3CX3A

Crystal structure analysis of the streptococcus pneumoniae adcaii protein
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
277
structure length
264
Chain Sequence
TGKGMKIVTSFYPIYAMVKEVSGDLNDVRMIQSSSGIHSFEPSANDIAAIYDADVFVYHSHTLESWAGSLDPNLKKSKVKVLEASEGMTLERVPGTLYDPHTWLDPEKAGEEAQIIADKLSEVDSEHKETYQKNAQAFIKKAQELTKKFQPKFEKATQKTFVTQHTAFSYLAKRFGLNQLGIAGISPEQEPSPRQLTEIQEFVKTYKVKTIFTESNASSKVAETLVKSTGVGLKTLNPLESDPQNDKTYLENLEENMSILAEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Lipoprotein
publication title AdcAII, a new pneumococcal Zn-binding protein homologous with ABC transporters: biochemical and structural analysis.
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 75
structure length 264
sequence length 277
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3cx3A01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3cx3A02
3GI1A 2O1EA 4MLZA 3MD9A 3AEQA 4INPA 3K1AB 4WESA 4ND8A 2XH8A 4IRMA 4HMPA 3MINA 5HDQA 3PSHA 4N01A 4UDNA 3AERA 4PM4A 1H1LA 2WI8A 3G9QA 4UDOA 5CR9A 4HMQA 4LS3A 1G21A 5GGYA 3AEQB 3NU1A 4OXRA 3MWFA 4WESB 2OGWA 2PHZA 1N2CA 1QGUB 2XV1A 3MINB 5M34A 3U7QB 3ZK8A 1QH8A 4LJSA 3AESB 1K2VN 4B8YA 4DBLE 3AERB 2Q8QA 1G20A 1H1LB 2PS9A 1K0FA 1N4AA 5CX1A 3UJPA 4BBPA 2M6KA 1QGUA 3PDIB 1G21B 3R5TA 4G07A 4MX8A 5M29A 4FI3F 3U7QA 3BE6A 4FNAA 3AESA 2X4LA 1N2ZA 1N2CB 2PS0A 1PQ4A 4G09A 2PS3A 2WHYA 5JOQA 1QH8B 4TKUB 4WZBA 1ESZA 5FLYA 1G20B 3PDIA 3MWGA 4CL2A 5HX7A 4GICA 5CX1B 2RG7A 4OVKA 4FILA 1FP4A 3TNYA 1TOAA 1XVLA 4WNAA 4HN9A 3HXPA 4INOA 3R5SA 4TKUA 4H59A 2R7AA 1L5HA 2MINA 3EIXA 3LHSA 4HMOA 1KAEA 2ETVA 4K3VA 4WZBB 4MDYA 4TKVA 1M1NB 4UTPA 1N4DA 1K7SN 2AFIA 3HJTA 4WZAA 1QH1B 2OV3A 5BVHA 1PSZA 2XY4A 5AFSA 5JJ5A 3PSAA 1FP4B 1KARA 4WNAB 5BVGA 3HH8A 5KHLB 4PAGA 5KOHB 4XPIA 5KOJA 2AFHA 1M1YA 1M1NA 2XDQB 1L5HB 4NNPA 3EIWA 2MINB 4WN9A 1QH1A 2YNMD 4M7OA 3MFQA 4NNOA 4TKVB 2QI9F 2AFIB 3TLKA 4WZAB 5BVHB 3ZK9A 3ZK7A 2XQVA 1MIOA 2PRSA 5KOHA 5JPDA 3AEKA 4H0FA 1K75A 2XDQA 3AETA 2YNMC 5BVGB 1KAHA 4XPIB 5B58T 2AFHB 5KOJB 5M2QA 2R79A 1M1YB 1M34B 3AEUB 4WN9B 5GGXA 3TEFA 2OSVA 4UTOA 2OV1A 3BE5A 3K1AA 5I4KA 4OXQA 3LI2A 4FKMA 3ZKAA 3ZTTA 1MIOB 3AEKB 3CX3A 5M3BA 4MO9A 5JG7A 2Q8PA 1EFDN 3AETB 1M34A 4ND8B 3AEUA 2XUZA 2M6LA
chains in the Genus database with same CATH superfamily
1SHKA 3QBVA 1EFHA 1DRJA 4B4KA 3L0SA 5DBHX 3D3NA 2NTYC 2PBLA 1TCUA 1UK6A 3DEJA 3H5RA 3SYTA 1BYUA 3R5HA 3TK1A 3ZWYA 5CDUA 3PX7A 1H2EA 2I1LA 5T64A 2XNKA 1FJ2A 5F12A 1O97C 4XIGS 3VOTA 5JNWA 1VL1A 3B3FA 1P72A 2QRMA 1S1CA 1Z2PX 2PGAA 3E2MA 4J29A 4KWHA 2AUNA 5EZYF 3UB3A 4B3DA 1QH0A 4JEIA 1WB9A 1XD9A 1L6RA 4L1KA 5E4TA 4CRWB 3RYTC 4EL0A 2PDAA 3D4PA 4YXFA 2D6FA 5AKXA 2PX5A 2IYRA 1E2UA 1VL2A 4CM7A 4L50A 3R7WB 3EVCA 4EG0A 4BLVA 1RW4A 3TBHA 4DJAA 1XQXA 2WE8A 1KY4A 2WFLB 2GKOA 3B3JA 3B1YA 3HP7A 4DUPA 1JLKA 1R88A 1ZSNA 3DAOA 3TSZA 4KXWA 3FWPA 2G9ZA 1QPZA 4P7JA 5FBVB 3OIUA 3F6PA 1PT8A 2PBZA 4MUEA 2ZBUA 4F6LA 2P4EA 5E3HA 5ALTA 1C9DB 3C5WP 3LHKA 2IH4A 2X0KA 4GRDA 1Q95A 3C7TA 3HCRA 4RDIA 2RGEA 3LS2A 4RY9A 3LO5A 3SBXA 5EJ7A 2B35A 4G97A 4CBVA 3A4VA 1QMPA 3HRHA 3AXTA 4TYNA 3W06A 1YJXA 4GQAA 1Z5PA 2IODA 1WETA 2X6QA 3G79A 2GWRA 2YR0A 3EEQA 1JH8A 3MUFA 2PRIA 4DCVA 3K5HA 4K9KA 1AD2A 5KYWB 4FYIA 1TC2A 2UUOA 1BHJA 1G7SA 1XEXB 1I7PA 2VDPB 2WD9A 1ILEA 1TJ4A 5CCXA 1MB4A 5HA5A 3M8KA 4FOSA 4ZEXA 2EZ4A 1A88A 1CF2O 3HNPA 4ZDWA 2WG0A 4KQKA 1DL5A 3TFWA 5BSRA 4F9GA 4ASUD 4FHFA 4C76A 1L5KA 2MMCA 4FFDA 4FZ5A 4QBFA 4Y6LA 5FNVA 1Z13A 4YUXA 2H54A 4CLOB 2Q27A 3T5DA 3CG0A 1EFLA 1U7WA 2K7ZA 5AUOB 3WB0A 4B34A 2BEVA 5HRAA 4YRJA 2AYZA 4LSWA 2D2XA 5AKGA 5ALEA 5IF9A 2O5CA 2YC2C 3AVPA 1NJFA 2DUJA 1IVYA 4W8OA 1J0AA 5LOVF 2XF8A 3ZVNA 1VB3A 1VMAA 1Y1PA 2DKNA 2FKNA 3H05A 4BMYA 1VE9A 1GPWB 5C18A 5E6UA 3LRTA 4M1YA 3EFOB 2QP4A 2ZRGA 4LV8B 4RZHA 1ISJA 3PNOA 2I6XA 2VVTA 2EBHX 5CVEA 3UPTA 3ONEA 1ID1A 1K98A 4IH4A 2FPKA 4DIDA 5B7QA 4BCDA 2PZ8A 2Z04A 2BBTA 3QVLA 2AFHB 2C58A 2AEJA 3R5FA 2R79A 1D4AA 3OCXA 2HJHA 3VM6A 4C0JA 2B7BA 5EN4A 2HWWA 1Y4DE 3L6BA 4EFNA 1LPMA 1M6VB 1X0VA 3ORQA 1YL5A 4K8RB 7MDHA 3NIGB 3TZBA 2EX1A 5K5EA 2ZFUA 3GLUA 1EGAA 1FDOA 5E7JA 4K6GA 4JYZA 1DVRA 4B6RA 2NU6A 3I73A 2Q45A 3KYCB 1KK3A 2BM9A 2DXIA 4G8BA 1YR6A 5LKAA 1ABBA 3JQAD 4V3BA 3BQ9A 2RONA 3I1YA 2ORWA 2EVWX 2BGIA 2X5KO 4LWOA 1TJ5A 3FPFA 4E07A 2PN1A 3L8ZA 2W58A 2JCVA 2O1EA 5KTYA 3SPXA 1DEXA 2B83A 1QHHB 1CJUC 4HDRA 4U0KA 2WYVA 4ZT5A 1LZLA 3MN1A 1SC3A 5LL6P 5HIKA 4WZAE 1MHPA 3NM6B 2VQDA 1UEJA 4WK0B 1P1RA 3RS7A 4DV4B 3ROKA 5GZ6A 2Z6VA 4ZRMA 5IM4A 2C4TA 3A10A 3AKYA 1CB0A 4A6DA 2QUJA 4UBMA 4H7FA 1NMEA 2I7XA 3JQFC 1NXSA 1QZ3A 1Z18A 2CXHA 3GVXA 1M0TA 4FEAA 5JD6A 1XMJA 3W5AA 1U9JA 1FDIA 1N2SA 3FI0A 1NYLA 1L1FA 4AZVA 2O54A 2FN9A 1CNMA 1E96A 2PT9A 4BRZA 4FHGA 5AKIA 1RPTA 3ZLVA 1D4OA 2YJ6A 2ZE5A 2ZWMA 3GXOA 4LWZA 1Z35A 1N5JA 2PUWA 1Y3AA 4NG5A 3ZGZA 5BMOA 3NTRA 4IV5A 1AH2A 1ZUD1 3H5NA 1KI6A 3NAMA 1FQWA 4DCPA 3ITDA 3UMFA 1VP9A 5JCJD 3FF1A 3CCCA 4GPD1 3ZU4A 2H17A 1F1BA 2R5NA 3U6KA 1G5RA 1W4RA 2VCHA 1U3DA 1YSCA 1IHOA 1GPMA 4ZCSA 4YV2A 5C7LO 4CV2A 2WJHA 3QKWA 4QNRA 2QE6A 1WCXA 2IGTA 2IYLD 2R5FA 3WKDA 5EKTA 2ZUFA 