1QFXA

Ph 2.5 acid phosphatase from aspergillus niger
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
447
structure length
441
Chain Sequence
KQFSQEFRDGYSILKHYGGNGPYSERVSYGIARDPPTSCEVDQVIMVKRHGERYPSPSAGKDIEEALAKVYSITEYKGDLAFLNDWTYYVPNECYYNAETTSGPYAGLLDAYNHGNDYKARYGHLWNGETVVPFFSSGYGRVIETARKFGEGFFGYNYSTNAALNIISESEVMGADSLTPTCDTTTCDNLTYQLPQFKVAAARLNSQNPGMNLTASDVYNLMVMASFELNARPFSNWINAFTQDEWVSFGYVEDLNYYYCAGPGDKNMAAVGAVYANASLTLLNQGPKEAGSLFFNFAHDTNITPILAALGVLIPNEDLPLDRVAFGNPYSIGNIVPMGGHLTIERLSCQATALSDEGTYVRLVLNEAVLPFNDCTSGPGYSCPLANYTSILNKNLPDYTTTCNVSASYPQYLSFWWNYNTTTELNYRSSPIACQEGDAMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (PH 2.5 ACID PHOSPHATASE)
publication title Crystal structure of Aspergillus niger pH 2.5 acid phosphatase at 2. 4 A resolution.
pubmed doi rcsb
molecule tags Hydrolase
total genus 145
structure length 441
sequence length 447
chains with identical sequence B
ec nomenclature ec 3.1.3.8: 3-phytase.
pdb deposition date 1999-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00328 His_Phos_2 Histidine phosphatase superfamily (branch 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1qfxA02
3NTLA 3NFYA 1XQ9A 1RIIA 1BQ3A 4D4MA 1E58A 1NT4A 3R7AA 5AK0A 1H2FA 3E9CA 3K4PA 2GFIA 2P77A 4PGMA 2P9FA 1QHFA 4FDTA 4JOCA 1BIFA 2H4ZA 4GPZA 2EOAA 3FDZB 3E9EA 3D6AA 4FDUA 2P30A 2P9ZA 1FZTA 1DKMA 2H52A 5CU7A 1SKAA 3ZHCA 1BQ4A 2H0QA 1DKNA 2EKBA 2OWEA 4MA4A 2P6MA 2HIAA 5PGMA 1DKLA 1YJXA 4EMBA 1UJBA 2IKQA 3F2IA 3IT2A 4IJ6A 4ODIA 3QPVA 4EO9A 2DWPA 4IJ5A 2WNIA 4AROA 2AXNA 5AJYA 5HTKA 2QNIA 3IT0A 1ND5A 2YN0A 1IHPA 3MBKA 2P9YA 5AJWA 2WU0A 5CDHA 3FJYA 1V37A 3KKKA 3F3KA 3E9DA 4QIHA 1C80A 1RPTA 2F90A 3DB1A 2P6OA 2H4XA 3MXOA 3BIFA 3LG2A 2P79A 3HJGA 3LNTA 1UJCA 1C7ZA 2PA0A 2P2ZA 2P78A 1DKPA 1SK9A 1DKOA 3EOZA 1ND6A 5CX4A 3C7TA 3QPUA 1FBTA 1CVIA 1SK8A 2YN2A 1TIPA 2I1VB 2HPAA 4JOBA 3IT3A 3OI7A 2OWDA 3QPWA 4PZAA 4ARUA 3O0TA 5AJXA 3PGMA 1E59A 4HBZA 3D8HA 3GW8A 5AJVB 4PZ9A 5AJZA 3K4QA 2A6PA 1SKBA 2EKZA 3GP3A 4GPIB 5HR5A 1QWOA 1QFXA 2BIFA 1K6MA 2ENWA 1V7QA 2P2YA 3LL4A 1EBBA 3DCYA 1H2EA 3D4IA 1YFKA 2P75A 3FDZA 3IT1A 1RPAA 2HHJA 2WNHA 1T8PA 2ENUA 4D4JA 3EZNA 4ARVA 4D4LA 3GP5A 2RFLA 2DWOA 4E3WA 4ARSA 1DKQA 4D4KA 1C81A 4JODA 2A9JA 4TSRA
chains in the Genus database with same CATH superfamily
2GTIA 1K98A 4G4GA 4MV4A 5D1HA 4F8YA 4MMZB 2Q07A 1A5ZA 1T1IA 4MI1A 2QW0X 1GKIA 3OEWA 2F9FA 5ADVA 3TQSA 4RPGA 1J24A 3VHXB 2VPYA 2GN9A 3L1JA 2F1HA 4MMXB 3K6RA 1E0AA 2HJRA 3LT0A 4QULA 1YZFA 2MSEB 1W0CA 1YQDA 2Q8NA 1Z34A 2P90A 1PKEA 1MC5A 3CNEA 3G2IA 3HR4A 4FDTA 4QE3A 2ZAIA 3H2HA 4UARA 5CXUA 5FOVA 2JFYA 2C2BA 3RJ5A 4G5QA 5FA5A 2Q0HA 3DBVO 4AO7A 2P4QA 1FCJA 1SKAA 4LSWA 1W5BA 4RD6A 3UMSA 1B14A 3ZLBA 3CNBA 5A5DA 3BJEA 4CEJB 1EVYA 3TRIA 4YJHA 4EZIA 1CYEA 3BK2A 4V24A 4QARA 2R3SA 5B1IA 3NMUF 3IH5A 3WDLA 2UZ4A 1QPBA 3LVRE 1ODIA 4RE6A 1UKYA 1PJZA 4LOLA 1AUPA 1IULA 4JIMA 1JDNA 3MF4A 2XXBA 1V1MB 2V45A 4TQ9A 1BA2A 1AY0A 1L8QA 1M1ZA 3BK7A 1QX3A 4FYWA 1UPAA 2IA5A 1HL7A 4YEDA 3Q0IA 1F3OA 5F1YA 1IJEA 4AG3A 4FTWA 1YDHA 2QUKA 4FMDB 3RJMA 2EX4A 2O8FB 2ZSDA 1XD2A 1TZCA 1O5OA 4TQUS 2F8SA 2GD1O 2JIRA 5MGBA 3ACCA 3HUTA 4ZYZA 2B4KA 2CMFA 5F4ZA 3RW9A 3SE7A 3L7DA 1H4TA 4UDXX 3C6BA 3F5SA 4LHZA 4GKAA 4HDSA 1MCZA 1JBKA 4RACA 1SVIA 4AZ3A 3NVAA 3WGHA 1H2ZA 1XMJA 2C5EA 1MX3A 4RL4A 1KK1A 3UHPA 5A4JA 3JX9A 4ARZB 2WB2A 4TKZA 2Y1GA 1XYGA 5HK9A 5EUCA 4H31A 4NSNA 5D3ZA 2EZUA 5A5VA 4JLJA 3BEOA 2QLNA 2ANCA 3M1AA 3ZGZA 5KYUA 2CLDX 2V4ZA 4AXBA 3KVVA 3ZJUA 3NHZA 4N8EA 2W48A 1GZ6A 4Q3OA 4YB8A 4P1ZA 1P33A 5AVJA 1XEXA 4J7XA 1TIBA 3LHIA 3ZDEA 5FR2A 1X7XB 1OBVA 1P4GA 4MKFA 3BX1A 4A03A 4MVCA 2X40A 4NCKA 4KPGA 1OC2A 2N47A 1A4XA 1E2BA 1N6HA 1A9RA 3HKBB 5CJ2A 5DCUA 3W2HA 2H00A 5DLEA 4W5RA 2C03A 3GUVA 1JGTA 3NGXA 3OT4A 4XIYA 5F78A 2XB4A 3D3NA 2AEFA 2CBGA 4RKEA 5BSEA 4TS9A 2IZ1A 1XMPA 4LYDA 3PPIA 3G23A 1EK2A 2D00A 2Y6VA 4Q4HB 5HIIA 5F73A 3ROGA 3WLPA 2YJ5A 3DVAA 3UT6A 1QVAA 4BFCA 3VTAA 1NVBA 4IGKA 3L1VA 2OCKA 2B35A 3LX5A 4KWIA 1LBQA 2C99A 5BQOA 2FE1A 3R9XB 1LPOA 3D7LA 5B4VA 1BXZA 4KC0A 1IPHA 4AP6A 1RWVA 2VDRB 4GYWA 4W4TA 4RMNA 1MRZA 1FNBA 1XTRA 2BMVA 2IDJA 3ED1A 4D99A 1TX4B 3G0BA 5J43A 1NYQA 5EIBD 3USES 2GUGA 2FEMA 3Q41A 3LM8A 5E4TA 2XZDA 1U2RA 4H7IA 5B3KA 2W4IA 3Q0EA 2A1UB 3TZHA 3AVVA 4WINA 3KB6A 1B26A 4Q1FA 1US8B 2ETXA 1V8OA 1J21A 5HF9A 4GPZA 5KJ1A 1UM9A 2VBIA 3CRMA 4KN9S 4PQEA 5K0BA 1XZGA 2WWRA 1SB9A 4ED9A 4RF4A 1OXBB 2C7VA 2HFJA 2M1XA 2V7EA 4IV0A 3M6IA 4CJXA 4N3BA 4WCFB 2KM1A 2PUGA 4JYBA 4UEKA 5C5EA 2M32A 1I2CA 4PW0A 3SVZA 3KR2A 5EY5B 4B84A 4DDKA 1I10A 5JAOA 3BHNA 2WVGA 4HSEA 3KOUA 1Q0PA 2QQ5A 5A7GA 4ZD6A 2VT3A 1MMFB 1E6KA 3LL7A 3VPXA 1R8JA 4J2TA 2O0JA 4LVCA 4ZVSA 2HWXA 4B3TB 3HB9A 3Q6NA 2ZSJA 2VDNB 4Y2TA 2ZYVX 3RBZA 5SV2A 3V4FA 3H9GA 4E88A 4AKTA 2YHBA 1P0PA 1PG0A 3BPSA 4RHXA 3A1UA 1ULTA 3W3AD 2ZZMA 4ZRNA 1G5FA 3H1BA 4B6FA 5HPYB 4IHJA 5IZCC 3IE0A 1T2AA 5C5IA 4CGZA 2COKA 2C3OA 3K0CA 5AOCA 2M9MA 1VJRA 2E82A 1WOYA 2G08A 2PX6A 4J0DA 5TSDA 3IAS6 4QOEA 4X6YA 3MUFA 3KYCB 4C43A 3LQ2A 3RFFA 3VNUA 3IVCA 3D6JA 1JQEA 3BCUA 2B1JA 2XCQA 4MVWA 1L7OA 2YV2A 5DM1A 4U5QA 2V6IA 2C0QA 3IUSA 4HAIA 