3CX3A

Crystal structure analysis of the streptococcus pneumoniae adcaii protein
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
277
structure length
264
Chain Sequence
TGKGMKIVTSFYPIYAMVKEVSGDLNDVRMIQSSSGIHSFEPSANDIAAIYDADVFVYHSHTLESWAGSLDPNLKKSKVKVLEASEGMTLERVPGTLYDPHTWLDPEKAGEEAQIIADKLSEVDSEHKETYQKNAQAFIKKAQELTKKFQPKFEKATQKTFVTQHTAFSYLAKRFGLNQLGIAGISPEQEPSPRQLTEIQEFVKTYKVKTIFTESNASSKVAETLVKSTGVGLKTLNPLESDPQNDKTYLENLEENMSILAEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoprotein
publication title AdcAII, a new pneumococcal Zn-binding protein homologous with ABC transporters: biochemical and structural analysis.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Metal binding protein
total genus 75
structure length 264
sequence length 277
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3cx3A01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3cx3A02
1PQ4A 2YNMD 1L5HA 1QH1A 4HMQA 4TKVA 5JG7A 5KHLB 4PAGA 5BVGA 4HN9A 1K2VN 4M7OA 4TKUA 3TEFA 4INPA 1G20B 3ZK9A 1KAEA 1QH8A 2WI8A 3PSAA 5M29A 3ZTTA 2Q8QA 2XDQA 4FILA 1M1YB 4N01A 4INOA 3BE5A 3CX3A 1KAHA 1N4DA 4ND8B 2R79A 2X4LA 3MINA 3MWGA 5CX1B 3AERA 5M2QA 3TLKA 2OSVA 4HMPA 5M34A 3AEKB 1FP4B 2PS3A 4WZBB 5KOHB 4WN9A 1N2ZA 4UDOA 1N2CB 2OV3A 4ND8A 1K0FA 2AFIB 2AFHA 3AEQA 5BVHB 5CX1A 2QI9F 1M1NB 1M34B 3GI1A 4LS3A 5CR9A 4XPIA 4FI3F 4UTOA 2OV1A 2YNMC 3TNYA 3G9QA 3R5SA 5GGXA 1G21A 1N2CA 1QGUB 2AFIA 3MWFA 5BVHA 2XV1A 1TOAA 2O1EA 2ETVA 1XVLA 3AETB 4MO9A 2WHYA 1H1LB 1G20A 4LJSA 4H0FA 5KOJB 4G07A 4NNOA 2PS9A 4GICA 2XQVA 1M1YA 2OGWA 3R5TA 4MDYA 4OXRA 5HX7A 1MIOB 4K3VA 2Q8PA 3EIWA 4PM4A 1K75A 4WNAB 5KOJA 4MLZA 1KARA 1FP4A 3AEKA 3AEUB 3PDIB 3BE6A 4WZBA 5FLYA 2M6KA 5KOHA 1ESZA 4WESB 2XUZA 5JPDA 4UDNA 1L5HB 1QH1B 3HXPA 3MFQA 3PSHA 4TKVB 1N4AA 1M1NA 4FNAA 4IRMA 1M34A 5JOQA 1EFDN 2MINB 5BVGB 2PS0A 3HJTA 1K7SN 4TKUB 3NU1A 4WZAB 3K1AB 4WESA 1QH8B 1QGUA 2XH8A 4HMOA 5JJ5A 4FKMA 5GGYA 2R7AA 4OXQA 3ZK8A 3U7QB 3LI2A 5AFSA 2XDQB 4CL2A 3AETA 2MINA 4G09A 3AESB 3MINB 4UTPA 2PRSA 4H59A 5M3BA 3AERB 1H1LA 4DBLE 4WZAA 3HH8A 3K1AA 3ZK7A 2M6LA 4B8YA 3U7QA 4WN9B 3UJPA 4NNPA 3ZKAA 2AFHB 3AEQB 3LHSA 2PHZA 3AESA 4MX8A 2XY4A 5B58T 4OVKA 4BBPA 1MIOA 5I4KA 3EIXA 4WNAA 4XPIB 2RG7A 3MD9A 3PDIA 1PSZA 3AEUA 5HDQA 1G21B
chains in the Genus database with same CATH superfamily
3V4SA 1FEZA 3ZCPA 4EG5A 1SCKA 1ODJA 4TWAA 6AT1A 5HZKA 1DFHA 1M2FA 3OCCA 5CGQB 2SKCA 1SKUA 1XD2B 2C3PA 2KYRA 3MIIA 2Q46A 1FW6A 3WDSA 4R9RA 3V5NA 5FQOA 2W6JD 2B4QA 1KC1A 4PXYA 2DX7A 2V7WA 1SOMA 1Y9DA 5C5CA 5BQ5A 1BH6A 4BHTA 2X4DA 3NHZA 4XSVA 1KYVA 5A4MS 4RSGA 4FR5A 3TB4A 4DJDC 3DEIA 4MGIR 2IFTA 3BRCA 1H3FA 4F5WA 5BW8A 4PLHA 1YI0A 1K86A 2CLDX 2VSNA 4KXFB 3EXFA 3PQDA 3FPSA 3B5EA 4MEBA 2R44A 2XMDA 4FGUA 1CVIA 5GM2A 1XAGA 2YV1A 4NFHA 5C9ZA 2G0TA 4IJKA 1CY6A 1XU4A 4CKCB 1GADO 3RS0A 3GAAA 3ISTA 4WZBB 1OV6A 4EATA 1VLQA 2FMTA 2APJA 1JT9A 3TW8B 1PR3A 1Y8QB 4A6DA 4CKBB 1LF0A 3ZGXA 3BULA 3NH6A 4J4TA 4OQEA 1FYEA 1MD9A 5FBHA 5BSTA 2ZYUX 3O2JA 4TWBA 1K88A 4H77A 5CDTA 3U7FB 3DW1X 3LGAA 4TSFD 2QMZA 3N7TA 2AOVA 4H3HB 2E85A 1YSCA 2QL7A 5K3EA 3AUKA 4MV1A 5DMXA 5DNUA 1GT91 2WSBA 4P7BA 1G2OA 2OMEA 3A6GA 4TXJA 3OCWA 4QQRA 3UB2A 1VSTA 1KVQA 3D8UA 1H4SA 5FUYA 3N0TA 1H3NA 3BHIA 4GKBA 3UMBA 3VPHA 3ZBTA 5LOVB 3U6BA 1D2EA 5CBPA 5L53A 2C57A 2PQ6A 5DM60 1FFYA 1QX4A 4ZQEA 2E4UA 5K0LA 1UBKS 2C9YA 2PS9A 2VZEA 3DTTA 4JNCA 2VUTA 4O6VA 3EZFA 4WKPA 3E9QA 2ZJ7A 1HFEL 4KL8S 4BN5A 2HN9A 2V7TA 1RYFA 4YDQA 4UM8B 3M1IA 4ZO9A 2X0JA 1PL8A 3O4VA 2VPTA 4QXRA 1U0RA 1XPJA 5FPQA 2F59A 3QF7A 4OQZA 4H1WA 4LJRA 4UZSA 3JR7A 4LDPA 1EIWA 3M70A 1JJFA 2VJMA 3LIPA 1LKZA 2OOKA 4HX2A 1MA3A 3HJNA 4CM6A 2Q0XA 3DP9A 4FNAA 4RE5A 4TMYA 5EE3A 3OT5A 1MU0A 2PZMA 1YOBA 1GUBA 2WT9A 2G09A 2NM0A 2O2GA 1YZTA 4A15A 4YMIA 1A2KC 1C0LA 1LA2A 4XIJA 4RVOA 3N5CA 2PD4A 4LE2A 4U3JB 5I7VA 3U16A 2W6OA 3AGQA 3O3NB 2QU8A 3FHTA 2YN0A 4RS3A 2FN9A 1JALA 4BUJA 3ADCA 4ZVLA 4PGMA 2PZ8A 2DFNA 4F46A 1RLJA 1XZFA 1I01A 3OKFA 3NIBA 1PL7A 3BAZA 4NZMA 3OHMA 1P91A 1BDIA 2BONA 1ODSA 1BX0A 3WLNA 2J5BA 1H94A 1PWYE 1X7XB 4G36A 4MPPA 4QDXA 3E1KA 3GJYA 4CODB 4DNFA 4NCAA 1LUAA 5BO5A 5GONB 3QX7A 2BMWA 1F7UA 3OTQA 2VTDA 4HNAB 4NNPA 3NIWA 4EFLA 2L17A 1B3BA 4F8YA 1CTQA 5LD2C 1NYQA 2LCFA 3A6ZA 3ZY5A 3VR2D 5LMCA 2E4ZA 2J9YB 2RAUA 3GRRA 4NFSA 4DCTA 1NAIA 3H1GA 5CDGA 4NZOA 1E18A 1AS3A 2W6IA 5DU2A 3WP1B 4ZCQA 5FUVA 1U2PA 1M6WA 1XCLA 3EIOA 1XQWA 2R85A 3RFUA 1Z5ZA 2PA0A 4M1EA 3GC6A 2MT9A 4BQSA 5DULA 4I3HA 3VR6A 3CT6A 4ZO7A 2ZU0C 1C3EA 4BJ1A 4WL0A 4JODA 2FJPA 3A27A 4G24A 3HMQA 1WDWB 2X23A 4LEIA 1QORA 3EXHB 3LK6A 1NUHA 5CTJA 2G1PA 4GXTA 3GL9A 2K87A 3RWMB 4HVCA 5J2TA 1EVLA 5HP4A 4URHA 1WP4A 3R1IA 2XTAA 3EFEA 1BD3A 2D7JA 3RSOA 1P5FA 2FN8A 2ZBUA 3W05A 2JEZA 4NYIR 5M2QA 1P7PA 3WQSB 3EOAI 3JAWA 2R00C 5DX8A 3TOSA 4L0DA 3U1TA 5AVJA 1CDZA 9MHTA 3GJ5A 2WJ6A 1B8OA 5T6MA 1W4ZA 4X1KA 3GVPA 1I4EB 2CN1A 4LYEA 3ZWWA 3PQFA 3D2AA 1IWOA 3NETA 4B4KA 5C8XA 5BW4A 4TYWA 1AD2A 5DVZA 4BV8A 3LBFA 2BW0A 2FG7C 1JR3E 4U7DA 5CVTA 3M5DA 1OR8A 2FW9A 2R1TA 4C78A 2BFEA 2HA2A 1DV2A 1GG8A 1YZHA 1ZZGA 3BFVA 4L4RA 4MZDA 4AULA 5CDFE 4BXOA 