1F3LA 1YR2A 5IWAB 2P2DA 1RXIA 1YCFA 3DKRA 1F20A 1DIBA 4Q1CA 1YJ8A 3GEEA 4HNHA 2RHGB 3C8ZA 5FTKA 4HLQB 3HADA 1IZ7A 3P2YA 4YMIA 2P9YA 4IH9A 2IEAA 1FP7A 3F1KA 3UMRA 3K92A 4BWFB 2WJPA 3HDHA 3DKVA 3OJLA 4RIGA 3WGKA 2I34A 5JAZA 2FEXA 3BIFA 3ZD6A 1JHUA 1ZJ4A 4DR2B 1PKXA 5JQGA 4R3NA 2IFTA 3M34A 1NVFA 1GCIA 2JGFA 1GA1A 2BE7A 1X38A 2VT2A 2Y27A 4K9NA 1Z3IX 3ACDA 3T7KA 1PQUA 1YASA 3TZLA 3JRWA 4DMCA 8GPBA 1CVIA 1R8QA 1XDDA 4GMKA 4MV8A 4QNNA 1A0OA 2JGDA 2DPMA 3PC3A 2YY5A 5EJ2A 3STWA 5J5AA 2A9JA 2VSOA 4DSNA 4MKIA 3MCTA 1V5FA 1GQFA 2GASA 5F4ZA 1RRFA 2GZ2A 3C3CA 3LC7O 4LOIA 1VBMA 3NTOA 5HCIA 1HETA 1QPBA 5G1PA 3EPKA 1RVDA 1OF1A 2O5VA 1HTWA 3G2OA 3SOPA 1K75A 3AIIA 4EYSA 2IH5A 1YTLA 2DFLA 4LYAA 1TXGA 3OQMA 1C2YA 1ZNZA 1Z8FA 3OQVA 2JIOA 4MULA 1JHOA 2CZQA 3N28A 1GGFA 1B7GO 1M34B 1GFSA 4KXFB 2YS6A 4WN9B 4Z7JA 3N2GB 3VOAA 4RPHA 3W1EA 1TTTA 1PDOA 1ZCJA 5DX8A 5LBUA 1JDVA 2AOUA 2KE5A 4DJDC 2PUFA 1ZRSA 2ZI3A 3B7GA 3DB2A 3DFMA 3CX3A 5AHRA 3UA4A 3VNRA 1U1EA 5FWDA 3TCXB 3ORRA 1IU9A 5HJ5A 5CD1A 3ZWOA 3V4RA 5JI2E 1M9NA 2BGTA 3LRPA 3QVWA 4FN5A 2XQKA 2D00A 2JFVA 2XNCA 3I9JA 3WRVA 2Z6AA 1YVPA 3DMYA 3ETHA 4WCDA 2IZ5A 4WKCA 4F86A 2NVOA 4B85A 3THWA 3G8BA 1QMGA 3MHPA 4GVPA 3D8BA 2RK6A 4QM6A 4C07A 3AGQA 1R4NA 1NI5A 3G2KA 4HGRA 4YCSA 2B69A 2GPSA 1KORA 5F7JA 3WB9A 5GJVC 5INTA 1EUDB 4J0FA 1S3GA 4YACA 1PX0A 2BFFB 2GK6A 2HY7A 3RUCA 3T4XA 3W5IA 2BMDA 5DWDA 2P6RA 3LUJA 2CZCA 1K27A 2BFBB 2R60A 2VNIA 4LCEA 4YP1A 4C4AA 1VFPA 3HJGA 1UBGA 4J0KA 4J7CA 4O2AF 4TRRA 5CLIA 3Q1KA 1TUGA 2NACA 4OUDB 4QFMA 4JT2A 5FUBA 2FQ1A 2PGDA 3G8YA 4CM8A 4TROA 1NQ5A 1Q0PA 4MCHA 2OHHA 3DTTA 1V2HE 2WJZB 1APBA 1ZICA 3DO6A 3AP2A 3ASUA 1HE4A 2WF7A 3IGFA 3T3IA 1X2BA 3SC2A 1NX9A 5AVUA 3HA7A 2Q3FA 3I4LA 1GGJA 3IOCA 3PQDA 3P4YA 3TAXA 2DX7A 1ISHA 2X6TA 4Q3AA 5LMUB 1T0HB 2PUGA 4PHGA 3I34X 4AL4A 1DI0A 4HZIA 3WFZA 4F3CA 3DHNA 3I9V6 4H1VA 2IGBA 1S89A 3SHOA 3ZCSA 3BSWA 3SIPA 4K81B 3B5JA 1VC2A 2D2FA 2J5RA 2QTVA 5FR1A 1ULZA 5CBPB 1Z25A 2RHTA 5HG0A 2PJUA 1WDWB 1XVVA 1U0TA 4D4MA 3B5IA 1EFRD 1XZFA 1TF2A 4K26A 3FE2A 2VYQA 2MSNA 5BT8A 4PX5A 4S05A 4MYDA 5JJIA 4RLHA 2KLBA 3ZV5A 4C7JA 4ECEA 2UAGA 1VLHA 2H4YA 3PNSA 3UHAA 1HE8B 5DGHA 1SU8A 2R7KA 4GGOA 4BB5A 2NUAA 2AVNA 5AW1A 1DS6A 2CN1A 4HMOA 1EWVA 1QCYA 2BEJA 3HYSA 2WUEA 3C6XA 4EYQA 5AM4A 3UK0A 2GBIA 1H1TA 3DYIA 2DTDA 1K6JA 4A6EA 1FFAA 3IPXA 1JFLA 2QLJA 2PO5A 5ALFA 3LC2O 2YINC 3UOGA 2CFTA 3G0OA 2HM7A 3QV2A 1NFQA 4KMOA 3WMFA 2YC4C 1NBME 1LLUA 4ETIA 4G37A 3RU7A 4FW8A 4FD3A 5F2EA 4BPBA 2GR9A 4W9RA 4Q9KA 4HFMA 3LBFA 4CXMA 1GSHA 1S2OA 2IY7A 4ASUA 3QUBA 2JATA 2C5BA 2ZSUA 3DQQA 3TKYA 1VA4A 2QSJA 3L1JA 1RAAA 2JFOA 1G5PA 3HKBB 4UU7A 4JR1A 3HCEA 3OCUA 4GYWA 1G42A 1XZQA 4MWZA 4LHXA 3MMSA 1PBTA 1RWQA 3L6DA 4EGQA 1UZLA 3AONB 1G6HA 2E82A 5AW6A 4KO2S 5K0TA 1GD1O 1MHTA 5A3QA 1OLSA 2RH9B 3GAFA 4W5RA 2O23A 3AGPA 4G0ZA 2I9PA 4LYHA 1PNOA 1QIFA 4IIFA 2JFXA 1UDCA 3ZGVA 1UDBA 1BRMA 4H7PA 3QLUA 4AXXA 4E09A 1V37A 1WXQA 3VH2A 3GMDA 2H57A 3JQPA 2AR9A 4NU6A 1JEDA 4XX0A 5BSMA 3PI7A 4PSVA 2PNJA 4NNJA 4PZ0A 1OVMA 1OY1A 5BQOA 2NNLD 2GDZA 8ADHA 1E4EA 2GAJA 4K9OA 4XDHA 1NXVA 3EIUA 4JJGA 3LCMA 5AJUA 2RB5A 3TN7A 2MJLA 4C6HA 4B3MB 3TQHA 1L9XA 1R8XA 5I4IA 1CRZA 1B15A 2D0PB 4QQFA 2GZAA 5CT5A 1XN4A 4IIYA 3TSOA 5EJ9A 3K09C 3QM1A 3TQOA 2ZRMA 1F7UA 3KRTA 2PYZA 1VPEA 3CF6R 4IIJF 3RD5A 2VJDA 2NTJA 4RFSB 4F85A 3OJXA 5DTJA 2IYVA 3ZHBA 2R6GA 1U2SA 5FEUA 1B6SA 3KYJB 3NVKI 2BFAA 3M81A 1TLFA 1ZD5A 2P68A 3JQAA 5LB2A 3SM3A 3EGIA 4CDNA 2ZRDA 3SBEA 1G6KA 1X94A 1X42A 2ROQA 3TIVA 1EDDA 3INTA 1L5GB 5HYVA 4ENQA 1C1DA 1VYUA 4YTEA 3UC9A 1P39A 3WTCA 1TQHA 3OZBA 1JR2A 3QEBZ 3DUFB 2VATA 3MIIA 1JFRA 3KEFA 3TKAA 3ET4A 3ILHA 1B26A 1FX0A 1K5PA 3FDXA 1P5JA 3NDIA 5DTRA 3CONA 5GZ3A 4RQUA 5DRYA 2B0CA 4IJKA 5KNCH 5LP6B 4XGKA 3V1LA 1Q92A 3BE6A 3CSDA 1Y9AA 3NHAA 4OSOA 4U5XA 1UC8A 3D3JA 2JKVA 4G0WA 2C9DA 2ODQA 4G1UC 1UJ6A 3ESDA 3JD4A 4K5QA 4MRNA 2PUBA 4JC8A 3H75A 5AOVA 3LBIA 3EXAA 5C7YA 2G1PA 2VTBA 4GICA 1RAGA 2VJKA 1I4TD 5J2TF 4UW9A 3DC2A 1JIIA 1Z37A 1Y63A 3IPRA 1QGDA 1DV2A 4LIPD 2BHTA 2YXPX 3K73O 1XX6A 3EVAA 2L82A 1MQ9A 5JCJA 5BWLA 1E2DA 1MKYA 1QFYA 1NQVA 4ALJA 1XQYA 4A8TA 3AUKA 4TWIA 2YJ5A 1KXJA 2ZJ5A 1QQ6A 3GR6A 4LYEA 2BOVA 3M1IA 3LQ2A 3OOHA 5EMLA 1JKXA 4F04A 1OXXK 1YCHA 4MWEA 2D8MA 4RA9A 1NR1A 2B1JA 3ZCQA 5BVGA 1VG8A 2ZDGA 1KEWA 3LXRA 2PJRA 5IVPA 1EM8B 1JL3A 3MJHA 1VFNA 4JLDA 3P19A 4ZP1A 4CFZA 1C3OB 4IAOA 1BGWA 3QKRB 1YJQA 2UZIR 1JQAA 3KTAB 1TW3A 4G1CA 1RPAA 3NHSA 4P4LA 1TZ2A 4A2CA 1F5NA 5TF4A 1N1DA 2DLNA 5EIAA 1KQFA 1EDBA 1ZD1A 3OBIA 2QM0A 1Q14A 3OTHA 4BWVA 5BVHB 2DFPA 5JXGA 3U3DA 1GUDA 3QBJA 1NASA 2BGMA 3T95A 2CLLB 4QOGA 1T8UA 2XGOA 2BEWB 3V4FA 1F8GA 2OBLA 3TZHA 4MQBA 3NJRA 5KKAA 3WK8A 3CVWA 3FWHA 1PHPA 1M83A 3DZIA 2NZYA 5REQA 3ZWMA 3ZIDA 4BMDA 4Q9JA 1Y9JA 1KXZA 2OLKA 4ZYVA 5JH7B 1RWNA 2QG4A 3JAMA 4YQYA 2HZ7A 1N9ZA 1UEXC 1HF3A 1QK4A 1SGWA 3QG1A 4YCJA 2CFCA 5EMNA 4A0HA 2OHJA 4DANA 4KREA 4ZDKA 2QX7A 3DMHA 2JD2A 2X9LA 1NBMD 4MUAA 2ZAOA 1AIPA 3DTVD 3HHPA 3BORA 4RPLA 1BE0A 1HA3A 2Y99A 5LUBA 3BA1A 2V7VA 1U8YA 1Z0KA 4CF6A 2ZBVA 4BO4A 4IIXA 3OVMA 2DQKA 5ARDA 1EBFA 1OC2A 1KBOA 4Q4HB 1JVSA 