4WOCA 2D7JA 3RYTC 3DZHA 1YDEA 3EIQA 4XA8A 1COWD 3PRHA 2Y77A 4D57A 4EY6A 2BV3A 1CV2A 2XKBA 5JMTA 2YIMA 2DQZA 4EQ6A 1OH7A 1Q6ZA 2ZE6A 2R8EA 1RAEA 2ZT5A 1WXDA 2OM2A 4NDAA 4JY7A 3WLRA 4DA6A 4MYHA 1XMXA 2V3WA 3DHWC 4K46A 1MAHA 4UU8A 5BSMA 3V46A 4DY4A 5FV4A 1NWCA 4OLFA 3ROQA 1TM3E 5EJFA 3K0KA 3W5IA 5HUJA 2Z8ZA 2Q3FA 3RK1A 1NBMA 1H6DA 1VHQA 2HCJB 2WHQA 4I5FA 2IOYA 4Q9JA 1BFKA 1MFZA 4YMLA 4AJPA 4E12A 2O2EA 2WT4A 5BSHA 4DL9A 1P0QA 1NUUA 3JY6A 1NLUA 2Q4EA 2Q49A 2KS6A 3VR2D 1QCYA 1P74A 2QGZA 2IX3A 3V8EA 4RPHA 1YQXA 3R76A 2B5VA 1G6OA 1V6AA 3AJ9A 3Q7IA 4X6LA 1HZZA 4CF3A 1AHIA 3AKZA 5J1TB 3D6TB 5SYAA 1YRAA 5E3IA 3V2GA 3FZNA 3OQNA 4PC3A 1CY4A 3ZD6A 1X7WA 1K3TA 3W8EA 2AIRA 1Q0LA 2PWAA 3E3LA 4HJXA 4IMRA 1IBSA 3NT2A 4L5IA 1J8DA 3IFSA 1IZ9A 3CT4A 1PWYE 4QTYA 1XDSA 1JXMA 1Q1EA 4AJ1A 4XH9B 4DCSA 3FYCA 3HYTA 4UTRA 5JVDF 2WICA 4M60A 5TVGA 4B3CA 2EDCA 3ED5A 2G1KA 4PAMA 3NXSA 3OMWA 4GZ5A 1D03A 1DZ3A 3JYQA 2HCFA 4XJVA 5BR7A 3FNFA 2IGTA 2GCPA 1K6JA 2RH8A 3LYHA 2D3WA 1BXRB 1C0PA 3W2FA 1W85A 1AC5A 2EL9A 1OU4A 3W6ZA 2WDZA 3M81A 2GHRA 4CCSA 2Y6UA 1R6DA 2JBHA 3ANXA 4Y9RA 3VPFA 1F0KA 2RBEA 2YQ5A 1SQFA 3DE1X 3SD7A 3K15A 3EIEA 3NX4A 4BUCA 1T6YA 5BQ3A 5BR8B 3KK0A 2A5GA 3PUZA 1V45E 1HFJA 3V1LA 3GRVA 1FFCA 3BJIC 3PEVA 1IVNA 4M0LA 3GARA 4N41A 1JNYA 1DAFA 1W8IA 1DJOA 3V5NA 1JEYB 4OOFA 4TTQA 3UT5B 2I4NA 2YRXA 1ZHHA 3V8RA 1BCRA 1NATA 1NBEA 3C6YA 3FPBA 1N6PA 3RC1A 3TD6A 3KSUA 3LBYA 1O9GA 3BK1A 4QPCA 3MIIA 4IJ5A 3KYBA 3SZOA 2JIPA 2JVIA 2CT8A 2VQ6A 1SHJA 2MR6A 3A7EA 3MIZA 3TTXA 4QGAA 3ZE9A 1YJ5A 3HPQA 4MUXA 4B71A 5IUNC 5C4GB 1SA0B 1EFDN 1GPLA 3CZ5A 3HE3A 4UDOA 5F2NA 1QG0A 2NT4A 2H4JA 4URYR 2BFPA 5ALZA 2MWMA 4QX6A 4I9NA 3ZLJA 3I5MA 2FEXA 4RPJA 3BIFA 5CB0A 1DXYA 2ZJ0A 1E99A 1UOEA 4FGSA 3IP3A 1HTBA 3AHFA 1MABA 1UBFA 2FZEA 2NXNA 3M5CA 5F5XA 3CY6A 1BHJA 4BZPA 4YXWA 3BOSA 5JD6A 1S8FA 1K3FA 1Q95A 4X5OA 4CETA 3OOWA 4WK6A 4COKA 4IZIA 4PTYA 4UJ5A 3RDPA 4Z0PA 2X14A 3BICA 4QYWA 3CUWA 2D13A 3I37X 3GOQA 3KQQA 2NQ2C 2C9CA 4NIMA 3ZWYA 4W5OA 2I6SA 2A5DA 5DN9A 3RIMA 4CCYB 5KVQA 2GPSA 5CJJA 4LNUA 1E5VA 4RJJA 2FUCA 3LBIA 1R7RA 1FOEB 2QMQA 4K28A 1IQUA 2DB3A 4WNAA 3GLIB 3CEJA 1SH7A 1QGOA 5AOVA 4TMKA 5KWVA 4XDGA 5K2OA 1I7LA 4PYOA 4L4UA 4C4AA 1N5OX 3S1LA 2LCIA 4R9NA 1J1ZA 1GZUA 2IYTA 3OE5A 1YNOA 3H9BA 4RTMA 4KR3A 1FY2A 2HRQA 3QWHA 1ZM3A 4LBZA 3KXKA 4URHA 4WPGA 3TFOA 1PSDA 3D0KA 3FE2A 1M2KA 5G2OA 4S1WA 5CURA 1ITZA 1Z0FA 2DBZA 2OXEA 1KMMA 4L4RA 4OGLA 2GXSA 4N48A 4N5LA 2IF2A 2WHYA 1C7IA 1A9XB 1ACLA 3JAKA 3F3YA 4JBXA 3L79A 5C80A 3KQMA 4U5XA 5ISMA 3R3JA 1G3UA 3T06B 3E9MA 5AKIA 2GN0A 3KETA 3I6BA 2DP4E 1BD4A 1YS9A 1U11A 3GP5A 3ZHTA 1PJQA 1T9DA 3ZHSA 4C2AA 4OLBA 5HMLA 1F6BA 2OP1A 1KBZA 3N8IA 3EZ6A 4TROA 4ZA2A 5ADHA 5FWXB 3TQTA 1KI8A 1CRQA 1YIOA 1L7BA 1QIDA 5CFZA 3T9EA 5T64A 4DVGA 5AHXA 4KHZA 4H27A 1MX1A 1CR1A 5CYOA 4AKEA 1KO7A 1TM1E 2REOA 4YI5A 3FVWA 4AUMA 1EFPA 3KDAA 4MW7A 2Z5FA 3THRA 3EXIA 5LP6C 4D74A 1NLFA 2CK3D 3HXMA 3I9FA 4XEUA 2CVQA 4G37A 2ILTA 2B99A 4WVLA 4B4WA 4YDRA 3OU7A 4YRDA 3D0OA 3KS9A 3ZV7A 1NXXA 3PWKA 5TVKA 3ENNA 1H2HA 4L9WA 3GJ5A 3PX2A 5J9FA 3R7NA 4WLFA 2CGEA 1NJFA 3ZHCA 1HMPA 4JBGA 3AVWA 1CS4C 4WLOA 2ZR8A 3WMWA 1X1QA 1NASA 3EWAA 1U3WA 5MF6A 4ZPJA 3H87A 1JECA 5FNZA 4WEQA 5DYNA 3DDNA 4YJHB 2BVNA 5JCOC 5EIAA 1WR8A 4N5DA 5IM4F 3KCNA 3UTCA 1F48A 3GG2A 4AD8A 4ZT4A 3GYBA 3OT5A 4RH0A 1ZOSA 1BEEA 1FPQA 1MJGM 1RFGE 3VUFA 1HC7A 1IEVA 1O4VA 1ZGAA 1EQUA 1HQKA 2BH9A 2VQDA 3U7FB 2CV0A 1I36A 2QLFA 2NU8A 1JFTA 4URXR 1J9ZA 3PNQA 4PPNA 3EVCA 2PH1A 3NV9A 5IF3A 3MXOA 1DOHA 1XLVA 4YMSA 3IURA 1NXOA 4Y1EA 1CDEA 1UDCA 1SNYA 1XD2B 3OCYA 3EMKA 1K4YA 5FH9A 2LDXA 3HJTA 4PSDA 1O58A 1U3UA 3O2SB 2Q4TA 1OX6A 1T6XA 2PR2A 1QO7A 4L9RA 1Q19A 1TM2A 1W581 2CL6X 4HGRA 4CNBA 2C9OA 4MUBA 3P9RA 3OECA 3PPXA 1ZJYA 1XG5A 4HDSB 3WRXC 1E1QD 1V7PC 2L42A 3VYVA 4AZ3B 3EFBA 2WSIA 3EY4A 3F96A 2YHUA 1FS4A 3OIUA 3STYA 4KQHA 1JF8A 2XGGA 4G81A 4ZJUA 4KVGA 1JG1A 1XRNA 4MVJI 1MV8A 4O4LA 4W99A 1YFJA 3FF1A 4M76B 3VV3A 4C6TA 5KB3A 1UODA 5AXDA 3M82A 4J0FA 4GLFA 4B44A 5TT0A 4BCCA 1CUGA 4KPUA 4QFBA 5KYUB 2HCBA 3FHJA 3HXTA 3HZOA 5IZ4A 3VU8A 1B00A 1KP3A 1G8PA 4YPOA 5EG5A 4LHYA 1U8XX 1ZNWA 4MJ7A 3Q85A 4Z9AA 2TMDA 2PT7A 4Y6OA 1G9SA 1TYCA 3PUKA 4ZYYA 1M67A 2BAGA 2PZFA 3N58A 1NUTA 1AGNA 1U99A 5DZSA 4BXOA 4IXNA 1O6CA 3MJFA 3PDIA 4HWOA 3UKDA 1N5IA 3UKOA 2QMZA 2Q5EA 4MP6A 2P1ZA 1O0CA 2QTRA 2JIBA 3HU5A 2G83A 2I4MA 4WA8A 2P40A 1PF7E 1T5SA 3EOBI 2ZRNA 1CY6A 2AOXA 2CE7A 1SC1A 2O20A 1NONA 3A1EA 3CKLA 3H5NA 4F5EA 1EZZA 1PJRA 2R7NA 3NYQA 3DVAB 4E4TA 4KLAA 2O48X 4EO4A 1JP7A 4YRJA 3I2KA 1N1GA 4EJFA 4ZCMA 3OZBA 1SQ5A 1Z2DA 5JC8A 4MLCA 1Z26A 4IBOA 4QRHA 3TSYA 3KZCA 5CFPA 1QP7A 1GARA 4DPMA 3LLUA 2FH5B 2PQ2A 3E7FA 5ENDA 1PZMA 1EFUA 3MW8A 4UE6A 4YWJA 3BXXA 4RDCA 2SCUA 5LYJA 4E1BA 1K3UB 2AUMA 1UBUS 2DM6A 3GV0A 3MWDA 3ROFA 2VN8A 4Z54A 1TA9A 4GZ6A 2XVZA 3SX2A 1A96A 1Z6AA 2OL4A 4Z53A 5HFJA 2O4UX 3NYIA 1SZCA 2BHRA 3TQIA 1EJBA 1M5UA 1N2CA 4FFRA 3LDFA 4L5CA 3VDRA 1PSWA 4EFLA 3P9XA 3CZ4A 3KJNA 4UPVA 3UV6A 1U4OA 1KBOA 1YRHA 2J0QA 4ZCPA 4E1AA 3Q5EA 1DELA 2OHHA 4UUQA 3STXA 1EFVA 4ZDKA 4QUKA 3RWMB 1XHEA 3TPZA 1SQSA 3GMTA 5JAPA 1E6CA 2CMDA 1R0RE 3K9CA 3HH8A 4HFNA 