1KYYA 1P1FA 1N9KA 1EX7A 2J33A 2LTAA 2X7XA 3BZWA 4LMBA 2C00A 4BTLA 4O3MA 4O2LA 5B37A 4IVQA 4CTKA 2OCXA 3WOHA 1AQ6A 3SFZA 5TJ9A 4B81A 2VPPA 2P41A 3PUJA 1SA0B 4JLNA 3G1TA 4XWKA 5ALMA 3ZJ5A 2PEYA 2W2LA 1PV2A 1W0CA 1TYCA 3C3EA 3R5TA 4Q1BA 3W6OA 1WMBA 1RWXA 3NGMA 3W1WA 2O4UX 1KE2A 2RH8A 4GWGA 5K0BA 2EX1A 1EVEA 4ZV9A 2ZJAA 3UXMA 1WTCA 3KEQA 2G9RA 5C37A 5HXAA 3DOIA 1W4LA 3BIJA 3CCCA 4JP8A 1JKFA 4C0HA 5AW6A 2I4OA 1L5HB 2WMDA 3DMFA 3JQEA 4DA6A 3GEIA 5EHNA 2QTNA 2C95A 4MTLA 1TPYA 1KSGA 1J70A 1P9LA 5LN1A 3ZY6A 5GOTA 1KIAA 5KYUB 5EQFA 5D01A 1KWKA 5IX8A 5F9HA 3RFVA 1RYDA 1L4HA 1FDVA 1WMEA 1GCGA 2D74A 3M7IA 1A7JA 4I55A 5FL3A 4B4OA 1EUCA 2RBKA 3UMGA 4QQNA 5GJCA 3CNNA 1J25A 4PG4A 1Y3IA 2P78A 4B46A 3C6ZA 2JHGA 1QRUA 4WJLA 3WWZA 1TO6A 1Z36A 1DJLA 4Y2YA 2ZSHA 3ZHTA 2V3WA 3B6MA 1AGXA 4NZNA 4F1KA 1GZVA 2WSIA 4HGNA 4LYAA 1N6IA 4HZUB 5ILOA 1JYFA 1NVVQ 3GUVA 4TTQA 2HT6A 3WNBA 3O1JC 1FJGB 2WWTA 3QEAZ 4H27A 3HUUA 3JAKA 1O94A 2X9VA 2HQRA 1KYZA 3A6LA 3MTDA 1JDPA 1WOYA 1CUAA 3H65A 1HX7A 3Q0TA 1I5OA 2Y1DA 3LP6A 4W1SA 4UTNA 1YMQA 3WO0A 4EVRA 4D2IA 1IN4A 2AI3A 1U0JA 3KQPA 1JHPA 1KJJA 1WUIS 2ONCA 4TS9A 3SHVA 1E9CA 3H11B 2F00A 4J1TC 4X1YB 1NR1A 4EPVA 1XZMA 1EVIA 3N76A 5D85A 3FUUA 1VI6A 4ER7A 2C4MA 5HOQA 4R2XA 1GTMA 2QE7A 3D6NB 3W90A 1NHWA 1SCNE 5JIBA 1NVGA 4XGIA 3WYNA 2HHJA 3EQ9A 4ZOLF 1PVVA 3J80A 1WUYA 3CRMA 1LC0A 4P4LA 4E88A 1T5TA 2VBGA 3BBLA 2JCSA 5DWVA 4BVBA 4E21A 3ESXA 2W90A 4LNUB 5JH7F 3OTIA 5JDCA 1LTKA 3AM3A 5CNKA 4Z8XA 4FX5A 1S2OA 1GJRA 1GZHB 1XTKA 1BMDA 4GLBA 3KSUA 5A7FA 3MTIA 4M0EA 3EXG2 2DFPA 1SPBS 4V24A 2HM7A 3DO8A 5CR9A 3L1KA 3IQZA 1U2DA 4FI3F 5HJ2A 5TPWA 5T5QA 4QRDA 5LM3A 4CIVA 2Z4TA 2QN6A 3M4ZA 3VPDA 5EWLA 5EPOA 4I9GA 1V3QE 2WWFA 3KC2A 4IHKA 4A16A 2IHTA 4LF6B 3UENA 5GVSA 2E9SA 2VRWA 4P7JA 2PH1A 3CKLA 2DHDA 2QAGB 4DLUA 4HFJA 2OG1A 2XITA 4BVHA 4Y2PA 2ZAYA 3TLAA 1MDFA 4RSRA 4DBZA 3H2ZA 4AP5A 1F8FA 3Q12A 3A9WA 1UIMA 4KIWA 1NW5A 2J4CA 5FOSA 1KY5A 1E7YA 4KN9S 2YZ2A 5BV1A 1C3VA 1UM9A 1JEQB 3ROTA 4YRMA 4CEIB 4HDKA 3HXTA 2A94A 3KP1A 3QX3A 3MVEA 5CITA 1T5LA 3V4LA 3AV3A 3CN7A 3HEBA 4R3WA 7REQB 4I2NA 3PXGA 2Z8YM 4L0CA 1JP7A 3BE8A 1FRFS 4XRRA 1T9GS 2RGUA 4QX6A 1QOQB 3AEUB 5ALGA 4A5OA 4LHSA 1YONA 5A4IS 2NVUA 4BJ6A 1MO4A 1PK7A 2ECOA 3H4TA 4QELA 2VK2A 2PL9A 4UEWA 4PNZA 2A4MA 3RAPR 4OLBA 4ZRDA 1WSBA 5FPSA 1Z5PA 4FEGA 4RMNA 1ZUD1 2A9QA 3EOBI 3BILA 3OOYA 1BE8A 4JV5B 3ABZA 3ZLJA 2HNKA 4AJHA 3MLEA 1OI4A 1EGHA 4FYWA 1K92A 3COPA 4WCFB 3UB3A 4ZZ0A 5IEJA 1YGPA 2ECPA 1SWWA 4U4AA 1N5JA 1WMAA 4XX1A 3RT1A 2QPAA 4BGUA 3ZNNA 4M88A 5NULA 2JIZD 2IPAB 4NEHB 4C7OB 3MUFA 2FE4A 4GOXA 1HNNA 2A0FA 2GKSA 2BGUA 2Q4DA 1NYLA 1V9LA 2R2AA 4M21A 3L49A 1KY4A 1G42A 4WBXC 4XEHA 1VZ2A 3FDXA 3EY9A 3I4FA 1MGOA 1P4SA 3ZXXA 1RPNA 1AKVA 1O89A 2WNHA 4JJEA 3TRFA 3AG5A 4GGOA 5J5VA 1F12A 1SM4A 2Q99A 4YV0A 3PXUA 4FCTA 4RHTA 2NACA 2YZ7A 2Q7DA 1RTTA 2H1CA 4BVAA 4CEJB 1B23P 3U7GA 1UMDB 4INJA 2PX4A 1M0SA 2AG8A 4W82A 3P32A 3D6VA 4ZVTA 1O5IA 2FPKA 1E4EA 1MVNA 4RIFA 4AZ3A 4D3DA 4FE3A 3W06A 1FLDA 4PCVA 4AMUA 2DTEA 1IEQA 3T0FA 3T7SA 4EK9A 1CKEA 3H7IA 1I14A 1A9PA 1NY6A 1IYZA 2ARKA 2H4JA 2Y1CA 4TV8B 4QFDA 4BCDA 2VYCA 4QODA 2GNOA 2ZPAA 3KKQA 2QNIA 3EXG1 4IS2A 3A1WA 1E1RA 4ZT7A 2Q6OA 4YV1A 1Q6ZA 2P6OA 4IKOA 4RCYA 5FPHA 3ZYCA 2AF4C 2NYRA 3PXCX 5LZ2A 2KBFA 1QHHB 1M2VA 1NMXA 2GNPA 1V8ZA 3L07A 1JLKA 2O7NA 4MWDA 1ZGBA 4E12A 1QHXA 1IQ0A 4FHEA 3M6UA 3P2OA 4LOIA 1FSFA 1MQ8B 1BWRA 5DCWA 3R0ZA 5FBVB 3OIUA 4X7RA 3TDNA 2WFMA 5BVHB 5K45A 5SYMA 5BXYA 1OI3A 4H6XA 1EP3B 2D8AA 2JATA 3IKTA 3NYIA 1CIJA 4KQEA 5DGIA 2JD2A 3AF0A 4X63A 3LWDA 3NCHA 1IEVA 1XEFA 4LHXA 2RG1A 3FFWA 4JLBA 5IULC 3DMTA 3V7UA 1KVRA 3FPBA 2Z2ZA 3RIMA 2X14A 4XW2A 4MQUA 3VOAA 1CIVA 1RXSA 3VR3A 3GFRA 4NXNB 4MYCA 1OAOC 4FHCA 5DASA 3EEQA 5K8LA 4DRYA 2ACVA 3OC6A 2Q5IA 3L46A 3GU3A 1KKLA 4XYEA 5MHTA 4NICA 3CLVA 4B7CA 2A57A 1K68A 2PMFA 3KTOA 3IIMA 3VPBA 1C3LA 2V58A 2XRMA 1DKRA 3MT0A 2XT6A 1QP8A 3QUTA 1GZ7A 3JQAA 3RUAA 5B7NA 3GQVA 1L5WA 2WIBA 4KN5A 4KMOA 3LPNA 5DNEA 3USCS 3TWOA 2HGSA 2IZ1A 5JC1A 1RJ9A 3A06A 4YJKA 2E1PA 5HKAA 4FWIB 4Y1RA 5AM1A 3ZWAA 1KFEB 1XLVA 2QV7A 6PFKA 4JEHA 1ZH8A 2YOGA 4JB3A 2XGOA 3C5VA 1DKOA 2Q41A 3DE7X 4JOBA 4U7FA 4URXR 3L8EA 2DHQA 2QV0A 3GCGA 1GUDA 1ZIXA 5ECGC 1FNBA 3HGMA 4C2AA 1GUYA 1R9JA 2D1YA 4ZP1A 4RV5A 2RBGA 3K8ZA 4QUBA 3USZA 1WM1A 4IZIA 3DSRA 4ND1A 4WEQA 1T3LA 2GHTA 2IYVA 3GVHA 4CQMB 3KYCA 1NE2A 1P8JA 2NQTA 2BMAA 1DKMA 1SXJA 5EIWA 3QV2A 3OI7A 3T3HA 3P9QA 1V37A 4CLXA 3H2YA 1VLLA 3N6RA 4BC1A 1FUUA 1BS1A 5E1MA 1ORHA 1YAHA 4GBED 5IM4A 1N2JA 1CUBA 1PQPA 1ZM9A 3F7OA 1USGA 1Z33A 3ETGA 4IZOA 4JJKA 4BYMA 5J63A 4CIDA 1Z4MA 2N46A 1V5EA 3I04A 3KTAA 4A9AA 4DDUA 1E2KA 2WNIA 2OECA 3C0KA 4N40A 5L40A 2JK0A 3HPQA 4WNIA 2BM9A 2UKDA 3ZHSA 2FRDA 4M6WB 5BSVA 4L2IB 2FFAA 1V3TA 3TG8A 1W4AA 1ZG3A 5K4HA 3VYRB 1KEWA 5BN3A 2P9FA 4DLVA 1OZFA 3PC7A 4UCQA 1USIA 2ZWPA 2IVFA 4H7JA 3V4PB 3C3YA 2XB8A 1Z3CA 3T61A 4RZIA 4XPIB 1S1MA 1OAAA 1PU2A 1CZHA 1KR5A 4RGQA 1Y3AA 5B3AA 2I2FA 1C7FA 4GH5A 3FMGA 5G0VA 1R6DA 3Q40A 1W5SA 1ES9A 2VT6A 2FA9A 2P75A 4UVIA 3HBNA 4DZTA 1NBEA 1CUJA 4UM5A 4AO6A 4QOGA 3FCXA 3GFTA 2DKNA 3RFXA 4EM6A 