1QFXA

Ph 2.5 acid phosphatase from aspergillus niger
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
447
structure length
441
Chain Sequence
KQFSQEFRDGYSILKHYGGNGPYSERVSYGIARDPPTSCEVDQVIMVKRHGERYPSPSAGKDIEEALAKVYSITEYKGDLAFLNDWTYYVPNECYYNAETTSGPYAGLLDAYNHGNDYKARYGHLWNGETVVPFFSSGYGRVIETARKFGEGFFGYNYSTNAALNIISESEVMGADSLTPTCDTTTCDNLTYQLPQFKVAAARLNSQNPGMNLTASDVYNLMVMASFELNARPFSNWINAFTQDEWVSFGYVEDLNYYYCAGPGDKNMAAVGAVYANASLTLLNQGPKEAGSLFFNFAHDTNITPILAALGVLIPNEDLPLDRVAFGNPYSIGNIVPMGGHLTIERLSCQATALSDEGTYVRLVLNEAVLPFNDCTSGPGYSCPLANYTSILNKNLPDYTTTCNVSASYPQYLSFWWNYNTTTELNYRSSPIACQEGDAMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Aspergillus niger pH 2.5 acid phosphatase at 2. 4 A resolution.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords PROTEIN (PH 2.5 ACID PHOSPHATASE)
total genus 145
structure length 441
sequence length 447
chains with identical sequence B
ec nomenclature ec 3.1.3.8: 3-phytase.
pdb deposition date 1999-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00328 His_Phos_2 Histidine phosphatase superfamily (branch 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1qfxA02
1BQ4A 3QPUA 5AJZA 1K6MA 4AROA 4GPZA 3D8HA 2P78A 1FBTA 2HPAA 5CDHA 1DKOA 2I1VB 1E58A 1C7ZA 1V7QA 2P30A 2OWDA 3F3KA 3FDZA 4IJ6A 4PZAA 3NTLA 2IKQA 2P6OA 2YN2A 3C7TA 3E9CA 2F90A 1SK8A 2H4XA 1YJXA 3NFYA 1XQ9A 4QIHA 4GPIB 5CX4A 5AJXA 1NT4A 2ENUA 3IT0A 1DKNA 2P2YA 2P2ZA 1C81A 2EOAA 3LNTA 2H4ZA 1TIPA 3F2IA 4JOCA 1RIIA 2A9JA 1H2EA 3FDZB 2DWOA 3DB1A 3HJGA 5CU7A 1IHPA 1QHFA 2OWEA 1RPTA 4D4LA 1RPAA 1T8PA 2P6MA 5AK0A 5PGMA 2AXNA 5HTKA 4TSRA 4FDUA 4D4KA 4ODIA 2P9YA 1UJCA 3GW8A 4IJ5A 1C80A 3GP5A 1ND6A 2P75A 3MBKA 3E9DA 2HHJA 4PGMA 3LG2A 1DKMA 2GFIA 2P9ZA 2H52A 4HBZA 5HR5A 4MA4A 1H2FA 2ENWA 1QWOA 1E59A 2P79A 3MXOA 1DKLA 3QPWA 3ZHCA 5AJWA 3R7AA 3QPVA 3E9EA 3GP3A 3IT2A 1DKPA 2WU0A 1UJBA 3O0TA 2DWPA 3D4IA 4EO9A 2BIFA 3OI7A 4ARVA 2HIAA 3PGMA 3K4PA 4D4JA 4E3WA 1SKBA 3FJYA 3IT1A 3LL4A 4D4MA 4JODA 2PA0A 2RFLA 2YN0A 3DCYA 2WNIA 1ND5A 2EKZA 1EBBA 2H0QA 4JOBA 1V37A 3EZNA 3IT3A 4FDTA 1BIFA 1BQ3A 4ARUA 2WNHA 5AJVB 3BIFA 1YFKA 1DKQA 4ARSA 2EKBA 3EOZA 3K4QA 1CVIA 2QNIA 5AJYA 1SK9A 1QFXA 1SKAA 2P9FA 2A6PA 4EMBA 3KKKA 2P77A 3D6AA 4PZ9A 1FZTA
chains in the Genus database with same CATH superfamily
3C3WA 3INGA 4LJ5A 1MO6A 3F98A 1UOPA 4OGLA 1M34B 2BGKA 5IVIA 3WQBA 4Q66C 5AQ1A 2P78A 4Y9UA 1IY2A 4FC7A 1NVVR 1OZHA 5LXTF 4C21A 1F20A 1SCQA 1ZGHA 2FUKA 4JOQA 3R74A 3DMTA 4HDRA 4EITA 1QP4A 2PSHA 2FQWA 1JMYA 3RS7A 4ZI7B 2BTEA 4RE6A 4YRZA 1H2AS 1UM9A 5FEMA 3LT1A 1PJ8A 3L8HA 1AGYA 3KJGA 3RSLA 4AWXA 1VXRA 4KK4A 1UC8A 1YJCA 2CNWA 2Y1FA 3LPCA 1V8DA 4OYYA 1FVFA 2WB4A 4JNKA 2ZRKA 4RIHA 3IE0A 1FTGA 1MLDA 3UOAB 1M67A 1TPZA 1OWPA 3O92A 1NSYA 4M37A 4GZ5A 3ID6C 1FP7A 2BGJA 3K0SA 1VM6A 2D4HA 4XH9B 4DLWA 2ZWAA 5DCWA 4GP6A 4NOMA 4OX9B 3UOWA 2GPWA 6NULA 2G5PA 4AT1A 1AZTA 1D0IA 5JW6A 2XTMA 3F96A 5B36A 2EHJA 4OK3A 2DM6A 2Q1YA 3TCNA 1NMSA 1K9SA 2DUJA 3G5TA 3LIPA 3NG1A 3RANA 3TNFA 5HKKD 1HNWB 3AM1A 5LP6F 1A5BB 1HM5A 1OIWA 3WYDA 5BW4A 2F3RA 1VECA 3GDGA 1E5LA 2G28A 1XN1A 2ZRPA 3ZK8A 4D4KA 4P7KA 1AMOA 1LZKA 1SH7A 1J8QA 3A3KA 4HFMA 4ZU1X 4JUCA 4HC4A 1PQWA 2ID9A 4RD1A 1BD4A 1O8BA 3UG7A 4E33A 4EG4A 4RTLA 1XCBA 3HJTA 4AUKA 4DY6A 3SNKA 3D5TA 3QLUC 2XVZA 2YHIA 3H2JA 2A8YA 2FN3A 4AKSA 2G36A 2YY6A 4ZHQB 4OV6B 1M5RA 1F5SA 1Q14A 3ANSA 4B17A 2QVXX 2XD4A 4ZYUA 1K88A 5EP1A 4Y6SA 1H1LA 3HKCA 4QDJA 2GR9A 5BQ3A 4Z3OA 1XEAA 5ERGB 4QXMA 2CCGA 4NJMB 2OORC 3P9ZA 4LVOA 4Q4LA 4JBNA 3RVNA 1NX9A 3PIIA 4Z99A 5AVQA 3PC6A 3KUUA 1T4BA 2ZETA 3EW7A 3GVXA 3JYPA 5K8UA 2Q27A 3D4NA 2WOOA 3HJUA 4LY3A 1V7PC 5A7FA 1M8GA 4NV3A 3QX8A 4EY8A 1I3LA 1V43A 1KO7A 5JS1A 1IBSA 4PYLA 2PPLA 3CVXA 2GTPA 4DDVA 3AM3A 4C6HA 1GKUB 4GXTA 1O5OA 1PZXA 1QFSA 1CDOA 1E0JA 3BQNB 4XGNA 3CR3C 3E6AA 3ZGZA 3D1VA 5F2EA 3D8SA 4U5XA 2IE0A 2PQ2A 4CG1A 1HFKA 1XXHE 1QZUA 4H3KB 1VGVA 1VKNA 4DLZA 5AOBA 3A1FA 3ROEA 2GS9A 3GUYA 3JR3A 1KAHA 3RRFA 5G4KA 5KYTA 2PSSA 2RG1A 1HDYA 2SCUB 3WR5A 1IK6A 1KIFA 4KQKA 1BMFA 3L7JA 5GV7A 5IH7A 1Z4MA 3HNOA 3LP5A 4BKUA 4CKCA 2HJSA 1WXFA 1C3JA 2FDCA 1PK8A 3I45A 2DHEA 4U8GA 3G2NA 2O2IA 4WFQA 4YUAA 4CXMA 5BV0A 3G2PA 3A1WA 2XDWA 4PFKA 1ZIXA 1LLUA 3NHBA 3QU7A 5CFPA 2R00C 2JLUA 3PB3A 1OWOA 3G7NA 3NO4A 1JILA 4QU8A 5K0FA 2C83A 3ZD9A 3FMVA 3B7GA 2C0QA 4CLXA 3S1AA 4I5GA 4PYKA 4ZFNA 1WIWA 1KMMA 4WERA 4NG5A 2ZB4A 5EPOA 3GUHA 4AZWA 3O3MB 5JWRA 2GESA 1N4AA 2OZKA 3AMVA 4M0KA 4DNXA 4E0BA 1E2FA 3P71T 4HAXA 4KR0A 1K6XA 3A9VA 3KC2A 5G40A 3U26A 1JQDA 3OFKA 1L5GB 2R00A 5HWSA 1RZUA 3VAZA 3QOYA 1ZVMA 3OJWA 4GDFA 3QMMA 4BJ3A 4FYJA 4DMGA 2HCFA 5F1YA 5AM0A 3IRVA 1IG3A 3PI6A 3TOVA 3M6MD 4YRSA 1V4BA 3D4PA 2FN8A 2INGX 1XA3A 3B2NA 3HRIA 4XARA 2PEZA 2IV2X 3W1WA 1GFWA 2FPIB 3AESB 2I2WA 5K2OA 2WI8A 2J0UB 3ZJVA 1GNLA 1A9OA 2HU2A 1KMQA 1LK0A 1A9TA 2XB4A 2XUOA 2ZR7A 4NBVA 3CN7A 4Y3UA 2RAVA 1J00A 1G66A 2WUFA 3ST7A 2P6MA 4S12A 1Z35A 1KFBB 3MS7A 1R3DA 4WXHA 3UK7A 1NMEA 3LUFA 4TSRA 1TAQA 2E5LB 1D2NA 1EFPB 3OQHA 1H4VB 4JMLA 3R3ZA 1PN3A 1OFHA 3KVNA 4WN3A 1Q17A 6GPBA 5JH7B 3JAKB 4JA2A 1RXIA 2DLNA 1ZMTA 2QTCA 1P7ZA 2YFYA 3ANNA 4OKIA 5AK5A 4KCGA 3T4UA 