2JF0A 4L8YA 4V2IA 4W5JA 1DADA 5ICFA 3CGWA 2EJVA 3RRJA 2XWSA 4EHLA 5JTUA 3OA2A 3LO8A 4BTVA 3EIHA 3AVPA 5B1DA 1W34A 3KDPA 4DV5B 3KSDO 1ND5A 4AURA 4ZVPA 3R5SA 2LWIA 4KAAA 2P35A 2W6QA 3KUUA 1TKAA 2G6TA 3EBPA 2WV9A 4V0KA 4OQXA 2AUNA 4X8HA 3IP1A 2YIJA 5M7EA 1DAOA 1NDQA 5C1PA 3C4VA 1XRJA 1G9XA 5FOSA 4CL2A 1ZHFA 4QXMA 4ES6A 2ZB7A 1OH8A 3IR5A 4IIEA 2WUWE 1U9CA 4X84A 3S5JA 3UA3A 3DO6A 1OI2A 2J4FA 2EYQA 2W5UA 4TL7A 3GCDA 4YXWD 2PUTA 3TKAA 4HDMB 5BN5A 1YCDA 1U7WA 2ZRCA 2XADA 2IZ5A 4IDEA 3TXXA 2QRVA 3GLGA 4PFQA 1SD1A 4L57A 1G66A 3W5AA 2IU0A 1KMCA 4CV0A 1XZQA 3E9ZA 1P2BA 1L8AA 3GLVA 4LJKA 3R6GA 1LJ8A 3P32A 4RWZA 1R6UA 4KW7A 4F3KA 5KX5F 3M4ZA 3TUJC 4YRAA 1Q83A 4PZ9A 4PBSA 4DNFA 1FB5A 2HYIC 4HYTA 2WHXA 3VKHA 3I04A 3MBIA 4F6LA 1U1IA 3JZFA 4GX1A 1UDXA 3E7WA 4IFIA 3DQPA 3OOSA 3AJDA 3BMXA 1XCOA 2VS1A 3RARA 1Y5RA 3Q1LA 3CLHA 1QFXA 2UXCB 2HBYA 3RI3A 2XUQA 5F1OA 2WE7A 2FRXA 4IRXA 2PX5A 2IIQA 1FP2A 5A4DA 1RLOA 4M88A 3DNPA 4DLKA 4P86A 4M8KA 1C2TA 1LLQA 1Z5NA 2AOVA 4FOOA 1K5GA 2EF1A 2KHZA 2UDPA 4PIMA 4CW7A 2C58A 2B4RO 3G2NA 1NQXA 1WY7A 3M83A 1CB7A 4NFYA 1A27A 1F1BA 4IMIB 3IUMA 1BA3A 2QR2A 3PRKE 4ZQBA 3CLSC 4OOEA 4DMMA 1LZLA 5J3JA 5JSUA 3DEYX 1FUEA 1X7WB 4G9BA 2LGJA 3HBMA 3OF5A 1EBUA 4IQGA 4O2BF 1JR3A 1U1FA 5CDFA 4CR8A 1ZK2A 3LYUA 4I4CA 2W6NA 3FNEA 5BNWA 2ZIWB 3ESYA 4EWLA 5ULLA 3KXIA 1FQJA 2BFAA 4RKWA 2A9JA 2Q3LA 4I4IA 3M9LA 1PJSA 3TJRA 3WGVA 2IXDA 2FUNB 1Y37A 2A9OA 3ZI4A 3RYFA 1Y3CE 1NKVA 1JHQA 1QIMA 5AVRA 3ER8A 3CUUA 4DA7A 2ES4A 1R6XA 2ZCVA 3IQHX 4EGJA 4TOIA 1U7TA 2GESA 5AW6A 3G6KA 2O4CA 4DQDA 5G02A 1JFFA 4X3CA 5KAPA 3WLLA 2GLUA 3WI7A 4LDZA 2YICA 1YZ3A 4GGPA 1W85B 4NOMA 4ZGWA 5GZ3A 1URPA 4FT2A 3FIJA 1UINA 1RJDA 4JYZA 4RVDA 2XUFA 2Y0BA 4LRQA 4TKLA 4U00A 3W2GA 5J23A 3UUFA 4KQCA 1FZTA 4KLCA 1G41A 4GM0A 4MO2A 4DQKA 5SICE 4YDSA 1LDEA 4FOLA 5JJKA 1XTBA 1G63A 4EUNA 1A50B 1W5SA 3GGGA 3IKTA 3HL4A 2WV7A 4M0KA 8ATCA 1SN7A 2DSTA 2JCVA 3R7FA 1MHTA 2BGRA 1MXHA 2D0DA 1UK8A 4JHXA 5AW4A 4IP0A 1PUJA 1RKUA 9MHTA 2H3HA 3D31A 2WNIA 4DA0A 1BCRB 2C2WA 2G3YA 4X7PA 3NYRA 1HGXA 3WMRA 4P5EA 3CZQA 2IEDA 2FI1A 3QVLA 3JVIA 2H2IA 2BZSA 3R4VA 4KMSA 1VHJA 4JDPA 1IMOA 1MVLA 3G9XA 5LXTF 3L6CA 2CHEA 5EJ5A 1HTWA 1JDUA 4IOKA 5EKDA 4RESA 2WMYA 2GJ8A 4OGGA 4YACA 2J0SA 1AUVA 4PZZA 3Q9NA 1ZH2A 1KSGA 4XYGA 4LV6A 4EAAA 2H2GA 2POQX 5A4FS 3ZVKA 1DKOA 4G41A 1MABB 1D6NA 5C1DA 1FBTA 4MB2A 2Z9BA 3HJFA 4D9FA 2PO5A 3WS7A 3KL2A 1MN6A 1AT1A 4G56A 1DQZA 2C9ZA 2IXBA 4Q93A 4MUIA 5CFLA 1ZSVA 1HNWB 2XYQA 3PGMA 1OW3B 2DPHA 3L7IA 4YCAA 5D01A 1CCWA 4FDLA 1U90A 2JCSA 2CLFB 3VMFA 1OZ0A 3ZV4A 2MSCB 1Q0RA 3MILA 4LNUB 1UBJS 3HNRA 5TJHA 4RF5A 4BVLA 5H7XA 4Q4CA 3B13B 5HIKA 3FVQA 1LFAA 5K0TA 1ZM9A 3CLUC 2W71A 4WNAB 4BVAA 4MR9A 4GPIB 3QVGA 4ZYXA 1QWOA 2O57A 3W5SA 4MWZA 2QF7A 4RWEA 2IQIA 5BV0A 2A9VA 3WGLA 3ZQKA 1FSSA 1YT5A 5JTTA 4FE3A 5DX0A 1TYAE 3DCYA 3F98A 2MMGA 3LCUA 3N70A 5DP2A 5EWMB 3CO0S 3UWPA 5LLTA 3ZCQA 1BMDA 1PNOA 2OD9A 1E8MA 4BNKA 4M54A 4UOZA 3G68A 2HLDA 2MINB 3D5TA 3ICPA 3KJQA 4JUDX 4ER7A 5JCXA 4YYZA 2HHJA 4HRXA 1GTVA 3KJFA 3P26A 4FDVA 2WG2A 4PGFA 4M0PA 5E1DA 3ZEAA 1SZPA 3JAKB 3WLTA 2VPQA 2OXRA 1DEAA 4KNVA 3T3MB 2B1IA 5DXAA 1Y9AA 1V4VA 4FUTA 4ARVA 1ISGA 1UPCA 4DQXA 4LWZA 1L4NA 3D6VA 4KKVA 1QGYA 4AULA 1RYEA 1E9VA 2J3QA 4LWPA 1HBJA 3QUTA 3RGWS 4AP9A 4F5ZA 2WA1A 1XCPA 4D0NA 4PZLA 4LRSB 1C29B 1L5MA 3DVRX 3FFBA 1GILA 1ZINA 2GPYA 4G5FA 4EW6A 4GLBA 1GGFA 1GU0A 2HMVA 2AT1A 3C8MA 5CRIA 4Q39A 1W9MA 1ZJ5A 4W6QA 1DKUA 4S1VA 2QBYB 2UZ3A 2WJGA 3MERA 2RI0A 1L5SA 1QTRA 3DPUA 4NOLA 2CF6A 2JI7A 2F48A 2ERYA 4PNEA 1C0LA 1AN0A 2WP8J 1EFPB 3L7AA 1OIVA 4R40A 3EXIB 3DZDA 4QUGA 1CB0A 1PR1A 3ZHUA 1RJGA 3SHOA 5ELLA 3SVLA 2JGEA 1KJZA 1Z2PX 3LC2O 4GE0A 4QXPA 4RLFA 4CMGA 1U8UA 2WDPA 4C01A 3GGSA 3VVMA 3E61A 3L5OA 3GRKA 4CM5A 4F60A 2DY0A 4CIYA 1FW6A 1OY1A 2FOXA 1AXRA 1A7KA 2HIAA 2R7KA 1NW7A 3WXBA 2JFFA 3B3GA 3F2IA 2O2YA 5FTJA 3A9TA 2EF0A 1CJBA 5CW2A 2CXQA 2ODTX 4LISA 3JW8A 1F38A 3HA5A 4MIYA 1XNHA 4S0XA 4XOIA 3R44A 5AM4A 2B34A 4PZUA 1XQWA 3O8LA 1U5AA 5L9AA 1YKSA 1TEXA 3LA8A 4C6HA 2A88A 1Y34E 3NVKI 1SFRA 1U1CA 2O8NA 1CPYA 3L1KA 4RVOA 2BDUA 3UCXA 4DM3A 1XZDA 3PJFA 1G8JA 1QFSA 2A35A 3DXFA 4RPLA 2NU8B 2J3HA 1OFUX 4A82A 4ALMA 4LJ8A 2ZI9A 5CNIA 3FROA 1OFIA 2R2GA 4Z1MA 3TAHA 4E2WA 3TLBA 3COYA 3G13A 2B30A 4CVNA 4KP7A 2OCIA 4XPZA 1WUJS 1B0PA 2JH9A 3O38A 3OZUA 1U5CA 4G07A 4NE7A 1L5KA 3O1IC 4MAAA 1UEJA 2IUFA 3QXCA 4R9SA 1ZW1A 3AVTA 5LBUA 1SEPA 2GAJA 2W6OA 1D2NA 3TX6A 3C74A 1N36B 2Q4OA 2J85A 4LQ4A 2BP7B 3WZLA 1WDTA 2KBFA 4HX9A 1LSOA 1JJ7A 2PMBA 3Q7PA 1ES9A 2WTBA 4EG5A 1AUOA 2WJPA 3D8HA 1E2JA 1NNEA 2CZQA 2R9VA 1XVLA 2IYQA 1AHHA 2R1VA 2PZBA 3GNQA 4MYCA 3A1DA 4CV2A 2BI8A 3VISA 2RGYA 4ZT7A 4C6TB 3VI4B 5KMGA 3DDCA 1R9GA 4FVTA 3DD5A 4GG1A 5BW6B 3GF4A 2KSQA 5D87A 4KPUB 2B5WA 1VMEA 2ONZA 4MUGA 3OEYA 1ZSYA 4B47A 4B74A 4KSYA 4G85A 1T9GR 3D2LA 3UMVA 3VZDA 3T9AA 1A8QA 3LUPA 3X0DA 1TA0A 4Q18A 1CNFA 4JH0A 5H3CA 1O9HA 1O95C 3DKIA 3OM8A 1YIDA 4RZIA 4BXOB 2W2MA 3RK4A 5CD1A 4QSMA 3WG9A 3NWBA 5DNWA 4KE9A 1B1CA 2FQWA 1SAYA 3PDIB 4G5RA 1JJIA 3VSDA 2XMPA 1CFZA 4ARBA 1DCTA 4J4TA 3HNOA 3NT4A 2K7ZA 2GAIA 4H1WA 2CJXA 4NCJA 1NIJA 4INJA 3EIFA 3CMMA 1I9CA 