1F38A 1M1ZA 1UKAA 3PTZA 5IU6A 5GP1A 3TUIC 2WG0A 3OZ7A 4NBSA 4EHAA 1MF7A 3BWVA 4X6YA 3TEJA 1C3OA 4MQFB 4LTDA 3ZKWA 3GRPA 3TUZC 4BDSA 2FMUA 1N4DA 3I4LA 1JEYB 4DDHA 1AM4D 1D7OA 4OA8A 2FPPB 1AXEA 2AKYA 4S12A 3TVDA 4B6PA 1NXWA 1NATA 3B1VA 5DB4A 1OASA 5HQ3A 4PRLA 5TQ0B 1PL0A 1W46A 1Z63A 1ENOA 3FSJX 2BZGA 1ONOA 3BWDD 3PTLA 3NWJA 3BQMB 4BNZA 2WUVA 5FLXA 2AJDA 1KI8A 2WHQA 3WL8A 3CRNA 4WUVA 2YFYA 3HY4A 4DR4B 4PGGA 4EGFA 1WU7A 1BKYA 1P1HA 4IX1A 2OHGA 5I47A 1ZXXA 4ZOAA 2BF4A 1JL3A 1FLNA 1QGYA 1GQ2A 3H9JA 5CXXA 4U00A 1G8AA 4XLTA 4BGVA 3PPVA 3QMPA 1IZZA 4U9HS 5JCOA 5REQA 3WE7A 1NV8A 2XV1A 4JLOA 4HI0E 4KVGA 1TNDA 3GFBA 4LZJA 1M7GA 5E9JA 3WGZA 1GKYA 1ZICA 4H6WA 5D8DA 1IBKB 1DEXA 1VJGA 3W5AA 1CJUC 3EIUA 2ZAOA 4MP8A 4JJIA 4UZEA 1UJ5A 4XGQA 1C9KA 2O8VA 2OD7A 3JTEA 1I5RA 1VE7A 3ENVA 3I0ZA 1XQ6A 3OM0A 4H1UA 5LA6B 3VYTB 1R8XA 3TSCA 2SBTA 3GCZA 3SS9X 3G0IA 2G25A 2HQBA 1ZJYA 3FY4A 5AVKA 5KVQA 2O20A 4AECA 5KVCA 2P3SA 5TLSA 1OB2A 1KZ4A 4WA8A 1X42A 3KAKA 1WF3A 2IS6A 2YHAA 4I4TB 2AR9A 5HW0A 5CCXA 3PYXA 3ELBA 4XTCS 4MS1B 2ZOSA 1YOVB 2XT9A 4QWMA 3UICA 1T5BA 3GZNA 5LQSA 2IY9A 3DEKA 2E87A 4RZQA 5KS2A 2ZXUA 4LC0A 3KUUA 4MQ4A 2J85A 3D6UA 1G8SA 1JS1X 2VAMA 3TL2A 3X1JA 5EHGA 5I4IA 5JZMA 1MB0A 3SYKA 4KR2A 3ZCVA 5B2ZA 1SBHA 1Q74A 2I4NA 3FDFA 3DNPA 3H1AA 3RTEA 1XZDA 3VX4A 4DLRA 1FFAA 1TUEA 2XI4A 2QE6A 4I9NA 4M9RA 4EBFA 2J6IA 1UODA 1Y9JA 3RSQA 3K70B 1CUCA 4TYMA 4L85A 2P6NA 4IUDS 5TX7A 1VBMA 4LGMA 2OL4A 1ENYA 5A5FA 2H4ZA 1GUAA 4TLDA 3S2EA 1ML4A 2NO5A 3CF6R 2G17A 2G1UA 1QQTA 3WRYA 5C5EA 2WJ4A 2PZGA 4ISBA 2Q1TA 1YI1A 3WA6A 1CEQA 2I2BA 4WOCA 3OFNA 4CCWA 2V0NA 1PZNA 2CJPA 2EJCA 4L9AA 1B8PA 2PKQO 3A3PA 3G88A 3CH6A 4BASA 4EA8A 4W9MC 5C7IO 4C14A 1RHUA 3TRJA 4K9KA 5EYPB 4B6GA 4MVJD 5K2OA 1UT8A 1ZI9A 1GLNA 1YCHA 1QKIA 5FFNA 5TMDA 1NJ6A 1G16A 1QYWA 4KX5A 3WGIA 4LVCA 3UH1A 4W5JA 1FXSA 2IXGA 1CDDA 2WLSA 2Y76A 4ZYUA 2VEDA 2WU8A 4J6FA 5ENDA 3LBNA 1WZCA 1C9JA 4XGRA 4UAUA 4G2TA 3FM9A 4QQFA 4J90A 1DQSA 2HWKA 3N6XA 2IBSA 2JFVA 8OHMA 3N2GB 2RI0A 4E5YA 4LVOA 1HBJA 4YCSA 4MIYA 1NI3A 5E3JA 4A8JA 1YT5A 1MEEA 3A6HA 2PPLA 2XZPA 3RCBA 4AY4A 4W5QA 2WKSA 3QVGA 4BWYA 4IEIA 3KO8A 4B4DA 1MXHA 2V6GA 4XH9B 1T29A 1XRMA 3L6RA 3TR0A 5MN5A 1HV8A 1BXRB 1Z6AA 4B6RA 4JMPA 1PJAA 3DAFA 3HCDA 3UJ8A 4WXEA 4WN9A 1GTJ1 3UHFA 2K6GA 3FR7A 4DXAA 1E0SA 1WR8A 4CDRA 1G7RA 1GDHA 3G7SA 4AJIA 2YOHA 1WAMA 1CJVC 2O52A 3ADPA 3KVRA 4KEAA 1QK3A 4GR5A 1S96A 4V0KA 1JIKA 4HTAA 3JQQA 1ZHOA 3M49A 1C7RA 3RK4A 1PNOA 1G3UA 2RHHA 3KR0A 3UJ6A 1WHSB 1GKUB 4V0OA 1QB7A 4V0ME 4M0UA 4ZI7B 2P5UA 4RUKA 4MVJI 1WBDA 1A7AA 2AJTA 5BSKA 3FKSD 2HPVA 4LJ9A 1ZGJA 1Z15A 4A23A 1XELA 1MB2A 1SEPA 1JG7A 3PFGA 4LJSA 3E82A 3KB6A 4JT4A 5FA5A 2HDNB 1YZGA 4ZKDA 1YB1A 3NBFA 1O77A 2XB9A 4MJ7A 3NBMA 2VPYA 5EJ9A 1FVXA 3F6SA 1EGMB 1GPAA 3FCYA 2BJHA 4MDYA 4P92A 2BYTA 4ZU3A 4LFAB 3VPGA 3B7PA 1FNNA 3DBHB 2A78A 5AVXA 1B42A 1C80A 5CA1B 3ORRA 4U39A 1BJKA 4O4IB 3IPCA 4RJ2A 2XQGA 4HJRA 4EF5A 5DM1A 3VV3A 4CUZA 2MWMA 4NH4A 4OQXA 2ANCA 3O1LA 3PHGA 1Q7RA 5B6PA 2WM8A 3QPAA 3NOQA 3PHCA 4LOKA 1S1CA 4NBVA 2I3BA 4P3YA 1YB4A 3ZZ0A 4YRKA 3TLCA 3UAWA 2RHRA 4CL3A 1NLUA 4V1CB 1VQ1A 1YVUA 4CMAA 1ZK0A 1KFJB 2HIGA 2QRVB 1HE2A 4UNQA 2NO4A 4PFQA 1EB8A 2CY0A 1TUBB 3Q9SA 4XCQA 5CPFA 1GN9A 4YLEA 4EHFA 4PIVA 3PUZA 1RAHA 4UBNA 5HJ5A 1URPA 5DF1A 2QN1A 4JI4B 2QUIA 3GAMA 2VYQA 2VCHA 2B1GA 4CIBA 1OFIA 4V3CA 4P0TA 4MRPA 5J2TF 5EFOA 2XRZA 5KCZA 1TQ6A 4UU0A 1HETA 3EAQA 3KYIB 3FYUC 1FFBA 1SUWA 5HKBA 1HTBA 4M8NE 1X7HA 4B8YA 1QKJA 1RQGA 4G97A 1QLWA 5CTAA 3AXTA 2I33A 4IIYA 4RLSA 1TYDE 2JIDA 2Y66A 3TQQA 1EWRA 1E6UA 4UOZA 5HCNA 2WU3A 3QKWA 3I1IA 4YT5A 1XFDA 3WI7A 2ACKA 5CT8A 1GFWA 1MXFA 2XNCA 3FBWA 3GJ0A 1TT7A 2BKEA 1OXSC 3QVMA 4BZXA 2P4EA 2B3TA 1LF5A 5H3HA 1MC5A 1N1MA 1L9KA 2R8ZA 3CSDA 1QVRA 4K40A 1DC5A 3D6TB 2PNJA 2A9RA 2IIBA 2AMVA 3O8OB 4Q01A 4PYRA 2AI1A 3FAZA 1VBKA 3I58A 2UYOA 2QUKA 3UJAA 3MD0A 5JS2A 1F6WA 5DE3A 2BGWA 1E1KA 2OHFA 4FQ7A 4W7SA 4EZIA 1OWOA 2W2MA 4GPEA 4K0KB 1B73A 4ZOCA 3RYIB 2P9QA 4FP9A 4M9QA 1OXUA 3IX7A 1Q1AA 3FJ1A 1ZVKA 1YUBA 5LKAA 4Q1FA 1A27A 5B1SA 4OB6A 3EUAA 1T2NA 1SVLA 3KPYA 3E23A 4JUAA 4REQA 4GMHA 1GFSA 1PWZA 5FWXA 1C9YA 3ZHZA 1D0SA 4DA4A 1UXGA 3JQGA 3CRVA 3RUIA 2GZ2A 5F78A 2WWYA 2VHXA 3BTOA 3IOMA 1TJ5A 4ALLA 3SICE 3UWKA 4D8VA 1I3CA 3VVCA 4RGBA 4L7QA 4YJ3A 5CYPA 2CL7X 1LLDA 1UP6A 2VH1A 4Z51A 3JWEA 1PQWA 5FBKA 1I2AA 2B61A 4CG1A 1YZNA 4NMLA 3RUCA 2ZQYA 2Z5FA 1C1YA 4XYGA 2OZLB 4L5IA 4YX9A 1N3YA 3MWJA 3Q41A 1JHQA 2O4CA 4U02A 5EZQA 5KKAA 3TNYA 3RYFB 1AQYA 4RY0A 4S0XA 4W6QA 4WCDA 4RY8A 2ODAA 5AVSA 3CUUA 5I48A 3EWNA 5D5PA 5EXDA 3R74A 1N9GB 3CEHA 2JJ8A 3V97A 1IU9A 4KBGA 3TECE 4CIXA 4I55F 3VYVA 5HBGA 2NZ8A 1G6Q1 5JY1A 3O38A 4KE8A 2IV3A 3P0FA 4B3CA 3A6KA 4RZ2A 2C1EA 3SSAA 2EWMA 2WABA 1JWLA 3SD7A 1D3AA 3OLWA 2H3EA 1KJ8A 3P1JA 1KWGA 1GNVA 2EJUA 3H4VA 1AUPA 4DB4A 4QYMA 3REOA 1VYHA 4YQYA 1O97C 1QC5A 1YS1X 2OHVA 3K0FB 4F9EA 5DCUA 4E09A 4PC7A 5JECA 4WASA 1AF7A 3D1VA 3K92A 4GZ5A 4RSHA 5IC5A 1D0IA 3IXMA 1NOIA 3Q9UA 3KQUA 4U7HA 3OESA 4I50A 1S01A 4MI9A 2Z3ZA 4O4JA 5EIAA 2RIPA 2XUGA 1W4BA 4MS3A 1P18A 2JZCA 3HVHA 5CDUA 1V95A 2EYQA 3HBLA 2X4GA 4L4SA 