1QFXA

Ph 2.5 acid phosphatase from aspergillus niger
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
447
structure length
441
Chain Sequence
b'KQFSQEFRDGYSILKHYGGNGPYSERVSYGIARDPPTSCEVDQVIMVKRHGERYPSPSAGKDIEEALAKVYSITEYKGDLAFLNDWTYYVPNECYYNAETTSGPYAGLLDAYNHGNDYKARYGHLWNGETVVPFFSSGYGRVIETARKFGEGFFGYNYSTNAALNIISESEVMGADSLTPTCDTTTCDNLTYQLPQFKVAAARLNSQNPGMNLTASDVYNLMVMASFELNARPFSNWINAFTQDEWVSFGYVEDLNYYYCAGPGDKNMAAVGAVYANASLTLLNQGPKEAGSLFFNFAHDTNITPILAALGVLIPNEDLPLDRVAFGNPYSIGNIVPMGGHLTIERLSCQATALSDEGTYVRLVLNEAVLPFNDCTSGPGYSCPLANYTSILNKNLPDYTTTCNVSASYPQYLSFWWNYNTTTELNYRSSPIACQEGDAMD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (PH 2.5 ACID PHOSPHATASE)
publication title Crystal structure of Aspergillus niger pH 2.5 acid phosphatase at 2. 4 A resolution.
pubmed doi rcsb
molecule tags Hydrolase
total genus 145
structure length 441
sequence length 447
chains with identical sequence B
ec nomenclature ec 3.1.3.8: 3-phytase.
pdb deposition date 1999-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00328 His_Phos_2 Histidine phosphatase superfamily (branch 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1qfxA02
1H2FA 1YJXA 2IKQA 3E9EA 5CX4A 1YFKA 4ARSA 4MA4A 2P2ZA 4FDUA 3F3KA 4FDTA 1DKLA 5CU7A 2P9YA 2DWOA 3QPVA 4E3WA 2P30A 3E9CA 2P9FA 3KKKA 4HBZA 2ENUA 2AXNA 1ND5A 1DKPA 3O0TA 4ARUA 3NTLA 1E59A 2I1VB 1NT4A 2YN0A 3NFYA 4PZAA 2H52A 3IT2A 4AROA 4ARVA 1V37A 3IT3A 4D4JA 1V7QA 3OI7A 3IT0A 2OWDA 1SK9A 5HR5A 2A6PA 3GP3A 5AJYA 4PGMA 4GPIB 4EO9A 1QHFA 5AJXA 2RFLA 2P6MA 2H0QA 3BIFA 3D4IA 3D8HA 2H4XA 2YN2A 1T8PA 3MXOA 1DKQA 1BQ3A 1DKNA 3R7AA 2EKZA 1QFXA 1RIIA 2P79A 1QWOA 2A9JA 5AK0A 3IT1A 1K6MA 1E58A 4D4MA 4IJ5A 3DCYA 2P6OA 1UJCA 2F90A 2BIFA 4ODIA 2WNIA 1FZTA 3K4QA 1H2EA 2QNIA 3K4PA 5PGMA 1SKBA 2P75A 1UJBA 4EMBA 2P78A 3GW8A 1RPTA 4PZ9A 4IJ6A 1EBBA 3D6AA 5AJZA 4JOCA 3EZNA 2DWPA 4JODA 5CDHA 4TSRA 3FDZA 2HIAA 1DKMA 2EKBA 5AJWA 1C80A 3PGMA 1TIPA 1SKAA 3GP5A 3QPWA 3FDZB 1SK8A 2P77A 4QIHA 1CVIA 1DKOA 4GPZA 2P2YA 2PA0A 4D4LA 3QPUA 3C7TA 3DB1A 2WU0A 1FBTA 3HJGA 3EOZA 4JOBA 2HHJA 3LNTA 2OWEA 3MBKA 1BQ4A 1C81A 2HPAA 3FJYA 1RPAA 3LG2A 4D4KA 2WNHA 3ZHCA 3LL4A 1C7ZA 3F2IA 1XQ9A 5HTKA 1ND6A 5AJVB 2P9ZA 2H4ZA 2EOAA 3E9DA 1BIFA 2ENWA 2GFIA 1IHPA
chains in the Genus database with same CATH superfamily
3PENA 1H2FA 3QBTA 4NV3A 3REQA 5IF9A 1DX4A 4JC5A 4P4UA 1RWQA 1G38A 1ZISA 3AUUA 3U4HA 1JE0A 4EAAA 2AMJA 1SBTA 2G83A 4COKA 2PKYX 4Q9JA 4AMYA 3AP2A 2QL7A 1KKLA 1WEHA 4A8PA 3CFYA 2W6MA 4JYPA 1GRQA 1N3IA 3AVUA 3KCNA 4OP1A 3F7NA 4JB8A 3ZGYA 3CG4A 4ZV4A 6CHYA 3IDFA 2I6GA 2V8OA 3EG9A 1BCRA 4GX2A 2GMWA 2IODA 3A4YA 3GZNB 3WGYA 3H4TA 2H52A 4NL4H 2I4NA 1TX4B 2FNAA 1UODA 1XAJA 3K09C 4UPDA 5HS6A 1QG4A 1N0HA 1SXPA 4B43A 4KYUA 1TAHA 1UK8A 2ZYUX 3OEHD 3ELWA 2CL6X 5ALSA 2F1IA 3RK4A 3KVYA 3BRQA 1OA0A 1NP7A 2D54A 1X9HA 3NUGA 4M83A 5EP1A 3ZE1B 2V7BA 5ER9A 5E9WA 1QH8B 2SCUA 3KUXA 3U26A 3UJ7A 3TQHA 4LPKA 4FT4A 1Z4LA 2JCBA 3ZVRA 5FWNA 1PL8A 4OSOA 1CQXA 1XKLA 3W6OA 5IWAB 1YZHA 5LR6A 4JQCA 1BKDR 4JEUA 1HDOA 3WI7A 3K16A 1M6WA 4KCGA 1KP2A 4IHAA 1FFDA 1E64A 2QJRA 5KNDD 4U6NA 2IFTA 2OCGA 2OHJA 3IMGA 2VP3A 1VMIA 2R60A 4BS9A 1ZUD1 3NQ41 4G9EA 1KY3A 5EKSA 2FN3A 5KYWA 2QSUA 5JS1A 4F7WA 2RH9B 5UKDA 5ISMA 3ZJVA 3E70C 4UTNA 2B37A 3KO8A 2YJNA 1G2QA 4GQAA 3U7QA 5JMPA 3BBLA 3W90A 3HS3A 1GAWA 4QEZA 1GUAA 1QVAA 5IKOA 4P53A 4BE4A 2OOSA 2PMWB 4PF1A 4D9BA 4BWGA 3AR7A 4RV5A 2GLUA 2RHGB 1NVTA 4BLPA 1KO1A 2P69A 1EXNA 1JRLA 1J56A 2B1GA 3WTCA 2HA3A 1WE2A 2FE1A 3CLSC 4ARZB 3KTAB 3FFAA 4FU0A 4GP7A 4JS0A 2FPGA 4IOMA 2P40A 1XMJA 3A9RA 4OMFG 1L5GB 3RS7A 3CH5A 1U9CA 4FQ8A 2XODA 3VPSA 4FIZA 1LC3A 2FSFA 2LVBA 3ROXA 2YXNA 4XSVA 2J07A 1QU2A 4GLJA 5LIRA 1WSBA 3GLHA 4X1KA 3FYHA 5CVDA 2EYQA 4G07A 4AK9A 4F0JA 3AJDA 4RSRA 4COOA 2JG3A 2XTJA 4MR9A 4X8OA 1B2RA 5EIAA 5PNTA 4ZI2A 1SD2A 1XZNA 2VDWB 4GM0A 1NJ6A 2PK3A 1RC1A 5F12A 1EDOA 4PLZA 1PW5A 1T2AA 3OM0A 2EFGA 1NI4A 1O95C 5EIFA 1P33A 2V9CA 3KVRA 2V3WA 3QWAA 1UM8A 2JFYA 1Z0JA 4OYHA 1C81A 3DBHA 1E62A 3UHPA 2O3TA 4GPBA 3RYFB 2BMAA 1QVWA 3Q9UA 4XGKA 3A6LA 2IYFA 5HKLA 4CIBA 5KOJB 2IOYA 4BNZA 4Z1MD 2JH3A 5DHQA 2C7OA 4TYWA 1SUDA 1LSJA 1ZU5A 5TPZA 1RM3A 1ZXLA 2B1RA 3PNOA 3W3AH 1QIFA 1KDTA 1L3CA 1SC3A 3HY6A 3LA8A 4V0ME 2QJFA 1TT5B 5JE8A 4W5QA 3QVUA 3AHCA 1OOEA 1PE0A 3FSRA 5THQA 4TWBA 2F3PA 3X2FA 3VPFA 1O0BA 1C7EA 1CWUA 3ISTA 3WLRA 4CKCB 4N48A 4DQXA 2B94A 1OBOA 2C9DA 5MDHA 1JPUA 3DWIA 1YQWA 4GXQA 4WAUA 1RAGA 4UDXX 3MCWA 3IX7A 2G36A 3NHYA 2C4NA 3TW4A 4LOLA 2ZYGA 3BN3A 3GJRA 5ENDA 5HZGA 5K01A 1EFLA 2I7CA 5DWQA 3RABA 1B1CA 4UU8A 3HFGA 5LOVF 1K7FB 2CHQA 4OBBA 3IAFA 1HEYA 4J4TA 4NPCA 3CNOA 1DAIA 4FKBA 3U3ZA 3AILA 4A0FA 2O8VA 3AVXA 3LW8A 4YMVA 1V1RA 4NLLA 3W2HA 3B6IA 4MOWA 1CRLA 1Z5VA 4YUYA 3OPQA 5L4SA 1Z68A 2AMVA 3LPNA 1ZD8A 2JGJA 2VK1A 2XMZA 3ZU2A 3GCXA 2HZBA 3WK4A 2QTBA 5AUPB 2Y66A 3BWXA 4WOKA 3CWCA 4PYKA 5EZ6B 5FV4A 3A9CA 3J81A 1XQ6A 3RVLA 3OLZA 3HDTA 3MJRA 3BTUA 4NSNA 1AC5A 2VHXA 3KETA 2JJYA 3OEEA 3W4JA 4NENB 4HNVA 2OV1A 5LZ2A 2G09A 3P2OA 1R6AA 4ZO4A 13PKA 4NKRA 4OX9B 3PXBA 5FTLA 3T3NA 3WAJA 1V6SA 1W0KD 1ZCAA 2WVHA 1NTRA 3AH8A 1JNXX 3O83A 1M2NA 1N75A 