4MAMA 5AK3A 5EHIA 4JAVC 4LMRA 4WXPA 5JZSA 3TF5A 1JR3D 1MHPA 3E15A 1HYQA 3I2IA 2IHVA 1Z62A 5TMBA 3W90A 3H5IA 3A0UA 3P9ZA 3DDOA 3MWKA 4JLOA 4A5SA 4DNQA 4DQLA 1KKMA 3OIDA 3GLIE 2Q21A 2VK2A 3EWIA 4KDRA 2J87A 2VF2A 4NBKA 2CN1A 4ZI3A 4QPJC 4RH1A 2FW8A 3R7AA 1TZKA 1PQPA 2QLMA 4JWKA 5JLJA 2O06A 3U3MA 3O8OA 4L5BA 4B75A 2ZUTA 3ZD8A 3ESRA 5LYJB 4XB6B 2SCUB 5FBQB 4TWIA 2ZATA 4L0QA 3MWDB 2YZKA 3UC9A 5H3LA 1Z28A 3L8GA 1GGKA 2FPIA 1UH5A 1S2NA 1U63A 3B2QA 1A4UA 5LP6F 1GG8A 4KLNA 3ETEA 1P5FA 4U7FA 4EY8A 1JQDA 1XUOA 3GRFA 3MTGA 5DNYB 5FLEX 3H1TA 5EMLA 1DIAA 3UPTA 5DCWA 1IATA 1WNFA 2QW8A 3ASUA 1EFVB 3QOYA 4HGZA 3NNDA 4ND2A 4OL9A 4DLVA 4MVJA 2ZUUA 4YJ3B 1PR0A 1R16A 3QLUA 2QRKA 4BOYA 1DC6A 3OEHA 1C9KA 1J4AA 2JRCA 1W4RA 3ECSA 2D5BA 1C7EA 1MO6A 1FNNA 1QQBA 2IS4A 3DONA 1OWPA 4C0QC 1MQSA 5J40A 3ZCVA 1M8GA 5IYZB 3E1KA 3E7DA 3DOEA 3LLSA 4L4YA 4U0KA 4INOA 4AYTA 4JQYA 3GFBA 4GPD1 5KKNB 2BONA 2OV6A 2QTMA 2VWPA 3HDYA 2RHDA 1W4CA 4RXTA 5IDXA 1AO3A 3DC7A 1K5HA 4WCDA 4ZO8A 4C21A 2O5CA 5FTMA 3BSFA 4MJ3A 1NBAA 4PHGA 1DV1A 2QSUA 1P7YA 1OH6A 4LJ9A 2GD6A 2WJVA 4LF9B 2HA3A 3TZKA 5BN5B 3KLMX 4JC4A 4CIVA 2IFTA 1XTZA 3GLGB 2QRVB 3EAGA 2WUDA 4P7BA 4BP8A 3ZK8A 4A6DA 1WUTA 1TVCA 2V65A 2HDWA 5A1TA 4W9NA 2WTEA 3EUAA 5K8CA 3D2BA 5B2EA 1U2ZA 1EB9A 4D8VA 1BJTA 4OFWA 4R2KA 1E0JA 2FJUA 3I73A 3OHMA 3ZNPA 4GT1A 4Z7QB 1RC0A 2QN7A 3LP6A 4UQOA 3RVSA 1K0FA 2PD3A 1JTVA 3LDGA 3OQHA 2F1IA 1SVWA 2QNRA 3K16A 1ZJWA 1CS0A 2ZS9A 3UUEA 3KFVA 3ZH9B 2DQ4A 2XMRA 1C50A 4BE7B 4XJSA 2DHDA 4JUCA 2MU1A 1E79D 1M6NA 1P5ZB 3A9SA 3L8CA 4WV3A 1IM8A 2VC2B 1M7GA 2HLDD 3BMOA 4EBFA 3U4GA 1VPEA 3TNJA 1TC1A 3V7UA 2C2ZA 2J3EA 3LZDA 1LKZA 3C8HA 3K9GA 4O0MA 4RMIA 3W06A 4AIIA 1VKRA 4B31A 4F1WA 4REQA 4HH1A 3D3KA 1MOSA 4CMEC 4GNKA 4PPYA 1P39A 3IV7A 5E1BA 2VQFB 4DM7A 1I3OA 5EJIA 6ADHA 4JODA 3STUA 2GARA 4AC9A 5KYGA 1WABA 1BE1A 3HFGA 3KQPA 2OZVA 4BJHB 1PR6A 1Q7GA 3H7IA 5A5GA 3PRYA 4XQ0A 3AINA 3GUHA 1N2GA 1CEEA 4N8DA 3NONA 1ZKMA 4WX2B 2BKVA 1N3LA 3RYFB 3DYIA 3VJRA 2VT6A 1RBMA 4HNHA 3O74A 4K9QA 5F2EA 2VUIB 3B6ZA 4ZODA 2ATVA 2MCFA 4ME6A 3P27A 1I9GA 4C0KA 5ESWA 2MYNA 1JFFB 1K75A 4G86A 4P7GA 4S2EA 2WKPA 4TWJA 5FI3A 5E1OA 3HB0A 3U56A 3EYWA 4H3VA 2GBGA 4WNIA 4M1QA 1IBLB 4RZSA 4F04A 3ZZ0A 3R9IA 1Q0QA 1NQWA 3B5EA 3HR7A 4M9CA 2X6QA 3GLUA 3E9NA 2OFOA 1V26A 3KWFA 2PJUA 1G1MA 4QC2A 4JI7B 3U1TA 5LDGA 3TLZA 1WZ2A 2I91A 1I1NA 2WFMA 3QLJA 4AN0A 1E5DA 1TQHA 1B2RA 1WEKA 2FMUA 2OUIA 2PGXA 1GAWA 2J45A 2PD6A 2W2OA 1ZCZA 3MZ0A 3O93A 2C5GA 4C20A 1DWQA 4KE6A 1FVFA 4TXJA 4KIUA 3VPCA 5IABA 2HKIA 1A7AA 2WLSA 2PSFA 2VJBA 5DMHA 3RR2A 5JD4A 2A59A 2AN9A 2HNBA 4WJZA 2ZBVA 3WQQA 5A6SA 4QA9A 5KC9A 1NNLA 4MS1A 4PXYA 4QFCA 3WIOA 6GPBA 2I6UA 4YAOA 5T4FA 3L4KA 3WLSA 2FEAA 4Y7DA 2BEKA 2GCNA 2J5RA 4B46A 3CX8A 3NEJA 3I9KA 5CK5A 4FR0A 4LCBA 5JFTA 2Y0PA 2Z1MA 3HP7A 3S2IA 4RGVA 1Y0BA 2R87A 4J9UE 3I23A 3WL8A 2N1BA 2JVKA 2P6RA 3BTSA 2IYYA 4FGWA 2YV1A 2Z6VA 4X00A 3I09A 4INAA 2OCLA 5BSTA 1ZRMA 4BGDA 4ND3A 2W4MA 3UWMA 3AUXA 1SUDA 2OVFA 4KRGA 2IEZA 3JQFC 4D45A 1G291 4WHMA 4Q02A 3TJMA 4NYIR 3WGNA 2A9PA 3O1JC 4BNVA 2HTEA 3JR7A 2OD2A 3A6JA 3KPJA 3VZPA 2P62A 5MHTA 3EAFA 3GPIA 1RI5A 4QEDA 3ELUA 4UTZA 5U1PA 2PVSA 3ZE2B 1F3LA 2DOKA 4L6AA 2P9TA 3H2IA 3K1YA 2H1RA 1EE2A 4PFKA 4X92A 2HY7A 4BNFA 4PN7A 5HNKA 2XIQA 4PQGA 5MFPA 4XZ3A 4YJFB 2JJMA 2IPXA 3SCZA 1U7PA 2QRLA 2ZKIA 3OU2A 5DX8A 2V7XA 1TW3A 1X8LA 2HF7A 2VHJA 5AI4A 1SOVA 1GYRA 3F3MA 2ENWA 4K6MA 1IBRA 2EL7A 3QU7A 4QJ5A 1GNLA 1D2MA 3S2UA 3JPWA 2H11A 2X9LA 5LWHA 3ONEA 5AH0A 2P8SA 3TXAA 3IUPA 1HFEL 2VHYA 1Z7WA 2C92A 3ETNA 3NJRA 1Y3BE 1JEQA 4EBBA 1SXQA 1HLFA 1TQ6A 3FOAA 3JRNA 4PCVA 5C35A 3E3MA 5IEJA 2VPIA 2WF8A 3S2SA 1JHAA 3U3ZA 2Y0DA 1DE0A 1VE3A 1DDGA 1XU9A 2H51A 1KEVA 3AMVA 1HFWA 1D2RA 1YOVB 2G8NA 3C45A 3IB6A 3LT2A 3MGBA 4KCGA 4TTTS 5E6RA 1E1DA 2RAVA 4RK5A 5E95A 1HKHA 2DWUA 3WGKA 2E1RA 2QTVA 1AKUA 1J33A 5CDGA 5E6UA 3U3KA 1WMSA 4OFXA 1WE2A 4EA8A 2ZWAA 2GNAA 2C8VA 4ZKEA 4C4OA 3NETA 3PVZA 2CLCX 4OMDA 4Q4AB 2XZTA 4ER6A 3T3NA 4DWOA 4YJDA 5IN4A 4EAQA 2OA0A 2VNAA 2XWJI 3FRIA 3L1HA 5IG2A 4TLBA 2PM8A 4EFNA 5FPSA 3EB9A 4DR3B 4F4UA 4FNMA 2CB0A 3KQNA 1ST3A 3P2MA 2WD8A 3OZWA 4BVBA 2R6R1 2LXNA 4NL4H 2A5LA 2FWIA 3P9KA 3ORYA 3KQVA 1H8HA 4LE2A 2GCEA 3PFNA 3HG7A 2RB5A 1I01A 4DAOA 1K7YA 1KTVA 3HXKA 1C4XA 2O1SA 1KR2A 1YS2X 4WIAA 3RADC 3PXDA 4IKEA 3PC2A 4KV7A 3K0SA 1XAGA 4QDXA 5DGTA 1YD7A 2IXAA 4QAJA 4Z2AA 5IAEA 3P2IA 5KYYA 1BFUA 4AKGA 4G0QA 3R3YA 4I4TB 4ZC1A 3SR4A 4MVJD 4BQEA 2XQVA 2FUG1 4EVSA 1GL6A 2GEVA 3OEHD 1VG8A 1VIAA 4PQFA 4W5QA 1R37A 3JQAA 5FLXA 3R3SA 1KOLA 1AIPA 3IUQA 3KYJB 2P9YA 5FHQA 3VR4A 3TQOA 1H0RA 2PV0A 4NR0A 2O7SA 1FFXA 4Y2VA 5EJ4A 4M83A 5JCZA 1NSFA 3BXGA 3L05A 4M8LA 2YJNA 2H7VA 3H86A 3HJGA 5B1YA 3OFSA 3RPEA 4QDKA 2VT7A 2CHGA 3VA7A 4OI4A 1RQLA 2RGNA 2FEWB 1Z2OX 5CT4A 5IM5A 5ITSA 3HO8A 5BWCA 5EGSA 2E89A 3KD2A 2G71A 2F3RA 3IDAA 3SFTA 1EUCA 4EJ0A 3N2GA 4UZEA 4OX9B 1B7GO 3NHSA 2CXTA 1MKYA 1V5IA 1Z47A 3HN6A 3HEMA 2HSZA 4KKXB 4UZFA 4W8HA 1V3QE 4C3UA 1W4AA 1XMVA 4TN5A 4DWVA 3OMLA 1Y1TA 2BHTA 4L27A 1IXYA 1N0HA 1IZ8A 2BGMA 2F1KA 3KLBA 1HT1E 2W6IA 3FCOA 1KJQA 3MOGA 2RK6A 4ZIRA 4CIAA 3KHSA 2VPTA 3HB4X 4MGHA 1EE9A 2A3NA 