1PO7A 2XMZA 4A36A 5GGYA 3ORSA 1RBZA 4LI0A 2ZBVA 1WXEA 3UT0A 3PNKA 4Q3BA 2QSZA 3AETA 4LFBB 2HB6A 4Q3KA 1SVKA 2QR5A 2W6CX 4OSOA 3S2YA 3LKDA 1OA1A 4JLKA 1RC8A 4HZGA 3ZK7A 2FVXA 3AFMA 5KOIA 5MF6A 1P3DA 3VMMA 2COEA 2QM7A 4X94A 4ZC1A 2ZBFA 4MAFA 2IITA 2HZ7A 2J9XB 4B48A 4GMXA 2VDOB 3GROA 4TVOA 1EAMA 3GDWA 2ID8A 2IK8A 2JHFA 3M83A 5JRZA 1FNDA 3H9UA 2CUKA 3CE6A 3ODGA 2DH5A 1AQJA 4P84A 1T36B 2MYUA 4L76A 2CYCA 2O3SA 4XM0A 1J9EA 1I3LA 2IYUA 1IG3A 1RXIA 4W8OA 3L9XA 4WZ6A 4C3ZA 2E1RA 2I54A 2Z8XA 5HMMA 4DWOA 3HXKA 2ISSD 1DIGA 2YJGA 1NM5C 1V4BA 2PSDA 5CT6A 2E4AA 1TZMA 5TT0A 1KK3A 3I4CA 3ZWQA 4ESEA 4MICA 3QU9A 2QJWA 3ZC3A 4DSAA 4BLRA 1UF9A 4JAVC 2YIDA 4JI2B 3OLYA 3WKDA 1Z16A 3W8EA 2H8KA 4IL5A 5E3HA 1KDYA 3SVZA 4OYRA 1DUSA 3KOZA 4F3KA 4BPBA 3ZJUA 2O8BB 4F91B 2JG3A 2XT0A 1N6RA 4TROA 4Q4HB 3V7NA 4D0NA 4XWOA 4E5MA 5CA0A 3GGJA 3UT6A 3CH5A 4WLFA 4G1MB 4P35A 1LB1B 3LSYA 3QWHA 4E2ZA 3B78A 5JSZB 4EY8A 2OV3A 5AI9A 5KSWB 1V7QA 1DO8A 1RKXA 4GRDA 1BEEA 1U1FA 4G2NA 3VR4D 4N12A 5F1PA 3ZJVA 2C4UA 2HK6A 5JYBA 5BW5A 2XYHA 1OX4A 1RQRA 1YQEA 4QPZA 3ZXUB 1KOLA 3RRYA 1U0HC 4M46A 4QYIB 3CO0S 2E48A 2M9MA 5JSHA 1F2UA 3D5EA 1BN6A 2XWBF 3JZMA 4MLPA 3Q3EA 3F1KA 4IIXA 4Y7CA 3TZLA 3UHAA 2MR6A 5KMGB 1EGVB 1GG9A 1GU1A 2QRGA 3OP1A 1TCBA 2I87A 3OURA 3TZCA 3WNCA 3LHIA 2R86A 4HXGA 4PZPA 3GYBA 3LUCA 4WIAA 4Y2QA 4EECA 1EXVA 5BN1A 5ILQA 3OZTA 1AA6A 3WYEA 2ZCUA 2PLRA 2QRUA 3C15C 1UIRA 4LNHA 2IUYA 2MIIA 1ZCFA 1GV1A 3RANA 3U1BA 1K8YB 1E2FA 3PHJA 1XTJA 1GTZA 2YWXA 3G0CA 4K6CA 2YHIB 3WK4A 2KB0A 3UK0A 1S2DA 1KVSA 3S0JA 2IWRA 1PSWA 2H0QA 4N6OA 1VKJA 3AEKA 5IBRA 3LHFA 4UE2A 4ESOA 2CB0A 4JJ8A 1H2RS 1FIUA 2I8LA 3JQBA 2FVYA 2HHLA 5ICSA 3HPRA 2WUGA 1KOFA 3TIIA 3WLHA 4IV5A 2IZ7A 2I03A 5IM5A 2Q6KA 4KHPB 2OXRA 2R7MA 3DOJA 3P2JA 5AHOA 4FYIA 4HVTA 4GGPA 2MINB 4K9LA 3QSGA 1JR3D 4C4YA 5E0KB 5KYKA 3G9ZA 5HRAA 1EP9A 2OGZA 3CKMA 3HACA 4K6HA 2X0EA 3VGPA 3ABRB 3I9OA 3TTUA 1E9DA 2VP2A 3CJRA 1TAUA 2XWPA 4D79A 5EMMA 3R41A 4TUYB 4YO7A 3PGXA 2OHIA 2AKEA 4ZVUA 3RABA 2XVZA 3F8TA 4QDTA 1GNSA 3V2GA 4BWGA 5HSGA 1PD0A 4F4FA 5KYYA 4F0JA 1NVKA 3KHTA 4PQEA 5HKOA 2BEWA 3EGOA 3OZSA 4BFCA 3BK2A 5LP6F 2WSYB 1FFWA 3WWPA 4EHDA 1TECE 3VTAA 3FNFA 3ZVLA 5F2NA 2FF7A 2VH2A 1K7FB 4X7PA 1FX0B 2Y8EA 3G23A 4FDVA 1U8AA 3L1HA 2MMGA 4L5JA 1JFFB 3ZR4B 4ESHA 1MC1A 1AG9A 1GNPA 2BN4A 2F67A 1ACLA 1OC4A 1ZH0A 2D7CA 3TAHA 1DIOB 3V6LA 1I36A 1X7YB 2E3JA 1FS6A 5KSPA 3MUEA 5E38A 2A88A 4JR1A 4XTRA 1X7WB 2QN9A 3K31A 1LBQA 2HGZA 3QE3A 2OO3A 4IJ6A 4ITUA 4NFYA 5ALHA 4YR7A 1L5ZA 1SC1A 1X2BA 3HXLA 4HPXB 3ZCSA 3DV0B 2YWCA 1VCIA 1DWOA 4DARA 5LUBA 1N8SA 2ZTVA 2V8BA 1XCBA 5BV8A 2D06A 1WKVA 4AMVA 4N76A 3C1TA 3LA8A 4BB0A 4IXWA 1JH9A 3N2IA 1ZISA 1B43A 3QLTA 5GIPE 4M7RA 2ZYWX 4MI3A 4YC7A 1J8QA 1PGPA 1P5RA 3PGMA 4OKSA 2H2DA 2WUDA 1Q77A 3HCWA 1E1LA 4GL4A 2J0UA 4CMIB 3RRZA 4WFKA 1VP3A 3NHLA 1L1QA 3CNEA 3KOYA 4M38A 5C1DA 4N7RA 4EG0A 2CVOA 5FL7D 4JBXA 2VNJA 3WLAA 2OCIA 3K35A 4E0BA 1XDBA 2AXQA 2PD3A 3K8QA 4Z99A 1TKAA 2Q50A 3JPWA 4OUDA 2CYAA 5KJCA 2XOKD 2XSZA 3GI1A 2WHPA 3W5HA 3OPYI 2QVXX 4S1OA 4UW9A 4Y9TA 3R7FA 3WIUA 4JA2A 4YYZA 1T34A 1UBUS 4JP1A 1GFZA 2QKYA 3ZEIA 3HGQA 3WBBA 4RTKA 3C3JA 1EUDA 4RIGA 3S2SA 4XAQA 5FTMA 1UBHS 2OD9A 2VXYA 4EHBA 5KYTA 5JCXA 3GNQA 4GPAA 1KJIA 1RHQA 1X3LA 4NJEB 2P2LA 2Q3JA 1XI2A 3SZ3A 2B94A 3WK8A 2XB2A 1FMJA 3SHWA 4DLWA 1G20A 3QIAA 4FFOA 1ISSA 1M7BA 2IU6A 3OQPA 3SR4A 4RD0A 2PVCA 3LO8A 4DMFA 4ILEA 3HYNA 5ALVA 1DHRA 4IRUB 5JR3A 4G1UC 2WFLA 5FLEX 5B55A 3INTA 3OO1A 1QGED 2NUAA 4I9FA 4JLDA 4GOJA 1IY2A 5JHGB 2C58A 4K3VA 4QBKA 2ZE7A 3AY3A 4FHGA 5EPEA 3LXXA 4JZYA 4BN4A 4EVIA 1MC8A 1JDJA 1RMYA 3OE4A 4ZVMA 4KR9A 3TR6A 4WBNA 3R7AA 2EZTA 4RA9B 4QM7A 2GCGA 2I78A 3FWYA 1EU1A 1Y8RB 4PAMA 2AOTA 1ODIA 2P2YA 3SJBA 4C3OB 5DBFA 4ENQA 3SLKA 3D2CA 4KI7A 4WACA 2FQWA 3EH1A 3WWDA 1E5QA 3IIJA 1T3GA 4J7XA 4DYDA 1P4JA 4DLNA 3F73A 1N78A 3K0SA 3S1SA 1F9EA 2HWWA 1U2EA 2PKQP 2VDVE 4MW9A 1Q7BA 1D5CA 1QRRA 4PNEA 3LECA 4HRAA 1GR1A 1QHSA 4LBZA 3CRQA 3VR5H 2R7AA 3KD3A 3UMCA 1EWQA 4G4SO 2FDRA 1E3QA 3S28A 5A3RA 3IMKA 3GLQA 4YRJA 1RABA 3G9XA 4RM2A 1E6EA 3COVA 3T7EA 2PIAA 1JG1A 2CJWB 3O3MB 2XKKA 3GGCA 2RH5A 4WOKA 1W1WA 1NASA 4R1LA 2FSUA 3G8YA 3K0CA 1WQ1R 3E2PA 4J2HA 3U26A 3R7BA 2EFEB 3OFKA 4OVKA 1LVHA 3INGA 3HXMA 1VM6A 5HRCA 1GQQA 4RTRA 1DDGA 2H1VA 4G26A 1FLVA 4C4XA 4IICA 1M8GA 3FLMA 4GI2A 1WDLA 1J1IA 1A77A 1MNAA 1E9EA 5CB4A 5IPFA 5H16A 3S2GA 5LQJA 3MS2A 1J39A 1OSNA 3PA8A 3IO3A 5L3VA 1J42A 2HSZA 4CLEA 2B3DA 4RTNA 2BGIA 3QF4A 4H2DA 4WGGA 1K3TA 2QQEA 4QGSA 4Z7JA 3P9YA 3RGGA 5AM3A 4KE7A 3GLUA 3LL4A 2P8SA 3D3NA 5EKTA 2IQIA 1L5SA 2J7PD 4Q1EA 3WRXC 4Z4CA 3DTVA 2YW2A 2JVIA 4TQAA 1LS6A 4E4TA 2QDKA 2VBFA 1COZA 3ELYA 3RRBA 3LDGA 2XCSB 3FHLA 4CM8A 3KKEA 3HCBA 4DKXA 1WVMA 1K97A 2AC7A 1OFVA 2YHSA 4FGKA 1K4KA 2J3LA 2V5UA 3VZDA 3ZXSA 2JJ2D 1C8LA 5BWMA 1E2QA 1Q7EA 3WWYA 5KNCH 2NXNA 1Q7GA 4OAQA 4R8KA 3CUWA 3K2QA 4TQUS 4QNNA 4TZTA 3RD5A 1IMJA 4RK0A 4A0RA 1QO0A 4Y9UA 2CXRA 1J0BA 4GF5A 3WL5A 2X1MA 3N1UA 3BIOA 5I7SA 2IXTA 4GX1A 1ULBA 1TAQA 2XNHA 3EUWA 3DYVA 3QKSA 1A7UA 2VKQA 3AF5A 2BFDA 5D86A 2VWHA 1VHWA 2NW6A 3U0VA 2F8TA 2BBWA 2WAXA 3IOCA 