2EX0A 5KDDA 1ZGZA 4EY4A 3CSUA 2IU3A 1RXIA 2XT0A 4DDKA 2R5FA 3NEAA 5AOCA 5EERA 1M0TA 3I0MA 3DT9A 2GA8A 4PEVA 4S3MA 5E6RB 3V42A 1Q3KA 3ZHBA 2JLXA 3F2VA 3IP3A 4UUOA 2CUZA 5AJHA 5KSPA 3VO2A 5JLJA 1G1AA 2V7TA 3LHKA 1L4EA 1R6TA 4JVNA 4PXSA 1KFKB 3MBOA 4YAFA 1RTTA 1VL0A 3H05A 3HA5A 4CGYA 2JH8A 5BP7A 1LRLA 2F3SA 1BMDA 1KFCB 1M2JA 4WHMA 1Q3TA 1DEOA 3CXUA 4QU0A 2SKDA 2JPDA 3FPEA 3V1MA 4R6WA 4WKGA 3T5GA 4WNIA 5AM2A 1GTL1 1JR2A 4B8YA 3Q7SA 3VMFA 3UPUA 4C3ZA 1DKMA 4TYMA 4UNNA 1BFUA 1U31A 1XLUA 1P4JA 3HRKA 4OLFA 2ZJ1A 4Y6SA 2ZXUA 1EUDB 1VKNA 2MSDB 4UBIA 3UWKA 4NOKA 4IOKA 1E0KA 4YCCA 4DKXA 1NBHA 3RFCA 2FP4A 3P9CA 3CUVA 1P75A 1HE5A 1NAIA 2EAUA 2H4HA 4M86A 3EOZA 1TLTA 1SOWA 3ZYCA 3R4VA 4CTOA 3RSSA 3CVYA 3K5PA 4TKUA 1R0LA 1OWLA 1HMYA 2H2AA 4HADA 3FJYA 4KPGA 5B53A 3VJLA 1D9XA 2AKAB 4L4XA 4MJ3A 2GSDA 1NUPA 4HYEA 3LOPA 4OBWA 4AI6A 1NRWA 2EBFX 3O1JC 3AUAA 4L9RA 1P9OA 4FOTA 4G8JA 2J3EA 4Y9DA 4P7BA 3I39X 3K4HA 4R2KA 2HXGA 5IDVA 4FW8A 4KO1S 5FB3A 4K6MA 1PHPA 3PXEA 1G6OA 3J80A 4Z53A 3MT8A 5CXXA 2DBRA 3RYIB 2GN6A 4A26A 5HM6A 2P0EA 1ODIA 3LUDA 1SKYB 2FZKA 2ZS9A 5F7OA 3R0VA 1KAQA 1EQAA 3O2QB 5KQRA 5KVCA 1S89A 2NPIA 3KKOA 4HPXB 2DWOA 1GNRA 3AP3A 4FHGA 1FP6A 1UMBB 3E9CA 3KYCA 1W6RA 4YCAA 5HCIA 2BEVA 1ZW6A 4I50F 3Q9LA 1SRRA 3VUEA 1TTTA 3FTNA 4XYLA 3VZRA 4I19A 5K8VA 2UXDB 2F1KA 3I2YX 2P91A 5TMDA 4W5NA 2HF7A 4N41A 3EFOA 1RMTA 3OICA 5IHPA 1EXVA 1XVVA 2B7CA 2EX1A 1YAJA 2QLNA 1IXZA 1Z16A 5BN4B 5IXYA 3PWTA 2ZAOA 2ZSFA 1E5TA 1X14A 1P2TA 3WGIA 1NM5A 4LRYA 4DIOA 3I2JA 4Q7LA 4CE6A 1GCIA 3ROMA 1Z7BA 4JP5A 3I1IA 3SP1A 4C88A 1DADA 3KTDA 1O96A 1L7PA 3G02A 1Z6XA 3AYZB 1PZMA 2YOHA 4F60A 5AW4A 2XQJA 4YCSA 4KR2A 5JAUA 3SX0A 4RJ2A 3GLFB 3BBPA 1D6NA 1STOA 1JV2B 2LWIA 3RSGA 5B1DA 1J2JA 3RIXA 4KMOA 1TK9A 4LYFA 4Q4AA 4BO3A 4QU8A 2BFEA 2HTEA 3AVPA 4R8RA 4RVUA 3EEQA 3ZGNA 5AVXA 4PS1A 3D3QA 2ONYA 1GZ5A 1W5BA 2OKGA 3BH0A 3M89A 2QMHA 1DL5A 1K4MA 1JR3D 1Q19A 3IAS1 2HLPA 5AK0A 3W5IA 4D99A 3N39C 4AG5A 1JSCA 2H7VA 4AJJA 3KZKA 3BMOB 1EVEA 2YS7A 5E2AA 1M6HA 3TTSA 4YMGA 2I6UA 2PJZA 1BJTA 1LRKA 1UJBA 2EJVA 2GYUA 4L95C 2D2XA 4W7IA 3NGLA 3QG5A 2GX6A 1S6YA 3AJEA 4ZPJA 1QE0A 2X5KO 2KMLA 3WNQA 3FUWA 4K2AA 3MGBA 1KF0A 2FG5A 5JEDA 5A06A 1E1YA 1SR8A 3CRW1 3EGIA 3JYNA 4JJEA 5B1IA 2GD6A 5LP6A 1H5UA 1P3JA 2XMRA 3DEKA 4K3VA 5ARCA 4EYKA 2CSXA 1VYUA 1YJBA 2E37A 4U2KA 5B1YA 4N5DA 4NG4A 1U5BA 2OVBA 2PFKA 1T3GA 3QI2A 1MJFA 1C2TA 1E69A 3V8EA 2BM0A 3P19A 1FF9A 3G13A 4IGIA 2QVCA 3TQQA 4A5OA 1RPZA 4P22A 4R5MA 2UUPA 2BFBB 1V43A 3OC6A 3M4NA 1VE6A 1DXHA 1BYUA 1TMGE 4A0RA 4BMDA 3CPHA 3D3KA 4N1AA 3MSCA 4R2MA 1I0IA 3PUHA 2YVQA 1J1IA 4GMHA 4RA6A 1D8AA 3LPAA 4QC2A 4EYSA 2ZWPA 3DE5X 5JWRA 1B6SA 2JAQA 2O8NA 3VOTA 3CMCO 3FW1A 4NJEB 1LQUA 4Q7EA 4NBTA 4M53A 4POAA 1IK6A 1LTQA 1U98A 5KJ1A 4JUCA 2ZIUB 5IAKA 1OWOA 4UEJA 5TY0A 3TEMA 2DF8A 5G2OA 4A91A 1TO2E 2GD0A 2VJMB 1XZBA 2VHUA 1M74A 3A1TA 3DFMA 1X8LA 2N3ZA 3J7TA 3PC2A 4KXQA 4DUGA 4ETNA 4LZPA 3QV1A 1QO7A 4PFQA 3M8KA 3TXYA 4RZ2A 3GQBA 2P9FA 4LRSB 4QUAA 3RU3A 5AP9A 1GO2A 3FOBA 4DR7B 2YXDA 4O2RA 16PKA 3U6BA 3CLKA 3EPHA 3C1TA 2X6RA 1B73A 4NE7A 4V1CA 4MVJM 1T9BA 2WZDA 5D87A 2PQ0A 1EX7A 1IY1A 1L6RA 2YJ6A 4MV4A 3U09A 3W5AA 1NT4A 1NVEA 3OCUA 2AC4A 1GEEA 3GFPA 4GM1A 1TFUA 1BDBA 2C9CA 1ENZA 2J67A 121PA 1Z45A 3LWDA 2XT6A 2IE8A 3TW8A 5K0LA 1QZZA 1ZX1A 2PUTA 1ZIPA 1N78A 1BVUA 4XWAA 4F96A 2VWPA 4FE7A 1BTOA 4JQYA 4J0FA 1V9SA 4D8TA 2XNJA 1GRNA 4KE8A 2XBMA 4QBGB 5EPUA 3C6YA 3WK7A 5ICEA 1IQUA 1OC4A 2Q4RA 4M0KA 1FDSA 3E84A 1SZJG 3RC7A 2M6KA 1TMOA 2K7ZA 1B43A 1AO3A 2ZR7A 3JCZA 3PUZA 2BLNA 4J16A 4PLWA 2VF2A 5DN9A 4DNOA 2IXDA 2QRVB 1AIPA 3L9WA 3LT0A 4O59O 2X58A 5T67A 4B6FA 2VXOA 3G7SA 3NIGB 4S2UA 5I4KA 3FYUC 2PGDA 3C41J 1M6VB 4EP1A 2A4KA 2Q5EA 2Y9MB 3FOCA 2HWUA 3CLTC 3QI7A 3GAAA 2GCGA 2WICA 1RZRA 1JHRA 3DLBA 3HFJA 2ZJ3A 3O90A 1BKSB 2QP9X 4BY9E 1XAGA 1Z56C 3EVDA 1QKJA 3IAUA 4G5XA 1KA9H 4BGDA 4P4TA 3JQ9C 3ZGLA 4BBPA 1V3QE 3RK1A 1MVNA 4MVJA 5K3FA 2LKDA 4KN6A 5J2TA 2A35A 4I4TB 4WFKA 4Y2SA 1Y63A 1MJHA 1ZI9A 1QK3A 1TCUA 2ZYDA 5I8PA 1RPTA 3A2KA 2YHAA 1CF4A 2GZHA 3Q3EA 3ZD7A 1RBMA 4EEZA 2DWPA 2BKLA 1EGVB 2J3JA 2NV2B 5A62A 5JNRA 5L51A 2ZSJA 2W6IA 3QEKA 1XJ5A 1DT5A 3OCXA 3ASUA 1JXQA 4AWBA 4WERA 1OH8A 3C5HA 3ZVKA 3PE6A 1GTMA 4HB3A 5DX0A 3CLUD 3NIWA 2QI9C 1PJRA 1JSZA 5EQDA 4X91A 3JQAA 2I33A 2J0EA 4RPKA 1YUMA 5A4FS 4MUGA 4P5EA 1J0EA 1SG9A 4UE6A 2IYSA 2WF5A 4QTYA 4H6WA 4JELA 3X1DA 1QE3A 3I1FA 2MSKA 4AJ1A 1E61A 4DQKA 4IH1A 5JCJD 4TKLA 3H9GA 1E2IA 1YTUA 3S29A 3ZH9B 2FQWA 2HYDA 2ZBQA 1WD7A 3GO4A 5KPDA 3ICPA 1K7CA 4Z4FA 4U6QA 4RORA 1Z33A 1PUJA 3IKMB 1USGA 1JPJA 3NHKA 4YMSA 3L1VA 3JALB 4FFVA 2F17A 5C8DA 3C6MA 1F2TB 1JA9A 4CMBA 1HDXA 2P9ZA 421PA 2BDUA 1Y1TA 3IQDB 4ZQHA 5GONF 5A3VA 1CUBA 3QFTA 3GRAA 4BBAA 3HI6A 4DV3B 3U4QA 1JZQA 5EEHA 1W5SA 2Q49A 3BUSA 2WD7B 3P9YA 4EK9A 4HYTA 3SVLA 3HA7A 4CIAA 3H75A 4DCCA 1SXJD 3KKQA 3ELBA 3QXHA 3NBUA 4CHGA 5FI0B 2CMFA 4K9KA 4ZU6X 2PQ2A 3NO4A 3P96A 2VYVA 3ITKA 1TZBA 3OOHA 4XLTA 1X80B 3PSHA 3NDIA 2ALJA 3N2ZB 4F7DA 2O7NA 1Z62A 3EB9A 3O91A 4LVNA 4XEUA 1SB8A 5IABA 4G0PA 2NSHA 3BQ9A 1L9KA 2CV2A 1H2ZA 1ZHFA 3WV4A 1OILA 3BL8A 1SCQA 2XRZA 1R0BA 4B6PA 4UREA 1EGQA 4P7KA 