3UB3A 4KJZA 5A4FS 1R16A 1GTVA 2B8JA 1PZHA 1TADA 2ZJYA 4D6XA 1SWVA 2HT1A 3D3QA 4FDMA 3VPBA 3U7HB 1E3QA 4YT2A 1DP4A 1F14A 1M6VA 3PXXA 1ZM7A 5A04A 2A5FA 2IA5A 1O87A 5D5PA 1T4CA 1UDXA 2QTRA 1R9GA 1IRXA 1VI6A 4G01B 1GUBA 1X0VA 2C4NA 3SC4A 2QMEA 1NVBA 1WY7A 5LUBA 4C78A 1F12A 1W4RA 5A2QA 1Y8RA 2XUJA 4OXKA 1EUDB 1S01A 1XKQA 1PWZA 1DU4A 1FRNA 2C5GA 3HWX1 5FWYA 2VK1A 4XUGB 5AICA 2W2KB 2FN7A 2C5EA 1U8TA 1Z37A 4IV5A 2Q3HA 4MMYB 4RWZA 4CJXA 2ZS7A 3WRVA 1RP1A 2VC2B 3BXGA 1P4AA 3IHWA 2IRWA 2OPBA 3BIXA 3EZNA 1U5BB 5DE3A 5BT9A 2P8SA 1JJFA 3OCWA 2FP3A 1IBCA 2C77A 2Q99A 1A4RA 1L9XA 3WSWA 2TMDA 3T9AA 4KRYA 3HU1A 4BV9A 2OLJA 2YZ2A 2V97A 3DTVD 1IUKA 4TTVA 1XAIA 3EOBI 4QYXA 5TS3A 2BKAA 3VO9A 2BGWA 1L4KA 3DDZX 1ZD1A 3FCOA 3DGFC 4R51A 1P9LA 4BEVA 1VJ1A 2I8CA 4HYYA 2C9ZA 4ZZ1A 1NSTA 3MXTA 2CLKB 3F74A 3E5HA 2P0EA 4J0HA 4TKLA 3RYCA 5I48A 1L5LA 5TPWA 2FPWA 2GCOA 2IGTA 4LNUA 2QG6A 1Y7HA 3L9WA 4FQ7A 3O8BA 3DZKA 3CT4A 2FSPA 2VPPA 5DM1A 2Q9BA 1ZJYA 2O2GA 4ZJPA 4WINA 1RWBA 4FGKA 3CZAA 1ZK4A 5IC5A 2QRGA 2X76A 1ZLXA 4JWTA 4E2ZA 4RU1A 3KOMA 3DC7A 3T41A 4FM9A 1L4HA 4UE2A 2OGZA 3SZLA 1XP5A 5E4FA 3EG5A 2ZRNA 2QVYX 1KH2A 1Z5PA 3DM5A 1DZ3A 2XJ4A 1XZEA 2FZVA 3HEAA 2YY7A 4V0OA 1DC5A 2QTTA 4J9UE 3QV1A 4OHWA 3X2EA 4BO3A 1E1DA 4FMCB 2QUBA 1GG8A 3X2SA 4YQZA 4ETIA 3KLNA 1U28A 5J47A 2ZGVA 4KE8A 2D0PB 4Z54A 2Y76A 5CDSA 3BWBA 4MI9A 2Z6QA 2YXEA 4KIWA 1GWNA 5KU7A 2CW5A 1K75A 2NUTA 1IPHA 4LZLA 1AQ6A 3FUXA 4C87A 3I2FA 1YU9A 2WMDA 1DI0A 3FGOA 3NCTA 4X44A 3UJ8A 4EPTA 1H2EA 3A6JA 3U3RA 5JQGA 4BVEA 3PEWA 1TMYA 2B98A 4JJ6A 1FQKA 1V16A 4AUEA 2O59A 2PDAA 2BR5A 5FYQA 4F45A 1CZNA 2IC5A 2Z3WA 4DA6A 3P2OA 3B48A 5JXIA 3AL3A 1S2DA 4CHGA 2EJVA 1TEVA 1U80A 1WMBA 2NSDA 2VZ9A 5GONF 2B6NA 4GP9A 5EZ5A 4EK9A 2Y71A 4NAHA 2LV8A 5HPYB 5KREA 1GFIA 1QHXA 1U2DA 1JIKA 3OH8A 4IOKA 1P19A 4Z8YA 5F3RA 4EDFA 4FEEA 3DZJA 5H16A 4YCNA 3ZVKA 3DO6A 1GV1A 2EBHX 2B94A 1E1RA 1OR8A 4MUYA 3ASZA 4KJXA 5TMBA 4G3XA 2XMRA 3BBPA 1W93A 1HL3A 4EENA 1KZ4A 1DADA 2VUIB 1KMHA 3P7MA 4MQFA 1OA1A 4BO4A 3N2YA 3MWEA 4DDUA 4QHSA 2ZLBA 4Z3DA 4MKGA 4QFBA 1TO2E 1ZSYA 1FNMA 4K9OA 4P3PA 3SG0A 1V3QE 4OA5A 2FY8A 3CUUA 4Z0HO 2AG0A 5H02A 1NXOA 1IB0A 2XKAA 5AKGA 2C9CA 1F2DA 4DXAA 3RRXA 3OJEA 2MINB 4RIIA 3U7QB 3Q98A 5TQ2B 3A4VA 2CJPA 3KQLA 5J9FA 3L5OA 3TRIA 4IRUB 2QRKA 3LWDA 2Q21A 2KSQA 3RV3A 5FI1B 2OG2A 1CUAA 2RBKA 2NZYA 3ROFA 5C53B 4ZT6A 3VXKA 1YIOA 3JD2A 3MTBA 3Q9NA 4RX1A 4D5EA 2P9QA 1EEXB 1Q6YA 1NBME 3WLFA 5DN6A 5TE9A 1IQRA 2C5FA 1S8FA 4IIXA 2C5LA 2TYSB 5FBWB 4YPFA 4UZFA 3TOZA 4B34A 1V35A 1ODSA 4EHLA 1TQ8A 3KELA 1ZXBA 1US8B 2VNAA 2Z58A 4AFNA 3H87A 2CDNA 2FHSA 8ADHA 3BMCA 1JAYA 1LB1B 2C9DA 2A9RA 2AGVA 2FWRA 2ORYA 1ST3A 3KL4A 1N9ZA 1ZK3A 1C29B 4E03A 2P77A 4FFPA 1L1QA 2PZBA 3HZOA 2W90A 5KNDH 2H1IA 3LSYA 1R9MA 1ZW6A 1GPWB 1UT8A 4WOPA 2XZOA 2O0HA 3D8HA 3W4IA 3EGCA 1Z0ZA 3JQEA 4MUNA 2MSCB 4DM7A 4OG2A 2HBZA 3BZBA 1OKKD 4BGVA 9LDBA 4HJRA 1YB2A 5C8ZA 2CJYA 1U3GA 3V1UA 1T2FA 2MYTA 4U2EA 5IVDA 5DLQC 3FNGA 3FAZA 3C1OA 3RVMA 2H11A 1ORTA 2HMAA 2QJOA 3EEQA 3H9QA 3OZFA 4FW9A 3GLHB 2E4VA 4Q3OA 4QTZA 4CIWA 4QDKA 2BJVA 4HGOA 2XNHA 5HE9A 1J23A 1XXHB 2AH5A 2GZ3A 4QIHA 4D8UA 2XHZA 1AHPA 4YJ3B 1B6TA 3FWPA 3MJ4A 2P1DA 2W2TA 1VHQA 4W63A 2YXLA 2WFZA 4OXQA 1MVOA 4JT4A 3WLNA 4ARIA 2K2WA 5B7PA 2EW1A 1J0CA 4GLOA 1UBGA 3H5NA 4DIDA 3BERA 1W1IA 2O5RA 3QYFA 2CHQA 2CUKA 1ZN2A 1FVHA 1WP4A 3VTZA 1WQ3A 3A06A 4RHEA 4Z5XA 5CRIA 2AFHB 4KYTA 4UDYX 4TWAA 4EYSA 2H5IA 1W4BA 2IF0A 4C88A 3EQZA 4Q1CA 2QBYB 4HDKA 2XOXA 1G5PA 1YVUA 2Z8XA 4ER5A 4RHFA 2YJZA 5C34B 1OYWA 5DHAA 4C30A 6ABPA 4LF7B 2BEKA 2ODQA 4E6PA 2CHGA 2CVZA 1FMLA 1W30A 1ZUNB 4KKVA 1UBNA 5ES4B 2OV8A 2YJ6A 3B6MA 2JASA 5BXQC 1IQPA 3FSRA 4PX5A 3WV5A 4AB1A 1UKAA 1SIOA 1ZU4A 1JA0A 2F9FA 1E32A 1SVKA 2YHUA 3OOWA 5FQOA 3ZDXB 2CNNA 2BFOA 2DOKA 3OSZA 4O8ZA 5HA5A 4EOGA 2ENWA 2G9VA 1OLSA 2FNAA 3NEPX 4HQKA 4A0GA 1CPYA 4XPZA 4WQMA 2VVTA 4LGCA 4UDNA 3PQ5A 4GM4A 3KOUA 2ZJBA 1VKRA 4MW7A 2HPHA 1J97A 4ND3A 3R3WA 4WI1A 5CM2Z 5SZHB 2IU0A 4II2A 2YOGA 6Q21A 3R7DA 5EE1A 2QQGA 2QX7A 1G21A 1KC3A 1JN0A 1L5FA 2YUIA 1A96A 3DMHA 2G9UA 3QBJA 3K8YA 4LV8B 4M49A 3ZH9B 4DILA 1QP8A 3RFXA 3NHSA 3IMKA 2XI4A 3LLVA 3IQHX 1S9DA 1WCV1 3QLJA 3FCAA 5ENDA 4LF5B 2VH5R 3VPGA 2JFNA 5DULA 3JVEA 2J30A 4LBYA 1GPBA 4QQKA 3SLGA 5KIAA 2QLJA 4HAVA 1TAHA 1GZ7A 2IVFA 2I34A 2ORED 1EWVA 2PGXA 3B13B 3K92A 4G5FA 4JOBA 5DVZA 2D2VA 4FCWA 2DCUA 1QZ3A 5I6DA 5AVKA 2QTHA 4JYPA 5BSMA 4BMSA 5IM5A 4EPWA 3BIFA 2JVJA 2NO5A 4CG0A 3D1LA 2W8ZA 1XDBA 4RA6B 1DIHA 1FS5A 3P97A 4RPGA 5HJEA 3NHWA 4CHTA 3WMXA 1MD9A 4D4GA 2XOEA 4UHBA 3MVEA 3V6MA 2WRZA 4E2WA 2QLFA 4L4ZA 4DIKA 3R09A 2QE7A 4QM6A 4PLZA 4KXMA 3PR3A 4HH3C 1U3DA 1KMCA 3DA8A 5FWYB 3LBHA 4MIOA 4PZYA 2I1VB 3IX7A 2GVDC 4P3YA 5GY7A 2P68A 3GWZA 3IDAA 4LZNA 2EP5A 3U4DA 8ATCA 1I2BA 2JCVA 4K3VA 5EJEA 1FQWA 1G21E 1NUSA 3A10A 1ONSA 5B30A 5HRAA 4DV1B 2JFHA 4R1NA 5CTJA 3AR8A 2OK7A 5JT1A 1JQLB 1Q1NA 3QWIA 4XWKA 1B3BA 2Y9MB 4F91B 4WJKB 2HMVA 4D0GA 3W8NA 4EZEA 1H2HA 1WB6A 4TS1A 4Z2YA 4HGRA 1H6CA 3OE7D 5HQTA 1W5FA 4YAJA 5IEBA 3LCVB 4WECA 5AJHA 2NO4A 2RGAA 3AT1A 4AJPA 1M74A 5M29A 1FSSA 2XXJA 5I3CA 3GRVA 3IS3A 4EI7A 3NHKA 1A8UA 1LPNA 2BHRA 2GHTA 