4TQGA 3VKFA 3CNBA 1ZXLA 4N01A 4UVIA 1CUHA 5EPOA 5DIFA 1EJ2A 2DULA 3T3NA 1IN4A 2C2YA 2C7OA 3BTSA 4OHOA 4E70A 4YGXB 1YJBA 3RS0A 3BMCB 2R6CA 3OQIA 1V9CA 4JODA 1HQCA 1T2CA 1T9KA 3BWMA 3SQDA 3BXOA 4HVAA 2Q3HA 1M10A 3ZNNA 4BKOA 1DIAA 4KUGA 3L6EA 4BOYA 5C52B 1P74A 2V65A 1T1SA 4KZKA 3F67A 5KREA 3E22B 3TJZA 5JYDA 3E03A 1BXRA 1KMHA 2Q2WA 3B9RA 3OURA 3HA3A 3LT1A 1W5AA 5ALNA 3ZWVA 1I32A 1SNYA 4JSTA 2XMQA 1PS0A 1AJEA 2AZTA 4X64B 3EEBA 1WXGA 1EWTA 3NYQA 1DWOA 3AHGA 4OYYA 3K05A 1JJVA 4KQMA 4BUZA 4MW5A 4X6LA 1RXEA 2XWSA 3DDZX 1YJAA 3C4VA 1OXBB 1X7YB 4M37A 1DXHA 3PUYA 3OZVA 4DCJA 4EARA 2G0TA 3QKIA 4UCQA 4YROA 3UG7A 4JBHA 5AVSA 1OXKB 1XB2A 3OE7D 2EBWA 3PEFA 2QZJA 3GIWA 4LXQA 1T3LA 5ALLA 2DR2A 3X0DA 1G8AA 3I09A 3BRSA 2I33A 3GRUA 4RFVA 4OXIA 3ZWNA 3KETA 2Y6UA 1LTHR 2IEIA 1N3LA 5EE1A 1XP5A 4HXFB 4FPXA 1CQIB 2PKRA 2XDYA 3MERA 4DLUA 1OCEA 1HDCA 4BLPA 4OM7A 3UJDA 4H2DA 4L4ZA 4NJEA 1SB8A 4P8RA 3M9WA 4KWTA 4WEQA 3T3PB 5E9AA 3AJEA 4U2FA 4WZAA 1SELA 1TFUA 4PNZA 1XNGA 1VYVA 4OA5A 2ABWA 4AO8A 2JFNA 3R7FA 1EFRA 1YTUA 3PFNA 4O4HF 4PAGA 3VDRA 5AW3A 4D9HA 2EDAA 3SVLA 4DG8A 2IYTA 2AC2A 3M4NA 4NL4H 4QBHA 5YASA 1HV8A 1WNFA 4HPWA 1EK2A 1R64A 3B3QA 2E4ZA 1IJBA 1PF7E 3GJ7A 3INYA 3RIMA 4E33A 1AT1A 2V3CC 1FP1D 2B2CA 2WUDA 2YWHA 4JSRA 3PB3A 3T1TA 1SFRA 2O5RA 1GLVA 5E6SA 4GNRA 3PP8A 1U7PA 1K5GA 4ZICA 2J5QA 2ZWOA 3LCVB 1B2RA 1SG9A 4X20A 2O06A 3GW8A 1L2TA 1QWSA 1GAEO 1XRJA 4KP7A 5GGXA 4L3OA 2V5UA 4XQEA 1UWCA 4PONA 3CX6A 3IP5A 3PVZA 1V1MB 2JCYA 2L18A 1BMTA 1SVSA 2CL6X 4H08A 1Q20A 4EJ6A 1F6DA 2YV3A 3WIVA 3OMLA 1KVQA 1OGJA 1UPUA 2WHQA 3A1TA 3CUKA 3I6ZA 4AZ0A 5JLJA 2EZUA 2VFAA 3MAGA 2OVBA 3OCZA 4CQNA 2P7HA 5DZSA 5LQSA 2SKDA 2G9NA 3CMMA 3RIEA 2HQ1A 5HQ3B 2BGGA 4GPAA 5KU7A 3L6CA 3KK0A 1DWPA 1EGVB 3FETA 4QVIA 5DXAA 3F7NA 1PJBA 1FFYA 1UMBB 1KIFA 1SXQA 5LQAA 1J7KA 2ZTHA 5FOUA 3RAJA 1QVZA 5EOVA 4FDAA 3KAQA 3G23A 1P2TA 3KLBA 1VP3A 1ZQ9A 5FQNA 1JFSA 1GCAA 4D02A 1GPJA 5JQWA 1TUBB 4MRMA 2CVZA 3NEJA 5B1HA 5IULC 1P1CA 3OEHD 2GOYA 1VQ1A 5EXPA 1K88A 5JDCC 3EZGA 1OBHA 5L3ZA 3TTXA 3UCXA 4CKWB 2BC9A 2HR1A 1UPTA 3ZDYB 2W2MA 2J1LA 3O75A 4XEHA 3DSRA 1ZD8A 4L16A 3T9EA 3L4JA 2JW5A 3ENZA 4FFRA 3IDFA 3DXYA 3NLLA 4TXLA 5DX0A 1U7TA 2QAIA 4Q4CA 5J1TB 2ZWPA 5M34A 4HS9A 4QFDA 4D8YA 1WXXA 4I9NA 5TQ2B 5IW8A 2Q6OA 4R84A 1N2HA 3NG1A 1DUIA 3BOSA 3T9DA 1RBQA 1EP3B 4CKBA 3SHWA 4D6YA 4M6WA 5C5DA 2BGJA 4RDCA 3HVKA 4U39A 1V3VA 1DAKA 3H84A 3JTMA 5L4LA 4LJ5A 1FZQA 1RWOA 1TIKA 2IP2A 5ECWA 5IJAA 4ZZIA 3GQBB 3NGXA 1CF9A 1O57A 1SVKA 4PO1A 4PVCA 2QGZA 3AL2A 1JYFA 1BW9B 3RM3A 1LDEA 3BMXA 3MAAC 2IYOA 3PCTA 5J59A 3UCEA 4DR7B 1P0PA 1HPLA 3BZUA 4C0QC 1UM9A 2VL7A 2CB9A 4L2IB 3MWDB 3HYRA 3ZCRA 4CKEB 1ZNQO 2EKDA 5EJFA 1LTKA 2QYTA 2WWFA 1L5OA 3IP3A 1BQEA 5CHEA 3DZHA 1D0VA 1CDZA 1EWRA 1HLDA 3CRQA 3D4LA 4H16A 4I55B 3RHSA 3TD2A 2HPHA 1X9HA 4F5DA 2EFEB 4G63A 4BPRA 1CIPA 4EX6A 4GRAA 1BFDA 1H2RS 2AFRA 2PWPA 1N1MA 2DPLA 1E7QA 1CUCA 4GI7A 3H9UA 4KXUA 1KDZA 1CLEA 3O82A 3JAKA 2HAEA 2W6ZA 1MAVA 3LK6A 4LF9B 2WWRA 1QOZA 3WSTA 2OBBA 3QWAA 3C3JA 4IV0A 4QSHA 1QGAA 3HXKA 1S7GA 1M6WA 2VK1A 2CXXA 4JIGA 4Q4LA 3CEMA 4CM1A 2ANCA 4KPGA 5D5HA 1EA5A 4MP8A 4Y6QA 5I4CA 4RFLA 5IZCC 4H31A 3F90A 3PXGA 4JAVC 4JI8B 2FB9A 1TPZA 2ZI9A 2RMKA 2QBYA 1XR3A 3HU2A 4BVBA 3PC4A 4Z0NA 4BO7A 2EEPA 1E9EA 4MVCA 3GROA 3RVNA 2R8BA 3MT8A 1R6BX 4QYIB 4Q0MA 4U7HA 4YMSA 4TMVA 3A4NA 3P4XA 1F8FA 1TYEB 2CUNA 1EFUA 2BUAA 3H9CA 3WISA 4FEEA 3TTWA 2RJNA 4YRTA 1SUCA 2JJMA 2WKSA 4KGDA 1E1KA 3EC7A 4L4UA 2BI7A 5B6JA 1OC4A 1N6HA 3DR3A 3A06A 4IMPA 5IU6A 3ZDCA 4MWTA 5BOSB 2X42A 2FW1A 1TUIA 1G6Q1 2H16A 2W6OA 3JD2A 1G41A 3QUCA 1II8B 5TMEA 4U8GA 1YVRA 1T2UA 4NWIA 2VWQA 4G26A 2PZMA 3MJSA 4NG4A 1W87A 3PGA1 4M0FA 2RH5A 3I2IA 1ESMA 4JIMA 4K9MA 4RK4A 4J49A 4MVJF 3A6FA 4U9IS 3WHIA 3AOEA 3BHNA 5HUJA 2Q50A 3MWYW 1E2GA 2W2TA 1HXHA 3EVGA 3BBLA 4FI3C 3UMVA 5IZ4A 3NNNA 4RKYA 3I61A 5AUNB 3MINA 4NFYA 1W8DA 1ZW1A 1P19A 1KSJA 1Q11A 2JGLA 2WW8A 4XYBA 1GKYA 1V4NA 3MT0A 2CNOA 4CT5A 1JWLA 1NBMA 2GUWA 1IM2A 5DE3A 5K1ZA 2GLUA 3IP9A 3UV7A 3ZYCA 4C0KA 1F0PA 3DTVA 2A5JA 4JITA 4HR7A 1U8CB 4LXXA 4R8VA 1AMOA 4X00A 5CFZA 2GHRA 1DFGA 1H2WA 1PR3A 1P61B 4ZV4A 3MWFA 5ES3A 2O2GA 4E32A 4IF4A 4I2VA 4EAQA 5U9CA 3A1UA 3FWKA 1YHZA 4FFVA 4IX9A 5AW7A 3JYPA 2EEZA 3CLTD 5TT0A 4DV3B 4NARA 2FRXA 1J97A 1CRWG 1MB9A 2JD1A 2GCOB 3HKEB 4I1VA 4IXWA 3K9NA 4HLDA 1ITZA 4MUKA 1GZ4A 1WU7A 4WH0A 2IBSA 2VYFA 1L5FA 2G04A 2GPNA 2B82A 2DB3A 2H1OA 2W6PA 1EFCA 2J0SA 1DC3A 1JZQA 1PEDA 3EVTA 5CYPA 3TJRA 1H3EA 1CQPA 4FSDA 2PZKA 3MTBA 4C88A 1POWA 1QH8B 3D54D 1RJWA 1NKSA 3FMGA 1FTSA 3QU4A 3UJ7A 1UDWA 5CPFA 4KPUA 1E6KA 4OXYA 3WLJA 3KT8A 2QPOA 2WU4A 1V11A 4I8XA 5K6TA 1MIHA 4Q19A 3MBKA 3M0EA 3OOYA 4FSXA 1B42A 1P45A 1EHIA 2B1RA 1M5RA 2J9RA 2LPMA 1IOLA 3NX4A 5ALKA 1DOHA 3TPFA 3OE4A 1XL1A 5KWVA 3RS8A 3AFOA 4P38A 4EM6A 4D57A 3NONA 1JQBA 2VEOA 2PQMA 4ILEA 4FB5A 4NENB 5AH0A 1WOMA 3R9IA 3PUZA 5BYAA 4X66B 2C1XA 1O8CA 3OE7A 3VGPA 1UBTS 2FSGA 3OJOA 3VR5H 3UV6A 4JT8A 5JZVA 2FSUA 2PVCA 2RC6A 3DLCA 4H3HB 1FMJA 3VSBA 4B09A 2FWBA 1M2EA 3QLEA 1VZ3A 2PZLA 2VSQA 3X1YA 4E5MA 2P69A 4O1IA 3BMNA 3T35A 1XZ8A 4KPEC 2BAGA 4RA6A 