1M73E 1W34A 3WL6A 2MSWA 3VQTA 5JH7B 2QN1A 3L46A 4DEXA 1S2GA 5E4YA 3A6GA 2FMKA 4E46A 1KJ9A 2BE9A 2COUA 3LUGA 2GPTA 2VJDA 1XU4A 4O4HF 4A6XA 1WS6A 1GZUA 2DX7A 4HB4A 1PI3A 5FD8A 1ISIA 1JPNA 2JAWA 4ZYXA 4LJYA 3OZEA 4PQGA 3BVPA 3EPRA 4WZAA 4DCTA 4ABTA 4WDQA 5F51A 1A9OA 2CHEA 1P1FA 4MITA 2G0TA 2G67A 2LW7A 3IHTA 3O8QA 4N18A 4UTOA 2XXAA 1NOKA 4LY0A 4JMPA 2BW0A 4DLWA 1V4VA 1IY9A 4GZ6A 3UWMA 4E33A 2C7GA 4KNYA 3JR7A 5IP5A 2QTCA 2AXQA 2CNDA 3L7AA 1CJVC 4PNZA 5DSZA 4ZI7A 1S2IA 3WMFA 3Q5EA 4LJLA 2OHXA 2W2KB 3DYVA 4JL6A 1Z5GA 4S2EA 4YAKA 5BUZA 2O2GA 2DUNA 2GYWA 2QSZA 2PIDA 4YRTA 1KI4A 1Q0LA 1WXEA 3H0KA 1SU7A 4E5PA 2VAVA 2FPSA 721PA 4LTMA 3PE4A 4OMUA 3KZVA 4RY9A 1E5LA 4G23A 4UHEA 4PZZA 1Z2OX 2N46A 4WMLA 2MR5A 4QOHA 3CPEA 2PX5A 4TVKA 2XGMA 1AGXA 2B8EA 2H17A 4QFDA 4ER5A 4YMTA 2QSJA 2ZSAA 3NXSA 4Q9DA 3HQ4O 1MH1A 3QY9A 3TLBA 1XE3A 3BXZA 1QNLA 3UMBA 1RI5A 2AUMA 3ABOB 3IEUA 3NHSA 3PEUA 3RHTA 3WL7A 3U7JA 4BU0A 2OXEA 4IKEA 4UEOA 3EXHC 2I2AA 4IPTA 2SKEA 3NAQA 4U3JB 5DVZA 3RSOA 3VAYA 4GOKA 5EJ4A 5IBRA 4IOLA 5CW1A 4QPJC 3RGGA 2QRQA 3LUCA 4KWIA 3STUA 3MBIA 1YNSA 5C2JB 1JKMA 1TNDA 2BBWA 2XQGA 3AB8A 4KXXA 3PC8C 1YOBA 4G86A 1IEQA 2Q2NA 3BGIA 5EZSA 4HZIA 3A2LA 2AK2A 3ZWXA 5KWSA 4PC6A 5AW9A 4PVCA 2C77A 3DTNA 5KYVA 1M2WA 3W77A 1N2BA 4PAGA 2OV2A 4XB1A 5SYMA 3SIPA 2JZCA 1JAXA 1QWSA 1KVSA 2EIXA 3ZW9A 4Y2QA 3S2IA 4OQNA 1Y4UA 2W4IA 3MTJA 4X7MA 2FZGA 3E05A 3G9XA 1EK2A 1N5JA 1YQ9A 3H8WA 3VNRA 5K0SA 4CQMB 1JDNA 4DGSA 1ZIOA 1NVDA 4N0DA 3GLGB 1JH8A 1QFYA 4MA4A 3ZD8A 4IJWA 3HR4A 2NG1A 1U8FO 3IIMA 2YWCA 4IH9A 3D1LA 4C0XA 3DDNA 2V3VA 2WHPB 3OLCX 1A9XA 1WRBA 3SS8A 3V6MA 3ZX4A 4XRGA 4OHCA 2ZZKA 3GRFA 3O2SB 3QMWA 4UD2A 3FUVA 5ARDA 3WQQA 1XDWA 4XE5A 3OMLA 4GE0A 1O94C 4CM4A 2ZJ8A 3AGPA 2HH9A 3R9KA 3P9SA 3I9NA 4TYQA 2DMRA 2O3JA 3QQPA 4M7OA 5BWNA 5CW2A 1G64A 5DPMA 1JXOA 1G9SA 4U2GA 2PSJA 5JCOC 2RAUA 4D3DA 3N3AC 4D4KA 4S04A 2XADA 2WKSA 3AC0A 3H6GA 5FTKA 2B7BA 4FNOA 2RAVA 3U3XA 1LVGA 3LPCA 4C0BA 4Z4IA 2KBEA 5I5GA 3PPXA 1ES9A 1G3IA 2XJ9A 5IC4A 4IV0A 4ZCMA 4Q05A 1U2TA 2IYNA 3U1VA 3L06A 3QF4A 1EU1A 3IMFA 1VL1A 3NAMA 4WXPA 4XIJA 5CM2Z 4YMWA 5JZ9A 1DXQA 3U4AA 1DQYA 4FFOA 1KAGA 4QE3A 4E5YA 3MW8A 1TOAA 4DB2A 2L2QA 2AN9A 3JPYA 3PC7A 1DZIA 2BEWB 1U9ZA 3DUFA 2JJ2A 1ZPDA 2QTRA 5B7NA 3VJRA 4HJXA 2JFVA 3Q1LA 1NBOA 5LD2B 1C9DB 3KFVA 4YONB 5IAJA 5F3DA 3U16A 1V8ZA 3GLTA 4ZTUB 1E1RA 4KOEC 4E08A 1K6MA 1KJWA 1L4HA 1TA9A 1Z35A 1EK0A 2G7ZA 3D3JA 4BNKA 2YIMA 3T15A 1M1NA 5B6IA 2BIFA 2HCRA 4X61A 4MGEA 3OLWA 2PMDA 5DDIP 3CUYA 4XTRA 1WHSA 1JEEA 2QRKA 2QTZA 3K32A 3OU6A 2XT9A 4X6XA 2BF4A 2HPZA 3CIFA 4YS6A 4IMPA 4UBMA 4P58A 4FDVA 3TJMA 1QJCA 1GPDG 3F8SA 3KRTA 1K6IA 1VPEA 2R6R1 3O8OB 1SUCA 3E9MA 4ZZ1A 2J0UA 2XYRA 3LXMA 1ILWA 3NHUA 3NUQA 1JI3A 4DCMA 3ADKA 2BGKA 3HCCA 3PRHA 4PLGA 2AN1A 2IV7A 5EWLB 3O0DA 4DDWA 4JBGA 1UBNA 1QP8A 1XTVA 2YY6A 2P4UA 3B5JA 2Z30A 3JAWA 4XDHA 2HCFA 3MMPA 5DNEA 5EXPA 5H83A 2WVAA 2P77A 5M3BA 5E8RA 3RRNA 5L7TA 2QG9A 2QE7D 2QQ0A 1Y8QA 4LRWA 4Y6PA 1CJSA 4WK6A 3UNXA 1QU3A 3KXLA 4DLKA 1GLVA 4KRYA 3T5BA 3U48A 1BHSA 3C16C 4B85A 4EX6A 2YWJA 5BMOA 4NEHB 3CU5A 4K9RA 5DBFA 4DRZA 1AKYA 5CTJA 1L5ZA 1WU8A 3G17A 3T52A 1S3SA 3G49A 1UK6A 4TSKA 3IXQA 4ZOAA 2IHZA 4ES6A 3NFRA 1D2GA 3QBVA 4PYNA 3G1TA 4IGKA 2NXWA 3GMIA 2XKBA 1UXKA 1E1DA 3QVLA 3D7LA 5SY6A 2D1SA 1T5BA 2B92A 1E9DA 3K7EA 1LV7A 3FD8A 3K53A 2GJSA 2REBA 2QEQA 3L0YA 1FFXB 1UPUA 5DM70 3OD5A 3NVKI 3A10A 1XL0A 3FRIA 3M1IA 3E9DA 5JQGF 4YCJA 4QM7A 2UZ4A 3JWGA 4BV8A 2I8AA 1BE8A 2YWFA 3TGLA 3DC7A 2V6JA 3IQIX 4M7WA 5TGTA 2D2FA 2R1UA 1YJAA 4LKRA 3FHOA 5C35A 3TECE 3V55A 2JHFA 5KYUB 1E3QA 1IBMB 4B3GA 3DBLB 3JRWA 4JBHA 2VK2A 3KLNA 4K1XA 2D6FA 2G63A 1ZIXA 3FSGA 3PEYA 4HQRA 4ZAVA 4E2WA 5A6VA 2OLKA 5DIFA 1N5RA 1DELA 2WD9A 4G26A 4JX9A 3R7FA 4C7MA 2Z58A 2QF7A 4CKYA 4PXAA 1KKUA 1RD4A 2RHRA 2JI6A 5IDQA 2OUIA 1J4AA 3T0GA 1Z6AA 2FDRA 5JR3A 1W4RA 1GTRA 3HRHA 3INNA 1T8SA 1EUYA 1ULAA 4GD3Q 3G8DA 3V1KA 3OJWA 4MUNA 4O4JF 1X8XA 3DPUA 5ALQA 5AHRA 2EFEB 1XCLA 5DTQA 2KE5A 2BTQA 3UMSA 2HUNA 1J7JA 1TEXA 4OUDA 2VSQA 3FVTA 2EVWX 1RWWA 2D8MA 2PLNA 1GV0A 3LX4A 4YCLA 3FWHA 3OIWA 1KO4A 2C4TA 2KWIA 4UZSA 3R7LA 3EVGA 5AJXA 4QX6A 5DCWA 1V2HE 4BUZA 4URHA 2ORIA 1N2GA 1VIVA 3HB4X 4KBYA 1YBFA 1FTGA 3ETGA 3FN4A 4UNSA 5J5VA 4B09A 4PYJA 1HSZA 1I2ZA 1FU8A 1MEOA 2FSVA 3B53X 1PR1A 3H5RA 3ABIA 2EDAA 4X1IA 1W19A 3QELA 1E3MA 1Z29A 3MXOA 3SIWA 5FBVB 1B3RA 3QX3A 1RWNA 3NR2A 5DASA 2WZCA 5EXDA 4YNBA 2YZMA 1KI1A 1B6RA 4ENUA 2NV6A 1DEAA 4CMHA 2CF5A 4EB0A 3UWDA 1YE3A 1WOYA 1Z13A 2VSNA 1H2EA 4JIMA 2CMKA 3R1IA 1ZD1A 4HY3A 2JIRA 3G8AA 4MARA 2R8ZA 4I5FA 2CCKA 4NBNA 4R1OA 3T4PA 3UVEA 3W7AA 3WKEA 2P78A 3ZWKA 4EPYA 3TWOA 3OJOA 5AI5A 1PK7A 3L5OA 5CTAA 3ZX5A 3KOYA 2I4LA 4UNRA 3UPDA 2ZSBA 2HEIA 3O75A 4EABA 1H6CA 2CLIB 4UDOA 3DE3X 2QR3A 5IVDA 2ZRMA 5DGHA 4KAFA 3BWBA 2PEZA 3FNFA 2HSGA 2JKZA 2TMGA 5AXCA 1IAQA 4BTEA 2XUQA 4PSAA 1Y6FA 2Q5FA 4DLUA 1COZA 4KMRA 2WU8A 3TI9A 4KRGA 2VDQB 4M6WA 4YJFB 1BW9A 2DGDA 4KP7A 2Q21A 4PX2A 5K8TA 4BQSA 3MFQA 1KZ6A 4EHFA 3R9WA 1U0NA 5JVDA 1UDXA 1I6KA 2D2IA 5HEKA 4PCVA 1V71A 2R87A 3LYLA 3R76A 5D51S 3WMGA 3V4SA 4G0WA 1OFHA 2J9FB 5EP2A 3OT1A 1JQKA 2XSZD 1JU3A 3LIPA 1Z2NX 