3TDMA 5JANA 2VSNA 2GQ0A 2ZIXA 3RRBA 1GZ4A 4ZTBA 1UPUA 1Y4UA 2ZYIA 2OD2A 2DR0A 3HZZA 3Q7IA 3HJGA 4DLUA 4UZSA 4MJLA 2IHVA 3FBWA 4NFHA 3VBEA 2BMAA 1X7ZB 4D3SA 2QT1A 5IG2A 3JSAA 3QBEA 2XADA 4G8CA 5EIWA 4RS3A 4OHUA 3AETA 3RPEA 1HE3A 5DXJA 2YFQA 4UOEA 3HKBA 3KS9A 1XFDA 2HDOA 2R87A 3CKKA 1SQGA 3R3VA 3WKEA 3E4CA 2A14A 4QYMA 2J0UA 1NOIA 2R8PA 4OXYA 4DUGD 1YFZA 3VZPA 4RPKA 1Y9DA 3O83A 5REQA 1PNVA 3AG5A 5AR1A 4OP3A 9ABPA 2EJTA 4OQ4A 2F55A 1FSZA 2SHKA 5T8KA 2HF7A 3I6BA 1F6DA 3GHYA 2ETVA 2AS0A 2GN9A 4OXRA 1U3WA 4AL4A 2ESRA 2XWSA 1LA2A 2GN4A 3FZGA 1IUNA 3LTEA 2OGUA 3OZRA 1HDGO 1VBNA 2FWBA 3E9EA 2R8EA 3FPKA 4H3HB 2YINC 4GBMA 4HP8A 3SXUB 3OQVA 4EJSA 1ELOA 1X3LA 1KZ6A 2PNJA 3C8ZA 4BC1A 3CJTA 5FF9A 2F3QA 1MABB 2O3JA 4FFWA 4LQ4A 4FTWA 4GPD1 3JAWB 3EXG1 3K53A 2P4EA 2ZULA 3X44A 4CCWA 1HV8A 3WADA 4RULA 3QMWA 1EDBA 1F9AA 5LA6A 4E3WA 2VRWA 3CMCO 1Y5MA 4BLRA 4C04A 2C82A 5A4DA 1HQKA 1H2ZA 2VDUE 4HWRA 5AKJA 4G4JA 4AI6A 3R5KA 2KBFA 2XDAA 1GR1A 1DAEA 1DHTA 1OY1A 4NEHB 3DEIA 1J1IA 3EXHB 3F3YA 5JAIA 2IOHA 2AZTA 3ZBUA 4HK4A 1JLMA 2GBLC 3N2GB 1WJGA 5IF3A 4KO2S 1ZEMA 1QMGA 2WMYA 3OLZA 3EZ7A 3IEXA 4S0XA 5KQMA 3C85A 5KZMB 3U3KA 2IYNA 2PUHA 1NUHA 3PC8C 4CCYB 2Z1MA 1EHCA 3HE3A 3J7TA 1MB4A 3ORYA 3KKLA 3K73O 3EOZA 4HB4A 2YJTD 1DJNA 1O94C 1Z2CA 3WK6A 1WEHA 1GSHA 1M34E 2AZMA 3L7KA 5F5XA 1MX1A 2IEBA 1X3SA 1D4OA 3ZWXA 1RZRA 1DC6A 2G76A 2IUFA 2IEDA 3OECA 5EWMB 1EFDN 2L0XA 5ICEA 4FJ2A 1KP2A 1GD1O 2QMOA 2RGDA 4GSYA 5CNIA 2Q5CA 3L92A 3DGEC 4ZQCB 3SJ7A 4W9MC 1YB1A 2QAJA 4IILA 1YTUA 3TBFA 4TV8A 5D01A 4AJNA 1PLLA 1DEKA 3HKEB 2YN2A 1WX1A 3AEXA 3RS4A 3KZVA 1Z3CA 2BRUA 4K6GA 1RLJA 1K5PA 3A4IA 4WV3A 1SK8A 4X24A 1ZA1A 5EWJA 2BGLA 4DMKA 1Z7EA 1E63A 4KFRA 1PT8A 3FWYA 3I8SA 4ZZIA 1DO0A 4JLOA 3KE9A 2MINA 3AJAA 4MUGA 2F1OA 4HXYA 4OJQA 4YECA 5GGXA 3WFJA 3HYSA 1CYDA 1V26A 4QL3A 4RMHA 2D13A 3SXPA 2VP6A 3UIEA 1NT2A 3EY9A 3SSOA 1N2IA 1X7GA 3RSZA 4E1AA 2OV3A 3SVLA 2HO4A 5DBEX 3I1IA 2XT0A 2ZIGA 2Q3EA 2VP3A 4BKPA 3OVMA 5ITWA 5IKOA 5LJIA 2NN3C 5ECWA 3ZZTA 1A2KC 4CTKA 2IEIA 2ZJFA 4X3OA 2OR3A 1HNZB 2JBAA 2H16A 3KQUA 4RWEA 3GK3A 2BFMA 1X80A 3EN0A 5FI3A 1NLZA 1ZHHA 5DBOA 3UBMA 1ZR4A 4XQEA 3AHFA 3TQFA 4KPEC 3OQNA 1OB2A 3NDIA 1V1RA 1COZA 3ZY5A 1RWWA 4JROA 5GVRA 3ZLJA 5IX8A 5IDVA 4A6EA 4LYHA 3FOWA 3OSUA 4LJ9A 4LOKA 4ZCSA 1Z0AA 3GZ4A 1PQPA 3ZE7A 1Z5WA 3AEZA 4N3AA 1WUKS 5HILA 3AW8A 3NTQA 5KINB 1N0HA 3LQQA 3CKLA 1J8FA 2ZRAA 3D8NA 3NOQA 2NG1A 4U6SA 4ZKEA 4EJSC 3U4QB 1B8VA 1NHGA 1TTHA 2VJQA 2ZJ4A 3D3EA 5M34A 5JYDA 4FHZA 1PZGA 1P72A 3FCSB 4G8DA 4N3BA 2O52A 5EG5A 3NB0A 4O3MA 3BGWA 4M7WA 1U11A 2SKCA 1T2EA 1K8QA 2AIRA 4MVYA 4P0TA 4IFIA 5AVUA 1RXYA 2Y93A 1RFLA 1LGYA 2IDKA 3DE1X 3PFFA 5IXYA 4UNRA 1ADJA 2BKLA 2K7FA 3O4GA 1NZJA 4Y67A 3IPRA 4C0SA 4DMUB 3DEKA 8GPBA 2D6FA 2ZYHA 3OY2A 4KAAA 1RQGA 2GJAA 2PL5A 4MS3A 1S8OA 5HF6A 5I8ZA 5A6SB 1MMFB 3LV8A 3UANA 5JTUA 2EFHB 5SY6A 2VSOA 4TMYA 1U0NA 3NBUA 4MWSA 4PTLA 4DPKA 3FDJA 4I8IA 3DMRA 3EEBA 1ZHFA 3GDWA 5FJIA 1GL3A 1TDJA 3U7QA 4DCMA 5L9AA 1WZIA 1NJ5A 2CNOA 2WJGA 2Q4OA 1N5OX 1MO5A 3PD1A 2BM0A 3PE3A 3SD7A 4M9XA 1NRWA 1DAFA 3C1AA 2NTYC 1DKQA 2CHVA 1W47A 2QWXA 4LSGA 2CLDX 4CMGA 3C3CA 1JFTA 1LDMA 4EGCB 5EVJA 1PAUA 2BW0A 4KBGA 5LUAA 5AKKA 4HFRA 4QUEA 5JNWA 1F1BA 1LDBA 1NZFA 4IDDA 3URKA 4G0VA 4Q7JB 4WPGA 3DE7X 3LNCA 1RU3A 2JA1A 3VPFA 5BYAA 4PPFA 3LKVA 3JQCA 5CB4B 4B8WA 2Z5FA 3R9IA 1KAMA 2HSJA 3GDFA 3W06A 1FTWA 2JAUA 3ADOA 4RKRA 2CZQA 2Q41A 4PGGA 1G2QA 4ZV9A 3VX3A 3L1HA 1BFUA 5GTDA 2JJQA 2OFFA 4D4IA 4D80A 2D2FA 3OT1A 4TSFA 3N0XA 4XOUA 4RTJA 4UJ3A 3AF4A 3WYNA 1BCSB 2ZWPA 1MT3A 1P1JA 4BFWA 1ZM4A 2R97A 3AEKA 4IQ8A 2EIHA 4OQYA 3AKZA 4D41A 5CFNA 3G0BA 5ALTA 2SECE 5KTTA 3NAQA 4MCJA 4MWCA 1KH1A 4AMUA 1J9ZA 3TAXA 4H9GA 3VR4H 1X7WA 5TEVA 5CK4A 2O0MA 2B0JA 3GAFA 3CPJB 3I53A 4I0WB 2Y0PA 3TRHA 4JQCA 5E2AA 1S89A 4M0FA 2VNJA 4BNHA 2G8LA 4MROA 1L7BA 2Z4TA 1X7ZA 1JKXA 3UW3A 3VR5A 1HGXA 3C7DB 2FSVC 4I9UA 4LMAA 2WU4A 2YMLA 3OUZA 3PPVA 5EN4A 1G20A 4Z7NB 1C8VB 3PHIA 3KWLA 4IAOA 4A92A 3CT6A 3OFNA 5B1YA 1CY0A 3RC8A 4IR7A 5DKFA 1W59A 1Y98A 2Z1DA 4POAA 1P5HA 3TW8B 1B8OA 2F1IA 4MWTA 1PK7A 1G1MA 3E9ZA 2P9EA 3IA7A 1V6SA 1J2RA 3IOEA 3IP9A 5EHQA 3TX6A 4G0WA 2RHOA 1E3EA 4LYDA 3N8HA 3K70C 2AG5A 2FSFA 4INJA 3KQVA 2X2OA 5F12A 3VC1A 4URXR 3G17A 3KQNA 4OHXA 4HH0A 3QJ5A 1QYVA 4BZXA 2VTBB 2D7JA 2PLNA 2DR2A 1JHUA 2D62A 1NXVA 1KFCB 2SICE 4HDMB 5LB2A 4YFYA 5CA1F 2YVAA 3I58A 3EDOA 5CFZA 2D1RA 3DV0A 4Q6BA 3T0GA 1I9CA 3X1XA 3ANTA 3IQIX 4RAOA 2P2NA 4XUEA 2OBBA 1TYCA 4Y0NA 4DGQA 2IVZA 4K0RA 3H83A 3D3WB 4L4XA 5J2UA 4EF4A 3NBXX 1ZJZA 3BMOA 2PKXA 4P93A 5F33A 1HLDA 1A77A 2WSMA 3VU9A 1U0JA 3VJMA 2I33A 2DX7A 4D9GA 2VHWA 4JBLA 3IIKA 3KAPA 1KEPA 2UZ4A 2VJOA 3ZVLA 1SGWA 1Z39A 1BFKA 1UPFA 1DIGA 2ZI6A 2Z0MA 3LQKA 3MBOA 4X92A 4NZZA 4D9MA 4FCTA 4DR4B 2H29A 4L5CA 1OZFA 4J9VA 4HR7A 3P2JA 2VDLB 1M83A 2FOXA 4X95A 5FYDA 3U4HA 5KTMA 2QRNA 3G1UA 3Q12A 1EDOA 2GBCA 2QRMA 4LYEA 2UYCA 3UV7A 4JC5A 1B93A 3TG8A 1UJ6A 4R1PA 2CWDA 3IBSA 3P26A 3YASA 2C8KA 2G6BA 1TCBA 3M6WA 4KMSA 5AUPB 5DNAA 5F1OA 1XB2A 2LVBA 2VJNA 2AUNA 3QWAA 3TL2A 1Q7GA 2BZ1A 2XX3A 2ZQZA 3K9NA 4G1BA 2DTDA 2QMQA 3H8WA 3N6RA 4WASA 4KQGA 1H0HA 3ITEA 1Y3BE 2ZS9A 