2P6RA 4N7JA 2FFQA 5DBEX 5IJ0A 1NTOA 2YIMA 2ZUBA 4Q93A 1DEOA 2EP7A 4C87A 1JBEA 4Q3OA 2IHYA 2QX6A 1E2IA 4ZU1X 5K8UA 2YJ4A 3EYWA 4PSDA 2OQVA 2KI5A 4G07A 1SIUA 3EDRA 1G9SA 2GZHA 2QP3A 3D4IA 1YS6A 3ZW9A 3KWLA 3ZI0A 3DMGA 3IDZA 4RKYA 1CUXA 4F3CA 3S27A 1JHOA 4OHBA 2C4NA 4C9BA 5I8ZA 4AS1A 5CB8A 4UUQA 1CRLA 4KPUB 4GMDA 1KQ3A 2ODQA 4DDMA 1MFZA 1PJ3A 3KSBC 2N1MA 2UZAA 1GYPA 2GMWA 2JCBA 1LXCA 2D5BA 5AWFC 1G8PA 2DJIA 3H0KA 1JKMA 2HCRA 2ZB3A 4WLUA 5GV7A 2DQ4A 2FRVA 2XXAB 4RVNA 1A1VA 3IV7A 4L5BA 5F4BA 3HDHA 4X95A 1ZUNA 3OQNA 1HE5A 1CS4C 4YUAA 4O2AB 2YFHA 4HUJA 1CCWA 3NORA 4E5DA 5ED0A 1YA6A 3CVWA 1YU9A 3L02A 4LV5B 1LCIA 4BUZA 2N3ZA 1CHNA 3KKOA 5ECYA 3DVSX 1XL0A 3L8CA 5AKIA 4MCIA 3ISJA 4QGAA 5G0TA 4P3NA 4EIWA 1EFHA 1YFLA 1KY2A 2GM9A 4HYYA 3CIFA 1HQCA 1RWWA 1XTIA 2H2AA 2QMOA 1ZOSA 4NENA 2GCNA 4OHWA 3KLBA 1ZUIA 821PA 3I45A 4D6YA 3X2FA 2BI8A 2XLCA 1YRQA 3FVTA 3BS4A 2WF7A 5TDHA 1G6HA 5EMKA 2GFHA 4DYHA 3LRXA 4V3BA 4KLNA 1E9SA 4DA0A 1ZXLA 3IH5A 1ATZA 1YE3A 3MJRA 2G9UA 3QLJA 1EDEA 3RPEA 2WKQA 4ZV4A 3WGQA 4BNKA 2RHTA 2IHVA 2PKYX 3QP9A 1BCSB 1LPNA 3JASB 3IODA 4TKVA 4XFDA 1XYYA 5CLHA 1E2LA 1O94C 5JG7A 3TO5A 3KALA 2OENG 5G40A 1C7QA 3TF5A 3NHAA 2XUIA 4FGWA 3RM3A 3W4JA 4BO0A 2P0EA 2O2XA 4FT2A 3IUYA 3EVGA 3OEHD 3ZK9A 3KPWA 5LYJB 3P9CA 1R9NA 3NANA 5LIRA 3I72A 1M1YB 1EDDA 4ENVA 1QQBA 3DD1A 1IRXA 2P77A 5ESWA 2BI4A 4RENA 4KWCA 2O0JA 4JLWA 4B2LA 1NFQA 1P6XA 4YT8A 2I65A 3BHJA 1VFNA 2OV8A 3SHQA 5ES4B 1R0BA 1VE9A 1IEXA 1YS9A 2PGJA 5H3CA 4EGAA 4MI1A 1VIMA 2FPOA 1JSLA 1T5OA 5JDCC 2YVKA 2E4XA 1PFUA 2WU0A 1DOZA 4N0MA 1Y1RA 1OLOA 3A0RB 4CM1A 1ZR4A 2DHCA 3DNFA 1O9GA 3OLXA 1ZESA 3CRZA 1L4MA 1N2CA 3O4GA 4FR2A 3V1MA 1SCAA 1G8KA 2PBZA 2ZGVA 1U2DC 1YBAA 4JITA 4PANA 5JHHB 2Z04A 3I3SR 4GT1A 3GRAA 1QYXA 3RAGA 2O57A 1JDVA 2XA9A 2ZTMA 3E1SA 3NM6B 3QMWA 5BSHA 1THGA 1X1EA 4FCCA 3DFZA 3TZHA 1FZQA 3ZS8A 2WYWA 2CD7A 3FHOA 4BWVA 1ISMA 3UANA 1G5TA 4MIOA 4DQXA 3TZBA 4W5RA 2EGHA 4UBOA 5IBQA 2YS6A 3VTKA 2CLIB 2ZSJA 3EE6A 3TTVA 2Q6TA 1EX9A 2DBZA 2ZBGA 2WP8J 3MZ0A 4TRMA 4N47A 5D87A 4EW3A 4N4AA 3KEGA 3CISA 3NTVA 2J08A 4FSXA 3P9ZA 3U44A 2REQA 5HTOA 2ZQZA 5ELXA 1JFSA 3D3QA 2IEBA 5FNVA 2K7FA 3RODA 2BCJQ 4MKGA 1MOQA 1TZKA 3MCUA 2OBYA 3NEAA 4P38A 5IS2A 4UDNA 1QH1B 1WG8A 3P71T 3E0XA 1L5NA 2V9PA 5BYAA 5JNUA 3HKDB 3MJVA 1GCAA 2CVQA 4NX2A 4EJ6A 4K6FA 1CR0A 1ZKMA 2YRWA 5JJCA 1G19A 2FWIA 3NHUA 3FCCA 1PNQA 1XJ5A 1LLUA 2JLZA 4OLFA 1OV4A 3SS7X 2HSDA 1AGNA 4NOJA 4D02A 5CFMA 1C8VB 1PFVA 3FTPA 1QPZA 1VRCA 3TB6A 2C0CA 1N6OA 4RWEA 1LNZA 4GO1A 3GJ6A 3SZUA 4B3FX 3ORFA 1JMVA 3OE5A 1G64A 4OXKA 4CM9A 1CQXA 5AXBA 4JDUA 3SK0A 2A35A 1KH3A 4JELA 2FCAA 1QHNA 2D8MA 1YZVA 1H2WA 5B4TA 3ZDDA 4P6VF 4IXMA 1C5KA 3ETNA 3LT5A 1XKQA 3EEBA 3LD9A 5HZGA 1KS2A 1VYUA 1RD4A 2B8WA 1VMEA 5DLQC 1Y8AA 3KRTA 2P69A 3KWMA 4R1PA 3NPAA 4R1UA 4B47A 1TD1A 2W6ID 4R16A 5LJLA 4HSGA 4J2OA 5LXTA 4O4LA 2GZDA 2PAAA 4QASA 2YNMD 4I8DA 1WZIA 3PDJA 3E6AA 4W1PA 4WKOA 1OOEA 4NE9A 3VR6D 1L8OA 2CLKB 3RIXA 1E1YA 3JARB 5BRJA 2PUBA 2YJTD 4HD8A 5AKYA 1YDEA 4R9SA 3F5DA 1KU0A 4MRAA 3M1AA 4MIKA 2AMFA 4Q37A 4Z2YA 1N5IA 3PJDA 4DE5A 2YWHA 3ENKA 4GNKA 521PA 1NXVA 3FBTA 4RDIA 2YWEA 5G4KA 3OF3A 4IAOA 2ZRCA 3UMJA 1M2WA 2OUKA 3JD3A 1J21A 2ANBA 3QUAA 1NW4A 4URZR 5E4FA 3CNLA 3ZDEA 1JN0A 2WD7B 5COBA 3L8HA 2XUAA 2ZRHA 1SUEA 3NP7A 3WJ2A 1WZ2A 1QG4A 2HJGA 3HHEA 2EKZA 1A82A 5JPIA 5DGTA 2ZSFA 4I5FA 4BVFA 2JLXA 2AN5A 1PWXA 2QR3A 4X91A 4BFYA 4EGJA 4PFSA 1FC0A 1DRKA 3Q7IA 3W9BA 1PJBA 3PNOA 1KI9A 1LW6E 1F4PA 3DE0X 4Q4AA 2Q28A 3GQBB 4B9EA 3IAAA 4I50F 4BMZA 2A5YB 4BRWA 1ISIA 4O4JF 1MQSA 2H08A 3DDHA 2Q1WA 3BDIA 1JTEA 2PU7A 1WUTA 5BVHA 2KX7A 3RARA 1RBMA 4DR2B 1ESCA 3O75A 5CM9C 1W88A 1UDWA 3JQ8B 1I1HA 1PFGA 3DMTC 4GKVA 4E70A 4EHKA 3TPCA 2QN2A 3RU9A 5JY6A 4N48A 1F17A 3DP7A 3BH6A 3PC2A 1OLXB 1E60A 4AP9A 3JW8A 3Q8XB 5AKXA 2P65A 1HQDA 5AOAA 4CKZA 2VSYA 1O1YA 1TMGE 3FYDA 4GICA 3H42B 3NEPX 1LBIA 3L8MA 1EVYA 1WCIA 5CFNA 3G0GA 2NZYA 1E8MA 1U8TA 5DH9A 3AHIA 2WJWA 4HDRA 5THKA 4UNRA 1F1BA 5L3QA 1SUDA 1R50A 3T5BA 3TGPA 1VL5A 2ATVA 1CEYA 4NSNA 3RSHA 1B2RA 4YRQA 1XJ0A 1QSGA 5C4MA 5IVHA 1K06A 4P3XA 1CW2B 2CMKA 2QZJA 1SVIA 2FDCA 1GZ5A 2GK7A 5KU1A 1RXVA 4EY3A 1XNQB 4EB6A 1P9WA 4KK4A 2Q5LA 5AI5A 3NHWA 2P9BA 5KAPA 3ZDFA 3LT0A 3F9RA 1J9GA 4TKUB 1TQDA 3K1TA 2A1TR 3NBKA 1KZ6A 5C0OE 2UXBB 3B8EA 1K7CA 2JEOA 2PUWA 3U4CA 1SXJC 2X2OA 3ZCXA 1OZAA 5JALA 5FX2A 1IBLB 1BU5A 3BJMA 4X3PA 1NZJA 4CNBA 2OCGA 1ZN9A 2FMKA 2K7ZA 4DBLE 3ZWMA 3DFIA 2CD9A 4HGZA 5FOWA 1E5TA 2I6SA 1RWNA 3MAAC 3V46A 2VO1A 4JIMA 2NNWB 4EQ6B 2DUMA 2VRCA 3DDWA 4ZAFA 3QBDA 1SBCA 4I8IA 1O0CA 4E08A 4M86A 3FVVA 2OLKA 2J7KA 3I2HA 3BAFA 3VO8A 1Q3HA 1U7OA 3NEJA 4IWXA 2FMFA 3U62A 1F48A 3EIEA 4AAYA 1BXKA 2FWBA 3BFKA 3GJRA 4JXXA 3G6KA 1UPXA 3M2PA 1I1OA 2XNSA 1MP0A 3LBAA 5ALTA 3UGKA 1XXLA 3RWOA 4BU0A 1YQUA 4JEUA 3QLVA 2GN6A 3FB1A 3U39A 3UGQA 3X1KA 1WY7A 2VDKB 3I9V6 3FUWA 3U4HA 4Q7KA 4XLZA 4DMLA 3PA6A 4LJ6A 4J75A 2W4MA 4MROA 1B0PA 3BXGA 1WDKA 3ZTTA 1J2RA 1BFKA 1X9GA 3QKTA 2BFNA 1MB4A 3SNHA 4MV7A 2LKCA 1FTGA 3IDFA 1LZKA 1OIXA 2A3RA 2VBIA 4PHCA 3VDQA 4E1BA 1YKFA 3CLSC 2VTBB 1N33B 1FXUA 4LXGA 1I51A 1OHHA 3R24A 4JKIA 