2JHGA 4M0EA 4R1UA 1MOSA 4U7GA 5ECYA 5JC1A 3ZDBA 4RD3A 5FP0A 4XZ3A 1NQOA 2DE0X 1WDTA 3HP1A 3VZSA 5KTSA 4H7DA 2PBFA 5BRJA 4DLXA 1MV5A 3ZBTA 1BWSA 1EM6A 4KVZA 3I4CA 2E55A 4Y1GA 4P7GA 1KE2A 2GCOA 2GN9A 2YNMC 4YBZA 1SELA 2R9VA 4GOOD 3AYXB 1KETA 5EMMA 4E31A 3IERA 1RWXA 1PFKA 4AVYA 1QHSA 4QTUB 1U9JA 2VNSA 2Q5HA 3AQIA 1VKRA 3IP7A 1SUEA 3MK31 4WV3A 1VG9B 3RRYA 5DP2A 3L2OB 4GYYA 2FPMA 1NONA 1Z8DA 1LFDB 4CM9D 1OBVA 3WOVA 3IE0A 3FZQA 1I33A 2O3UA 3D2BA 1VHWA 4M36A 3BSYA 4I3FA 4BB9A 1CJTC 1E7WA 1KZ7B 1D4FA 4W5JA 2O2ZA 5TT0A 1A69A 1MD9A 1EE9A 1GQYA 3BL6A 4EW3A 9LDBA 2AYZA 2GSWA 2X1MA 1TYZA 1A5TA 2C3OA 4OP3A 3K0FA 3S99A 3V8BA 2C04A 2DZDA 3OWHA 2WDPA 3OF5A 4HWOA 2AMFA 3RHZA 3RVSA 3WJ7A 5C8YF 2E5WA 3S5JA 5KX5F 2E7ZA 4MDFA 5JWHA 1MX1A 3TAXA 5KIAA 1PWEA 2XZPA 2EV9A 3JASA 3II6X 3N8KA 3P97A 5ESXA 4BKRA 2IWRA 1R10A 3HEBA 3HVHA 3CM0A 2YYSA 5AKEA 2V7QD 1SKMA 1E92A 1P2BA 1UK9A 2YN2A 3NZEA 5T8KA 4BO2A 3OECA 1YMQA 5E2IA 2GS9A 4FZ3A 2W2VA 4FFDA 2RHHA 3QNWA 1UAYA 3D0RA 4N8DA 2WG1A 4I3HA 3RAPR 4QG3A 5EZ5A 5IXJA 2E18A 4MCIA 4MS4A 2G80A 1HORA 3CGGA 4M8IA 1NYRA 1R37A 4LQDA 4ZXPA 3K1TA 2R1VA 3EVEA 3GGDA 4MRSA 3SS9X 1MFPA 2ADMA 4IMRA 3L02A 4FHFA 4LOJA 1J2EA 5KYXA 4MLCA 3GVHA 1U1DA 4NBRA 3ZKAA 2QN6A 2ZVQX 3DBRA 1V4NA 4RSHA 1KQNA 1H0HA 1QCDA 3ITDA 4F85A 1DUSA 5JSKA 4Q9IA 4DNQA 3D7NA 4GSLA 4WW0A 1XTRA 2V7PA 2Y1XA 5E0OA 5TX7A 3Q8KA 4OQQA 1ILEA 5CB4B 2B3DA 1A8HA 4DC1A 1SHTX 2PLRA 4S0XA 3RYHB 1NLFA 4QJ3A 4X84A 3EXEA 3RIMA 1TM5E 5EJ8A 2P6RA 5FI1B 3NG1A 4WA8A 1CY7A 4OFBA 4F04A 2OENG 3OTWA 2G71A 4LYGA 3I4FA 1KRXA 3ESYA 1XOIA 3VOAA 4CM8B 5JG7A 4LJRA 5M5BA 2PT6A 2QBYB 3FSJX 4NZPA 1KMNA 1F6DA 4L7VA 4N40A 3FCXA 5DEOA 5KNCD 1VLZA 1SUBA 2IDKA 3GOQA 3DT8A 4UULA 4B2YA 4EELA 7GPBA 3K05A 5D7BA 2OFXA 5KWJA 2R7AA 5K0EA 1AURA 4V03A 3QU4A 3EUWA 2IYYA 2VAWA 4TTSA 1ZW1A 2QUKA 1LD3A 2GDJA 2XMCA 4LNUB 1W1WA 2BEJA 2JDIA 2RAFA 3WGMA 4Y2TA 2QNRA 3HBNA 4ZQCB 2IP2A 4EVIA 3ZCTA 3FOFC 3WIBA 1ZICA 2Y1OA 1R4NA 4WK4B 2V3CC 4G2NA 1FRZA 1KQOA 3R8FA 4B0PA 2JA2A 2CFTA 1SNYA 1TZ2A 5C5CA 4O08A 2WZQA 3Q3CA 1T0PA 3SLGA 4DE5A 1G8SA 4N8SA 1U4SA 1X77A 3CF6R 2O2XA 3OPNA 3GLUA 2NVUB 3W1VA 5C80A 4MULA 2XLCA 3OFJA 1CY8A 2IEGA 4HT3B 3JY6A 1JXAA 2FVXA 3EGXB 4X60A 1SCUB 4URFA 3VISA 4M38A 3E27A 2P9JA 4TTAA 2I8CA 1ECCA 2O2HA 2P9YA 4IQ8A 4P36A 3PTLA 5ICSA 3QU9A 5ALNA 1WUIS 1Y3BE 5CAEA 4WZBB 3LXXA 2OXIA 3EUFA 4AJ2A 5FOSA 3GLIE 4JBYA 3M6UA 4HYQA 4NTZA 3WKAA 4IILA 1V8BA 1XEXA 1I32A 4LSGA 2XE4A 1USWA 3P0HA 1YR8A 5DYTA 1NUSA 2BOVA 4YRLA 2ZQ5A 1E7QA 3GEDA 4HH1A 1IHDA 4DTCA 3SAJA 5CCDA 4C1BA 5A4MS 2PSFA 5SYAA 3KQHA 2FDXA 3DV2A 2Q28A 1PG0A 3D02A 2VZ8A 4Y6RA 1LPNA 3RJ9A 5LNK6 1V7QA 1IMOA 3CISA 1AKVA 3OI7A 1WP4A 3GF4A 1KDOA 1A72A 2ZB8A 5DM4A 2H65A 1MR3F 1VZ2A 4FYYA 1KI8A 5CT8A 1SK9A 1M34E 1XNJA 5HA5A 2EATA 2O3QA 4PRLA 5CVEA 1C4XA 2JI9A 4PGMA 2V55B 4OJTA 3ENVA 1DBPA 4HXYA 2FJPA 2QB5A 1ZNWA 2H8KA 3NOVA 1HDCA 3S2EA 3CE6A 4D8WA 5BSKA 4I14A 5DNUA 5EKDA 2Z5FA 2FW9A 3C3DA 4MZDA 5EUMA 2V6GA 1LNSA 1R6UA 1YDFA 1YK0A 4I08A 2ZIAA 4GT1A 4G8BA 4LS3A 4IUCS 1MIHA 3P94A 4MYCA 4O2BF 4UEQA 3EZLA 3LE8A 3MGKA 3OIYA 3PQ7A 1SC6A 3MWGA 5EEGA 2XF2A 1PJSA 2VC2B 3SFTA 3A11A 2PXHA 3PDJA 5IT5A 2RGUA 4ID9A 1XEWX 1E2KA 2FU5C 2L82A 3JQRA 2HSDA 4Z9YA 5FUQA 4DMLA 3D8BA 5LB2A 2FSUA 5ALLA 4L74A 2ZSUA 1YC5A 4AO8A 4C5CA 1EIWA 4JU9A 4P34A 2X42A 2DTXA 3R5SA 1W0JA 3OURA 5CYPA 2PUFA 4GDFA 2OC9A 3W8FA 1JLLA 4JR2A 1XJCA 2DQYA 4BDTA 1LK0A 2H06A 2QGZA 3RDPA 1XTUA 1UJNA 2IYAA 1IH8A 1UBJS 2VTBB 1Y8ZA 1CIPA 2H1FA 2HRQA 3AEYA 2EARA 1M0SA 3ROKA 3TQSA 1COWD 1CZUA 1ITZA 1H9BA 5KI6A 1Y6GA 5AQEA 3SMQA 2JVIA 5BWMA 4G97A 2BDEA 5LLDA 4V24A 5B2ZA 1ZL0A 2H7XA 1QV7A 3FGZA 3FB4A 1L4UA 1T4GA 3HADA 5KTPA 1DJMA 1SBQA 1DI0A 1YGYA 3GHYA 3MOGA 4L16A 4EY7A 1IWBB 2CMHA 1TJPB 3UXMA 2R2GA 3NX4A 4CKEA 1H2AS 4IH4A 3A3NA 2JFBA 3UJPA 3L4KA 1ZH8A 4KO3S 1SEVA 1KYTA 4PGGA 4ZAGA 5CHEA 1ZRHA 5G53C 5JSUA 1QOQB 2ZS7A 1U6IA 2GPSA 3GFOA 5KU1A 1W36D 4A1OA 1A95A 1RC0A 1L5VA 1TRKA 2AFVA 3EZ7A 5CVUA 1KMHA 2ZS8A 3LX6A 4HAIA 1ST3A 4W8OA 2ERYA 1ONSA 1P0IA 4J1QA 2R48A 1DAEA 3PEVA 2IT1A 3LT2A 3H16A 4MVYA 3RRJA 1XU9A 3QVGA 3KUKA 3ICQB 1YOVA 1CE8B 3E7FA 4JSTA 3FBGA 4KRXA 4KW7A 4MAAA 4PIMA 5FPTA 3UFBA 4LF8B 1YA4A 4NCIA 4P54A 1QRSA 2WILA 2YFKA 4HL6A 1ZHOA 1E2BA 3RK0A 1BD4A 3W5UA 1AB6A 4GXRA 2Z08A 4LSZA 2Q1SA 4Z4EA 1F2UB 1DWQA 1WUKS 1F9EA 1YR7A 2GARA 5EJ7A 3OE7A 3F9CA 4NECA 4KDRA 3JAKB 3L4EA 2X1HA 4ZVNA 3DFUA 1A76A 2QM0A 2A0FA 2TMYA 3M6LA 1TPYA 2P0AA 4EY6A 3S8EA 3QKSB 1Q6YA 2Q3FA 4NMXB 1DXYA 2A9RA 1V7ZA 3CR8A 4NZOA 3V3KA 2IU0A 3FKSA 3T7KA 4BCBA 5B6PA 1V8PA 2DCMA 4CFZA 4EY3A 3U31A 4QA9A 4BRSA 3RS0A 1F1JA 2FKNA 3QF7A 4DG9A 3KQLA 1NJFA 4LJSA 1KEKA 4JLWA 4HPWA 2FMIA 4UTPA 1AE1A 3MCVA 1Y1SA 3I3SR 3TG8A 4U2BA 1LX6A 3HUTA 1IY0A 4L3VA 4TVSA 3QYFA 2LIPA 4JI0B 4Q9HA 1U04A 1CDZA 3KZ1E 1N7IA 1PWHA 3SX2A 4HDNB 3RLIA 1KMCA 1XA0A 4DDUA 4MHSA 1VXRA 4QDKA 1WD5A 1GAQA 5LYYA 1A97A 1E2QA 4BQNA 4C7XA 1QC5B 2Z4RA 4A27A 4DFDA 3B9PA 1CSEE 3CA8A 2J4DA 2JVKA 2PMEA 1O7JA 3STTA 4ZCTA 2VYCA 1RQGA 4B7ZA 4YCBA 1NWCA 2Z5LA 3MT7A 2HA4A 4PHHA 4UNQA 4XR9A 3VPGA 2J5XA 4ZCRA 5BOSA 3VTFA 1EFTA 4BNTA 4ID3A 1VJ0A 4LE2A 2DY0A 4G65A 2H1LA 3DVAA 