3KKNA 3WLSA 3ZX4A 1SD5A 2ZW9A 3UT6A 1YBMA 4KI0A 1N32B 2B5VA 4J1QA 1OZAA 4NE2A 4QXAA 1N6KA 1Z0IA 3U7EB 4BNVA 3EDYA 3I5XA 3MD0A 4DMFA 3CFYA 4XLTA 1ZMXA 1SELA 2PX3A 2I65A 1LDEA 2Y1WA 1YQQA 5G0UA 5IJ0A 1TX4B 3BCHA 4FXPA 4HQ0A 4MCHA 2FXVA 4URYR 4D26A 1P2VA 3GG9A 5CA0F 3TBHA 4TS4A 3BHJA 2XT9A 2EFJA 5D86A 3P19A 2Y0CA 3KQQA 4DN6A 1HYEA 2JG3A 1M72A 3SC3A 4K05A 4EIWA 4E5SA 3FOCA 1RXWA 1W35A 3DF7A 3EDCA 4GI2A 3W3ZB 4BFZA 4CFZA 4CETA 1DEXA 4RPCA 2PUAA 4DQDA 3VV3A 2KS6A 3GRAA 3ZY6A 4PLTA 2BGUA 3PENA 4JB3A 2NU8B 5HUHA 2G71A 3F9IA 4EG7A 1PG5A 1QYIA 2JAXA 2PX8A 1C7FA 3FDZB 2ZU0C 3R5JA 4LJAA 2W0MA 1VSUA 3DXFA 2XNJA 4GOOD 3T5DA 2O05A 2D0DA 2L17A 2ZIEA 4JKYA 5FUMA 3GBPA 5K0BA 3BMCB 1P1IA 3GGSA 1PVVA 3GVCA 5ITSA 1G9XA 1MA0A 2ZAGA 3WLRA 1XQXA 2OESA 2JNWA 5L7TA 2QKYA 5HF8A 1Y89A 1FDIA 2ZE8A 4C0BA 4DWWA 1IYZA 2FR0A 3H17A 1E1QD 1E8MA 3MQ2A 2C2WA 2ZG6A 4E5VA 3THSA 2B69A 4GZLA 3SS9X 2D59A 5IBRA 3VH3A 5DJ5A 1U8YA 2YMPA 3BJEA 4C6SA 2GXQA 5GADl 1GZSA 1P4GA 2WLSA 4Z53A 3S8MA 4HAYA 4WKBA 5HOQA 1W96A 2AWNA 1MW8X 4YMGA 2VN8A 3V4LA 2I3AA 1U8EA 4XA8A 4Q1EA 1I9GA 1HFEL 3GARA 4JI6B 4M9UA 3ONFA 4MPTA 1OREA 1QHIA 3AJRA 3R3SA 3VPAA 1UBLS 3DE5X 3GLTA 4DLVA 1QIDA 2D7DA 3S2EA 3OF3A 1Q2UA 1Z06A 4TMWA 3VR4D 4LTNA 3TQHA 4OFZA 1UZLA 2IITA 2VQ3A 4BS9A 5LQUA 2XB2A 2QGFA 4O4JF 4YB8A 4XB1A 5DMHA 1OXUA 4MR9A 3SEFA 4A3SA 1KOGA 2AEFA 3ETGA 3LC7O 4F2GA 4IXTA 3UJBA 3TFOA 3E8SA 2XV1A 4MQFB 4BO9A 2I5PO 4P9NA 4ZAXA 1HO3A 3OLCX 4FZJA 5AHRA 4BFLA 3D54D 4WZBE 3UJ6A 3UG6A 2QX8A 5K3OA 4Z51A 2VG8A 4F38A 1JAZA 1L5HB 4G8BA 2XB9A 3HJBA 2H6EA 3SJAA 3WVNA 2IPXA 1QKIA 3T4XA 1JDZA 2RK4A 2FPPB 2VJLA 4HXEB 3ROZA 3FCYA 1RM5A 5KNBD 5ALEA 1MAAA 1DJPA 2OQRA 4D0RA 1GAJA 1XZQA 4I8DA 3I32A 4QU5A 3CZ4A 1AA9A 3BWCA 1IE3A 4EQZA 5JI3E 1I6MA 1EGMB 3FI0A 3PGJA 1G3MA 3PR2B 4AQDA 3P2EA 1Z6GA 3H1GA 2CZCA 2C8JA 1A04A 1N2HA 2R4UA 2Y8EA 3AILA 4KQJA 4N65A 4A5OA 3OT4A 3X1YA 3UPUA 2C9MA 5HJ2A 1V3UA 1N8SA 4NTZA 4ZOCA 4R9NA 5FOWA 3PBKA 3H2HA 1GPDG 2HPAA 3NX4A 3ZOZA 4N76A 3G9UA 1KAQA 1NSFA 4ZC8A 5IP5A 3TW0A 3GFTA 2JAOA 2BKVA 3FXAA 3P2MA 1VL6A 2OO7A 3DOHA 3GLGB 1LBHA 1L4BA 4JP3A 5K8TA 2PKWA 4ITVA 2QA5A 1KYZA 3OQIB 5M7EA 1LTQA 3INNA 5F1PA 4B0PA 2Y0EA 2AFVA 1NNSA 1TUEA 4N6NA 1F2TA 4DR3B 1L4LA 4C7OA 1UK7A 1BJRE 2WVHA 3ASVA 3R5TA 1DEHA 1RYZA 1W76A 1RAGA 1SUCA 2HK9A 3FHJA 4BCBA 4PR0A 5EP2A 1XRPA 1UAGA 2C95A 2XMSA 3UWPA 3DM9B 2FW9A 4MR8B 1C81A 4RA9B 5BYBA 3FF1A 5H5JA 1E1MA 1MHPA 3COPA 3T7SA 3ZDRA 5JI2E 1PQYA 1XAJA 4U00A 5CH3A 1RIIA 1USUA 5FA6A 3S44A 4IIJA 2RGGA 2QYHA 4DMLA 1VJCA 1WCWA 4DBVO 1WF3A 2QU7A 4MRVA 2EX0A 2O8DA 4R3NA 5BNZA 4JAVC 5KSOA 1ISHA 1GNPA 2XSZD 2YBDA 4IIDA 4HBGA 3PX7A 1N3YA 1K8YB 1LSJA 1B6GA 1NVMB 1WMEA 2PLRA 1DBQA 1TFUA 2YIDA 3A3OA 4HLQB 3R75A 2BGRA 1PR1A 2FWNA 3NWBA 2HJWA 4X8OA 4X63A 2R48A 4RJLA 3WSTA 4AG5A 4EPRA 2OFXA 3EISA 2FWAA 4FYVA 2V7EA 3IAHA 3GELA 4WNYA 4LFCB 4RY2A 1GT6A 4NK5A 4Z0TA 4RCZA 1M0SA 3WICA 2EWMA 2HCTA 2P9ZA 4G6ZA 4UCXA 1WW8A 2REQA 2C58A 3QW2A 4NBUA 4LYJA 2J3JA 3UB4A 4RYLA 5T6MA 3GMIA 2JC3A 5DFAA 4WY8A 2IYSA 2HIGA 3S99A 1G5IA 2VDVE 3QE4A 3BA1A 3FLBA 1TKRA 1DQNA 5I7OA 4FD2A 1LRKA 2OHHA 4LRYA 4W8HA 1N2JA 4I50A 5B37A 3N9IA 3VU8A 4ARVA 5KQLA 4YUZA 1NAIA 2FX3A 3PYMA 1X7DA 5L6MB 2OL4A 2Z8YM 1KEEA 3GJ7A 1CJTC 4WACA 4QPCA 1AQYA 3MTGA 3VKWA 1CULC 5K3BA 4ETMA 4Y18A 2IHBA 4UU8A 5CHYA 2CYBA 2WYVA 4JXKA 3ABQB 2Q1WA 1SXJA 1NVUQ 4FS3A 3LI2A 1TPYA 5ALYA 4KKXB 1ZC3A 3EK2A 2JFVA 1O3YA 1LNQA 1QO7A 1P33A 1W5TA 3IE1A 2NU8A 3G9QA 4QECA 4IDBA 1WKBA 5EHGA 1BX1A 5JAMA 4GMFA 3FUCA 4LDNA 4TV9A 4DCPA 3ENNA 3TEJA 1UBKS 1EE1A 2HQSA 2QRHA 3BHNA 4JL8A 4RD6A 3KKZA 4TVKA 4D56A 3TUZC 2BBWA 3DV0B 4ABTA 4JR2A 1GZUA 1KZHA 1NQWA 4IL5A 4CQLA 4L0QA 1Y9EA 2OZLA 3B6KA 1WD5A 1USVA 2ZREA 3EXFB 4KXWA 4QDOA 5FUXA 4DM3A 3LP6A 2VPIA 5HRUA 1NKVA 4JB2A 2DRIA 3MMXA 3FPJA 2O2HA 4G0PA 4L76A 1OFTA 1WR8A 3EZ9A 4B7CA 4RSHA 3OMWA 5FH9A 2BUCA 3IULA 2EATA 2AI1A 2BVNA 2IU6A 1A9SA 2W7TA 4FEYA 1E6WA 3F8TA 3WYAA 1DAGA 1E60A 1K7XB 1VRCA 3GGCA 4NULA 4AY5A 1AUPA 1GTG1 2ASVA 3L02A 3GD5A 4JQZA 5JXWA 1CEEA 2XQIA 3G02A 4GOLD 3ZKWB 1YDFA 2VRNA 5ESXA 2QRUA 4RYDA 1KHTA 1IEQA 3HL0A 5KSZA 3FKSD 3WTBA 4GLJA 3BQMB 2PG3A 5DTMA 1BKSB 1UWKA 5EUMA 1QYXA 2AT1A 3QNWA 4MYSA 3ZEAA 4AZ0B 3S7ZA 1X7XB 3QW4B 3WG9A 5K4GA 3OKPA 5JD3A 1SVSA 4QA9A 4WKPA 1XN4A 2QIPA 3E0QA 2GVZC 5BSTA 1JL3A 5EE0A 2VEDA 2F1KA 3G0HA 4AKTA 1P18A 2VSQA 5CGQB 3VPXA 4DMHA 4BB0A 4UEKA 2YWHA 2ZR9A 3Q8MA 2HKIA 1JR6A 1OPRA 3F3SA 4HQRA 1ZUNA 4S0ZA 3LPNA 2BGIA 5L40A 1L7PA 3DL7A 2R60A 3L8MA 1JIIA 3T0FA 2QT0A 1N9GA 5IAJA 4PF1A 1AHNA 2GM5A 1E7YA 1R5BA 2ISCA 4FXOA 4OP1A 1GCIA 3CNOA 3ZG6A 2NWQA 4U7DA 3L1UA 2AWOA 2D74A 5K3FA 5T41A 4TMTA 1PE0A 4Z4HA 2ZROA 3IO5A 4IDAA 3AIIA 1WPQA 4MEAA 4DTCA 3W2GA 5EHZA 2EERA 1VI5A 4NMXB 3TLKA 1K98A 3OOJA 2BEVA 4ZI7F 2EAUA 2SKDA 2YWEA 3ZW9A 4X60A 1T6XA 4FDVA 4C6RA 1F38A 4CWAA 2PPVA 4JMPA 1VKOA 1J5PA 1OHHA 2PBZA 1KBZA 3UM9A 2XWPA 3RARA 1NUTA 1Z7WA 5EPUA 3NYQA 4ND4A 4H31A 1C30A 4JLPA 1YVRA 1JI0A 1WXHA 2B4TO 2CFIA 3DMGA 3OA0A 3VO8A 1GV0A 4DJ5X 4RH0A 5AO9A 5HYVA 2V7QD 3M1LA 1NXQA 1D4FA 3I9MA 2VBGA 4PN3A 2JLXA 1N5IA 4W7IA 1J09A 2DTEA 3BM5A 1WW3A 1NUQA 2GSDA 1NKSA 1CQZA 