4A1OA 2EVWX 2HBQA 1HDEA 1E3SA 1PQYA 3AI2A 2VKQA 1PVVA 4JGGA 2R1VB 3DL2A 5A9RA 4RIFA 4O5OA 3D5EA 4OMFG 2PUJA 3DVQX 3H6GA 2O54A 2FP4A 3FDJA 2M6LA 4MGKR 5KMGB 1ONPA 4DWJA 5B4UA 4LJ4A 5CEJA 3MPUA 4BFVA 4W5WA 1EBBA 1M1XB 4YFYA 1BU5A 3OHPA 1BX3A 2VJAA 4C05A 4DMLA 3NRJA 2VVTA 3D4IA 1G2QA 4F3TA 1CJMA 1NLYA 2EBFX 2ODBA 2O23A 3UJ7A 3J81k 3A4TA 1KJYA 2BUAA 3DFKA 1BYIA 4B0PA 5KOYA 2GZ2A 3ZWMA 2OGWA 3SR0A 4M36A 1Y9EA 1KK2A 3HCWA 4I1RA 3WGYA 3OJOA 3PUVA 1EESA 3RH0A 1Y6FA 3MUEA 4Q7LA 4X95A 4EJSA 2GZMA 5KTOA 1MOQA 4GO1A 4S05A 2WJIA 1Y3DE 5EKTA 3ZD9A 5ALOA 4QQKA 1U0EA 1MBZA 2CBZA 5HUHA 3PJGA 4JLWA 3WK5A 2X0RA 3FZEA 1ZCJA 1RRFA 2RKBA 1XRSB 4KMRA 3OJFA 5JSFA 2ICAA 3O2QB 3T34A 4O1HA 1KI9A 3S5UA 1I7QB 2WIJA 3H2YA 1EDOA 1QIJA 2BJVA 2DQKA 3MT8A 1A1VA 3EXAA 3O8OB 1M6HA 2RCNA 2XQKA 4L5AA 3L46A 5EJGA 3GVIA 3G0GA 2IGBA 3DGEC 3PKIA 4AMVA 4ZU6X 1PZFA 2C8KA 4RTJA 3DHNA 3CW8X 1MG0A 3TO5A 4FSHA 1R64A 1SOUA 2OSBA 2IHUA 2G9NA 3BGOS 5AO9A 3TVYA 1B43A 3DKRA 3Q2IA 4XIJA 1FUYB 4L9AA 1JHPA 3ADBA 4R9VA 1H2XA 3E8SA 3VM6A 3LV8A 3NRCA 1RWBA 4K2HA 4BAZA 3PP8A 2RD2A 6YASA 2QM8A 3HCCA 1PZXA 3N6XA 2IW3A 3PXCX 4XD2A 4DLXA 4ALIA 1WVMA 2VPZA 2ZAGA 5IAAA 3G2PA 3FKJA 3QIAA 1X7YA 3KQHA 2XA9A 2P0EA 2CBXA 3IQIX 5I8PA 4Z4EA 3F3KA 5AHRA 4C7OA 3MN1A 2OLEA 2ZE5A 3D3QA 2JGLA 3WHPA 4BWVA 5EAIA 2W0SA 3ODPA 5EESA 5ARCA 3TR5A 1PDOA 1LFDB 4MPRA 4PGGA 4W9MC 2XKKA 4G5YA 4CNQA 3ANMA 2HOQA 2DQSA 2QLBA 1Z8DA 1F2TA 3FPEA 1OWOA 3HJBA 4US1R 4QBTA 2C2MA 5TY0A 2C94A 5EL0A 2B4QA 2Q5OA 2WHEA 3KQSA 5REQA 4LPSA 3OX3A 5CX4A 5HQTA 1JZQA 2ZRDA 3AOEA 1GPDG 2CD7A 2Y4OA 3D7SA 3TUIC 4CT0A 1D07A 1YBMA 3W78A 4N1AA 2GEUA 3BF8A 4KAXA 1AHPA 3HLKA 4MUHA 4LV5B 3KJEA 1N9ZA 1T5OA 3ESBA 2O2IA 4TGLA 4TLMB 3TWOA 4EHDA 3EW9A 3EJWA 3G5TA 5E2BA 4C7KA 3CSSA 3KXLA 4EHFA 1GRCA 1IQ0A 1W5AA 1XCLA 3GZJA 1PTJA 2EARA 1VG9B 2A33A 4RMJA 2VHUA 3UJ9A 1X2BA 3UGQA 2DLNA 1EGAA 4P4LA 1E7SA 2AOTA 4J0IA 3FVRA 2K7FA 2CNDA 1PE0A 3IUNA 3MQFA 2CUNA 2CCKA 2CVOA 3IKVA 3WYGA 1CS0B 4KGZA 4RORA 3FB1A 2R8YA 1NYTA 4HF7A 4B2LA 3QX7A 4EKNB 3AERA 1U80A 3WYNA 4G3XA 3WLNA 4U3JA 4FI3F 3PEEA 4QJIA 4O4JF 4B6JA 1G20A 1UK7A 3KXDA 1VTKA 3NCHA 3BMOB 1TVKB 1UKVY 3SS8A 1XWWA 2R6CA 4PC7A 5LMCA 1OYVA 4OP2A 5H16A 4RA9A 3G0CA 2OC9A 4REQB 3LQRA 5TGTA 2GJ9A 2LR0A 3IALA 4GS5A 3CNNA 4RADA 4H6XA 2BUBA 1NX9A 1QVVA 3NHLA 2VP3A 4AUNA 3OSUA 4V0LA 1BROA 2I7CA 4II7A 5CNKA 1H2FA 2YYYA 3RHFA 4BO5A 4YRMA 1LBEA 5GWXA 2OAGA 3BIXA 3H1AA 1DV2A 5DXJA 1L4EA 2W37A 3UUGA 1S7CA 4O29A 4R6XA 1KQNA 1DO0A 3WRVA 4IMPA 1H8HD 3LHKA 4EJMA 1W6UA 2RG7A 3UJNA 3MMNA 3ZDAA 3PNPA 2BR4A 2HUNA 4HXFB 1U1DA 4UHCA 2B8JA 1P0IA 2VJNA 2NXJA 3KR0A 1FMJA 1YNSA 3B8EA 3PGKA 2RIRA 5HKKA 2VQEB 2J6BA 1HE4A 3CRZA 3L07A 1CJVC 2DC1A 2OKGA 1I2DA 4IL5A 3BE4A 1KJ8A 3R40A 5LOVF 1NF8A 1RP7A 4MTCA 1RM5A 1ZUWA 3COWA 1I1OA 3U4AA 1KO1A 4BKRA 4RJTA 4ZYUA 1TLLA 5LU9A 2NO4A 4C0BA 4HI0E 1M6WA 2EFDB 2OQRA 4C04A 5KQGA 1GCIA 3L8ZA 3OOYA 2FFJA 3OCWA 2ORVA 4I3FA 3VR4D 3SWWA 5ALLA 1PP4A 3RODA 1GVHA 2Q2OA 3LPLA 4UEQA 3T3IA 1G6HA 3R6LA 3VC3A 4KJXA 3GJ8A 5I5GA 5A6SB 2JLUA 4MS1B 3FYUA 4TYQA 4K2AA 4CDNA 3K0AA 5A04A 1WBJB 3G8BA 3GPLA 2W2KA 1D0IA 3DKPA 1Y3HA 2N75A 3DMPA 3ROKA 1FYWA 2Q6LA 4U6QA 3O8BA 3V1TC 2FVXA 3K9FC 2QORA 5DX1A 2AQHA 4BTEA 1F7UA 1QNLA 4MRPA 1I3CA 4N0MA 3MD9A 1O87A 2VOEA 2XECA 1TO6A 4KVAA 4LRWA 4G8CA 4UBJA 4YECA 1JTEA 1PKXA 3LCRA 3VDXA 4DSAA 1XD8A 3E5RA 4B3RB 1X87A 3ANLA 2FJPA 2QX6A 4TYPA 3VAYA 4AG5A 5AESA 1YA6A 2G06A 2Y71A 3DG9A 3KHUA 3VYSB 4O08A 1ZS9A 3SQOA 1Q1GA 4ZYWA 2X9VA 3R8FA 2PWBA 4K6FA 3AFMA 4FOPA 4JYMA 4ZCLA 4X91A 3NB0A 3MELA 3BG5A 1OV6A 4FMCF 2OVBA 6ABPA 1ELOA 1TLTA 5EZ6B 5C8ZA 3V3TA 1Q84A 4N03A 3ZW9A 4JN6B 2WJZB 3OA0A 1ZHOA 4E51A 1BKSB 1L4KA 5JJCA 4G24A 2F9MA 4MLDA 4RS3A 4QUBA 5TX7A 3SBOA 1AA6A 1C1XA 2AC2A 3NATA 2PRZA 3K6KA 2ISQA 1RXEA 1EUZA 4BFZA 1E7YA 4G36A 1UR5A 5EYPA 1TM7E 2HT6A 3LPDA 4XGNA 4DKJA 3MK31 3W4KA 2YKGA 4BC0A 3O83A 3GLGE 2IEBA 1JEQB 4S04A 3PNLA 4R4JA 1BGXT 2ZUCA 1WDKA 3AUAA 1AE1A 3M4YA 5I7HA 1A9SA 3N0VA 1YDGA 3IOYA 3UAYA 2K5UA 2IYWA 3VRHA 1P3Y1 5AI6A 1CZHA 2WJWA 2Z83A 5E6RB 2B5OA 4J0JA 4UCFA 3ZKWA 4LY0A 1DWPA 2NACA 2P2DA 2QTVB 2WEKA 1I4TD 2YV5A 1B16A 3HHEA 4L6IA 5DDIP 3TLYA 2I1LA 2G0AA 3G7UA 3H9CA 5IKOA 2IEYA 4LF7B 3V8QA 1TEHA 3PX7A 3K4PA 2H48A 1QO9A 4P7JA 1UEIA 2PRYA 2JA2A 2P9FA 4FJ1A 4CKBA 1F8GA 1THGA 2PZ8A 2XWQA 3LVFO 1Z3CA 4B79A 5EUMA 3H8VA 4PAGA 5JY1A 1Q77A 1FNMA 2P30A 3MT0A 4WK2B 1MEOA 5FPTA 1ZM4A 3DLPX 1OSNA 3MRVA 2MYTA 3ENVA 1GADO 3MWEA 1ZM7A 3TYXA 3ZY6A 4NPAA 4NQRA 1LB1B 5BMVB 1PUIA 1Q22A 4BIMA 3L41A 4ZOLA 1J1UA 2DBVO 1IMJA 4PS1A 4DCCA 1OAKA 4BNIA 2XYPA 5JT1A 4YRNA 1Z5WA 3HKEA 5AW5A 3HLTA 2GT1A 4BIIA 3I12A 3JQBC 4NCBA 3RT9A 1AK1A 2VAVA 4DLBA 4YMGA 3JPYA 4REOA 5CDFE 3ETCA 1JMKC 1JR3E 4YT8A 5KYYB 3U40A 1KRXA 3GFRA 1GSHA 2GCGA 3BGIA 3C98A 4JC0A 2QDKA 2OZPA 2AZMA 2WF6A 1MENA 3DC2A 3EVDA 4QFDA 3TLCA 3UICA 4D8YA 2V4MA 1SUCA 4WUVA 1ECLA 5LOVA 2YASA 3BRQA 3EQ7A 5ICCA 4G0OA 3SDSA 3D8BA 5LBIA 3EXFA 4OFBA 3VR3A 2CDBA 3NHUA 3D2CA 2D5CA 4JLDA 3TTWA 4PBRA 1Y9ZA 2QTHA 4QQNA 1NVWQ 1FFXB 5DYGA 3U7IA 4L50A 1KEEA 5I8ZA 2B25A 1S9HA 2G7MC 4XW2A 4HGYA 4IIVA 3CUEF 1HDXA 1C7JA 4C0WA 1N2IA 3EWNA 