A 4NULA 1D3AA 1OLOA 1RC0A 3CEJA 3C6BA 3OWOA 5TGZA 2JH8A 2SICE 4V3BA 1W2GA 1M54A 1LLUA 3I83A 4J90A 4J1SA 1GLNA 3ETCA 4UZEA 3IPRA 4O63O 3RHZA 2A8YA 2EQ5A 3UMBA 1V45E 3QU2A 1TQ8A 2QUHA 1CV2A 1JKMA 1GPH1 3F5DA 2FFBA 1QZXA 2QM0A 3N2GB 4LQDA 1XROA 1NJ8A 1ZRHA 4DCOA 1LSUA 2O6HA 1V8OA 1FMCA 1NRIA 3MTGA 1V8DA 4CM8B 3OPVA 2BMDA 1QONA 1E69A 4O2BF 3GN1A 3ICOA 3I28A 9ABPA 3KEQA 5A71A 2HADA 4L57A 3EPRA 4Z53A 1KMHB 3Q5DA 1I33A 4M8LA 4AK9A 3RKSA 4GOXA 4MCIA 3LOPA 2ECQA 2FP4A 3EGVA 3ZVLA 3I09A 4FGLA 3GIWA 4YAWA 4QU5A 1WBBA 3LPNA 4Y7CA 3O1JC 3ZK9A 4FSXA 1OFUX 4G1BA 1X7GA 2JLAA 4F93B 1HE5A 1LUAA 1OIVA 2EXXA 1OLUA