4IXTA 3CUUA 2QRUA 1T8WA 2XYQA 3GEHA 3GIWA 3GJ8A 3ZQUA 4D74A 4R1SA 3NDBB 2PXXA 4N7JA 1IZ7A 4QODA 4YI5A 2QL9A 3IMEA 1ZD5A 3TJZA 2QLMA 5C5EA 4KWHA 4FEEA 3R20A 2QX4A 3ZI7A 4J7UA 5M29A 2AKYA 4NARA 4OXNA 4BKOA 1NVBA 1A7JA 2XQVA 3KZNA 3R3YA 3CT6A 1ESEA 1LKZA 4G25A 5CFLA 3H11A 3OQOA 1NU8A 1T5HX 2XHEA 3KLOA 3RBAA 3V7YA 4MWSA 1X94A 3A3YA 1KEUA 3V4VB 5KBYA 3Q10A 3HVRA 2GCIA 3BFPA 4GWKA 1N5KA 3HABA 4Q1EA 1QBKC 4F92B 2GUGA 2FUG1 2V7VA 3AETA 4Q1AA 4TS4A 1UXOA 1GGEA 3IUBA 1OB2A 2FSGA 2WFMA 4QPZA 4NNOA 3REGA 2OHIA 4FYIA 5I6DA 1UKVY 3D5TA 1KYYA 3L40A 4RIIA 3ZE9A 2NUPB 3T61A 4A8JC 4EOGA 3P0RA 4Q1VA 2UXCB 4BFXA 4LBYA 2QRZA 5EHXA 2R1ZA 3EUEA 4YIKA 2QTHA 1GTVA 2POCA 3FUXA 4W7SA 2O1XA 3PD1A 2AQHA 1IQPA 3TM4A 1IVYA 3JD3A 4XTCS 4OHZA 1HY3A 4BZPA 2FG6C 2B0JA 5CXQA 3LU1A 5BR8B 3PKIA 1JLMA 4ND6A 4BOYA 2BGIA 1U28A 2XB8A 1YQXA 2OZPA 2WA2A 1UBLS 3GFFA 4LBVA 4G5FA 3KSAC 1FVHA 1Z75A 5KWIA 1IK4A 4YA6A 4L1KA 3AINA 3T7AA 4IF4A 1EFAA 4HQ0A 2XX3A 2QZSA 1UC9A 1FX0A 5EP3A 1A77A 4JU8A 4ZK6A 3U60B 4QBKA 1H6DA 1P19A 2LTAA 2WSBA 1PQ4A 1VE5A 4K6KA 1SQFA 2OR3A 3HJTA 3ANLA 1TVCA 4TUYA 1ZONA 2VDPB 3AUYA 2V5AA 1DG3A 5BUSA 5FF9A 1WZCA 4ZQGA 5GZ1A 3NS7A 5CH8A 5B30A 4R4JA 2C2BA 2ZRAA 3KKEA 2ODWA 3DWGA 3ACCA 1MABA 1T5OA 1TJ4A 4AS2A 3GLKA 4C1NA 4R98A 4NP6A 4PSUA 4O1HA 3QITA 4EKDA 3KOWA 1NW6A 4OIFA 4PR3A 1PJAA 3EZYA 4Q3CA 1EP9A 1V7CA 3C39A 4IO0A 2Q7DA 1L7AA 2QY6A 4ESOA 5JJLA 4WOBA 3FWYA 2R8EA 2A9VA 1M8JA 1T1SA 2HMAA 1SBYA 1C3VA 2ARKA 2I3AA 4IINA 4QHSA 4RY0A 3RTEA 5KS2A 1M7BA 3ZWNA 3NP9A 4YV0A 2AG0A 1YQUA 4QREA 4RAQA 2UZ1B 4JJ4A 3UAVA 3D4IA 2CHVA 5EMHA 4HOYA 4PZDA 3KQUA 3EARA 2J6CA 2LZ0A 2YWEA 1CNFA 2WWFA 3HLKA 4GLFA 1P4GA 3JQBC 4H7KA 4L4ZA 2RC5A 2VH5R 1A4IA 4HRVA 1M1YB 4OYRA 4LECA 5ALGA 1PX0A 5KNBA 5J4LA 1ORIA 1PD0A 4XJXA 3VNBA 4CL3A 1L8OA 4ZYZA 2QMYA 5HWSA 1C3OA 2YFQA 1BN7A 1E58A 4MQBA 3AERB 3RUEA 3IRUA 2JFWA 1C0LA 1CDDA 2G9VA 1XP8A 4AKIA 1RLIA 4E14A 1AXRA 1EFRD 3IOMA 3FYDA 4D9JA 4D3FA 1TI7A 1E6UA 1SM4A 1LV8A 3LWNA 1ZG3A 1BWRA 2ZWVA 4TMXA 4WIAA 2O8CB 1NV8A 1CZHA 4BVJA 1QMPA 1W30A 1XTTA 4UHHA 3ZVNA 1DCMA 3G7NA 3ZU4A 1NW7A 3EEBA 3INRA 2XB4A 3B3FA 3UIEA 1NVVR 1BJRE 3SR3A 3KD3A 2PZBA 1QJ4A 5BSMA 2OZKA 4ALNA 4HDMA 1AHNA 3I12A 5BYKA 1CCWA 2XNDA 3DMYA 5FUXA 2BSQA 1L1RA 1OROA 4FFRA 3RTDA 5JTTA 2D5LA 4PTYA 4ML3A 2G77B 3ITNA 1N7GA 1C8VB 3LCVB 3AW9A 5CP8A 1D09A 2HSWA 3OAAD 1DKOA 1PTJC 2FWMX 2WQ7A 4J91A 2PGOA 2BPOA 1K8XB 4CMKA 1U0BB 4L0MA 1MOPA 1UWKA 3T3GA 1K75A 2BMVA 4DMGA 3RSHA 1JFTA 1U9IC 1FRVA 3TZCA 3ONNA 3OMWA 2WQZA 3SIRA 3O8LA 4NVRA 2R8RA 5BQOA 1AB5A 3LG2A 3P2EA 5CVVA 1K5HA 4EG7A 3Q6NA 2YXEA 2VSFA 5FBHA 2VA8A 1QF9A 3DJYA 4PRKA 1Y4AE 1YFJA 5HMLA 1O3YA 3HJBA 2D0OB 1ULHA 3IRVA 1YASA 3HV2A 3QMPA 5BPFA 1HNNA 2HW8A 2QS9A 3BJEA 2GN8A 4OHXA 5DM0A 3TB4A 1KYXA 2A1UA 2IHBA 4WNAA 1D03A 4U7PB 3AKYA 3L5KA 4QG7A 2PNJA 4Q4CA 1GUBA 1U3WA 5LLTA 1U6JA 4LYYA 1IE3A 1QIHA 1ZUNB 2DY1A 4IFTA 4M7RA 4P80A 1RC8A 4I6EA 3AR9A 1GGKA 4ZZIA 3RAGA 3WGNA 5NULA 4JI1B 4EJSB 1UKEA 1PBTA 3DFZA 3V4OA 2E5LB 3ECCA 1G6Q1 1FDWA 4K88A 4MGYR 1FMCA 3AG6A 3CIOA 2FFRA 3JVEA 4Q3NA 1OSNA 5BYJA 1MP0A 4F3YA 1Z3IX 4WBNA 4K26A 4AP5A 2G4LA 5JAPA 2PSDA 4GMDA 2AK3A 4LF4B 5CJPA 2GGSA 3IBCA 3T0FA 4YDRA 4NYJR 4YUWA 7ABPA 3AV0B 2FDCA 4M0UA 4PYQA 3S1LA 1BZYA 2E87A 3GT7A 1XCGB 4XGNA 4MO9A 3CTPA 4F8JA 3SEZA 4D0SA 5I5EA 1R8JA 4CFYA 3KXIA 1ORVA 3D6TB 4PX9A 4EB8A 4XLZA 4ZU1X 2Y67A 4QQNA 5KQSA 2IHKA 5L3RA 4NC9A 1TCAA 2FF7A 2Z56A 3IDQA 4DB4A 2AYYA 5HKOA 1OTXA 4MS1A 3AI7A 5B4UA 1PWXA 4KTVE 3C8HA 3RC9A 1XKQA 2B6HA 4F1JA 3QIAA 3MINB 4B45A 2X8LA 5DYGA 1K1EA 2EDCA 2EQ5A 5EINA 1M67A 1E9SA 4WZ6A 4MO2A 3RHSA 1HDRA 2AJ8A 3LECA 4AQDA 2V9ZA 1KYIA 2DQKA 3LBHA 1Z2DA 3AOGA 2J3QA 3OZIA 3UC9A 3B85A 4YLEA 4PZLA 4HGYA 4A15A 4G85A 2VUUA 2PS1A 1HE2A 4ZVVA 1DAOA 3O93A 4GEKA 2L42A 2DUMA 3KPYA 2XBUA 3MLBA 4NFSA 3X1KA 1PWZA 1T25A 2IOQA 5ALOA 2HLDD 3V7UA 2F43A 4RD4A 2WWGA 3SR0A 4C4PA 5HZHA 4JBXA 3HWSA 1H4QA 4GGMX 3K5WA 3W6ZA 1JBKA 1OIVA 2XV1A 1DAPA 1IDOA 1XPJA 1YRQA 2ODEA 1KPHA 4FHCA 4GWLA 4PC3A 3V32A 1BDMA 2PSEA 3HFRA 1H66A 2O8BB 1OXBB 1IUPA 1D2AA 1U7XA 5D3QA 1VPDA 2H2FA 1QS0A 2RCNA 4FBLA 2X7XA 4M1EA 3SM9A 1R0KA 1M1ZA 1TLFA 2IZ5A 4GPAA 5JNUA 3AEQB 1E9FA 3EMKA 5LQMA 4O4LB 1GDDA 2QN3A 2QVZX 3TJRA 2XCOA 2ZJFA 4LQCA 2JIBA 1CJMA 3JQGA 4LSWA 3WLHA 5IBCA 1ZBDA 5LWHA 2I80A 3ET5A 1H2BA 4ZOCA 1MAWA 1V5IA 1I4WA 1TJ3A 2ZI5A 3C3KA 2HU2A 3PNSA 2CHFA 2GN1A 1V9CA 3BRCA 2XD4A 3BMNA 3IUQA 3DB1A 1GU1A 1C5KA 2AOTA 4LBZA 4TXNA 4WN9A 4XA8A 4XWTA 5IJ9B 1JR6A 5BSGA 3D6HA 3REQB 1XN1A 2LXNA 1R2QA 5FNVF 3MRSA 3KT6A 3OSUA 4NU0A 1BQ4A 1VHJA 4GI1A 3H7AA 4EZEA 3PGJA 4FKZA 1TU3A 1VRWA 1VM6A 2MSCB 4KODA 5GOTA 2ZKIA 3K0SA 1WX1A 3HU3A 5F77A 4E5UA 1GM5A 4LOKA 4JL5A 1NDQA 2C8KA 3C43A 3LSYA 4W82A 1IOWA 3CJRA 3COVA 3PITA 4HQOA 5ALYA 1PJLA 2ENWA 3EISA 3EG9B 2Q8NA 1BCRB 3A25A 4IIVA 3B38A 4WLUA 5ANRB 2R5NA 3RC2A 1M0WA 4JLKA 4Y6LA 1K08A 1WMDA 4BMNA 1QGUA 3C6XA 3F5FA 1P3DA 1PVVA 3L4JA 4AYWA 1SHZA 4ZYVA 1J97A 3B1KA 3JYHA 2IX9A 3L05A 3N8HA 4WDRA 4GBED 2L0XA 2FGKA 5IRCD 1PZFA 4C0KA 2ZUEA 1KKMA 1SO8A 3OIDA 4TL7A 1VMKA 1O6BA 3NASA 1G5IA 1P7WA 5FADA 2C42A 2PMKA 5JW6A 2P5UA 3AF5A 3JYOA 3USES 4GR4A 