3QFRA 4IKOA 1Y37A 3TW8A 4J1TC 3RUEA 5CAEA 5LKAA 2BFWA 1ZCFA 5JZMA 1ECGA 1J90A 2BPOA 3B60A 1IWOA 2DEUA 2XOKA 3AI7A 4TUYB 5FADA 1OFUX 1TZCA 2OV2A 3DNPA 3N2KA 1I30A 2QYSA 3AUUA 5LP6B 3WGLA 4C0JA 3A7EA 2ARKA 1BCSA 1PZNA 3MLBA 2TMYA 121PA 3EPLA 3VM6A 2XE6A 4A8PA 1YHZA 4EFLA 2I66A 1YZQA 4W5RA 4BRUA 1U0HC 4CMBA 4DIEA 1HOXA 1QRRA 3NTUA 2B30A 2Z5LA 5F1KA 3IKTA 2NIPA 4FOSA 4Q4AB 4B3CA 2PGLA 2PZFA 1G60A 3SMQA 1VSVA 4DIUA 3QKIA 3WZLA 1MFPA 1N25A 3GLFE 1QFXA 5FLXA 2QLNA 2R6HA 1KQ3A 5J1TB 5TPWB 1QOZA 1A5ZA 4Q9KA 5FUWA 5B7NA 3CSSA 5LQNA 2QLLA 1U5CA 2HQ1A 1P7YA 3KT8A 2HA4A 4I46A 2GN2A 4REOA 3OPMA 1DVRA 4F06A 1TKBA 2F4NA 2R8BA 3PSHA 1DRVA 6PFKA 1I7SB 1WB9A 1RMTA 5CLLA 5SYNA 3GOQA 2CMGA 4QNMA 1PR5A 2Q3LA 2IPNA 3FPEA 1C1XA 1G7RA 1WBBA 4BU0A 3KZXA 3ZI0A 1E9DA 2P7HA 2WUVA 3I2YX 5HSGA 1MJGM 4DQUA 3CRVA 4CTOA 3R0ZA 3MGKA 2B2CA 4A6XA 4IUBS 3RIXA 5CM8B 1OASA 2JL1A 3ODPA 4EL5A 1MHTA 1WUTA 2WP0A 1KE1A 4WW0A 5FAKA 1F8XA 1CJVC 4LY9A 4QHTA 1B0PA 1BMTA 3N0RA 5ITVA 3KQKA 4BV8A 2NT3A 1AXRA 1Q3HA 3KQOA 4NYIR 1DAPA 4K87A 4B5KA 3IPCA 3R9XB 4NMMA 5ABPA 1X1DA 3OPYI 1SUSA 3H99A 4TTJA 2HSZA 1GSAA 4YMTA 1XCLA 4AS2A 5KYXA 2VP4A 4EZBA 4X61A 4BVAA 4Q4HA 2XEDA 1N2GA 3MJEA 1JR3E 1O6ZA 1J42A 2XJ9A 5AKXA 1OFIA 2H7YA 1QH8B 1RBMA 5AM1A 1MAHA 1NAHA 1FYFA 1RPTA 4HATA 1G42A 2Y67A 4L16A 5AK0A 5ANRB 5TMPA 2CZGA 3NHRA 2C5SA 2Z83A 4XVQA 3ZV6A 3GAMA 4CM9D 5C8VA 5L3VA 2XGGA 2CV0A 1YCHA 3F1KA 5FNVB 5CVTA 1ZGCA 3S27A 4RD0A 1B3RA 1RJGA 1AXEA 3WFIA 5JS8A 1W6RA 5E6SB 2XHEA 3PC7A 4ILKA 4EY3A 5JH7F 4PYMA 3C74A 4MW4A 3WC4A 1JW9B 1OKKA 2NXJA 2YJ4A 2LIPA 3MLAA 4C20A 1XZCA 3L8GA 5BWOA 1W8DA 5B3AA 1M1YB 3EWNA 5FEUA 1Z0DA 2QTAA 1FU8A 4N3CA 2QHXA 3U6BA 4MOWA 2IEYA 3KCQA 1RW4A 1DHRA 1T0HB 1S1CA 3LYLA 4WNCA 3PQ8A 5DX8A 3PQFA 3SM3A 4LNAA 3S5JA 1UOEA 4KMOA 4M1OA 1REQA 2HAEA 1T9AA 1WXIA 3PGLA 4F1KA 4J0EA 4RFVA 4G0ZA 3K72B 4P36A 1BAPA 5KNBA 5TVKA 1I33A 4MRNA 3MOSA 4MHOA 1EFHA 4OB7A 3PF9A 1VA5A 3OCJA 3UXMA 1NXPA 2BBSA 3CVJA 1XUOA 3ZKWA 4OIFA 1D5WA 1FZQA 1L8AA 2B25A 2FZGA 2HSGA 3OFJA 3ZOKA 2HB6A 1H2RS 1FE8A 4CEIB 1U2TA 2LBPA 5KC9A 3ZWVA 4DQKA 1NQVA 4HF7A 2ZI5A 2UAGA 4M88A 5FL7D 3IELA 5JROA 1TKAA 2GBPA 3I6QA 3IT3A 3NHYA 2XUIA 4O2BF 2PS9A 4PGHA 1XZLA 5DM70 1FFBA 1G2OA 1W94A 2X3YA 4MV0A 3VU0A 1SAYA 4JJGA 2PU7A 3FTDA 3DDNA 1EVQA 4BLVA 2GM3A 1JB1A 4Q01A 3KSBC 3HM2A 3RF6A 5FOQA 1WS6A 1Q0RA 3KSUA 1LLDA 1TM5E 3LRPA 4NP6A 4FYKA 3PHGA 3MWDA 4ZK2A 2P9FA 2XQGA 2OK8A 5EIBD 4OAPA 2AQKA 2QYTA 3F5FA 5LA6F 4J1TA 3U9TA 5DPMA 3UK2A 2AJLI 3WB2A 4IHJA 3SX4A 2QZJA 4MW9A 5HIKA 4U8HA 4UVDA 1R6BX 3GNQA 4D79A 5IWCA 2NP7A 5EEGA 4DY4A 1KJNA 2WIFA 1M2OB 3GT0A 4QJBA 4D6PA 3TWOA 1ORHA 1GUZA 2P9JA 3Q85A 4DVJA 4XB2A 3FNFA 1WTAA 1JIJA 2ZM6B 3DC2A 4B6EA 1X2EA 5HIAA 1CRLA 4GVPA 4C03A 3EE6A 2IXFA 1BXZA 3TQCA 3FWKA 3EDMA 1APBA 2O1SA 1GM5A 2PH1A 2O2EA 2PKEA 2O8FA 4OBBA 3UUWA 1B43A 1NR5A 1UOOA 4AY4A 3G6KA 2XR1A 4H6WA 2JFZA 3BC1A 2H07A 4QOSA 2JBWA 3QEOA 4QTXA 1AZWA 1T0IA 3EZ6A 3WQSB 3R0QA 1BDHA 1A76A 5SY9A 5F3WB 1T5SA 1W2WB 2P2YA 2HGSA 2E89A 3SQNA 3Q5EA 4G1UC 1CY6A 2AQ8A 1RXSA 1G8MA 5ALMA 4OH1A 2E1RA 4M87A 4ZYZA 3QMPA 2OCLA 1XJCA 1UKEA 2WJZB 3G5UA 2ZYVX 5NULA 3TOCA 4E21A 5IABA 3W9YA 1A7AA 1LW7A 1NI5A 2I91A 3IB3A 3FMOB 1GLGA 1I1HA 4YDRA 1Q20A 3HO6A 3OPVA 3BXXA 3UB2A 2EYUA 2QTVA 3AR4A 3COYA 3EQ6A 4TS3A 3KR2A 3Q10A 3ICCA 1FNSA 4YFVA 2B2NA 2J48A 3JQQA 2WAOA 2FR1A 3GJZA 1R0BA 3OIWA 3ZWQA 4LF4B 4HTFA 4H1WA 3G9XA 2IELA 2DUNA 3DD5A 1G8AA 2VYVA 1EE9A 4KOAA 1SCBA 2A58A 1TM1E 3LIIA 4JVSB 3RB8A 1O57A 2XOKD 1KY5A 1TCUA 4CTJA 3DEJA 4QBGB 3DP7A 3UMYA 3D7LA 1AZLA 5DB4A 1OX4B 1ZMBA 2FEKA 3AONB 3K9LA 4WESB 4ZVMA 3RQIA 3V4OA 1JMKC 1GPAA 4CFYA 4X1IB 1BA2A 1ECPA 2IQIA 3A32A 3BRWA 1XX6A 1ECCA 1GEEA 4R8SA 2NTJA 4TLBA 2YWBA 3MWYW 1WU8A 2EDAA 2VK8A 3RGGA 5CEJA 4LHSA 2FEXA 1LUAA 1EBFA 4CL8A 1IUPA 2BFEA 4OSEA 4YCDA 5ETJA 4TXNA 4QPDA 1RKQA 2X0IA 4NYIQ 3S2ZA 5DLPA 2FP4B 3EZLA 4AVYA 5D6OA 1IIRA 1B4DA 1IMOA 1HDRA 3FCCA 3Q2IA 2B4QA 2XITA 1YQGA 1SVUA 3BB4A 4TKZA 1VL2A 3UQZA 1YBHA 2P2GA 1O77A 4AZTA 5KWVA 2HO5A 1NHWA 4Q15A 4IDNA 1B16A 1N1MA 2NZJA 2GMWA 2EZUA 4Q93A 1SQ0A 3U0BA 2NM0A 3CZ9A 1NP3A 2YIJA 1U6JA 3I04A 3E7WA 3K0FA 2GUWA 3KQWA 4ZAYA 3D8TA 2V0NA 4MKHA 4HB2A 2RH9B 4LYYA 3B12A 4MXDA 3OZAA 3CTMA 2G7ZA 1GPUA 5JVDF 1P3JA 2QZ4A 4MVXA 3WK8A 3WK5A 1Q1EA 1YDHA 4E46A 5KOJB 1EG7A 5AW1A 5EZ6B 5KSPA 2XBMA 3VI4B 4GX0A 1EX1A 2AZ4A 5ALZA 3ZHTA 4DUZB 5JMWA 1H23A 2BFFA 4M3NA 1KR2A 2H9AA 4DV3B 2NX2A 1E7QA 3K0EA 5JRDS 2GARA 3HV0A 2G77B 3A1SA 1I5OA 3BXFA 3CINA 1RRMA 1EFRA 4JUBA 4L4UA 4LX0A 4PVCA 3PDIA 1SOMA 2P0YA 4TS9A 2WJPA 3AB8A 3G79A 4QBKA 5K0JA 1IXKA 2FMXA 5FBLB 5FRDA 1X8LA 3V48A 5AVRA 1PNRA 2NP6A 1XZHA 2XMPA 3R2JA 4QJ3A 5IUKC 2GVNA 2A30A 4I4IA 2J9ZB 5EQJB 3OP1A 4WN9B 2HUPA 3M3DA 2E82A 4RDIA 5FKJA 3IKLA 4UM9B 3TTXA 4EEKA 1SQ6A 3TXYA 2JAPA 2QR3A 3DAFA 2J09A 3P94A 3DXYA 4PLCA 3URMA 2L82A 3VGPA 1T6NA 2AR7A 1QSGA 1YRQA 1OFGA 1KTVA 1LJLA 5JFTA 3C43A 4CEJA 2OCDA 3IP6A 1DWPA 1FFSA 3A1VA 3MJTA 1VLMA 4UUPA 4YDSA 3UK6A 4AIIA 1QH8A 3AUTA 4JQOA 4BWFB 5EHIA 1VE7A 2FZEA 3CRNA 3UOGA 4Z0PA 2QD5A 1VIVA 3AU8A 5DNEA 1PVDA 1YHNA 2CHEA 2Y6VA 3KTAB 3OZDA 5JZOA 1A97A 4AJEA 3QVWA 4N3NA 