4RPGA 3D02A 1NNUA 3F73A 1GTRA 2EJWA 1PUXA 3AFHA 2DPYA 1FFBA 1WCV1 1ATIA 2FV8A 1GUFA 5BNWA 3F3MA 2X4DA 1YRWA 3EZYA 1MTZA 2CNKA 3NHLA 4MV0A 3VTAA 5G41A 2O14A 3K2EA 4LOLA 3PCRB 1I24A 3EPJA 3I9MA 2OBFA 3CURA 3QPCA 5K01A 4LY3A 3E2PA 4J1TA 3Q3JB 4X65B 2C3MA 2RHJA 3VU8A 4F5YA 2FW6A 4JL6A 3ZW7A 3O21A 2WUGA 3L7OA 1TKBA 1VIAA 2V6IA 3H1TA 1BJRE 4M0EA 1ZVMA 2PKXA 3RLFA 1O54A 2IXFA 1YZGA 3FR7A 3GG9A 4FCCA 2B30A 1HM5A 1SVIA 5EYPB 5A6SA 2BFEA 2PZBA 4JXXA 1NTRA 2GARA 2JCXA 3DCYA 3KTOA 5A4KA 2ICAA 1ECLA 4LBZA 1GDTA 1MOQA 1PWEA 2FKAA 2JJ1D 4Q02A 2OGTA 4KAXA 4BFWA 4EELA 2UV8A 1AX9A 2OHVA 1Q0QA 3AJAA 4HJRA 4WZZA 3WSVA 3MMXA 3NAZA 3EPLA 2HCRA 1E18A 4C4XA 1XEFA 3UG6A 1LPNA 5L7TA 3EYAA 1JEOA 2HBYA 3A3PA 1QAMA 1XCLA 2OHOA 3KB2A 2W0SA 2VWGA 5ERGB 3WJ1A 4LJRA 3F4BA 4D45A 2G63A 5K51A 1RZUA 4QPDA 4XUCA 1DBRA 1MZVA 5HKKD 5LA6B 1R5OA 5H8WA 3ZDBA 4Y3UA 5DM4A 1NMQA 2YRWA 1QFMA 1VE1A 4FIZA 4HX9A 2Z4RA 1SHLA 2Z5VA 3MTEA 1LRKA 5G2OA 4EF4A 5A5FA 4S3MA 4MV6A 1SU6A 2G6BA 4NBRA 1NBIA 2COEA 3P2OA 5DCLA 1UOOA 2AG5A 1KDRA 2Q4EA 1VKHA 4U7WA 4B31A 1WB6A 4BKMA 1YCDA 2O57A 2X0DA 3T41A 1BDBA 3A9CA 3OEHA 4N76A 4IJ6A 2OOKA 4X45A 4C2TA 1A7UA 1I9GA 4ZV7A 9LDBA 5CAEA 3Q40A 4FYJA 1K6EA 4Q6WA 2FSSA 4UUOA 4C0SA 2ZB2A 3P20A 1FW6A 3KSUA 4JU8A 3OY2A 1JDBC 1CUIA 3L8MA 2EFJA 5E0OA 3RRBA 4MQLA 3ANSA 5CLQA 1KYXA 1IJKA 4GDMA 3RVDA 2X4GA 5DNEA 5FYDA 2VHZA 4MEBA 2OORC 3U5ZB 1LZKA 1GUYA 4L7QA 4TWRA 2DERA 1V7ZA 4RH0A 1BH2A 3TW0A 4RZUA 2G0NA 3X3HA 3AR9A 2B5WA 1MN6A 1PJ8A 5CJ2A 5B7PA 1TU3A 2YQZA 4IS3A 5C53B 4GOOD 1K63A 1STOA 2NV0A 2PANA 2AUMA 2YQ5A 1SIWA 1RI3A 1XZCA 2H7XA 3DV9A 4GKBA 2H2AA 2GH1A 3C1TA 3H7AA 4P7FA 1SAYA 2APJA 4PPYA 5ECDA 2JJYA 5F5NA 4ZHQA 3JZDA 2P0AA 2P11A 2V97A 4KGXA 3BJRA 2I54A 2ET6A 3IEMA 2AX3A 2A5GA 4RPKA 2HU2A 3KEQA 4DUZB 1NDUA 2POQX 3G88A 2DUUA 1Q77A 4YRRA 2E3JA 2C9YA 1L7RA 3F9CA 4IQ0A 2Q7DA 3TIFA 1OXMA 5C8YB 3IT2A 5K0NA 4JJZA 4N5DA 1F17A 2VPTA 4ZTUB 4UTXA 3CR7A 5FV7A 1PJTA 1IBCA 3N39C 1ZM3A 1XU9A 4MAAA 4M54A 1EGHA 2R47A 3HY4A 3QFCA 3IVXA 3G5AA 3QGMA 3TZEA 1BEEA 4KQCA 4O5AA 2I29A 4NR0A 4BXOA 5JWRA 1WZIA 2LWIA 5FPQA 3WTBA 2RHWA 4WTOA 3BXEA 3LLUA 3VU9A 4EUHA 3BILA 1VPWA 3STVA 2BMFA 2OL4A 3H2HA 4JJAA 4CM4B 1CZNA 1UQUA 2HIMA 2V7WA 4DIMA 4RVDA 2RGXA 3V1NA 3U3KA 2M98A 2N75A 2VZEA 4XTRA 1URPA 1CJTC 1KJ9A 3NDJA 1JWBB 1YJ5A 3DUWA 4JUAA 1LLDA 3WZLA 1ULTA 3OZEA 1JKIA 3JASA 5HDQA 1C7RA 5LU8A 1C1XA 1WHTA 2EIHA 4OP2A 5EJ6A 1GA4A 2VBGA 1HDXA 5IH3A 1IPFA 4LMBA 3G9QA 1U0NA 4NDZA 4RD2A 4B2IA 1KJJA 4DLAA 6REQB 2WT9A 5GJBA 1Z5GA 3L7JA 2D5AA 2P77A 3EPRA 1WX1A 5LDDC 5C80A 4PW0A 1JYEA 2C2HA 3U7EB 2HCFA 3H8VA 4HDMA 1YZ3A 2H8GA 3SEFA 3AESB 2V03A 4Y2UA 1OROA 4B45A 1RYNA 3E27A 2Q3CA 4L5YA 4QT0A 4QXAA 3LKDA 1FSZA 1NOKA 1NVEA 4OXKA 2PZAA 4CCWA 2X0EA 5G0TA 3C7KA 2PMEA 5TQ0A 2I03A 3ZCVA 4J43A 1BMDA 1JEJA 1N57A 1UPCA 2Z43A 3EZ9A 4XYMA 4IHJA 1F3OA 3CUTA 4ZI7F 4NOKA 1BYIA 2C2OA 4KITB 1KYWA 1PX2A 2WWYA 1TEXA 1KK2A 3IEVA 3KAKA 4NABA 4L22A 2J46A 5B3LA 1NW6A 1ZGAA 3QI7A 2W2OA 2ZCVA 2ZRAA 1Y4SA 3DULA 4LGVA 3DVAB 4KKXB 4LJ6A 4NOMA 4A2WA 2X9NA 3JR3A 3A1VA 3EULA 4C0WA 4F72A 1ETUA 2K5UA 3P9YA 2D2EA 2XVXA 1FTQA 3MPOA 3WFIA 1NP6A 3EAGA 1W46A 4B83A 5EWJB 4E2ZA 1B0ZA 4RU1A 3EK2A 5IXJA 3C3EA 4H77A 4AJ4A 3H4MA 1EVLA 1U8AA 4GM1A 1FFGA 4ROSA 5DISB 3VHRA 3AFMA 2B4RO 1IHXA 1RQXA 2GA8A 1GZ6A 1QYXA 1RQGA 2JJQA 2QLTA 1ISRA 3H1GA 4D8TA 1TF7A 3ZZ1A 4C05A 1MZPA 2WU8A 5D6NA 3BKXA 5T4FA 4C4PA 1ABFA 2JAUA 5B1EA 3S8YA 4BZQA 3Q5EA 3RUIA 4B4OA 3C97A 4DA0A 3CX7A 2PSDA 3IHLA 1ISFA 1FUYB 5LMNB 5JEDA 2FA9A 4JBWA 4BZZA 3ZI4A 1G21E 2OCXA 1U0RA 4I5FA 5J2UB 4C14A 1NBWB 5JUWA 3E1GA 3P9PA 3J81A 3ZU2A 3ESZA 1QS0B 5FJIA 2BJVA 4WERA 2NU9B 4IEEA 4P1ZA 4AZ3A 2FN7A 2FZVA 4G25A 3CLHA 2DHQA 2JFZA 2OUIA 4TTTS 1W19A 5E38A 5KWIA 1J8MF 3KE8A 2FX2A 3U3MA 3FJ1A 4XVUA 4PO9A 3WGZA 3P9SA 1NJ1A 3Q7QA 3NBFA 1RQRA 4MYTA 4RHFA 4ESOA 4X1KB 2HJWA 5JZ9A 2MIIA 1P1JA 2I6FA 2XNJA 1C0EA 4FFWA 3IKJA 5GOTA 4V2IA 3EH1A 2E2WA 3QV1A 3BXPA 3IAUA 1KO8A 4Y6PA 4R8KA 3FY4A 4DRYA 2FFRA 5BR4A 5C8VA 5JH7F 2OBMA 4IV8A 2UZ3A 4QPJC 4P0PB 2J9YB 1P2VA 4W1RA 3FX2A 3A14A 3JAWB 2ZS9A 2NPOA 2GF2A 5EKUA 5A6VA 2FOIA 721PA 1W2GA 3KJEA 3AQIA 2WWIA 3L0BA 4NMHA 4O4LA 4FBMA 1Z36A 1MLDA 3AEQA 2R1TB 3OE1A 1UFKA 4NZ9A 1K6XA 1PTJA 3N2KB 3A2LA 1PVVA 1IUKA 2J09A 5LYJB 3IQWA 3SZLA 3MC1A 5CH5A 5JXJA 3ZLBA 1EK6A 2XMDA 4CETA 4PGGA 2D4HA 2X8JA 5LP1A 4QBGB 5T8KA 1SD1A 4QYWA 1IB6A 3Q2OA 1KI4A 1WUHS 4TS4A 1PEKE 4TL8A 4JB2A 5CR9A 1KC3A 2JAPA 4O1MA 3OEYA 1AQIA 1V3TA 3IKLA 4LGYA 5L40A 2RAUA 4HDAA 4C7VA 4ZN6A 2AV6A 4KXNA 1LRLA 3L8FA 4TRNA 5J3JA 3ETEA 4XJVA 4K1XA 4YYEA 4IO1A 4FB4A 1FDWA 3VZDA 5JNRA 1NOIA 3BCUA 2I6UA 2JAXA 2JJ1A 1JMKC 1Q1AA 2FP4B 3WO1A 2YWCA 1JU3A 3U6BA 2WKWA 3C6QA 1G8KA 4X7MA 3LWNA 5FA5A 2M6KA 3TM4A 4F4JA 1R27A 4PTZA 3R5TA 1RQ7A 2AEFA 2O6LA 2R9VA 2EFDB 3WGTA 2WTXA 4CDRA 5EAIA 1I6KA 2FEPA 2WAAA 1FZTA 5TIIA 1ISGA 3SEZA 3WKCA 5HKKA 4MS1B 1TK2A 2R6ZA 4QECA 1MOPA 1Z6TA 1C0KA 2ZGVA 1Z4NA 2AA3A 3KQYA 1EFPA 1IDN1 4IYJA 4UC0A 4DQVA 3BMQA 4MQ6A 1AXGA 2EWMA 2OGSA 3PRJA 4F38A 3JRXA 5FL7A 1KQNA 1WXHA 4QYSA 1XRQA 4TKUA 1V43A 1HSZA 4YC7A 2ZTLA 1OILA 5E7IA 