5BR7A 2O1WA 2QOEA 3N2NA 4K40A 4E51A 5CFRA 2A5LA 1LDGA 4N5MA 4MWEA 2A3NA 1U8YA 1EYZA 1B7GO 1SPBS 1K5PA 3CWZA 4FC6A 3R6WA 4DQLA 1A9PA 3VR4H 1GLNA 5JFGA 1R8SA 3ZIUA 4W5TA 2JGKA 1DDOA 1UQRA 4KL8S 3KSUA 1XFDA 1XYVA 5KYWB 4MAFA 1H4SA 3PNBA 3C24A 3U9SA 2HJWA 4J6FA 1G17A 3X1MA 1E20A 2WV9A 3TQCA 2G0NA 3U7QB 2QWXA 2B99A 1XGKA 2HB6A 4MHOA 5JJBA 1YQGA 4R84A 1SU4A 2A0XA 4I2VA 4RNCA 1K92A 2B4YA 2P6MA 2XRYA 1NE2A 4MW5A 5C1BA 2JLVA 3FCSB 1KEVA 2D7JA 3JR3A 2QV0A 4GOXA 3TZBA 3TIXB 4N3BA 3KFLA 4MI3A 1VKOA 3PPVA 5FYQA 5FFNA 2FPGB 5DMXA 5GGXA 5T3YA 4HR7A 4MV0A 1XNRB 3R7AA 3X1XA 1BH6A 1Z08A 3WJ2A 2NYVA 2Y6VA 2C5SA 4IZHA 2PU5A 2VL7A 1US8A 3KJFA 1L5MA 4MYRA 1U81A 4CKXA 3GLHB 4X1KB 4U7DA 2QYHA 1GPLA 4X41A 1MVLA 2NSJA 3TOZA 3UCEA 3W5HA 4X85A 3GT4A 1VECA 2H59A 2RJ3A 1WXFA 4MR9B 1XPRA 4OSEA 4V0SA 1ESCA 2ZBDA 2QVLA 4M3NA 1QHHB 4FB4A 2B82A 2W2LA 5FWXA 1MN6A 2JGRA 4GE3A 4RYDA 4OKNA 1NI4B 2E82A 4KQIA 2WWRA 4RGBA 1U7WA 2EHDA 3JYLA 4RLQA 4GQIA 1PKEA 3TOVA 3LPLA 3QKRB 1NUHA 5F21A 3DBHB 5EOVA 4N65A 5ICGA 1CS4C 2AEEA 2CVOA 4YXWA 2EKBA 2HCBA 3ONFA 4AC9A 1UXJA 5JNLA 4TRMA 3LVQE 4D0GA 2PO7A 4MH0R 1SBIA 2VP4A 4YDQA 4JQZA 1J00A 1EA5A 1SKAA 1G8YA 3EGWA 4LPSA 3AVVA 3TQFA 1XN4A 1GU7A 2D1YA 3N9IA 1P73A 1IUKA 2VRWA 1E2NA 2WHXA 3GQVA 4QOJA 4KR7A 2VJOA 4KMMA 5HW0A 1DJPA 3IEXA 3OCZA 4CR8A 1ODTC 5AKIA 4MV5A 2FHSA 2JNWA 1KNXA 2PZMA 4N01A 3DOFA 2HA7A 4GG1A 1X6VA 3DW1X 2PSSA 1ADCA 2RIPA 4HPJB 4M60A 2R62A 1YBHA 1ZKDA 2ZW9A 2VDJA 2ZJ4A 5F76A 3U7FB 1R88A 2NSYA 3NXKA 3FOWA 2GESA 3WYCA 3GN2A 1T24A 4S1VA 3FAZA 2BONA 5FI3A 3GJ6A 1K8ZB 5C34B 3DT6A 5LZ5A 1YRYE 2V0CA 4MAMA 1V1RB 2VRCA 5ES3A 3SYKA 1M0EA 3ZKWB 2W9XA 5LB4A 1TAGA 3UICA 5CM8B 3LP8A 1GOTA 1TAQA 4UM8B 2NTYC 5EP4A 1FU4A 2WJ4A 1J2RA 1YR1A 2D00A 2F1OA 2IIPA 3IIEA 5D6NA 3V1LA 5KVVA 2CEKA 4RKWA 3W5DA 1IQRA 4P35A 3S44A 1XQYA 5TRTA 5HHTA 5FAXA 1G8MA 2ZUDA 3H5VA 1B8VA 5EJGA 3QLJA 2OKCA 3D2CA 5CDYA 2ID7A 2AWOA 1T9CA 4K9SA 3WRYA 4ZGBA 5CURA 4FYHA 1PR2A 4MMYB 2QP4A 1VE7A 4YO7A 3KBBA 1EDBA 1FE8A 4LOHA 4AY2A 1DQRA 3U1TA 1WSAA 8GPBA 1PF7E 1Y4DE 4BLVA 2ZI3A 3A6EA 4CU2A 2BFMA 5HR5A 2O7RA 3G3EA 4KIWA 3W6UA 3FLAA 1P61B 4R1MA 2WHEA 3I83A 1MO2A 1NURA 2WTAA 2UXBB 1IWPB 4LK3A 2FN9A 4BTLA 2H2GA 1UKZA 5F33A 2HGSA 3HKCA 4QHTA 1GRVA 1EJ6A 1U3GA 4QEDA 3OEHA 3Q98A 4EUKA 3PIDA 5JAHA 1KSGA 1AUXA 1JHOA 2VT3A 1PTJA 3TEFA 3ZDEA 4ZHQA 1HNWB 4Q00A 5DRTA 1F7VA 1U0GA 4F1WA 1KO7A 4UAGA 5JZVA 1GEGA 3ZZUA 2P4QA 1U9IA 2GM3A 2OP1A 5K0TA 4NFYA 2RE8A 1DIRA 3D43A 1UWLA 4D02A 3LXUX 1I7LA 1CQIA 1FNCA 2IZ0A 4L9AA 5HGJA 1H65A 4JT9A 3RR2A 4B5LA 5PGMA 2FP4B 2P27A 4IUDS 3Q2IA 4RPHA 2GEDA 2Y99A 5IZCC 4KOAA 3C3AA 3RTGA 2VG8A 2WAOA 3TTVA 2WAYA 5IKEA 2QIPA 3FF1A 4YUXA 4AZSA 3RTCA 3CCBA 4Q1DA 3W04A 2BI7A 5LQNA 1G5FA 1T2VA 2BEUA 1CR1A 4RVFA 2AG8A 4TKUB 5DHPA 4D43A 2AVNA 3AUSA 3M6MD 3OQMA 4D6PA 1HTBA 2V5VA 1FPQA 5TPWA 1ZD4A 1TE2A 4JFRA 3U4MA 4JWTA 1WSWA 4JUAA 4PICA 4ZT4A 3TSYA 4BVEA 2PL5A 3NORA 1S01A 3GH3A 3IVGA 5JI2E 2X8BA 2WG0A 4YC7A 1D1PA 3WBJA 1DNPA 2C00A 1CXZA 2XTMA 2YIJA 3QEOA 2ZUTA 1EG2A 3AR2A 5JBQA 4K9LA 1JBQA 2VI5A 3SNKA 3GPIA 3KYCB 3EY9A 3ZHCA 3BREA 4WLEA 5IBPA 4DAOA 2VPTA 3NBQA 2FPIA 4CFSA 4J2OA 1GRRA 1OT3A 2CNWD 3F4BA 1PGPA 4E21A 3ICEA 3EFOB 4N8EA 3ZV6A 3C97A 3LQ2A 3A1DA 3ASYA 4C2TA 1IMJA 4LY6A 3IBTA 4MJLA 3RFUA 1TKRA 5LUAA 5BRNA 4BB5A 2WBLC 3N87A 2ZKLA 5CU7A 3H2GA 2EJTA 3AW8A 4Z1MA 3WHKA 1YB6A 4CLXA 5BR1A 1UBKS 1ZD3A 1SXIA 4Z7JA 5M7EA 4R83A 1O96B 1XRLA 3H5WA 4YP0A 2XNCA 2VCYA 4AECA 2M6LA 2WSSD 5CG1A 1NG9A 1X1RA 5EIXA 1H94A 4X3OA 1E59A 4M89A 3HVKA 2XMDA 2PSHA 5EJ6A 2QAGC 1UBRS 4KAXA 1Q1ZA 1AY0A 1RHQA 3CLUC 5FL7D 1XVTA 1S1MA 2YZNA 1QP7A 3Q87B 2JAOA 2PD6A 1BFDA 3R3UA 4E32A 1WB6A 4OHPA 1UDCA 4R8VA 3EZ2A 3QW2A 3I53A 5EHIA 3RRZA 2ORYA 4MVXA 5TMPA 4CT0A 3DC2A 1OIWA 2KM1A 3O3NB 4OXIA 4UXIA 3AUXA 2GAAA 1MGOA 4D42A 3QYJA 1JA0A 2NSLA 4MB6A 1DBRA 3L8HA 3AJAA 3EGVA 2V03A 3OP4A 3TR0A 4M1MA 4FP9A 2JHCA 4RF4A 1YDEA 4L5CA 3RE1A 1VBKA 2H9YA 3QJGA 1JX6A 1JSLA 4LHEA 4QFCA 3ZGVA 1BA2A 1DIGA 1YMVA 2F64A 5A02A 2J48A 3UATA 1XRMA 2VDUE 1DMSA 3G2LA 3LDGA 3LUBA 4PG5A 2NN3C 2AE1A 3H3JA 2UKDA 3ICOA 3TIFA 1EINA 1U4NA 4GMGA 3GGSA 4II7A 3TSAA 3KQKA 3ZHOA 5LP6B 1B1AA 4Z4HA 3G82C 2VDLB 3EBOA 3O9ZA 1T8YA 3LVFO 5LOVA 4EYGA 4CLRA 3WK8A 1HV8A 1FNDA 2FPPA 3IDZA 4LZLA 1M7GA 1W0KA 3KS9A 2CN1A 2UVQA 4MP8A 3SJAA 3ZDQA 5HIAA 2MOKA 3MJEA 1C29B 5EHQA 1HYGA 3VKWA 2FZWA 4W1SA 1T9ZA 3RG2A 5ESWA 4DA8A 5HILA 1ESDA 2EBUA 1OH7A 3EZNA 4J6EA 2Z1MA 5H9WA 3FUCA 4TS1A 2NSDA 5I7FA 3EHDA 2REQB 4RA6B 4ER3A 1XBTA 3Q8WA 2I67A 4DJ5X 4N0MA 3BH7A 4WNYA 2BKVA 2IU4A 4CR6A 3ZCUA 1NY6A 5JNVA 1NBIA 1XWFA 2ZYHA 1I9CA 3EWNA 3H9JA 2GDZA 4V02A 1WV1A 3DOOA 2R6JA 1IUOA 1EX1A 3OX3A 1QFZA 4P32A 1AO0A 5A3QA 4JV5B 2P2DA 4KE9A 5AHXA 3P52A 4KN9S 1U8CB 4J0CA 3JVIA 4FYXA 3H2IA 4MS3A 1QBGA 2HMWA 4DV7B 4JY7A 2FEOA 4LBWA 5GJCA 2HQRA 2JJ1A 2UYGA 1DT3A 3F0TA 4OAQA 5EHZA 2J30A 4O2AB 3GQBB 4G6ZA 5CT4A 1C7ZA 4OK3A 1PL6A 3UMYA 1TJ5A 1VSBA 4ZA2A 1XQ9A 3ILSA 1D4OA 3GMSA 1E7YA 3ROFA 3LZ6A 3OTGA 2WUFA 3KVVA 3R7DA 3T5MA 2GHRA 3ZNOA 1HI9A 1MPTA 1FYEA 1QYDA 2QRJA 3EXFB 3CVJA 3NBFA 2DWQA 2GPWA 3A4MA 1ORTA 2VHYA 4JJKA 5BW6B 4WN3A 2VDKB 3UBTA 4LV8B 