3K1JA 3MVEA 1GTG1 4H77A 4ALJA 4UM5A 1H9CA 1P62B 3N2GB 3ACDA 3FCYA 1FJHA 1W9HA 2BUCA 3G79A 5HKLA 5I9IA 5F52A 3OKAA 4LCJA 2GM3A 1H42A 2ATIA 2DFPA 4NENA 1J8FA 4YS6A 3WYFA 3JVDA 1N3IA 4OQYA 2I4OA 2JGFA 3AX6A 3RFUA 2E48A 4OLJA 1XP5A 1PX0A 1RYYA 3F97A 4EA6A 1VJ0A 1E6LA 1JYSA 1DC8A 1R8XA 2PX2A 1TJPB 4ZIRB 4YCLA 5B3LA 4U7DA 4OJYA 3BRWA 4RTSA 2GHTA 2CXUA 1SUPA 3DJFA 3R23A 5DCLA 1KFEB 3LUDA 5I3ZA 4Z49A 3G8YA 2FGKA 1SHLA 2IYLD 2ORIA 3CR8A 1NVVR 4NULA 4DNOA 4LXYA 4L22A 2XD9A 3T9FA 2IIBA 4PX2A 2ZYTX 2GK3A 4P98A 1GV0A 1XMIA 2X5NA 3AFNA 5DWVA 3V8PA 5LN1A 3FTEA 1JQAA 1G55A 4B4KA 2CVHA 3HWWA 3NQ41 2OV8A 1KE2A 1H4QA 4Z7JA 3TQRA 4HS9A 5J5CA 3TRDA 3DV0A 4LQCA 2B20A 4NU6A 2ZB4A 4ZVMA 2ZCUA 1DX9A 3VNRA 1N5KA 5KI6A 3EEYA 1RLMA 3UM9A 1NR1A 1TU0A 2WWFA 4QYXA 2Q0XA 3DMGA 3TIIA 5A0FA 2OBBA 4UBNA 4DJFC 4Q7JB 5FHRA 4ENQA 3A4IA 4A8JA 3QJGA 4BLSA 1Y4SA 3ESQA 2SBTA 2DECA 4X7MA 2P3QA 2QJTA 2DFDA 3DEAA 4IOMA 4EJSB 9LDBA 4XLLA 1V48A 5CTJA 1LD3A 5JMPA 4EL5A 1E64A 3KJGA 3L4BC 5CDTA 2DTXA 1QRUA 5ITVA 4MPPA 1IWOA 4L07A 5LJIA 1QV6A 1EMDA 2ZS8A 3L6OO 4DUGA 5E9AA 1YAJA 5SZJA 4C2UA 2QAGA 3C85A 1Q7EA 1BW9A 1VG1A 3CEAA 2ZSHA 3UHFA 3WHIA 3KVNA 2NXWA 4ZN6A 1MX9A 1P1RA 3KKOA 3KQKA 3CH6A 1QIHA 2RHMA 3VR5A 3M9XA 4IXMA 3PJDA 3T95A 2BI4A 3NANA 5ALWA 5F12A 3KJXA 4H1TA 5IJ0A 5HKKD 1QHHA 4R98A 3SEFA 1V47A 3C3YA 5T6MA 1DKRA 1OAAA 4DDWA 3B89A 4E15A 3AR8A 2CL5A 3FDFA 2Q3EA 1XIVA 2CXOA 4J1NA 3OTOB 1N0WA 2WIFA 4KQXA 2FG6C 1WY5A 2NTNA 5TEVA 2IUYA 5EC8A 3PRJA 4B83A 1T5LA 2VZ8A 1KHHA 4EB8A 1VLMA 5KREA 1ZR2A 1YB5A 4X62B 1MJGA 2PRKA 3A70A 1W88A 5CHYA 4HTAA 4YBZA 2OZKA 1KE1A 1JT9A 2XTZA 4JP3A 4P4GA 4CF6A 4XB2A 1G3RA 4AJ4A 1AJEA 1OXSC 3WIUA 3ZHBA 2FRVA 5BN3A 2OV1A 3HU2A 1NW5A 2P5UA 3AY6A 2OZEA 2JJ2A 2QYHA 1AG9A 2DR0A 3CC8A 4XX0A 1X7YB 1YA8A 4MKHA 2FKNA 5AVVA 4C7OB 4QREA 4BQIA 1N78A 1U8TA 1YQGA 3KKQA 1LU9A 5LL6P 3IDFA 1OV4A 1C9JA 3QLVC 1I14A 2IHBA 5A06A 1RACA 4QUEA 3C1UA 3HZRA 4H1VA 2X2PA 1EXDA 4MO9A 4ON9A 2XF8A 3VZRA 1IZYA 2L69A 2Z2IA 2GBLC 3RTCA 1AOXA 1WCV1 4OO3A 2Z08A 1YZVA 2D5IA 5REQB 1RKQA 2CFRA 3TNFA 4C89A 2J9XB 4HB4A 2H17A 4KXNA 2ONJA 2R62A 1SCNE 4M1YA 4DHEA 5AW8A 3O0TA 1X1BA 1U98A 4J4HA 4OQFA 3O47A 3ZY3A 3E2MA 4OI2A 3ZBTA 1Y81A 3SP1A 1H2AS 1MX5A 4KDCA 4QRDA 2I4RA 4XTRA 3H19A 1NI5A 2ECPA 4PRYA 2XRFA 1UMBA 1O2DA 3RRBA 3ZCTA 5LQNA 4MGEA 1REQB 4Q03A 2XXJA 5DMXA 3SC3A 5CB6A 1PWHA 2ZBPA 4LYYA 4YP7A 3H1EA 4JJEA 1VE9A 4XLTA 4YUAA 3K8OE 5ADWA 1ICEA 3I01M 2E18A 1ZIPA 3WDMA 4C5CA 3NUQA 2O8CA 1UWCA 2K2WA 5AK6A 1UXOA 1KWKA 1WS6A 4AFNA 4IHQA 5DN6A 4A2QA 1NVUQ 5AXCA 1KDPA 1L4HA 3STHA 4A7PA 4D3XA 4HYQA 3TW4A 2FHPA 3DLIA 3NBAA 2IWHA 1H93A 4NESA 1MRNA 3AERB 3HUEA 4IIXA 1EVQA 4U3JB 3HR8A 1VYTA 5HDQA 5EERA 2FK8A 3R5FA 4NDZA 4R8MA 4IQ4A 1A77A 1H8ED 1CUZA 2PGOA 4QTZA 5KNDD 2YFHA 2C59A 1Q14A 1QH8A 4BDSA 2ZIVB 1TF2A 1X7DA 3PHHA 5CXXA 3EEBA 1ZLXA 2P3OA 3F1LA 2OLJA 4RA9B 4UQLA 4UQPA 2WFAA 1EFHA 1BQ3A 1Q15A 2XA1A 5JJBA 3FCXA 5FTWA 2Z56A 1EVLA 3S70A 4PGMA 2RHJA 3AONB 3B85A 3EOAI 3KPWA 4FEGA 2C4UA 2FR8A 2QG4A 4HBGA 1H65A 3M4XA 3RM3A 2ZJ3A 3W3AH 3DFFA 4LXGA 3WWPA 1XWIA 4N0DA 4H3KB 2GS9A 5JZBA 4JVLA 4V0MA 1RYDA 1E9CA 1XRQA 5FDFA 3U09A 1L7AA 1Q12A 5B7GA 3PEYA 1M1YE 3AP3A 4HWGA 4NCNA 2A0WA 4RFLA 3PL1A 1LJUA 1H3NA 3I8SA 5T8KC 3NEYA 2KPOA 4X6XA 3L5KA 1ZJ6A 2OBXA 2X6RA 3B2NA 3ID6C 4URVR 5EWJA 1VI2A 4IXTA 5KU1A 1T2FA 2CNWD 4OQPA 3RJ9A 3GJ6A 5CA1A 3FOEC 1FLNA 4D8UA 2VHEA 3JU3A 2WMOB 4N3GA 2XUOA 4EDHA 3GEIA 4DBVO 1EM8B 3KB8A 4F6RA 2AHOA 1IQPA 5AKZA 4PS0A 4MINA 4BZXA 1TCUA 3EDYA 1GTZA 1P7PA 5EZYF 1IUNA 4B45A 5DYIA 4MTLA 3Q3EA 4MKZA 4Q3DA 3QH4A 5JSZA 1TECE 2CFSA 2G80A 2N9UA 1K0UA 4WOBA 3VR3D 2BM1A 1DWUA 1U2DA 2O2SA 5D84A 1H2WA 1DLJA 1OGIA 3THWA 3AKCA 3ZXIA 1T8RA 4PTLA 4HLDA 3MXTA 4LZAA 3M0EA 2P78A 4AWXA 5U4QA 4BNTA 4YCMA 3FYUB 4F96A 3D5QA 3K0AB 3R74A 4O8ZA 3NPMA 3ZK9A 1GO2A 1XTVA 1WV0A 3Q9UA 4FSXA 4JD5A 2AOUA 4MJLA 5FULA 5DM2A 4XWWA 4DV0B 4MH0R 4OQZA 4NABA 4RD0A 3AILA 5A0VA 4MPJA 4U7TB 1P61B 5FFNA 1WB9A 3CHYA 3K9BA 3NUGA 4M7WA 1G8GA 1ZNQO 4NCAA 2XA2A 4J91A 1Y6RA 5K6RA 3HBNA 2QY6A 4MVJE 3X1MA 2Z98A 1HZJA 1VIMA 2ANBA 2N1MA 5EFZA 4GVXA 3RSFA 2GDZA 5CX1A 1KSJA 2BEUA 1KDOA 5KTPA 2AYZA 4LPKA 4NZZA 4UCQA 4IGIA 5I47A 2XOKD 1H1LA 4M1KA 3VH3A 1T8UA 2ZTUA 1TRHA 2HQOA 3LWZA 1YKFA 4M1ZA 5AD1A 4HATA 4NNPA 3RU9A 2JHGA 3MLEA 4Q1EA 3OQ1A 4ASUD 2LBPA 4QUJA 4DBLE 4FN5A 3I9OA 4LJLA 1SVSA 4JSRA 1C3LA 5ED0A 4V03A 1C1XB 5JPDA 2OECA 1UIRA 2JEYA 3A3OA 3F3SA 3FPHA 3QBEA 3T7DA 3W5HA 3W6UA 1YFLA 1ZD9A 2A4MA 5HJEA 1TVMA 5EN4A 1EB8A 4YI3A 5EYPB 5CA0A 3VH1A 3W5CA 1D09A 3JVVA 4PSCA 3RYIA 1GGVA 1SIBE 2Y1XA 3DE2X 2FFAA 3F46A 4DEXA 4LHWA 1CG6A 3RT7A 4EYKA 3F2VA 1VMDA 2AR7A 1NQOA 1UF9A 3LDAA 5B3AA 3NBKA 3KT6A 3PIDA 3GIWA 5J47A 3OKPA 3UBTA 2GNOA 4WGGA 1SBZA 3ZH2A 2XUKA 1H6BA 1H2RS 4BO3A 4QM6A 2O5VA 2WFZA 4G63A 4QHSA 4BU0A 4BLPA 4KUGA 4L3VA 3MAJA 3HZHA 3OWHA 4NBRA 3MCZA 4RYDA 5AKYA 4ND1A 4RQUA 5F1PA 4ENPA 1ISJA 2R1ZA 5HQ3A 4EG7A 3B1XA 1QKKA 1YB6A 3T5BA 4GH5A 2A1IA 4IWNA 2OXTA 1R5OA 2ID4A 1OWMA 3WY9A 4I0WB 4DUGD 1GWNA 4X24A 3VTKA 3I9V1 1DEOA 1SXJC 3E9EA 3MWFA 3QW2A 4LDPA 2NIPA 4FE4A 2QTNA 5LDDC 1LI4A 2NAFA 1JU3A 2GYUA 3BHJA 4OGKA 1AGRA 