2Q4TA 3W7AA 1R0CA 3D64A 3U4IA 3VBEA 1JYSA 1W9HA 1UXHA 1IXRC 2B4YA 4UBKA 3NIGB 4TWJA 2ZJOA 1XNRB 1E0AA 2MYTA 2CHUA 2VDRB 2Y1OA 1DAPA 2CNKA 4F2WA 3ZU6A 3O6VA 2XBUA 1H22A 5ERYA 4IR7A 4YAIA 1Q2XA 2XZDA 2FWJA 5LLDA 5JBNA 4RHCA 5JD5A 4ZHQA 4EFNA 5DWDA 4Y6SA 4JBWA 1UZLA 1AKUA 2VCYA 3C6QA 2QXTA 2CEAA 3D59A 5JCOC 1W2GA 2MMCA 2Z9DA 3G2QA 3H86A 4MO9A 4MGHA 4RD3A 2HHCA 2HJVA 3GAFA 6GPBA 1FQOA 2RHWA 1PN3A 2CDCA 4IVRA 2OV4A 1IM2A 1UBCA 4EW1A 1JZTA 3L7NA 3LPCA 3G5LA 5DNWA 1NUAA 1JTFA 5A03A 5KDDA 1A3CA 1WV1A 4IMPA 4XJSA 2PZFA 4F45A 2V98A 5BUQA 1R64A 3FFBA 4KC0A 4QHTA 3DF9A 1KEPA 1J20A 4K28A 1OGIA 4OHUA 4P3PA 2V1UA 1IN7A 2UXCB 1DKQA 3I1YA 3WNVA 3RHTA 4G4SP 3U44B 1I7DA 4AT1A 2YFKA 3KUCA 4EKIA 1NZDA 5FKJA 2RGEA 2PCJA 2NZXA 4O3FA 3SQNA 3BG5A 2AH5A 4QNRA 5IABA 5ABPA 2VP4A 3ELWA 4QFMA 2X7HA 3G0BA 2IKQA 4OJKA 2ZUEA 4UOQA 4GI5A 1OFTA 3JWGA 1U3GA 3T3EA 4QC2A 4N39A 3DVAA 4DR1B 3W9UA 4Q21A 3ZVKA 4A0FA 4JI6B 3LOPA 4IQFA 4JGBA 5AICA 4F11A 1DGQA 2QTMA 3WA7A 3W9YA 1MHPA 3FRIA 1E3MA 5H8WA 3ZOKA 1VL2A 3GUUA 2ZW9A 1C4KA 1DMRA 2BIFA 2F1OA 4KZPA 4DIUA 1OBFO 4JQCA 4C0WA 5BV7A 4ER3A 2IEDA 2HWXA 1GZDA 1HMPA 2CL0X 1TRHA 2NSYA 4FFDA 2IHBA 3TQIA 5LB2A 3WGYA 3LDAA 3GPIA 1O87A 1X14A 3F5FA 2ZXFA 3OX2A 2CHQA 3NWBA 3RS3A 3QBJA 3V8VA 5FO0A 2TMKA 5DCYA 2G82A 3CZPA 3NBXX 3URMA 1V25A 2OZPA 3GEHA 3PDIA 3NC1C 1U4SA 4D1YA 2BTQB 1M9NA 2IXFA 4LGCA 2QVCA 2OK8A 3Q7TA 2G1KA 2JGMA 3LUPA 4LV6A 3W3AD 4B3DA 2O2CA 2B8TA 3S68A 3VMFA 1I4DD 2CFIA 1CQJA 1TIBA 4D0SA 4JOCA 1QIDA 1E2NA 4FC7A 5MGNA 3G0HA 3SKXA 4G89A 1IHOA 4RZSA 5JMOA 2O5EA 1E1RD 4DPLA 1X1DA 5LBIA 5LP1A 3STTA 3GNSA 2NU9B 5LIPA 5LKRA 1I30A 2PK3A 1E2GA 1NW9B 2FWMX 1TTQB 3L4EA 1HF3A 2NYVA 3MG9A 2ZRDA 2XNJA 4A8JC 2D13A 3QPBA 1Y89A 2W6ZA 1HTWA 5TVKA 3IESA 2MDTA 1L8QA 1FYVA 1XZPA 2P7IA 2GPYA 3QK7A 3S5JA 1ARZA 3PHIA 3ICPA 3L9WA 4RZ3A 3LLCA 3H19A 4MHOA 3PI6A 3IQGX 3KHUA 5KO2A 1CR1A 1K5GA 2QSJA 1JGTA 4X90A 4CEHB 4YP9A 2IEZA 2PT5A 3A2LA 2FMHA 5TQJA 3EQZA 1Z2NX 5ALYA 1GZ6A 1L8LA 1XNGA 2QVBA 2WG1A 4WDRA 2BDTA 3UA4A 1ZCZA 1AKYA 1YR9A 3FGZA 1MBZA 4FBGA 4FEAA 4JP2A 1S8NA 1VFPA 2ZJ1A 3F6EX 5YASA 4C89A 4F72A 5HOEA 1UJCA 3UUWA 1QM5A 5BWCA 4XX0A 1SUFA 2GN0A 2DE0X 3G17A 4OPMA 5CU7A 1TKRA 4B0PA 1Z2AA 2XGMA 4BC0A 4K2AA 3FUVA 2OYCA 5A4FS 4RNCA 1NVWQ 3AJ9A 4BWFB 3IP9A 2Q3BA 1M6VB 2DYKA 2GN8A 1AKEA 1YR7A 4L6CA 3FPAA 4BZZA 4KGXA 4MR9B 3IV6A 5FXMA 4N54A 1N25A 4DR7B 3PX3A 4JT9A 3TOCA 1GOTA 4QDOA 1GAJA 1VXOA 2I66A 1UZMA 3C7AA 2H52A 4MV6A 1CRPA 2C96A 2PMEA 2IYXA 1KXZA 4IHAA 5ALRA 3RRMA 3GCDA 4D9MA 3T1HB 3CLKA 3HP7A 4ZT2A 1EMDA 2G0NA 2LW7A 5J4LA 2JLWA 3K5WA 3K72B 5JT1A 5EJ4A 4E30A 1A69A 1D1SA 2EIXA 3BT7A 3FLAA 4E11A 1MW9X 4LF5B 3A1FA 2WMNB 2B30A 5F33A 5HCUA 1PX0A 5AW9A 4FIZA 1DFGA 3MFQA 3JVVA 2RGGA 2EP5A 3DOOA 1GG5A 1K2WA 5DPMA 1AV7A 621PA 1A9QA 1Y34E 3MTGA 4KO4S 1GAEO 4RHXA 1B8UA 1ML3A 3I5MA 3TQRA 2H3HA 5JAUA 3L7OA 4XOIA 3RU7A 3O82A 1VL8A 2XHEA 4XEUA 5JS6A 2YCLA 2WVGA 1GTL1 5AW8A 1SUCA 4QE3A 4N0EA 4YWJA 1DQYA 1GL3A 4ZGWA 2PE5A 1V6CA 2FWPA 3K16A 2PSHA 4F6CA 1YD7A 1E3SA 4PICA 1A95A 1CUZA 4GMGA 4Q00A 1SCUB 3TKLA 2I34A 4DXDA 5KTSA 1O2DA 1OYVA 3SXPA 4BRZA 5CLJA 4MLCA 1E79D 2YOFA 5BSFA 4OBBA 4BMDA 2WU4A 4NECA 4QLOA 5KVSA 3USES 1NPDA 3N0RA 3SEAA 5DLYA 1YIOA 4IHJB 2H7CA 4M60A 1SC4A 2C03A 4P93A 4QGGA 4DJTA 2R7LA 3P9XA 4DA8A 4JBIA 4IQ0A 4BIMA 3KJXA 3E9RA 1YV9A 2PGIA 1LW7A 1MPTA 1KEVA 3IVXA 3ORQA 4Z0TA 4OI2A 4LAFA 1CF9A 4EZBA 2CXTA 3PNQA 1H0SA 4I1RA 4AYWA 2CBGA 1N2CE 1UAAA 1BFDA 3DV9A 2C92A 2I67A 3Q6MA 4JOSA 2PH3A 1Q44A 4JP5A 3TJZA 1Y4DE 4ZEXA 3EY4A 2DBRA 1GA1A 4DEYA 4GXNA 4J0QA 4UU8A 3F5QA 3OU7A 5U9CA 4B3GA 4LMRA 2VQ3A 3CLSD 4UC0A 2V1XA 4P7KA 4DUZB 3LLVA 3TNFA 2C2XA 3WIBA 3JSAA 1LI7A 3WZ2A 1F60A 5HS6A 4A5SA 4L8GA 2GYVA 1ZHHA 2JFBA 4ZT4A 3JAMA 1E66A 1KAOA 5I3ZA 1E2BA 2YY5A 3I8OA 5D51S 5AW0A 3IT3A 4Y6GB 5K3FA 4UATA 2C9MA 2VWPA 3M34A 4LC1A 3T99A 6CHYA 4UDOA 4ND8A 1L4FA 4IHQA 4F4DA 1GD1O 4IUCS 4L6AA 3ASUA 4Y1GA 3M9XA 3WFZA 2VJCA 1II8A 3SF8A 3TD2A 5AVUA 5LDDC 1PHRA 4WXYB 1LWOA 1DBVO 2B1IA 3E9ZA 2IU0A 2WQ6A 1QR6A 4PPYA 3VSEA 4HGYA 1FUYB 2ZRJA 1RAGA 3OFVA 3MUOA 3IUJA 1DTWA 2OBLA 3CW2A 3BHMA 3ZV3A 1V7PC 4F92B 2FFHA 4LY3A 2WF5A 1DX6A 3L7MA 5CYFA 1A5SB 4X6XA 5E6SB 5EP4A 3QE2A 1E2HA 2N1BA 3UK1A 1VL0A 1NF8A 2BZ1A 2C2HA 1QPGA 3K30A 1JH8A 3GIWA 2IH5A 3N7UA 5DN6A 5BQOA 1VIDA 2WG2A 5KOJB 4X1IA 4E51A 5KYWA 3HB0A 4LQ4A 2CV0A 1UPFA 1BO6A 3ND8A 5KYNA 3TLEA 4DA9A 1Q0UA 4GUDA 4MR8B 3FKQA 1FTQA 1IJEA 2JI8A 3GEPA 2GS9A 3H2JA 5FPPA 2WVHA 1FF9A 4YT2A 4PYMA 1K75A 3RVJA 2FR1A 1E8DA 4JCCA 1P1IA 3ETJA 2BFAA 2CT8A 4FDAA 2OHHA 2FN7A 2J0VA 2W83A 1KERA 2RKWA 5F64A 4HNTA 3HO1A 1NMZA 1PS8A 2P2SA 4DLTA 1NMEA 2PMCA 1I13A 1M1UA 2HA0A 5LNK6 2HA4A 4G01B 2EFCB 4JJ6A 4HB4A 1KMHA 3HS3A 3PGLA 2GN9A 3RWBA 2Z43A 3WHPA 4AO7A 1VSQA 4QVGA 1EB9A 3IVGA 2W8BA 4UEOA 2ZIEA 1TK2A 2B37A 3P9KA 1SUBA 2YS7A 1T1IA 3E7FA 2WNSA 4IXTA 2R6JA 2ZREA 4FW9A 1RI3A 5G41A 4BO8A 2O1XA 2QQ5A 8MHTA 2G06A 1AQUA 3KU4A 3IPXA 4LJYA 4XQGA 2XEXA 3V6MA 1NRIA 1WS6A 1UMCA 2YVQA 3CJTA 3OFND 3PD1A 1ECGA 4KU4A 3RDPA 3TCKA 2XMSA 4KRGA 3B1KA 2AR0A 2BGJA 1GDDA 5K8VA 1OLSB 4NDZA 5ECWA 2XMBA 4TLAA 3LHSA 