1X39A 2PZLA 3CRZA 3VX4A 1YL6A 1YOVA 1Q0SA 3FIJA 1BHO1 3N70A 3O84A 4IWNA 5A5VA 4KGZA 1MVNA 2VWQA 2QGZA 1XCJA 3ZC3A 3WIVA 4O4HF 2Y66A 3AG6A 2JLYA 2IBMA 1S2LA 2WTMA 4N0PA 5F52A 5FPQA 4NCBA 1IAVA 4DLKA 3KJXA 3BCSA 4Z7OB 3GLVA 3ESXA 5A9TA 2RCNA 1IOLA 2Z1NA 3PNPA 4I1UA 1EK6A 3H5LA 3I5UA 4XW2A 1YHYA 1VKHA 5B1IA 1ODTC 5BSVA 5EHNA 1EA7A 3HC7A 2GN1A 4LZPA 3TM5A 1XA4A 3KOZA 3KLMX 5DCLA 4C76A 5ER9A 2QVZX 4MIKA 3PSAA 3K9HA 5FOSA 1D1PA 3HBAA 3OTOB 1QG6A 3Q3GE 3JZAA 3O8DA 4IO1A 3ZDYB 1GU7A 3OKCA 4ZO6A 4EKGA 2A0KA 5JCXA 1M54A 2I29A 1JR3A 2BISA 3GJ0A 1L7MA 3L18A 1V3TA 1CIJA 2XE7A 1J8VA 4UATA 1IDN1 1UMDA 1ZNWA 3TSYA 4DQVA 1S7CA 2PA0A 1OLXB 4IIJB 4WZAB 5B2EA 4K9LA 1GOTA 3FUUA 3V6LA 2VBFA 1JE0A 1TL7C 2VJMA 4UNIA 5EUBA 2BMJA 2FN4A 3W05A 4OLFA 3PPWA 4MARA 3R7NA 1GO2A 5DWDA 3LU1A 3SI7A 5KOJA 4KK3A 3AYZB 4XLLA 2H1VA 3CH6A 5ALFA 4DLRA 4DW8A 4EVSA 3SWWA 3QFHA 1HNXB 1QYCA 2PGIA 2V9CA 4NCJA 3R77A 1USGA 4H15A 4AO7A 3SLKA 3ZQ6A 1LRJA 2ZUFA 5BQPA 3ZGNA 3T5PA 1QHHB 3UMMA 4EQ6B 5LQDA 1NBAA 3TFWA 4BFSA 1BYUA 2FPKA 1C2YA 2B1QA 2JJMA 1UXHA 3KFVA 3VPCA 1KJQA 4RPJA 4CGYA 2EFEB 4NKRA 1OBCA 4IHJF 1JHZA 1FBTA 2BC9A 1AKRA 3EGIA 2VCEA 4MEBA 4LQLA 5F73A 5U4XA 1JTEA 4DLLA 3FGNA 4NHEA 4CMIA 3IP5A 1UPXA 4HVTA 2D4AA 1UUFA 3BICA 1WVMA 1MX5A 5L95A 2BSQA 4XYBA 2AVDA 1TJ3A 2ZRCA 4P0PB 3HH8A 4FKBA 1WB5A 2M2IA 5BW6B 3X1WA 5ESWA 4D25A 3DTYA 2F90A 2VOEA 1HYHA 1OLOA 1TLFA 1XVLA 2H4XA 2HLNA 2E55A 3C6QA 3HHEA 4HMOA 1K8XB 5GOZA 1E92A 1K4KA 3E22B 3C3PA 1FMCA 4JC8A 2ONKA 1NPYA 2ZBDA 4R9RA 1QFMA 2PUVA 3GJ6A 3CEMA 4V0LA 1ZGGA 4P08A 1HBJA 3GC6A 4BP1A 5JYBA 5EJMA 2P41A 3V9AA 3PNLA 2ZT8A 2B7CA 3RFVA 2BFAA 1NJ1A 3S8EA 3KB6A 1L5HA 1AHIA 1R0CA 2A9PA 2IXBA 2VL7A 1PFUA 2VA9A 3QELA 1Q91A 2YX1A 4B09A 1NJFA 4JC0A 2JCSA 4A0FA 1RS0A 1F0NA 4WKNA 1LPSA 4GKKB 3EVFA 1ODKA 2Q5HA 4N03A 2GK4A 4KX3A 4BGEA 3L0PA 4JXXA 1QFJA 2PHZA 4RMNA 2GJ8A 4M55A 3AEYA 3O4IA 2E4YA 2VDKB 3MRTA 3LFUA 3U2QA 4PVDA 3WI7A 3ELDA 3ZGYA 1RSZA 2P11A 2PMCA 2IZZA 4FU0A 1OV4A 2EZ8A 1RKBA 3CM0A 3HVIA 2YV2A 3EEYA 1XELA 3JQ9A 3KHSA 4FE3A 1RQRA 1GNRA 2OE2A 4MAMA 1DJMA 3FHTA 2YV1A 5GJWC 4TYQA 5IK2A 4HWPA 4LC9A 1EFRD 1JA1A 1ONBA 3CUEF 4TXMA 2PVPA 5ELMA 3O2QB 4NCKA 5FOVA 2IWRA 3VR6D 2GJ4A 3NT5A 1CVLA 3OLXA 4EJ6A 2V1UA 2EJCA 2HD4A 2O6LA 3K7EA 3LW8A 2QRVA 1HTTA 2AFRA 5FPSA 5FWNA 2W8BB 2YMQA 2C9BA 1C9YA 1JYSA 4JA0A 4D9NA 2X9LA 1D9ZA 4OFXA 3W6ZA 2EIXA 4OTZA 3RNOA 3W8EA 4Q02A 4YMHA 5LOVF 2A9FA 4Y30A 1E89A 4EVRA 3F90A 2P9CA 2HJRA 1WSWA 2I0FA 5KMGB 3JQAB 3AUKA 1YK1A 4ZEMA 1NTRA 2WFLB 4JZKA 4N5LA 1T3TA 3G8BA 4RVNA 3TRJA 2PFGA 1UZNA 4CVNA 4X3CA 1TGVA 1CDZA 1ILWA 5FORA 3BS4A 3SDSA 1VL8A 4J90A 1P2FA 1ZOLA 2C29D 3JWPA 2VKQA 4NEGA 1BIFA 4XWWA 4H1HA 4RCVA 2A9QA 4L2IB 5AJVB 3QFFA 1O94A 1VE3A 3ZDZB 5HHTA 1S4MA 1U7OA 1MVLA 1N6PA 2JB9A 3N3BC 4W8GA 2PIDA 2A86A 1C7QA 2H54A 4FWBA 4RVDA 4WOJA 2JRLA 4YMWA 5DGDA 1HZZC 1E7WA 2RHGB 3NPAA 3PUIA 3W8FA 2B8EA 1KZYC 2QUKA 3IMFA 3TZQA 1W0CA 2C7VA 2B36A 4KREA 2R84A 1XDSA 1WMAA 5HFJA 4Y2YA 4PPNA 3WNVA 1P1RA 4TWJA 1GJRA 1OW3B 3EA5A 5GJBA 4LRQA 1IPEA 1NJ2A 2AD5A 2O8FB 2OXIA 4CIBA 1VMIA 1MG5A 4CMEC 2ZBVA 1EWRA 5D1HA 4PSVA 5AM4A 1LRLA 3B9QA 1N5DA 1OYOA 3UCFA 3ZK7A 5CLHA 4BVFA 1IHOA 4AMVA 1E2NA 2R5FA 4XIJA 2I62A 3USES 4V03A 3G13A 3DMTC 3WGKA 4DBLE 2H31A 5BQ5A 5F2NA 1ENPA 1XMVA 1DBPA 3PJFA 1TTTA 3G8YA 1REQB 2GJ9A 1KXZA 2ACWA 3TMYA 1XKLA 1P9OA 4QGBA 1DTWA 2WJIA 2GEVA 3HBFA 1WTCA 1MAWA 1O1YA 1UKCA 1E9BA 2HWKA 2X4DA 3IT0A 1Z6YA 3LKZA 5I7AA 4KPGA 4RS4A 1MA3A 4HNUA 1QE3A 2WHQA 1I4OA 3OA2A 3BCRA 4BFTA 1LBIA 2OXCA 2DR3A 4NOKA 1E1NA 1XJ5A 4BX9A 3T1HB 1PD0A 4KV9A 3VMMA 5KQRA 4RKFA 1QE5A 5HMLA 1CDDA 1DFIA 3A7DA 4LYGA 2QJRA 4GMKA 4Y1GA 5KPDA 3T3OA 4EI9A 4UVIA 2IYYA 1XWWA 2EKDA 2WKQA 1FDWA 2GYVA 4G5YA 1N34B 4J6EA 4B9AA 3VHXA 4OK6A 1ARZA 1HDXA 4R8KA 2V4MA 1YD7A 4MGIR 4UBIA 3DBRA 4XFDA 5HTKA 1UFOA 3B1YA 4FGZA 2POCA 4UMFA 3MB8A 5AQEA 3QIAA 1XBTA 2JD0A 3CW9A 5BUSA 5LQMA 3ER9A 3F6YA 3AQ4A 1WOMA 1Q77A 4W1PA 3L1KA 2IUUA 1ZLYA 4E2XA 3QXHA 4HPXB 2VH1A 3T1TA 1GTSA 2J0VA 2QYOA 2W8BA 1OIVA 3C1TA 1JDVA 1YWGO 2ZR0A 4OXIA 5DIFA 3GRCA 3ZXXA 1ZICA 2HADA 3A31A 4BRSA 3VA7A 2JIZD 5LIPA 3K2IA 4L5YA 4S1TA 5EZYB 2J7PD 3W6PA 1KQNA 2JGJA 1P2GA 3GP3A 4ZOEA 5A3VA 1TUGA 1FJHA 4OM7A 2JGKA 4ZQIA 5HKOA 3Q8KA 1Z26A 2D0OB 4I2VA 2GD1O 2BIFA 4L72A 2JIOA 4BECA 4KFCA 3R6LA 1EYZA 2POQX 3UWDA 4G9EA 5IRCD 3HA5A 1DELA 2W6JD 4ZPJA 1LZLA 1QPBA 3PNSA 1JA9A 1U2QA 1T5DX 4PWZA 4WZBB 5DK6A 2P27A 3V7UA 3G9TA 4JQSA 4ZOAA 1EFPA 3TPFA 3NXKA 5K0SA 1GFSA 2V9PA 1A8IA 2XZLA 2CXHA 2FQQA 2GZAA 3JATB 1QM5A 4UQPA 3KHUA 3A4NA 1PS8A 3LBAA 1XTRA 1FL9A 2FSSA 2TMGA 1RJFA 1K6IA 3R3YA 4RGYA 2QS9A 3EYAA 2E4ZA 3N8IA 4IMPA 4KLRA 3TLGA 2WB2A 2RSLA 1EZ4A 4LOAA 4RFLA 1CR4A 1KOJA 4L1KA 4P38A 4H1UA 3VOTA 4B5LA 2XTAA 4ACAA 4EUEA 3C6BA 4WY5A 5DHPA 1Y8AA 3GNSA 3NM6B 1NY5A 1PNQA 4EA8A 1ZN9A 2I9PA 4P83A 1BCRB 2YXDA 1RPJA 1OZGA 2BBTA 2RD2A 2KPOA 3WL6A 1SCKA 1AV7A 1J8YF 4TMFA 5IDQA 2CNLA 2QRLA 1QZXA 5DO9A 1R8JA 4RE5A 4TRMA 5B1HA 3HLYA 1SFRA 1FFWA 2DPGA 3M0EA 1JHDA 2IU4A 4R9VA 1YMVA 3DBIA 1FFGA 1XZAA 5AM5A 4PICA 4UTNA 1E9FA 3VR1A 1HTWA 1HXHA 3AM4A 3WB1A 3DTVA 4KFTA 1XEWX 4XE5A 4AN4A 4QYIA 3DFIA 2XNDD 