4K87A 2BMJA 3TW8B 2JKYA 5G0WA 5HS4A 4AWAA 2J1LA 2P90A 3HMQA 4FFLA 4EA9A 4QLBA 2AX4A 4FQ7A 3RVJA 2W6CX 4P86A 3MQ2A 2CCGA 1T4CA 2C7QA 4EQ6B 4FN5A 3R8XA 1S1CA 1GQSA 4YCMA 1JHQA 1YRBA 1E6MA 3GEGA 1SUIA 3ONVA 2I2WA 2VBCA 3EZ9A 3U80A 4MHTA 4WCVA 1IN1A 3PNLA 1U5CA 1RWMA 3EDYA 4JH0A 3ZE6A 4EMSA 3DF9A 5A04A 4RUKA 1XZDA 2OM2A 4JI3B 2J33A 4HQKA 1R1DA 4RKFA 1SRQA 2AJDA 2HK6A 5IULC 1PZXA 4WCDA 2XOEA 3CH6A 1UADA 1C4KA 1P5RA 3DPSA 3B2EA 1GKYA 2ZJ7A 4NJMA 2HDOA 3LUKA 3MMXA 2F9MA 5G0VA 3FCOA 5FLEX 5K3FB 5J2TB 2HO5A 4A6DA 2IV2X 3U1BA 1PV2A 1TMYA 1S96A 3Q85A 2ICAA 3A14A 4KXLA 2CZQA 5T6MA 1KP9A 1U0RA 2ZCJA 1JQAA 1MC4A 3NEPX 4B7XA 4IFEA 1DGQA 2JLCA 3OE1A 2XOXA 2HRDA 1X15A 4XYBA 3SIXA 1CJBA 2A0KA 3G6WA 2J3HA 1JAZA 3JXEA 3UANA 1FQJA 1G5RA 2NIPA 2VUTA 2Z3WA 3AIIA 1DEXA 2WHRA 1WMSA 3K0CC 3ZV7A 4D8UA 5ETJA 4EG6A 1NVAA 4JI2B 2Y9PB 2X77A 2BSAA 3F96A 1J8QA 3GG2A 3IR5A 1WVGA 2JASA 1UJ4A 4DPLA 3W2GA 3MTQA 2HM7A 4C0HA 4D44A 2G1AA 1FFGA 3HXPA 3H17A 2NT3A 4CETA 1IG3A 2PZGA 4XQCA 1HR0B 2KX7A 2P5YA 2Q5JA 5ECGC 1IHXA 1ZI6A 1G98A 1QP0A 2W98A 4L6IA 4I4TF 3MQFA 1AA9A 2BUBA 3MUFA 2OQIA 2OZEA 1X0VA 3LYAA 3C8DA 5A0TA 3ZNQA 1OZHA 4AO6A 4Z1OA 1DE0A 3W05A 2W42A 4DG5A 2ZSEA 4EDHA 5JCXA 1PNVA 4Z0HO 1TQ2A 2PGAA 3P9KA 1CRZA 3FFWA 3ZWVA 3WG9A 3KYBA 1Q21A 5JPDA 4QOIA 3C7TA 3RYFA 3U4QB 1WO8A 1DIOB 1ZN2A 5ELLA 3V2UA 5GJBA 2JLQA 2B2CA 2Y0DA 4TMTA 3R6GA 2QMOA 1BMQA 4M8LA 3BWDD 3CVWA 1A50B 4FLFA 4LY3A 1TQ4A 1IATA 4S0ZA 4HJRA 2AOWA 1H1TA 5DF1A 1KMIY 3LL4A 3VFDA 3CPJB 3LRPA 3NDRA 3PQ5A 4G8CA 1REQA 3PUJA 4YTEA 5L3ZA 4DF3A 4XUDA 1I6MA 1POXA 2Y0PA 5C8ZA 1QHYA 1W25A 1Q50A 1YULA 3E7XA 2I22A 4JB3A 3PVZA 4X6YA 5AVKA 3GJ3A 3WGOA 4OB8A 3ZHXA 4I4CA 1VLJA 2QUAA 3L84A 4PHTA 1B76A 3IHLA 3NDPA 3TLAA 3F5QA 7AT1A 4MX8A 1XL1A 3ND9A 1RQRA 1EFUA 3KUCA 4TTVA 3VYRB 4URXR 1NXQA 2AFHA 4DYDA 5AVUA 1V45E 2PBRA 3D4LA 4B1FA 5JCZA 5M04A 5HP4A 3H3FA 5E38A 2UZ3A 4HBZA 2YV1A 4TS9A 1CF9A 4TRJA 4HNGA 4Q0MA 2JK0A 4UAVA 2PRIA 4I1VA 4KLRA 1Z0UA 2Q3CA 3FR8A 3V7WA 4H7PA 4KHZA 5H3LA 3OBBA 1T9DA 1CP2A 2I76A 2ZIWB 4WZAB 3GUZA 4FNAA 4FXPA 2Q41A 1UJ5A 3HKBA 4OHVA 4M9XA 4YBRA 1Y5LA 1FJGB 3NIFB 1P5FA 3O8QB 2V98A 5EMNA 1AK1A 1X1SA 3DP9A 4FVTA 3COJA 2XXAB 1LY1A 1PR3A 4G5YA 3Q4GA 3UGTA 1II9A 1UZMA 2VN8A 4O63O 4OK6A 2I87A 4I9NA 3VNUA 1Z88A 2DPGA 3MTBA 3QMMA 4JEHA 1XD8A 4U1RA 4ARCA 1BGXT 4WK2B 4B40A 4ETMA 5JH7F 1ICEA 2ZUUA 2JLWA 1IWOA 1FBNA 2GAFA 3HL4A 1OAKA 4YJHA 1NLUA 5G1PA 3ZD9A 2D1FA 3OTIA 5JADA 1F60A 4R68A 4B8ZA 1IY2A 2E4AA 3O8NA 3QYAA 4B9AA 4DCSA 4ER0A 1OFIA 2R47A 1I6WA 2DR3A 3O9MA 2KW5A 4TVOA 3IIJA 2CLOB 1N8NA 3GJTA 3SVZA 2EKQA 4AKGA 4YRZA 1MXFA 1GKLA 2D4AA 4RGQA 5DMHA 4XM1A 2FXIA 4MROA 3T12A 1MORA 4MYDA 2FEPA 1N2CE 1U3TA 3SQLA 5BSHA 5C81A 4HLCA 3RKUA 3QWIA 1Y82A 2C4HA 3SN6A 1P80A 3ZE7A 2QD4A 3H97A 3OLXA 4IS3A 4HV4A 3RT1A 3RS9A 1S2NA 5CT5A 4UCFA 1T9HA 4M0PA 3K35A 3WSVA 1ZKMA 2BHSA 2Q3DA 1GG2A 1XRJA 3QLVC 4OAOA 2GBGA 1U99A 4GICA 1JEOA 1MJ5A 4RHXA 3CVOA 5HBRA 1NJGA 1DQZA 1WWKA 3SC6A 3P27A 5B64A 4A10A 5C8XA 1LDNA 3LY7A 3ADDA 3HMKA 1Z4PX 4PZUA 3E9ZA 3S2UA 3FJ1A 4HFJA 4ND2A 3KWMA 4F3CA 1R0ZA 1HQYE 2B25A 1P6QA 4F86A 3HCPA 1G2OA 2B1JA 2OBLA 3OFVA 3VI3B 3KJNA 4L78A 4YHHB 5KHAA 4FPXA 4BZXA 1K88A 4FHEA 1SVUA 2NW6A 2C9OA 3F2IA 3Q6MA 4J0QA 3JD1A 3RI3A 1KYZA 3ZGXA 2C4VA 4WXEA 4HGOA 4CM4B 4Q66C 2BGNA 4WVLA 2QX9A 3FXAA 3HUEA 4NG5A 2H4ZA 4KYVA 5LQJA 2AC2A 1JMVA 4CMEA 5CCXA 1BMTA 1J5PA 4M98A 3VR4D 2Z8YM 1UMBA 4BMVA 3IEVA 3L77A 2BHRA 3PWSA 1WUTA 4ZARA 1XWWA 4KPYA 1JQ3A 1JYEA 2ABWA 1QYCA 2NO0A 5HJEA 3AO0B 1F2VA 1UQUA 3BMCB 3C85A 1K5GA 3TPCA 1HZZC 2X6QA 2PY6A 2FN4A 1JG2A 3Q7QA 1PLLA 2ZTHA 3PXGA 1O6CA 2CXQA 1HQCA 2IJGX 3FTQA 3NIDB 5E1MA 3WNZA 4PAMA 3PGLA 2QD2A 1J06A 1XO1A 2O23A 4I5EA 1LF5A 1SXJA 2K7FA 1O9BA 1SMKA 3K9CA 3EAQA 1JHPA 5M2QA 1K2VN 3R0ZA 4ZYYA 3DUFB 3EEIA 4RHEA 5JAZA 1Q44A 5HNKA 4OP2A 1U63A 1HQKA 2V7EA 3IE1A 3GLFA 5BQ5A 1Z0AA 2XGSA 1N8TA 3V4PB 1T3SA 5DHUA 3GEPA 1M1NB 4NICA 3KJIA 4KR9A 2Q4DA 2AZDA 1Z9BA 2NO1A 2YHSA 4PFJA 2B8NA 1N5DA 3D1VA 2D5BA 2YV4A 5K6TA 1V5EA 1TCBA 4LGCA 4REOA 2M2IA 4NCAA 1DKRA 2YIDA 2B2XA 4U9IS 1CU1A 2Z8YA 3OE4A 4CLEA 1IN4A 2YC4C 3PFIA 5H68A 4C3VA 2JRCA 1ODSA 3ZGZA 5KTMA 5FX2A 4E70A 3G5MA 4CIYA 2J0UB 4QPNA 1IPHA 4ZDWA 2VT2A 1RE1A 1N5MA 3IT1A 5IAOA 4CEJB 3I9V6 3I09A 2VFAA 4DM3A 1YUNA 3IUNA 4DMCA 2I54A 4INPA 5KYKA 5F5XA 2W2QA 3D4BA 1RKXA 2ZUBA 3TB6A 3WNVA 2CK3D 4G5SA 1Y8QB 4G9GA 1QHEA 3PHJA 4OHKA 2IYPA 1E3IA 1H8ED 1TF5A 2XQFA 2PT9A 4YO8A 5IJAA 3QUBA 3BGDA 1L7DA 3PD0A 4J43A 1GZHB 5AH0A 1O08A 1JIKA 1AGNA 1INLA 1SHJA 3GDGA 5JAIA 1Z5WA 3WGZA 2C31A 4CI0B 5T3UA 1QTRA 4O4HA 3EZFA 3MNFA 1J1ZA 2BGLA 3B48A 3K9BA 4EVSA 4CDRA 3MELA 3QX7A 5EIOA 3IH5A 1GCAA 2C99A 4JDPA 5H0IA 1QX4A 3AEUA 1AOXA 4KN5A 5H3CA 5IBQA 1FSFA 4JBNA 4ZPXA 3W9YA 4HD8A 2JLSA 4L50A 4BRUA 1KBZA 2WLSA 1WCIA 3M5DA 1XFAA 2PJRA 4C4OA 3WWCA 1VL2A 1ORWA 2D2EA 1FZQA 1Y3IA 3WWDA 1F7UA 1G63A 1FQKA 2C2YA 1H3EA 3FYUB 4B6OA 4BV3A 4I8XA 4OL9A 4K5QA 1W0CA 2ZAIA 3M9XA 1IAVA 5LVAA 2PN1A 3O03A 4F45A 3C5WP 4RANA 2CMGA 2RMKA 2VJMA 3PEFA 5ALIA 3LLUA 4MV6A 3T3DA 1N33B 3IP1A 1NW4A 2LCFA 1I4TD 4XGQA 9GPBA 1JZTA 4EA6A 3RRMA 3KQYA 1Q15A 1ZWKA 3QKTA 4MIEA 4EI9A 3FVVA 