4O0LA 1F5NA 3HKCB 3ZI4A 4QYTA 4BLSA 4J3FA 2Q6LA 2ZETA 1V4VA 4OHRA 1RJEA 3FUXA 1I80A 3N6VA 1MOSA 2HA5A 1B4DA 4DV5B 3TIVA 3A9CA 2C2MA 3KBBA 2Q0SA 3L7YA 3PD7A 3WGMA 1UFVA 1ZCBA 3F96A 3A9RA 3ZGNA 4KMSA 2H54A 4EWLA 5K6AA 3RC2A 3RS5A 10MHA 2JJ1D 2Y27A 1ATIA 5T64A 3WG9A 5IUKC 3LY8A 4BNVA 2IDZA 2DP4E 3PFBA 1TFUA 3RFTA 5IANA 2R751 3BXPA 5IG2A 4KFSA 1NUSA 3ZJTA 2NP6A 1CIPA 3KSRA 2OPHA 2EHDA 1Y1KE 4DMHA 4M8IA 4AJ4A 2C8VA 1EQ2A 1GA4A 3QLEA 4HFRA 3UOWA 1DQNA 3WL4A 3EIFA 1RAEA 2Z1NA 3QMMA 5KAMA 3MGKA 1MAVA 1ST3A 3E9YA 2FE1A 1BHJA 2VATA 3NASA 2UVDA 1W5EA 3ZGVA 5BV2P 3K6KA 4MV4A 2BY4A 2XPCA 4NI5A 4C1BA 3JALB 3PDUA 1K6MA 1XNHA 3AFGA 3WMGA 5C52B 3AFHA 4EI2A 4NZZA 1YA4A 2XCTB 1DC6A 2ZSAA 2AYZA 1RT9A 4C20A 3PXXA 2Q1YA 3A6EA 1TUGA 3M3HA 3H4MA 1A50B 1FTYA 2RDMA 1NUQA 1VIAA 3GBSA 5FNVF 5BOSA 3H3FA 4F5EA 3FDZB 5AESA 4RBNA 1U90A 2EP8A 5H1YA 4YJ2A 2AZTA 4B4UA 4JKYA 2BCGY 2WYIA 4D5EA 3OM9A 1CS0B 5EZYA 3VVBA 1QZZA 1KP2A 3PXAA 5HEKA 2CMFA 3LYLA 3AB7A 1V1MA 3LC7O 2C61A 2NXWA 5AVOA 3PICA 4YAUA 3FNGA 2A92A 4ER0A 1CLEA 3IJRA 4OX9Y 5JD6A 3BUSA 2RGXA 1RWKA 3TUJC 3QHQA 4HPWA 1NAHA 2VHCA 1DT5A 4BNNA 3GJSA 3I23A 4Z9AA 3F4LA 1ONNA 2GZ1A 3BRWA 3TSYA 3COSA 3PGA1 3EIQA 1M2OB 4MGYR 3EJWA 3LVBA 4B3TB 3EZGA 1N0VC 2G76A 3F5SA 4BTEA 2HKIA 4IBOA 4EPYA 1DLIA 2DM6A 1HEUA 4RVDA 4CCYA 4BEVA 2P30A 1YRYE 1N3IA 1XLWA 2FPRA 2VUIB 3A7DA 1KGSA 1VG1A 1LTHR 3GJXC 3OTGA 4EQZA 1FP4A 3GOHA 5C8ZA 2OHJA 1WBBA 4CFZA 4M99A 2MJLA 2C0PA 4KR3A 2AOUB 3FNBA 2N42A 2OFXA 3EVFA 1T8PA 5ILGA 3AEZA 2GK3A 2JCVA 4O4LF 5M5BA 3JQBC 2Y2VA 2ZIUB 2HMSA 3PHLA 4XUCA 3T8YA 1U6KA 2WTEA 1OLUB 2BFCB 2FETA 3N59A 3UA3A 3K1AB 3NTOA 4WBNB 3WGJA 5FWXB 5F5XA 2JFOA 3WS7A 2VS1A 3ICWA 1E3JA 2ISQA 4MKXA 3OPYB 2NUTB 3V42A 3L04A 5LSAA 2C2GA 2IDMA 3QVLA 2WT4A 4EJ2A 3MJHA 4TV9A 1UK8A 3DUWA 3J7AC 1NQWA 3HA2A 2TRSB 4KYIB 3A6PC 4NPHA 3CXUA 2DR3A 5IDWA 1G6KA 1R66A 3LT2A 2QBYA 1K66A 1Q5PA 4C6TB 5I7EA 4RPLA 2GM5A 3KQQA 3ABOB 1YJ5A 2CXXA 2XX3A 2J9GA 3BIXA 3LDHA 4JC8A 4RY9A 1O6CA 1BE1A 3PFWO 2O0MA 4DLZA 4JT2A 4ZALA 3EXEB 4MWEA 5DHTA 2CFOA 2PX3A 1RLIA 4KWTA 3RHFA 5L4NA 2O7VA 3N05A 2ZJYA 1RKBA 2ZS9A 1UPUA 1BGXT 4JU9A 3BL5A 2DCMA 2CF6A 3D3JA 1TT5B 2LRHA 1OTXA 2GJKA 2Z8YA 3G2KA 5AD1A 1A8HA 1L9XA 1NG9A 4YXFA 2ZTSA 3UFXB 3EUEA 1VMDA 5BSUA 3BK1A 3VBCA 1Z06A 4EYOA 5LFAA 1KIMA 4HGOA 3H6KA 3LPDA 5J2UB 1N3BA 4FWBA 4IXDA 1JJ7A 1I6WA 3E22A 4PC1A 1YRBA 1TB4A 1SQ0A 4KNYA 2YXDA 4NU5A 4EJ0A 5GTDA 4S04A 2R9VA 4EA6A 4LHVA 2BE9A 3I42A 3WO1A 4WD3A 4UDXX 5H68A 3OIFA 4JLAA 4BMSA 3ZWNA 4D0LB 1XEXB 1ZYUA 3WIDA 4M1WA 3LGSA 4DBLC 1AF4A 5CBKA 2ZM6B 1DFIA 3CLRC 4J16A 4GLFA 5G1PA 1F9AA 4TRRA 4NV3A 1JBKA 3G3EA 1RXEA 4RACA 1NLZA 4JCOA 4QFBA 4PINA 3D8RA 4I1OA 4D4IA 1U99A 2WPDD 5FORA 1L5KA 4MHTA 3IEKA 1HSZA 1EA5A 3Q15C 1FU4A 1XALA 1IHYA 3RJ9A 9LDBA 4CLRB 1RNLA 2VDWB 3Q3GE 5BN4A 1IM8A 1Y4ZA 1YJCA 1Z8NA 2ZB2A 1R15A 3CF0A 2QG6A 3CG0A 4HLDA 4OAPA 1N1GA 3OAAA 2ZZNA 4HWRA 5JANA 1RP7A 1WU8A 2NNLD 3V80A 2PUTA 1JLSA 3DULA 1FYFA 3VNVA 2AXNA 2BEKA 4Q3CA 1H9AA 4XVRA 1ZH4A 2I6QA 3KUXA 4Z0NA 3TPZA 3TRIA 4EY7A 1L8XA 4O4HA 3D6MA 1YK0A 3ZCUA 2I9PA 4RZXA 5AK6A 1VL1A 1J2YA 5CAEB 4HX5A 1R6UA 1SRQA 1X39A 3ZCRA 2QW0X 4OHXA 5IKPA 1ZZEA 4G81A 4WNAB 1S7CA 1UZUA 4YPOA 3OMWA 3W77A 4AF8A 3AY7A 2JCYA 1BXGB 4LBWA 5TVGA 1U0FA 2PT6A 1I9GA 5I8WA 1RLMA 4Q6BA 3HDVA 1JEJA 3ADOA 1R4NB 1KOGA 2DHRA 1ELOA 3EEFA 4N3BA 3VC3A 3MPOA 4DQUA 1ZD9A 4RSMA 3RV4A 3GUHA 2ZIXA 3D7NA 2QTAA 1WXFA 4UHCA 3UK6A 2O1WA 1QR2A 3CCBA 3OCVA 4CMJA 5BV0A 4XWWA 5LCXA 1U2ZA 3GMDA 4LMPA 1WHTB 1ZU5A 1H42A 2Q0HA 1MIHA 4CL0A 1IHXA 2E18A 5FLKA 3NUQA 1S4MA 2CUZA 4IJVA 1ZNQO 5SZIA 4HADA 5JZBA 4DGSA 1Z13A 1RMQA 5IN4A 2PBLA 4OHOA 2HMYB 1QRDA 5EWJB 1V5GA 2JFFA 2WJIA 4GFDA 1VCOA 1JFLA 1PJ8A 4G8DA 4HZIA 5CW1A 1JWBB 3K0CC 4RDCA 4MGZR 1PZXA 5SYAA 3RRFA 5AKLA 5KNBH 5HDQA 4CV1A 2X0RA 3BJZA 1KBQA 3D6AA 2EL7A 1DG9A 3PB3A 4QHSA 1BCRB 1KQPA 2OZEA 2NIPA 1J5XA 2NU8A 5HKKD 2CXNA 1M0TA 1WW3A 3K4PA 2Q4RA 1LBEA 3HMKA 4ZHQF 5ITWA 3IR5A 4UNNA 4Z4GA 2VNAA 3GVIA 4NOMA 2YL2A 2BELA 4US2R 1HT1E 4M7OA 4BL5A 1QANA 2CHGA 3PNVA 5ARBA 3KSAC 4J8PA 3GLHA 1V35A 1SXGA 3DZFA 3I04M 1H6CA 4WI1A 2IYLD 1ABFA 1UAYA 4Q9DA 4IVPA 2FMIA 1AURA 3S8YA 5DWQA 3DWEX 3SSNA 2BISA 3PFHA 4KXQA 2YWBA 4UFNA 3TLKA 2XYPA 4AIIA 2GEKA 1CDEA 2HRRA 1MAHA 4GI1A 1ZOPA 2BEVA 3S99A 4FK8A 2KJQA 1KRHA 1Z2OX 4BQOA 3EX7C 3ZVMA 4OY3A 1MVOA 2OAEA 4IIBA 4N41A 4YJHA 1ZQ9A 5T67A 1SHTX 4RVCA 1LRJA 2XKBA 5BT8A 4DV7B 2BBSA 1V3UA 1M83A 2H2HA 2J6BA 3NOVA 4PLPA 2ZZMA 3SWWA 2YZGA 3AJEA 5G1NA 2WKPA 3L8GA 3PTAA 4OHVA 1N2OA 1RLOA 4JSYA 3D7LA 4IO1A 2GTIA 1VB5A 3BFJA 2X2PA 4HTFB 4F6RA 1ONPA 1ZHFA 1U0BB 4FXPA 1PJSA 1JRLA 3F4BA 5C3MA 4ABTA 1EVJA 4K86A 2EVWX 4L57A 2JIOA 5AVWA 1QQ6A 2VP5A 3B52X 1RAIA 2ZT6A 4I5EA 4ZT6A 3OCXA 3ZTYA 2NU6B 1W35A 1BX3A 3QE0A 2DULA 5A71A 3FOCA 4RXTA 3KR2A 4S1WA 2MCFA 2YRFA 3O5AA 5CXUA 4ZZ1A 3ID6C 4ZVQA 2CK3D 2PUDA 1E0JA 3O3OB 4Y7DA 1IVYA 1YXMA 2FSIA 1O95A 5BXQC 5ITSA 4DKJA 2PUHA 2B9EA 3D4PA 1AHHA 3FI0A 3OFJA 4MVJH 3DZIA 5JQGA 4AWXA 1DBRA 2P2DA 3EGXA 1N8TA 1Q1ZA 1Z38A 2VT2A 3EEIA 1KO4A 3FFXA 2UVPA 4IDQA 3T7JA 2Z2KA 1YVEI 1NP7A 1XVAA 1MAWA 2MSNA 