1G7TA 1T4DA 2FRDA 2VXBA 3QXXA 4HRAA 3VR5D 5CR9A 3UFXA 3VVBA 4D4GA 1IN1A 1V1JA 4Z5XA 3C16C 1JKFA 1NVMB 4D9MA 4MQMA 1M75A 1T13A 2NQ8A 3QFHA 1H5UA 2EC5A 4TM7A 3MWEB 5CVVA 5EWLA 3RABA 2HHLA 5M5BA 1JV2B 5ABPA 4RCVA 4ZOLB 1HXHA 3M2PA 4OF4A 5FI5A 4XWOA 4GZLA 4QOGA 5KVVA 2ZXFA 4EG3A 1E3EA 1Z06A 2I54A 4UM7A 3GDFA 3R6DA 4GUDA 1KBQA 4E46A 1SVKA 1N1EA 4EB0A 3ROMA 1UWKA 4F06A 3AYXB 3PQ5A 2HJSA 1UANA 1D1SA 5GV8A 3SC6A 2JJ2D 3AJRA 3D9QX 2PUHA 2FWBA 1LVUA 1GRRA 1NBHA 2C4MA 3NNSA 3F49S 5E0KB 1ORIA 5BNIA 3PC6A 4XJXA 1TA4A 3W77A 1DOAA 4LZOA 4JP8A 1BNCA 3G17A 3GEHA 4D02A 1IPEA 4YALA 1FMFA 1KEEB 1Y4DE 3KD3A 5D8DA 1UKZA 1VJ1A 2B4TO 4GPTA 1TU4A 1IJKA 3RKUA 1GDHA 5BUZA 4HGOA 1SK8A 1KARA 2FQQA 3L49A 4KG7A 5DM60 1XVIA 1QTNA 5JS7A 2VUTA 1EEHA 4JLSA 1KF0A 3V3KA 3DHVA 3A6DA 4PZPA 1SELA 3T3GA 3U1BA 5L8VA 1I94B 4HUQA 3GCGA 3OC6A 3BL6A 4LECA 4N0EA 4NENB 4WEOA 1FEZA 3FPCA 4XARA 4AY4A 1VXOA 1CBUA 3SEZA 4DS3A 3U61B 5C34B 3AESB 4FFDA 2QK4A 1GYPA 3AUYA 2MSWA 4LHXA 4AJJA 4EI7A 1C4OA 2EWWA 1RQRA 3KSMA 1YZKA 1Z37A 5JLAA 3PYMA 4N3CA 4ZJZA 3ZC3A 3P71T 4ZDJA 4QDZA 1RWMA 4U0JA 4WJKB 5FUWA 1SBQA 1D2EA 1IUOA 1FDOA 1OPXA 2W0MA 4O3FA 1Z7BA 3WLKX 1WTCA 4D25A 3FSEA 3O7MA 2G1PA 1M74A 4D4HA 5I9TA 2WU3A 2YZMA 4PLYA 2YZ7A 1DG1G 4X3OA 4F5YA 3FCCA 4IIGA 2G70A 2RDMA 4YDHB 1N2EA 2PX4A 1Y8AA 3T38A 3AVYA 1DJMA 4WLVA 4IH9A 1L3IA 4MR8A 5JZVA 3IBGA 4I1PA 3AYZB 4FZ3A 1WQ3A 1EFKA 4MDYA 3DV0B 4UHEA 1T3GA 4LXTA 1X80A 1RLJA 4B7AA 1NR7A 3FDXA 1WTAA 1SOMA 2YJGA 5TE9A 4BX2A 3GJXC 2P27A 1AGPA 4WFIA 1UDBA 1J06A 1AVTA 1Z39A 4NMMA 4D6YA 2O8BA 5CB4F 1WW3A 1XMSA 1R18A 4YQZA 4DAEA 3FUCA 5IJZA 1IU9A 3E23A 1QZ3A 5HM6A 5I9BA 1JEEA 4WOPA 3EXEA 2J5XA 3SC2A 4TMYA 4ARIA 3B20A 3X1ZA 4FGKA 3GLTA 2FPKA 4AJNA 4BN4A 4YNBA 4YRIA 5GIOE 2QXUA 2AJBA 5DLPA 4FEYA 4J90A 3FPFA 4IOJA 1J7KA 2YZ2A 4MRNA 1WUIS 2VA8A 4M0CA 3VO9A 2QAGB 5JQGA 1BW9B 2F3TA 4ZVRA 3HU3A 4RAOA 1KZYC 5JXIA 1JG7A 1JBEA 4OK6A 4ACBA 1SC3A 4TV9F 3RG2A 5AVQA 2Q3BA 5IJ0B 1GPJA 1QHHB 3BD9A 4IJ6A 4UAUA 3O8NA 2C4WA 3AH8A 4LX0A 3SR3A 4NZNA 1NZFA 1BXKA 2Y66A 4RC9A 3OBIA 1A9QA 1VHWA 4EFKA 2XMZA 3P97A 4XDHA 1JXOA 2OD7A 5KZMB 2EZ4A 2GN1A 3GBSA 2QRMA 4BNZA 3NV7A 2OV4A 1B23P 1UPUA 1W88B 5AT1A 3IOEA 1VDMA 2NSDA 2DVMA 4EX6A 1ZGZA 3WNZA 5A62A 2ZYRA 3NS7A 1SCJA 4XX0B 3QOFA 4IQ8A 2VAXA 3OKCA 4N47A 4PO9A 1YOBA 4MUJA 4HJRA 1B74A 1CXZA 2JCYA 4PNHA 3CWZA 2QTTA 3F7MA 1NZJA 5EMMA 3AF2A 4NCIA 4BKQA 3NGMA 4LI0A 3LX4A 3O8QA 3RYHA 1BVHA 3NHJA 2Q6TA 1E2FA 2F1RA 2ZRGA 1PS8A 1R0WA 3G8CA 4L5YA 1Z6PA 3IJRA 4H6WA 1RSZA 1XPRA 4H1HA 1YS1X 3NKFA 2WJ4A 4ZYVA 2OTCA 4BFXA 3H75A 3OSZA 3L7MA 4N7BA 3CRRA 3EPJA 5AW1A 4FIDA 4LJ6A 1M9NA 3LQKA 3G9QA 3PD1A 4N40A 2EZ8A 1NRXA 4L4ZA 1S8OA 4C3OB 3LYAA 4IIFA 2FPGA 4E3ZA 4QOFA 4BEJA 1UMBB 4ESOA 3RS9A 3UJ3X 5HZHA 5JNRA 4B3SB 1GYQA 2K6GA 1CIJA 4EYSA 1PVOA 4RTRA 2GRJA 2R6GA 5GZ6A 1RWPA 1XXHA 3C6ZA 4BBZA 1Z4LA 3WNDA 2J30A 4KREA 2GAOA 2QB5A 4O4HF 4K9MA 2O8CB 5D5HA 1XEWX 2VEDA 4P3PA 2L0XA 4ZT3A 4UREA 3ROZA 4J16C 1R2QA 1IUPA 2WNHA 3C3KA 3RUDA 1K8XB 4LF8B 3B78A 3T7SA 2VK8A 5JAHA 1TUGA 3VXKA 3M5WA 2P6NA 5BT8A 10MHA 5CCBA 1P8JA 1XHFA 3SDZA 4QWWA 5CP8A 2XVXA 1Y5IA 4ZEOA 4LF6B 1C81A 1N6RA 1NHGA 1XZNA 4W1PA 5E4JA 1LTQA 1QH8B 3NO4A 3NG1A 4PAOA 1HR0B 1SVNA 2UUOA 2IV7A 4YQYA 2JHPA 4P3NA 3I5YA 1FDRA 3O73A 1IOZA 3GCZA 2W6ZA 1SMKA 2DWQA 2WUVA 2RGEA 3FW1A 3DBOB 5K6AA 1T24A 6NULA 4MZDA 2JBAA 4C06A 4JXZA 3DZIA 4GPEA 3ESDA 4MMYB 1DFHA 4I6GA 4ZREA 1HE5A 2GWRA 1KQFA 3O3CA 4GQIA 2AFHB 1D9XA 1G16A 1OFTA 3LGSA 5EE0A 2HZ7A 4X1OA 2JAQA 2X0FA 1TJ3A 2H16A 4OB7A 5AVUA 2WYVA 3MCTA 4UBLA 4OHOA 4IZ6A 3SS7X 2VJLA 1M8KA 4HDNA 1KO5A 1YGPA 1CW2B 5J5VA 2QM0A 1ZITA 2R8BA 2XVAA 4LGMA 3AB8A 2WM3A 3MWYW 4WMLA 3RIYA 2PZLA 2QQ0A 5IBRA 2E87A 4A27A 1ZESA 3FOCA 5BWMA 5EWJB 5KYNA 3J80A 3TI7A 2SKCA 2DWPA 3ZTTA 5CA1B 3EGCA 4LZZA 3D6HA 4OXRA 2NU7B 3ZCPA 3HCDA 1QMPA 3GT7A 2WWGA 2GZDA 1OMOA 4P84A 1PO7A 2D0OB 5L7YA 3E9DA 2YRWA 1VL8A 1MR3F 2R6DA 3EQ9A 4KGDA 4CV1A 2GZSA 2P4HX 1YS6A 3GB9A 3FCAA 3GAAA 5B58C 2OXFA 4LOJA 4EKIA 2R751 1GZDA 1ZUNB 1I13A 4Q6BA 1GPMA 1N7IA 3BN3A 4N76A 2DZDA 2GN4A 4LTDA 2QU7A 4MDFA 1NBWB 2XX3A 3MAAC 2MSKA 5JH7F 3B7GA 3THWB 1JALA 3OC0A 2E21A 1N2XA 2J3IA 1RWQA 4P4UA 3BULA 2UYOA 5ER9A 1D1QA 3CLRC 3HLYA 1L9KA 1YC5A 3LC7O 4Z8XA 4RD3A 3S2YA 3TW0A 1XDDA 1XLUA 2QTWB 4AY5A 1LCIA 3CO5A 4DCVA 3HI4A 3NWJA 1YACA 3EC1A 4HYEA 2Q8QA 3AF4A 5B1HA 4MVXA 3RV3A 3SLRA 3AF6A 4M6WA 4ZRDA 5JPCA 1WMBA 1H4VB 4NX2A 5BRAA 4TUYA 1EUYA 2HWUA 5DLQC 1Z4PX 2W4QA 4WXHA 2IHJA 5FUQA 2J9RA 4RTQA 4NNOA 4TVKA 3OZDA 1E2LA 1MB9A 2I03A 4BMCA 4ETNA 5B5SA 3KV3O 3BWVA 4X54A 5EUBA 4EA9A 3UF0A 3HRKA 4M0MA 4WN9A 1KAMA 2AC7A 2BEUB 2Z43A 3SEQA 3MBOA 3ZTYA 4OHZA 3RVQA 4G1BA 1MRSA 1E32A 1KPGA 5F4BA 1H1LB 2A4KA 1GAEO 1Q17A 2H2FA 3GZ4A 5EVJA 4DVJA 2R85A 3D4PA 3WWZA 4ZMBA 2AG1A 3CRNA 1VBMA 2XOXA 3KUDA 1B15A 4N39A 4C6SA 3WLJA 2XCRB 3TDNA 4RSMA 4MR7A 2I2BA 5I4CA 1HYEA 2V6BA 3OJWA 4R05A 2RFLA 4OAQA 2MYUA 3C8DA 5AM2A 5CA0B 2PX3A 3PSHA 3HN2A 3AGPA 4O1IA 4PV7A 3V7FA 4OXYA 4RCZA 4RKRA 3TE6A 3CZ9A 4A2CA 4DEYA 4NLLA 4D5GA 4EGFA 1YUBA 1YXMA 3OQOA 1QTQA 4TYYA 4BC1A 4MW9A 4XFJA 5C53B 3AKDA 5J2UA 4EDFA 4Q7MB 5F9HA 5DNUA 3NASA 5ALIA 3UOGA 