3KQUA 4DMHA 3NGLA 3GJ5A 4DWOA 4IW3B 2A67A 1OX5A 3K1ZA 1A9XB 4XJTA 1J39A 1E20A 3D8RA 4TMKA 4NCAA 4IVRA 2ZAGA 2H06A 3HWRA 4EF5A 3AJ8A 4TQUS 3O03A 1P1FA 3IXMA 4WXRA 4AW9A 4KXLA 4I4NA 1J8YF 1ZOOA 3AU9A 3DFUA 4MKXA 2SHKA 4C03A 3HZOA 3A1WA 4CLEA 5BW6B 2AQHA 3MVEA 3ZG6A 2B94A 2PX2A 3MOGA 1ZA2A 1ZMTA 1L6IA 3EIHA 3IJEB 3VJMA 4L6AA 1KQGA 1CR4A 2DQ4A 4WUTA 2EIXA 3IOYA 5AW9A 4Y1RB 5DLQC 4GL4A 4BLRA 4GXRA 5CM9C 3WRYC 5JJKA 1E5XA 1VJ1A 3L02A 4EJSA 1IBMB 1KY2A 1VG0B 3NOOA 5HEKA 3FOCA 2EFHB 2X4IA 2Y1OA 3WA7A 3L7BA 2Q5CA 1MO5A 2ZDHA 1SN7A 4RDHA 5HCUA 3OPYI 1XZEA 3T7CA 3EG9B 3CH7A 3OUUA 5JI3E 5LQKA 4WX2B 1GEEA 1FJHA 1NC1A 3P52A 4W4TA 4X7BA 4YS6A 1ZONA 3DV0A 1CS0A 3SLKA 5E95A 1LTQA 2WKPA 5FH9A 1GNVA 2V45A 1ONBA 3AYXB 4K6CA 1D9ZA 3UT5A 2Q5HA 2RGCA 4AZTA 1KEZA 4BNDB 3MRVA 621PA 1ZM7A 5BMVB 4L4YA 3R09A 3VAYA 2BP7A 4ACAA 2QY9A 1GTL1 2YUIA 3BB3A 1K6IA 4IQGA 3KOWA 3KAJA 4B4UA 4L27A 1OH6A 4MHTA 2AKYA 5CYOA 1M8PA 2HF7A 4M1SA 3OOJA 5CA1A 2C8KA 3AY7A 3W2TA 1QWOA 3OZAA 2BEUB 2JIQA 2PK3A 4QYTA 3FSEA 3V7WA 3ZLUA 1S2GA 3EXHC 3H2YA 1N2OA 3F0TA 4OQQA 3TRKA 4OHVA 3DCJA 3GLGE 2X8AA 3D3WB 1U8XX 3DE0X 3PF8A 1NMXA 4ZYWA 2EZTA 2V4ZA 3BA6A 3L9WA 4W5QA 1RYFA 1YOVB 3AVXA 2AD5A 5BQPA 3I8SA 4HQNA 1V95A 2KS6A 2H5LA 3QMVA 2DKFA 1BJTA 3NU1A 2OA0A 1E6CA 2GLXA 4IPTA 1T0JB 4ZTBA 1SB9A 4JOBA 1J2TA 1YQXA 2X9GA 2B1IA 2XMSA 1K89A 1NR5A 3EGXB 4UUQA 2RHRA 3HB1A 3LP6A 3T52A 2BFMA 3D3EA 5D3ZA 4AJ1A 3WWOA 2ZQZA 2CDRA 2VT7A 2HH9A 2HRZA 1X7ZB 2FRVA 2JI9A 3F5SA 3AP1A 3QVSA 4P7KA 4X7PA 2NADA 2FHPA 1T0PA 3KR0A 3LT2A 3QU5A 2QUIA 3QW2A 3RUFA 3ABSB 4Q3EA 4BP1A 4YJ3B 4F0JA 2ZYAA 1RNLA 3KPYA 2VUIB 4LY9A 2RKBA 2A1TR 3R0XA 1M75A 5EIBD 4ZWNA 1P7PA 3TNLA 5EWMB 1UXOA 2D1YA 2O8BB 3WIEA 1M76A 3I04M 4KR0A 2FMKA 1AKMA 1CP3A 3KR1A 4FYMA 3LFUA 3DBLB 3TL3A 2DFDA 1P1KA 1VKNA 1GU0A 1WW3A 1T0IA 4CQLA 3PQ2A 4Q1EA 1R9MA 5CHYA 1K9VF 4B6EA 1WB5A 5JSQA 5CB4A 3QIVA 3WYFA 4ZO4A 3DKKA 1BHO1 1T8YA 2W22A 4GBGA 3LY8A 1GADO 4P53A 4B2PA 3UWKA 2XKKA 5D51S 2HFJA 4AJJA 4L72A 5A4FS 2R8EA 3PXBA 4UDXX 4EDFA 1H3NA 3B60A 5ED4A 4BBJA 3V7UA 4DA9A 4QJBA 5DTEA 1W30A 3TTUA 2IWRA 2I7CA 1EHYA 3ENVA 2EOAA 2GFIA 2XQIA 4EB6B 4J3JA 4BLQA 3GUZA 4KGZA 3FYUB 4BTEA 1UWVA 3W8FA 1PFQA 3DOOA 4L8FA 1GTSA 2XQJA 2C92A 2FCRA 4FFOA 3P9XA 4HK4A 1P3DA 4HEJA 2H0AA 3SZUA 4ECAA 1AQJA 2ANBA 4I5EA 4XJXA 3LFHA 2C5HA 2CLMB 1EGQA 1B2LA 1RFLA 3TXYA 2ATCA 3COZA 3QMMA 3JQBC 4PC1A 4X6XA 4ABYA 3ONDA 1AO0A 2XYHA 3ICPA 3NP7A 3ZKAA 1WBJB 1YRBA 4K9SA 2WYOA 4MR8B 4HNGA 1W4BA 2IVFA 4AYTA 5EUCA 4JJEA 3JQDA 1HE3A 4LV5B 2FUKA 3HBJA 2BR5A 1MQSA 4BNJA 2YZKA 2D1SA 1RCFA 1A72A 1JIUA 1X8JA 3F7TA 3JY6A 1FQKA 1SUEA 4JN6B 3N7TA 1QZZA 2H00A 1L8LA 1RRVA 4ZQHA 3LTNC 1UK7A 1AOXA 4U9HS 3T4UA 4O59O 3CZPA 3W7VA 3KJGA 5HTKA 1TE2A 4S1WA 1THTA 2XMCA 1QKIA 4BE7B 1IJFA 1X92A 2XJ9A 4BQPA 1XXHB 2ETXA 5BV8A 3UFXB 2EATA 2X0JA 1PFVA 1XVIA 1Y3FE 3K0CC 4G1BA 2BIFA 4WXPA 2IOFA 1QOPB 1VPTA 2DF8A 4ZC1A 1Z6ZA 4N8EA 1XC7A 4PYJA 1Z2AA 1JLSA 4TS3A 3JCZA 5ICSA 2N42A 3H1EA 4PCAA 4XCXA 2DQYA 1NMYA 1ORWA 3FM9A 4PLCA 2FLVA 4XVCA 1Z28A 4R1NA 4X41A 3SF8B 2J5BA 4LVOA 1QRAA 2DVMA 4Q3LA 1KO5A 3ED1A 5JO9A 3C7AA 4R7ZA 5AHWA 4B7ZA 4R1QA 3SSNA 4L0QA 4DYDA 3I2HA 1E9VA 3A4TA 3W7BA 1YE5A 4JGBA 4MS4B 2V5VA 3FMOB 2J6CA 4ZVKA 4ZQBA 4Z9FA 5HK8A 5T67A 2XIJA 5LB4A 1Q7CA 1RBZA 2OMEA 3AUUA 3T9BA 4EYOA 4CEJA 4IILA 3T94A 1Z0JA 4BZPA 5GONB 1R1DA 5DEOA 4O33A 3QK7A 4A03A 2D2IA 3HN7A 4AJ2A 3DVLA 1O87A 5CK4A 2WY2D 4DA6A 2AKEA 4HUTA 1XKTA 1KF0A 3VKVA 5J40A 4BYGA 1A4IA 1C14A 4KOEC 1OE0A 3IURA 1OAOC 5LMCA 2ONKA 1ODKA 4N0QA 2OUKA 4EW6A 1LPAB 1PLLA 4OY3A 4QUDA 5DT9A 4D81A 2EQBA 4MSUA 1WDTA 5JBQA 3TNJA 4B1FA 4D0SA 5DPMA 3VDMA 4LZJA 1CF4A 1ZVKA 1XLUA 2NPFA 2H1RA 1KR2A 1BKYA 4D99A 4JQSA 5FTWA 5KVCA 4Z4HA 1M2VB 3IQHX 4ZT3A 1VJDA 5E2AA 2D8AA 3A37A 1AQLA 1T5DX 3SEAA 5JHGB 2ZIEA 1P9OA 2XE4A 4LXTA 1P0FA 2CSXA 1KMMA 1NMZA 2H65A 2R6DA 3O3OB 3QNWA 4LK3A 1GKUB 1R18A 1Y8RB 3IVGA 4RD1A 3RIGA 3V2GA 5IYZA 5G3YA 4M9QA 5F1YA 1MAWA 3E8MA 2XUHA 4TLCA 4WKPA 3WLSA 2AOWA 4JI1B 5M04A 4YT8A 1MIOA 2G9UA 3OLYA 2WFZA 3L7NA 5EQFA 4DQ0A 1L1QA 4O1HA 2Q1YA 1Q17A 4OP3A 4IUCS 2OB1A 2RGNA 5IVHA 5JRJA 4XUEA 4EI8A 1COWD 3ETNA 3QF4A 1SUSA 4RXTA 3IAFA 4L15A 2H4JA 4C3UA 2CCGA 1A9RA 1KI7A 2XRFA 1MG0A 3KSZO 1YXMA 4ISBA 3RLIA 4BVKA 2C2KA 3A6DA 3UNXA 1EEXB 5TPWA 4BFXA 4BO5A 2KX7A 2O8DB 1MXFA 3CLSC 4WZBE 2W6ID 3V1TC 2C88A 2BGUA 2K4MA 1I9CA 1JG7A 1D2MA 1DIOB 4IZOA 1NI4A 4CKZA 2YCBA 2A3NA 4AJKA 1YBFA 2CJWA 2WJIA 4Y6RA 2R00A 2G1UA 2NYRA 3MTQA 3U7HB 2ONZA 3GXBA 4BX0A 1E61A 4K9LA 1PFYA 1AKUA 5BSTA 4YIHA 2B21A 4Z9AA 2YMQA 1DC8A 5AXCA 4BO6A 2G76A 4MWSA 3O8QB 2ZBDA 1XQ1A 2CVQA 5D1NA 2DH5A 1J5XA 3UOAB 1JIKA 4Z0HO 5HZGA 1C80A 4ZKEA 4F3KA 5A5GA 4DR6B 2CD9A 4M53A 2MDTA 1NLUA 2HRDA 2QD4A 2AJCA 3CF4A 4J16C 4HYTA 3ENNA 3RSLA 4QGFA 1CY6A 2GJ4A 3REOA 3RNLA 3BGSA 4H4DA 5EERA 1G21A 4ZCQA 1KKMA 4ZCTA 2NZJA 3QE4A 4G0NA 1GQRA 4QU8A 3EJ6A 3ZZ0A 2WR8A 3PNQA 2OLEA 5AJWA 5KQRA 3GP5A 4QJIA 1F0YA 5LA6F 5KYVA 2FPOA 4YUWA 1CE8B 1WXIA 4YJDA 4Z4IA 1FLAA 3BIJA 1I7LA 4LOKA 1U3CA 2OC9A 5AKLA 3A0UA 1KZHA 4JLJA 2AMJA 5AK6A 2YBEA 4G5XA 3L7KA 3AG6A 4QEDA 5IMBA 1D09A 