4CCSA 1BWSA 4AUNA 3AM1A 1XMQB 3AONB 4Z54A 3AZOA 4HXYA 1IK4A 2RGCA 2Z98A 1C7JA 1QTIA 5F23A 3D6FA 5JDIA 3TLJA 4MPDA 4U0KA 3KJQA 4GECA 3LGXA 4WESA 1JW9B 2ZSIA 3UQZA 3QFFA 1B6GA 2AWOA 3WGOA 3A05A 3MYYA 3KXPA 1GEGA 2OCLA 4B74A 2WFAA 2JD0A 1N8KA 4NS4A 4TT8A 3AESB 4HJXA 3BERA 1J6UA 3PLAE 4LHEA 2Y9PB 2OQ2A 1IIRA 3ZWKA 3IE2A 1B16A 4Q4JB 1U3WA 2AKAB 2YFQA 4YAOA 1ODTC 1ORRA 1BN7A 3BD9A 2B83A 4M9SA 3TZ6A 3WGNA 3AVUA 3NRBA 2EKDA 2J48A 3GLFA 4GOND 1K7YA 2JLAA 1Q1BA 4AB1A 1NI4B 2RGRA 2QN8A 1JSCA 3PE6A 4RF4A 5BQ3A 1P39A 1VJRA 2VNIA 5DNCA 2P4HX 1D04A 2FG5A 3UH0A 4ARCA 1ST2A 2GAOA 5LUAA 2QB5A 1N5OX 3K53A 5ELMA 3LZCA 5A3QA 4ZQBA 3QNUA 3OOWA 3WKBA 5ADVA 1JEOA 2Q2VA 1TM1E 4JQYA 1DEHA 2PTHA 4YAEA 5IM4F 2O8EB 2X0NA 3GPLA 2KM1A 4LOLA 2GA8A 4DJAA 3DGEC 1Z2PX 1KIFA 1M2NA 4PZ0A 4NG5A 3ZGLA 1YMUA 3GX1A 4Q3DA 3JWJA 5E6RA 5C4IA 1ZFNA 3GT7A 2O3UA 3A2NA 3B36A 3L7IA 2ZCJA 1EUZA 4NJOA 2XCLA 1KMCA 4JB2A 1RR6A 1TM7E 5ELLA 1TXGA 1WL8A 2H92A 1ZPDA 5A3VA 3ZV6A 1TQ4A 4FEYA 4YRBA 4GP6A 2W8ZA 1VSUA 4ND3A 1NKVA 4FHZA 4C4RA 3WYBA 3FIUA 3A4VA 3EA4A 4HS9A 3QVWA 3KXIA 2XSZD 4JUFA 4ARZA 1DO0A 5A06A 3JU3A 1YDMA 3DVRX 3ITKA 4BE4A 1UMBA 3B6EA 1MX1A 4KTVE 1DLJA 2RK3A 1FX1A 3R5SA 4IWNA 1NY5A 3PUXA 5JYCA 4LYHA 2IGBA 3IUEA 1AUOA 5JAIA 4LY6A 1QGDA 4WVLA 1MJGM 4EEKA 4F56A 2AYYA 1UDCA 1JDSA 2AFVA 2PZJA 3UHJA 3K6SA 3E7XA 4MVXA 4CF4A 4ER6A 4F9GA 4JYAB 1PEKE 5K03A 1C0EA 3IUPA 5T3YA 3X1XA 2O7RA 5ARDA 2AG1A 4YCBA 1G3RA 4E13A 3K0BA 3PE3A 3JZAA 1RKQA 3QYAA 1P0IA 4BLUA 4PW0A 1KY3A 4IDBA 4WPGA 4ALNA 4PX5A 3LY7A 3V2IA 2LPMA 2BJWA 4PCUA 3NHKA 2HPZA 2R4UA 1GZ4A 4M89A 1PK9A 1LJUA 1W29A 1YZLA 3KK0A 3IO5A 4QOIA 3RE1A 1NN3A 5FBWB 3X3HA 2ZQ5A 1LPPA 1T3SA 1ZMTA 4ZIRA 3GK3A 1Q0PA 4O1MA 1NQ5A 1OH5A 3MTEA 3UGTA 4B40A 1AHPA 1Q0TA 2I62A 1J5PA 1US8A 4Z86A 2EF1A 5F2KA 1BEUB 1HEYA 2NV2B 3ABSB 1SULA 2XJ4A 3LS2A 5B64A 1AKNA 2EWWA 3ICOA 1HLGA 4MP6A 4P3KA 4X45A 4E6PA 7GPBA 4JJFA 1J2JA 2O14A 3E3AA 2ZYIA 3WL3A 3E5HA 2P4QA 4FZ3A 5H80A 5GJBA 1ZD1A 2ZYHA 3QBTA 3BDAA 5FA6A 1GRRA 1S02A 1K98A 4JI3B 2QZZA 4MW1A 4Q48A 3V7YA 3FF1A 2WZQA 5EEGA 3ZU3A 5CG2A 3W2IA 4ZOQI 1NBMA 2SCUB 1UAGA 5B30A 3B51X 1ZIDA 3GDGA 1TC1A 1RWOA 1F4LA 4YAKA 1X1SA 4WSOA 4BDTA 1ZIOA 2I55A 4EPTA 4OHPA 1OMOA 2J41A 1RVV1 4QUKA 3PITA 3I28A 4DG5A 5HWSA 4AICA 3FCOA 1RJWA 1B15A 1Z0SA 3WLEA 4A8PA 1AU9A 1YMVA 1WV0A 1RYZA 3HR7A 4ITRC 2OVFA 4XKJA 4DSOA 2WHXA 4J9VA 2IOYA 3OLVA 5DHFA 1E7RA 4X71A 4DYVA 1GCIA 3BMCB 3VM6A 1MHTA 2HRCA 1NF9A 3S3TA 1HE3A 4W5HA 4HBGA 1SCBA 2GFIA 2DSTA 3SNKA 4UFPA 2GN2A 1QVZA 3CLHA 2IPNA 1IM5A 3MOGA 4TTAA 3FAKA 4V0LA 4P08A 2QLMA 4UBLA 4MW2A 4YNBA 1PFKA 2HA6A 3V55A 1FU8A 2HF9A 1CZRA 1NBAA 2J5XA 2V7GA 4O1HA 3TJRA 3CHYA 4EB3A 2FUNB 3IDQA 1AJEA 2QX9A 2XYQA 5JO9A 4J0FA 3WQHA 3QG1A 5I9MA 4DV6B 2WM9B 4KPGA 4ENUA 5J3JA 4KG7A 1TGVA 1T4BA 4PG5A 5C8YA 3RIHA 3GFVA 1SKYE 3B6ZA 3URKA 4IG4A 3UK7A 1G5IA 3CB2A 4RKQA 2UZ0A 3DLBA 1FMTA 4PSKA 1W96A 3FSGA 1X0VA 2PZBA 2BFEB 2R1TB 4BKUA 4OFBA 1QO0D 3QG5A 2O2SA 4XZ3A 2CFRA 5ALZA 1NYRA 2OZKA 3NT2A 2X15A 3EULA 3QVSA 3ITDA 3U13A 1KU6A 4ZAVA 3ZS9A 1AXGA 1L2TA 4PXAA 3T5AA 1ISFA 4TXLA 1XD2A 4LZNA 3ACDA 1OREA 1I7QB 3A9UA 5H3LA 2UZ1B 1H8ED 2B5WA 4JN6B 4JXJA 2VT7A 1H1LB 4R31A 1HLDA 5DIFA 1O4VA 1EX6A 2NZUG 2OGTA 2VCEA 2VF5X 2PY6A 3V4OA 4YP6A 4AX8A 2VAPA 3ZDBA 3RSGA 4MIEA 3HN7A 1ABBA 2ZBRA 3DEJA 2KW5A 1WMSA 3NX4A 4FS8A 1WUHS 1TCVA 3HR4A 2B4KA 1JHUA 2XMCA 1FMLA 3DBRB 3UCEA 3DVLA 3WRXA 4ALMA 2RKOA 5A5GA 4KQ6A 1JBQA 2YINC 4CKCA 3ZIDA 4UEKA 6REQB 1T9KA 4WZBA 5M04A 5EIXA 4MV9A 1VLJA 2OZVA 1XZAA 1ZI8A 2TMYA 3IC5A 4Z4QA 1Z2DA 1XCMA 2VAXA 3IKVA 1B76A 2QW8A 4I4CA 4QHYA 4MA0A 4L22A 1Y8QA 1EUCB 1T4MA 4PZ9A 1WNFA 2FP3A 4RH0A 4CKBA 3AP3A 2B9VA 5HE9A 2B0CA 3IBYA 3N53A 5SY9A 2OCKA 2EJBA 3A7EA 1BS2A 5CEJA 3L7JA 3HK2A 3OWHA 3EPHA 4IO0A 1KE1A 3RT7A 3V4VB 3PEVA 1DU4A 3CNBA 4XFJA 3C39A 5DGCA 1XA3A 3ESZA 2JBAB 2VDMB 2V6MA 3EXAA 4AG6A 1WB9A 4D43A 4DS3A 1V71A 2QRMA 1M75A 2UDPA 3MINB 3Q1KA 3RBVA 5I4CA 4P7GA 2JFYA 4ZQIA 5ESXA 1N0UA 3DOCA 1KDRA 1ZA1A 3GP8A 2FGJA 4R1NA 1E6MA 2A1UB 2J6HA 2YTZA 3T06B 4HWOA 1B0ZA 5F51A 2CHVA 4JB0A 2I76A 3JAKB 4PLTA 2GBFA 1IWPB 3FXAA 3O8CA 1MLDA 2P9CA 3CGWA 5K3DA 1Q84A 3VR4H 2BH2A 2WV9A 1A5AB 1T2AA 5ALJA 1KZHA 1SUAA 2J07A 3VC2A 2VXCA 3PWTA 3BZBA 4KQXA 1UPAA 4NQZA 5GIOE 3GRCA 1HT2E 2YVLA 3EH2A 1RFGE 3OETA 3IVRA 4ED9A 2Q49A 3GGPA 2ZAIA 3KZXA 5C8VA 3C5EA 3TLBA 4NDNE 3QENA 4ZPJA 5TMBA 4ZMBA 5DM2A 3AR7A 4YJ2F 1ZK4A 5B6JA 3WDKA 3C8HA 3CX4A 3DDSA 2CXOA 1W8DA 4X24A 5EZYF 5AVYA 1JV2B 2EG5A 3IE1A 4JJ7A 1ENPA 5AUQA 1DZ3A 1LEHA 4U3JA 1YIAA 1QRSA 3QLVC 4ES6A 1O96B 4MV8A 3U17A 1PBNA 5EKDA 1R0YA 4RMHA 3CBGA 3DMRA 3SJUA 1X8KA 3D02A 5HR5A 3BIFA 5IJ9B 1NBIA 1RHJA 4PC3A 1IN6A 1YBFA 4GPTA 1NNI1 4L6IA 2CNDA 2AN4A 2YDYA 2DEUA 1X7XA 3A2MA 4EEZA 3TSZA 2HOQA 1ZGCA 2CL6X 1DELA 5SZKB 1JFTA 5GONA 1F6BA 3R77A 4BGDA 4OLAA 2YDXA 5CK5A 2GTHA 2IC5A 1EFRD 2QPLA 2VZLA 3L1VA 3RREA 3TTSA 3LC1O 4I7EA 4BNWA 2HF8A 2AE2A 3ILSA 4HL6A 1NVBA 2XVAA 3TQFA 1EHYA 3LZDA 1GAWA 3DFUA 5H4GA 3ZHBA 1ZL0A 1UOEA 5F2OA 1Y7HA 2RARA 2ZI6A 1FDUA 1NKSA 3KJFA 2X42A 5HUJA 3THRA 1NNEA 3DG9A 3H17A 3L6DA 1FA9A 4J07A 4OQDA 1ILWA