3GFVA 1NQXA 1PIWA 3IE2A 2BTQB 1N3LA 3GR6A 3H3XA 3CX8A 3G2PA 1PZHA 2WYHA 1UBOS 3K0BA 4R31A 4RVDA 5CXSA 2KI5A 1EGHA 3OY2A 3JV7A 3KR9A 5IEBA 5EMKA 3PK0A 4M7PA 4OL0A 3U37A 4P2BA 3BKXA 3QMVA 3HCRA 2ZIZA 1E89A 2GTPA 2VYND 3DR3A 1QYXA 1A9SA 1DG9A 1Z18A 3JQCA 4L7QA 4QLAA 4EFMA 5JXGA 1THGA 3QELB 5I4CA 3UM9A 3ECAA 3KE9A 4G0NA 3S7TA 1FMJA 4C7OA 1GCOA 3KSZO 4PCUA 5GAJA 4KUHA 3TL6A 4DY4A 5FLXA 2OWDA 3S0JA 3HPQA 2QRVA 4Z8XA 4QJ4A 4NF2A 1PQWA 1BU5A 1CY4A 2A9FA 2WFZA 3CURA 5JDCC 1WBBA 3TIGA 3C7CB 4DANA 5B57C 2OLEA 3UB4A 3L8DA 3RWOA 4JVLA 3BFVA 3GG9A 1ISGA 4Y6OA 3R0JA 3SE0A 4DR4B 1HTTA 4M9ZA 1QHGA 4RADA 4S1PA 5L6MB 3WFJA 4BJ5A 2OL4A 1IQ0A 4V2IA 5FOXA 1MUUA 1SVIA 1ZZEA 5JANA 2WE7A 5FTNA 3FH0A 2ZSIA 1LBEA 3UMCA 5BW8A 4J29A 4LF6B 1N3BA 3EVTA 2OBNA 1XZMA 3C7KA 3STXA 3BCSA 3FYCA 1J6UA 1NVUQ 1Y1RA 3N8NA 2IHUA 3GNLA 3FKQA 5B37A 1SVWA 3DFKA 3WADA 3D59A 3OSZA 2XYHA 3WKDA 2PKCA 4M6WB 1SUWA 4C29A 3KB1A 1BW9B 4A0HA 3GYGA 1QSGA 1MU0A 4N3AA 4DWWA 1YU9A 4PW0A 1P8AA 2IYRA 3SLRA 4CIVA 2F8MA 3PP8A 5CIYA 1J2TA 5JVDB 2HMSA 2NPFA 2H1CA 1U7OA 1SCDA 5CMLA 1RYZA 2Q2VA 3EPPA 3NVAA 3ONDA 2PL3A 3F90A 2PX2A 5G3YA 2IYXA 3UYKA 1ZCBA 4UPVA 1DWUA 5F1OA 1AQNA 4JKIA 5TDHA 2DHEA 3RS3A 3THXA 2I4MA 3L1HA 3HGMA 3ETNA 3WO1A 2CY0A 3OT1B 1SVKA 1R4MA 4J7AA 4M8KA 4OGFA 2Q6KA 4Q93A 3DS8A 4J0KA 5FKJA 1XELA 5CPBA 3UTDA 4EJMA 3ZLJA 2YCLA 3MB8A 2VVTA 2HQ1A 2QT0A 4FTWA 4IIEA 1R0CA 3RYCA 1JVBA 3V9AA 5F2EA 2IU6A 1P31A 1EHCA 1GGMA 3SJ7A 2O8DA 2JEOA 2J4FA 2ST1A 4KQEA 4N3GA 4IICA 3K2EA 4V0MA 2XMPA 2H54A 3JALA 1ZOPA 4LXUA 3TK1A 3IPYA 4X24A 3JVVA 4Q21A 5ADVA 2VK8A 4J7XA 3AB7A 4KV9A 4NYIQ 4D6YA 1GTSA 2FEAA 5EIHA 2WJJA 1NPDA 2PLWA 2OPBA 2ZR0A 3JZFA 4REQA 1SC9A 3E9NA 2QE7A 2X7HA 1OI4A 4TV8F 4R7GA 4EVRA 3VYWA 3OZWA 4JJZA 5EFZA 3TMAA 1O5TA 5E4JA 1SD1A 2D06A 4FLMA 1ZM4A 3EIUA 1B8UA 4N9WA 2MTBA 2W6QA 1RI1A 4X1YA 3REOA 5BURA 3OO1A 3RFFA 3ESQA 3T41A 1HT1E 3KOMA 1YB7A 3FM9A 3PJGA 4ROSA 4HWTA 4XD2A 5T4FA 4UTRA 4A0QA 4LX8A 3TM5A 1GGHA 2OORA 3EC2A 4UNIA 5TB5A 1XF9A 5D1HA 4QELA 4NHEA 3E15A 3KSBC 2QIOA 3K0FB 2BEKA 4QWWA 3KB2A 5J5CA 3HCDA 4H7HA 3D6NB 2C8VA 4DLZA 5A9RA 1Z8HA 4FMCF 1K8QA 1UJMA 3JASB 3OWXA 3VKHA 3KAPA 2CFRA 2H3EA 2RKBA 2C3PA 2D5CA 2PRJA 1NXXA 1WDMA 1Z5NA 3HKDA 1L5LA 3D1JA 4TV9B 4IIJF 2BWJA 5EKUA 5C4IA 1H5QA 1K2WA 2RHJA 1Z6GA 2O0MA 1T0JB 1JDBC 1PK8A 1QFJA 1ZU4A 3PHLA 3HJFA 4UHKA 3WLOA 3AXSA 3F4LA 3W7VA 2PYZA 3BM5A 3D6JA 4MS4B 3HVIA 5TJHA 3V4LA 1CZLA 3AOEC 3GJ0A 4IS2A 2DR0A 3CHYA 3L0BA 1KQGA 1ZGBA 2FF5A 2ONCA 2EKLA 1VHDA 5KYXB 1LQTA 1Q74A 2YTZA 3HY3A 5HIJA 5KDOA 4GX1A 1G42A 3OJLA 1W36C 3DBRB 4OEHA 1II8B 3BFJA 4CW7A 1HC7A 3NKLA 4DZTA 5FUMA 3WZLA 3D8HA 3KPJA 3IOEA 4Y0VA 5IM5A 4C30A 3REFA 2I2DA 1OB5A 1QG2A 5BV0A 3O4FA 4L5YA 3R0QA 3TCNA 4PRZA 4O5OA 4ROTA 3L4SO 4MUYA 5BNWA 3B3GA 2X4IA 3K2QA 3TN7A 1C0EA 1U1EA 2CB9A 3T7SA 5IX8A 1JQLB 4GL2A 4H2DA 1I2MA 1H9CA 3MMNA 2C4UA 4TT8A 5DM1A 3UUWA 4MLZA 4R1PA 1E1QD 3ZZ0A 1BE1A 1L3BA 1QO0D 1VA5A 3F74A 2GF9A 3K0HA 3I1JA 5IS2A 2EFHB 2VUSA 3D81A 3BGVA 1Y9AA 2CFSA 2HBYA 2PNFA 2WUWE 4K8RB 1XCJA 3M4YA 4OMCA 3E7DA 3JTMA 2YY7A 3HTXA 5CIQA 1TTPB 1DKUA 1KY4A 3DONA 1WP9A 4TSRA 4U7FA 4AUEA 2B4KA 1J42A 3PF9A 1NZFA 2XNHA 4B7CA 5IM4A 2I6QA 2G5GX 4B74A 1H1LA 3CLTD 3ITEA 4XYGA 2HWKA 4DC9A 3COPA 5HDQA 4YV1A 4KQFA 3D8TA 2I62A 4HDSA 3IP9A 4G9BA 3U3JA 6Q21A 3PBKA 4L4YA 1FFHA 1R4NB 5DNWA 1CFJA 1PQUA 4MXDA 4WKBA 2Q2QA 3TGWA 2OBBA 4R7TA 1WCXA 2VA9A 3CPSA 4L3OA 3B1VA 4XCVA 2GQ0A 3UW3A 1NUUA 4EGFA 1HZZA 3DKPA 4BP3A 1DRWA 2B98A 4PG4A 1QRRA 5IJ0B 1W46A 3A1CA 1QRUA 1EVLA 1XRQA 4HNUA 3TZKA 4H1TA 3TX6A 1LSOA 1A88A 1O4VA 3AUTA 3F6PA 4RPJA 3GJQA 3OZRA 3Q11A 4J0JA 4OIMA 2X3YA 2GNPA 4P3KA 5GVRA 3ETHA 1NHGA 3MUEA 2JLUA 1Y5IA 2F59A 3NBMA 4KHPB 2HY7A 3G7UA 4D0NA 1G8FA 2AN5A 3NC4A 3PC6A 2QZ4A 4HTAA 2FRVA 4UARA 3HNRA 3TLMA 1PN3A 2W90A 4YRDA 1NBEA 5CH3A 1XEXB 2A7QA 1Z82A 3I8XA 4CRWB 4OQLA 4KN8A 1OXTA 4RJIA 3GT3A 4B3CA 3O7MA 1YVUA 2WHPA 1G59A 3A37A 2VHTA 1OPXA 1AZSC 1DTWA 3NDJA 4DDHA 4FMPA 3LFUA 1W2WB 2HFJA 4KGXA 4G8DA 3HLTA 4C07A 2CUTA 4WWHA 4KVFA 4DV6B 3NHRA 4LF5B 2Q1XA 1O9GA 2A78A 1UP7A 3ESBA 3I8OA 2IW1A 1OI7A 4JX8A 1VPVA 2VTDA 3LC0A 4M8NE 1H6AA 1M2FA 1L5WA 1KZ4A 4TN1A 4OOEA 2NAPA 4GBGA 2ILVA 4PWZA 5CA1A 3HB5X 4ENVA 2OP0A 5IXSA 2IS2A 3I6YA 4RF2A 4DT1A 1FYWA 4FILA 4MUIA 1E5DA 3SJZA 4EB6A 4F72A 1OXUA 2IH5A 4U0JA 4ABYA 4EO7A 3G0OA 1XZAA 2JIZD 3SHVA 2QTWB 4RDCA 4ZT7A 3TLXA 4GYKA 4IZIA 2C0PA 3G68A 3L4BA 1UOQA 3HGTA 4GOJA 2QQ5A 2VTKA 1Y1PA 4CM9A 1W8IA 3L0OA 3WLNA 4ENQA 1VG8A 3TVYA 1G0OA 2QK4A 2JZNA 4C7JA 4LC0A 4L4SA 2XUOA 3W78A 2XI4A 5KYNA 5JECA 5J2UB 1AA6A 4E4TA 1RT9A 3ZCVA 2P1DA 2PU7A 3SWWA 4P4SA 2VWHA 1XDSA 3MJHA 3UK0A 3ZE8A 4UASA 4XUGB 2P2NA 1GHTA 1ECBA 3QOXA 1JLLB 2ZWIA 1JFFA 4IJQA 3SEAA 2A2ZA 4G4SP 2PKWA 4RTKA 1PJZA 4XARA 5D00A 4EGAA 2QW0X 3LGAA 4YAGA 2ZGVA 5ABPA 5KPJA 2F8TA 3WXMA 1MW8X 2IY7A 4P3PA 2PDAA 3OC0A 1MBZA 1HLGA 4B80A 1K97A 4MRNA 1WTCA 4C6RA 1EP1B 3JRXA 4G1CA 4KE7A 1NVGA 3O8OA 5CJ2A 4Z3DA 1F17A 4LQ4A 3TLKA 5LA6F 5IYZA 4QYXA 2PKQP 4PCAA 1JIVA 3UAXA 2MIIA 3X1ZA 2TRSB 2M9MA 3OVMA 4CKEB 5JXWA 1C41A 2IXEA 2QLBA 5EWLA 1L5NA 4IXDA 1CS0A 3OA2A 3H65A 3PCRB 1FLAA 4GI5A 3ZDRA 4EEKA