2QUZA 2VPXA 1G1AA 1NJ8A 1EJ6A 4XRGA 1GQYA 3LY5A 1TLLA 2ZJZA 3FI9A 3JD0A 4ZCIA 2VNHA 2BTQA 3WNBA 5JV5A 2VYVD 1S9HA 2BGWA 4DF3A 4RSRA 2ZJ2A 3T9FA 2FPXA 1SHZA 2CNBA 2R6AA 4O2BA 1M1XB 1ZWLA 2GCPA 3SSOA 3LX8A 3C48A 2P1ZA 1DRVA 3OQPA 4BB9A 2Y3IA 3AR5A 4E2WA 1WEHA 1Z45A 1X7WB 3LCCA 2JIZD 3OCWA 4GOMD 2Y9MB 3R9KA 3KB1A 3VR2D 2D5IA 4RTJA 1W9MA 1MA3A 1VSQA 2B3DA 2VDKB 2Z2IA 1DOZA 3OTQA 3VC2A 3B1WA 5IBPA 3FNRA 4GKAA 4KH1A 5I8WA 3I83A 4KQ2A 3EGEA 2GYYA 2HF8A 2HLDD 5EJAA 1EFAA 3DEFA 4EUSA 3IIKA 5DLDA 5ECYA 1LW6E 1SEVA 1I13A 3L0OA 4W5WA 2PUVA 4JA0A 1N3IA 1HH4A 1WBBA 1YDEA 5H4GA 1OX4A 2HPAA 1B8VA 1ZMRA 4CCAA 1ZU4A 2ZTSA 1Y3HA 4F46A 1CDDA 1I1NA 1OPRA 1RS0A 1MTOA 1FRVA 1YU9A 1AC5A 3M5DA 1DE0A 4ZT6A 4DN6A 5BSFA 2O50A 4XQ0A 1QRSA 4JJFA 1JKJA 2YNMD 4KFSA 2ZYGA 4Z9YA 3U3XA 4HVLA 3O8NA 5BPFA 2V7XA 1O9HA 4OTZA 1A4XA 3N8GA 4EB3A 3QXCA 1EQUA 2VZLA 4EMBA 4EPVA 2JEZA 2PU5A 4PZAA 3KFXA 3K6SB 1UMKA 2E7ZA 3Q7PA 1P77A 1Z0IA 3NT4A 3AO0B 3Q9UA 5IJZA 4JI7B 3IIEA 2DLDA 4LFBB 1U7ZA 1Z08A 2FR8C 4R3WA 4RLSA 4LJAA 3UUWA 3U3OA 1ADYA 4CQMB 3BBPA 1SKBA 4PC6A 4JC0A 3EZ6A 2OAGA 1E6WA 2JRLA 3UN1A 1V71A 2IYYA 1N0HA 5KAPA 3MJTA 4FFSA 4ZZ1A 1R74A 1P4RA 2WU1A 2YJ4A 3IE2A 3UGQA 9ATCA 1H0SA 1REQB 2D74A 5ITZB 5B1SA 2CV2A 1EWKA 1E0AA 4LPSA 5A9SB 1CQXA 4U6NA 1GPH1 2JFHA 2GXSA 2MSCB 5CYFA 3V4OA 4AWAA 4GLFA 4PPGA 3QIAA 3KHSA 5HJ2A 4F3NA 5AM5A 1L5WA 5C1IA 1YI1A 1I3MA 4A15A 1VPDA 3NWPA 2Z5GA 4H6PA 4E31A 4L8LA 2I9KA 3H2GA 3PBKA 3G2MA 3HWWA 1YB1A 2QSYA 1CG6A 2WJWA 2WWHA 3E7WA 2B0JA 3JATB 3PSHA 3SYLA 4DMKA 4XSGA 1J2UA 4W6QA 1I0ZA 1RLMA 2HU8A 3E7DA 3NKLA 3Q3GE 1MJNA 5MN6A 4GZMA 1HEUA 4XWOA 4N7MA 4A2PA 1HI9A 3M2PA 4N49A 3WV4A 2PG3A 1NW5A 2AN3A 4PG8A 1UKAA 5EZYA 5JR3A 2DBVO 3A6KA 3ABZA 5IBQA 1UC5B 4MB0A 3WE7A 2PGOA 2I2XB 4CEHB 2IDKA 3OZRA 3ZJ4A 3HHEA 1NQUA 3ZE2B 2HHHB 3U7QB 4Z4CA 3U37A 2ZSKA 1BXZA 3PTZA 2DM6A 2Y1DA 4RHXA 3HGQA 2Q3BA 1THZA 1U0GA 3UY4A 3WLFA 2CF6A 1TB4A 2W6JD 4LVNA 5KTMA 1LUAA 1KSFX 3UB2A 3O8OA 5C8ZA 4BQNA 3VTKA 4CLRA 1IE3A 3K94A 4PYNA 3NHPA 2G72A 4RZSA 1K5HA 4ETNA 3N6RA 1EIWA 4D5GA 2J9ZB 5ICGA 4RKFA 4DNPA 4R0VA 3Q7EA 3WLNA 1RLIA 2D0DA 2GKSA 3LP8A 4E08A 3R8FA 2XIQA 4CIDA 5DNDA 1JBQA 3HEMA 2C5LA 4LHEA 3QLJA 3R7AA 1W5EA 3AF4A 2IPXA 2C0CA 3JQ6A 3FHCB 3ICWA 3K9GA 1Z5VA 4N7RA 2QYSA 1PJ2A 1A77A 3COWA 3EFHA 4UPVA 5EP1A 3WYCA 3DW3X 4OBXA 4EJSB 3NYIA 4ITRC 1IQPA 4XX1A 4CPDA 3LHSA 3CVUA 3DLHA 2FQYA 2HZBA 3GLGA 3D1VA 3ZIAD 4HG2A 3PA6A 3D1LA 1NATA 2V5AA 5ALRA 4MUNA 3CLUC 4FS8A 2IA5A 5F21A 3FGZA 4POOA 2IEDA 3K96A 1DJLA 3TPZA 3TG8A 4KR7A 4A5SA 4G0OA 2COUA 4NONA 4V0KA 2B2XA 3OKFA 3Q3EA 1WPXA 2GF0A 1TEZA 4E5YA 1AGNA 3AI3A 8LDHA 4RULA 3G7SA 2A9RA 1J1IA 4F60A 1DQPA 5AXBA 5KVSA 1RSZA 3GP3A 3PXUA 1BE8A 2PMWB 1KIAA 4LQ4A 5J2UF 1DXOA 1CY4A 1WVGA 2WQ6A 1JEEA 5KOHA 3CHYA 2Q2VA 5LOVA 2ERXA 4OI2A 3OZTA 1G64A 2H1HA 1A8HA 3HCPA 3NYRA 4RMJA 1OWPA 4PAMA 2Y77A 5FPKA 3HDVA 2IS4A 3D4NA 2WD8A 2PQ0A 4BJ5A 1WLSA 1KHTA 1XJ5A 3AR4A 1R66A 5AESA 3U49A 3OF2A 4RENA 2XAAA 4DXDA 5AVVA 3CJRA 4WK4B 3ZQUA 4JLKA 4C0LA 4LZNA 1U5BA 3FUUA 2FG6C 4N0MA 3FPHA 3K9WA 1NFRA 4GOXA 5ER6A 4K6KA 2XOKD 4MIOA 3JYOA 4EECA 4EUKA 2OPHA 2GI4A 2R8ZA 2LTAA 5CP8A 1JA0A 2IYFA 2I6TA 2UYGA 1RAHA 3IQDB 2XZLA 3CRNA 2SKEA 3E5HA 4MRRA 1BD3A 1COWA 4Q05A 1UBRS 2R4TA 1QU2A 4BL5A 1F2TA 4O5OA 1PWZA 5AI4A 1L7VC 5KTPA 1SIBE 3EZ2A 5LYJF 2BRUC 4RACA 4UDNA 4BLTA 1BGXT 4E7PA 1GAJA 4NBNA 5K45A 3O84A 2DGDA 1N9GB 4YRZA 5DM70 2W6IA 1IK4A 4MEAA 4M87A 1BWPA 121PA 2GN4A 5IAEA 2GF9A 2J4FA 3GELA 1Y7PA 3N2LA 4NZNA 1DXYA 1E5DA 2YCLA 3D7MA 2J5KA 3E05A 1CK4A 3I2GA 3SX4A 3U7JA 2VTVA 3AUYA 4RMNA 4JUBA 4ZT2A 4ALKA 3CPJB 3H17A 4UEWA 1DDGA 1YOBA 3TTVA 5J4HA 3BL5A 1OB2A 1QGUB 2HIAA 1KYIA 4HNRA 4JBYA 5D87A 2JGAA 2P2NA 2H08A 1BEZA 3WWDA 3WLPA 3ZWXA 3TFQA 8ABPA 2SNIE 1NBHA 1SCKA 1R8JA 1YULA 1M2NA 5F7XA 2VRBA 1EPUA 3BXHA 3KELA 2XKBA 1JVNA 1SCUB 4S04A 4REQB 3CEJA 3UZUA 4GM4A 1NPYA 4A9AA 3MS4A 2ZUWA 2OBXA 2XVMA 1XFDA 1CRLA 3LNTA 1NXOA 2FZWA 3ORFA 4TWBA 1Q50A 5BNZA 5A5VA 5JWOA 1NJSA 3ZGNA 1ISIA 1G1MA 2BD0A 2QLBA 1PFUA 3OP1A 1DO0A 5F1KA 5B3JA 5HKAA 5HKBA 2UZ4A 1CHNA 4IDAA 1DBWA 4XIJA 3A9WA 5HIJA 3KYBA 3UWDA 2JBWA 5HZMA 4YN3A 1TYZA 1YQUA 4G5QA 3Q0EA 2VUSA 4J8PA 4KQ6A 3ZWWA 1VRVA 4P92A 1HL3A 4TKVA 2R8YA 2WZCA 1G5TA 4HDNB 5DHUA 2VYVA 4JYAB 4KRGA 1EVYA 3BDVA 1RACA 1SXPA 4CG2A 1OYYA 1H5QA 1RR6A 4NOJA 4N3AA 1CZLA 1TZBA 2F1KA 1V7CA 3BSYA 3EZFA 4ZARA 3DJYA 4C4OA 5B36A 5C35A 4OQ4A 4WLUA 2AI2A 3KT6A 2FWMX 1R5BA 1LBHA 4DCNA 4U6QA 4X1YA 4YHBA 3PE4A 4GC9A 1VHQA 4URYR 2MINB 3QX9A 3VR2A 3L92A 3SVTA 4QDOA 1Y98A 4YJFB 2F43B 5DYNA 1ZHHA 1YQQA 1W6RA 2XLBA 3IAM1 4ZAZA 2AR0A 2ZJFA 3L82B 1NM5C 2DPHA 2HLDA 1J0BA 2HSDA 2F4NA 2G36A 2HQBA 2XVZA 4BNFA 2IIPA 3QVMA 4HNAA 1Y5LA 1DKOA 2GEDA 2YXBA 3T99A 1WY7A 2PUDA 5IVDA 4H9GA 4R31A 4G9EA 3WIBA 2VAVA 1KBQA 5AHXA 4CF5A 5JVDA 1GPYA 3GBPA 3VKUA 3ND9A 4P08A 1T9CA 3O8CA 4DCUA 2YNMA 3MMPA 2VN8A 2YMLA 2VRCD 4BEWA 2ORYA 4OQNA 1XAHA 5KPJA 2R25B 5BMVF 3LV8A 2W2XA 4LHSA 2N1BA 3TLGA 4JX8A 3WLQA 1OAAA 2Y71A 4BNDA 2RK3A 2I91A 1KS9A 4FK8A 1XUOA 3AUSA 4BDSA 4IVNA 5DX1A 1G9TA 4HI0E 4R9VA 2KSQA 5BT9A 3FDIA 2JEOA 2X1MA 2Q29A 