2UU9B 8AT1A 4KQFA 1F6WA 1Y0BA 2JLBA 2OAEA 4BQNA 2R6R1 4Z9XA 5CCDA 2H1LA 1CY1A 4XJXA 2J0SA 5AW8A 4JS0A 5I47A 2AFHE 4BNYA 2XF2A 4OJMX 1QWSA 4KOEC 3EZXA 4B33A 1KQFA 3T9CA 1T3LA 3SHOA 4JL5A 4CEHA 4LRSB 2EQ5A 5IAGA 3AIOA 5T57A 3WK7A 1HORA 2ECQA 3HFJA 2AK3A 1NVAA 1L5OA 3NZEA 4G4SO 4H0FA 1SURA 5DLEA 4EQ6A 2X58A 4HH4A 4GKVA 4MS1A 1Q22A 4PNHA 3P9YA 5DU2A 3ZEIA 3ISTA 3UVEA 3N28A 4FMBB 3LNTA 5J58A 3F6BX 3AVUA 5BOSB 3CE9A 3REOA 2ACKA 4EH1A 2X8BA 4DJTA 1TJPB 2CLCX 4I50F 4EBBA 1FQJA 1T1SA 3DE0X 3K09A 4MJXA 4B4DA 5IDWA 1MDBA 1R6TA 2XUZA 4B3IA 5A3JA 1U3UA 1PJ4A 1NJ6A 1V9CA 1TZKA 4CCYA 3NVDA 1VCIA 4XVRA 2OCIA 2I6FA 4GPAA 5K2MA 5LLDA 1UWVA 2GAIA 2GRJA 3ETDA 2BCGY 3ORHA 2AEEA 2VPQA 4DCJA 1C80A 1NP7A 4M9CA 1ZWLA 4GPTA 5FTNA 1EK0A 1P91A 2QQFA 2BEUA 4P82A 3SE7A 2X6QA 5KYWB 4GBED 3DWGA 1JKFA 2LXNA 4PYOA 3TZHA 4FFRA 4LFAB 2BHTA 1F0YA 1KF0A 4IZIA 1J8DA 2W42A 1EVEA 4LYFA 2DUMA 2OP1A 3NC0C 4KH0A 3AR2A 5KWSA 2WJYA 4V0QA 5IBPA 1HI9A 4DCNA 3EEOA 2P9HA 4I6GA 2RHLA 3KVVA 5TF0A 1T8TA 4MQEB 3P9NA 3UH1A 3TEMA 4HZIA 3DB2A 3GPLA 4IP0A 5DIZA 4UHKA 5CYGA 2GT1A 4TUYA 3ABIA 5CBPA 4NH0A 4EFNA 5BRJA 1CYEA 5DN6D 1ONNA 4FMPA 4C4SA 1NF9A 2IH4A 1COWD 4XDGA 3RYHA 1QQ5A 2O19A 4AQYB 4FHDA 3KAQA 4PZLA 2I1WA 4O2RA 4AIRA 3DH0A 3BIWA 3OZXA 4IINA 1RPZA 4RLQA 3VSEA 1AMNA 1EUQA 2DYKA 4LRXA 4N3GA 1NG9A 3Q2OA 5ICGA 3LY7A 2WWVD 4MV8A 3RJZA 1A9RA 2CLMB 3E70C 1O95D 2AR0A 3LUCA 3DR3A 5ICFA 1XVAA 2XY4A 4V24A 3HKBB 4DWVA 3MTQA 4S3MA 1P0PA 2Y1CA 1CS4C 2X0FA 3AETB 5FXMA 1A9YA 2X5NA 5CM9C 5EJ2A 9LDTA 3FNBA 3KJQA 3L7DA 1XLTA 4L7QA 2X3UA 2ID4A 5DM60 4BO6A 2CNBA 3CEAA 1VYTA 4ZIRA 1O6GA 3UXYA 1J0AA 2YVQA 5DRTA 5E6RA 1NL3A 4X7PA 1R6AA 2J45A 3O38A 1CE8A 3UT0A 2WV9A 3IV9A 4FBGA 4AROA 1O03A 5EOVA 2J3EA 5ARDA 1E6UA 1N7HA 4FMDB 4HDMA 4Q1BA 2GBIA 3AL2A 7YASA 2QQEA 3HLTA 5BNWA 3QEMA 3HEBA 3JZDA 4L0CA 4OQPA 3EULA 4U6QA 2QRJA 4DWOA 1MF7A 2BM1A 4BKMA 5EE5B 4H4DA 2P6OA 3K9BA 2Z8ZA 2ZRIA 3DOEA 2FVXA 2FUG1 1E9SA 4GMHA 1YS9A 3PFHA 4QC2A 2FLWA 1U6IA 2WVGA 3NGMA 5D3MA 5GPBA 4A1FA 2LP4Y 3HB0A 1TYAE 4N7MA 4FINA 1GZVA 1MTOA 2WYWA 3PV0A 4RIGA 3PKZA 5H4HA 3UF0A 2EKLA 3CWQA 4Y9SA 4DBLC 3NAGA 4ZT7A 4B7AA 3D8BA 1GAEO 2RK3A 1KARA 2I6SA 2RI6A 2UZAA 3F7NA 1HSZA 3NNSA 3OZCA 4QRIA 5FLYA 4F11A 5B7GA 5KQPA 4L4RA 3A58B 2BGMA 3F8WA 4JDPA 5ESDA 3Q2KA 4A23A 5I3ZA 2WJJA 2HWWA 1BEZA 1AK2A 1ORRA 3OHMA 5A3RA 1OC4A 2HZ7A 2OO5C 2XTZA 3OIUA 1O96B 4ND7A 3C6XA 1X1TA 4TLCA 1VG0B 4BASA 2JJ1D 1X9GA 1XQ6A 3COVA 4QBHA 4D46A 4LK3A 2H9IA 5E7QA 5EMHA 3WO0A 3JX9A 2Q0QA 4D3XA 3GLIB 1FIUA 3UNXA 5C8DA 2YCLA 1A82A 2C4UA 2ETXA 2GCEA 2OAGA 4UBNA 4Y2XA 1MQSA 3R6GA 5FTMA 1K9VF 3ROTA 3SEAA 4AUNA 7REQB 1B73A 4O4IF 3MUFA 2B83A 2R8YA 2YYYA 4RVGA 4DQXA 5U4QA 4ZCMA 1QORA 1T4DA 4NK4A 5D51S 1DWOA 2J6HA 3HYTA 3J81A 5A05A 4IUCS 4H2DA 4KFUA 5EKXA 1GLVA 3C6YA 2Q45A 2QPLA 3UENA 1DKPA 3GUZA 5HKKA 4BFCA 3GQVA 3OCZA 2X1HA 4KWTA 4NFSA 2W2QA 3LO5A 3UHJA 3TSWA 2G0AA 2FG5A 1Y7LA 1YXMA 5ILQA 2P3SA 4NX2A 4CMCA 3OZUA 5LNK1 1I7PA 3D2LA 1JWBB 5BQXA 5CTAA 1NOKA 5H83A 3V2GA 1GGNA 1L2TA 2ATVA 2NYAA 1QUEA 1F8GA 3QWBA 3ZHBA 2B21A 3ZHZA 5IVKA 1UR5A 4PPQA 4GBGA 2IUSA 3BD9A 3M1AA 4FYIA 4MR7A 4ND2A 5BQFA 5KX5B 4ZVPA 1IK4A 2ECFA 4J2HA 4W1RA 2VRCD 3GT7A 4CNQA 1SIBE 4IF4A 1NNLA 1CZRA 4NS1A 2CNWD 1BJTA 1S2MA 1SQ5A 3D31A 1KDYA 1GRQA 4MO2A 4L8LA 4C4YA 1VCOA 3M1YA 3NT2A 3N5CA 2HSEA 4B6SA 3WGTA 2KBEA 5KTYA 5I5GA 2R8ZA 4HDKB 3ONWA 4B6PA 3SF0A 2D2EA 4AU1A 1DMRA 5A6SA 5FPKA 4F60A 4QWMA 3KCNA 4IO0A 1JG7A 1BE8A 2X0RA 4MQBA 3K31A 4QUGA 3KLOA 3VBCA 1VE6A 1E1YA 3A6HA 1X7YB 2Z2IA 2G09A 3K5IA 4LC1A 3S1SA 2PBRA 1R8SA 1NV9A 2QZSA 4Q4CA 4YRBA 2PH5A 2ROQA 3F6PA 1KI8A 2VNKA 1M1UA 1XNJA 1EVZA 2X2FA 2G0TA 2J5RA 3QWFA 3W5AA 1E62A 2Z08A 4ETNA 5CEFA 1P77A 1XRQA 3JTMA 3RVDA 3X1DA 3MWGA 3LCMA 4ZVUA 3CPEA 4IX1A 1T2VA 2ZJ0A 2WKWA 3Q8XB 2XUHA 2EC5A 1GIAA 2WYOA 1H2BA 3IPXA 2JZNA 3PPXA 2RMKA 3AUFA 3Q3JB 3GBVA 4N5NA 4R1LA 1HSOA 3U3ZA 4F84A 3U1BA 1GKYA 3FYUA 3T5CA 4ALIA 4CQMB 1Y5IA 3CH7A 1K6JA 3K9CA 5B64A 1R1DA 3CLUD 1BN7A 2ADMA 2G3YA 3I3OA 1PZFA 3E0XA 4B83A 3SR0A 2XSZA 4P4TA 5FX2A 3UN1A 4F4DA 2G9QA 2CLOB 1KR5A 3T7JA 1JPNA 1JXMA 2OQVA 1GAXA 4ZANA 2C2HA 2YW2A 3FZYA 3VR0A 1KDRA 1X7HA 2YDXA 3ZWOA 1H94A 4PU0A 1V39A 3JQGA 1X1CA 3IEPA 3WNDA 3RIGA 4TL8A 1YA8A 3ED5A 4GI3A 1K63A 2NU6A 2O3RA 4MP8A 3GRFA 1UZUA 4DE5A 2W6JA 3M3HA 1XMIA 4BTLA 3PT9A 3NVMB 5JBIA 4J2OA 3AEQA 3I9JA 4P84A 3LDAA 2H59A 3UICA 2O5VA 4K9SA 4TT8A 1E6EA 3FE2A 4HEA6 1BDIA 3GOHA 3QVTA 2BI8A 2VIIA 4TXJA 4YUXA 2O54A 2QVBA 3GFQA 2DFTA 4R98A 1U9ZA 1C3VA 5D2CA 3PC3A 1A7KA 2I76A 5H0IA 4B76A 4YV1A 1IZ7A 3S2SA 2ZB2A 1AUVA 3DFUA 4MB0A 3WWCA 4PGMA 1Z36A 1QUFA 2DFVA 4M8KA 1GP2A 2C2OA 4Q3KA 3M49A 1YDGA 2Q5FA 3CU5A 5JCPA 5JZSA 2E18A 4CV3A 1G8JA 5ALHA 3NUQA 1LNZA 5AXCA 4O59O 1K5GA 4PFQA 3KYCB 1BMFD 4S24A 4HQOA 3MJDA 3OWHA 1P2SA 2NSHA 4UREA 5KJEA 3SZGA 3VHRA 4CDGA 4FHCA 5IJ0B 1ZCJA 2QZ9A 4TLMB 4UXIA 4IDGA 5BN3A 2PMBA 4CQJA 2WSIA 4CI9A 4G4SP 3IMCA 2WM3A 5THKA 5H3CA 2XVYA 4DUPA 2MIIA 2WT8A 2PYZA 2ERXA 2GEDA 4KTVE 2QQ5A 3VGJA 3WWOA 2A0UA 2E3JA 1PJTA 4EEXA 1EBBA 1W9HA 2FPUA 1R4NB 2O2DA 2PR2A 3DW1X 1UIRA 2NVUB 3ZGLA 4JI3B 1GZ3A 3WWPA 1MT0A 4LTDA 3CTPA 2LKDA 2JHGA 