4ZAVA 1E69A 1QPGA 1UT5A 3CPJB 1TKBA 3CU5A 4IG4A 3DNFA 1KZGB 1IC6A 5HQ3B 4BBPA 1DG3A 4MS4A 3JVUA 1QSGA 3AU9A 1EIWA 1OT5A 3CNQS 2Z3WA 2A0YA 2F43A 2JHCA 4HK4A 1XDUA 2HM7A 5L40A 2YXLA 1U0TA 3Q72A 4GRAA 4J1TA 1ML3A 4OP1A 4R01A 4RIGA 4KBGA 1L4MA 2CW5A 1LRKA 1PD1A 1WAMA 1A2KC 2VT2A 1X19A 1XB2A 4IYRA 3OX1A 1XNJA 1I1HA 3FM9A 3HB7A 3OLQA 4XASA 5EWLB 4CUJA 4CLHA 5I9LA 4XWKA 4YHHB 4WL0A 2BFDA 4MWCA 3IT0A 3AKEA 4U9IS 2D1YA 3NBXX 1WUYA 4TQGA 2XVYA 3C6KA 2ISSD 4YLEA 1L4BA 4KN6A 2X41A 5ICEA 2BBOA 1YMUA 2PSDA 3DAYA 3M6FA 4Q3CA 2Y2UA 2DAPA 1UEXC 3RJTA 4MYDA 3TS1A 1NQ5A 3M4JA 3V8VA 4FYVA 4BLTA 2FSIA 1L5RA 4KQKA 4BVJA 4W8OA 3UGJA 1JWLA 2ZBRA 3EEQA 3NIDB 4U7GA 1NI3A 4HH3C 3IVAA 1M34A 4A10A 4FHDA 4PEVA 3AF0A 2P5TB 1R6TA 1PFGA 1U3FA 1MAWA 3QXHA 3C3PA 4KN8A 5EI5A 2OQVA 4ZK2A 4LTMA 5LUAA 4UVEA 3KFLA 2DTDA 3D8NA 3RFXA 3T7TA 3A6HA 2Q2VA 4YUZA 3QENA 4W82A 4J43A 5L51A 6REQA 5JH7A 5KOJA 1K68A 3BGVA 2AG8A 1KMHA 3CBGA 4XKJA 1ZA1A 5FXMA 1DTWA 4I5IA 1R8SA 3T4XA 2BMDA 1FRQA 2E0IA 2GD2A 4UBOA 1RWXA 4OHRA 1IG0A 4N9WA 4RANA 2OPBA 4HUQB 5JDCC 5BNTA 2B3DA 3TG2A 3CX3A 1YHYA 4HNAB 3AJAA 3CG0A 4KTVE 1T2VA 2ORYA 4HNGA 3WMXA 5H70A 2V7PA 3EXHB 4F92B 2JEOA 3OU6A 1KK3A 1ZI9A 4LC0A 1MVOA 1R0BA 3EASA 2B2NA 4F93B 5DE3A 5ITWA 1SC6A 4FYPA 3RROA 2JLXA 2WBLC 3ORSA 1ZVVA 1Z07A 2IYPA 2VJDA 3TI9A 1QORA 3QWAA 2A8YA 3JQ7A 5K9ZA 2B9VA 2YOGA 1UXJA 1YR1A 2G04A 1CVLA 2QMYA 2TECE 3DAGA 1NYLA 3GRYA 4HZUA 4IG9A 4NE9A 1TTTA 2V98A 3DVSX 1PR9A 1E0DA 2O1WA 4R9RA 5KHOC 3PD7A 2W22A 4MR8B 4B3HA 4TV8F 3G49A 2ZJ7A 3K2EA 1HEYA 4TSFA 4LDAA 3E82A 4GBGA 2C84A 2J9ZB 4UCXA 3NORA 4LJ7A 5JCOA 1X80B 2HPHA 3KPYA 2NM0A 3FNQA 1E7RA 1GUYA 2O8EA 2OCGA 2UZ0A 2D62A 1SCUA 2QX7A 4EGSA 2ZEJA 4ND4A 5KJEA 3ZIDA 1PZEA 4EH1A 1ORTA 3PHIA 4P32A 2O6HA 5A9TA 4B7UA 2O8BB 3SYLA 1H23A 2AZTA 2DYKA 4WT7A 3ZWVA 3TSCA 3UH0A 3I9NA 5TS3A 3DE4X 1EHCA 3EXEB 4NC9A 4Z86A 1PW5A 2WB4A 4OHKA 5DT2A 3SC2B 1NMZA 3IEVA 4EATA 5FR1A 4JFRA 1N5LA 2Q4RA 4FYIA 3JYHA 1LBHA 1XRLA 1XFAA 2FPPA 2RKWA 4R8LA 1ORHA 1U7UA 1NUSA 2OWEA 1HTTA 1UDAA 3M7IA 5JQGB 1J0BA 3KQTA 3PKZA 3VNQA 2WU8A 2XT6A 2W2TA 4NV0A 4WBNA 4YMHA 4NBUA 2H4FA 3HFRA 1E77A 2AJLI 2W6PA 3AUTA 4AUKA 3X1YA 1X13A 4IFTA 5ENZA 3UENA 5KJ6A 3EA4A 5HKAA 3RGGA 5SZKB 5D3MA 5E4YA 3PDJA 3DMRA 4RF3A 5WRFA 3QPCA 4QOIA 2UXDB 1LV8A 3DEHA 2RI6A 3LJKA 2XR1A 1WCIB 2X4LA 4DJAA 2A3RA 2YZNA 1WW2A 3ABSB 4N12A 4HN4B 1RBYA 1NX6A 1K7CA 3VTFA 2ZJAA 1YFZA 3O6VA 4IV8A 5COQA 5KEIA 3N2KA 3VR1A 3BT7A 4GI7A 3EMDA 4QL3A 2ZI3A 4W9RA 1M5RA 1AUQA 4YMIA 2I6TA 5E7MA 1N3BA 3GDOA 1G5QA 3HQ4O 3O1HB 1NAIA 4PX5A 1UFOA 3V2UA 4H60A 4ZEXA 1B73A 4FFVA 2FEPA 3W1WA 1BS1A 1WPQA 3BH0A 5ITZA 3THXA 2BSQA 4LZNA 5LP1A 2AOWA 3AU8A 3QEMA 1Z29A 4OHXA 1K8QA 4ZU3A 2D6FA 1X8XA 1ETUA 2A1TS 1LPNA 2XQIA 1LDMA 4RPKA 1LRJA 4YJ2F 2DG2A 2QR3A 3IT3A 4ZVVA 2ZJ6A 4YJKA 3RYHB 3O8QB 3DMDA 4RUKA 1LS1A 3ZJ5A 3JAMA 2YWCA 5AJVB 4YRSA 1RI3A 1GQFA 4WZZA 3RKSA 4D79A 3NWPA 3A9UA 4D6PA 5DBOA 3CH5A 4H0NA 4B3XA 4C29A 4DE5A 1BH6A 5FBKA 4PCLA 4XYLA 3MFQA 1M7HA 1OH5A 2QEQA 4WCFC 4M9XA 1M2NA 1Z68A 1ZIYA 4GP9A 4OBEA 4DSZA 5JATA 2WTUA 1VI5A 2V55B 3L02A 1E9AA 3LT5A 1RJFA 1KU6A 1JHZA 1J56A 4DLNA 4WLNA 1L7DA 3W5VA 2B2XA 3N8GA 4IIHA 3MUOA 1O6GA 4NBWA 1CDOA 3KYIB 1H1DA 1I30A 3K0HA 4AICA 4D80A 1ZD2P 1MGPA 1XXHB 1Z88A 4NMHA 4UUNA 1PFKA 4HC4A 3PFIA 1O9BA 1QWSA 1FFSA 3GVHA 3R5KA 4RETA 1XO1A 4XGQA 3SBDA 5JBNA 4UVHA 3ZDDA 1ECFA 2C7BA 2BFCA 2R5FA 3DHYA 2X0IA 4PQYA 3TB4A 821PA 4MV3A 5CCXA 4B3MB 3HVUA 4LYHA 3W1EA 1QYIA 1N0VC 1Z6YA 2OK8A 4BO7A 2BSAA 1ORDA 5K3DA 4JASB 3ZD7A 1M0WA 3CVYA 3QZUA 1PCXA 4PPFA 1XN4A 1T9KA 2QL6A 1AB5A 3UWOA 2X9NA 4CCAA 2Q41A 3V42A 4AUEA 2JRLA 3SE0A 4MZXA 2CUKA 2N46A 4C4XA 2OPHA 4C4RA 4HWSA 2W8BA 1K66A 3E3AA 4FFPA 4TL8A 4JEIA 1CY0A 4K9SA 4JB2A 2GFIA 2ZJFA 3A14A 4TS1A 1G6KA 2D2XA 2WG1A 4GC5A 3V9AA 1FTYA 2A14A 1A8PA 4KQWA 2IJGX 2EGGA 4V3CA 4AVYA 4WD3A 4M9RA 1PFUA 4RYLA 3B3JA 2QL5A 3BXOA 2JBAB 2Q3DA 1QMGA 4IDHA 4M0DA 4CKXA 2JAPA 2BISA 1KYQA 1Y80A 3WMFA 3VNVA 4BVEA 1TU3A 4H4CA 3I92A 4L74A 1L4GA 1VA4A 4X90A 4CODB 4EHKA 4KNWA 2J33A 2R8PA 3N5KA 1GGJA 2ODPA 1UBMS 1UJBA 1FQOA 3LTEA 2OHXA 3FMGA 4HDNB 3N53A 4YWHA 1LI7A 1L7PA 4ZTZB 2QN1A 3RNOA 3OD1A 2WWTA 4J0HA 1NLZA 2HLNA 4O4IA 4AZVA 2QW1A 1UJ6A 3WRYC 3SSOA 3TOCA 1L7MA 2PL5A 5B58T 3A3KA 3PLRA 5DTRA 1HDZA 1A1SA 1O94C 1SWVA 4LX8A 5P8WA 4HH0A 3B3QA 1HQDA 4ENUA 5F9MA 2H1LA 2W7TA 4DYHA 1SG9A 3IXMA 4ZTUB 4OI0A 5CIQA 4EHNA 1VKNA 4DTCA 5TQ0A 3QA3E 4G1MB 2YMMA 3NIGB 1V1RA 2YTZA 1JA1A 1PVDA 3IESA 4XSHA 5U4XA 1JAHA 1WM1A 2XI4A 3AIOA 5JAQA 5LQRA 3FVTA 1HG1A 2FSHA 3ITKA 4WFQA 1FMTA 3GEDA 3EA5A 1FVHA 1G17A 3K4HA 3AXSA 3LLCA 3HXPA 4DSOA 3EMVA 5AJXA 1ESEA 2IXTA 1DBRA 3HS3A 4RTKA 1DJLA 2GZ3A 1J2RA 4HBZA 5D85A 2CCGA 1QAQA 3QKSA 1BOOA 3RS3A 1SU6A 4OJQA 3E5MA 4AQDA 2QZZA 4L8WB 3ISTA 3PC7A 4NV3A 2I2XB 4OCZA 1GU7A 1SKBA 4TRNA 4TQAA 3ZNOA 1E3JA 1SY7A 4TUYB 1ZVKA 4BQSA 3IAFA 3DWGA 1RE0A 5ELMA 1OFGA 1CY7A 1PFQA 3LI2A 2EXXA 5C31A 1N7GA 3FSJX 4CHGA 2BZ0A 5IKXA 1QGDA 3B2EA 2OCBA 1V71A 2CDAA 2R2AA 2HJGA 3K7EA 2R68A 2JGJA 3DDHA 3K09A 4UHDA 1WXEA 4BUZA 1TXGA 5DK4A 5GM1A 4ETIA 1QYXA 1WUHS 1KYWA 2G88A 1YRYE 3N8HA 3BQNB 4ZV7A 5SY6A 4L8LA 3W2IA