3WXMA 4NMMA 2ZYDA 5LKRA 3QVTA 4I5IA 4RH1A 4YNBA 2AFIE 5BQFA 2CF5A 4JLOA 2NU8B 1O96B 1ZUIA 2CZGA 4E22A 3DAFA 3NZEA 2I2DA 3AEXA 3UK1A 3C3XA 2AQ8A 2UYHA 3PPIA 3VU3A 3WKBA 3FAKA 2BFPA 4MKHA 4TYQA 2CUTA 2YZNA 5AJHA 5GGYA 3DF7A 1CY0A 1FCJA 1G0NA 1MRZA 4PHHA 3KKNA 4X91A 2F62A 4O2AA 1MX3A 4QQ8A 2M6RA 3CT6A 1R8YA 1SA0A 1I3KA 3IOMA 5IEBA 5I8PA 4QO7A 4DNFA 4YJ2B 4TTVA 1R0YA 3S44A 1SZJG 4HAWA 3RK4A 3H86A 1GXSA 1FFWA 4I5DA 4NEGA 4G9GA 1N0UA 4TT8A 1CUUA 2A1UB 3ZY2A 2R8RA 3EODA 1UXJA 3CO5A 1C29B 2O7SA 3CVYA 2IXDA 3LL7A 1K6MA 4MX8A 2EW2A 4XE5A 2JKYA 3EQ9A 2WK1A 3OHPA 1L4GA 3DONA 4GVLA 4JQZA 1XMPA 3OP4A 5TQVA 4YJ3F 4E2FA 1AO3A 3AVYA 2R7MA 3AI7A 4WZBA 3TR0A 4ZKDA 3DDCA 2YIVX 1WZNA 2R97A 5EP4A 4B3JA 4YRNA 3OCCA 3IJ5A 2CEKA 3R77A 4IFEA 4MNTA 4Q48A 2GJKA 3KYDB 4UXJA 4YBZA 3V32A 3HK2A 2HHAA 3R6LA 2QG9A 4OFZA 4OI0A 3JSXA 1XVLA 2PZFA 3PDWA 3N5CA 3EWIA 1ZGJA 4EPXA 2W6JA 3A28A 5IN5A 1UF9A 3QXXA 3UB4A 3L46A 3RWBA 1YZYA 4B3IA 1EK5A 1T29A 4Q9NA 3STUA 3L7YA 1DBIA 4CNBA 1JDZA 1Y89A 3RRZA 1MRNA 5SZHB 4ZALA 1U2GC 3KU4A 2OXIA 2OB2A 5GVRA 4MVJE 1VYHA 2MHCA 5BXYA 2AKAB 4ILKA 4XPIA 2FN4A 1NYQA 3U39A 2LCQA 1BN7A 2XMRA 5BQ3A 4NU5A 4UE6A 4D74A 3CEAA 3K6JA 1E9AA 5FORA 2ZPAA 1CUBA 3QYPA 5F33A 4EVRA 1T4BA 4QHYA 1E69A 5FFMA 1H6DA 2JLAA 3P96A 3F5FA 5E9JA 1P4SA 2ATEA 2JIMA 3HEBA 3BMOA 5IS2A 2CHGA 4MI1A 1DUSA 5LVAA 3OQBA 2RK4A 3R7LA 3HE3A 4NMXB 3EMDA 1Q2XA 2OQ2A 4MUYA 4PIMA 2FSVA 4FC6A 5EJEA 3DNFA 1OAKA 4INZA 2IS1A 2A35A 2QT9A 3W1VA 1QR2A 3BFPA 4A4DA 5IKXA 3IEPA 4LC9A 4YAFA 1UMCB 4A8HA 4D42A 2Z58A 4L57A 1FXWF 4OHXA 1OIWA 4IJUA 3GFVA 1EH5A 3AEUA 3RJTA 1XZDA 3KB6A 2BMVA 1MNQA 4BMZA 2VDJA 2CL0X 1HTTA 4HVCA 1CU1A 3R6TA 4C6SA 2D7DA 1JFFA 4EHAA 1UJCA 1PGPA 4XDYA 4E5VA 3GIDA 1SXJE 1IBLB 1ULHA 3A9VA 3GJ6A 5KYUB 2ZIXB 1T5SA 3DBVO 3NVAA 4QPPA 4RKEA 4WXEA 5A4AA 4DDTA 4OJMX 2WBLC 3ZD9A 2VG8A 4MQFA 5BN5B 2OCIA 1C50A 4DMGA 1UANA 4JGIA 1ACJA 1V8DA 3I4CA 3HGTA 1XVAA 1Z4KA 1XA4A 4Y0AA 4DV7B 4UQOA 2XBUA 3V9PA 3VH4A 4H1WA 4DTIA 5IXYA 2A92A 2AZ4A 3B70A 1Z6XA 2ZAMA 2VNKA 3L43A 4IIJA 4KK3A 3E3AA 5JIBA 1W4ZA 1OASA 3ZHVA 5KSWB 3U7FB 3Q8XB 2QTTA 4UBJA 2K7FA 2HNKA 3QPAA 4WFQA 1L5SA 1NVAA 3EXFB 1VRCA 3E5MA 3AERB 3O2NA 5TNXA 7GPBA 1TVKA 2F48A 2H2DA 3H8JA 4UARA 1UDRA 1EX7A 1P9LA 4KX5A 4P5EA 3PUXA 5AK5A 3HR8A 3JYQA 4TN5A 3VNSA 1E5LA 1GA6A 3LIPA 3RTCA 1I5OA 5DB4A 1T8SA 1YONA 1U3VA 2QXTA 4PSKA 4GDFA 4IJVA 1CX9B 2X5XA 3BS4A 4GH5A 3S2IA 3VYTB 4GZ3A 2QZZA 5GONF 2E89A 1KEEA 4Y2YA 1C9EA 3ZLJA 4EA8A 4YJ2A 1GG5A 2V6JA 3BG5A 1KJYA 1M34E 3NBYC 5CJJA 2W11A 3IPYA 3OUZA 5JNUA 4GMDA 3G6KA 3B38A 1E2MA 4J16A 3KP1A 1EFTA 3NJ4A 4J4HA 2ZANA 4Y2QA 1Z22A 2E4XA 2JJ2D 4YGYA 3GEPA 1L4KA 3WLIA 1PVOA 1ESDA 2CFIA 1J2EA 2IHJA 2LR0A 1JECA 3JWIA 2NOAA 4AIIA 2GNPA 2E18A 5C81A 5J2TA 5NULA 1N4DA 1GZUA 1XK6A 2CUKA 5KCZA 4S1NA 3DL4A 4MW1A 5F3RA 4NZMA 4HP8A 3GLKA 2FF5A 4IY1A 1A9SA 3F4LA 5LC1A 4PPFA 2W2PA 2VPIA 1I0IA 1IEWA 2EJVA 1X8XA 3OQ1A 5JAIA 2HHCA 1KEPA 3VNAA 2YZMA 5HNKA 1L5HB 4FFBB 4X8LA 4XSHA 5FAXA 3THXA 4UNQA 4C4RA 2GN8A 2QAJA 1ORIA 3RU3A 1RMYA 5J47A 1II9A 3LQQA 4BMCA 2H85A 3EF0A 5CYGA 3KS9A 5GJCA 2UYCA 1DX6A 1LPPA 1DJMA 3AMVA 5TPZD 4EQZA 2H07A 2W6CX 2WYHA 4JJ8A 3FTFA 1V48A 1ZM4A 2QAGA 1CLUA 2OENG 1LV8A 5ENDA 1O0SA 2J0VA 4JWKA 3RDPA 1IIBA 3EMKA 3RUEA 4N8DA 4ZVQA 5K3FB 3KZNA 1THMA 4DRXA 4AUKA 4IF6A 3WBJA 4ZZ0A 2QMQA 4XI9A 2ODNA 2OV1A 2Q6TA 1FUUA 5DCUA 3KL2A 4A6XA 3QLTA 3GGSA 4MVJD 5BN4B 3QYFA 4XD7D 2J3JA 3PQCA 2CXTA 4EOGA 3P9QA 5KYYB 1T2VA 2PEZA 4MICA 4U3JA 5CM8B 1USKA 4A5OA 5LFAA 2VQEB 3K1YA 1P7WA 1ADCA 1SC4A 5JJCA 3JWGA 4YAGA 3BVPA 3GLIA 3AM5A 3W6NA 1LBEA 1OZ0A 1UIRA 3HXLA 1DKUA 3ZCPA 1VCMA 3CLRC 1US8B 1O95C 2MT9A 3BD8A 4KWIA 3QSGA 2GGSA 1TM3E 3KM0A 3R9XA 5LP6C 2VO1A 2ZBRA 2Q5EA 3N1UA 5FHQA 5LCXA 4X8HA 4FE7A 1NBEA 5TMPA 4LCJA 1MAUA 1UKYA 2H1LA 3GOQA 4FT4A 2XKJE 2ACVA 3BL6A 4AURA 2VRCA 3TQCA 1QG4A 2GKGA 3V00A 1GPLA 4CMBA 2A0WA 2DUWA 2KQUA 3C85A 3ZHTA 1U63A 3IEUA 3ZNQA 4ENPA 1GL9B 5LM3A 3NHBA 3HO1A 5FIUA 1O89A 3VR6D 2Z1NA 3F3KA 2UVPA 3SZGA 3QEKA 2ZJ4A 3AWDA 2QIPA 3CUEF 3CZRA 3I2JA 3E61A 1T43A 3EXEA 1Z16A 5E1OA 1ZK0A 5FQOA 5A03A 5B57C 4EY7A 4HEA1 3RKUA 5J4LA 2O8FA 1A7AA 3WL6A 4ZANA 3REQA 4TV9F 2GA9A 3ZEAA 4ZAYA 2REBA 1LSSA 4C7BA 5CX1A 1RLOA 1SXJD 3DE2X 1LF0A 2QVXX 3TGLA 2IK8A 3TAHA 4HLUC 4JV5B 3LLCA 2PAFA 3PNMA 4RQBA 1CUYA 4BX2A 4PVDA 2UZAA 3F6CA 4OFWA 1KFCB 2B37A 1MT3A 4QKQA 2QLMA 3RPEA 1NT4A 1WF6A 3WL4A 4B3HA 4GMHA 3HO6A 4XA8A 1JXOA 4QXMA 1SPBS 3O1LA 5K99A 1FFXB 3MJVA 2JI4A 3TSCA 1IDOA 2Q6IA 3AVOA 3KXPA 3AY0A 1MH9A 4HQ6A 5I7VA 1FJGB 2BSAA 1D2CA 2J48A 4MQMA 4D44A 4XLLA 4IIEA 4CKWA 3DMNA 1W73A 2HXSA 3H83A 5JMTA 1H4QA 5E3IA 2O3SA 2W6QA 1LJUA 3FZQA 1MABA 3F5QA 5TQJA 1VSVA 2WHXA 4UEJA 2JANA 2DBRA 2JEYA 4AZSA 2ENUA 4MEJA 4WNAB 2I6QA 2QVYX 3HXOA 2VJMA 4WA7A 3C3BA 1RRGA 2BISA 1XJ0A 4Y6SA 3PDCA 2H6EA 4HWOA 4A8JB 3D4OA 2ZZMA 5LU9A 1JAYA 1KOJA 1HEIA 1B4DA 3USES 3RIYA 1PZXA 2RGWA 4O4HA 3UGTA 2ZXUA 4EHBA 3SSMA 1QU3A 4TMTA 2XMZA 3MGKA 3OO0A 1YAJA 3H2JA 3I5YA 1JHMA 1OT5A 3KKZA 5L3SA 4FCVA 1C9MA 4IDOA 4BO8A 2J9FA 2HT1A 2WTUA 1UKZA 3C7CB 2Y4OA 1WE2A 1Q1BA 2CLFB 3BD7A 3R3UA 5DXJA 3O4GA 