2O48X 2XDQB 3GRRA 1PR9A 5D7NA 1I14A 4DRXA 4FWTA 2CFOA 4HDSA 2PAFA 3LCJA 2IOFK 4XWAA 5FWAA 4ZEOA 1R0RE 4RJIA 3SQLA 1T6ZA 2VUTA 3FTCA 1X1AA 1QVWA 2BFDB 3D2CA 3ILYA 3W04A 4G1VA 4ZWNA 5CG2A 2ATEA 4IYJA 3HY6A 4EG6A 3VTFA 3PIDA 4DCCA 4I4TA 1Y1QA 1P61B 4AUMA 1P2DA 5LA6B 3AI3A 1HF3A 3OCUA 1M0TA 1BNCA 1FLAA 3NNNA 3W4KA 4XQ9A 5J5AA 4D4HA 1H8HD 3GGDA 3L7LA 2FPMA 2E5WA 1BMDA 2AJ8A 2QTBA 1R15A 5AHKA 5EL0A 2WJ3A 4DDMA 2OCAA 5IU6A 1OXTA 2DSTA 3K6KA 2DECA 1PT5A 3HCBA 4NENA 5JNTA 2V7VA 1W87A 1U8CB 4L08A 3R7FA 2FSHA 3STTA 3UV3A 2ZSKA 3K0CC 2GCNA 1BCRA 2GEFA 2WKPA 1ID1A 2ZE6A 3DWIA 2V5UA 3RTCA 3ZJ4A 2HM7A 5J4KA 1UCFA 4R2XA 3V2HA 4JVMA 4ZMBA 5K0CA 5LQJA 3EVZA 3UKOA 3ZWNA 1T13A 1L4GA 1K3FA 1OXSC 1V4NA 3L6CA 2YHAA 1TVEA 3O9ZA 3JQ7A 4GP7A 2CMHA 4ER6A 5B3JC 2ZRFA 2QL9A 4ESEA 2EJUA 1RQPA 2A5YB 2BFBB 2NU6B 4UAVA 2IYRA 4R71A 5IH3A 4CDNA 1UWCA 5KCMA 3LUKA 4Q9NA 2HMYB 3A05A 4CEHB 3I4FA 4N47A 2HLDD 3CF0A 4FVTA 3DR5A 1TVKA 2E4UA 3LOPA 1KZ9A 4UPDA 2W93A 3QEAZ 3RRMA 4LDPA 1V4VA 3LE8A 3HCFA 3L7AA 2AOWA 3TQIA 4AJ4A 4BNKA 1P4HA 2ID7A 1GAWA 1FVXA 2IEZA 2O0JA 3L5KA 4JD5A 1CQWA 5LB4A 1KNXA 1QGUB 3G2JA 4HX5A 4PSKA 3I9V1 3JARB 4M8IA 5TC4A 3TTYA 4EHFA 2HREA 3F1LA 1XSEA 3ACCA 1RLTA 2HA0A 2OV1A 3SFTA 1QANA 3A9UA 1XV5A 4BN4A 5KOIA 4US0R 2ODWA 2PTHA 3D7RA 4YWJA 1IN6A 2IW3A 5IF9A 4WCVA 4J3JA 1CF9A 3DNFA 1MW9X 3TD2A 1AF4A 3RBVA 2O0LA 3WYCA 5A3SA 4D3FA 3O0DA 2IFTA 2XTNA 1HKHA 1N5RA 1TQ2A 3IT2A 2VNIA 2G1KA 1JLSA 2H17A 1AKTA 2WR8A 2IHZA 1RWNA 4IXWA 3U9LA 4LNHA 1E66A 4WLVA 3WBKA 4MPJA 3TUJC 3AKCA 3VJLA 4NPAA 2RGXA 2Q4DA 1A8SA 3OTHA 3PGMA 3B1ZA 2ZBUA 3ZS9A 1DAMA 1WMSA 2OBNA 4X1IA 4CM8B 5KVCA 1JBQA 1AV6A 5EQTA 3TQOA 3FJYA 2V74B 2ZSUA 3BMNA 4GMXA 1JSXA 4QGGA 5CLFA 4R3UC 3WFZA 4UXJA 5CDTA 2Y77A 1Z6QA 3SHWA 3K9FC 1AT1A 4CLOA 1CDEA 4D9EA 3P0FA 3B3JA 4IXMA 1MDFA 4ND8A 1R5NA 3CPHA 3P5BA 4GD3Q 3KTFA 5TPZD 5FLEX 2I22A 4NECA 3U1VA 1QB7A 2ZB3A 1XNQB 1NDHA 1SBCA 4RZ2A 2FWJA 3GJ4A 3T7IA 5LJLA 4X7MA 5BSEA 2WHPB 1MB3A 2PCLA 4FLEA 2GF9A 5BNFA 2B1JA 2QUAA 2VTVA 3VZCA 3AFMA 5IYZF 3VKUA 3C7KA 2GHRA 1IEXA 1EX9A 5JJIA 4EO4A 2K7ZA 4ZVLA 2J1LA 1FY2A 4X66B 2VJBA 2XYGA 2CXQA 1CUEA 3ON5A 3D6AA 1NONA 4UBMA 3TOSA 3SHQA 5MFPA 4RAQA 3F6RA 2HTEA 4KSCA 3T94A 2VP5A 1YQEA 3AEKB 3BPSA 4EPVA 1FK8A 3TD9A 4E5UA 5G0SA 1AY0A 1AB5A 1CRQA 4N54A 1TE2A 4PCVA 2PIAA 3QIVA 4G86A 1XKXA 4GUDA 3C0KA 3FN4A 3PICA 4NPCA 2NVOA 4TQGA 5UKDA 3AF1A 4D9FA 5FPHA 5B3JA 4ZCRA 1J0XO 4KMRA 1JE1A 2B2XA 5A62A 4F4JA 3ZHSA 3TKYA 2FWMX 2Q6IA 1AUOA 1W34A 3IFSA 3GL9A 3HRKA 4MYDA 3STYA 3UAYA 4ZVRA 2GPJA 2VF5X 1EK5A 3E9NA 4K6CA 4DDKA 1XHLA 4W1QA 5KOHB 2CKDA 1L8XA 2BY4A 1L7DA 1ML3A 2GCGA 4BQRA 2NUPA 1FXWA 3QA3E 2J4DA 5HIJA 2GA8A 4HQLA 4AM8A 2HDWA 4B3JA 5K0ZA 4KQ2A 1XROA 4LOIA 3SN6A 1U5BA 4RHXA 5D87A 1Y7IA 4X1YB 4ARBA 2DJIA 4L27A 4EX7A 2HUNA 1KI7A 3PNBA 2I87A 2QM7A 2R44A 1XEXA 2WIGA 3GLHE 1NMXA 3ORSA 4LS3A 1VPEA 1SXGA 2Q1TA 4I4LA 1Z4LA 16PKA 4NYJQ 5KSYA 3EQ2A 4RUKA 2Y9PB 4NCXA 2XH8A 5LYJA 3VNSA 3M83A 1IONA 3C87A 1RYNA 4EG1A 4AN1A 5FT9A 1RADA 2JCXA 4LTMA 5TGTA 3VH1A 4PZCA 4MS3B 1LCIA 2FA9A 2XZPA 1V5EA 2FUNB 3L6UA 3O8OA 3SX2A 4DS3A 5EIEA 2P3QA 5FNVF 3IDZA 3K6SA 2ZJ8A 1HE5A 2VTEA 1NN3A 1WDMA 1JEQA 4M1EA 2YH2A 3HWSA 3D3JA 2Z56A 3ZI4A 2WSSA 4CM4B 3S4YA 1NQTA 1AN0A 3WWDA 5KJ1A 4XM2A 1TYZA 3H9UA 1PDVA 4GLBA 3PGVA 3OE5A 2FGKA 3KZNA 2AFIB 2N46A 2IYAA 2P9BA 3DMFA 3RG2A 4DG9A 4UUBA 4AMYA 1B8NA 1BWPA 2C97A 5F23A 3GLFA 2CFTA 2DXIA 4N5MA 4AG6A 1VIMA 3EVCA 3G3EA 1NN0A 1XTIA 3G9ZA 1CR2A 4LYAA 4YJKA 5AVVA 3ZD6A 1JRLA 4H16A 3DBLA 4NONA 3ZZ1A 3Q41A 2GA9A 4QKQA 3LVRE 4QJ4A 1YJBA 3NP9A 4Q82A 3RVQA 4BLPA 4C7OB 5JAHA 2UXCB 3B1WA 4MVJP 1JQKA 1I0ZA 3A2LA 4V0ME 4E30A 2C5HA 1RMQA 2IYUA 4I2NA 2QTGA 1ISIA 5DP1A 1J2YA 2XB6A 4JJEA 1A95A 1J70A 2GCIA 3B7PA 3MMNA 1K7FB 1WUIS 2J07A 4J4TA 4PRLA 5EPEA 6YASA 3GFGA 3ZKAA 4O3FA 4R54A 3T3EA 5JFGA 4MQLA 4UJ5A 1UPAA 4M9ZA 3W9UA 1CFJA 2VP9A 1VG1A 3X43A 4J16A 5JDCA 5JOQA 3ONDA 4TT3D 3G0GA 4GR4A 5K1ZA 4KP7A 2GWHA 3FW1A 2MSKA 5K6TA 2QRPA 4L02A 3KQMA 2DBYA 4NBNA 3MJSA 4O2AB 2I7TA 3U4CA 4KXLA 3A14A 4C7JA 4AYWA 3CVUA 2D1YA 1E1CB 4GKJB 2H4JA 2PKQO 2HTFA 1U7HA 2VT2A 4I5FA 2ADFA 4UFPA 5HVNA 1A9XA 1SBTA 3CRMA 4C7KA 1YR7A 2WT4A 3TVYA 4HDNA 4AD8A 1NMYA 5EUCA 4I9GA 1WXXA 3H0KA 3HKDB 4ACBA 1OI3A 2E6KA 4LC0A 4Q7QA 2PUEA 4HS9A 4EGSA 5HZHA 1XRJA 2WTXA 2JBHA 3E15A 2RGRA 4EYKA 3O95A 2E49A 2QVGA 2WUGA 2WD8A 4MYHA 3QZUA 3F97A 4C2TA 1JV2B 2YWXA 3V1TC 3ER6A 1RAEA 2VRCA 1DG9A 1BXRB 4OQXA 3U39A 2VYFA 2EW8A 4R2KA 4LXGA 2HY7A 5CDGA 1EUCA 2FR8C 3MILA 2ODPA 1JLLA 4IH1A 1GDDA 3NATA 3R9KA 1Z16A 2IWHA 1SU6A 2ZUCA 1DV1A 1E1QA 1OVMA 1KYQA 2Z57A 3NOVA 5COQA 2JK0A 2VATA 2W2VA 3I9NA 1JTVA 2FPPA 3MMZA 4XASA 1ITZA 4IJUA 5ULLA 1WAMA 2JFWA 5HKBA 1U02A 1Y6GA 1TMOA 2M32A 4OQMA 1EK2A 2Y1LA 1X7YA 2DQYA 4R2MA 1QJ4A 3MCUA 1IUOA 5F2KA 5L3SB 5LXTA 2RAPA 2KYRA 1BJKA 3EIFA 1UZAA 3MEQA 4CM7A 4ZKDA 4YP7A 4R01A 4MPRA 2ZYDA 3E9DA 4RELA 3ICOA 4YQYA 1DEAA 4LDAA 4CF5A 3GGJA 5DNCA 4UEWA 3FDIA 2G1AA 3E03A 3H5OA 4FE4A 4IMIB 1N77A 1N7GA 4HBZA 2AN1A 2J9FA 3IPLA 4UW9A 2ZWMA 5C31A 5F78A 4NQZA 6AT1A 1J6UA 4PO1A 4JI1B 4YMVA 2O50A 3EMKA 3MM4A 4E4TA 4ZMSA 3V3TA 4IUDS 4M9SA 4IVNA 2YYS