1SULA 1QCDA 3DYBA 1T6XA 3ESCA 2M1XA 3ICVA 3FPAA 3L0IB 1YA4A 3FB4A 5C8XA 4PE5B 5ED0A 1X1AA 3W2GA 1AQNA 3O4VA 1EE2A 3I04A 3IVCA 3NV7A 1ZN8A 2ZI6A 4O8ZA 4UU1A 3NWBA 5DI3B 1E9RA 5P8WA 3NM4A 1QZTA 3AUXA 1SRQA 3FVWA 2V8BA 1MG5A 3G9UA 2ZUBA 4XQGA 3Q7TA 3C3DA 3N2IA 4G86A 1JHXA 2C83A 1GYPA 1KH1A 1YQWA 2QQ0A 2P2YA 3PCXA 4W63A 3X2EA 2PUHA 3RYIB 1CYDA 1W5FA 2QXUA 4LC1A 4X62B 4EW1A 4IIVA 2HYDA 1L4YA 2BFCB 1WCIA 2DTXA 4XB6B 4CR7A 3AEZA 2C7QA 1BOFA 1RJ9B 4DLWA 2NTVA 1TGYA 3I9LA 4IXNA 3N75A 4TVOA 2I4MA 3W6UA 4RVOA 5CEFA 3JWHA 3RC3A 2C4WA 3KO8A 5A5DA 1CJSA 2C4NA 3FIJA 3OQJA 1O94D 1UBCA 2D62A 2F7SA 4RK0A 4N54A 1QHNA 3DZFA 2JLQA 2Q8NA 3THRA 1PU2A 5EESA 3M1AA 1L5YA 1G59A 2AOVA 3AZQA 1V47A 2ERYA 4PQGA 1NUPA 1YB5A 1DFHA 2RHLA 4WCFC 3U17A 2AOXA 2VPYA 5CD9A 1RI1A 1AM4D 3LYLA 3O90A 2OWEA 3CUWA 4LY6A 4AF7A 3PD7A 5IPFA 4TLLB 5THQA 5B3KA 1G8SA 2AWOA 4XWKA 1VIDA 3P2JA 4XWGA 4LZAA 2Q1TA 1RTTA 4C30A 2ZW9A 2V3VA 4MRPA 1ZJYA 1XTKA 2ST1A 2W2KB 3M3PA 1DP4A 2A30A 2QVBA 3OLZA 4P80A 2QVLA 2NVUA 3KOOA 4IOLA 1BCSA 5FBHA 3W1WA 1M2OB 1U6JA 5HTOA 1G3MA 3RSGA 3S55A 5IKPA 1G20B 1BJKA 3ANYB 1FFHA 2XOXA 3AWIA 1OI2A 3OLCX 4LRQA 4NRDA 5PGMA 2WUWE 3QLVC 3RWOA 3UWMA 3U31A 2FMHA 3DDOA 3ZQJA 4M2LA 5HJEA 2ZYWX 1X7XB 4O4IB 1EK1A 3ROMA 3DXZA 3M9LA 4M1OA 1UBEA 1W93A 4X85A 4YO7A 5U4XA 3KQLA 3HFGA 3HACA 4Y2PA 4MCIA 1EZ4A 1N6RA 5K8TA 4PAQA 3Q0TA 4ML3A 4OL9A 2HADA 1XEXA 1AS3A 1GCOA 2AFIA 2UZ1A 3EWSA 3HBMA 1QOQB 1ZQ1A 2BM0A 4HGQA 3EG5A 3Q85A 1PNVA 5AM1A 3IAHA 3OX3A 1IXRC 2W90A 4MB2A 4C7KA 5FKJA 4CLOA 3K8QA 1LU9A 5JSZB 1PR5A 2GMWA 1V25A 4M0DA 2ERCA 4OP1A 2PD6A 4I50B 4D9EA 2JJ2A 4G5SA 4Q00A 2NO1A 4IIGA 3K4HA 4R2KA 3TLKA 3ZTWA 5HIIA 1NG9A 4WOPA 3EOZA 1VIVA 2BONA 1B00A 2WLSA 4FUQA 3UHFA 4CE6A 5IKEA 1WUJS 4JLUA 4U0JA 2Y1FA 4IR7A 1XZHA 1A27A 1YQTA 2C8LA 1FMFA 1M33A 1KK0A 3NRCA 4ND3A 4FC7A 2RIRA 4KI0A 4CF3A 2MSDB 4E3WA 2CKDA 2ORED 3VNVA 3MMNA 1B23P 4FXPA 4B8ZA 5CVVA 2Y1CA 5SZJA 4KFCA 1D6JA 4JFRA 4DMUB 1T4GA 1V16B 4XPZA 4S0XA 3KV1A 2FDRA 2ZVDA 3DO8A 4MO9A 4BMVA 5LMZA 1SK9A 2FWJA 2QTCA 3CH6A 3OZDA 1S1MA 4X93A 4FWIB 1M6VA 4J03A 4ZU3A 2DMRA 5TPZA 1JI0A 3U1BA 2H2HA 5JAQA 3MSXA 3NRBA 2VJYA 3ENWA 3MTJA 3ZBPA 3F7MA 3P5BA 3Q87B 5CCBA 3N05A 1N8NA 4HGNA 2HIGA 4XR9A 3KYCA 3ZE9A 3UEOA 4EITA 5EJ5A 1XTQA 1L8OA 1X2EA 1DKMA 2H8KA 4IGIA 4KQWA 4PIVA 4R81A 4TTQA 3OJWA 3EGCA 4Q1AA 4ZI3A 4MVJA 3WIUA 4XD7A 3V1MA 1NC3A 1GZHB 1QHHA 4R8MA 3V4VB 5L45A 3GP8A 3K0SA 1MEJA 1WIWA 1GNPA 3CLRD 3I01A 2ZXFA 1D3AA 1HE1C 4UD2A 2PXXA 4JKIA 1DDOA 3RV3A 3K8ZA 1EHCA 2B1GA 1RABA 4HNUA 1ULSA 2GAAA 1Z5UA 2IYNA 3BAZA 2AXNA 2IXEA 1ECBA 1NUQA 2HMSA 2LP4Y 3P2IA 4HZGA 3F4KA 4PYRA 4M0KA 4LJ8A 4WSOA 5TXGA 2FRDA 3RODA 1MAHA 3TMAA 2C4VA 4F3RA 4BX3A 3S68A 4HSGA 4E15A 5DRTA 1FRNA 4I08A 1ADGA 2YW2A 3ZVRA 1HE5A 3OM1A 2F8MA 1Z73A 4OQEA 1H42A 2YOFA 4Z5XA 3KVYA 3O1HB 2QV7A 1L5QA 1EINA 2E5FA 3DOJA 1DARA 5H83A 5KWSA 1DMRA 3VR6A 1YZFA 1VDMA 2HXGA 3DVQX 5JPIA 4OU4A 3EYWA 3D6UA 3WK5A 4HD8A 4OHCA 1IQ0A 3BE4A 1V8FA 3AR2A 5EZ6B 2VI5A 1PK7A 1RIIA 4KEAA 3ECSA 4ZO9A 3C5HA 4BNGA 2ZRQA 1CNFA 3FOEC 4MR9A 3A6PC 2H31A 3EA0A 1U3FA 4C04A 2OZPA 3SNHA 1TAQA 1SXJA 4FYWA 1JI3A 1HRDA 3DWFA 1Q1EA 4KWCA 3W78A 2FEMA 4C3VA 4N65A 1RT9A 3UMGA 1TNDA 4FQ8A 2PKWA 1E6UA 1E63A 1R7RA 4RK5A 1JF8A 1FLVA 2ZCJA 1EGMB 4UBOA 4Z2AA 3ULKA 4ON9A 1W36B 4N5IX 1AF4A 2HB6A 3VYVA 1M2WA 1QIDA 5JXWA 1WA5A 2Z9DA 3ZQ4A 4YAUA 3W7AA 2ZJYA 4ZA2A 3WQRA 4B4WA 1RVV1 3AV3A 3OU7A 4UE2A 1LC3A 2ZRFA 3D6VA 3EUEA 3N8KA 3MGBA 4LWQA 3ZPXA 4R9SA 1WPQA 5EY5B 2H3EA 4RXMA 1C7FA 4X84A 5ABPA 4IJ5A 3U9TA 1EVQA 4GNKA 2CFOA 5BR8B 3CUSA 1Y5MA 2BEVB 2QKYA 4MWDA 3RC9A 2B5OA 3KTFA 3M9XA 3O4HA 3W8NA 4ROTA 4BVGA 4ZGBA 5JASA 5EKSA 3L0DA 2GK3A 4FOOA 4O02B 4J9UE 3SMQA 4Z0TA 5AVXA 2C04A 1YNSA 2VP6A 1T13A 1FP2A 3ICOA 1YO6A 4G85A 1X77A 3T34A 2PRJA 1NKTA 1CUAA 3ECAA 3S27A 4ATNA 5HDBB 5M5BA 2WIFA 2R3SA 3T12A 5IUNC 4KFRA 1GG9A 3HU1A 1YKGA 3CV3A 3DCNA 4D6PA 2Q3MA 2AE2A 2PR7A 4LJLA 5HCNA 3HVIA 2RFLA 3GH1A 4MIYA 3GPIA 3TIGA 1HDGO 1UBOS 3TMKA 3I0ZA 2HMUA 3WNVA 1QQ5A 2OV8A 3NPAA 5K03A 1TW2A 2FPLA 3UBMA 3FF4A 1M34A 2NXEA 2LD4A 2O5EA 1IEXA 3IDAA 3ICQB 4F45A 3PT9A 2XQGA 4OATA 5K6RA 3DDWA 4YIKA 2CDBA 3IPLA 4OREX 3L4KA 1UZAA 2CK3D 4IQ8A 1T4MA 2G1JA 3MTIA 3ZWQA 4HAOA 2XUKA 1G38A 1KZ7B 1NW8A 1KMQA 3W77A 2QT0A 4N12A 5TVKA 4DG5A 1JIQA 1RHRA 3NGMA 1MRSA 2NU6B 3BGIA 4UUPA 5AVWA 3PF9A 1JPUA 1ZN2A 1JHQA 1N9KA 1GOTA 2LDBA 2LW7A 2OHGA 1QP8A 1WMBA 2P4UA 1A8QA 4IDCA 3IB6A 2OCPA 3OSUA 2ACKA 3ESBA 1FRFS 4PGFA 4RVSA 4ZYTA 2GTPA 1E99A 5K9ZA 4HMQA 3JVDA 1NP7A 3MGAA 1E2LA 2NZ8A 3IUQA 3PC8C 3HJFA 2BFFA 4GZLA 4CMGA 4FLEA 4B3XA 1M1YE 1UOPA 3RQIA 3BK7A 4HDRB 4UMDA 3QBTA 3QMWA 4JFAA 1H85A 2Z9BA 4P4SA 5KIAA 3ECCA 3AG5A 3MRXA 4ZREA 5DM1A 1XQ6A 4ND2A 1OFVA 4GD3Q 2YICA 4Q4JB 4YJ2F 3T5PA 1DBQA 4K86A 5J9FA 4DFDA 4I6JA 1N4AA 3OLWA 4F4HA 2VHCA 4CV1A 2M1ZA 2Q3DA 1WWKA 4MJLA 3HRIA 1FU7A 2EF0A 1EM6A 3IVAA 4UBLA 3B2EA 3DFKA 1O94A 4WBNB 2VUHB 4NMLA 2X7XA 1E2PA 5TY0A 5LWHA 4J0DA 1GU7A 5AXAA 3PQ7A 3JRNA 3R20A 3P9ZA 4RM2A 1TAHA 4MS3A 1ADBA 4GSYA 4OVKA 5BR1A 1GV0A 1R5NA 2YY7A 4WLVA 5K6AA 3R6DA 3VTFA 3D7RA 1WSAA 4WASA 5LLDA 3AU8A